Page 1

Harga Eceran Rp2.500,-

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) JUMAT, Legi, 26 Juli 2013/17 Ramadhan 1434 H

No: 24295 Tahun Ke-67

Terbit 28 Halaman

Operasi KNIA Lancar

Terima Kasih Masyarakat Sumut

Waspada/Surya Efendi

SATU helikopter melintas di atas pesawat komersil yang mendarat di Kualanamu International Airport (KNIA) pada hari pertama operasi diabadikan dari menara pengawas, Kamis (25/7).

Giliran Badai Biru JAKARTA (Waspada): Timnas Indonesia menuai kekalahan ketiga dari klub-klub Inggris, yang sedang melakukan persiapan pramusim dengan tur Asia mereka. Setelah sebelumnya digunduli Arsenal 0-7 dan Liverpool 0-2, Kamis (25/7) malam, giliran Chelsea yang menggasak Kurnia Meiga dan kawan-kawan dengan skor telak 1-8.

Hang Kesturi TJ Said, Kontributor Waspada dari Stadion Gelora Bung Karno melaporkan, Si Biru asuhan manajer Jose Mourinho tetap bermain tanpa ampun menggempur tim BNI Indonesia All Star, meskipun laga ini bertajuk eksibisi. Uniknya, mayoritas para penonton Lanjut ke hal A2 kol. 1

KUALANAMU, Deliserdang (Waspada): Menteri Negara Badan Usaha Milik Negara (BUMN) Dahlan Iskan memuji PT Angkasa Pura 2 pada soft operational Kualanamu International Airport (KNIA), Kamis(25/7) pukul 06:00.

AirAsia Dan MAS Beri Kemudahan Penumpang Telat

“Semula saya khawatir. Alhamdulillah jelang pengoperasian semua kerja kompak. Ini prestasi yang baik , di mana 20 ribu manusia tumplek di Bandara Internasional Kualanamu, namun tidak seperti yang dikhawatirkan. Terimakasih pada masyarakat Sumut dan semua pihak, khususnya pengguna jasa udara yang tampak antusias datang lebih pagi kemari,” kata DI—demikian Menteri yang tak kenal lelah ini biasa disapa—saat konferensi pers di Pintu (Gate) 5 Keberangkatan Domestik Kualanamu International Airport (KNIA). Pernyataan DI, tak jauh beda dengan pernyataan Pangkosek Nas 3, Sungkono, di mana pihaknya mengawasi lalulintas udara selama 24 jam. Lanjut ke hal A2 kol. 3

MEDAN (Waspada): Dua lagi maskapai penerbangan memberikan kemudahan bagi penumpang telat tiba di Kualanamu Internasional Airport (KNIA), yaitu penerbangan AirAsia dan maskapai penerbangan Malaysia Airlines System (MAS). Sehari sebelumnya, maskapai penerbangan Silk Air asal Singapura juga memberikan keringanan kepada penumpang telat, sehubungan mulai beroperasi KNIA sejak 25 Juli 2013. Mulyana, Guest Service Manajer (GSM) PT. Indonesia AirAsia menyatakan, kemudahan bagi penumpang telat

batas waktu selama seminggu. “Kalau mereka telat tiba akan dialihkan ke penerbangan berikutnya tanpa membayar tambahan biaya,” kata Mulyana. Upaya ini, menurutnya, salah satu kebijakan yang diputuskan manajemen AirAsia. “Kita mengharapkan penumpang dapat mempertimbangkanwaktudanjaraktempuh ke Bandara Kualanamu, sehingga tidak telat,” kata Mulyana.

Ada-ada Saja

MEDAN (Waspada) : Kota Medan dan sekitarnya kembali dilanda kabut asap sejak pagi hingga siang, menyebabkan pantulan sinar mata hari tidak begitu cerah, Kamis (25/7). Mega Sirait, Kepala seksi bidang data dan informasi pada Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I stasiun Meteorologi Bandara Kualanamu, membenarkan hal itu saat dikonfirmasi, Kamis. “Ini kabut akibat kebakaran lahan di beberapa daerah di

Ornamen Melayu Di Gerbang Masuk

Antara

BINTANG Chelsea Eden Hazard (kiri) berusaha melewati kiper BNI Indonesia All Star Kurnia Meiga (kanan) di Stadion Gelora Bung Karno, Jakarta, Kamis (25/7) malam.

Al Bayan

Shadaqah Yang Ikhlas Oleh Tgk. H. Ameer Hamzah

SHADAQAH-Bersedekah bulan Ramadhan sangat banyak pahalanya apabila mereka memberikannya dengan niat yang ikhlas. Orang-orang yang menafkahkan hartanya pada jalan Allah, lalu tidak menyertai pemberiannya itu dengan umpatan (atau menyebut jasa) yang dapat menya-kitkan hati si penerima, mereka mendapat pahala di sisi Tuhan mereka.... (QS. Al-Baqarah:262). Ucapan yang ramah dan pemberian maaf lebih baik dari pada sedekah yang diiringi sesuatu (sebutan mengungkitungkit kedermawanannya) yang menyakitkan. Dan Allah Maha Kaya dan Maha Penyantun (QS.Al-Baqarah:263). DALAM hadits juga disebutkan, kalau bersedekah harus ikhlas, memberi dengan tangan kanan, jangan diketahui oleh tangan kiri. Maksudnya, setelah memberi jangan diungkit-ungkit supaya manusia lain mendengar dan memujinya sebagai dermawan. Sadaqah yang diberikan berdasarkan ria (pamer) tidak akan mendapat pahala apa-apa, meski jumlah bantuan itu sangat banyak, sebaliknya sedekah yang ikhlas meskipun

Lanjut ke hal A2 kol. 6

MEDAN (Waspada): HM Zaki Abdullah, salah seorang tokoh masyarakat Melayu di Sumatera Utara mengusulkan, sebaiknya dipasang ornamen Melayu di pintu gerbang (Gapura) masuk ke Kualanamu Internasional Airport (KNIA) Deliserdang. ‘’ Komunitas Melayu di Deliserdang dan Sumatera Utara pada umumnya tergolong cukup banyak.Alangkah baiknya ornamen Melayu dipasang di sana agar ada perimbangan dan indah dipandang mata,’’ kata HM. Zaki Abdullah, saat menyambut kedatangan penerbangan terakhir dari Jakarta di Bandara Polonia Medan. HM Zaki Abdullah di Polonia bersama Ketua SPS Sumut H. Teruna Jasa Said, yang juga Wapemred Harian Waspada beserta pejabat lainnya, Rabu (24/7) malam. Lanjut ke hal A2 kol. 6

Angsa Jaga Malam UNTUK menjaga keamanan di malam hari, kepolisian daerah terpincil di China menukar anjing dengan angsa untuk membantu menjaga markas mereka. Kepolisian di provinsi Xinjiang, China barat laut, Lanjut ke hal A2 kol. 3

Menurutnya, operator maskapai tersebut sebenarnya berulang kali telah menyampaikan sosialisasi kepada masyarakat, baik melalui pertemuan langsung, SMS maupun brosur. Jadi, ke depan diharapkan tidak terjadi telat lagi tiba di bandara. Hari pertama AirAsia berangkat di Kualanamu, seorang penumpang telat tiba, sudah dibantu. Lanjut ke hal A2 kol. 7

Medan Kembali Dilanda Kabut Asap Riau dan Sumatera Utara,” kata Mega Sirait, di sela-sela kesibukan pemindahan tugas dari Bandara Polonia Medan ke Bandara Kualanamu. Begitupun, kondisi cuaca di Sumut secara umum masih dilanda suhu panas pada siang hari mencapai angka 33 hingga 34 derajat Celcius, antara pukul 12:30 hing-ga pukul 15:00. Suhu panas akan berlangsung beberapa hari ke depan, Lanjut ke hal A2 kol. 7

Buka Puasa Di Kota Santri Al Barokah BERKAIN sarung, berkoko putih, berkumpul di bawah tenda di halaman masjid. Menjelang waktu berbuka itu, doa-doa tak henti dilantunkan ratusan anakanak itu. Di ketinggian dataran Simalungun itu, sahut-menyahut doa mereka disambut angin kencang yang seolah ikut bertasbih. Tak lama hujan benarbenar datang, lebat sekali. Angin pun tak berhenti bertiup. Zikir anak-anak itu juga semakin kuat, bersisian dengan deru hujan. Salah seorang di antara mereka berdoa sekuat suaranya:Ya Allah, jadikanlah hujan ini berkah bagi kami. Jadikanlah kami orang-orang yang Engkau rahmati. Amiiin.., temantemannya menyambut doa itu bergemuruh. Lanjut ke hal A2 kol. 3

Berbuka : 18:43 Imsak : 04:54 Abu Hurairrah r.a. berkata bahwa Rasulullah bersabda: “Barang siapa yang terpaksa muntah maka ia tidak wajib mengqadanya dan barang siapa yang dengan sengaja muntah maka ia wajib mengqadanya.”

Serampang Waspada/Hendrik Prayitno

SUASANA berbuka bersama santri Al Barokah, Simalungun, Kamis (25/7).

- Maunya Pak Dahlan 3 bulan di sini - He...he...he...


WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) JUMAT, Legi, 26 Juli 2013/17 Ramadhan 1434 H

z zNo: 24295 * Tahun Ke-67

Terbit 28 Halaman

Terimakasih Masyarakat Sumut KUALANAMU, Deliserdang (Waspada): Menteri Negara Badan Usaha Milik Negara (BUMN) Dahlan Iskan memuji PT Angkasa Pura 2 pada soft operational Kualanamu International Airport (KNIA), Kamis(25/7) pukul 06:00. “Semula saya khawatir. Alhamdulillah jelang pengoperasian semua kerja kompak. Ini prestasi yang baik ,

di mana 20 ribu manusia tumplek di Bandara Internasional Kualanamu, namun tidak seperti yang dikhawatirkan. Terimakasih pada masyarakat Sumut dan semua pihak, khususnya pengguna jasa udara yang tampak antusias datang lebih pagi kemari,” kata DI—demikian Menteri yang tak kenal lelah ini biasa disapa—saat konferensi pers di Pintu (Gate)

5 Keberangkatan Domestik Kualanamu International Airport (KNIA). Pernyataan DI, tak jauh beda dengan pernyataan Pangkosek Nas 3, Sungkono, di mana pihaknya mengawasi lalulintas udara selama 24 jam. “Proses simulasi 2 kali dengan keseriusan dan

perencanaan yang luar biasa, sehingga hasilnya bagus dan bermanfaat untuk masyarakat,” sebutnya yang mengajak kita untuk menjaga bersama KNIA. Ajakan Pangkosek itu sebelumnya dituturkan oleh Lanjut ke hal A2 kol 6

Waspada/Surya Efendi

KNIA BEROPERASI: Satu pesawat komersil melintas di Kualanamu International Airport (KNIA) yang mulai beroperasi, Kamis (25/7).

Pengadilan Federal AS

Jerusalem Bukan Wilayah Israel Presiden: Hormati Ramadhan, Jangan Ada Kekerasan JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono mengingatkan semua komponen masyarakat untuk menjaga kesucian bulan Ramadhan dengan tidak melakukan tindak kekerasan.

“Saya beberapa kali serukan agar semua memuliakan d a n h o r m a t i Ra m a d h a n sekaligus menjaga jangan sampai ada kekerasan, konflik, perusakan, apalagi tindakan anarkis,” kata Presiden saat

membuka sidang kabinet paripurna di Kantor Presiden Jakarta, Kamis (25/7). “Mari kita semua melibatkan diri dalam, pertama, Lanjut ke hal A2 kol 1

Polri Selidiki Medan Kembali FPI Hina Dilanda Kabut Asap MEDAN (Waspada): Kota Medan dan sekitarnya kembali Presiden dilanda kabut asap sejak pagi hingga siang, menyebabkan JAKARTA (Antara): Badan Reserse Kriminal (Bareskrim) Polri membentuk tim penyelidik untuk mengkaji adanya unsur penghinaan terhadap Presiden dari pernyataan Ketua Front Pembela Islam (FPI) Habib Rizieq sebagai tindak lanjut atas perintah Kapolri. “Kabareskrim membentuk tim penyelidikan atas perintah Kapolri. Pasal apa yang bisa dikenakan bergantung dari fakta tim penyelidik nanti,” kata Kepala Divisi Humas Mabes Polri Irjen Pol Ronny F. Sompie di Jakarta, Kamis (25/7). Penyelidikan tersebut, menurut dia, telah berjalan Lanjut ke hal A2 kol 1

pantulan sinar mata hari tidak begitu cerah, Kamis (25/7). Mega Sirait, Kepala seksi bidang data dan informasi pada Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I stasiun Meteorologi Bandara Kualanamu, membenarkan hal itu saat dikonfirmasi, Kamis. “Ini kabut akibat kebakaran lahan di beberapa daerah di Riau dan Sumatera Utara,” kata Mega Sirait, di sela-sela kesibukan pemindahan tugas dari Bandara Polonia Medan ke Bandara Kualanamu. Begitupun, kondisi cuaca di Sumatera Utara secara umum masih dilanda suhu panas pada siang hari mencapai angka 33 hingga 34 derajat celcius, antara pukul 12:30 hingga pukul 15:00. Suhu panas akan berlangsung beberapa hari ke depan, setelah itu bakal turun hujan baik sore maupun malam. Sementara kondisi perairan baik di Selat Malaka dan pesisir barat Sumut seperti kawasan Sibolga maupun Nias untuk saat ini masih dalam kondisi stabil. Artinya para nelayan masih bebas turun ke laut baik di pesisir barat maupun timur Sumatera Utara, karena tinggi gelombang laut tidak mengganggu aktivitas para nelayan. (m32)

WASHINGTON (AP): Pengadilan Federal Amerika Serikat menolak mengakui Jerusalem sebagai wilayah Israel. Lembaga itu menyatakan, pengakuan tersebut tidak sesuai konstitusi. Keputusan itu menjadi pukulan bagi kelompok pro-Israel di AS. Mereka berniat mengajukan banding ke Mahkamah Agung. Pengakuan Jerusalem sebagai wilayah Israel dikeluarkan Kongres pada 2002. Namun, Pemerintah AS menolak kebijakan tersebut. Pemerintah takut kebijakan itu merusak hubungan AS dengan Arab. “Kongres ingin mengubah posisi netral AS dalam isu Jerusalem,” sebut putusan Pengadilan Federal, seperti dikutip Washington Post Kamis (25/7). Presiden Barack Obama memang sedang berupaya membawa Israel dan Palestina kembali ke meja perundingan. Dia mengutus Menteri Luar Negeri John Kerry ke Timur Tengah untuk mendorong negosiasi. Lanjut ke hal A2 kol 6

Antara

DUA calon penumpang tidur saat menunggu keberangkatan perdana pada “Soft Operation” Bandara Internasional Kualanamu di Deli Serdang, Sumut, Kamis pagi (25/7). Bandara Internasional Kualanamu (KNIA) seluas 1.365 hektar tersebut resmi beroperasi Kamis dinihari (25/7) pukul 00.01 WIB dan secara bersamaan operasional Bandara Polonia ditutup Rabu malam (24/7) pukul 23.59 WIB.

Ada-ada Saja

Al Bayan

Shadaqah Yang Ikhlas Oleh: H. Ameer Hamzah SHADAQAH-Bersedekah bulan Ramadhan sangat banyak pahalanya apabila mereka memberikannya dengan niat yang ikhlas. Orang-orang yang menafkahkan hartanya pada jalan Allah, lalu tidak menyertai pemberiannya itu dengan umpatan (atau menyebut jasa) yang dapat menya-kitkan hati si penerima, mereka mendapat pahala di sisi Tuhan mereka.... (QS. Al-Baqarah: 262). Ucapan yang ramah dan pemberian maaf lebih baik dari pada sedekah yang diiringi sesuatu (sebutan mengungkitungkit kedermawanannya) yang menya-kitkan. Dan Allah Maha Kaya dan Maha Penyantun (QS.Al-Baqarah:263). Dalam hadits juga disebutkan, kalau bersedekah harus ikhlas, memberi dengan tangan kanan, jangan diketahui oleh tangan kiri. Maksudnya, setelah memberi jangan diungkit-ungkit supaya manusia lain mendengar dan memujinya sebagai dermawan.

Lanjut ke hal A2 kol 2

Pangeran Kecil Inggris Bergelar George VII LONDON, Inggris (CNN): Si pangeran kecil dari Inggris, yang baru berusia tiga hari, telah diberi nama George Alexander Louis.Demikian diumumkan . Jika dia memerintah kelak, gelar yang akan disandangnya adalah Raja George VII. Nama Pangeran George memiliki arti penting bagi Kerajaan Inggris. Nama itu dipakai oleh raja-raja besar dalam sejarah Inggris. Menurut BBC Kamis (25/7), Raja George V memimpin Inggris pada Perang Dunia I. Lanjut ke hal A2 kol 6

Angsa Jaga Malam

UNTUK menjaga keamanan di malam hari, kepolisian daerah terpincil di China menukar anjing dengan angsa untuk membantu menjaga markas mereka. Kepolisian di provinsi Xinjiang, China barat laut, memilih sekelompok angsa sebagai penjaga gerbang di markas mereka karena dianggap memiliki pendengaran yang lebih baik dan mengeluarkan suara lebih ribut saat Lanjut ke hal A2 kol 5

Amankan Lebaran, Polda Aceh Kerahkan 1.170 Personel BANDA ACEH (Waspada): Polda Aceh bersama jajarannya mengerahkan pasukan sedikitnya 1.170 personel yang disebar di seluruh wilayah Aceh hingga perbatasan dalam pengamanan Lebaran.

“Kita telah mengantisipasi berbagai gangguan keamanan, mulai dari ancaman terorisme, sabotase, aksi kriminalitas seperti curanmor, hipnotis, peredaran uang palsu, perkelahian antar warga,

Brimob Serang Sabhara Di Jateng, 8 Luka J A K A RTA ( A n t a r a ) : Sungguh prilaku tidak terpuji, namun itulah kenyatan yang terjadi. Rabu (24/7) malam, sejumlah anggota Polri dari korp Brimob Polda Jawa Tengah menyerang markas Direktorat Shabara Polda Jawa Tengah, mengakibatkan 8 orang dari dua korp tersebut menderita luka-luka. “Delapan orang terluka, empat dari Brimob dan empat orang dari Sabhara,” kata Kepala Divisi Humas Mabes Polri Irjen Pol Ronny F. Sompie yang dikonfirmasi wartawan di Jakarta, Kamis (25/7). Para korban dari pihak Sabhara, kata Ronny, Bripda Irham ,21, dengan luka sobek 3 cm di kaki kiri, Bripda Aditya ,19, dengan luka 2 cm di kaki kanan, Bripda Anugrah Dwi,

20, dengan luka sobek sepanjang 10 cm pada tangan kanan dan Bripda Fajar Gunanto ,20 dengan luka memar pada wajah akibat pukulan benda tumpul. Sementara para korban dari Satbrimobda yakni Bripda L. Lukita dengan memar pada paha kanan, Bripda Setia Aji dengan luka kaki kiri, Bripda M. Nur Solihin dengan memar pada bahu kanan dan Bripda Pundi Lingga Pratama dengan luka lecet pada kaki kanan. Ronny menjelaskan kejadian tersebut berawal dari pengiriman “BlackBerry Messenger” (BBM) yang mengakibatkan kesalahpahaman. Sehingga Rabu (24/7) pukul 22:30,sebanyak 30 anggota

penyalahgunaan narkoba dan Miras, petasan, hingga bencana alam dan kecelakaan lalu lintas,” ujar Kapolda Aceh Irjen Pol Herman Effendi kepada wartawan di Polda Aceh, Kamis (25/7). Pengamanan jelang lebaran ini dilaksanakan Polda Aceh melalui “Operasi Ketupat Tahun 2013”, dengan melibatkan 1.170 personel Polda dan Polres di wilayah Aceh guna menanggulangi berbagai ancaman dan gangguan terhadap keamanan serta ketertiban masyarakat. Operasi ketupat tahun 2013, berlangsung selama 15 hari. Dalam operasi ini Polda Aceh mendirikan sebanyak 51 pos pengamanan dan Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 4 Berbuka Imsak

: :

18.43 04.54

Aisyah r.a. berkata: “Apabila sudah memasuki sepuluh terakhir bulan Ramadhan, maka Rasulullah SAW selalu menghidupkan malammalam itu (dengan ibadah) dan membangunkan keluarganya serta mengikatkan sarungnya (tidak menggauli istrinya). (HR. Bukhari dan Muslim)

Serampang - Hebat gak mati lampu di KNIA - He.... he....he....


Berita Utama

A2

WASPADA Jumat 26 Juli 2013

Hari Pertama Operasional KNIA

Belasan Penumpang Kesasar Ke Polonia Gaya Hidup Halali Oleh: Syahrin Harahap MENERAPKAN gaya hidup halâli merupakan kosekuensi logis dari keberislaman seorang muslim bahwa hidup dan matinya, kerja dan ibadahnya diorientasikan untuk pengabdian kepada ilahi (Q.S.51/al-Dzâriyâr: 56) sebab visi penciptaan manusia adalah hidup yang berorientasi pada kehidupan halâli, sebagaimana firman Allah: “Katakanlah sesungguhnya shalatku, ibadahku, hidupku, dan matiku hanyalah untuk Allah Tuhan semesta alam. (Q.S. 6/al-An’âm: 162). Kehidupan halâli yang dimaksudkan adalah cara pandang mengenai kehalalan kehidupan, kehalalan tindakan, dan kehalalan konsumsi, serta kehalalan komunikasi. Kehidupan halâli adalah cara pandang bahwa hidup di dunia adalah pengantar dan jembatan bagi proses kehidupan yang abadi. Oleh karenanaya prestasi keduniaan harus berorientasi pada kesuksesan yang lebih panjang dan abadi di hari kemudian.

Lanjut ke hal A8 kol 1

Tersangka Pembunuh Seret Polisi Ke Jurang Hingga Tewas MAGELANG (Antara): Kanit Resmob Polda Jawa Tengah AKP Yahya R Lihu meninggal dunia setelah terseret seorang tersangka pembunuhan dan penggandaan uang, Munjaroh, yang menjatuhkan diri ke jurang di Desa Ngemplak, Kabupaten Magelang, Kamis (25/7). Munjaroh yang diminta menunjukkan tempat penguburan korban Yolanda, tibatiba melompat ke jurang dan AKP Yahya, yang mengawal dengan memasukkan tangannya ke lengan tersangka, ikut terseret. Menurut laporan tertulis yang dibuat Kasubdit III Jata-

Polri Selidiki ....

menghormati bulan Ramadhan, dan kedua menolak atau mencegah tindakan-tindakan yang tidak semestinya,” katanya. Ia juga menegaskan bahwa hukum harus ditegakkan dan setiap pelanggar hukum harus ditindak. “Hanya dengan cara itu akhirnya kita bisa betul-betul memuliakan dan hormati Ramadhan. Ini mari kita jadikan tekad kita, ke depan situasinya harus lebih baik dari sekarang,” kata Presiden. Kepala Negara meminta semua pihak menjaga keamanan dalam negeri supaya semua umat beragama dapat menjalankan ibadah tanpa gangguan.

Polri Selidiki ....

dan tidak menunggu pelaporan Presiden terlebih dulu. “Apa delik aduan atau delik biasa, Polri langsung bergerak, tidak menunggu laporan karena ini menyangkut pimpinan tertinggi,” katanya. Menurut dia, pernyataan yang dimuat melalui media massa termasuk media cetak, media online bahkan kicauan di jejaring sosial akan menjadi bahan penyelidikan bagi tim.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur:

1. Bf7+, Rg8. 2. gxh6 (target h7+mat), Gf4. 3. Bg7+mat. Jawaban TTS: TTS

Santapan Ramadhan

nras Polda Jateng Kompol Arman Asmara, AKP Yahya bersama tim yang dipimpin Kompol Arman tiba di Magelang sekitar pukul 03.30 WIB. Mereka kemudian langsung ke Polsek Windusari sekitar pukul 04.00 WIB dan meminta bantuan ditunjukkan salah satu pelaku atas nama Aspani dan tim menangkapnya. Sekitar pukul 05.00 WIB, tim dari Polda Jateng itu bersama anggota unit Reskrim Polsek Windusari meminta tersangka Munjaroh menunjukkan tempat penguburan korban Yolanda. Sesampainya di lokasi, Munjaroh kemudian menunjuk serumpun pohon pisang di area bibir tebing sebagai tempat dimana ia menguburkan korban Yolanda.

Jupiter Kontra Vario, Satu Tewas Lima Luka

3 6 5 9 8 1 2 4 7

9 1 8 4 7 2 6 5 3

2 7 4 6 5 3 8 9 1

1 2 9 5 3 8 4 7 6

6 8 7 1 9 4 3 2 5

5 4 3 2 6 7 1 8 9

7 5 1 8 2 6 9 3 4

4 3 2 7 1 9 5 6 8

8 9 6 3 4 5 7 1 2

rak dari Medan tujuan KNIA.. Agus Batin, staf PT Railink membenarkan, jumlah penumpang yang berangkat pagi cukup lumayan. Trip pertama, ketiga dan trip ke empat hampir rata-rata seat terisi dari 272 tempat duduk KA sekali jalan disediakan, kecuali trip kedua, penumpang agak berkurang, katanya. Namun terlihat operasional KA belum begitu mulus bahkan masih tersendat-sendat. “Maklum, baru hari pertama perjalanan KA dari Medan ke bandara, kalau hari-hari berikutnya pasti lancar,” kata Prof Dr H. Syahrin Harahap saat akan menuju ke Kualanamu. Ornamen Melayu Sementara itu tokoh masyarakat Melayu di Sumatera Utara mengusulkan, sebaiknya dipasang ornamen Melayu di pintu gerbang (Gapura) masuk ke Kualanamu Internasional Airport (KNIA) Deliserdang. Komunitas orang melayu di Deliserdang dan Sumatera Utara pada umumnya tergolong cukup banyak.Alangkah baiknya ornamen Melayu dipasang di sana agar ada perimbangan dan indah dipandang mata. H. Zaki Abdullah, tokoh Melayu Sumut mengatakan hal itu saat menyambut kedatangan penerbangan terakhir

MEDAN (Waspada): Dua lagi maskapai penerbangan memberikan kemudahan bagi penumpang telat tiba di Kualanamu Internasional Airport (KNIA), yaitu penerbangan Air Asia dan maskapai penerbangan Malaysia Airlines System (MAS). Sehari sebelumnya, maskapai penerbangan Silk Air asal Singapura juga memberikan keringanan kepada penumpang telat, sehubungan mulai beroperasi KNIA sejak 25 Juli 2013. Mulyana, Guest Service Manajer (GSM) PT. Indonesia Air Asia menyatakan, kemudahan bagi penumpang telat batas waktu selama seminggu. “Kalau mereka telat tiba akan dialihkan ke penerbangan berikutnya tanpa membayar tambahan biaya,” kata Mulyana. Upaya ini, menurutnya salah satu kebijakan yang diputuskan manajemen Air Asia. “Kita mengharapkan penumpang dapat mempertimbangkan waktu dan jarak tempuh ke Bandara Kualanamu, sehingga tidak telat,” kata Mulyana. Menurutnya, operator maskapai tersebut sebenarnya

berulang kali telah menyampaikan sosialisasi kepada masyarakat, baik melalui pertemuan langsung, SMS maupun brosur. Jadi, ke depan diharapkan tidak terjadi telat lagi tiba di bandara. Hari pertama Air Asia berangkat di Kualanamu, seorang penumpang telat tiba, sudah dibantu. Sementara itu Rajuan, Distrik Manajer (DM) maskapai Malaysia Airlines System (MAS) saat dikonfirmasi via telpon juga menyatakan bakal ada kemudahan dari manajemen penerbangan itu, bagi penumpang telat tiba di Bandara Kualanamu. Misalnya, penumpang yang telat tiba pagi akan dialihkan pada penerbangan siang asalkan seat pesawat tersedia. Dalam kaitan ini manajemen MAS tidak akan membebankan biaya tambahan kepada penumpang, kata Rajuan. Bantuan bagi penumpang telat menurut Rajuan, terbatas.Artinya bisa kemungkinan selama seminggu. Setelah itu pihaknya mengimbau penumpang agar tidak telat tiba di Bandara, misal 1 jam sebelum berangkat. (m32) rapa kaca yang pecah,” ucapnya. Menurut Ronny, insiden ini merupakan masalah individu sesama anggota Polri dan tidak terkait dengan Satbrimob maupun Direktorat Sabhara sebagai sesama satuan di instansi Polri. “Ini masalah pribadi, masalah kenakalan, guyonan yang sepertinya ditanggapi serius,” tuturnya. Dia menambahkan Kapolda Jateng langsung turun menyelesaikan insiden tersebut. Hingga saat ini Divisi Profesi dan Pengamanan (Div Propam) Polda Jateng masih memeriksa 30 anggota Satbrimob tersebut, dan beberapa anggota Sabhara yang terlibat pertikaian dengan status sebagai saksi dan terperiksa untuk kasus pelanggaran disiplin.

Wilda, 3 tahun. Dua korban yang disebut terakhir dilaporkan anak Aisyah dan Masyitah. Kapolres Aceh Utara AKBP Gatot Sujono melalui Kasat Lantas Iptu Mega Tetuko menjelaskan, Jupiter MX melaju dari arah Lhoksukon menuju Matangkuli. Setiba di lokasi kejadian, MX mendahului satu kereta lain. Naas, pada saat bersamaan, dari arah berlawanan meluncur Vario BL 5420 QW , dan langsung terjadi tabrakan. Korban meninggal dievakuasi ke rumah duka. Sementara korban luka-luka, sampai kemarin petang, masih dirawat di RSUD Cut Meutia, Aceh Utara. (b19)

Amankan Lebaran ....

sedangkan puncak arus balik akan terjadi pada H+5, atau tanggal 14 Agustus 2013. Sedangkan untuk arus balik pemudik menggunakan angkutan udara diperkirakan terjadi pada H+8 atau pada 17 Agustus setelah Idul Fitri, karena masih terdapat hari libur HUT Kemerdekaan RI pada 17 Agustus 2013. Akan Tindak Ormas Brutal Dalam keterangan pers di Mapolda Aceh, Kapolda Aceh Herman Effendi menegaskan akan menindak tegas setiap organisasi masyarakat (Ormas) yang melakukan razia sendiri tanpa sepengetahuan pihak kepolisian. “Polda Aceh ingin memelihara Kamtibmas. Kita melaksanakan secara menyeluruh, kita akan menindak tegas siapapun yang membuat onar dan prilaku brutal,” ungkap Kapolda. (cb01)

Brimob Serang ....

silan yang diperolehnya akan berlipat ganda. Dan sekiranya tidak ada hujan lebat, hujan gerimis saja sudah cukup untuk menyuburkan benih di tanah yang bagus itu. Allah berfirman: Dan perumpamaan orang-orang yang membelanjakan hartanya karena mencari keridhaan Allah dan untuk keteguhan jiwa mereka, seperti sebuah kebun yang terletak didataran tinggi yang disiram oleh hujan lebat, maka kebun itu meng-hasilkan buahnya dua kali lipat. Jika hujan lebat tidak menyiraminya, maka hujan gerimispun memadai. Dan Allah Maha Melihat apa yang kamu perbuat.-(QS.2:265) Berzakat, infaq dan sedekah sebenarnya sangat tergantung niat seseorang. Hanya Allah yang tahu, apakah niatnya ikhlas atau tidak. Biasanya amal yang ikhlas itu diberikan oleh seseorang tanpa mengharap imbalan atau pamrih apapun dari orang yang me-

nerima. Apabila seseorang ada niat yang lain, saat itulah amalnya tidak mendapat pahala dari Allah. Ajaran Islam membolehkan beramal secara terangterangan, dipublikasi asal diberikan niat masih ikhlas. Kita boleh memberi sadaqah di depan orang lain dengan syarat harus berniat agar orang lain dapat meneladani kemurahan tangan kita. Memberikan sadaqah secara sembunyi atau terangterangan telah diberitakan oleh Allah sebagai berikut: Jika kamu menampakkan sedekah-sedekahmu, maka itu adalah baik. Dan jika kamu menyembunyikannya dan kamu berikan kepada orango r a n g f a k i r, m a k a m e nyem-bunyikannya itu paling baik bagimu. Dan Allah akan meng-hapuskan bagimu sebagian dosa-dosamu, dan Allah mengetahui apa yang kamu kerjakan. (QS.AlBaqarah:271)

sebanyak 35 pos pelayanan, tersebar di seluruh wilayah di Aceh. “Kita hanya ingin memberikan rasa aman kepada masyarakat baik yang mudik maupun yang tidak mudik serta mencegah terjadinya tindakan kriminal maupun kecelakaan lalu lintas,” ujar kapolda. Sebelum OK 2013 telah diawali dengan kegiatan cipta kondisi melalui “Operasi Patuh” dan “Operasi Pekat” ,diikuti pendataan terhadap lokasi rawan kemacatan, rawan longsor dan rawan kriminalitas serta hasil evaluasi dan pengalaman dari pengamanan lebaran tahun-tahun sebelumnya. Jenderal bintang dua ini memprediksi puncak arus mudik akan terjadi pada H+4 atau tanggal 4 Agustus 2013,

Sadaqah yang diberikan berdasarkan ria (pamer) tidak akan mendapat pahala apaapa, meski jumlah bantuan itu sangat banyak, sebaliknya sedekah yang ikhlas meskipun sedikit pahalanya berlipat ganda. Bantuan yang sok pamer itu tidak sesuai dengan ajaran Islam. Allah mengibaratkan sedekah semacam itu sebagai firman-Nya: Perumpamaan orang-orang yang bersedekah karena ria bagaikan batu licin yang berdebu, kemudian debu itu ditimpa hujan lebat, tidak ada yang tersisa atas batu licin itu, kecuali hanyalah batu licin belaka. Begitulah amal orang yang ria, pahalanya h a b i s p e rc u m a . ( Q S . A l Baqarah:264) Sebaliknya orang yang bersedekah dengan niat yang ikhlas, diumpamakan Allah sebagai tanah yang subur di dataran tinggi yang disiram hujan lebat, maka peng-ha-

dari Jakarta di Bandara Polonia Medan bersama H. Teruna Jasa Said, Wapemred Harian Waspada serta pejabat lainnya, Rabu (24/7) malam. Menurut mantan Ketua PWI Cabang Sumut, dia sudah membicarakan hal itu dengan Wagubsu HT. Erry Nuradi. Kelihatannya Wagubsu mendapat lampu hijau agar dipasang ornamen melayu di Gapura KNIA. “Ini bukan maksud memprotes, namun hanya mengusulkan karena di kawasan Deliserdang dan Kualanamu pada umumnya komunitas warga Melayu cukup besar agar mereka merasa bermanfaat kehadiran bandara kebanggaan masyarakat Sumut,” kata Zaki Abdullah. Alangkah baiknya dipasang ornamen tersebut, Wagubsu didampingi Menteri BUMN H. Dahlan Iskan, Dirut AP-II Tri S. Sunoko dan General Manajer (GM) Bandara Kualanamu H.T. Said Ridwan, pada prinsipnya para pejabat terkait tidak keberatan. Awalnya ornament tersebut kami minta dipasang di gerbang Gapura KNIA dan selanjutnya kalau memungkinkan diipasang juga di tempat-tempat strategis bagian dalam Bandara Kualanamu, kata tokoh masyarakat Melayu Sumatera Utara. (m32)

Manajemen Air Asia Dan MAS Beri Kemudahan Penumpang Telat

MATANGKULI (Waspada): Satu orang tewas dan lima lainnya luka-luka, dalam tabrakan maut antara kereta Jupiter kontra Vario di jalan Matangkuli-Lhoksukon, Desa Teupin Keubeu, Kec. Matang Kuli, Aceh Utara, Kamis (25/7) sekitar pukul 12:00. Korban tewas Irwanda, 25, pengendara Jupiter MX asal Desa Alue Drien, Kec. Cot Girek, Aceh Utara. Sementara korban luka, Asari, 22, teman boncengan Irwanda juga warga Alue Drien, Aisyah 32, pengendara Vario asal Desa Asan Arakeumudi, Lhoksukon, dan tiga orang boncengan warga sekampungnya, Masyitah, 30, Alifa, 4, dan

Al Bayan ....

Jawaban Sudoku:

MEDAN (Waspada): Hari pertama pemindahan Bandara Polonia Medan ke Kualanamu International Airport (KNIA), belasan penumpang kesasar, Kamis (25/7). Calon penumpang masih datang ke Bandara Polonia Medan, dari pagi hingga siang. Sedikitnya lebih 10 orang calon penumpang pesawat masih kesasar ke Bandara Polonia Medan, kata Patar M. Hutasoit, supir bus Damri yang mengantar penumpang kesasar ke Bandara Kualanamu (KNIA). Pihaknya sudah kesekian kali pergi dan balik mengantar penumpang dari Bandara Polonia Medan ke Bandara Kualanamu. “Ada penumpang yang akan berangkat ke Kuala Lumpur dengan Air Asia pagi maupun tujuan Batam dan lainnya sudah diantar,” kata Hutasoit. S ementara kawasan Bandara Polonia Medan terkesan seperti kota mati, hanya belasan petugas keamanan dari Angkatan Udara (AU) berjagajaga di pintu masuk dan hilir mudik ke dalam terminal bandara. Sedangkan, sampah-sampah berserakan dimana-mana karena petugas cleaning servis tidak bekerja lagi sejak Kamis (25/7). Hanya tersisa barangbarang pemilik kios seperti pintu aluminium (rolling door) yang dilarang dibawa keluar oleh petugas keamanan di bandara. KA Bandara Sementara itu suasana di stasiun kereta api Medan tujuan Bandara Kualanamu, ada juga penumpang yang kebingungan , karena baru hari pertama operasional KA dari PT Raillink jurusan KNIA. Orang-orang Medan yang menggunakan KA bandara terlihat ramai dari beberapa kali berangkat ke sana sejak pukul 03:55. Trip pertama berge-

Sa t b r i m o b p o l d a Ja t e n g mendatangi markas Direktorat Sabhara Polda Jateng di Jl. Hadi Subeno, Mijen, Semarang. Mereka menanyakan perihal isi BBM yang diduga bernada menghina salah satu anggota Satbrimobpolda Jateng. Pesan BBM tersebut dikirim salah satu anggota Sabhara yakni Bripda Fahri. Sementara penerima pesan BBM, menurut Ronny, belum diketahui. Saat itu, adu mulut pun terjadi dan berlanjut dengan aksi perkelahian fisik, sehingga mengakibatkan delapan orang luka-luka. Ronny membantah adanya senjata tajam yang digunakan dalam pertikaian ini. “Tidak ada penggunaan senjata tajam, mereka datang menggunakan kendaraan, terjadi pemukulan, ada bebe-

Ada-ada Saja ....

ada penyusup yang mendekat. “Anjing memang bagus, tapi ketika pencuri datang, mereka akan langsung meracuni anjing,” ujar seorang polisi yang dikutip dari Orange, Kamis (25/7). “Angsa lebih siaga dan mereka memiliki pendengaran yang sangat hebat. Saat mendengar suara mencurigakan, angsa akan mengeluaran suara ribut. Dan angsa yang besar cukup berani, jika melihat orang asing mereka akan maju menyerang. “Terlebih lagi, angsa memiliki pengelihatan yang buruk pada malam hari. Jadi saat mereka diberi racun, mereka tidak akan melihatnya dan memakannya.” Menurut polisi, bulan lalu kawanan angsa ini membantu memperingatkan polisi yang sedang tertidur ketika ada seorang petani datang untuk mengambil sepedamotor miliknya yang sebelumnya disita polisi. (net/rzl)

Waspada/Abdullah Dadeh

SUASANA para penumpang termasuk anak-anak saat kereta api bandara PT Raillink akan bergerak dari stasiun Medan tujuan Kualanamu, Kamis (25/7) pagi.

H Ashari Tambunan Buka Puasa Bersama Warga Percut PERCUT SEITUAN ( Waspada): Ketua PW NU Sumatera Utara H Ashari Tambunan, yang juga calon bupati Deliserdang periode 20142019 mengatakan dengan banyaknya para kandidat yang mencalonkan diri untuk maju menjadi calon bupati dan wakil bupati Deli Serdang, menunjukkan banyaknya putra- putra terbaik daerah yang ingin membangun kabupaten berpenduduk 1,7 juta jiwa ini ke arah yang lebih baik. Demikian dikatakan H.Ashari Tambunan di ha-

dapan para tokoh pemuda dan pemuka masyarakat saat silaturahmi , sekaligus buka puasa bersama dengan Pengurus NU Kec. Percut Sei yang dilaksanakan di aula kantor camat, Kec. Percut Seituan, Rabu (24/7). Menurut Ashari, selain masyarakat Deliserdang harus jeli dalam memilih, juga diharapkan dengan mayoritas penduduk yang 75% penduduknya beragama Islam harus bisa tampil dalam Pilkada dan tidak terlena dalam menentukan pilihan. Siapapun nantinya yang

terpilih dalam Pilkada, adalah pemimpin yang satu aqidah dengan kita karena hal itulah yang sewajarnya harus terjadi di samping mampu menjalankan apa yang diamanahkan masyarakat kepadanya. Acara diisi tausyiah oleh Ustadz Drs. Ngatman Azis, Mpd, yang mengupas masalah puasa yang merupakan suatu kewajiban yang harus dijalankan oleh umat muslim yang beriman karena dengan puasa nantinya akan membentuk jiwa orang yang bertaqwa. (crul)

Jerusalem ....

Samri yang menambahkan bahwa ‘pasukan keamanan mencari sisa-sisanya.’ Sebuah roket menghantam daerah yang sama pada Minggu, dan dua lagi mendarat di Israel selatan pada Kamis pekan lalu, namun tidak ada korban atau kerusakan. Insiden saling serang terakhir antara Israel dan pejuang Gaza terjadi pada 25 Juni, ketika kelompok Jihad Islam menembakkan lima roket ke Israel yang dibalas dengan gempuran udara ke Gaza. Hamas bertanggung jawab

memastikan, kelompokkelompok pejuang Palestina menghormati ketentuan gencatan senjata yang ditengahi Mesir yang mengakhiri konfrontasi besar delapan hari dengan Israel tahun lalu. Israel dan kelompok pejuang Hamas yang menguasai Jalur Gaza terlibat dalam perang delapan hari pada November yang menewaskan 177 orang Palestina, termasuk lebih dari 100 warga sipil, enam orang Israel — empat warga sipil dan dua prajurit. (ok/m10)

Terimakasih ....

karena pembebasan lahannya hanya tinggal 1 persen lagi. Pada konferensi pers itu, Dirut PT AP 2 Tri S Sunoko selain menceritakan kronologis lancarnya pengoperasian awal KNIA, mulai dari ferry flight GIA B-737-800 NG hingga take of perdana GIA B737-818 dan sejumlah penerbangan lainnya, seperti Lion Air, Air Asia, Silk Air dan lainnya, juga hasil cross cek Security Chek Poin (SCP) Boarding Lounge dan ciity chek ini. “Alhamdulillah saya amat bergembira sekali semuanya lancar,” sebutnya yang kembali menegaskan 25 Juli sesuai publikasi airrac no 3/13 ke dunia internasional bahwa KNIA mulai beroperasi dan mengingat Polonia sudah over di mana jumlah pengguna jasa udara mencapai 8 juta tahun. “Nah, berkaitan dengan

lonjakan penumpang pada saat Lebaran, ini merupakan salah satu alasan pengoperasian 25 Juli agar pengguna jasa udara nyaman di bandara baru ini meski masih ada kekurangan ibarat pindah rumah. Yang pasti kita antisipasi hingga H-7,” ujarnya sembari menambahkan VIP untuk sementara di lantai dasar dan KNIA memiliki sejumlah mushalla di setiap lantainya. Konferensi pers itu menjawab keraguan berbagai masalah yang akan muncul pada soft operational KNIA kemarin. Pasalnya, sekira pukul 03.40 calon penumpang Lion Air sempat tertahan di counter Lion Air karena carousel atau conveyor di counter chek ini sempat tak berfungsi. Namun saat DI dan Wagub sidak, kondisi itu kembali normal. (m16)

Pangeran Kecil ....

Pangeran Charles dan anggota Kerajaan Inggris yang lainnya. Pangeran William memang ingin putranya hidup normal seperti layaknya anak lainnya. Pangeran George diharapkan dapat lebih menyatu dengan rakyatnya. Ditentukan para petaruh? Bayi yang lahir Senin, dan menarik media massa sedunia itu menempati urutan ke tiga pewaris takhta Kerajaan Inggris, dan akan menyandang gelar Yang Mulia Pangeran George dari Cambridge, kata Istana Kensington.Ketiga nama itu diunggulkan dalam daftar pilihan nama oleh para petaruh Inggris dan pengumuman nama ini tergolong cepat dibanding tradisi kerajaan.Banyak petaruh memasang taruhannya ketika publik menunggu pengumuman nama pangeran kecil itu. Pasar taruhan Inggris Ladbrokes memiliki George dan James sebagai favorit Rabu, yang disusul oleh Alexander, Arthur, Louis dan Henry. Kerajaan perlu waktu sampai sebulan untuk menamai Pangeran Charles, putra mahkota, dan sepekan untuk mengumumkan nama Pangeran William, putra sulung Charles. Nama George dipakai oleh enam orang raja Inggris. Terakhir nama itu dipakai oleh George VI, ayah

Ratu Elizabeth yang bertakhta pada 1936 hingga 1952. Alexandra, versi nama perempuan dari Alexander, adalah nama tengah sang Ratu dan juga nama istri Raja Edward VII yang berkuasa pada awal abad lalu. Sementara Louis adalah nama tengah Pangeran William dan nama yang diambil dari guru dan paman Pangeran Charles, Louis Mounbatten, yang terbunuh dalam serangan gerilya Tentara Nasional Irlandia pada 1979. Namun pemilihan nama itu tidak lantas membuat putra William menjadi Raja George VII. Ayah sang ratu dibaptis dengan nama Albert tetapi memilih nama George VI saat bertahta. “Sangat menarik karena mereka memilih tiga nama tersebut. Sepertinya keluarga kerajaan mendekat ke rakyat, yang cenderung memilih nama tengah lebih pendek dibanding keluarga kerajaan,” kata ahli sejarah Suzannah Lipscomb kepada Sky News. Sebagian komentator mengatakan, nama tersebut tidak memiliki kaitan pada leluhur pihak keluarga Kate. “Mereka membuatnya sederhana dengan tidak mencoba membawa wakil dari kedua keluarga,” kata ahli sejarah kerajaan Tracy Borman kepada Sky News. (vn/m10)

Perundingan PalestinaIsrael buntu sejak 2005. Palestina memprotes pembanguan pemukiman Yahudi di Tepi Barat dan Jerusalem yang dilakukan Israel. Serangan dua roket Sementara itu, dua roket yang ditembakkan dari Jalur Gaza menghantam Israel Selatan, Rabu, namun tidak menimbulkan kerusakan atau kor ba n , ka t a jur ubica ra kepolisian. “Roket-roket itu mendarat di daerah Eshkol,” kata Luba

Wagubsu HT Erry Nurdin yang kembali mengulas histori penantian KNIA selama 19 tahun. “Mari kita jaga kebanggaan Sumut ini. Meski kita akui jelas masih ada harapan masyarakat yang belum tercapai, namun dengan adanya sejumlah proyek nasional di antaranya MP3EI di Sei Mangke dan lainnya, ini jelas akan membawa Sumut sejahtera,” ujar Wagub pada konferensi pers secara singkat kemarin pagi. Begitupun, Wagub secara santun mengungkapkan, semua pihak harus memaklumi kondisi pengoperasian KNIA yang pasti tidak sempurna 100 persen. “Namun hingga pagi ini, Alhamdulillah semua berjalan lancar,” sebutnya sembari menyontohkan jalan non tol (arteri) yang belum sempurna Dia menyerukan perang melawan Kekaisaran Jerman yang dipimpin sepupunya, Kaisar Wilhelm II. Raja George V berasal dari keluarga bangsawan Jerman. Dia mengganti nama keluarganya dari Saxe-Coburg Gotha menjadi Windsor, karena sentimen anti-Jer man yang berkembang di masa itu. Raja George V kemudian digantikan putranya, Raja George VI. Sang Raja berhasil menjaga semangat rakyat Inggris pada Perang Dunia II melalui pidato-pidatonya. Padahal, dia sejak kecil menderita kesulitan berbicara. Kisah hidupnya kembali diceritakan dalam film peraih penghargaan Oscar The King’s Speech. Saat ini, sang pangeran berada di urutan ketiga penerus takhta Inggris di belakang Pangeran Charles dan ayahnya, Pangeran William. Setelah menunjukkan wajah putra mereka kepada publik Selasa, Pangeran William dan Kate Middleton mulai menghindari perhatian publik. Mereka membawa Pangeran George ke rumah orangtua Kate di kota Bucklebury. Sebelumnya, Pangeran George dibawa ke kediaman Pangeran William dan Kate di Istana Kensington. Disana dia dikunjungi oleh Ratu Elizabeth dan kakeknya,


Berita Utama

A2

WASPADA Jumat 26 Juli 2013

Hari Pertama Operasional KNIA

Belasan Penumpang Kesasar Ke Polonia Gaya Hidup Halali Oleh: Syahrin Harahap MENERAPKAN gaya hidup halâli merupakan kosekuensi logis dari keberislaman seorang muslim bahwa hidup dan matinya, kerja dan ibadahnya diorientasikan untuk pengabdian kepada ilahi (Q.S.51/al-Dzâriyâr: 56) sebab visi penciptaan manusia adalah hidup yang berorientasi pada kehidupan halâli, sebagaimana firman Allah: “Katakanlah sesungguhnya shalatku, ibadahku, hidupku, dan matiku hanyalah untuk Allah Tuhan semesta alam. (Q.S. 6/al-An’âm: 162). Kehidupan halâli yang dimaksudkan adalah cara pandang mengenai kehalalan kehidupan, kehalalan tindakan, dan kehalalan konsumsi, serta kehalalan komunikasi. Kehidupan halâli adalah cara pandang bahwa hidup di dunia adalah pengantar dan jembatan bagi proses kehidupan yang abadi. Oleh karenanaya prestasi keduniaan harus berorientasi pada kesuksesan yang lebih panjang dan abadi di hari kemudian. Lanjut ke hal A8 kol 1

MEDAN (Waspada): Hari pertama pemindahan Bandara Polonia Medan ke Kualanamu International Airport (KNIA), belasan penumpang kesasar, Kamis (25/7). Calon penumpang masih datang ke Bandara Polonia Medan, dari pagi hingga siang. Sedikitnya lebih 10 orang calon penumpang pesawat masih kesasar ke Bandara Polonia Medan, kata Patar M. Hutasoit, supir bus Damri yang mengantar penumpang kesasar ke Bandara Kualanamu (KNIA). Pihaknya sudah kesekian kali pergi dan balik mengantar penumpang dari Bandara Polonia Medan ke Bandara Kualanamu. “Ada penumpang yang akan berangkat ke Kuala Lumpur dengan Air Asia pagi maupun tujuan Batam dan lainnya sudah diantar,” kata Hutasoit.

Sementara kawasan Bandara Polonia Medan terkesan seperti kota mati, hanya belasan petugas keamanan dari Angkatan Udara (AU) berjaga-jaga di pintu masuk dan hilir mudik ke dalam terminal bandara. Sedangkan, sampah-sampah berserakan dimana-mana karena petugas cleaning servis tidak bekerja lagi sejak Kamis (25/7). Hanya tersisa barang-barang pemilik kios seperti pintu aluminium (rolling door) yang dilarang dibawa keluar oleh petugas keamanan di bandara. KA Bandara Sementara itu suasana di stasiun kereta api Medan tujuan Bandara Kualanamu, ada juga penumpang yang kebingungan , karena baru hari pertama operasional KA dari PT Raillink jurusan KNIA.

Orang-orang Medan yang menggunakan KA bandara terlihat ramai dari beberapa kali berangkat ke sana sejak pukul 03:55. Trip pertama bergerak dari Medan tujuan KNIA. Agus Batin, staf PT Railink membenarkan, jumlah penumpang yang berangkat pagi cukup lumayan. Trip pertama, ketiga dan trip ke empat hampir rata-rata seat terisi dari 272 tempat duduk KA sekali jalan disediakan, kecuali trip kedua, penumpang agak berkurang, katanya. Namun terlihat operasional KA belum begitu mulus bahkan masih tersendatsendat. “Maklum, baru hari pertama perjalanan KA dari Medan ke bandara, kalau harihari berikutnya pasti lancar,” kata Prof Dr H. Syahrin Harahap saat akan menuju ke Kualanamu. (m32)

Gubsu: Bayar THR 7 Hari Sebelum Lebaran

Waspada/Ist

KETUA PW NU Sumatera Utara yang juga Cabup Deliserdang, H. Ashari Tambunan saat memberi sambutan di hadapan masyarakat dan tokoh pemuda se Kec. Percut Seituan dalam silaturahmi sekaligus buka puasa bersama di halaman kantor camat setempat, Rabu (24/7).

H Ashari Tambunan Buka Puasa Bersama Warga Percut PERCUT SEITUAN (Waspada): Ketua PW NU Sumatera Utara H Ashari Tambunan, yang juga calon bupati Deliserdang periode 2014-2019 mengatakan dengan banyaknya para kandidat yang mencalonkan diri untuk maju menjadi calon bupati dan wakil bupati Deli Serdang, menunjukkan banyaknya putra- putra terbaik daerah yang ingin membangun kabupaten berpenduduk 1,7 juta jiwa ini ke arah yang lebih baik. Demikian dikatakan H.AshariTambunan di hadapan para tokoh pemuda dan pemuka masyarakat saat silaturahmi , sekaligus buka puasa bersama dengan Pengurus NU Kec. Percut Sei yang dilaksanakan di aula kantor camat, Kec. Percut Seituan, Rabu (24/7). Menurut Ashari, selain masyarakat Deliserdang harus jeli dalam memilih, juga diharapkan dengan mayoritas penduduk yang 75% penduduknya beragama Islam harus bisa tampil dalam Pilkada dan tidak terlena dalam menentukan pilihan. Siapapun nantinya yang terpilih dalam Pilkada, adalah pemimpin yang satu aqidah dengan kita karena hal itulah yang sewajarnya harus terjadi di samping mampu menjalankan apa yang diamanahkan masyarakat kepadanya. Acara diisi tausyiah oleh Ustadz Drs. Ngatman Azis, Mpd, yang mengupas masalah puasa yang merupakan suatu kewajiban yang harus dijalankan oleh umat muslim yang beriman karena dengan puasa nantinya akan membentuk jiwa orang yang bertaqwa. Menyinggung kepemimpinan, Ngatman meminta agar dapat memilih pemimpin yang bisa membawa amanah masyarakatnya karena jabatan yang diberikan bukanlah hadiah melainkan sebuah amanah yang harus dipertangungjawabkan kepada masyarakat terlebih kepada Allah. Sebelumnya, Ketua NU Kec. Percut Seituan Drs H. Syamsuddin Nur Sirait, MPd, mengatakan buka puasa bersama ini dilaksanakan untuk menjalin tali silaturahmi dengan masyarakat agar senantiasa terpelihara rasa persaudaraan. Dalam acara itu, Cabup H Ashari Tambunan meneyerahkan bingkisan. Turut hadir dalam acara itu diantaranya Ketua PCNU Kab.,Deliserdang Gustur Husin Siregar,SH, pemuka masyarakat Kec.Percut Seituan H.Ismayadi,SH. (crul)

Giliran Badai Biru ... yang memadati Stadion GBK Jakarta, justru mendukung aksi The Blues. Sebagian di antaranya bahkan terus bernyanyi dengan syair “Chelsea…Chelsea…Chelsea”. Luapan kegembiraan mereka lampiaskan, setiap kali pemain Chelsea berhasil menjebol gawang pasukan Rahmad Darmawan. Sejak menit awal, Eden Jawaban Problem Catur, Hazard cs secara konsisten TTS Dan Sudoku terus menekan pertahanan tuan rumah, yang bermateriDari Halaman Sport. kan gabungan pemain Timnas Senior dan Timnas U-23. Pesta gol London Blues Jawaban Problem Catur: dibuka Hazard menit 20 lewat tendangan penalti. Ha1. Bf7+, Rg8. diah tendangan 12 pas ini diberikan wasit, setelah kapten 2. gxh6 (target Chelsea John Terry dilanggar saat melakukan penetrasi ke h7+mat), Gf4. kotak terlarang Indonesia. Tertinggal satu bola, anak 3. Bg7+mat. asuh RD berusaha bangkit. Serangan terkoordinasi dilakukan Andik Vermansyah, Jawaban TTS: Greg Nwokolo dan kawankawan, namun selalu berhaTTS Santapan Ramadhan sil dipatahkan Si Biru. Menit 28 tendangan keras Ramires membobol gawang Kurnia untuk kedua kalinya. Gol ketiga Si Biru diciptakan striker asal Senegal Demba Ba menit 31, dan gol kapten John Terry menit 46 membuat skor menjadi 0-4 saat memasuki turun minum. Unggul empat bola, Badai Biru masih terus menekan tim tuan rumah pasca rehat. Belum 10 menit babak kedua berlangsung, gawang Indonesia sudah kebobolan dua gol lagi. Dua pemain pengganti, bek Branislav Ivanovic dan striker Romel Lukaku, yang membawa The Blues memimpin 6-0. Menit 56 Ramires mencetak gol keduanya untuk memperlebar jarak menjadi 7-0. Menit 65 Lukaku nyusul Jawaban Sudoku: memasukkan gol keduanya 3 9 2 1 6 5 7 4 8 ke gawang Kurnia sekaligus yang kedelapan bagi Biru. 6 1 7 2 8 4 5 3 9 Indonesia All Stars akhir5 8 4 9 7 3 1 2 6 nya mampu mencuri gol hiburan. Striker Greg Nwoko9 4 6 5 1 2 8 7 3 lo memaksa Tomas Kalas me8 7 5 3 9 6 2 1 4 lakukan gol bunuh diri menit 1 2 3 8 4 7 6 9 5 68 ke gawang tim asuhan Mourinho, yang dikawal ki2 6 8 4 3 1 9 5 7 per anyar Mark Schwarzer 4 5 9 7 2 8 3 6 1 yang masuk menggantikan Jamal Blackman. (m15/haka) 7 3 1 6 5 9 4 8 2

MEDAN (Waspada): Gubsu H Gatot Pujo Nugroho minta seluruh bupati dan wali kota di 33 kabupaten/kota se-Sumut agar menginstruksikan pengusaha memberikan Tunjangan Hari Raya (TH) kepada seluruh pekerja,selambat-lambatnya 7 hari sebelum Lebaran. “Bagi perusahaan yang tidak membayar akan diberi sanksi pidana 3 bulan kurungan,” kata Kadisnakertrans Provsu Drs Bukit Tambunan MAP, kepada wartawan, di ruang kerjanya, Kamis (25/7), menanggapi surat edaran

Gubsu soal pembayaran THR kepada pekerja di Sumut. Dijelaskan Tambunan, surat edaran Gubsu No 568/ 6728/2013 menindaklanjuti surat edaran Menteri Tenaga Kerja dan Transmigrasi, meminta perusahaan membayar THR kepada pekerja yang merupakan tradisi tiap hari raya keagamaan. Pemberian THR kepada pekerja dituangkan dalam Permen Tenaga Kerja Republik Indonesia No PER.04/Men/ 1994, tentang tunjangan hari raya keagamaan bagi pekerja perusahaan dan diberikan kepada

pekerja yang telah mempunyai masa kerja 3 bulan atau lebih secara terus menerus. THR bagi pekerja diberikan 1 kali dalam 1 tahun oleh pengusaha dan pembayaran disesuaikan dengan hari raya keagamaan selambat-lambatnya 7 hari sebelum hari raya. Untuk itu, para bupati dan wali kota dan para kepala daerah yang membidangi ketenagakerjaan kabupaten/kota di Provsu hendaknya senantiasa mengigatkan dan menegaskan para pengusaha agar pembayaran THR dilaksanakan tepat waktu. (m28)

Terima Kasih ...

“Alhamdulillah saya amat bergembira sekali semuanya lancar,” sebutnya yang kembali menegaskan 25 Juli sesuai publikasi airrac no 3/13 ke dunia internasional bahwa KNIA mulai beroperasi dan mengingat Polonia sudah over di mana jumlah pengguna jasa udara mencapai 8 juta tahun. “Nah, berkaitan dengan lonjakan penumpang pada saat Lebaran, ini merupakan salah satu alasan pengoperasian 25 Juli agar pengguna jasa udara nyaman di bandara baru ini meski masih ada kekurangan ibarat pindah rumah. Yang pasti kita antisipasi hingga H-7,” ujarnya sembari menambahkan VIP untuk sementara di lantai dasar dan KNIA memiliki sejumlah mushalla di setiap lantainya. Konferensi pers itu menjawab keraguan berbagai masalah yang akan muncul pada soft operational KNIA kemarin. Pasalnya, sekira pukul 03:40 calon penumpang Lion Air sempat tertahan di counter Lion Air karena carousel atau conveyor di counter chek ini sempat tak berfungsi. Namun saat DI dan Wagub sidak, kondisi itu kembali normal. Arus Kendaraan Medan- KNIA Padat Pergerakan kendaraan dari Medan ke Bandara Kualanamu (Kualanamu International Airport) pada soft operational 25 Juli, terlihat padat. Bahkan, di sejumlah titik terjadi kemacatan arus lalu lintas. Sementara, puluhan anggota Polri dari jajaran Poldasu, Polres Deliserdang bersama Polsek Tanjungmorawa dan Polsek Batangkuis, terlihat aktif berada di lapangan untuk mengantisipasi kemacatan arus lalu lintas dan hal lainnya. Pantauan Waspada, sejak Rabu (24/7) hingga Kamis (25/ 7) dinihari, ratusan kendaraan roda empat maupun lebih terutama truk bak terbuka terlihat memadati ruas jalan arteri non tol Tanjungmorawa- Batangkuis dengan membawa sejumlah peralatan atau barangbarang dibawa menuju Kualanamu International Airport (KNIA). Para sopir truk yang dikonfirmasi Waspada di ruas jalan arteri non tol Tanjungmorawa, Kamis dinihari mengatakan, barang-barang yang mereka bawa adalah milik maskapai penerbangan.Namun, sopir tersebut tidak tahu maskapai apa.’’ Kami hanya mengambil

jasa angkut,’’ kata sopir tersebut. Sedangkan pada Kamis pagi, sejak pukul 05:00, puluhan mobil- mobil dari berbagai jenis memulai memadati jalur arteri non tol dari Simpang Kayu Besar Tanjungmorawa menuju KNIA. Para penumpang mobil tersebut, selain dari para penumpang yang akan berangkat menggunakan jasa penerbangan, juga warga biasa yang ingin melihat penerbangan perdana di KNIA. Sementara, arus kendaraan terus bertambah dari waktu ke waktu. Hingga pukul 09:00, arus kendaraan dari Medan terus memadati ruas jalan arteri Tanjungmorawa menuju KNIA. Bahkan,terjadi kemacatan terutama di persimpangan Kayu Besar Tanjungmorawa menuju arah jalan Batangkuis ke KNIA. Kemacatan arus kendaraan semakin parah, karena pengerjaan jembatan di Jalinsum Sei Belumai depan Kantor Direksi PTPN II masih berlangsung. Sehingga aparat kepolisian dari jajaran Polres Deliserdang dan Polsek Tanjungmorawa melakukan jalur buka tutup. Hal ini mengakibatkan kendaraan menumpuk dan merayap, ditambah lagi lampu pengatur lalu lintas di pintu masuk tol Tanjungmorawa, tidak berfungsi. Kemacatan tidak hanya terjadi di seputaran menuju Simpang Kayu Besar Tanjungmorawa tetapi hingga dua kilometer arah ke Medan, dan lebih tiga kilometer menuju arah Lubukpakam. Ditambah lagi, adanya pengerjaan pelebaran jalan di kaawasan Jalinsum Tanjungmorawa –Lubukpakam, tepatnya di Desa Tanjungbaru, Kec. Tanjungmorawa. Sedangkan dari Medan, kemacatan dipicu oleh razia yang digelar pegawai Dinas Perhubungan di Jalinsum perbatasan Tanjungmorawa- Medan, yang melakukan penyetopan terhadap truk-truk baik bermuatan maupun tanpa muatan. Akibat kemacatan itu, anggota polisi yang bertugas di sejumlah titik menuju KNIA tetapi di ruas arteri Desa Dalu X, Jembatan Seibelumai dan pintu tol Tanjungmorawa sedikit kewalahan. Namun, hal itu dapat diatasi untuk kelancaran arus lalu lintas. Pantauan Waspada, hingga sore, kepadatan arus kendaraan masih terlihat di sana terutama menuju KNIA dan Lubukpakam . (m16/m11)

bersih, seperti bersihnya masjid dan lingkungan pondok pesantren seluas 9,5 hektar—dengan kontur tanah bebukitan itu. Di dalam masjid, aktivitas tak kunjung sepi. Lantunan ayat suci Alquran menandai dimulainya acara seremornial. Suasana khusuk lantas meliputi—khas kehidupan para santri. Acara berlanjut ceramah oleh para santri bergantian, dalam bahasa Arab, bahasa Inggris, dan bahasa Indonesia. Sampai menjelang berbuka bersama—dilanjutkan dengan shalat Maghrib berjamaah. Anak-anak itu, mereka adalah santri pria pada umumnya, karena memang di pesantren ini cuma ada santri pria tingkat tsanawiyah (SMP). “Sementara ini kita masih mendidik santri pria tingkat tsanawiyah. Insya Allah kita juga akan membuka untuk tingkat aliyah (SMA),” kata H.Amri Si-

regar yang merupakan pendiri pondok pesantren ini bersama H.Syamsir Siregar. Seperti santri pada umumnya, aktivitas selama Ramadhan di pesantren ini juga padat dengan ibadah. Sejak sahur mereka sudah makan bersama, shalat Shubuh berjamaah, mengawali hari dengan membaca Alquran, kemudian belajar dari pagi sampai siang hari. Siang sampai sore adalah waktunya bagi mereka untuk istirahat sebelum aktivitas beribadah dimulai lagi dengan shalat Ashar, berbuka, tarawih, dan membaca Alquran. Buka puasa di pesantren itu meninggalkan kesan ber-buka puasa di kota santri. Ke-bersamaan, jalinan ukhuwah, dan padat ibadah. Keindahan beribadah menyemai kebahagiaan di hati para santri. Seperti kata salah seorang dari mereka, “Saya senang sekali mondok di sini,” katanya. (m07)

“Proses simulasi 2 kali dengan keseriusan dan perencanaan yang luar biasa, sehingga hasilnya bagus dan bermanfaat untuk masyarakat,” sebutnya yang mengajak kita untuk menjaga bersama KNIA. Ajakan Pangkosek itu sebelumnya dituturkan oleh Wagubsu HT Erry Nuradi yang kembali mengulas histori penantian KNIA selama 19 tahun. “Mari kita jaga kebanggaan Sumut ini. Meski kita akui jelas masih ada harapan masyarakat yang belum tercapai, namun dengan adanya sejumlah proyek nasional di antaranya MP3EI di Sei Mangke dan lainnya, ini jelas akan membawa Sumut sejahtera,” ujar Wagub pada konferensi pers secara singkat kemarin pagi. Begitupun, Wagub mengungkapkan, semua pihak harus memaklumi kondisi pengoperasian KNIA yang pasti tidak sempurna 100 persen. “Namun hingga pagi ini, Alhamdulillah semua berjalan lancar,” sebutnya sembari menyontohkan jalan non tol (arteri) yang belum sempurna karena pembebasan lahannya hanya tinggal 1 persen lagi. Pada konferensi pers itu, Dirut PT AP 2 Tri S Sunoko selain menceritakan kronologis lancarnya pengoperasian awal KNIA, mulai dari ferry flight GIA B-737-800 NG hingga take of perdana GIA B-737-818 dan sejumlah penerbangan lainnya, seperti Lion Air, AirAsia, Silk Air dan lainnya, juga hasil cross cek Security Chek Poin (SCP) Boarding Lounge dan city chek ini.

Ada-ada Saja ... memilih sekelompok angsa sebagai penjaga gerbang di markas mereka karena dianggap memiliki pendengaran yang lebih baik dan mengeluarkan suara lebih ribut saat ada penyusup yang mendekat. “Anjing memang bagus, tapi ketika pencuri datang, mereka akan langsung meracuni anjing,” ujar seorang polisi yang dikutip dari Orange, Kamis (25/7). “Angsa lebih siaga dan mereka memiliki pendengaran yang sangat hebat. Saat mendengar suara mencurigakan, angsa akan mengeluaran suara ribut. Dan angsa yang besar cukup berani, jika melihat orang asing mereka akan maju menyerang. (net/rzl)

Buka Puasa Di Kota ... Tapi hujan belum mau berhenti. Anginnya seolah ingin menerbangkan segala sesuatu. Tenda-tenda itupun tak sanggup lagi menahan limpahan air. Satu persatu anak-anak itu kemudian berlarian ke dalam masjid. Mereka mengambil posisi berjejeran menghadapi makanan berbuka. Hari itu, Kamis (25/7), merupakan hari berbuka istimewa di kota santri itu—Pondok Pesantren Al Barokah, Simalungun—sedang ada acara buka puasa bersama. Banyak pihak yang diundang untuk hadir. “Biasanya mereka berbuka bersama di ruang makan,” ujar H. Riza Syamsuddin pimpinan pondok pesantren tersebut. Maka saat-saat bergembira menjelang berbuka sangat jelas tergambar di wajah para santri itu. Air muka mereka

Waspada/Abdullah Dadeh

SUASANA para penumpang termasuk anak-anak saat kereta api bandara PT Raillink akan bergerak dari stasiun Medan tujuan Kualanamu, Kamis pagi.

Ornamen Melayu ... Menurut mantan ketua PWI Cabang Sumut, kini Direktur Eksekutif Serikat Penerbit Surat Kabar (SPS) Sumatera Utara itu, dia sudah membicarakannya dengan Wagubsu HT. Erry Nuradi. ‘’ Kelihatannya Wagubsu memberikan lampu hijau agar dipasang ornamen Melayu di Gapura KNIA,’’ ujar Zaki. “Ini bukan maksud memprotes, namun hanya mengusulkan karena di kawasan Deliserdang dan Kualanamu pada umumnya komunitas Melayu cukup besar agar mereka merasa merasakan manfaat kehadiran bandara kebanggaan masyarakat Sumut itu,” kata HM Zaki Abdullah. Sementara, Wagubsu didampingi Menteri BUMN H. Dahlan Iskan, Dirut AP-II Tri S. Sunoko dan General Manajer (GM) Bandara Kualanamu

H.T. Said Ridwan, pada prinsipnya para pejabat terkait tidak keberatan. ‘’ Awalnya ornament tersebut kami minta dipasang di gerbang Gapura KNIA, kalau memungkinkan diipasang juga di tempat-tempat strategis bagian dalam Bandara Kualanamu, ‘’ kata HM Zaki Abdullah. Seperti diketahui, areal Bandara Kualanamu yang membentang dari Desa Aras-

kabu Kec. Beringin, dan Kec. Pantailabu dahukunya merupakan kawasan kekuasaan Kesultanan Serdang dari mulai zaman Sultan Taf Sinar, Sultan Basjaruddin hingga Sultan Sulaiman Sjariful Alamsjah. Bahkan, sekira 50 hektare lahan milik zuriat Sultan Serdang yang berada di ujung landasan pacu, dibebaskan untuk pembangunan Bandara kebanggaan warga Sumatera Utara itu.(m32)

AirAsia Dan MAS ... Sementara itu Rajuan, Distrik Manajer (DM) maskapai Malaysia Airlines System (MAS) saat dikonfirmasi via telefon juga menyatakan bakal ada kemudahan dari manajemen penerbangan itu, bagi penumpang telat tiba di Bandara Kualanamu. Misalnya, penumpang yang telat tiba pagi akan dialihkan pada penerbangan siang asalkan seat pesawat tersedia. Dalam kaitan ini manajemen MAS tidak akan membebankan biaya tambahan kepada penumpang, kata Rajuan. Bantuan bagi penumpang telat, menurut Rajuan, terbatas. Artinya bisa kemungkinan selama seminggu. Setelah itu pihaknya mengimbau penumpang agar tidak telat tiba di Bandara, misal 1 jam sebelum berangkat. (m32)

Masukan Buat Pengunjung KNIA Dan AP2 KAMIS (25/) pagi, merupakan hari perdana pengoperasian Kualanamu International Airport (KNIA). Secara teknis soft operational berjalan lancar, khususnya pada sekian banyak penerbangan mulai sebelum subuh hingga sore. Namun, tim Waspada, Rizaldi Anwar dan Surya Effendi (fotograper) mendapat sejumlah temuan yang harus segera diatasi PT Angkasa Pura 2.Singkatnya, pada soft operational, area KNIA bak lokasi wisata. Maklum, pihak pengelola menggratiskan biaya parkir hingga Jumat (26/7). Tak ayal, begitu melihat publikasi yang gencar akan kelancaran pengoperasian KNIA, masyarakat sekitar khususnya, mulai dari anak-anak hingga orang tua dan dari yang

berkantong tebal hingga kaum papa, tumplek di KNIA. Khusus untuk warga menengah ke bawah jelas tampak berjubel di lobi. Mulai dari yang hanya sekadar melihat hingga berbaris di pinggir badan jalan baik ke ruang keberangkatan maupun kedatangan. Kondisi serupa juga tampak dari warga menengah ke atas. Ironisnya, mereka yang umumnya membawa kendaraan pribadi tampak memarkirkan kendaraannya sekenanya saja. Walhasil, petugas keamanan baik security maupun Avsec tak berdaya menerapkan aturan. Maklum, pengunjung kian membludak mulai tengah hari hingga menjelang berbuka puasa. Kondisi ini tentu mengganggu pengguna jasa udara.

Di sisi lain di dalam terminal, khususnya kedatangan, yang terletak di lantai dasar, terdapat dua penyewa makanan yang sedari awal sudah opening. Namun, pengunjung kebingungan karena di situ no smoking area alias tidak boleh merokok. Namun, karena area merokok belum ada, jelas pengunjung melanggar aturan itu. Akibatnya, lantai yang sudah dibersihkan kotor dengan debu dan puntungan rokok. Nah, dalam hal ini perlu kesadaran dari kedua belah pihak. Untuk pengunjung, sejatinya mulai menerapkan rasa memiliki baik dari kebersihan maupun patuh pada aturan yang ada. Untuk pengelola (AP 2) seluruh bagiannya tetap kukuh menjalankan aturan dan berlaku bagi siapa saja.

Pengadilan AS Tolak Jerusalem Wilayah Israel WASHINGTON (AP): Pengadilan Federal Amerika Serikat menolak mengakui Jerusalem sebagai wilayah Israel. Lembaga itu menyatakan, pengakuan tersebut tidak sesuai konstitusi. Keputusan itu menjadi pukulan bagi kelompok proIsrael di AS. Mereka berniat mengajukan banding ke Mahkamah Agung. Pengakuan Jerusalem se-

bagai wilayah Israel dikeluarkan Kongres pada 2002. Namun, Pemerintah AS menolak kebijakan tersebut. Pemerintah takut kebijakan itu merusak hubungan AS dengan Arab. “Kongres ingin mengubah posisi netral AS dalam isu Jerusalem,” sebut putusan Pengadilan Federal, seperti dikutip Washington Post Kamis (25/7). Presiden Barack Obama

memang sedang berupaya membawa Israel dan Palestina kembali ke meja perundingan. Dia mengutus Menteri Luar Negeri John Kerry ke Timur Tengah untuk mendorong negosiasi. Perundingan PalestinaIsrael buntu sejak 2005. Palestina memprotes pembangunan pemukiman Yahudi di Tepi Barat dan Jerusalem yang dilakukan Israel. (ok/m10)

Ketika Jadi Raja Kelak, Pangeran Kecil Inggris Bergelar George VII LONDON, Inggris (CNN): Si pangeran kecil dari Inggris, yang baru berusia tiga hari, telah diberi nama George Alexander Louis.Demikian diumumkan. Jika dia memerintah kelak, gelar yang akan disandangnya adalah Raja George VII. Nama Pangeran George memiliki arti penting bagi Kerajaan Inggris. Nama itu dipakai oleh raja-raja besar dalam sejarah Inggris. Menurut BBC Kamis (25/7), Raja George V memimpin Inggris pada Perang Dunia I. Dia menyerukan perang melawan Kekaisaran Jerman yang dipimpin sepupunya, KaisarWilhelm II. Raja George V berasal dari

keluarga bangsawan Jerman. Dia mengganti nama keluarganya dari Saxe-Coburg Gotha menjadi Windsor, karena sentimen anti-Jerman yang berkembang di masa itu. Raja George V kemudian digantikan putranya, Raja George VI. Sang Raja berhasil menjaga semangat rakyat Inggris pada Perang Dunia II melalui pidato-pida-

tonya. Padahal, dia sejak kecil menderita kesulitan berbicara. Kisah hidupnya kembali diceritakan dalam film peraih penghargaan Oscar The King’s Speech. Saat ini, sang pangeran berada di urutan ketiga penerus takhta Inggris di belakang Pangeran Charles dan ayahnya, Pangeran William. (vn/m10)

Medan Kembali Dilanda ... setelah itu bakal turun hujan baik sore maupun malam. Sementara kondisi perairan baik di Selat Malaka dan pesisir barat Sumut seperti kawasan Sibolga maupun Nias untuk saat ini masih dalam kondisi stabil. Artinya para nelayan masih bebas turun ke laut baik di pesisir barat maupun timur Sumatera Utara, karena tinggi gelombang laut tidak mengganggu aktivitas para nelayan. (m32)

Al Bayan ... sedikit pahalanya berlipat ganda. Bantuan yang sok pamer itu tidak sesuai dengan ajaran Islam. Allah mengibaratkan sedekah semacam itu sebagai firman-Nya: Perumpamaan orang-orang yang bersedekah karena ria bagaikan batu licin yang berdebu, kemudian debu itu ditimpa hujan lebat, tidak ada yang tersisa atas batu licin itu, kecuali hanyalah batu licin belaka. Begitulah amal orang yang ria, pahalanya habis percuma.(QS. Al-Baqarah:264) Sebaliknya orang yang bersedekah dengan niat yang ikhlas, diumpamakan Allah sebagai tanah yang subur di dataran tinggi yang disiram hujan lebat, maka penghasilan yang diperolehnya akan berlipat ganda. Dan sekiranya tidak ada hujan lebat, hujan gerimis saja sudah cukup untuk menyuburkan benih di tanah yang bagus itu. Allah berfirman: Dan perumpamaan orangorang yang membelanjakan hartanya karena mencari keridhaan Allah dan untuk keteguhan jiwa mereka, seperti sebuah kebun yang terletak didataran tinggi yang disiram oleh hujan lebat, maka kebun itu menghasilkan buahnya dua kali lipat. Jika hujan lebat tidak menyiraminya, ma-

ka hujan gerimispun memadai. Dan Allah Maha Melihat apa yang kamu perbuat.-(QS.2:265) Berzakat, infaq dan sedekah sebenarnya sangat tergantung niat seseorang. Hanya Allah yang tahu, apakah niatnya ikhlas atau tidak. Biasanya amal yang ikhlas itu diberikan oleh seseorang tanpa mengharap imbalan atau pamrih apapun dari orang yang menerima. Apabila seseorang ada niat yang lain, saat itulah amalnya tidak mendapat pahala dari Allah. Ajaran Islam membolehkan beramal secara terang-terangan, dipublikasi asal diberikan niat masih ikhlas. Kita boleh memberi sadaqah di depan orang lain dengan syarat harus berniat agar orang lain dapat meneladani kemurahan tangan kita. Memberikan sadaqah secara sembunyi atau terang-terangan telah diberitakan oleh Allah sebagai berikut: Jika kamu menampakkan sedekah-sedekahmu, maka itu adalah baik. Dan jika kamu menyembunyikannya dan kamu berikan kepada orang-orang fakir, maka menyembunyikannya itu paling baik bagimu. Dan Allah akan menghapuskan bagimu sebagian dosa-dosamu, dan Allah mengetahui apa yang kamu kerjakan.(QS.Al-Baqarah:271)


Medan Metropolitan

WASPADA Jumat 26 Juli 2013

A3

Orangtua Dan Guru Berperan Cegah Penyalahgunaan Narkoba Sat Res Narkoba Polresta Medan Buka Puasa Bersama

Waspada/Rudi Arman

KASAT Reserse Narkoba Polresta Medan Kompol Dony Alexander (tiga kanan) saat berbuka puasa bersama dengan jajarannya dan wartawan di Restoran Lembur Kuring Medan, Rabu (24/7).

MEDAN (Waspada): Jajaran Sat Reserse Narkoba Polresta Medan melaksanakan buka puasa bersama di Restoran Lembur Kuring, Rabu (24/7). Acara yang turut dihadiri wartawan unit Polresta Medan ini bertujuan untuk lebih memperat tali silaturahmi. Kasat Reserse Narkoba Polresta Medan Kompol Dony Alexander mengharapkan dukungan masyarakat terutama para orangtua dan guru agar bersama-sama memberantas penyalahgunaan narkoba di daerah ini. “Dukungan berbagai pihak sangat dibutuhkan dalam memberantas peredaran narkoba narkoba di wilayah hukum Polresta Medan,” tegasnya. Dony memaparkan tentang pentingnya peran serta seluruh lapisan masyarakat terutama orangtua, guru, pemuka agama dan tokoh masyarakat dalam mencegah penyalahgunaan narkoba di kalangan remaja. Dalam melakukan upaya pencegahan, peran orangtua menjadi sangat penting karena setiap hari mendampingi anak-anaknya di rumah. Begitu juga dengan guru yang selalu memberi bimbingan kepada para pelajar di sekolah. “Karena itu, para orangtua dan guru diharapkan mampu memberi pemahaman kepada para remaja baik di rumah maupun di sekolah tentang bahaya penyalahgunaan narkoba. Sedangkan pemuka agama dan tokoh masyarakat berperan mengantisipasi dampak negatif pengaruh lingkungan melalui ceramah agama maupun kegiatan kemasyarakatan,” ujar Dony.

Sedangkan polisi berperan memutus mata rantai peredaran narkoba serta menangkap bandar dan pengedar narkoba yang merusak masa depan generasi muda. Bahkan, polisi siap bekerjasama dengan pemuka agama, tokoh masyarakat dan lembaga pendidikan untuk memberi penyuluhan kepada para remaja tentang bahaya penyalahgunaan narkoba. “Dengan adanya kerjasama ini, dipastikan tidak ada lagi penyalahgunaan narkoba di tengah-tengah masyarakat,” jelas Dony. Kendati telah berhasil mengungkap berbagai kasus penyalahgunaan narkoba termasuk menggerebek pabrik ekstasi dan menangkap bandar sabu, namun Dony tetap mengharapkan masukan dari masyarakat dan kerjasama dengan berbagai pihak. “Sat Reserse Narkoba Polresta Medan siap dikoreksi jika ditemukan adanya penyimpangan tugas anggota di lapangan,” ujarnya. Kepada sesama personel Sat Res Narkoba, Kompol Dony mengharapkan agar saling menjaga kekompakan di lapangan, tidak saling menjatuhkan serta bersaing dengan sehat dalam mengungkap kasus penyalahgunaan narkoba. Dengan kekompakan ini tentu akan meningkatkan etos kerja anggota di lapangan, sehingga lebih memaksimalkan pengungkapan kasus-kasus penyalahgunaan narkoba. “Kita akan terus berupaya mewujudkan Medan bebas narkoba dengan menindak tegas para sindikat pengedar narkoba yang beroperasi di daerah ini,” tegasnya. (m39)

Polisi Tangkap Bandar Sabu Jual Narkoba Dari Hotel Ke Hotel MEDAN (Waspada): Bermaksud mengantar sabu-sabu kepada pelanggannya di Hotel S Jln. Prof HM Yamin II, Kec Medan Perjuangan, seorang bandar narkoba diringkus petugas Polsek Medan Timur, Rabu (24/7) malam sekira pukul 22:00. Selain menangkap tersangka SW alias Yayat, 31, warga Jln. Sei Kera Gg. Indraloka, Kel. Sei Kera Hulu, Kec Medan Perjuangan dan MAGM, 30, warga Jln. Cokroaminoto, Kel Sei Kera Hulu, Kec Medan Perjuangan, polisi juga menyita 4 paket sabusabu seberat 4 gram, uang tunai Rp1.650.000, satu timbangan elektrik, satu pipet, satu bong, dua mancis dan mobil sedan Honda City BK 754 RP sebagai barang bukti. Informasi yang diperoleh Waspada di kepolisian, penangkapan tersebut bermula saat pe-

tugas mendapat informasi bahwa tersangka SW alias Yayat yang selama ini dikenal sebagai bandar narkoba hendak mengantar sabu-sabu kepada pelanggannya di Hotel S. Dalam menjalankan bisnisnya, SW menjual sabu dari hotel ke hotel sesuai dengan pesanan pelanggan. Setelah lama menunggu, akhirnya tersangka SW alias Yayat dan MAGM tiba di pelataran parkir Hotel S. Begitu turun dari mobil dan hendak masuk ke hotel tersebut, petugas Reskrim Polsek Medan Timur yang dipimpin Iptu Jama K Purba langsung menyergap tersangka SW alias Yayat dan MAGM. Kedua pengedar Narkoba itu langsung digeledah namun tak ditemukan barang buktinya. Kemudian polisi menggeledah mobil Honda City BK 754 RP dan menemukan satu paket sabu di dalam bagasi belakang. Setelah meringkus keduanya, polisi menggerebek kedia-

man SW alias Yayat di Jln. Sei Kera Gg. Indraloka. Hasilnya, ditemukan tiga bungkus kecil plastik berisi sabu-sabu, satu gulungan aluminium foil dan satu bungkus plastik kecil kemasan sabu-sabu. Saat diinterogasi, tersangka SW aliasYayat mengaku hendak mengantar pesanan sabu-sabu kepada seorang pelanggannya di Hotel S. “Rencananya mau ngantar sabu kepada pelanggan, namun gagal karena ditangkap polisi,” tutur tersangka SW alias Yayat. Kapolsek Medan Timur AKP Efianto didampingi Kanit Reskrim Iptu Jama K Purba menjelaskan, tersangka SW alias Yayat sudah lama masuk dalam target operasi (TO). “Saat hendak masuk ke hotel, tersangka Yayat langsung ditangkap,” jelas AKP Efianto kepadaWaspada, Kamis (25/7). Menurut Kapolsek Medan Timur, pasca penangkapan

terhadap bandar narkoba di Jln. Sei Kera itu, sejumlah warga mengirim pesan singkat (SMS) serayamengucapkanterimakasih kepada Kapolresta Medan.“Warga ada yang mengirimkan SMS ucapan terimakasih atas penggerebekankediamanbandarnarkoba tersebut,” ujar AKP Efianto. Sehari sebelumnya, petugas Reskrim Polsek Medan Timur menangkap tiga pengedar ganja dan sabu-sabu di Jln. Paduan Tenaga Gg. Genteng, Kec Medan Kota dan Jln. Balai Desa, Pasar XII, Kec Patumbak. Ketiga tersangka berinisial DI, 30, warga Jln. PaduanTenaga Gg. Genteng, Kec Medan Kota; Sum, 32, dan Sug, 45,keduanyawargaJln.BalaiDesa Pasar XII, Desa Mariendal II. Dari ketiga tersangka, polisi menyita bungkusan berisi daun ganja kering dan satu kotak permen berisi empat paket sabusabu. Ketiga tersangka tertangkap tangan saat hendak mengedar sabu-sabu dan ganja. (h04)

181 Pelaku Kejahatan Terjaring Operasi Pekat MEDAN (Waspada): Selama sepekan pelaksanaan Operasi Pekat 2013, Polresta Medan dan seluruh jajaran Polsek berhasil menangkap 181 pelaku kejahatan dan preman. Selain itu, polisi juga menyita barang bukti ratusan botol miras, ribuan petasan, CD porno. Kapolresta Medan Kombes Pol Nico Afinta Karokaro, SIK, SH, MH didampingi Kasat Reskrim Kompol Jean Calvijn Simanjuntak mengatakan kepada wartawan, Kamis (25/ 7), Ops Pekat dimulai 18 - 25 Juli 2013. Sasaran Operasi Pekat meliputi premanisme, perjudian, pornografi, prostitusi dan minuman keras (miras). “Selama sepekan operasi ini telah diungkap 109 kasus kejahatan dengan 181 tersangka,” katanya. Polisi akan terus menekan kasus ‘penyakit masyarakat’, terutama menjelang perayaan Idul Fitri. “Untuk kasus premanisme pihaknya akan mengedepankan tindakan persuasif. Jika ada pelanggaran pidana akan diproses sesuai dengan ketentuan hukum yang berlaku,” tegasnya. Jadi untuk kasus premanisme, kami akan lebih kedepankan tindakan persuasif dan meminta mereka lebih mematuhi hukum. “Bila ditemukan unsur pidana, maka akan diproses

sesuai peraturan yang berlaku,” kata Nico. Sementara itu Kasat Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak mengatakan, Operasi Pekat akan terus digelar hingga Lebaran.

Selain itu, polisi mendirikan posko di sejumlah lokasi rawan tindakan kriminal. “Operasi Pekat terus digelar sampai Lebaran dan sejumlah posko pengaduan masyarakat akan terus siaga. Posko penga-

duan masyatarakat akan didirikan di setiap wilayah hukum Polsek di jajaran Polresta Medan. Ini kita lakukan untuk menekan angka kriminal yang meningkat menjelang Lebaran,” jelasnya. (m39)

Waspada/Rudi Arman

KAPOLRESTA Medan Kombes Pol Nico Afinta Karokaro, SIK, SH, MH didampingi Kasat Reskrim Kompol Jean Calvijn Simanjuntak memperlihatkan barang bukti miras yang terjaring Ops Pekat di Polresta Medan, Kamis (25/7).

Waspada/Andi Aria Tirtayasa

KAPOLSEK Medan Timur AKP Efianto didampingi Kanit Reskrim Iptu Jama K Purba SH, MH memperlihatkan sabu-sabu milik tersangka SW alias Yayat Bandar SS yang ditangkap saat hendak mengantarkan sabu-sabu kepada pelanggannya di Hotel S Jln. Prof HM Yamin II Kec Medan Timur, Kamis (25/7).


A4

Medan Metropolitan

WASPADA Jumat 26 Juli 2013

Wagubsu Minta Damri Tidak Naikkan Harga Tiket MEDAN (Waspada): Wakil Gubernur Sumatera Utara Ir H Tengku Erry Nurady, MSi meminta Perum Damri yang menangani moda transportasi menuju Bandara Kualanamu Internaional Airport (KNIA) terus meningkatkan pelayanan. Faktor keamanan dan kenyamanan harus menjadi perhatian utama agar pengguna jasa penerbangan via KNIA puas. Tak hanya dua faktor itu, sebagai perusahaan plat merah Damri juga diminta tidak buru-buru menaikkan harga tiket. “Kita sesuaikan dengan Bandara yang indah, seperti apa kata Menteri BUMN saat membuka penerbangan pertama beroperasinya bandara Kualanamu. Bus Damri memiliki ac, toilet dan tidak cepat-cepat menaikan tarif angkutan dari dan menuju Bandara,” Kata Wagubsu saat menerima rombongan Perum Damri, di Ruang Kerja Wagubsu, Kamis (25/7). Wagubsu juga mengajak Perum Damri bersama Pemprovsu terus mencari solusi untuk bersama memberi kenyaman kepada para penumpang. Kepada Perum Damri diminta untuk berkoordinasi kepada pihak AU terkait eks Bandara Polonia untuk menjadi pool Damri tujuan KNIA. Sementera Itu GM Perum Damri Sumut Basri Mubin mengatakan, saat ini bus Damri yang

diopersionalkan ke Bandara KNIA sebanyak 20 bus yang berada di dua titik, pertama di Carefour eks Taman Ria dan terminal terpadu Amplas. “Tarif yang dikenakan kepada penumpang bus dari Carefour menuju Bandara Rp15.000 dan dari terminal Amplas Rp10.000,” katanya. Untuk memenuhi kebutuhan penumpang, bus yang harus stand by di tempat sebanyak 25 armada untuk satu trayek mengingat kemacatan yang akan terjadi. Selain itu bus yang menuju Kualanamu dilengkapi wifi dan ac dengan jumlah penumpang 32 seat dengan satu sopir dan pembantu sopir.(m28)

Waspada/Amir Syarifuddin

WAGUBSU HT Erry Nuradi menerima kunjungan rombongan dari Perum Damri di ruang kerjanya Kantor Gubsu, Kamis (25/7).

Dugaan Pengalihan Aset

Ketua Kadin Sumut Diperiksa Waspada/ME Ginting

RATUSAN kendaraan terjebak macat di Jln. Balai Kota Medan, akibat penutupan arus Jln. Bukit Barisan yang digunakan sebagai tempat parkir seiring dengan beroperasinya Bandara Kuala Namu, Kamis (25/7).

Kota Medan Macat MEDAN (Waspada): Pasca pengoperasian Bandara Kuala Namu, Deliserdang, Kamis (25/7), bersamaan transportasi kereta api dari Medan-Kuala Namu juga ikut beroperasi. Kondisi ini mengakibatkan dilakukannya penutupan arus lalulintas di Jln. Bukit Barisan karena dijadikan lahan parkir mengingat lapak pedagang buku belum bisa digunakan. Akibatnya, kemacatan total terjadi di sejumlah ruas jalan di inti Kota Medan. Pantauan Waspada sejak pukul 10:00-17:00 sore, seluruh ruas jalan seperti Jln. S Parman, Jln. Gatot Subroto, Jln. Kejak-

saan, Jln. Diponogoro, Jln. Pengadilan, Jln. Kapten Maulana Lubis, Jln. Ahmad Yani, dan Jln. Raden Saleh yang menuju ke kawasan Lapangan Merdeka macat total. Penumpukan kendaraan terjadi di sejumlah ruas jalan di inti Kota Medan karena Jln. Bukit Barisan ditutup dengan menggunakan traffic cone. Kendaraan tersendat karena masing-masing pemilik saling ingin mendahului sehingga tidak beraturan lagi. Yang mengakibatkan traffic light tidak berfungsi begitu juga dengan arus kendaraan dari Jln. Pulau Pinang. Alhasil, tiga arus kendaraan menumpuk di Jln. Balai Kota dan tidak mampu diurai. “Macat ini sudah terjadi mulai pagi, seharusnya Jln. Bukit Barisan ini dibuka saja, biar

Profil Khatib Jumat

Nasib Silmi: Jangan Ingkar Janji BULAN Ramadhan menjadi hari yang semakin menyibukkan bagi Al Ustad Drs M Nasib Silmi (foto), karena dia semakin banyak jadwalnya menjadi penceramah dalam berbagai kegiatan. Jadi khatib Jumat, penceramah di pengajian kaum bapak dan ibu serta nara sumber dalam kegiatan ceramah setelah shalat Zuhur di berbagai instansi. Tetapi dalam setiap ceramah yang dia sampaikan, Nasib Silmi selalu mengingatkan kaum muslimin agar tidak ingkar janji. “Muslim yang baik itu adalah mereka yang ingat akan janjinya, tidak tergiur dengan materi yang banyak, sehingga meninggalkan tugas di tempat yang imbalan materinya sedikit. Terutama pada ustad, jangan sampai membatalkan janji berceramah di kampung A, karena tiba-tiba mendapat tawaran di kampung B yang lebih banyak finansialnya. Ini bukan ciri seorang yang bertanggung jawab,” kata Al Ustad yang pernah menjadi guru agama di SMAN 2 Medan ini. Kata dia, jika seorang taat atau patuh pada janjinya, maka Allah akan memberikan berbagai kemudahan dan kelapangan rezeki karena telah menyenangkan saudara sesama muslim yang mengharapkan kehadirannya di suatu acara. “Bayangkan jengkelnya panitia acara kalau sudah dijadwalkan ceramah tiba-tiba pak ustadnya membatalkan janji. Kalau bisa dapat ganti, kalau tidak bagaimana kelangsungan acara yang sudah mengundang warga,” sebutnya. Demikian juga dalam menyampaikan khutbah Jumat, dia selalu menekankan pentingnya menepati janji ini agar orang lain selalu percaya pada kita. “Hari ini, saya akan menjadi khatib di Masjid Al Ikhlas Pondok Batuan Setia Budi. Materi yang akan sampaikan berkaitan dengan memenuhi janji dan menjadikan bulan suci Ramadhan sebagai bulan bertaubat dan bulan mengakui kesalahan. Allah telah menjadikan bulan ini sebagai bulan pengampunan bagi umat Islam, karena itu harus dimanfaatkan untuk benar-benar bertaubat dan meminta ampun kepada Allah. Selain itu, harus selalu menjadi seorang yang mengakui kesalahan pada Allah dan kepada orang yang terdekat,” ujar ayah dari Miswanul Akhyar, Saiful Amri, Adi Suheliyanto, dan Budi Darmanto. Menurut Nasib, profesi sebagai khatib memang memerlukan proses, apalagi dia berasal dari pendidikan seorang guru. Tetapi, keinginannya menjadi seorang pendakwah terutama di mimbar tilawah, membuatnya giat menambah refrensi ilmu pengetahuan bidang keagamaan. “Membaca, berdiskusi dengan orang yang ilmunya lebih tinggi dan memadukan konsep mendidik dan strategi berceramah membuat saya menyukai profesi ini. Bahkan, tanpa memandang materi, karena salah satu tujuan berdakwah itu menyampaikan kepada manusia ajaran kebaikan dan bagaimana mereka bisa merubah diri kearah yang lebih baik setelah mendengarkan ceramah kita,” tutur suami dari Miskiyah ini. Setelah tidak lagi menjadi guru karena telah pensiun, apakah akan fokus sebagai penceramah ? “Memang saya baru saja pensiun sebagai guru. Tetapi berceramah atau menjadi khatib tentunya tidaklah seumur hidup. Saya menyadari bahwa setiap manusia punya waktu yang sudah ditentukan Allah dalam menjalani karirnya. Karenanya, saya juga menyiapkan mental bila nantinya tidak lagi diminta menjadi khatib pada masjid yang selama ini menggunakan jasa saya. Tapi saya tetap akan hadir di masjid itu, sebagai bukti bahwa saya tidak kecewa karena tidak disertakan lagi. Inilah aplikasi dari apa yang kita pelajari dan amalkan selama bahwa kita berilmu, beriman dan apa yang kita lakukan itu adalah ibadah,” kata Nasib. (m37)

kendaraannya jadi terbagi yang pentingkan kan jangan berhenti di depan stasiun,” ujar Ponidi, pengemudi becak bermotor yang mangkal di depan Kantor Pos Medan. Ponidi mengatakan, penutupan arus kendaraan di Bukit Barisan selain membuat kendaraan padat, juga membuat penghasilannya berkurang. “Biasanya kalau tidak ditutup agak ramai orang pakai becak, selain itu kita juga harus memutar lebih jauh kalau mau ke arah Jln. MT Haryono,” sebutnya. Kepadatan dan penumpukan kendaraan di Jln. Balai Kota juga diakui petugas kepolisian yang berjaga mengatur lalulintas di depan Kantor Pos Medan. “Macat ini karena masyarakat banyak yang tidak mengetahui dan masih celingak-celinguk, paling seminggu-seminggu ini sudah lancarnya,” katanya. Kondisi macat di Jln. Balai Kota ternyata berbanding terbalik dengan kondisi di depan Stasiun Kereta Api. Kendaraan yang melintas tampak lenggang dengan pembagian dua ruas jalan oleh Dishub untuk membedakan ruas jalan penumpang kereta api dengan ruas jalan masyarakat umum. Kendaraan yang membawa penumpang hanya diperbolehkan untuk menurunkan dan menaikkan penumpang tanpa harus parkir (drop off). Meski begitu, beberapa betor masih terlihat ada yang bandel dan “ngetem” di depan pintu masuk. Di parkiran depan stasiun, sepedamotor dijejerkan dua baris, sementara betor yang biasanya berada di depan stasiun digeser di bawah Titi Gantung. Taksi masih terlihat ada di depan

stasiun dan mobil rental diparkir kan di Jln. Pulau Pinang. Untuk mengantisipasi kemacatan ini, sejumlah petugas Dishub dan Sat Lantas Polresta Medan disiagakan di sektiar Lapangan Merdeka Medan. Kepala Dinas Perhubungan Kota Medan Renward Parapat ketika dikonfirmasi mengatakan, pihaknya memang sudah melakukan penongkrongan di titik-titik kemacatan Kota Medan. Kemacatan yang terjadi itu, dikarenakan masyarakat yang masih bertanya-tanya akan terjadinya perubahan arus lalulintas. “Masyarakat masih bertanya dari mana jalannya, seperti mereka yang mau ke Bank BCA di Jln. Bukit Barisan dan kantorkantor yang ada di situ. Sebenarnya, kita kan sudah halo-halo kan, kalau mau menuju ke Jln. Bukit barisan bisa memutar ke Jln. HM Yamin,” kata Renward. Begitupun, pihaknya masih akan melihat dulu dalam beberapa hari pengalihan arus setelah itu bersama Kasat Lantas Polresta Medan, akan dilakukan evaluasi. “Ini karena masyarakat yang banyak belum tahu, jadi jalan kendaraan lamban. Kita lihatlah beberapa hari dulu, nanti akan kita lakukan rapat evaluasi. Karena kita juga sudah membuat rencana pengalihan arus lalulintas di Jln. Jawa. Itu sudah kita persiapkan menjadi alternatif, kalau sekarang kan masih lenggang, makanya kita lihat dulu dalam beberapa hari ini,” tutur Renward. Ditempat terpisah, Kasat Lantas Polresta Medan Kompol M Budi Hendrawan mengatakan, padatnya arus lalulintas di

Jln. Balai Kota karena masyarakat pengguna kendaraan belum mengetahui adanya perubahan arus. Selain itu, arus terhambat karena masih adanyaparkirberlapisdidepankantor pos dan stasiun kereta api. “Banyaknya pengemudi becak yang menunggu di pintu keluar stasiun kereta api railink. Kemudian parkir berlapis di sekitar Pasar Perniagaan,” kata Budi. Untuk itu, menurut dia, disepakati mulai besok Jumat (26/7) akan dilaksanakan kegiatan antara lain pembagian brosur dan pemasangan spanduk tentang pengalihan arus. Kemudian menempatkan anggota di lokasi parkir berlapis dan pencegahan terhadap pengemudi betor yang menunggu di pintu keluar. Pantauan Waspada, hari pertama pengalihan arus di seputaran Lapangan Merdeka saat beroperasinya KNIA terjadi kepadatan arus lalulintas di Jln. Balai Kota Medan. Ini akibat penyempitan jalan disebabkan adanya bangunan air mancur di depan kantor pos yang menjorok ke luar jalan besar sehingga kendaraan yang melintas berjalan pelan sehingga menimbulkan antrean panjang. Sedangkan pengendara dari Jln. Balai Kota tidak bisa berbelok ke kanan karena pengalihan arus. Di simpang Jln. Bukit Barisan ini dijaga petugas Dishub dan Sat Lantas Polresta Medan. Petugas juga belum memasang rambu jalan di Jln. Kereta Api bisa masuk ke Jln. Bukit Barisan sehingga masyarakat masih bingung dengan peralihan arus lalulintas ini. (m50/m39)

Pengedar Ganja Antarkampung Dibekuk MEDAN (Waspada): Tim Khusus (Timsus) Reskrim Polsek Medan Baru membekuk tersangka pengedar ganja antarkampung dalam penyergapan di kawasan Jln. M. Idris, Gg. Komik, Kel. Sei Putih Timur II, Kec. Medan Petisah, Kamis (25/ 7) dinihari. Dari tersangka RI, 40, polisi menyita barang bukti 222 amplop ganja, handphone, uang Rp165 ribu hasil penjualan ganja, senjata tajam dan lainnya. Informasi yang diperoleh Waspada di lapangan, pada Kamis (25/7) dinihari sekira pukul 02:30, Kapolsek Medan Baru Kompol M. Nasrun Pasaribu,

SIK, SH mendapat informasi dari masyarakat tentang peredaran ganja di kawasan Jln. M. Indris, Gg. Komik. Selanjutnya, Nasrun menurunkan tim khusus dipimpin Kanit Reskrim Iptu Handres, AMd, IK, SH dibantu Panit Reskrim Ipda Sehat Tarigan, SH. Setiba di lokasi, polisi melihat tersangka RI sedang menanti calon pembeli di kawasan itu. Ketika hendak ditangkap, tersangka berusaha melarikan diri. Namun polisi berhasil membekuknya. Saat digeledah, polisi mene-mukan 222 amplop ganja dalam tas milik tersangka. Kapolsek Medan Baru Kom-

pol Nasrun Pasaribu, SIK, SH mengatakan, tersangka dikenal warga di sekitar lokasi penangkapan sebagai pengedar ganja antarkampung. “Dengan tertangkapnya tersangka diharapkan jaringan pengedar narkoba ini bisa terungkap,” ujarnya. Sementara itu, tersangka RI mengaku membeli ganja dari Wr dan Ngn (kedua buron) di kawasan Jln. Medan-Binjai, Kec. Sunggal, Kab. Deliserdang. “Membeli ganja sudah berulangkali. Sebelumnya membeli ganja 5 ons seharga Rp150 ribu per ons. Kemudian ganja ini dijual kepada pelanggan terutama remaja,” ujar RI.(m36)

Waspada/Ismanto Ismail

KANIT Reskrim Polsek Medan Baru Iptu Handres AMd, IK, SH (dua dari kanan) didampinggi Panit Reskrim Ipda Sehat Tarigan, SH (kiri) menginterogasi tersangka pengedar ganja antarkampung, Kamis (25/7) dinihari.

MEDAN (Waspada): Ketua Kamar Dagang dan Industri (Kadin) Sumut Ivan Iskandar Batubara diperiksa penyidik Subdit II/Tahbang Direktorat Reskrimum Polda Sumut, Kamis (25/ 7), terkait dugaan pemalsuan akta notaris terhadap kepemilikan lahan sawit seluas 10 ribu Ha yang dilaporkan mantan Wakil Wali Kota Medan Ramli Lubis. Ivan Batubara diperiksa selama empat jam, mulai pukul 11:00 sampai pukul 15:00, didampingi kuasa hukumnya Hermasyah Hutagalung, SH. Sebelumnya, Ikhsan Lubis, notaris yang diduga membuat keterangan palsu dalam pengalihan usaha PT Rizkina Mandiri Perdana (RMP) milik Ramli Lubis telah diperiksa Poldasu, Selasa (23/7) lalu. Namun, baik Ikhsan Lubis maupun Ivan Batubara tidak ditahan karena dianggap cooperative. Tetapi penyidik sudah menahan Direktur PT RMP Safwan Lubis, yang juga terkait kasus itu. Ivan Batubara diwawancarai saat rehat pemeriksaan mengatakan, sebagai warga negara taat hukum, dia datang ke Polda. “Saya datang sebagai warga negara yang taat hukum, mudahmudahan ini bisa mempermudah penyelidikan,” katanya. Namun Ivan enggan memberi penjelasan terkait kasus menimpanya. “Saya tidak ingin sampaikan kepada pers karena akan menimbulkan polemik, tetapi kepada penyidik saya sampaikan apa yang saya ketahui,” ujarnya.

Sementara terkait kasus itu, Ketua Presidium Indonesia Police Watch (IPW ) Neta S Pane menemui Kapoldasu Irjen Pol. Syarief Gunawan, Kamis (25/7). Kepada wartawan, Neta mengatakan, pertemuannya dengan Kapolda untuk menanyakan proses penyidikan kasus laporan Ramli yang ditangani Polda, karena terkesan lambat. “Dalam pertemuan itu Kapolda mengatakan tidak ada intervensi dan akan menyelesaikan kasusnya. Kapolda juga sudah memerintahkan Wakapolda dan penyidik kasus itu AKBP Jusuf Saprudin menuntaskan kasusnya,” sebut Neta. Bersamaan pemeriksaan Ivan Batubara, puluhan massa Dewan Pimpinan Daerah Ikatan Mahasiswa Muhammadiyah (DPD IMM) unjukrasa di depan gedung Sentra Pelayanan Kepolisian Terpadu (SPKT) Poldasu. Mereka meminta Polda menangkap dan mengadili Maslin Batubara dan putranya Ivan Batubara, serta Ikhsan Lubis karena sudah ditetapkan sebagai tersangka. Mereka juga meminta Ditjen Imigrasi Sumut mencekal ketiganya agar tidak melarikan diri ke luar negeri. Kemudian meminta Polda segera menyelesaikan kasus itu, karena sesuai Perkap No. 14/2012 Pasal 36 ayat 1 huruf b tentang manajemen penyidikan tindak pidana, mengharuskan tersangka ditangkap dan ditahan bila sudah dipanggil dua kali berturut tapi tidak datang atau mangkir.(m27)

Menteri BUMN Harus Atasi Krisis Listrik MEDAN (Waspada): Pemerintah pusat atau Sumut boleh berbangga hati dengan beroperasinya Bandara Kualanamu. Tetapi, pemerintah pusat atau Sumut tidak boleh ‘menutup mata’ dengan terjadinya krisis listrik di Sumut yang mengakibatkan pemadaman listrik. Pemerintah dalam hal Menteri BUMN Dahlan Iskan harus bertanggungjawab dan bertindak cepat mengatasi krisis listrik ini. “Menteri BUMN jangan bangga dengan beroperasinya Bandara Kualanamu, jika krisis listrik di Sumut belum bisa diatasi. Sebab, tidak adanya pemadaman listrik lagi menjadi keinginan warga Sumut,” kata Direktur Indonesian Constitutional (Icon)Watch Razman Arif Nasution kepada wartawan di Medan, Rabu (24/7). Menurut Razman, pemerintah pusat dalam hal ini Menteri BUMN harus bertanggungjawab penuh terhadap infrastruktur di daerah, termasuk krisis listrik yang dialami Sumut. “Namun kenyataannya sekarang, tidak ada yang menjamin sampai kapan listrik padam di Sumut. Masyarakat hanya diberikan janji-janji belaka. Sampai saat ini tidak ada keseriusan pemerintah dan PLN memperbaikipelayanankepadakonsumen,padahal dalamtahuninisajaTDLsudah2kalinaik,”sebutnya. Kata dia, kebutuhan listrik bagi masyarakat sangatlah vital. Masyarakat butuh listrik untuk terus berproduksi dan meningkatkan taraf hidupnya. Namun, kebutuhan masyarakat tidak terpenuhi. “Tapi ketika masyarakat telat membayar listrik, PLN yang dirugikan dengan lantangnya memberi denda atau memutuskan aliran listrik. Ini sangat berbanding terbalik, ketika masyarakat yang dirugikan oleh PLN akibat pemadaman terjadi, mereka mudahnya meminta maaf dengan alasan mesin dalam pemeliharaan, tidak

ada dispensasi yang diberikan pihak PLN,” tuturnya. Satu lagi keganjilan yang dirasakan oleh masyarakat, pihak PLN begitu cepat mempublikasikan kerugian, namun masyarakat tidak pernah tahu berapa keuntungan PLN tiap bulannya. “Kalau kerugian cepat-cepat dipublikasikan, tetap keuntungan mereka masyarakat tidak ada yang tahu,” kata Razman yang juga Caleg DPR RI dari Gerindra. Terkait pemadaman yang terus terjadi ini, menurut dia, pihaknya membuka Posko untuk masyarakat yang setuju memboikot pembayaran rekening listrik sebelum ada jaminan tidak terjadinya pemadaman. “Mari ramai-ramai kita boikot pembayaran rekening listrik ini,” ujarnya. Icon Watch sangat serius menanggapi hal ini dan karena itu pihak PLN segera merespons pemadaman listrik sebelum rakyat bertindak. “Kita juga sudah berkomunikasi dengan Pemprovsu, dan pihak Pemprovsu mengatakan sudah angkat tangan dan jika hal ini tidak bisa diatasi, maka rakyat yang akan bertindak,” tegasnya. Pada kesempatan tersebut, Razman minta agar Dahlan Iskan yang hadir hari ini di Medan untuk pengoperasian Bandara Kuala Namu, harus melihat persoalan listrik padam ini sebagai sesuatu yang serius. “Kalau Pak Dahlan mau Capres, ini tantangan buat dia agar masyarakat Sumut mendukungnya”, katanya. Razman juga mengingatkan pihak PLN agar berhati-hati dalam soal pemadaman listrik karena masyarakat sudah gerah dan sudah beberapa media mengangkat masalah ini. “PLN sudah buta dan Tuli dan jika rakyat nanti bertindak itu artinya respons dari kebutaan dan ketulian mereka,” sebutnya.(cwan)

Ramadhan Momentum Kebangkitan Islam MEDAN (Waspada): Bulan suci Ramadhan dapat dijadikan momentum untuk menambah wawasan tentang kebangkitan dunia Islam. Latar belakang kebangkitan dunia Islam sebenarnya sudah banyak dipaparkan Alquran dalam surat Al Maidah ayat 54. Namun saja sampai saat ini masih terjadi perdebatan apakah Islam sudah bangkit dari keterpurukan atau sebaliknya. Untuk membahas hal itu, Universitas Islam Sumatera Utara (UISU) Al Munawwarah menggelar Seminar Kebangkitan DuniaIslamdikajidarisisiakademisdigedungFakultas Sastra Jln. Sisingamangaraja, Kamis (25/7). “Bulan Ramadhan dapat dijadikan momentum untuk mengetahui dan menambah wawasan tentang kebangkitan dunia Islam,” kata Rektor UISU Al Munawwarah Prof Ir H Zulkarnain Lubis MS, PhD ketika membuka seminar dihadiri civitas akademika kampus itu. Melalui momentum Ramadhan ini, UISU mengajak mahasiswa dan masyarakat agar mendalami tanda-tanda kebangkitan dunia Islam. Rektor sengaja mengambil inisiatif menggelar seminar ini dalam ruang lingkup akademis dengan menghadirkan pakar Islam terkenal di Sumatera Utara, disamping seminar akademik yang bertemakan sosial, pendidikan, politik dan ekonomi yang biasa digelar di kampus UISU Al Munawwarah. “Melalui seminar ini diharapkan peserta mengetahui apa-apa saja yang menjadi syarat kebangkitan dunia Islam,” katanya. Rektor menambahkan, dunia Islam akan bangkit jika semua kaum Muslimin saling

membesarkan satu dengan yang lain, dan harus terlibat dalam kebangkitan Islam. Dia menambahkan, forum diskusi kKeislaman akademis ini akan terus dilanjutkan dan lebih fokus dengan melibatkan tokoh-tokoh Islam lainnya guna menambah wawasan dan pengetahuan Keislaman. Sementara itu, Dr. HM Sofyan Saha, Lc, MA pembicara dalam seminar itu mengungkapkan beberapa negara yang mengalami kebangkitan Islam yakni Mesir dan Turki. Menurutnya, yang menjadi fenomena kebangkitan Islam antara lain kebangkitan ekonomi. Kebangkitan ekonomi ditandai dengan semakin geliatnya sistem syariah memasuki dunia perbankan. Selain itu juga kebangkitan Tahfizul Quran di berbagai tempat dan semangat solidaritas untuk muslim dunia. “Sementara yang menjadi hambatan kebangkitan Islam yakni sekularisasi masih tinggi dan minimnya figur pemimpin panutan,” tambahnya. Seminar ini juga menampilkan dua pembicara lainnya yakni H. Abdul Latif Khan, SAg dari IAIN-SU dan Abdul Halim dari majelis tabliq. Ketua Pelaksana Parlaungan Lubis, MA didampingi Kepala Biro Humas dan Kerjasama H. Onan Siregar, MSi mengatakan, seminar ini bertujuan untuk mengetahui dan menambah wawasan tentang kebangkian dunia Islam dilihat dari sejarah, kejayaan dan kemunduran Islam, faktor-faktor kebangkitan dunia Islam dan tandatanda kebangkitan dunia Islam. (m49)


Medan Metropolitan Medan Kehilangan PAD Rp700 Juta WASPADA Jumat 26 Juli 2013

MEDAN (Waspada): Pemerintah Kota Medan bakal kehilangan Pendapatan Asli Daerah (PAD) setelah beroperasinya Kuala Namu Internasional Airport (KNIA) di Kabupaten Deliserdang.

Pasalnya, PAD dari Pajak Bumi dan Bangunan (PBB) serta Pajak Parkir di Bandara Polonia Medan selama ini mencapai Rp600 juta hingga Rp700 juta per bulan. Kedua jenis pajak ini tidak akan disetorkan lagi ke Pemko Medan, tetapi akan ma-

suk ke kas Pemkab Deliserdang. Demikian dikatakan Pelaksana Tugas (Plt) Wali Kota Medan Dzulmi Eldin kepada Waspada, di Medan, Kamis (25/7). “Seharusnya kita mendapat PBB dan Pajak Parkir dari Angkasa Pura, tapi itu tidak akan tertagih lagi setelah KNIA beroperasi,” kata Eldin. Pajak Parkir yang selama ini ditagih setiap bulannya mencapai Rp600 juta hingga Rp700 juta. Namun, lembaran rupiah tersebut tidak akan mengalir lagi ke kas Pemko Medan yang dalam tahun 2013 menetapkan APBD Rp3,8 triliun. Dengan demikian, target capaian PAD tahun 2013 sebesar Rp3,6 miliar tidak tercapai. Sebab, mulai Juli 2013, PBB dan Pajak Parkir Bandara Polonia tidak akan masuk lagi ke kas Pemko Medan.

Di tempat terpisah, Kepala Dinas Pendapatan Kota Medan H. Muhammad Husni mengatakan, dengan beroperasinya KNIA, maka Pemko Medan kehilangan Pendapatan Asli Daerah (PAD) sebesar Rp600 juta Rp700 juta per bulan dari Pajak Parkir dan PBB Bandara Polonia. “Selama ini, memang Pajak Parkir Bandara Polonia yang disetor dari Angkasa Pura II ke kas Pemko Medan berkisar Rp600 juta - Rp700 juta setiap bulannya. Namun, sekarang kita kehilangan pendapatan itu. Makanya, nanti kita akan berupaya menggarap potensi pajak lainnya seperti dari objek pertumbuhan mall dan melakukan kebijakan intensifikasi pajak,” ujar Husni. Kondisi ini diakui Husni menyebabkan pihaknya harus

melakukan review terhadap target perolehan pajak tahun ini sebesar Rp16 miliar. Paling tidak dari hilangnya Pajak Parkir dan PBB yang selama ini disetorkan pihak Angkasa Pura II, maka diperkirakan Pemko Medan akan kehilangan PAD sekitar Rp4 miliar hingga Rp5 miliar. “Paling tidak kita akan kehilangan PAD sekitar Rp4 miliar hingga Rp5 miliar. Namun, kita akan terus berupaya mencari objek pajak lainnya, seperti pengembangan Central Bussines Distrik (CBD). Dengan begitu maka parkir dari CBD dan pajak lainnya masih dapat masuk ke kas Pemko Medan. Ke depan dengan proses kebijakan mengintensifikasikan pajak daerah, kita harapkan perolehan pajak bisa stabil kembali,” demikian Husni. (m50)

Pasca Penutupan Bandara Polonia Waspada/Rudi Arman

WAKIL Ketua OKK Partai Hanura Kota Medan M. Rusli Tanjung dan Wakil Ketua DPC Satya Anugrah Akbar alias Sadam menyerahkan bantuan sembako kepada warga pinggiran rel kereta api Jln. Salak, Rabu (24/7) malam.

Hanura Medan Bagikan Sembako MEDAN (Waspada): DPC Partai Hanura Kota Medan membagikan sembako kepada warga pinggiran rel kereta api di kawasan Jln. Salak, usai melaksanakan shalat Tarawih di mushalla Ichlassulamal, Rabu (24/7) malam. Pembagian sembako ini merupakan berkah Ramadhan dari Partai Hanura untuk membantu meringankan beban warga. Ketua DPC Hanura Kota Medan Harimantua Dibata Siregar diwakili Wakil Ketua OKK M. Rusli Tanjung dan Wakil Ketua DPC Satya Anugrah Akbar, Caleg Partai Hanura Dapil I mengatakan, bantuan sembako ini diharapkan bisa meringankan beban warga yang bermukim di pinggiran rel kereta api kawasan Jln. Salak. “Bantuan sembako ini merupakan berkah Ramadhan DPC Partai Hanura Kota Medan yang ingin berbagi bersama warga dalam bulan penuh berkah ini,” kata Rusli Tanjung. Selain memberikan sembako, lanjutnya, Hanura Kota Medan juga melakukan berbagai kegiatan diantaranya Lomba Abang Becak Teladan, Isra Mikraj, buka puasa bersama dan Safari Ramadhan. Sedangkan Wakil Ketua DPC Hanura Kota Medan Satya Anugrah Akbar alias Sadam mengatakan, di bulan Ramadhan yang penuh berkah ini, umat Islam harus saling berbagi untuk meringankan beban warga yang kurang mampu. “Kegiatan ini merupakan silaturahmi DPC Hanura Medan dengan warga pinggiran rel kereta api sekaligus untuk meningkatkan keimanan di bulan Ramadhan,” kata Sadam. Sedangkan Kosim mewakili warga pinggiran rel kereta api Jln. Salak mengucapkan terimakasih kepada Hanura yang telah membagikan sembako. Dia berharap ke depan Hanura bisa sukses. (m39)

Personel Polsek Medan Baru Ditarik Ke Komando MEDAN (Waspada): Tujuh personel Polsek Medan Baru yang bertugas di Pos Polisi Bandara Polonia, ditarik kembali ke Mapolsek Medan Baru. “Ketujuh personel itu satu di antaranya Kepala Pos Polisi Bandara Polonia Aiptu Sahut Sihombing SH ditarik kembali ke Mapolsek,” kata Kapolsek Medan Baru Kompol Nasrun Pasaribu SIK, SH kepada Waspada, Rabu (24/7) sore. Menurutnya, personel yang betugas dibandara itu kembali ke komando karena pukul 00:00 Bandara Polonia secara resmi ditutup untuk kegiatan operasional penerbangan sipil. Ketika ditanya apakah personel kepolisian bertugas di Bandara Polonia ikut bergabung di bandara Kuala Namu, Deliserdang, Nasrun menyatakan, tidak mungkin karena lokasi bandara yang baru itu bukan wilayah Polsek Medan Baru. Sementara itu, Kepala Polisi Pos Bandara Polonia Aiptu Sahut Sihombing mengatakan, dirinya betugas di pos bandara

sekitar lima tahun dan banyak mendapat pengetahuan dan pengalaman. Kata dia, pengamanan di bandara cukup ketat dan disiplin karena lokasi itu merupakan obyek vital. “Selama bertugas di pos bandara, kita bekerjasama dengan instansi lain sudah beberapa kali mengamankan kasus narkoba,” tuturnya. Personel Polri yang betugas di Pos Pol Bandara Polonia se-

lain dari Polsek Medan Baru, juga dari Polresta Medan 4 personel Intelkam, 5 personel Pamovit; Poldasu yakni Intelkam 2 personel dan Denma 4 personel. Sedangkan 2 personel Polda Aceh. Pantauan di lapangan, para personel terus sibuk membongkar memindahkan barang mereka karena lokasi itu pukul 00:00 telap ditutup oleh pihak Bandara Polonia. (m36)

Waspada/Ismanto Ismail

KEPALA Pos Polisi Bandara Polonia Aiptu Sahut Sihombing SH menyaksikan personelnya mengangkat pintu kaca untuk diamankan karena Bandara Polonia sudah tidak melakukan operasional karena dipindahkan ke Kuala Namu, Kab. Deliserdang.

A5

Waspada/ist

REKTOR IAIN-SU Prof Nur A. Fadhil Lubis (kiri) dan Rektor Universitas Al-Qarawiyyin Maroko Prof. Dr. Mohammed Rougie menandatangani MoU disaksikan Menteri Agama Surya Darma Ali (kanan) dan Duta Besar Indonesia untuk Maroko (kiri).

IAIN Jalin Kerjasama Dengan Universitas Tertua Di Dunia MEDAN (Waspada): Institut Agama Islam Negeri Sumatera Utara (IAIN-SU) menjalin kerjasama dengan universita tertua di dunia yang terdapat di negara Maroko. Kerjasama kedua universitas itu dituangkan dalam naskah kesepahaman (MoU) yang ditandatangani pada 18 Juli 2013. Demikian disampaikan Rektor IAIN SU Prof. Nur Ahmad Fadhil Lubis di kampus IAIN, Kamis (25/7). Dia mengatakan, bulan Ramadhan membawa berkah bagi IAIN-SU. Kerjasama pengembangan studi Islam dengan Universitas Al-Qarawiyyin yang dikenal sebagai universitas tertua di dunia ini, sudah dilakukan. “UniversitasAl-Qarawiyyindidirikanpadatahun 859, lebih tua dari Universitas Al-Azhar Kairo yang didirikan pada tahun 970-972,” kata rektor. Penandatanganan MoU dilakukan di Kedutaan Besar Indonesia untuk Kerajaan Maroko disaksikan Menteri Agama RI Dr. Surya Darma Ali, MSi, Duta Besar Indonesia di Maroko Tosari Widjaya, Dirjen Pendis Kemenag Prof Nursyam, Direktur Perguruan Tinggi Islam Prof Dr. Dede Rosada, Direktur PemberdayaanWakaf Ditjen Bimas Islam Dr. H. M. Attamimy dan sejumlah pejabat Kementerian Agama lainnya. Pada kesempatan itu, IAIN-SU mendapat kepercayaan untuk ikut dalam delegasi kunjungan kerja Menteri Agama ke Maroko guna menjalin berbagai kerjasama dalam bidang pendidikan dan keagamaan. Dalam sambutannya, Menteri Agama menaruh harapan besar bagi pengembangan kualitas pendidikan di IAIN terutama dalam rangka meningkatkan status menjadi Universitas. Dua

IAIN, yakni IAIN Ar-Raniry dan IAIN Sunan Ampel baru saja disetujui, dan dalam waktu dekat IAINSU, IAIN Walisongo dan IAIN Raden Fatah. Dirjen Pendis Prof. Dr. Nursyam menambahkan, pentingnya pengembangan jejaring dalam bagi perguruan tinggi. Karena itu, diperlukan penguasaan bahasa-bahasa internasional. Di perguruan tinggi Maroko, kekuatan intelektualitas ditopang dengan penguasaan mereka terhadap bahasa internasional yang wajib dipelajari seperti Bahasa Perancis, Inggris dan Spanyol. Rektor IAIN-SU Prof. Dr. Nur A Fadhil Lubis mengatakan, penandatangan kerjasama di Maroko ini merupakan momentum yang sangat penting dalam sejarah perkembangan IAIN-SU guna mempersiapkan diri menuju universitas. Selain membuka prodi-prodi umum, penguatan studistudi Islam tetap dilakukan dan salah satu caranya adalah menjalin kerjasama dengan berbagai universitas Islam di Timur Tengah. Selain universitas Al-Qarawiyyin, Universitas Muhammad V di Rabat juga akan melakukan kerjasama dengan IAIN SU. Ketua Project Implementing Unit IDB Dr. phil. Zainul Fuad, MA menyatakan, MoU yang disepakati mencakup kerjasama pertukaran mahasiswa dan dosen, penyelenggaraan seminar dan konferensi serta penelitian dengan memanfaatkan ahli dan sumber-sumber dari kedua belah pihak. Sebagai follow up MoU ini, IAIN-SU akan mengirim 10 – 15 dosen untuk mengikuti training bahasa Arab dan penelitian ilmu-ilmu Keislaman, dengan kontribusi dari universitas dimaksud. Kegiatan ini juga diikuti IAIN-IAIN yang sedang dibantu dalam skema proyek 4 in 1 Islamic Develoment Bank. (m49)


A6

WASPADA, Jumat, 26 Juli 2013

SANTUNI ANAK YATIM: Dompet Dhuafa Waspada (DDW ) dan KMC Citibank Cabang Medan memberikan santuan uang tunai kepada anak yatim dan dhuafa di Panti Asuhan Muhammadiyah Jln. Tuba 4, Medan Denai, Kamis (25/7). Bantuan diserahkan Ermaliana Wijaya, Branch Manager Citibank Medan dan Pimpinan Cabang Dompet Dhuafa Waspada Armansyah serta Pengurus KMC Medan Syahril Siregar dan Azuardi. Sebanyak 75 anak mendapat bantuan uang tunai Rp100.000 per orang. Pengurus Panti asuhan Agus Padang mengucapkan terima kasih kepada KMC Medan dan Dompet Dhuafa atas bantuan yang diberikan. (rel)

Kajian Tafsir Alquran

Jundullah (Pasukan Tuhan) Oleh Achyar Zein Dia-lah yang telah menurunkan ketenangan ke dalam hati orang-orang beriman supaya keimanan mereka bertambah di samping keimanan mereka (yang telah ada). Dan kepunyaan-Nya tentara langit dan bumi, dan adalah Allah Maha Mengetahui lagi Maha Bijaksana. (Q.S. al-Fath ayat 4) Salah satu bentuk rasa simpati Tuhan kepada orang-orang Mukmin ialah dengan memberikan bantuan dalam setiap perang untuk menegakkan agama-Nya. Bantuan itu berupa tentara yang siap sedia membantu orang-orang Mukmin. Oleh karena itu orang-orang Mukmin selalu memperoleh kemenangan dalam perang. Adapun mengenai jumlah tentara Tuhan ini tidak ada yang mengetahuinya kecuali Tuhan sendiri, sebagaimana disebutkan dalam Q.S. al-Mudatstsir ayat 31. Rahasia tentang jumlah ini menunjukkan bahwa Tuhan siap menerjunkan tentara-Nya sesuai dengan jumlah yang dibutuhkan. Tentara Tuhan, menurut al-Razi dalam tafsirnya Mafatih al-Ghayb, terdiri dari tiga pasukan. Pertama, pasukan langit terdiri dari malaikat. Kedua, pasukan bumi terdiri dari manusia, hewan dan jin. Ketiga, pasukan bumi dan langit terdiri dari benda-benda langit dan bumi. Pasukan langit membantu orang-orang Mukmin disaat peperangan Hunayn sebagaimana disebutkan dalam Q.S. alTawbah ayat 26. Pasukan langit ini tidak dapat dilihat tetapi aksesnya jelas kelihatan. Mereka bergerak mematahkan serangan orang-orang kafir dengan menimpakan bencana kepada mereka. Adapun pasukan bumi yang terdiri dari manusia, jin dan hewan (burung) diperbantukan kepada Nabi Sulaiman ketika hendak menyerang negara Ratu Balqis. Pasukan ini digambarkan di dalam Q.S. al-Naml ayat 17 sebagai pasukan yang dapat diatur oleh Nabi Sulaiman dengan tertib (dalam barisan). Kemudian pasukan bumi dan langit membantu orangorang beriman ketika menghadapi orang-orang musyrik sebagaimana disebutkan dalam Q.S. al-Ahzab ayat 9. Pasukan langit terdiri dari para malaikat, sedangkan pasukan bumi berupa angin topan yang sangat dingin dan ditimpakan kepada orangorang musyrik. Keunggulan tentara Tuhan ini mampu memberikan motivasi dan spirit kepada orang-orang Mukmin sehingga iman mereka terus bertambah. Pertambahan iman ini membuat mereka selalu tenang dalam menghadapi musuh, dan karenanya orangorang Mukmin selalu mendapat kemenangan dalam setiap peperangan. Pesan tauhid dari adanya “tentara Tuhan” bahwa Tuhan tidak pernah tega membiarkan orang-orang Mukmin sendirian menghadapi musuh. Dalam tataran ini orang-orang Mukmin harus yakin bahwa tentara Tuhan pasti membantu, dan karenanya tidak perlu takut meskipun jumlah pasukan kecil ketika menghadapi musuh.

Waspada/Laz Peduli Umat

300 Paket Sembako Untuk Dhuafa MEDAN (Waspada): Yayasan Pendidikan Islam Terpadu Al-Fityan School Medan membagikan 300 paket sembako senilai Rp45 juta kepada kaum dhuafa dan warga kurang mampu di sekitar lingkungan sekolah itu, Rabu (24/7). Pemberian paket sembako dihadiri Camat Medan Selayang Zulfakhri Ahmadi, Lurah Asam Kumbang, kepala lingkungan, komite sekolah dan orangtua siswa. Mengusung tema Ramadhan Ceria Al-Fityan Peduli dan Berbagi, seluruh siswa disebar mendatangi sekaligus membagikan paket sembako itu ke

rumah-rumah warga yang dianggap berhak mendapatkannya. Direktur Al-Fityan H Taufik Haris Lubis, Lc, didampingi Ketua Panitia Deni Nurfarida, SP dan Humas Panitia Maya Darmayanti mengatakan, kegiatan itu merupakan program tahunan yayasan bekerjasama de-

Drs HM Nizar Syarif (Ketua Bidang Fatwa MUI Medan) Tanya: Assalamu’alaikum, Al Ustad saya orang yang suka makan enak, karenanya kolestrol saya selalu naik di atas ambang normal. Kata orang, puasa dapat menurunkan kolestrol, benarkah demikian? mohon penjelasan ustadz. Jawab: Puasa adalah ibadah menahan makan dan minum serta hubungan suami istri sejak terbit fajar sampai terbenam matahari. Dengan mengikuti aturan agama ini secara disiplin, maka usus perut yang selama ini aktif berproduksi mengolah makanan dapat beristirahat. Apalagi pada malam hari disibukkan dengan berbagai kegiatan ibadah yang mengeluarkan energi, seperti berjalan ke masjid, shalat tarawih, tadarus Alquran, shalat malam dan sebagainya. Semuanya membuat kolesterol yang berasal dari lemak makanan akan larut dan keluar melalui kotoran dan keringat. Badanpun akan terasa ringan. Maka bila puasa seperti ini dipertahankan, jadilah ia sebagai obat terhadap beberapa penyakit, termasuk obat kolesterol. Tetapi ketika berbuka makan dan minum melebihi dari hari-hari biasa, ditambah pula cemilan yang enak-enak setelah tarawih, maka kolesterolnya bukan berkurang, tetapi bertambah tinggi. Nabi Saw sendiri membiasakan makan sebelum lapar dan berhenti sebelum kekenyangan. Kata Nabi “Perut itu sarang penyakit” dan Allah Swt mengingatkan dalam surat al-A’raf ayat 31: “Makan dan minumlah, dan janganlah berlebihlebihan Sesungguhnya Allah tidak menyukai orang-orang yang berlebih-lebihan”. Oleh karena itu hendaklah diperhatikan sebagai berikut: 1. Disiplinkan diri dalam hal makan dan minum apa adanya. 2. Ikutilah aktifitas selama Ramadhan pada malam hari 3. Bekerjalah di siang hari sebagaimana biasa 4. Berhematlah dalam pengeluaran belanja dan jangan mempersulit diri Firman Allah dalam surat al-Baqarah ayat 185: “Allah menghendaki kemudahan bagimu, dan tidak menghendaki kesukaran bagimu, dan hendaklah kamu mencukupkan bilangannya dan hendaklah kamu mengagungkan Allah atas petunjukNya yang diberikan kepadamu, supaya kamu bersyukur”.

Masjid Bermenara Unik MASJID Al Falaah terletak di Jln. Ibrahim Umar, Kel. Sei Kera Hilir, Kec. Medan Perjuangan. Nama masjid Al Falaah

diambil dari bahasa arab Al Falaah, yang artinya kemenangan. Masjid dibangun pada 1970 oleh masyarakat sekitar. Pencetus

Waspada/Rizky Rayanda

MASJID Al Falaah sudah ada dari tahun 1958, masjid ini juga memiliki menara unik yakni lafazh Allah yang dapat berputarputar di ujung menara.

bantuan tersebut diharapkan siswa bisa melihat langsung bagaimana keadaan orang di sekelilingnya. Sehingga dimasa-masa datang akan tergugah hatinya untuk selalu berbagi dengan orang-orang di sekitarnya. Menurut Taufik, selain Ramadhan Peduli dan Berbagi, AlFityan setiap harinya selama bulan Ramadhan menggelar kegiatan buka puasa bersama dengan siswa dan warga kurang mampu. Sebanyak 6 ribu porsi makanan akan dibagi selama bulan Ramadhan. (cwan)

Membangun Semangat Kebersamaan MEDAN (Waspada): Keluarga Besar Tapak Suci Putra Muhammadiyah Sumut menggelar acara buka puasa bersama di Gedung Ikatan Keluarga Bayur

(IKB), Jln. Utama, Kel. Komat II, Medan Area, Selasa (23/7). Acara dihadiri ratusan kader, pelatih dan pendekar Tapak Suci Putra Muhammadiyah,

Ru b r i k Ta n y a Ja w a b M U I K Koo t a M e d a n

Puasa Obat Menurunkan Kolesterol

ngan komite sekolah. “Dana bantuan ini murni dari siswa yang diambil dari infak mereka yang dikumpulkan setiap Jumat, yaitu program sekolah yang disebut dengan Rumah Infak Sekolah, dan setiap bulan Ramadhan infak yang terkumpul itu diserahkan kepada orang yang membutuhkan dalam bentuk paket sembako,” kata Taufik Haris. Tujuannya agar siswa lebih menjiwai rasa peduli dan berbagi, karena dengan mendatangi dan menyerahkan sendiri

Waspada/Ayu

Dari kanan Rafdinal, Farianda Putra Sinik, H Ahmad Arif dan Zulham pada acara berbuka puasa bersama Tapak Suci Putra Muhammadiyah Sumut di Gedung IKB, Selasa (23/7).

Ketua Umum Pimpinan Wilayah Tapak Suci Putra Muhammadiyah Sumut H Ahmad Arif, Wakil Ketua Farianda Putra Sinik, Wakil Ketua Besri Nazir, Wakil Ketua PAN Medan Zulham serta pengurus dan anggota PAN se- Medan Area. Ahmad Arif mengatakan, momentum berbuka puasa bersama harus dijadikan sarana mempererat tali silaturahmi dan kebersamaan, sekaligus memperkenalkan dirinya untuk kembali maju pada Pemilu Legislatif 2014 dari PAN daerah pemilihan (Dapil) Medan 1. Selain dirinya, kata Arif, Farianda Putra Sinik juga ikut Caleg DPRD Sumut dari Partai Demokrat. “Kalau untuk DPD RI kita usung Rafdinal. Semakin banyak kader Tapak Suci di lembaga legislatif akan semakin baik dan mudah perjalanan Tapak

Suci ke depannya,” kata Ketua Fraksi PAN DPRD Kota Medan itu. Arif juga menyampaikan ucapan selamat atas keberhasilan para atlit Tapak Suci Putra Muhammadiyah sebagai juara I di Malang dengan memperoleh tiga medali emas dan seorang di antaranya menjadi pemain terbaik. “Prestasi ini harus dipertahankan, kalau bisa ditingkatkan,” harapnya. Rafdinal dalam tausyiah singkatnya mengatakan semangat kebersamaan di bulan Ramadhan harus dibangun dengan kekuatan kebersamaan, bukan kekuatan pribadi. “Untuk membangun kebersamaan kita harus saling dukung dan menghindari perpecahan. Ramadhan harus dibangun dengan silaturahmi yang baik,” ujarnya. (m30)

DPP IPK Beri Paket Lebaran Kepada Anak Panti MEDAN (Waspada): Bantuan diberikan keluarga besar Dewan Pimpinan Pusat Ikatan Pemuda Karya (DPP IPK) memiliki arti dan sangat membantu anak-anak panti, kata pimpinan Panti Asuhan Yatim Piatu Aceh Sepakat Yayasan Darul Aitam H Ishak Madjid ketika menerima paket lebaran berupa sembako, peralatan sekolah, kain sarung, sirup serta sejumlah uang tunai di balai pertemuan panti tersebut, di Jln. Medan Area Selatan, Kamis (25/7) pagi.

Kata Ishak, bantun IPK menjelang lebaran dan tahun ajaran baru sangat berarti bagi anak panti. “Dengan bantuan itu anakanakmemilikibekalmenghadapi Idul Fithri. Kami berterimakasih kepada keluarga besar IPK, semoga organisasi ini semakin besar dan dapat member kontribusi nyata di Sumut,” kata Ishak. Irwansyah, SH di dampingi pengurus IPK lainnya, Dr. Teren, H Syafaruddin Pasaribu, Mustarum, SH, Armen Nainggolan, Ismail Harahap, Franky Lom-

bogia, Affandi, Sulafmi, Zainal Abidin, Charles Sihombing, Moan Siagian, Thoyib Marbun, Tiara Ginting, ketika menyerahkan bantuan mengatakan pemberian bantuan merupakan program DPP IPK terhadap 14 panti asuhan di Kota Medan dalam rangka safari Ramadhan, sejak 18 Juli 2013. “Diharapkan bantuan ini dapat dimanfaatkan oleh anakanak panti asuhan. Ini merupakan agenda rutin yang telah dilakukan oleh ketua besar IPK alm.

Olo Panggabean, baik menjelang idul fitri, hari natal atau hari besar keagamaan lainnya,” katanya. Selanjutnya rombongan DPP IPK berjumlah ratusan orang menuju Pasar IX Tembung Kec. Percut Seituan untuk menyerahkan bantuan ke panti asuhan Aisyiah. Menurut Wasekjen DPP IPK Mustarum, safari Ramadhan DPP IPK selama tujuh hari berjalan sukses dan mendapat sambutan hangat oleh setiap panti yang dikunjungi.(m24)

LAZ Al-Hijrah Beri Paket Belanja Kepada Yatim Dan Dhuafa MEDAN (Waspada): Lembaga Amil Zakat Al-Hijrah Sumut memberikan paket belanja ceria di Gelora Plaza Medan kepada 40 anak yatim dan dhuafa, Rabu (24/7). Ketua Panitia Ramadhan LAZ Al-Hijrah Sumut T Sofyan Hamid di dampingi Caleg PKS Dapil I Medan Juliandi Siregar mengatakan, paket belanja ceria merupakan kegiatan rutin setiap Ramadhan untuk menyenangkan anak-anak yatim dan dhuafa. Kata Hamid, setiap anak yatim dan dhuafa bebas membeli berbagai jenis makanan dan minuman halal, termasuk keperluan lainnya. “Setiap orang akan menghabiskan Rp100 ribu,” katanya. Selain belanja ceria untuk anak yatim dan fakir miskin, mereka juga melaksanakan buka bersama, menyantuni anak yatim, mengirim 20 da’i serta sejumlah Alquran dan Iqro ke Kab. Tanah Karo. Juliandi Siregar menyebutkan, belanja ceria merupakan bentuk kepedulian dan membangun kebersamaan. “Semua orang tahu saat ini anak yatim dan fakir miskin memerlukan uluran tangan donator. Dengan belanja ceria ini diharapkan kesulitan dirasakan para yatim dan dhuafa terbantu. Kita juga berharap ada gerakan lembaga lain yang mengikuti jejak LAZ Al-Hijrah,” kata dia.(m26) ide pembangunan pertama kali H Bahaudin Lubis, Sekda Kota Medan pada masa itu. Wakil Bendahara BKM Masjid Al Falaah, Iswansyah biasa dipanggil Ameng menceritakan sejarah masjid itu, dahulunya berupa mushallah berukuran 5x5 meter persegi yang dibangun tahun 1958 secara gotong royong oleh penduduk. Bangunannya masih berupa kayu, menggunakan atap daun nipah. Kawasan ini juga masih berupa perkebunan pohon jati milik PTPN, dan di sekitar masjid terdapat banyak sado (kereta lembu) milik warga yang mangkal. Karena itu pula jalan ini disebut Gang Sado, sebelum diganti menjadi Jalan Ibrahim Umar. Mushallah ini dulunya juga hanya bisa menampung sekitar puluhan jamaah saja. Namun setelah 1960, masjid ini dibangun kembali secara swadaya sehingga berbentuk permanen, karena seiring bertambahnya jamaah. Uniknya masyarakat menyumbang bu-

kan dengan uang, melainkan berupa material seperti dua batu bata, satu ember pasir dan seterusnya hingga bangunan ini berbentuk semi permanen. “Jadi orang tua dulu yang membangun mushallah ini dengan mengantarkan batu bata, pasir serta kayu menggunakan kereta sado,” ujarnya kepada Waspada. Pada masa revolusi 1965, masjid ini juga menjadi saksi bisu pembantaian para PKI oleh sekelompok pemuda mengatasnamakan diri sebagai Pemuda Pancasila (PP) dipimpin Rustam Effendi SZ. Para pemuda membantai antek-antek PKI di wilayah itu dan membuang jasadnya di belakang masjid. “Di sini dulu basis Pemuda Pancasila yang menumpas PKI, mayatnya pun dibuang di belakang masjid, tepatnya di parit besar yang ada di belakang masjid pada masa revolusi,” katanya. Setelah revolusi Rustam Effendi SZ diangkat para pemuda setempat menjadi kepala desa, dan akhirnya menjadi lurah pertama Sei Kera Hilir. Pada 1970 barulah masjid

Waspada/Erwan Efendi

Celeg PKS Dapil I Medan Juliandi memberi kata sambutan di hadapan anak yatim dan dhuafa di halaman Gelora Plaza, Medan, Rabu (24/7). ini dibangun permanen, bangunan ini pun menjadi bangunan indah dan megah di wilayah tersebut. Arsiteknya Ir Hasan yang tinggal tak jauh dari masjid. “Masjid ini yang bangun Ir Hasan, beliau juga yang membangun Jalan Fly Over Pulo Brayan,” tambahnya. Menara unik Masjid ini memiliki menara unik, dan cuma ada satu-satunya di Indonesia, yaitu di puncak menara terdapat sebuah tulisan berlafazh Allah yang akan berputar terus menerus, dan jika malam dihiasi dengan lampu. “Paling unik dari masjid ini menaranya, sampai-sampai masjid ini di datangi salah satu insinyur dari Institut Teknologi Bandung (ITB) karena tertarik dengan teknologinya,” katanya. Setelah dibangun masjid ini dapat menampung sekitar 1.000 lebih jamaah. Kegiatan saat bulan suci Ramadhan juga terbilang banyak, di masjid ini selalu diadakan kultum sebelum shalat tarawih, ceramah ba’da zuhur lima kali

dalam seminggu, dan kuliah subuh pada hari Minggu. Saat menjelang berbuka, banyak masyarakat maupun musafir datang ke masjid untuk berbuka bersama.Warga sekitar silih berganti mengantarkan makanan dan minuman untuk berbuka. Masjid ini juga dahulu punya makanan khas saat di bulan puasa, yakni bubur sop daging yang terkenal lezat dan gurih, namun setelah yang membuat bubur wafat, bubur sop tidak pernah lagi di hidangkan di masjid ini. Ameng mengatakan, sudah banyak pejabat Negara yang datang ke masjid ini, seperti Menteri Mensos Hj Tuti Alawiyah dan ustadz kondang Zainnuddin MZ pernah ceramah di masjid ini. Uniknya lagi setiap tahunnya selalu ada saja para qoriqori Internasional yang datang ke masjid untuk sekedar bersilaturrahmi, seperti dari Negara Timur Tengah, yakni Arab Saudi, Irak, Iran, Mesir dan Asia seperti Malaysia, Thailand dan Brunei Darussalam. *Afli Yarman

Fiqih Ramadhan Perkotaan

Self Service DR. HM. Jamil, MA (Dosen Fak. Syari’ah dan Pascasarjana IAIN-SU/ Ketua Umum MUI Binjai) Self service yang di maksud dalam tulisan ini adalah melayani diri sendiri, baik ketika berbelanja di supermarket atau makan di rumah makan. Kita akan fokuskan kepada self service dalam masalah makan. Bagaimana tinjauan hukum Islam (fikih) terhadap masalah ini. Ada tiga hal penting yang harus diperhatikan. Pertama, hal-hal yang berhubungan dengan makanan. Kedua, etika makan dan ketiga, cara memperoleh makanan tersebut. Semua itu dimaksudkan dalam konteks melihat hukum self service. Tinjauan pertama, dalam Islam makanan harus halal, kemudian mesti baik, tidak berbahaya bagi kesehatan dan juga bersih. Kedua, banyak etika makan yang dijelaskaan di dalam kitab-kitab hadits dan kitab-kitab fikih, di ataranya, makan dengan tangan kanan, makan tidak dalam keadaan berhadats besar dan ketiga, jangan terlalu kenyang. Meskipun terjadi perbedaan pendapat, banyak keterangan hadits menjelaskan boleh makan dan minum berdiri, misalnya, Aisyah dan Said bin Abi Waqqash juga membolehkan minum sambil berdiri. Diriwayatkan dari Ibnu Umar dan Ibnu Zubaer, bahwa beliau berdua minum sambil berdiri. (lihat kitab alMuwaththa’), dari Ibnu Umar, mengatakan, “Di masa Nabi Saw kami minum sambil berdiri dan makan sambil berjalan.” (HR. Ahmad dan Ibnu Majah). Meskipun demikian, banyak hadits yang menunjukkan bahwa duduk ketika makan dan minum lebih baik. Demikian juga boleh makan sambil berkatakata dan etika lainnya. Self service secara hukum asalnya boleh (jaiz). Tetapi hukumnya bisa menjadi makruh atau bahkan haram jika salah satu dari hal di atas dilanggar. Sebagai contoh sewaktu mengambil makanan dalam self service ada gharar (penipuan) dalam jumlahnya. Karena itu perlu dilihat sesungguhnya mana yang lebih baik dalam konteks self servis antara bayar dulu baru makan atau makan dulu baru bayar. Menurut penulis, bayar dulu baru makan lebih baik, sebab sipenjual bisa dengan jelas melihat apa saja yang akan kita makan, kemudian menetapkan harganya. Kemudian makanan itu jelas sudah milik kita setelah diadakan pembayaran, sebab disana sudah terpenuhi rukun jual beli dan kemungkinan kita lupa membayar setelah makan dapat terhindari, serta sudah tahu sejak awal harganya, jika terasa mahal bisa langsung komplain. Wallahu’alam

Ta n ya Ja w a b K Koo n s u l t a s i Z a k a t

Diasuh oleh :

Ustadz H Muhammad Nuh (Dewan Syari’ah LAZ Peduli Ummat Waspada) LAYANAN JEMPUT ZAKAT (Khusus Kota Medan):0812 6200 6967 Pembayaran ZIS Via Bank Zakat, Infak/Sedekah An. Dompet Dhuafa An. Dompet Dhuafa BNI Syari’ah 300.300.3144 BNI Syari’ah 300.300.3155 An. Peduli Ummat Waspada An. Peduli Ummat Waspada Bank Mandiri 106.0002203803 BSM 006.000832.1 Bank Sumut Syariah 611.01.04.000024.0 BMI 211.00002.15 BSM 006.002240.7 BMI 211.00044.15 BRI 069301000055309

Zakat Tabungan Fluktuatif Tanya: Assalamu’alaikum Wr.Wb. Ustadz, Saya punya tabungan di bank syari’ah, tapi dananya sering keluar dan masuk. Kalau ada keperluan mendesak saya tarik, tapi setiap bulannya saya tambah. Apakah tabungan saya yang seperti itu terkena kewajiban zakat? Bagaimana cara menghitungnya? Terima kasih atas jawaban Ustadz. (Mardhiyah, Medan) Jawab: Wa’alaikumussalam Wr.Wb. Uang adalah sarana jual beli pengganti, setelah dulunya dengan cara langsung atau disebut barter. Kemudian manusia menggunakan emas sebagai pengganti antara. Jadi fungsi emas bukan hanya sebagai logam mulia dan perhiasan, tetapi juga sebagai penjamin uang. Allah SWT berfirman: ”Dan orang-orang yang menyimpan emas dan perak tidak menafkahkannya di jalan Allah, maka beritahukan kepada mereka, (bahwa mereka akan mendapatkan) siksa yang pedih pada hari dipanaskannya emas dan perak itu di neraka jahannam, lalu dibakar dahi, lambung dan punggung mereka (lalu dikatakan) kepada mereka: Inilah harta bendamu yang kamu simpan untuk dirimu sendiri, maka rasakanlah sekarang (akibat dari) apa yang kamu simpan” (At-Taubah/9:34-35). Kata: ”tidak menafkahkannya” menunjukkan bahwa emas berfungsi untuk alat jual beli yang kini diwakilkan kepada uang. Maka Ulama’ sepakat ketentuan tentang uang, termasuk jika ditabung disamakan dengan ketentuan emas. Adapun nishab (batas minimal wajib zakat) emas sebagaimana sabda Rasulullah Saw: ”Tidak ada kewajiban zakat emas yang kurang dari 20 mitsqal dan perak kurang dari 200 dirham”. (HR. Daraquthni). 20 mitsqal = 85 gram emas (Fiqh Zakat, DR Yusuf Qardhawi). Kalau saudari Mardhiyah menabung 15 Ramadhan 1433 H sebesar Rp10.000.000, dan setiap bulan ditambah Rp5-10 juta. Kadang-kadang mendesak ditarik Rp3-Rp4 juta, maka pada 14 Ramadhan 1434 H tabungan sudah mencapai haul (setahun) dengan jumlah Rp60.750.000. Harga emas umpamanya Rp500.000/gram x 85 = Rp42.500.000, maka saudari Mardhiyah sudah wajib mengeluarkan zakat 2,5 % dari Rp60.750.000. Wallahu a’lam.

Kader Buka Puasa Bersama MPO PP MEDAN (Waspada): Majelis Pertimbangan Organisasi (MPO) Pemuda Pancasila (PP) Kota Medan diketuai Kodrat Shah menggelar buka puasa bersama dengan ratusan kader dan anggota di Hotel Garuda Plaza Medan, Minggu (21/7). Acara diawali pembacaan ayat suci Alquran oleh qori tingkat internasional H Darwin Hasibuan, dihadiri Ketua MPW PP Sumut Anuar Shah, Sekretaris MPW H Firdaus Nasution, Plt Walikota Medan H Dzulmi Eldin, Ketua MPC PP Kota Medan Boyke Turangan, Ketua DPD KNPI Kota Medan El Adrian Shah, para ketua PAC dan Ranting PP se-Kota Medan. Ustadz Dr H Azhar Sitompul mengatakan, secara struk-

tur organisasi selain MPC PP Kota Medan, MPO PP Kota Medan juga merupakan bagian tidak terpisahkan dari struktur MPC PP Kota Medan. Karena itu setiap kader dan anggota dihimbau patuh kepada pimpinan sesuai yang diajarkan Rasulullah. Acara berbuka puasa, menurut Azhar Sitompul sebagai sarana meningkatkan tali silaturahmi dan mempererat kebersamaan sesama kader dan anggota PP, dan berharap meningkatkan keimanan dan ketakwaan kepada Allah Swt. Sekretaris MPW PP Sumut H Firdaus Nasution menyebutkan, kader dan anggota PP harus mengantarkan Ketua MPO PP Kota Medan Kodrat Shah duduk di legislatif. (m39)


Ekonomi & Bisnis

WASPADA Jumat 26 Juli 2013

A7

Tidak Perlu Panik Rupiah Melemah JAKARTA (Waspada): Menteri Keuangan Chatib Basri, mengatakan tidak perlu ada kepanikan dengan melemahnya mata uang rupiah. Walaupun saat ini rupiah semakin melemah, bahkan mencapai Rp10.200 per dolar AS, pada Kamis (25/7). Berbicara saat ditemui di Gedung Bank Indonesia, Chatib Basri, mengatakan jika dibandingkan dengan negara lain di Asia, pertumbuhan ekonomi Indonesia masih berada di posisi kedua setelah China dengan pertumbuhan ekonomi 7,7 persen. Sementara India hanya tumbuh sebesar 4,8 persen. Dari segi depresiasi, kata-

nya Indonesia sekitar 3,4 persen. Itu tidak lebih buruk dari rupee dan yen dan indeks saham ytd mencapai 9,8 persen lebih tinggi dari Singapura dan Thailand. Chatib, mengatakan kondisi Indonesia masih cukup baik karena yield sudah mulai mengalami penurunan dari 8,3 persen ke 7,8 persen, bahkan sempat menyentuh angkan 7,4 persen. Itu artinya, lanjut Chatib, asing sudah mulai masuk ke Indonesia. “Saya lihat sejak eksportir mulai suplai dolar dan valuta menjual doalarnya, ini relatif stabil dari sisi fiskal,” lanjutnya. Bukan karena BBM Sementara itu, pelemahan nilai tukar rupiah diklaim bukan lantaran kebijakan pemerintah untuk menaikan harga

Bahan Bakar Minyak (BBM) bersubsidi. Pelamahan rupiah dipercaya lantaran adanya gejolak pada ekonomi global. “Kita justru sambut baik bahwa APBN-Perubahan bisa disetujui, kemudian diputuskan harga BBM dinaikkan dan akibatnya, yang tadinya ada dua defisit, yakni defisit anggaran dan defisit transaksi berjalan, paling tidak defisit anggaran sudah tidak lagi,” kata Gubernur Bank Indonesia (BI) Agus DW Martowardojo, di kantor presiden, Jalan Medan Merdeka, Jakarta, Kamis (25/7). Menurutnya, saat ini yang harus diperhatikan yakni defisit transaksi berjalan. Meski demikian, pemerintah juga harus waspada terhadap gejolak yang terjadi pada perkembangan ekonomi dunia. “Jadi, kalau seandainya nilai tukar itu berada di atas

Harga Daging Di Medan Masih Stabil MEDAN (Waspada): Meski daging impor sudah memenuhi pasar di pulau Jawa, Sumatera Utara belum mendapat pasokan daging impor dari pemerintah pusat. Walau begitu, harga daging di sejumlah pasar tradisional kota Medan relatif stabil. Seorang pedagang daging sapi di Pusat Pasar Medan, Wahidin mengatakan, meskipun tidak ada daging impor masuk hingga saat ini, tidak membuat harga daging di pasar tradisional Medan mengalami kenaikan. Bahkan di pertengahan Ramadhan ini, harga tetap stabil berkisar Rp80.000 hingga Rp85.000 per kilogram. “Percuma saja daging impor masuk ke Medan, harga murah tetapi tidak dapat langsung dijual dengan harga murah. Daging impor itu kan beku, kalau dijual dan berada

di pasar pasti akan menyusut, otomatis timbangan berkurang dan pasti harganya harus tinggi agar pedagang tidak mengalami kerugian,” ujarnya, kemarin. Menurutnya, di Medan daging impor belum terlalu diterima oleh masyarakat. Pasalnya, masyarakat Medan lebih mengutamakan kualitas daging dibandingkan harga murah. Apalagi, katanya, jaminan kehalalan daging impor tersebut masih diragukan. “Daging impor paling bisa bertahan beberapa hari saja dan itu kurang segar. Kalau daging lokalkan lebih segar dan berkualitas, dan rata-rata pedagang mengambil daging dari rumah potong hewan dan PT serta dijamin kehalalannya,” tuturnya. Sementara untuk stok jelang Lebaran, tambahnya, ma-

sih terbilang aman. Sedangkan untuk harga daging, diprediksi akan naik seminggu sebelum Lebaran dengan kisaran harga mencapai Rp90.000 sampai Rp100.000 perkilogramnya. “Wajarlah harga naik sampai segitu karena setahun sekali. Pasti spekulan sudah bermain harga di lapangan. Pedagang beli mahal dan otomatis jualnya harus mahal,” tandasnya. Ditambahkannya, meski harga daging stabil tetapi minat konsumen dalam membeli daging menyusut hingga 50 persen dari awal hingga pertengahan Ramadhan ini. Ia berharap, pemerintah dapat menurunkan harga daging agar dapat terjangkau oleh daya beli masyarakat, karena pembelian dari pihak distribusi berkisaran Rp78 ribu perkilogram. (m41)

Bulog Sumut Tidak Dapat Daging Impor MEDAN (Waspada): Perum Badan Urusan Logistik (Bulog) Sumut mengaku tidak mendapat pembagian daging impor dari Bulog pusat. Komoditas itu hanya diperuntukkan bagi pasar-pasar di DKI Jakarta dan sekitarnya. Humas Perum Bulog Sumut Rudi, mengatakan itu, Kamis (25/7), menjawab pertanyaan Waspada. Disebutkannya bahwa karena tidak menerima daging impor, maka Bulog tidak memasarkan daging tersebut ke pasaran. Hal itu sesuai dengan kebijaksanaan pemerintah dalam rangka menstabilkan harga daging. Sesuai penjelasan Dirut Perum Bulog Sutarto Alimoeso, Bulog hingga saat ini telah mendatangkan 100 ton daging dari Australia melalui Bandar Sukarno Hatta dan 100 ton lagi melalui kapal laut di Tanjung Priok. Selanjutnya akan datang lagi 400 ton dari 1.000 ton yang direncanakan. Pemerintah telah memberikan izin kepada Bulog untuk mendatangkan daging beku dari Australia dengan kuota hingga akhir tahun 2013 sebanyak 3.000 ton.

Humas Pelabuhan Indonesia I Cabang Belawan Azmi Jauhari, juga mengatakan bahwa impor dagang Bulog tidak masuk ke daerah ini. Sampai saat ini kapal pengangkut daging impor milik Bulog, baik dari luar negeri maupun antar pulau belum ada masuk ke Pelabuhan Belawan. Beberapa kapal, diakui Azmi, sudah masuk ke Pelabuhan Belawan. Namun mengangkut sapi bakalan, langsung dari Australia. Katanya, untuk memenuhi kebutuhan daging selama puasa Ramadhan Idul Fitri, sebanyak 5.578 ekor sapi bakalan telah masuk ke Sumut melalui Pelabuhan Belawan, langsung dari Australia. Sapisapi itu masuk dengan dua kapal. Satu diantaranya MV Ocean Drover ,yang merupakan kapal terakhir pengangkut sapi yang masuk ke Pelabuhan Belawan, Rabu (26/6). Masih Stabil Sementara itu, meski Sumut tidak mendapat pasokan daging impor dari Bulog, namun begitu harga daging di sejumlah pasar tradisional

kota Medan relatif stabil. Di pertengahan bulan Ramadhan ini, harga daging sapi Rp80.000 – Rp85.000 per kg. “Percuma saja daging impor masuk ke Medan, harga murah tetapi tidak dapat langsung dijual dengan harga murah. Daging impor itu kan beku, kalau dijual dan berada di pasar pasti akan menyusut, otomatis timbangan berkurang dan pasti harganya harus tinggi agar pedagang tidak mengalami kerugian,” ujar seorang pedagang di Pusat Pasar Medan Wahidin. Menurutnya, di Medan daging impor belum terlalu diterima. Masyarakat Medan lebih mengutamakan kualitas dibandingkan harga yang murah. Apalagi, jaminan kehalalan daging impor tersebut masih diragukan. Untuk stok menjelang lebaran, disebutkan Wahidin, masih terbilang aman. Begitupun, harga diperkirakan akan naik pada seminggu sebelum lebaran, dengan kisaran Rp90. 000 - Rp100.000 per kga. “Wajarlah harga naik, karena setahun sekali,’’ katanya. (m35/m41)

Buruh Pabrik Rokok Terima Tunjangan Kemahalan KUDUS (Waspada): Ribuan buruh pabrik rokok di Kab. Kudus, Jawa Tengah, pekan ini mulai menerima tunjangan kemahalan. Yakni sehubungan pemerintah sejak 22 Juni 2013 menaikkan harga bahan bakar minyak (BBM) bersubsidi. Menurut salah seorang buruh rokok PT Djarum Kudus, Siti Kalimah, di Kudus, Kamis (25/7), tunjangan kemahalan yang diterima setiap hari Rp1.500 sejak Senin (22/7). Tunjangan tersebut, katanya, bermanfaat untuk menutupi ongkos angkutan berangkat dan pulang kerja. Sedangkan honor yang diperoleh sebagai buruh borong di gudang produksi Pabrik Rokok Djarum di Desa Karangbener, Kec.Bae, kata ibu dua anak itu, bervariasi. Disesuaikan dengan jumlah borongan dalam memproduksi rokok setiap hari. Selama ini, kata dia, honor yang diterima sekitar Rp15.900 per hari. Dengan adanya tunjangan kemahalan, kata dia, setiap hari menerima honor Rp17.400. “Terkadang, honor-

nya bisa jauh lebih tinggi. Karena disesuaikan dengan jumlah rokok yang diproduksi,” ujarnya. Buruh rokok lainnya, Suyatmi, menyambut gembira adanya tunjangan kemahalan yang diterima dari perusahaan rokok Djarum, meskipun hanya Rp1.500 per hari. Senior Business Development PT Djarum Kudus, FX Supandji, membenarkan mulai pekan ini para buruh memang menerima tunjangan kemahalan sebesar Rp2.000 untuk buruh harian serta buruh borong dan batil Rp1.500 per orang. “Tujangan kemahalan tersebut sudah direncanakan,sejak ada kenaikan harga BBM,” ujarnya. Rencananya, kata dia, tunjangan kemahalan tersebut dijadwalkan hingga Desember 2013. Wakil Sekretaris SPSI Kudus, Ahmad Fikri, mengungkapkan hingga kini perusahaan rokok yang dipastikan memberikan tunjangan kemahalan baru PT Djarum. Sedangkan perusahaan rokok lainnya belum diketahui.

Selain itu, lanjut dia, kebijakan serupa juga diberlakukan pada perusahaan percetakan Adi Karya, yang merupakan anak perusahaan PT Djarum Kudus. “Beberapa waktu lalu, kami sudah mengedarkan surat imbauan kepada pengurus unit kerja (PUK) di masing-masing perusahaan rokok untuk melakukan negosiasi kemungkinan adanya tunjangan kemahalan, menyusul kenaikan harga BBM,” ujarnya. Seharusnya, kata dia, proses negosiasi tunjangan kemahalan tersebut dilakukan secara tripartit yang melibatkan perwakilan pekerja, pengusaha dan pemerintah. Berdasarkan data dari PT Djarum Kudus, jumlah buruh rokoknya mencapai 56.100 pekerja yang tersebar di 33 brak atau tempat produksi yang tersebar di Kabupaten Kudus, Jepara, Pati dan Rembang. Dari jumlah tersebut, buruh hariannya mencapai 9.000-an orang, selebihnya buruh borong dan batil (merapikan rokok). (ant)

Rp10.000 per USD, kami mohon masyarakat untuk tenang, karena BI akan selalu menjaga stabilitas daripada nilai tukar,” tuturnya. Dia mengungkapkan, pada Juli ini memang terjadi banyak tekanan, pasalnya banyak masih ada utang swasta yang harus dibayarkan. Oleh karena itu, kebutuhan akan valas sudah tinggi. “Natni kalau Juli sudah terlewati, ke depan kita berharap kondisi menjadi lebih baik lagi,” tambah Agus Marto. Agus Marto melanjutkan, saat ini rupiah telah mencapai keseimbangan (ekuilibrium) baru. Meski demikian, dia enggan mengungkapkan berapa kisaran yang nyaman bagi rupiah. “Kita melihat ini sudah konvegen menuju suatu ekuilibrium yang baru,” katanya. (okz)

Waspada/Gito Rolies

HARGA NORMAL: Di pertengahan bulan Ramadhan, harga kebutuhan pokok di Pasar Induk Lambaro normal, Kamis (25/ 7). Hari itu Ketua DPRD Aceh Hasbi Abdullah beserta anggota Komisi B, melakukan pemantauan pasar. Turut juga Kepala Dinas Perindustrian dan Perdagangan (Disperindag) Safwan.Komoditas kebutuhan pokok, seperti gula pasir Rp13.000 per kg. Begitu juga bawang merah, tomat, dan bawang putih. Sementara harga daging sapi di Pasar Induk Lambaro justru lebih murah dibandingkan dengan pasar di Banda Aceh. Yakni Rp100.000 per kg.

Busana Muslim Indonesia Tembus Luar Negeri JAKARTA (Waspada): Dunia garmen Indonesia, khususnya busana muslim kembali mendapat perhatian di tingkat internasional. Tiga karya disainer Dian Pelangi, Jenahara, dan Nur Zahra, terpilih untuk menembus luar negeri. “Tiga label ini dipilih untuk go international karena memiliki karakteristik yang sangat kuat,” kata Direktur Kreatif Jakarta Fashion Week, Diaz Parzada, di Jakarta, Kamis (25/7). Terpilihnya hasil karya tiga disainer tersebut direkomendasikan melalui program Indonesia Fashion Forward (IFF) yang diselenggarakan oleh Jakarta Fashion Week (JFW). Meski busana muslim namun koleksi ketiga label busana ini dikatakan nyaman dan dapat dikenakan oleh siapa saja meskipun mereka tidak mengenakan jilbab atau hijab. Hal itu menjadi keunggulan dari tiga label tersebut dibandingkan dengan label busana muslim lainnya. “Dengan strategi ini tentu saja karya-karya mereka dapat diserap oleh konsumen di berbagai negara dan siap bersaing dengan busana kategori lainnya,” jelas Diaz. Menurut para ahli dari Centre for Fashion Enterprise asal London yang menjadi pembimbing mereka dalam program IFF, karya milik Dian Pelangi dengan kombinasi warnawarni cerah sangat tepat dengan selera konsumen di Eropa dan Timur Tengah. Selanjutnya karya-karya Jenahara, dinilai pas untuk pasar Eropa Barat dan Amerika dengan gaya rancang yang minimalis dan cenderung berpalet warna-warna monokromatik. “Kalau Nur Zahra dengan material bahan organik dengan rona alami paling cocok dengan konsumen di Eropa Selatan dan Jepang,” imbuh Diaz. (ant)

Laba BNI Rp 4,28 T JAKARTA (Waspada): PT Bank Negara Indonesia (BNI) (Persero) Tbk mencatat pertumbuhan laba pada paruh pertama tahun 2013 sebesar Rp 4,28 triliun atau 30,2 persen lebih tinggi dibanding periode sama tahun lalu. “Pencapaian itu berhasil diperoleh meskipun terdapat tantangan ekonomi pasca kenaikan harga bahan bakar minyak (BBM), tekanan inflasi, masalah defisit neraca perdagangan masih berkelanjutan, hingga arus modal keluar yang menekan nilai tukar rupiah,” kata Direktur Utama BNI Gatot M Suwondo di Jakarta, Kamis (25/7). Menurutnya, penyumbang utama peningkatan laba BNI adalah pendapatan bunga bersih (net interest income) bertumbuh 23,1 persen menjadi Rp 8,8 triliun, menyusul kemudian pendapatan non-bunga (non interest income) yang tumbuh 22,0 persen menjadi Rp 4,56 triliun. Kedua sumber pendapatan itu menciptakan pendapatan operasi BNI menjadi sebesar Rp 13,45 triliun atau melonjak 22,7 persen lebih tinggi dibanding Semester I- 2012. Loan to Deposit Ratio (LDR) meningkat dari 74,0 persen pada Semester-1 2012 menjadi 84,0 persen pada Semester-1 2013. Peningkatan kredit ini didominasi oleh kredit dalam mata uang rupiah. Dukungan BNI pada perekonomian nasional melalui aliran kreditnya mulai menampakkan hasil, antara lain adanya debitur BNI yang telah naik kelas dari nasabah medium menjadi nasabah korporasi. “Ada 116 nasabah medium BNI yang dinaikkan kelas ke nasabah penerima kredit korporasi dengan nilai total sebesar Rp 10,3 triliun,” jelas Gatot. Ekspansi kredit BNI tersebut ditopang oleh pertumbuhan Dana Pihak Ketiga (DPK) mencapai 8,7 persen dari Rp 242,72 triliun menjadi Rp 263,82 triliun pada Semester-1 2013. BNI terus fokus pada upaya-upaya menghimpun dana murah. (j03)

Kopi Gayo Tidak Lagi Merek Belanda JAKARTA (Waspada): Pelaku usaha Indonesia tidak perlu khawatir dengan sulitnya kopi Gayo dari Aceh masuk ke pasar Eropa, akibat pendaftaran merek Gayo Mountain Coffe, oleh perusahaan Belanda. Karena kopi Gayo tidak lagi diklaim sebagai merek dagang perusahaan Belanda. Dutabesar Indonesia di Brussel Arif Havas Oegroseno, mengatakan itu Kamis (25/7). Dia menanggapi surat kepada Direktur Office for Harmanization in the Internal Market (OHIM) Uni Eropa, yang memberikan klarifikasi tentang pendaftaran merk suatu produk Indikasi Geografis (GI) Indonesia. Yakni kopi Gayo tidak lagi sebagai merek dagang perusahaan Belanda. OHIM menangani trademark di Uni Eropa menyampaikan surat tanggapan serupa yang disampaikan Komisioner Uni Eropa untuk Agriculture and Rural Development, yang bertanggungjawab melindungi produk GI. Pihak OHIM menyatakan, Indonesia melalui KBRI Brussel, dapat mengajukan keberatan atas suatu permohonan merk dagang

di Uni Eropa dengan menyampaikan keberatan kepada OHIM yang dapat memberhentikan merk dagang yang diusulkan. Sementara itu, Komisioner Uni Eropa secara positif mengajak Indonesia untuk bekerjasama dalam melindungi GI masingmasing. Ajakan Komisioner Uni Eropa merupakan hal yang sangat positif mengingat Indonesia telah menerima pendaftaran perlindungan dua produk GI Eropa yakni Champagne dan keju Parmesan. Dubes Arif Havas Oegroseno, mengatakan pendaftaran produk GI Indonesia seperti kopi Gayo Aceh, kopi Kintamani Bali, kopi Flores Bajawa dan kopi Kalosi akan mencegah pihak yang tidak bertanggungjawab mengalahkan produk kualitas tinggi Indonesia untuk kepentingannya tanpa mempedulikan kepentingan Indonesia. Saat ini Indonesia dinilai perlu untuk mulai memperluas proteksi terhadap produk GI di berbagai negara yang menjadi tempat ekspor Indonesia, termasuk Uni Eropa. (ant)

Ameck – Hardi Diyakini Mampu Majukan Perekonomian Deliserdang MEDAN (Waspada): Warga Kecamatan Percut Seituan, Kab. Deliserdang, mengaku menaruh kepercayaan besar kepada pasangan T. Akhmad Thala’a – Hardi Mulyono, memajukan perekonomian masyarakat. Pasangan calon bupati dan wakil bupati Deliserdang ini dinilai mampu menggerakkan sektor ekonomi masyarakat, terutama usaha kecil menengah (UKM). Ketua Partai Golkar Kecamatan Percut Seituan Munawir Fuady Hasibuan, mengatakan itu kepada wartawan, Rabu (24/7). Ady, sapaan akrab Munawir Fuady, mengaku mengeluarkan pernyataan itu setelah pihaknya menyerap aspirasi masyarakat. Katanya bahwa Percut Seituan merupakan kecamatan terbesar di Deliserdang dan berbatasan langsung dengan Kota Medan. Kecamatan itu memiliki potensi kelautan dan masyarakat pesisir yang bersahaja. Dengan pengalaman kedua pasangan Tengku Akhmad Thala’a (Ameck) – Hardi Mulyono, diyakini bisa membawa masyarakat

ke arah lebih baik lagi. Masyarakat menyakini pasangan ini memiliki wawasan tidak saja pada penataan kota, tapi juga pada sektor kelautan, dan pengembangan UKM. Disebutkan Ady, selama ini, Pemkab Diliserdang tidak pernah memperhatikan hal yang menjadi harapan masyarakat seperti yang disebutkannya di atas. ‘’Makanya masyarakat butuh orang yang paham tentang masalah dan potensi itu agar diperoleh cara yang tepat,” katanya. Di masyarakat, katanya, Tengku Ameck, dikenal sebagai seorang pimpinan masyarakat. Dia tahu persis kebutuhan masyarakatnya. Dengan gaya bahasa yang santun, Tengku Ameck diyakini mampu mengayomi masyarakat, karena cara berkomunikasinya baik. Sementara itu, calon wakil bupati Deliserdang Hardi Mulyono, diyakini mampu menyusun konsep tentang penataan kawasan. Kemampuan Hardi, yang pernah duduk sebagai anggota DPRD Kota Medan dan saat ini anggota DPRD Sumut, dinilai sangat andal untuk bidang ini. (m12)

Pemerintah Optimis Pertumbuhan 6,3 Persen JAKARTA ( Waspada): Pemerintah optimistis target pertumbuhan yang tercantum dalam APBN 2013 sebesar 6,3 persen dapat tercapai. Caranya dengan dengan melakukan berbagai upaya, seperti mengendalikan inflasi, mempercepat penyerapan anggaran dan memperbaiki iklim investasi. “Kita melihat Indonesia dengan pertumbuhan enam persen keatas tetap kita jaga, dan peluang tumbuh sesuai target dalam APBN masih tetap kita dapatkan,” ujar Menteri Koordinator bidang Perekonomian Hatta Rajasa, seusai rapat koordinasi antara pemerintah dengan Bank Indonesia membahas perkembangan ekonomi terkini di Jakarta, Kamis (25/7). Hadir dalam rapat koordinasi ini, Menteri Keuangan Chatib Basri, Menteri Perindustrian MS Hidayat, Menteri Perdagangan Gita Wirjawan, Menteri Pertanian Suswono dan Gubernur Bank Indonesia Agus Martowardojo. Hatta, menjelaskan upaya untuk mencapai angka pertumbuhan ekonomi diatas enam persen adalah dengan menjaga laju inflasi dan melakukan perubahan terhadap tata niaga barang sebagai antisipasi terhadap kenaikan harga. “Kita melakukan itu untuk betul-betul menjaga agar harga tidak melonjak, komoditas barang terjaga dan suplainya cukup. Ini menjadi perhatian kita untuk mengendalikan inflasi,” ujarnya. Kemudian, lanjut dia, pemerintah berupaya menghilangkan hambatan dalam upaya mempercepat penyerapan anggaran belanja pemerintah, yang selama ini cenderung melambat hingga pertengahan tahun. “Kita mempunyai policy untuk mempercepat belanja dengan tetap menjaga governance baik serta menghilangkan berbagai hambatan,” tutur Hatta. Ia menambahkan upaya selanjutnya adalah memperbaiki iklim investasi dengan melakukan relaksasi atas beberapa aturan insentif perpajakan, menghapus birokrasi yang meng-hambat dan mempercepat revisi Daftar Negatif Investasi (DNI). “Kita menjaga iklim investasi dengan melakukan relaksasi dan pemangkasan terhadap aturan yang menghambat. Ini sedang kita evaluasi dan kita kerjakan, termasuk evaluasi terhadap DNI untuk merangsang investasi,” ujar Hatta.(ant)

Waspada/Sori Parlah Harahap

MUKLIS Harahap, salah seorang penderes karet di wilayah Kec. Padangbolak, Kab. Padanglawas Utara, mengeluh akibat turunnya harga karet dua bulan terakhir ini.

Harga Karet Di Paluta Rp6.000 GUNUNGTUA (Waspada): Petani karet di Kab. Padanglawas Utara (Paluta) mengeluh. Harga karet turun sejak dua bulan terakhir. Yakni dari Rp8.000 per menjadi Rp6.000 per kg. Kondisi seperti ini membuat petani sulit dapat mencukupi kebutuhan sehari-hari. Apalagi telah memasuki Hari Raya Idul Fitri. Muklis Harahap, 48, warga Desa Paranginan, Kec. Padangbolak, Selasa (23/7), mengatakan sejak harga karet turun dua bulan lalu, dirinya sulit untuk memenuhi kebutuhan keluarga. Lahan 1 hektare miliknya, tiap mampu hanya menghasilkan 40 kg getah. “Untuk saat ini kita hanya dapat menu-

tupi kebutuhan pokok saja. Sebab sejak harga turun dua bulan lalu sudah sangat menyulitkan untuk kita. Apalagi menderes ini ratarata mata pencarian masyarakat sini,” ujar Muklis. Himpitan ekonomi masyarakat terpencil ini semakin menjadi seiring perlahan naiknya harga kebutuhan pokok pasca kenaikan BBM lalu. Namun harga karet masih saja belum standar bagi masyarakat. Dalam hal ini harapan masyarakat kiranya pemerintah daerah dapat menyikapinya guna mengurangi beban para petani karet. (a35)


Nusantara

A8

WASPADA Jumat 26 Juli 2013

Waspada/Surya Efendi

GENDONG BALITA: Menteri Negara BUMN Dahlan Iskan bersama Wagubsu HT Erry Nuradi , Pangkosek Hanudnas III Marsekal Pertama Sungkono menggendong balita ketika meninjau kesiapan operasional Kualanamu International Airport (KNIA) yang merupakan bandara baru pengganti Bandara Polonia, Kamis (25/7).

KNIA BEROPERASI: Satu pesawat AirAsia melintas di Kualanamu International Airport (KNIA) yang mulai beroperasi, Kamis (25/7).

Waspada/Surya Efendi

18 Juta Pemudik Tahun Ini, Kemenkes Beroperasi Di KNIA, AirAsia Tambah Pesawat Siapkan 3.200 Titik Pelayanan Kesehatan JAKARTA (Waspada): Jumlah pemudik lebaran tahun ini diperkirakan mencapai 18 juta jiwa. Jumlah itu meningkat sebesar 4,4 persen dari tahun lalu yang mencapai 17,3 juta jiwa.

Waspada/dianw

WAMENKES Ali Ghufron melepas tim siaga mudik lebaran 2013 di kantor Kemenkes, Jakarta, Kamis (25/7).

Kasus Dugaan Penipuan Akta Pekebunan Sawit Mantan Wakil Wali Kota Medan

IPW Laporkan Ke Bareskrim Mabes Polri 2012 lalu. ”Ada empat orang yang sudah dijadikan tersangka oleh Polda Sumut, yakni SL (Dirut PT RMP), MB, IIB dan IL. Namun dari keempat tersangka baru satu orang yang kasusnya masuk pengadilan, yakni SL. Sedangkan tiga lainnya, yakni MB, IIB, dan IL tak memenuhi panggilan polisi,” kata Neta Pane. Berkaitan dengan itu, kata Neta, IPW mendesak Kapolda Sumut Irjen Syarief Gunawan memerintahkan jajarannya agar menangkap ketiga pengusaha itu. (j02)

MEDAN (Waspada) : Ketua Presidium Indonesia Police Watch (IPW) Neta S Pane meminta langsung kepada Kapolda Sumut Irjen Pol Syarief Gunawan untuk menahan IIB yang, Kamis (25/7), tengah menjalani pemeriksaan pada penyidik Dirkrimum Polda Sumut. ”IPW minta pak Kapolda untuk segera menahan tersangka IIB. Apalagi saat ini tengah diperiksa, langsung ditahan saja pak,” kata Neta Pane mengutarakan kedatangannya ke Polda Sumut yang diterima Kapolda Sumut Irjen Pol Syarief Gunawan diruang tamu Kapolda lantai dua Markas Polda Sumut, Kamis (25/7). Neta Pane yang didampingi wartawan Waspada diterima Kapolda Sumut yang didampingiWaka Polda Sumut Brigjen Pol Basarudin dan AKBP Yusuf yang menyidik kasus penipuan dan penggelapan lahan seluas lebih 10 ribu hektar milik Ramli Lubis (pelapor) dengan tersangka pengusaha SL, MB, IIB dan IL. Saat kedatangan IPW ke Mapoldasu, tersangka IIB tengah menjalani pemeriksaan, sampai berita ini diturunkan. ”Sesuai perkataaan Kapolda, bahwa kasus ini akan diproses seadil-adilnya, sebagaimana permintaan IPW kasus ini akan dibuka dan transparan serta kita kawal bersama agar tidak intervensi,” kata Syarief Gunawan. Ke Mabes Polri Ketua Presidium Indonesia PoliceWatch (IPW) minta Badan Reserse dan Kriminal (Bareskrim) Polri bertanggungjawab secara moral atas penanganan kasus dugaan penipuan dan penggelapan akta autentik PT RMP yang bergerak pada perkebunan sawit 10.671.49

hektare milik mantanWakilWali kota Medan Ramli Lubis. ”Kedatangan kami (IPW) ke Bareskrim Polri ini untuk meminta tanggungjawab moral Bareskrim yang melimpahkan laporan kasus dugaan penipuan dan penggelapan yang diduga dilakukan 4 pengusaha di antaranya IIB ,” kata Ketua Presidium Indonesia Police Watch Neta S Pane kepada wartawan di Mabes Polri usai mendatangi Bareskrim dan Pengawasan Penyidik (Wasdik) Mabes Polri, Rabu (24/7). Menurut Neta, kasus yang telah terangkat ke publik ini tidak dapat dibiarkan, karena penegakan hukum harus berjalan. ”Wasdik Mabes Polri berjanji akan melakukan pengawasan terhadap kasus dugaan penipuan dan penggelapan akta authentik RUPS kepemilikan dan saham Ramli Lubis dan orangorang yang ditunjuk Ramli Lubis bernomor 03 Tanggal 18/10/ 2003 diubah keempat tersangka menjadi RUPS-LB dengan nomor 12 Tanggal 12/12/2007. Sehingga RUPS-LB tersebut batal secara hukum karena penyidik menyatakan tidak sah dan notarisnya IL ditetapkan sebagai tersangka,” kata Neta Pane. ”Untuk itu tiga pengusaha yang sudah tiga kali mangkir dan menolak panggilan pemeriksaan polisi harus ditangkap Polda Sumut, agar kasus dugaan penipuan terhadap mantanWakil Wali kota Medan Ramli Lubis bisa segera dilimpahkan ke kejaksaan, untuk kemudian diproses di pengadilan,” terangnya. Kasus dugaan penipuan terhadap perkebunan milik Ramli Lubis di Kabupaten Mandailing Natal, kata Neta Pane, sudah dilaporkan sejak

JAKARTA (Waspada) Ketua DPP Partai Golkar yang juga Wakil Ketua DPR, Priyo Budi Santoso mendukung langkah koleganya Ketua DPR, Marzuki Alie untuk maju dalam konvensi Partai Demokrat. Marzuki menurutnya adalah satu tokoh di Partai Demokrat yang memiliki talenta, intergritas dan kemampuan untuk menjadi pemimpin bangsa Indonesia kedepan. “Saya kenal Pak Marzuki dengan baik.Sehari-hari sebagai pimpinan DPR kita sering berkomunkasi.Dia punya talenta,integritas dan kemampuan untuk ikut konvensi dan maju sebagai calon presiden dari Partai Demokrat. Rakyat akan senang jika dia bisa maju sebagai capres ,” ujar Priyo di Gedung DPR, Jakarta, baru-baru ini. (aya)

Islam Dinamis...

na meningkatkan kapasitas dan daya saing. Tindakan halâli diukur dengan standar niat dan motivasi seseorang untuk melakukan suatu aktifitas dan tindakan. Tindakan halâli juga diukur dengan kayfiyat, metode serta cara yang digunakan seseorang dalam menjalankan aktifitasnya. Pada saat yang sama aktifitas halâli juga diukur dengan standar ghâyah atau tujuan dan target dilakukannya suatu aktifitas. Tindakan halâli akan berfungsi multi playuer effect, berpengaruh multi ganda: berpengaruh pada pelakunya, keluarganya, dan masyarakat serta dunia secara keseluruhan. Oleh karenanya kehalalan tindakan menjadi sesuatu yang niscaya. Gaya hidup halâli tentulah terkait dengan kehalalan konsumsi. Kehalalan konsumsi dapat dilihat pada dimensi sumber dan peroleh setiap benda yang dikonsumsi. Sebab sumber dan cara peroleh konsumsi sangat mempengaruhi kehalalan

konsumsi. Selain sumber dan proses perolehan konsumsi kehalalan benda yang dikonsumsi menjadi sesuatu yang amat krusial. Allah meminta manusia untuk menjamin kehalalan makanannya. (Q.S. 5/al-Mâidah:88). Kehalalan benda yang dikonsumsi terkait dengan proses perolehan, wadah yang digunakan, dan kapasitas konsumsumennya. Gaya hidup halali menunjukkan sikap konsumen yang selalu memeriksa asal benda yang hendak dkonsumsinya. Prosesing perolehan makanan atau minuman yang hendak dikonsumsinya. Mempertimbangkan tempat memperoleh dan mengkonsumsi bendabenda yang dikonsumsinya serta mempertimbangkan simbol-simbol yang terdapat pada benda-benda yang dikonsumsinya. Selain benda, kehalalan konsumsi juga dilihat dari aktifitas konsumen pasca mengkon-

Sebagai konsekuensi dari kehidupan halâli maka nilai kehidupan dunia (al-adnâ) menjadi rendah dan taktis. Sementara kehidupan akhirat (al-âkhirah) menjadi tinggi dan strategis. “Sesungguhnya hari kemudian itu lebih baik bagimu daripada yang sekarang”. (Q.S. 93/al-Dhuhâ:4). Gaya hidup halali, dengan demikian, akan menjadikan capaian kehidupan dan prestasi keduniaan sebagai sesuatu yang dibolehkan dan bahkan dianjurkan, akan tetapi dalam koridor dan wilayah yang taktis dan sederhana. Gaya hidup halali juga menjunjung tinggi kehalalan tindakan. Seluruh tindakan manusia harus halal. Halal dalam arti haq, terhindar dari unsur kebatilan dan pelanggaran ketentuan. Halal juga bermakna shaleh, bermanfaat bagi yang lain serta terhindar dari hal-hal yang merugikan pihak lain.Halal juga berarti khair yang bermak-

Priyo Doakan Marzuki Menang Konvensi

Wakil Menteri Kesehatan, Ali Ghufron Mukti mengatakan, tradisi mudik lebaran tidak dapat dihindari. Tapi para pemudik harus berhati-hati terhadap tindak kriminal, keselamatan di jalan raya dan kesehatan diri. “Yang harus diperhatikan adalah keselamatan dan kesehatan pemudik, khususnya anak-anak,” kata wamenkes saat memimpin apel siaga pelayanan kesehatan mudik lebaran di halaman kantor Kementerian Kesehatan, Jakarta, Kamis (25/7). Apel siaga pelayanan kesehatan mudik lebaran 2013 diikuti 250 personel Tim Kesehatan. Mereka teridiri dari lintas program seperti Palang Merah Indonesia (PMI), Jasa Rahardja, TNI/Polri, Kwarnas Gerakan Pramuka, Dinas Kesehatan Provinsi/Kabupaten/ Kota se-DKI Jakarta, perwakilan organisasi masyarakata serta perwakilan unit utama di lingkungan Kemenkes. Dikatakan Ali Ghufron, seiring meningkatnya jumlah pemudik, tingkat kecelakaan di jalan pun meningkat terus. Korps Lalu Lintas Polri saat operasi Ketupat menyebutkan, telah terjadi 5.233 kasus kecelakaan sepanjang 2012. Jumlah itu meningkat sebanyak 10,31 persen dibanding tahun sebelumnya. Dari seluruh kecelakaan itu, 72 persen di antaranya melibatkan sepeda motor. Sedangkan jumlah kematian mencapai 1.028 jiwa. Guna mengantisipasi hal itu disiapkan sebanyak 3.200 titik siaga kesehatan di berbagai jalur mudik, khususnya di jalur-jalur rawan kecelakaan. Petugas kesehatan yang siaga pun ditingkatkan mencapai 12 ribu orang di seluruh Indonesia. “Jumlah itu belum termasuk yang ada di puskesmas dan rumah sakit rujukan,” kata Ghufron. Selain itu, ada juga pelayanan bidang kesehatan yang sudah dilakukan setiap tahun sejak lima dasawarsa lalu. Pemerintah bersama masyarakat melakukan berbagai kegiatan pelayanan kesehatan bagi pemudik, mulai H-14 hingga H+14, di tempattempat yang diperlukan pada jalur arus mudik Lebaran. Upaya tersebut dilakukan dengan tujuan menurunkan angka kecelakaan, angka kematian dan tindak kejahatan. Kegiatan lapangan yang akan dilakukan, antara lain, penyebaran informasi; penyediaan distribusi logistik (obat-obatan, tenda pos kesehatan, emergency-kit, dan peta mudik lebaran); pengurangan faktor risiko melalui pemeriksaan kesehatan pengemudi angkutan umum di 11 Provinsi; pengendalian faktor risiko (sistem kewaspadaan dini KLB, pemeriksaan/inspeksi sanitasi, dan pemeriksaan kesehatan di tempat umum); promosi kesehatan tentang Perilaku Hidup Bersih dan Sehat (PHBS) dan himbauan untuk menjadikan Bulan Ramadhan sebagai saat yang tepat untuk berhenti merokok; pelayanan Medis dengan menyiagakan Pos Kesehatan Pelabuhan (206 pos), Pos Kesehatan Terpadu Lintas Sektor (646 buah); Puskesmas dan Ambulans 24 jam (892 buah). “Kami juga menginstruksikan kepada 1.554 RS di sekitar Sumatera, Jawa dan Bali untuk siaga 24 jam,” tandas Wamenkes Ali Ghufron. (dianw)

Giliran DPD Tuan Rumah Sidang Bersama DPR-DPD JAKARTA (Waspada): Dewan Perwakilan Daerah (DPD) akan menjadi pelaksana sidang bersama DPR pada acara pidato kenegaraan HUT ke-68 Kemerdekaan Republik Indonesia di Gedung MPR/DPR/DPD pada tanggal 16 Agustus 2013. Setelah pidato kenegaraan HUT Kemerdekaan RI, Presiden akan menyampaikan pengantar tentang Rencana Anggaran Pendapatan dan Belanja Negara (RAPBN) Tahun 2014 dan Nota Keuangan dalam rapat paripurna luar biasa DPR yang dihadiri pimpinan dan anggota DPD. Ketua DPD Irman Gusman mengharapkan peran aktif seluruh pimpinan dan anggota sebab acara penyampaian pidato kenegaraan Presiden kali ini sebagai acara kenegaran terakhir DPD periode 2009-2014. “Saya harapkan seluruh anggota DPD berperan aktif sebagai tuan rumah pelaksanaan pidato kenegaraan yang terakhir bagi DPD priode 2009/ 2014,” ujar Irman Gusman di Gedung DPD RI, Jakarta Rabu (24/7). Menurut Irman, penggabungan acara Pidato Kenegaraan Presiden dan penggiliran tuan rumah sidang bersama oleh DPR atau DPD merupakan evolusi keparlemenan. Untuk pelaksanaan sidang bersama, DPD telah membentuk tim kerja .(aya) sumsi makanan dan minuman yang dinikmatinya; apakah digunakannya untuk melakukan kebaikannatau sebaliknya. Dari kajian tersebut maka salah satu agenda umat dalam ibadah Ramadhan adalah mengupayakan kehalalan

konsumsinya selama Ramadhan dan yang tidak kalah pentingnya mengaktualisasikan kehalalan konsumsinya selama hidupnya sebagai buah dari ibadahnya selama Ramadhan. Wa Allâhu A’lamu bi al-Shawâb. [Syahrin_hrp@yahoo.com]

JAKARTA (Waspada): Penerbangan AirAsia Indonesia QZ 8078 rute Medan – Penang menandakan dimulainya operasional AirAsia dari Bandara Internasional Kualanamu, Medan. Pesawat lepas landas pukul 05:15 WIB dengan membawa 100 penumpang dan tiba di Penang, Malaysia pukul 07:00 waktu setempat. “Penerbangan dari Medan ke Penang ini menandakan resminya perpindahan operasional AirAsia ke Bandara Internasional Kualanamu dari sebelumnya di Bandara Internasional Polonia. Kami mengucapkan selamat kepada pemerintah Indonesia dan PT Angkasa Pura II yang telah sukses meresmikan pengoperasian Bandara Internasional Kualanamu hari ini,” jelas Presiden Direktur AirAsia Indonesia Dharmadi dalam keterangan persnya di Jakarta, Kamis (25/7). AirAsia menyambut positif peluncuran Bandara Internas i o n a l Ku a l a n a m u g u n a menggantikan peran Bandara Internasio-nal Polonia yang telah beroperasi selama 85 tahun. Pasalnya, kata Dharmadi, bandara Internasional Kua-lanamu yang berkelas dunia ini dibangun diatas lahan seluas 1.365 hektare dan dirancang untuk melayani pergerakan 10.000 pesawat serta mencapai 8 juta penumpang per tahun sehingga mendukung rencana pengembangan jaringan

Waspada/Hasriwal AS

PENUMPANG AirAsia sedang melakukan check-in di Bandara Kualanamu, Kamis (25/7). AirAsia. Lebih lanjut dikatakan Dharmadi, AirAsia Indonesia berencana mengalokasikan satu lagi pesawat Airbus A320 untuk mengembangkan jaringan melalui hub Medan. “Kami berencana menambah satu unit lagi Airbus A320 di Medan, sehingga nantinya akan berjumlah empat unit khusus untuk operasional Medan. Pengoperasian Kualanamu Internasional Airport (KNIA) akan membuat AirAsia semakin bisa meningkatkan layanan ke pelanggan dan juga mengembangkan jaringan dari hub Medan,” paparnya. Melalui bandara penghubung Medan, saat ini AirAsia Indonesia telah melayani 4 rute

domestik seperti Jakarta, Bandung, Pekanbaru dan Surabaya serta 4 rute internasional seperti Kuala Lumpur, Penang, Bangkok dan Singapura. Adapun rute ke Singapura akan mulai beroperasi efektif 12 Agustus 2013. Sebagai salah satu upaya memperkenalkan bandara internasional terbaru ini, AirAsia telah membagikan buku panduandwibahasa secara gratis kepada seluruh penumpang AirAsia yang tiba di Kualanamu mulai hari ini. Adapun buku panduan ini dapat diunduh secara gratis oleh seluruh pelanggan AirAsia melalui situs: http://www.airasia.com/id/id/ selamat-datang-di-kualanamu.page.(j02)

RUU KUHP Lebih Fasis Terhadap Pers JAKARTA (Waspada): Rancangan Kitab Undang-Undang Hukum Pidana (KUHP) 2013 yang dikirim pemerintah dalam hal ini Menteri Hukum dan HAM Amir Syamsuddin ke DPR, Mei lalu justru lebih represif terhadap pers dibanding KUHP buatan kolonial Belanda yang sekarang masih berlaku. “Bahkan rancangan KUHP ini lebih fasis,” kata mantan wakil ketua dewan pers, Sabam Leo Batubara, di Jakarta, baru-baru ini. Bagaimana tidak, pasal-pasal “delik pers” dalam Rancangan KUHP draf 1999/2000 yang perumusnya juga diikuti Menteri Kehakiman (1998-1999) Muladi bukan hanya meningkat dari 35 jadi 49 pasal. “Ancamannya pun lebih berat. Pasal 311 (1) KUHP misalnya, ancamannya hanya pidana penjara paling lama empat bulan, Pasal 448 (1) Rancangan KUHP menjadi paling lama lima tahun. Apa ini nnamanya buka lebih fasis?” katanya dengan nada berapi-api. Dia mencontohkan lagi KUHP Pasal 311 (1) KUHP: “Jika yang melakukan kejahatan pencemaran atau pencemaran tertulis dibolehkan membuktikan apa yang dituduhkan itu benar, tak membuktikannya, dan tuduhan dilakukan bertentangan dengan apa yang diketahui, maka diancam melakukan fitnah dengan pidana penjara paling lama empat bulan”. Di Pasal 311 (1) KUHP: “Jika yang melakukan kejahatan pencemaran atau pencemaran tertulis dibolehkan membuktikan apa yang dituduhkan itu benar, tak membuktikannya, dan tuduhan dilakukan bertentangan dengan apa yang diketahui, maka diancam melakukan fitnah dengan pidana penjara paling lama empat bulan”. Tapi pada pasal 448 (1) Rancangan KUHP berbunyi: “Jika pembuat tindak pidana sebagaimana dimaksud dalam Pasal 447 diberi kesempatan membuktikan kebenaran hal yang dituduhkan tetapi tidak dapat membuktikannya, dan tuduhan tersebut bertentangan dengan yang diketahuinya, dipidana karena pemfitnahan, dengan pidana penjara paling lama 5 (lima) tahun dan paling singkat 1 (satu) tahun atau denda paling banyak Kategori IV”. Leo juga menilai pemerintah masih mempertahankan pasal-pasal haatzai artikelen yang selama ini menjadi senjata ampuh untuk mengekang kebebasan pers. Dalam KUHP, delik permusuhan, kebencian, atau penghinaan terhadap pemerintahitu termuat dalam Pasal 154, 155, 156, dan Pasal 157. “Ketika itu kontrol dan kritik pers terhadap kebijakan kolonial Belanda dinilai sebagai tindak permusuhan, kebencian, dan penghinaan, ratusan orang pers dipidana penjara atau dibuang antara lain ke Boven Digul,” kata Leo. “Rancangan KUHP yang kembali menghidupkan pasal-pasal haatzai artikelen (Pasal 284, 285, 288, 289, 405, dan 406), tak kalah efektifnya membungkam kebebasan pers,” akunya. Pasal 406, misalnya, berbunyi: “Setiap orang yang menyiarkan, mempertunjukkan, atau menempelkan tulisan atau gambar sehingga terlihat oleh umum atau memperdengarkan rekaman sehingga terdengar oleh umum, yang berisi penghinaan terhadap kekuasaan umum atau lembaga negara, dengan maksud agar isi penghinaan tersebut diketahui atau lebih diketahui oleh umum, dipidana dengan pidana penjara paling lama 3 (tiga) tahun atau pidana denda paling banyak Kategori IV”.

Menurut Leo berdasarkan Rancangan KUHP, pemerintah menilai karya jurnalistik itu adalah karya kejahatan sebagimana termaksud dalam Pasal 308, 537 (1), dan Pasal 538 (1). Pasal 308: “Setiap orang yang menyiarkan berita yang tidak pasti, berita yang berlebihan, atau berita yang tidak lengkap yang mengakibatkan timbulnya keonaran dalam masyarakat, dipidana dengan pidana penjara paling lama 1 (satu) tahun atau pidana denda paling banyak Kategori II”. Pasal 537 (1): “Setiap orang yang dengan lisan menyerang kehormatan atau nama baik orang lain dengan cara menuduhkan suatu hal, dengan maksud supaya hal tersebut diketahui umum, dipidana karena pencemaran, dengan pidana penjara paling lama 1 (satu) tahun atau pidana denda paling banyak Kategori II”. Pasal 538 (1): “Jika pembuat tindak pidana sebagaimana dimaksud dalam Pasal 537 diberi kesempatan membuktikan kebenaran hal yang dituduhkan tetapi tidak dapat membuktikannya, dan tuduhan tersebut bertentangan dengan yang diketahuinya, dipidana karena fitnah, dengan pidana penjara paling singkat 1 (satu) tahun dan paling lama 5 (lima) tahun atau pidana denda paling sedikit Kategori III dan paling banyak Kategori IV”. Nada serupa juga terlontar dari mulut pengamat pers, Atmakusumah Astraatmadja. Dia menilai RUU KUHP lebih kejam terhadap pers dibanding KUHP sekarang. “RUU KUHP yang kini berada di tangan DPR, makin banyak pasal yang menekan pers dan hukumannya juga bertambah berat. Intinya lebih kejam,” tegasnya. Pengajar di Lembaga Pers Dr. Soetomo (LPDS) ini berharap kalau ada pasal hukum pidana yang dikenakan oleh pekerja pers ataupun perusahaan pers karena melanggar pasal dalam KUHP nanti, hendaknya jangan hukum penjara tapi cukup denda. “Denda pun hendaknya proposional artinya mempertimbangkan kondisi pelanggar agar tidak membebani pembayar denda,” terangnya. Kalau ada dua orang melakukan kesalahan sama atau melanggar pasal hukum yang sama, harus dilihat dari kemampuan masing-masing pelanggar dalam membayar denda yang dijatuhkan. “Umpannya pelanggar A masih aktif bekerja, cukup didenda satu juta rupiah. Kalau si-B yang tidak aktif bekerja atau sudah pensiunan atau tidak berpenghasilan tetap lagi, cukup seratus ribu rupiah,” jelas mantan ketua dewan pers ini. Begitupun dengan perusahaan. Kalau itu dikenakan kepada perusahaan pers, harus dipertimbangkan juga kemampuan finansial perusahaan tersebut walaupun kesalahannya sama. “Misalnya kalau dilakukan oleh perusahan penerbitan Kompas, dendanya mungkin bisa sepuluh juta rupiah. Sedangkan perusahaan Waspada cukup satu atau dua juta rupiah. Jadi dilihat dari aset dan kemampanannya juga,” jelasnya. Atma meminta para wartawan terus mempelajari RUU KUHP dengan mencatat pasalpasal mana saja yang ternyata membelenggu kebebasan berekspresi termasuk kebebasan pers, lalu menulis tentang itu baik untuk berita, kolom, tajuk, dan lainnya. “Jangan sampai RUU KUHP ini disahkan DPR. Kalau sampai lolos kita harus ribut,” tegasnya. (adji k.)


Luar Negeri

WASPADA Jumat 26 Juli 2013

A9

Serangan Roket Syria, 15 Pengungsi Palestina Tewas AMMAN,Jordania(Reuters):PasukanyangsetiakepadaPresiden Bashar Assad menewaskan sedikitnya 15 warga Palestina, sebagian besarperempuandananak-anak,dalamsatuseranganroketterhadap kamp pengungsi yang dikuasai pemberontak di ujung bagian selatan Damaskus, kata aktivis. Milisi Palestina dari Front Populer Komando Pembebasan Palestina (PFLP-GC) yang pro Assad bersama tentara Syria dan pasukan intel mengepung kamp itu selama berbulan-bulan. Mereka melancarkan serangan infantry darat yang diperkuat dengan tank dan peluncur roket untuk menguasai kamp itu namun menghadapi perlawanan sengit, kata sumber di pihak oposisi. “Roket-roket itu menghantam kawasan pemukiman dan area perbelanjaandibelakanggarisdepan.Parakorbanadalahwargasipil,” kataaktivisRamial-SayyeddariPusatMediaSyria,sambilmenambahkan 45 orang cedera. Laporan itu tidak bisa dikonfirma-sikan secara independen. Pemerintah Syria menolak akses bagi wartawan. Komite Koordinasi Kamp Yarmouk mengatakan, dua rudal Grad ditembakkan PFLP-GC mengenai toko roti Hamdan Bakery. Lima wanita dan lima anak-anak tewas. Satu keluarga yang tinggal di area itu, Fadlon, dengan lima anggota keluarga tewas, kata Pusat Media Syria. Rekaman video yang diambil aktivis memperlihatkan satu gedung hancur dan kerusakan parah melingkupi gedung itu. Penduduk mengumpulkan potongan tubuh dari bawah reruntuhan gedung. Pasukan Assad memerangi pemberontak selama dua setengahtahundalamperangsipilyangtelahmenewaskansedikitnya 100.000 orang.(m23)

Militan Hadang Konvoi Truk Di Irak, Bunuh 14 Orang BAGHDAD, Irak (AP): Militan menghadang satu iring-iringan truk dengan Syiah Irak di satu daerah terpencil di utara Irak yang menewaskan 14 pengemudi, demikian menurut polisi Kamis (25/ 7), kejadian terakhir dari serangkaian serangan berani yang bertujuan untuk merusak negara itu. Para penyerang pertama menembakkan mortir ke satu pangkalan militer dan mengebom satu menara telekomunikasi guna menarik perhatian pasukan keamanan sebelum mereka mencegat iring-iringan kendaraan itu Rabu malam dekat desa Sarha, kata Kol. Hussein Ali Rasheed. Desa itu berada agak keluar kota sebelah utara Tuz Khormato, kira-kira 200 km utara Baghdad. Menurut Rasheed, kepala polisi kota itu, semua korban adalah supirwargaSyiahdanparapembantumereka.Mayatmerekaditemukan dengan luka tembak di kepala, katanya. Kelompok bersenjata itu menembak para sopir truk di jalan raya sekitar 10 km arah selatan kota Sulaiman Bek, ujar Mohammed al-Bayati. Puluhan orang lain menyerang kota tersebut dengan melancarkan serangkaian tembakan sejak Rabu malam, kata Bayati. Serangan itu juga menyebabkan seorang warga sipil terluka, katanya. Sulaiman Bek sempat dikuasai oleh kelompok bersenjata itu pada akhir April, namun mereka kemudian mundur dari kota setelah membuat kesepakatan dengan pemimpin suku dan pejabat pemerintah, sehingga pasukan keamanan bisa masuk kota lagi. Penguasaan kota itu terjadi di tengah kekerasan yang berlangsung sejak 23 April saat pasukan keamanan mendesak kelompok pemrotes anti-pemerintah di dekat kota Arab Suni, Hawijah, kemudianmemicukeributandanmenyebabkan53orangkehilangan nyawa. Puluhan orang lagi meninggal dalam gelombang ketidakpastian termasuk serangan balasan terhadap pasukan keamanan. Sampai dengan kekerasan terbaru itu hingga Juli, korban jiwa telah mencapai 670 orang membuat Juli menjadi bulan paling berdarah dalam tahun ini.(m10)

Perahu Terbalik Di Perairan Singapura, 9 Orang Hilang SINGAPURA (Antara/Xinhua-OANA): Otoritas Kelautan dan Pelabuhan Singapura mengatakan pihaknya menerima laporan Rabu (24/7) sore bahwa sebuah tongkang telah terbalik di perairan Singapura, dengan sembilan orang masih hilang. Dua anggota awak tongkang itu diselamatkan, kata pihak otoritas, dan menambahkan bahwa ia telah mengkoordinasikan operasi pencarian dan penyelamatan. Pihak berwenang mengatakan menerima laporan bahwa tongkang Guo Liang 677 telah terbalik di perairan Singapura sekitar tujuh mil laut utara Mercusuar Horsburgh, yangterletakdisebuahpulaudipintumasuktimurkeSelatSingapura. Salah satu anggota awak, yang diselamatkan oleh kapal patroli Polisi Penjaga Pantai di daerah tersebut, yang mengatakan bahwa 10oranglainnyahilang.Pihakyangberwenangkemudianmenerima laporan bahwa anggota kru lain telah diselamatkan oleh kapal disekitarnya.Dikatakanbahwaoperasipencariandanpenyelamatan melibatkan aset udara dan pencarian di permukaan perairan, serta para penyelam komersial juga dipanggil untuk membantu pencarian. Pihak berwenang mengatakan sedang menyelidiki insiden itu.

The Associated Press

PEMANDANGAN udara yang diambil dari video menunjukkan satu pandangan umum lokasi kecelakaan kereta api di Santiago de Compostela, Spanyol, Kamis (25/7).

77 Orang Tewas Dalam Kecelakaan KA Spanyol SANTIAGO DE COMPOSTELA, Spanyol (AP): Para penyelidik Spanyol berusaha untuk memastikan Kamis (25/7) mengapa satu kereta api penumpang meloncat dari rel yang menyebabkan delapan gerbongnya saling bertabrakan satu sama lain hanya beberapa saat sebelum kereta api itu tiba di kota suci di baratlaut pada malam festival besar Kristen, yang menewaskan sekurang-kurangnya 78 orang dan mencederai lebih dari 140 orang. Tujuhpuluh tiga orang ditemukan tewas di lokasi kejadian dan empat lainya tewas di rumah sakit,kataMariaPardoRios,wanita jurubicara pengadilan utama kawasan Galicia. Sekurang-kurangnya 141 orang cedera — sebagiannya dalam keadaan kritis — setelah delapan gerbong yang membawa 218 penumpang terjungkal kira-kira satu jam sebelum matahari tenggelam Rabu malam. Pihak berwenang belum menyebutkan nama-nama para korban, namun seorang wanita jurubicara Kementerian Dalam Negeri Spanyol mengatakan Kamis bahwa tidak ada kemungki-

nan bahwa gerbong keluar dari relnya akibat serangan teroris. Diaberbicaratanpamenyebutkan jatidirinya karena kebijakan kementerian itu. Kecelakaan kereta api paling mematikan Spanyol sejak 1972, ketika sebuah kereta bertabrakan dengan sebuah bus di barat daya Spanyol, menewaskan 86 orang dan melukai 112. PM Mariano Rajoy, yang lahir di Santiago de Compostela, pergi ke lokasi kecelakaanKamis.Parapejabatdikota membatalkan upacara untuk festival keagamaan tahunan yang menarik puluhan ribu orang Kristen dari seluruh dunia. Menurut CNN Kamis kecela-

kaan yang diklaim sebagai yang terburuk dalam 25 tahun terakhir di Eropa itu juga melukai 100 penumpang lain. Menurut laporan yang diterima Menteri Infrastruktur Galicia, Agustin Hernandez Fernandez, sebanyak 20 korban luka, kini berada dalam kondisi kritis di RS. Para korban luka dilarikan ke beberapa RS di kota Santiago dan dua kota lainnya di wilayah sekitar. Pejabat berwenang juga mengumumkan melalui akun Twitter, bahwa saat ini mereka membutuhkan banyak donor darah untuk menyelamatkan nyawa para korban kecelakaan. Timpenyelidikhinggakinimasih melakukan investigasi terhadap kasusiniuntukmencaripenyebab kecelakaan kereta yang memuat 247orangtersebut.NamunmenurutasistenseniorPMSpanyol,Rabu , menduga penyebab kecelakaan bukan karena tindak terorisme. Sementara pengakuan operator jalur kereta api, Renfe, kereta mengalamikecelakaandibelokan yang berjarak hanya beberapa kilometer dari stasiun kereta di kota Santiago de Compostela.

MenurutjurubicaraRenfe,hingga kini belum diketahui berapa kecepatan kereta saat peristiwa kecelakaan terjadi. Namun mereka mengatakan kereta dapat melaju dengan kecepatan maksimal 250 km per jam. Peristiwa kecelakaan itu terjadi sebelum dimulainya perayaan tahunan bagi umat Kristiani di kota tersebut. Akibatkecelakaanitu,pejabat berwenang terpaksa membatalkan perayaan yang seharusnya berlangsung Rabu dan Kamis ini. Seperti diberitakan sebelumnya, sebuah kereta cepat tergelincir di Santiago de Compostela, pinggiran kota Spanyol Utara pada Rabu kemarin. Kereta berangkat dari Madrid menuju Ferrol, bagian dari pantai Galicia. Kereta tergelincir dan membuat gerbong-gerbong kereta berputar arah bahkan ada yang menimpa gerbong lain. Beberapa gerbong keluar jalur danmenabraktembokpembatas di sisi luar lintasan. Menurut salah seorang saksi mata, Ivette Rubiera Cabrera, kereta terbelah menjadi dua bagian.(cnn/f/m10)

Warga AS Pada Usia 112 Jadi Pria Tertua Dunia, Wanita Tertua 115

The Associated Press

FOTO ini disajikan oleh GuinnessWorld Records yang menunjukkan Salustiano Sanchez-Blazquez, yang berusia 112 tahun dan yang menurut riset oleh Guinness World Records, adalah pria tertua yang baru. Sanchez-Blazquez, dari Grand Island, N.Y., adalah seorang mantan pekerja tambang batubara dan musisi. Dia menjadi pria tertua dunia ketika Jiroemon Kimura dari Jepang, meninggal dunia 12 Juni lalu pada usia 116 tahun.

GRAND ISLAND, New York (AP): Seorang musisi otodidak, penambangbatubaraberusia112 tahun dari barat NewYork adalah pria tertua di dunia, menurut Guinness World Records Ltd SalustianoSanchez-Blazquez menjadi pria tertua di dunia ketika Jiroemon Kimura meninggal 12 Juni di usia 116. Orang tertua di dunia adalah seorang wanita, 115 tahun, Misao Okawa dari Jepang. Guinness World Records menggunakan laporan sensus, dokumen imigrasi, catatan perkawinan dan laporan berita untuk mengkonfirmasi catatan. Robert Young, konsultan seniorgerontologiGuinnessWorld Records, mengatakan 90 persen dari semua Supercentenarian adalahperempuandanSalustiano

saatinisatu-satunyalaki-lakiyang lahirpadatahun1901denganadanya bukti kelahiran. Lahir 8 Juni 1901, di desa El Tejado de Bejar, Spanyol, dia dikenal karena bakatnya di dulzania, alat musik tiup dari buluh yang dia pelajari sendiri dan bermain dipestapernikahandanperayaan desa. Pada usia 17, dia pindah dengankakaknya,Pedrodansekelompok teman-teman ke Kuba, di mana mereka bekerja di ladang tebu. Pada tahun 1920, dia datang ke Amerika Serikat melalui Pulau Ellisdanbekerjaditambangbatubara Lynch, Kentucky. Pada akhirnya,diapindahkedaerahNiagara Falls dari New York, di mana dia masihhidup,bekerjadikonstruksi dan di tungku industri. Dia menikah dengan istrinya, Pearl, pada

Gema Internasional

Penguasa Yang Represif Membahayakan Pondasi Ideologi TURKI semakin kisruh, pada awalnya warga kota Istanbul hanyamemrotespemerintahkota yang berniat menggusur Taman Gezi yang termasuk dalam lingkunganAlun-alunTaksim.Menurut rencana di Taman Gezi akan dibangun shopping center.Pihak keamanan terlalu berlebihan meredamprotesdengantindakan tidak sepatutnya terhadap warga yang berdemo secara damai dan duduk diam di taman tersebut. Tindakanberlebihanaparatkepolisian yang mengusir pendemo dengan menggunakangasairmata, telah memancing protes lebih besar hampir di semua kota dan akhirnyaprotesbukanlagiditujukanpadaketidaksetujuanpenggusurantamannamunsemakinberkembang luas menyeruduk pada pemerintahan PM Turki Recep Tayyip Erdogan. Peristiwa kekerasan oleh aparat kepolisian di Istanbul, ada satu peristiwa yang mirip yaitu tepatnyatigatahunlaluPMRecep Tayyip Erdogam menuduh Israel berperilakutidakmanusiawiyaitu terbunuhnyasembilanorangaktivis Turki di atas kapal berbendera Turki,Mavi Marmara, kapal yang sedangdalamperjalanankeGaza membawa bantuan kemanusia-

an bagi rakyat Palestina yang terkepung di wilayah Gaza. Peristiwa pembunuhan sembilan orang aktivis tersebut mencetuskan protes keras dari massa pro-Palestina, protes mana berlangsung di Alun-alun Taksim IstanbuldandiberbagaikotaTurki lainnya. Nah sekarang, justru pemerintahanErdoganmeluncurkan perbuatan yang tidak manusiawi pula terhadap warganegaranya sendiri. Menurut Erdogan, tindakan kekerasan yang dilakukan oleh polisi terhadap pendemo secara damai yang memrotes keputusan pemerintah untuk merubah TamanGezimenjadishoppingcenter pada akhirnya kesalahan itu diarahkanpadaelemenekstrimdan berpotensi segaris dengan kelompok foreign troublemakers. Sebagaimana dapat diperkirakan, sikap penguasa yang represif mengakibatkan demostrasi semakin membengkak dan Taman Gezi telahmenjadiikontempatmelampiaskan kekecewaan terhadap partaipenguasa:JusticeandDevelopment Party (AKP). Berbicara masalah ‘pembangunan,’ sebuahartikelyangterbit dalam harian Zaman berbahasa Turki yang melaporkan reaksi PM

Erdoganterhadapinsidenperusakan transportasi umum oleh pendemo. Selainitu,logikanyamenurut AKP,kerusakankecilolehpemrotes yang anti-pemerintah dikualifikasikan sebagai pekerjaan merusak sementara perubuhan oleh negara terhadap lingkungan dan tempat-tempat umum dikualifikasikan sebagai pembangunan dan modernisasi. Sebagai bukti lebih lanjut mengapa Turki diteriaki sebagai kampiunpenindasanrakyat,kembali harian Zaman edisi Bahasa Inggris pada tahun 2012 memberitakan anggota Dewan Kota DopgubeyazitProvinsiAgridijatuhi hukuman penjara satu bulan 20 hari dan walikotanya dipenjara enambulan.Hukumanyangdijatuhkan masih berkaitan dengan taman kota karena memberi nama taman tersebut Ehmede Xani seorang filosof dan penyair keturunan Kurdi. Memang tak dapat dibantah meskipun tingkat formal demokrasi dan kebebasan telah bertumbuh di bawah AKP, Erdogan faktanya bergerak menuju lebih konservatifbahkanbisadikatakan authoritariandalamtahun-tahun terakhir persis pada waktu Arab Springs menunjukkan kebang-

krutan moral dan politik. Mungkin pertanyaan yang sa-ngat penting yang akan menentukanbagaimanaprotes-protes ini dilaksanakan. Kemudian bagaimana lembaga-lembaga demokrasi seperti parlemen, pers dan media yang lebih kuat serta masyarakat sipil membuktikan perlawanan terhadap negara yang lebih mengedepankan kekerasan. Kenyataan dunia sekarang ini baik di negara maju maupun yangdiduniaketiga,mengambil tindakan keras sudah mengglobal. Negara-negara yang pimpinannya merasakan berada di bawah ancaman, mereka akan memperkuat dominasinya terhadaprakyat,pikiranmanatelah ditanamkan sebagai tujuan untuk melindungi kekuasaan dan kepentingan mereka. Jika di Turki terjadi penguatan dominasi terhadap rakyat dengan bersikap keras maka di Turki tidak akan muncul “Arab Spring” namun akan berubah menjadi “a very hot spring and summer”. Jadi, kekuasaan akan memelihara dan membiakkan arogansi, kekerasan dan korupsi tanpa hirau pada tiang pendasi ideologi. Entahlah! (Kosky)

tahun 1934. Dalam sebuah pernyataan yang diberikan oleh Guinness World Records, Salustiano - yang memiliki nama julukan “kerdil” - mengatakan dia tersanjung oleh perhatian, mengatakan ia tidak merasa dia mencapai sesuatu khusus hanya karena dia telah hidup lebih lama daripada kebanyakan. “Dia berkata, ‘Aku sudah tua dan mari kita berhenti di situ,’” kata putrinya, 69 tahun Irene Johnson. Salustiano tinggal dengan Johnson di Grand Island setelah istrinya meninggal tahun 1988, dia pindah ke panti jompo pada tahun 2007. “Kami melakukan yang ter-

baik,” kata Johnson. “Kami tidak akan menempatkan dia di suatu tempat hanya karena dia sudah tua.” Salustiano mengatakan umur panjang dapat dikaitkan dengan makan satu pisang per hari dan dosis harian nya enam Anacin tablet. Namun putrinya memiliki teori lain. “Saya pikir itu hanya karena dia seorang pria, keras kepala independen,” katanya. Selain putrinya, dia memiliki seorang putra 76tahun,John,tujuhcucu,15cicit danlimabuyut-cucu.Orangtertua yang dikonfirmasi adalah Jeanne Calment dari Louise, Prancis, yang meninggal usia 122 tahun dan 164 hari. (m10)

Ketika Jadi Raja Kelak, Pangeran Kecil Inggris Bergelar George VII LONDON, Inggris (CNN): Si pangeran kecil dari Inggris, yang baru berusia tiga hari, telah diberi nama George Alexander Louis, demikian diumumkan . Jika dia memerintah kelak, gelar yang akan disandangnya adalah Raja George VII Nama Pangeran George memiliki arti penting bagi Kerajaan Inggris. Nama itu dipakai oleh raja-raja besar dalam sejarah Inggris. Menurut BBC Kamis (25/7), Raja George V memimpin Inggris pada Perang Dunia I. Dia menyerukan perang melawan Kekaisaran Jerman yang dipimpin sepupunya sendiri, Kaisar Wilhelm II. Raja GeorgeV memang berasal dari keluarga bangsawan Jerman. Dia mengganti nama keluarganya dari Saxe-Coburg Gotha menjadi Windsor karena sentimen anti-Jerman yang berkembang di masa itu. Raja George V kemudian digantikan putranya, Raja George VI. Sang Raja berhasil menjaga semangat rakyat Inggris pada Perang Dunia II melalui pidato-pidatonya. Padahal, dia sejak kecil menderita kesulitan berbicara. Kisah hidupnya kembali diceritakan dalam film peraih penghargaan Oscar The King’s Speech. Saat ini sang pangeran berada di urutan ketiga penerus takhta Inggris di belakang Pangeran Charles dan ayahnya, PangeranWilliam. Setelah menunjukkan wajah putra mereka kepada publik Selasa, PangeranWilliam dan Kate Middleton mulai menghindari perhatian publik. Mereka membawa Pangeran George ke rumah orangtua Kate di kota Bucklebury. Sebelumnya, Pangeran George dibawa ke kediaman Pangeran William dan Kate di Istana Kensington. Disana dia dikunjungi oleh RatuElizabethdankakeknya,PangeranCharlesdananggotaKerajaan Inggris yang lainnya. Pangeran William memang ingin putranya hidup normal seperti layaknya anak lainnya. Pangeran George diharapkan dapat lebih menyatu dengan rakyatnya. Ditentukan para petaruh? Bayi yang lahir Senin dan membuat heboh media massa sedunia itu menempati urutan ke tiga pewaris takhta Kerajaan Inggris dan akanmenyandanggelarYangMuliaPangeranGeorgedariCambridge, kata Istana Kensington.Ketiga nama itu memang diunggulkan dalam daftar pilihan nama oleh para petaruh Inggris dan pengumuman nama ini tergolong cepat dibanding tradisi kerajaan. Banyak petaruh memasang taruhannya ketika publik menunggu pengumuman nama pangeran kecil itu. Pasar taruhan Inggris Ladbrokes memiliki George dan James sebagai favorit Rabu, yang disusul oleh Alexander, Arthur, Louis dan Henry. Kerajaan perlu waktu sampai sebulan untuk menamai Pangeran Charles, putra mahkota, dan sepekan untuk mengumumkan nama Pangeran William, putra sulung Charles. Nama George dipakai oleh enam orang raja Inggris.Terakhir nama itu dipakai oleh George VI, ayah Ratu Elizabeth yang bertakhta pada 1936 hingga 1952. Alexandra, versi nama perempuan dari Alexander, adalah nama tengah sang Ratu dan juga nama istri Raja EdwardVII yang berkuasa pada awal abad lalu. Sementara Louis adalah nama tengah Pangeran William dan merupakan nama yang diambil dari guru dan paman Pangeran Charles, Louis Mounbatten, yang terbunuh dalam serangan gerilya Tentara Nasional Irlandia pada 1979. Namun pemilihan nama itu tidak lantas akan membuat putra William menjadi Raja George VII. Ayah sang ratu dibaptis dengan nama Albert tetapi memilih nama George VI saat bertahta. “Sangat menarik karena mereka memilih tiga nama tersebut. Sepertinya keluarga kerajaan mendekat ke rakyat, yang cenderung memilih nama tengah lebih pendek dibanding keluarga kerajaan,” kata ahli sejarah Suzannah Lipscomb kepada Sky News.(vn/m10)

Putri Mantan Presiden John Kennedy Jadi Dubes Jepang WASHINGTON, AS (Antara/AFP): Presiden Barack Obama menunjukCarolineKennedyyangmerupakanputrimantanpresiden John F. Kennedy sebagai Dutabesar AS untuk Jepang. Anak pertama Kennedy itu telah lama berkarir untuk mendapatkan sebuah jabatan publik. Kini Caroline akan mendapat sorotan dari masyarakat untuk membuktikan kiprah diplomatiknya yang dimulai sejak usia muda. Dalam pencalonan yang sebelumnya diawali rumor panjang, Obama telah memanggil Caroline dan beberapa calon lain untuk menduduki posisi“pelayan publik terbaik. Negara kita akan diwakili oleh mereka dan saya bangga bisa bekerja sama dengan mereka dalam beberapa waktu ke depan,” kata Obama dalam pernyataan.

Ramadhan Ini Puasa Terpanjang Dalam Beberapa Dasawarsa PUASA Ramadhan yang dilakukan dalam suasana normal saja sudah demikian berat bagi masyarakat awam. Puasa akan lebih berat jika situasi dan kondisi yang tidak nyaman, misalnya suasana iklim yang tidak mengenal ‘kasihan’ pada orang yang berpuasa.Tetapi bagi masyarakat di Uni Emirat Arab, kondisi itulah yang kini mereka hadapi, suhu tinggi —rata-rata 48sampai50derajatCelsiusyang menyengat.Tidakdiragukanlagi situasiitumerupakantugasberat bagi orang-orang yang secara rutin terlibat dalam kegiatan di luar ruangan, apa lagi jika mereka melaksanakan perintah agama, harus berpuasa, kata seismolog Adil Hassan. Dia mengatakan matahari serasa berada dekat di atas kepala dengan suhu sekitar 48 dan 49 derajat Celsius di banyak tempatemiratsejakawalRamadhan, sehingga membuat ketidaknyama-nan bagi masyarakat. Bahkan di malam hari suhu tetap tinggi 30 sampai 40 derajat Celsius. Hassan mengatakan kalender Hijrah Islam didasarkan pada peredaran bulan dan seta-

hunnya biasanya ada 354 atau 355hari.TetapikalenderGregorius, yang juga diketahui sebagai kalender Barat, didasarkan pada gerakan Bumi mengitari Matahari dan memiliki total 365 hari dalam tahunnya. Karena sistem itu, ada perbedaan 10 hari setiap tahunnya antara kedua kalender itu. Perputaran itu membuat perbedaan dari satutahunlengkapdalamhampir 36 tahun antara kedua kalender. “Ini berarti bahwa [awal] Ramadhan berikutnya yang jatuh pada bulan Juli akan terjadi setelah 33 tahun.” Tahun ini,suhu mencapai 50 derajat Celcius pada hari pertama Ramadhan. Dia mengatakan suhu tertinggi tercatat suhu siang hari pada bulan Juli tahun 2002, saattemperaturnaikhingga52.1C. Di Arab Saudi, hari juga akan terasa lebih panjang, yang seharinya berlangsung lebih dari 15 jam, terutama pada awal-awal Ramadhan. Jam-jam puasa secara bertahap akan berkurang dan akan berlangsung sekitar 14 jamdan40menitmenjelangakhir bulan. Suhu diperkirakan naik di atas 43 derajat Celcius selama

Ramadan.Kota-kotasuciMakkah dan Madinah diharapkan akan mencatat tingkat suhu tertinggi selain Provinsi Timur,Yanbu,dan Riyadh. Kota pantai Jeddah mencatat kelembaban 70 persen hari pertama Ramadhan, tertinggi di Arab Saudi,denganpendudukdidaerah terbuka keringatnya bercucuran dan kota suci Madinah mencatat suhu tertinggi. Sementara itu, kondisi cuaca berdebuyangdihadapipenduduk Riyadh dan dua hari menjelang Ramadhan mereda. Cuaca itu, bagaimanapun,dikatakanhanya sementara dan bahwa cuaca berdebu akan kembali ke Riyadh dalam beberapa hari ke depan. Hussain Al-Qahtani, jurubicaraKepresidenanMeteorologidan Lingkungan,mengatakankepada ArabNewspekanlalubahwasuhu selama Ramadhan diperkirakan akan tetap panas karena tekanan rendahdiSemenanjungArabdan kondisi cuaca panas di kawasan Timur Tengah. Menurut dia, suhu akan berkisar antara 43-48 derajat Celcius di wilayah Makkah, 42-47 di wilayahMadinah,44-47diRiyadh dan Provinsi Tengah, 44-48 di

Provinsi Timur,50 derajat Celcius diAl-Ahsa,39-45diProvinsiPerbatasan Utara dan 42-46 di Provinsi Selatan. Menurut statistik, Al-Qahtani mengatakanbahwaMakkahpernah mencatat suhu 49,8 derajat Celsius pada 1 Juli 1989 lalu, Madinah terdaftar 49 derajat Celsius pada 20 Juli 2005, sedangkan Riyadh mencatat suhu tertinggi 48derajatCelsiuspada25Juli1987, danDammam mencatat 50 derajat Celcius pada 28 Juli 2007. Dengansuhupanasmencapai puncaknya di sebagian besar kawasan Timur Tengah, masalah dehidrasi akan menjadi tantangan nyata. Namun, meskipun kesulitan yang disebabkan oleh panjang, panas musim panas, Ramadhan adalah periode tahun yang dinantikan umat Muslim di seluruh dunia . Selamapuasa,energidancairan tubuhberadapadatingkatterendah. Panas,pedasatauasinmakananyang harusdihindariselamasahur.Dokter juga merekomendasikan agar memakan makanan dengan kandungan serat tinggi, yang membutuhkan waktu lebih lama untuk dicerna, sebelum memulai puasa.(an/gn/mujo)


Sport

A10

WASPADA Jumat 26 Juli 2013

Pep Puas Pecundangi Mantan MUNICH, Jerman (Waspada): Pelatih baru Bayern Munich, Pep Guardiola (foto), puas setelah pasukannya mempecundangi Barcelona 2-0 dalam laga eksibisi bertajuk Uli Hoenes Cup 2013. “Saya sangat puas sekarang dan tak ada yang perlu dikeluhkan. Saya memiliki tim yang sangat hebat, yaitu Bayern,” puji Pep, seperti dilansir Sky Sports, Kamis (25/7). “Ini laga yang sangat istimewa untuk saya. Saya menghabiskan hampir seluruh hidup sebagai pemain dan pelatih Barcelona,” ujarnya lagi. Mentas di markas sendiri, Allianz Arena, Rabu (Kamis WIB), Bayern mampu mengendalikan permainan sekaligus memastikan kemenangan lewat sumbangan gol bek sayap Philipp Lahm dan striker Mario Mandzukic di babak pertama. Kemenangan meyakinkan Bayern di hadapan 71.137 penggemar itu sekaligus memupus misi balas dendam Barcelona, yang dipermalukan FC Holly-

wood agregat 7-0 pada semifinal Liga Champions musim lalu. “Barcelona selalu menjadi tim yang bagus dan mereka ujian yang bagus bagi kami. Kami menciptakan banyak peluang, tapi kami mesti meningkatan sentuhan akhir kami,” pinta Pep. Die Roten akan menjajal Borussia Dortmund pada Piala Super Jerman, Sabtu (27/7) besok, yang merupakan ulangan final Liga Champions musim lalu. “Ini persiapan yang bagus untuk menghadapi Dortmund,” papar Pep. Kendati tidak menurunkan pendatang baru dari Brazil yang belum lama ini dikontrak, Neymar da Silvaa, Barca tetap menjanjikan dengan menurunkan Lionel Messi, Javier Mascherano, Adriano Correa, Alex Song dan

Alexis Sanchez sebagai pemain inti. Anak-anak Barca sepertinya ingin membalas kekalahan 04 pada leg pertama semifinal Liga Champions di Allianz Arena, yang lalu disusul kekalahan 0-3 pada leg kedua di Camp Nou. Karena entrenador anyar

Gerardo Martino belum datang ke Spanyol, caretaker Jordi Roura memimpin perjuangan El Catalan. Messi menciptakan awal cemerlang dengan berlari melewati barisan tengah Bayern, namun tembakannya melenceng. Gelandang tuan rumah,

Toni Kroos, memaksa kiper Barcna Jose Manuel Pinto berjuang keras menyelamatkan gawangnya. Franck Ribery dan Arjen Robben juga menciptakan peluang. Bayern kemudian memimpin menit 13, setelah kapten Philipp Lahm menyambut umpan silang Ribery dengan sundulan yang tak bisa diselamatkan Pinto. Di akhir babak pertama, kiper Bayern Manuel Neuer menghalau upaya Sergio Roberto. Thomas Mueller yang bermain sebagai penyerang tunggal Bayern, membalasnya dengan menciptakan gol menjelang akhir babak pertama usai. Babak kedua formasi tim tamu berubah besar. Mandzukic menjadi salah satu dari 10 pemain baru yang dimasukkan. Striker asal Kroasia itu kemudian memantapkan kemenangan FC Hollywood menit 87. (m15/ant/afp/sky)

Titel Atletico Tuah Ronaldinho AP

PENYERANG Panama Blas Perez (7) memenangkan laga udara melawan dua pemain Mexico di Cowboys Stadium, Arlington, Texas, Kamis (25/7) pagi WIB.

Panama Lawan Final Paman Sam TEXAS, AS ( Wa s p a d a ) : Landon Donovan mencetak dua gol untuk membawa Amerika Serikat maju ke final Piala Emas 2013 Concacaf kelima kali secara beruntun, setelah mengalahkan Honduras 3-1, Kamis (25/7) pagi WIB. Panama menjadi lawan tim tuan rumah Paman Sam pada partai puncak di Soldier Field, Chicago, Senin (29/7) mendatang. Ini merupakan final Piala Emas pertama bagi Panama sejak 2005, saat mereka kalah dari AS. Blas Perez cs menembus partai puncak pasca menjinakkan juara bertahan dua kali Mexico dengan skor 2-1 pada partai semifinal lainnya. Mexico lebih mendominasi pertandingan, namun Panama mampu bermain efektif.

Panama juga lebih baik dalam menyelesaikan peluang dan mencetak gol pertama melalui Blas Perez menit 13. Sombrero sempat menyamakan kedudukan menit 26 lewat gol yang dicetak Luis Montes menit 26. Namun kemudian Roman Torres memastikan tiket final Panama dengan golnya menit 61 di Cowboys Stadium, Arlington, Texas. Sebelumnya di tempat sama, kemenangan 10 kali berturut-turut bagi Paman Sam dirilis berkat inspirasi striker Donovan, yang telah mencetak tiga gol di turnamen ini. Donovan juga turut merancang empat gol lainnya pada dua pertandingan terakhir pasukan Juergen Klinsmann. Setelah kalah pada dua final terakhir Piala Emas atas Mexico tahun 2009 dan 2011, penampilan anak-anak Sam Army’

Hasil Semifinal AS vs Honduras Mexico vs Panama

3-1 1-2

saat ini begitu menjanjikan. Khususnya Donovan, sehingga memungkinkan mereka memperbaiki prestasi di final nanti. Donovan membantu AS mengawali duel semifinal dengan bagus, ketika dia merancang gol pertama timnya yang dicetak Eddie Johnson menit 11. Dia sendiri kemudian menambah gol kedua bagi Paman Sam menit 27. Honduras memperkecil ketertinggalan menit 52 melalui gol yang dicetak Nery Media. Namun satu menit kemudian, Donovan kembali menambah keunggulan untuk memastikan kemenangan pasukan Klinsmann. (m15/ant/rtr/afp)

RIO DE JANEIRO (Waspada): Atletico Mineiro berhasil menjuarai Piala Libertadores, Kamis (25/7) pagi WIB, setelah mengalahkan juara tiga kali Olimpia 4-3 melalui drama adu penalti pada laga final leg kedua. Kalah 0-2 pada leg pertama di Asuncion pekan lalu, Atletico mengganas saat gantian menjadi tuan rumah pada leg kedua di Belo Horizonte. Titel pertama kejuaraan bergengsi di Amerika Selatan itu lantas diraih, tak terlepas dari tuah bintang baru Ronaldinho Gaucho. “Ini gelar yang saya rindukan. Saya kembali ke Brazil memang untuk ini,” tutur Ronaldinho. “Setiap orang mengatakan saya sudah berakhir, sekarang mereka mau bilang apa lagi,” tambah mantan bintang Barcelona dan AC Milan berusia 33 tahun tersebut. Jo membuka keunggulan Atletico menit 46. Kedudukan agregat menjadi imbang 2-2, ketika bek tengah Leonardo Silva menambahkan gol bagi klubnya tiga menit menjelang bubaran waktu normal. Leonardo menjadi bintang kemenangan karena mencetak

Swedia Sebatas Sulitkan Srikandi Panser GOTHENBURG (Waspada): Juara bertahan Jerman, Kamis (25/7) dinihari WIB, mendapat perlawanan sengit dari tuan rumah Swedia pada laga semifinal Piala Eropa Putri 2013. Tetapi putri Viking Kuning hanya sebatas menyulitkan saja bagi Srikandi Panser, yang akhirnya berhasil menang 1-0 dan maju ke final untuk menjajal pemenang semifinal lainnya antara Norwegia kontra Denmark. Sejak pluit awal berbunyi, kelihatan tinggal tunggu waktu saja bagi Swedia untuk memasukkan gol ke gawang tamunya di Gothenburg. Tapi malah juara Eropa tujuh kali Jerman yang berhasil menjebol gawang lawannya menit 33 melalui Dzsenifer Maroszan. Tim tuan rumah sebenarnya mendominasi permainan dan beberapa kali mendapat

peluang mendekat ke gawang lawan. Namun semua kesempatan itu tidak dapat diselesaikan dengan sempurna. Maroszan kemudian memukul balik mereka. Memanfaatkan umpan panjang dari Anja Mittag. Maroszan melesatkan bola dengan cepat kendati berada dalam tekanan lawan. Kiper Kristin Hammarstrom gagal menjinakkan bola yang melaju datar ke dalam ruang penjagaannya. Setelah mendapat sambutan hebat dari penonton, Swedia melakukan serangan bertubi-tubi dan dua kali berjuang mati-matian ketika gol Maroszan nyaris bertambah. Lotta Schelin menjebol gawang Srikandi Panser ketika laga berlangsung satu jam, tetapi wasit menganulirnya karena Annike Krahn dikasari pemain tuan rumah. Josefin Oqvist lantas mela-

AP

BINTANG kemenangan Jerman Dzenifer Marozsan (bawah) dikerumuni rekan-rekannya pasca membobol gawang Swedia di Gamla Ullevi, Gothenburg, Kamis (25/7) dinihari WIB. kukan gebrakan dan membuat kedudukan nyaris imbang, tapi ternyata bola terjangannya ma-

sih menerpa tiang gawang dan mental keluar garis. (m15/ant/rtr)

gol lagi saat adu penalti sebagai eksekutor keempat Atletico. Dia menuntaskan permainan, sebelum jatah tendangan penalti kelima bagi Olimpia yang dilakukan Matias Gimenez gagal dan 60.000 penonton langsung bersorak. Pemain Olimpia Julio Manzur diusir keluar lapangan menit 85, sehingga klub Paraguay itu terpaksa tempur dengan 10 pemain pada babak perpanjangan waktu. “Saya beruntung di final. Saya akan selamanya berterimakasih kepada fans atas dukungan mereka kepada saya,” klaim Ronaldinho. “Saya merasa seperti di rumah sejak tiba di Atletico. Para fans telah memberikan motivasi dan kami ingin melakukan semua yang kami bisa untuk membuat mereka bahagia,” beber mantan playmaker Brazil di Piala Dunia 2006 dan 2010 ter-

AP

PARA pemain Atletico Mineiro merayakan sukses mengangkat trofi Copa Libertadores pasca mengatasi Olimpia dari Paraguay pada final di Belo Horizonte, Brazil, Kamis (25/7) pagi WIB. sebut. Sukses Atletico merupakan kemenangan keempat secara

runkan formasi penuh di antaranya Cristiano Ronaldo, Mesut Ozil, dan Karim Benzema yang juga mantan bintang Lyon. Kedua tim yang sudah saling mengenal tipe permainan dengan baik setelah bertemu di Liga Champions selama 10 kali sejak 2005 itu menyajikan permainan yang enak ditonton. Clement Grenier membuat tuan rumah kegirangan setelah menciptakan gol pada menit 20 dari jarak jauh melewati Diego Lopez. Lisandro Lopez, dalam beberapa pekan ini diisukan bakal pindah, menggandakan keunggulan gol tujuh kali juara liga Prancis itu dari jarak dekat, sebelum kemudian Real bangkit ketika waktu tersisa 11 menit.

Gelandang Timnas Spanyol U-21, Alvaro Borja, sukses mengeksekusi tendangan penalti, sebelum Real menyamakan skor lewat pemain Brazil yang baru dikontrak Casemiro ketika waktu tinggal enam menit. “Ini adalah klub dengan sejarah yang luar biasa. Menjadi pelatih Real adalah sesuatu yang menakjubkan. Saya akan mencoba untuk melakukan yang terbaik untuk klub ini,” tegas mantan pelatih PSG itu. Zinedine Zidane juga merasakan kepuasannya bergabung di bawah kepelatihan Ancelotti. Zidane, menjabat sebagai Direktur Olahraga El Real, menganggap bahwa Don Carletto seperti seorang guru. (m33/goal/afp)

nia Antar Klub, Desember mendatang di Jepang. (m15/ant/rtr/ap)

Napoli Pesta Sambut Higuain NAPLES, Italia (Waspada): Napoli akhirnya memberi klarifikasi atas transfer Gonzalo Higuain. Bos Napoli, Aurelio De Laurentiis, menyatakan Higuain lulus tes medis berbarengan dengan Pepe Reina untuk kemudian diperkenalkan ke publik Kota Napoli, pekan depan. Bomber internasional Argentina itu resmi direkrut Il Partenopei dari Real Madrid dengan biaya transfer 37 juta euro. Sebelumnya, kabar itu sudah lebih dulu diperkuat komentar legenda Napoli dan Argentina, Diego Maradona, yang mengungkapkan kebahagiaannya atas kedatangan Higuain. Sebelumnya, pemain berjuluk El Pipita itu terlibat dalam pusaran gosip yang mengaitkannya dengan tiga klub, selain Napoli masih ada Juventus dan Arsenal. Tapi pada akhirnya, Napoli yang sukses mendapatkan tanda tangannya sebagai pengganti Edinson Cavani yang hengkang ke Paris Saint-Germain (PSG). Tak hanya terhadap Higuaín, De Laurentiis juga mengung-

keras, tapi kami takkan berhenti di sini! Forza Napoli!” pungkasnya.

AP

WARGA Naples heboh menyambut kedatangan Gonzalo Higuain yang direkrut dari Real Madrid, Kamis (25/7). kapkan kebahagiaannya atas kedatangan Reina. Kiper Liverpool itu diboyong Napoli dengan status pinjaman selama semusim. Diharapkan, keduanya sudah bisa tampil dalam laga pramusim Napoli kontra Galatasaray. “Higuain dan Reina telah lulus tes medis dan segera bergabung dengan skuad. Pada Senin malam, kami akan mengadakan selebrasi besar di San Paolo,” ujar De Laurentiis, Kamis (25/7).

Ancelotti Saksi Kebangkitan Real PARIS (Waspada): Pelatih Real Madrid, Carlo Ancelotti, menjadi saksi bangkitnya tim asuhannya setelah tertinggal dua gol saat sang pelatih kembali ke Prancis untuk menjalani laga melawan Lyon di Stade Gerland yang berkesudahan seri 2-2. “Ini malam yang indah. Sebuah laga yang hebat. Pada satu poin di musim ini, dengan 15 hari sesi latihan, tampak berbeda. Kami memiliki reaksi yang baik di periode kedua. Ini adalah pertandingan pemanasan yang bagus,” ucap Ancelotti, Kamis (25/7). Ancelotti, hengkang dari Paris Saint-Germain (PSG) setelah mempersembahkan gelar juara liga Prancis pada musim pertamanya, menu-

berturut-turut klub Brazil di Piala Libertadores. Altletico pun akan menjadi peserta Piala Du-

AP

DUET pelatih Real Madrid, Carlo Ancelotti dan Zinedine Zidane (kiri), diabadikan fotografer sesaat laga persahabatan melawan Olympique Lyon di Lyon, Kamis (25/7).

“Anda juga akan bisa mengetahui jersey-jersey baru, mendengarkan anthem baru klub dan bertemu cheerleaders Napoli. (Laga) Napoli-Galatasaray akan menjadi malam hebat yang akan diingat dalam sejarah kami. Kami telah bekerja

Dipuji Maradona Legenda Argentina, Diego Maradona, memuji keputusan Higuain untuk bergabung ke Napoli. Di saat bersamaan, Maradona juga mencibir pilihan Carlos Tevez yang merapat ke Juventus. “Mendengar kabar Higuain menjadi striker baru Napoli membuat saya bahagia dua kali. Saya yakin dia akan memberikan kepuasan bagi semua penggemar Napoli yang layak mendapat hormat dari sepakbola Italia dan Eropa,” kata Maradona. Perkataan Maradona ini juga bisa mengacu kepada Tevez yang notabene pemain Argentina. Carlitos memutuskan bergabung dengan Juventus, klub yang berbasis di kota Turin. (m33/fbi)

Korban Tendangan Gledek Ronaldo LONDON (Waspada): Seorang penggemar sepakbola berusia 11 tahun terkena tendangan bebas penuh tenaga dari Cristiano Ronaldo pada sebuah laga persahabatan pramusim saat bintang Real Madrid ini tak sengaja mencederai pergelangan tangan si bocah. Charlie Silverwood (foto), nama bocah itu, berdiri di belakang gawang dalam laga persahabatan Bournemouth melawan raksasa Spanyol tersebut di Stadion Goldsands milik klub itu ketika Ronaldo melepaskan tendangan keras yang mengarah kepada dirinya. “Itu adalah tendangan bebas pertama Ronaldo pada pertandingan tersebut. Tendangan itu mengarah langsung ke saya sehingga saya berusaha menahan bola dengan telapak tangan kiri saya dan kekuatan (tendangan itu). Saya kira bola menggetarkan tangan saya dan mematahkan pergelangan tangan,” kata

Reuters

Charlie kepada BBC, Kamis (25/7). “Adalah kesempatan langka menyaksikan Real Madrid bermain menghadapi klub lokal Anda, oleh karena itu saya tetap menonton sambil menahan rasa sakit,” lanjutnya. Merasa bersalah atas kejadian yang menimpa Silverwood, kubu Madrid memberikan satu kostum tim bertandatangan Ronaldo sebagai hadiah. (m33/bbc)


Sport

WASPADA Jumat 26 Juli 2013

A11

Tiket Palsu Buyar Mimpi Fans Tidak Bisa Masuk Stadion JAKARTA (Waspada): Menjelang laga BNI Indonesia All Star melawan Chelsea di Stadion Utama Gelora Bung Karno (SUGBK) Senayan, Jakarta, Kamis (25/7) malam, beberapa fans tidak bisa masuk ke dalam stadion. Pasalnya, mereka diduga membeli tiket palsu hingga gagal lolos pemeriksaan. Hal itu seperti dialami olah Putra Eka. Bocah berusia 9 tahun menangis di depan pintu masuk Sektor XIII ketika tahu dirinya tidak bisa menyaksikan langsung tim idolanya bertanding melawan Andik Vermansyah cs. Putra, diantar ibunya, ditolak panitia loket khusus tribun atas ketika tahu tiketnya palsu. “Saya beli titip teman saya di Jamsostek, tiga hari lalu. Tapi saat mau masuk nggak boleh,

karena nggak lolos scan,” kata Asriwin, 29 tahun. “Saya ini cuma nganterin anak saya yang pengen nonton, tapi ternyata tidak bisa masuk. Akhirnya saya mengandalkan oknum aparat untuk bisa masuk, katanya bayarnya Rp50 ribu,” lanjutnya. Selain Eka Putra, hal serupa dialami oleh Abi Novan. Abi, membeli tiket via online, mengaku tiketnya tidak bisa diterima karena hologramnya tidak asli. Kepada wartawan, Abi mengatakan lima tiketnya palsu, namun dua lainnya asli. Putra Eka dan Abi hanyalah segelintir pendukung Chelsea yang merasa tertipu oleh panitia akibat tiket palsunya meski membelinya di tempat penjualan yang resmi. Sebelumnya, puluhan orang berada di pusat

informasi untuk mengadukan masalah tiketnya. “Kata panitia, Insya Allah bisa masuk semua. Kami disuruh tunggu karena akan diusahakan bisa masuk,” kata penonton lainnya, Banter Istiadi Gunawan. Hasil pantauan, dperkirakan 50 ribu pendukung The Blues hadir di Stadion Utama Gelora Bung Karno untuk menyaksikan aksi John Terry cs. CEO Chelsea Indonesia Supporter Club (CISC), Junika Rahmat Ramadhon, menjelaskan tiket yang terjual sekitar 65 ribu. Jadi, kemungkinan sekira 40-50 ribu penonton hadir memadati stadion. Laga ini dijadikan pelatih Rahmad Darmawan sebagai persiapan untuk mengikuti SEA Games 2013 bagi tim junior dan

Antara

SUPORTER fanatik Chelsea asal Indonesia bakal memadati Stadion Utama Gelora Bung Karno Senayan, Jakarta, Kamis (25/7) malam. Pra Piala Asia 2015 untuk pemain senior. Setelah Indonesia, skuad besutan Jose Mourinho akan bertolak menuju

Amerika Serikat untuk persiapan pramusim dengan mengikuti turnamen mini. (m33/ant/kcm/ds)

Pemprovsu Tahan Mantan PSMS Laga Amal Untuk Alm Wibisono MEDAN (Waspada): PS Pemprovsu dan tim mantan pemain PSMS Medan bermain sama kuat 1-1 dalam laga amal mengenang almarhum Wibisono, mantan pemain Ayam Kinantan era 1970-an di Stadion Teladan Medan, Kamis (25/7). Pertandingan amal yang diprakarsai Sekdaprovsu Nurdin Lubis dan mantan pemain PSMS Parlin Siagian itu berlangsung seru. PS Pemprovsu, selain diperkuat Nurdin Lubis, juga didukung Anggota DPR RI Asrul Azwar, Sekretaris Disporasu Sakiruddin SE, dan sejumlah pejabat Pemprovsu lainnya. Tim mantan pemain PSMS diperkuat Samsuddin, Sugiar

(kiper), H Nobon, Sunardi A, Yongky, Sumardi, Sunarto, Julius Raja, H Sumantraji SH, Amrustian, Musimin, Edy Syaputra, Adi Sumarno, Yusli, Suwarno, Hamdardi, Syamsir Alamsyah, dan lainnya. PS Pemprovsu unggul lebih dulu lewat gol Asrul Azwar lewat tendangan jarak jauh sekira 30 meter dari gawang mantan PSMS yang dikawal Samsuddin.

Namun gol tersebut langsung dibalas tendangan bebas Julius Raja yang gagal diantisipasi Waluyo. Pascajeda babak pertama, kedua tim menggelar doa bersama untuk almarhum Wibisono. Dipimpin mantan pemain PSMS H Amansyah, pemain kedua tim khidmat berdoa di pinggir lapangan sebelum kembali melanjutkan babak kedua yang gagal melahirkan gol. Dalam kesempatan jeda babak pertama pula, sumbangan senilai Rp15 juta yang berhasil terkumpul dari laga amal tersebut langsung diserahkan oleh Sekda Provsu kepada istri almarhum Wibisono, Hj Asma

Indonesia Target Satu Gelar pbsi

JAKARTA (Waspada): Satu gelar juara di ajang World Championships 2013 dipandang sebagai target realistis bagi tim bulutangkis Indonesia. Hal ini diungkapkan Kepala Bidang Pembinaan dan Prestasi PBSI, Rexy Mainaky, di Pelatnas Cipayung, Kamis (25/7). “Kami menargetkan minimal meraih satu gelar juara di World Championships 2013,” kata Rexy yang merupakan juara dunia ganda putra tahun 1995 bersama Ricky Soebagdja. Ganda putra dan ganda campuran meru-

pakan dua nomor yang berpeluang besar menyumbangkan gelar. Sebanyak dua gelar Super Series Premier dan empat gelar Super Series diraih dua sektor ini pada tahun 2013. Hendra Setiawan/Mohammad Ahsan sejauh ini telah mengoleksi gelar di Malaysia dan Singapore Terbuka 2013 serta Djarum Indonesia Open Super Series Premier 2013. Sementara itu, Tontowi Ahmad/Liliyana Natsir (foto) kembali membawa gelar bergengsi All England 2013 ke tanah air setelah tahun lalu juga menjadi juara. Dua gelar lainnya diperoleh pasangan peringkat ketiga dunia ini dari India dan Singapore Terbuka. Untuk mewujudkan target tersebut, Rexy mengatakan bahwa tiap sektor mengadakan program latihan tambahan. “Di tunggal putri, Bellaetrix ditambah latihannya dengan mencoba pukulan-pukulan yang lebih spesifik. Begitu juga di ganda campuran. Masing-masing pelatih memberikan tambahan, dan ada analisis video pertandingan juga,” ujar Rexy. Dua tahun lalu, Indonesia hanya berhasil membawa dua medali perunggu lewat pasangan ganda campuran Tontowi Ahmad/Liliyana Natsir serta Mohammad Ahsan/Bona Septano di ganda putra. (m33/pbsi)

Problem Catur

TTS TOPIK

Putih melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2. 8

7

6

5

4

3

2

1 A

B

C

D

E

F

G

H

Hasibuan, didampingi ketiga anaknya. “Pertandingan amal ini kami gelar secara spontan untuk mengenang mantan pemain PSMS dan PSSI, Wibisono. Ini sebagai bentuk apresiasi atas jasa-jasa beliau saat mengangkat prestasi sepakbola Sumut, khususnya PSMS,” ujar Nurdin. Parlin Siagian mengucapkan terima kasih atas kehadiran mantan pemain dalam memeriahkan laga amal tersebut. Juga kepada Pemprov Sumut, terkhusus kepada Sekda Provsu yang turut menggagas acara.

Hj Asma Hasibuan mengaku terharu atas perhatian yang diberikan mantan pemain PSMS dan pihak Pemprovsu. Hj Asma merasa terharu almarhum suaminya tetap dikenang rekanrekan seperjuangan di PSMS dulu. “Seperti kita ketahui, selain menjadi pemain, almarhum Wibisono juga dikenal sebagai pelatih PSMS. Beliau bahkan sukses membawa tim Ayam Kinantan menjuarai Piala Perserikatan 1983,” timpal Ketua Panitia, Drs Azam Nasution MAP. (m42)

Sumsel Berharap ISG Tanpa Asap PALEMBANG (Waspada): Gubernur Sumatera Selatan, Alex Noerdin, minta kepada provinsi tetangga untuk tidak mengirimkan asap ke daerah ini terutama menjelang pelaksanaan Islamic Solidarity Games (ISG) di Palembang, 22 September hingga 1 Oktober 2013. “Bila ada kabut asap dikhawatirkan kedatangan tamu negara Islam nanti menjadi terhambat,” kata Alex saat pertemuan dalam rapat koordinsi siaga darurat bencana asap wilayah Sumatera di Palembang, Kamis (25/7). Apalagi tamu negara Islam nanti merupakan undangan kehormatan sehingga kabut asap akibat kebakaran hutan harus dihindari. Selain itu, saat pelaksanaan ISG diperkirakan musim kemarau sehingga rawan akan kebakaran hutan dan lahan. “Sehubungan itu, mari bersama-sama menjaga lingkungan termasuk hutan agar tidak terbakar saat pelaksanaan pesta olahraga bagi kalangan negara Islam itu,” imbuhnya. Berdasarkan pengalaman sewaktu SEA Games 2011, banyak hambatan yang dihadapi seperti musim kemarau saat pelaksanaan pembangunan sejumlah fasilias olahraga. Dia mengatakan, saat pelaksanaan pertandingan musim hujan tiba sehingga berbagai upaya dilakukan agar SEA Games sukses. “Alhamdulillah, pesta olahraga Asia Tenggara lalu berjalan lancar dan diharapkan ISG nanti lebih sukses. Namun, untuk mencapai sukses tersebut perlu dukungan bersama termasuk mengantisipasi timbulnya polusi asap,” tambahnya. Sumsel akan menyelenggarakan ISG diikuti ribuan peserta dari 25 negara yang telah menyatakan siap dengan mempertandingkan 14 cabang olahraga, di antaranya atletik, renang, bola voli, panahan, karate, dan wushu. (m42/ant)

SANT AP AN SANTAP APAN RAMADHAN

MENDATAR

1. Kejadian menyedihkan yang menimpa; Bencana. 5. Sesuatu yang dipakai Tuhan untuk menguji (ketabahan, iman dsb) 8. Bapak; ——Hurairah. 10. Salah satu cobaan yang menghapus dosa. 11. Pertolongan. 13. Agama yang diajarkan Nabi Muhammad SAW. 14. Huruf ke-18 abjad Arab. 15. Cukup waktu satu tahun untuk membayar zakat harta kekayaan; Peringatan hari wafat seseorang. 16. Huruf ke-8 abjad Arab. 18. Sesuatu yang sudah ditentukan oleh Tuhan atas diri seseorang. 20. Puasa. 22. Orang yang berkhotbah. 23. Shalat 40 di Masjid Nabawi selama delapan hari. 25. Al———, Yang Maha Esa, salah satu Asma’ul-Husna. 26. Nama bangsa di Timur Tengah. 27. Nama nabi, surat ke 11 Al Quran. 28. Kekal dalam masa lampau; Tidak bermula (Arab). 30. Pertolongan (Allah); —— dan hidayah. 33. Tuhan. 35. Abdi; Saya (untuk merendahkan diri). 36. Tidak halal.

Waspada/Dedi Riono

PS Pemprovsu dan tim mantan pemain PSMS diabadikan bersama sebelum melakoni laga amal untuk almarhum Wibisono, pemain Ayam Kinantan era 1970-an di Stadion Teladan Medan, Kamis (25/7).

Pasukan Blangkon Serbu GBK JAKARTA (Waspada): Pasukan suporter dengan menggunakan blangkon yang merupakan topi khas Yogjakarta menyerbu Stadion Utama Gelora Bung Karno Jakarta, Kamis (25/7), untuk menyaksikan pertandingan BNI Indonesia All Star melawan Chelsea. Meskimemakaiblangkonbukanberartimereka menggunakanbajulurikkhasYogjakarta,melainkan mengenakan kostum kebesaran Chelsea, klub asal Kota London yang berjuluk The Blues itu. Tidak seperti pasukan pada umumnya yang diisi kaum adam, pasukan yang datang langsung dari Kota Gudeg ini juga diperkuat oleh beberapa suporter perempuan yang juga memakai blangkon dengan berbagai corak. Pasukan yang didominasi pemuda ini terlihat cukup mencolok di areal stadion terbesar di Indonesia ini. Bahkan sebelum pintu X dibuka, pasukan berblangkon telah siap di pintu masuk berikut dengan tiket yang ada di tangan masingmasing suporter. Selain memakai blangkon dan menggunakan kostum kebesaran Chelsea, para pendukung setia tim asuhan Jose Mourinho ini tidak keting-

galan membawa syal dengan tulisan “Chelsea FC Supporter Club Indonesia” serta bendera. “Mumpung Chelsea sedang berada di Indonesia, makanya kami bela-belain datang ke sini,” kata salah seorang pasukan blangkon, Ega yang mengaku datang ke Jakarta tidak sendirian, melainkan dengan sekira 90 temannya yang semuanya berangkat dari Yogjakarta. Selain rombongan dari Yogjakarta, suporter dari berbagai daerah juga mulai memasuki areal Stadion Utama Gelora Bung Karno Jakarta. Mayoritas suporter ini menggunakan atribut klub asal London Inggris itu. Kedatangan juara Liga Champion Eropa musim 2011/2012 ini ke Indonesia merupakan yang pertama dalam sejarah. Kedatangan anak asuh Jose Mourinho ini menjadi kebangaan tersendiri bagi suporter fanatiknya asal Indonesia. Meski tidak ada pemain bintang seperti Fernando Torres, Juan Mata maupun Oscar, tim asal London ini tetap menjadi daya tarik sendiri. Apalagi masih ada beberapa nama besar seperti Frank Lampard dan John Terry yang menunjukkan kemampuan terbaiknya. (m42/ant)

Papua Belajar Dari Jawa Barat Persiapan Tuan Rumah PON 2020 JAYAPURA (Waspada): Ketua Panitia Pemenangan Papua menuju tuan rumah PON XX tahun 2020, Yusuf Yambe Yabdi, mengatakan pihaknya akan ke Jawa Barat untuk bertemu Panitia PON XIX/2016 guna mempelajari sejumlah hal terkait penyelenggaraan PON. “Hari ini kami bertolak ke Jakarta dengan sejumlah agenda yang di antaranya akan ke Jabar untuk melihat bagaimana persiapan-persiapan mereka dalam PON XIX tahun 2016,” katanya sebelum bertolak ke Jakarta, Kamis (25/7). Menurut dia, Provinsi Jawa Barat adalah tuan rumah PON XIX/2016 sehingga pihaknya ingin melihat lebih dekat apa saja yang dipersiapkan daerah tersebut, seperti cara menyusun jadwal pertandingan, penyiapan fasilitas olahraga yang memadai dan terintergrasi dengan satu sama lainnya. Termasuk bagaimana mempromosikan daerah dan media sebagai pencitraan pelaksanaan PON ke depannya. “Kami akan mencoba diskusikan tentang hal ini dengan pihak terkait di Provinsi Jabar. Sehingga ada tenaga kita yang bisa lakukan pendampingan saat dan sebelum

37. Al———, surat ke 18 Al Quran, artinya Gua.

MENURUN

1. Bangunan tempat shalat. 2. Suci; Keramat. 3. Sesuatu yang terdapat di dalam hati. 4. Hubungan antara manusia dan Allah (dua kata, tulis tanpa spasi). 6. Negara Islam di Asia Barat Daya beribukota Muskat. 7. Kelahiran seseorang; Kelahiran Isa. 9. ——bin Affan, sahabat Rasulullah. 12. Siksa Tuhan. 15. Perhitungan; Ahli——. 17. Beruntung (Arab), disarankan Nabi Muhammad agar tidak dijadikan nama orang. 19. Al———, surat ke-29 Al Quran, artinya Laba-Laba. 20. Kata; Perkataan (nabi, raja dsb). 21. Orang yang taat kepada Tuhan. 24. Huruf ke-10 abjad Arab. 25. Padang luas tempat wukuf. 27. Anak Abu Bakar penyimpan naskah kumpulan Al Quran asli Panitia Zaid. 29. Kejam; Tak adil. 31. Minuman keras. 32. Hakim agama. 34. Huruf ke-27 abjad Arab.

PON 2016 di daerah tersebut,” katanya. Menurut Yusuf, nantinya akan ada tenagatenaga asal Papua yang mendapatkan pemahaman baik dan benar tentang bagaimana menyiapkan dan menyelengarakan event seperti PON. “Sehingga ada pengalaman-pengalaman yang bisa didapat dalam persiapan PON 2020 nanti di Papua,” katanya. Selain itu, kata Yusuf, pihaknya akan membangun komunikasi dengan Pemprov Jateng, Jatim, dan DIY agar mendapatkan dukungan yang positif bagi Papua sebagai tempat penyelenggara PON XX pada 2020. “Selain itu, kita juga sudah berkomunikasi dengan sejumlah pihak terkait dari Pemprov DIY. Dan mereka bersedia datang ke Jakarta sekaligus berbuka puasa dengan KONI Pusat bersama kami dari Papua. Kemudian kita sampaikan keinginan kita untuk dapatkan dukungan setelah itu kita akan ke Jateng dan Jatim,” katanya. Terkait rencana ke Jakarta, Yusuf menyampaikan pihaknya bertemu dengan sejumlah petinggi KONI Pusat terkait usulan Papua sebagai tuan rumah PON 2020. (m42/ant)

Sudoku Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.

6 2 1 7 2 5 9 1 2 3 6 9 7 1

9

7 5

8

2 8 7 3

7 1 8 3 6 4 5 *****07


Sport

WASPADA Jumat 26 Juli 2013

A11

Tiket Palsu Buyar Mimpi Fans Tidak Bisa Masuk Stadion JAKARTA (Waspada): Menjelang laga BNI Indonesia All Star melawan Chelsea di Stadion Utama Gelora Bung Karno (SUGBK) Senayan, Jakarta, Kamis (25/7) malam, beberapa fans tidak bisa masuk ke dalam stadion. Pasalnya, mereka diduga membeli tiket palsu hingga gagal lolos pemeriksaan. Hal itu seperti dialami olah Putra Eka. Bocah berusia 9 tahun menangis di depan pintu masuk Sektor XIII ketika tahu dirinya tidak bisa menyaksikan langsung tim idolanya bertanding melawan Andik Vermansyah cs. Putra, diantar ibunya, ditolak panitia loket khusus tribun atas ketika tahu tiketnya palsu. “Saya beli titip teman saya di Jamsostek, tiga hari lalu. Tapi saat mau masuk nggak boleh,

karena nggak lolos scan,” kata Asriwin, 29 tahun. “Saya ini cuma nganterin anak saya yang pengen nonton, tapi ternyata tidak bisa masuk. Akhirnya saya mengandalkan oknum aparat untuk bisa masuk, katanya bayarnya Rp50 ribu,” lanjutnya. Selain Eka Putra, hal serupa dialami oleh Abi Novan. Abi, membeli tiket via online, mengaku tiketnya tidak bisa diterima karena hologramnya tidak asli. Kepada wartawan, Abi mengatakan lima tiketnya palsu, namun dua lainnya asli. Putra Eka dan Abi hanyalah segelintir pendukung Chelsea yang merasa tertipu oleh panitia akibat tiket palsunya meski membelinya di tempat penjualan yang resmi. Sebelumnya, puluhan orang berada di pusat

informasi untuk mengadukan masalah tiketnya. “Kata panitia, Insya Allah bisa masuk semua. Kami disuruh tunggu karena akan diusahakan bisa masuk,” kata penonton lainnya, Banter Istiadi Gunawan. Hasil pantauan, dperkirakan 50 ribu pendukung The Blues hadir di Stadion Utama Gelora Bung Karno untuk menyaksikan aksi John Terry cs. CEO Chelsea Indonesia Supporter Club (CISC), Junika Rahmat Ramadhon, menjelaskan tiket yang terjual sekitar 65 ribu. Jadi, kemungkinan sekira 40-50 ribu penonton hadir memadati stadion. Laga ini dijadikan pelatih Rahmad Darmawan sebagai persiapan untuk mengikuti SEA Games 2013 bagi tim junior dan

Antara

SUPORTER fanatik Chelsea asal Indonesia bakal memadati Stadion Utama Gelora Bung Karno Senayan, Jakarta, Kamis (25/7) malam. Pra Piala Asia 2015 untuk pemain senior. Setelah Indonesia, skuad besutan Jose Mourinho akan bertolak menuju

Amerika Serikat untuk persiapan pramusim dengan mengikuti turnamen mini. (m33/ant/kcm/ds)

Pasukan Blangkon Serbu GBK

Waspada/Dedi Riono

PS Pemprovsu dan tim mantan pemain PSMS diabadikan bersama sebelum melakoni laga amal untuk almarhum Wibisono, pemain Ayam Kinantan era 1970-an di Stadion Teladan Medan, Kamis (25/7).

Pemprovsu Tahan Mantan PSMS MEDAN (Waspada): PS Pemprovsu dan tim mantan pemain PSMS Medan bermain sama kuat 1-1 dalam laga amal mengenang almarhum Wibisono, mantan pemain Ayam Kinantan era 1970-an di Stadion Teladan Medan, Kamis (25/7). Pertandingan amal yang diprakarsai Sekdaprovsu Nurdin Lubis dan mantan pemain PSMS Parlin Siagian itu berlangsung seru. PS Pemprovsu, selain diperkuat Nurdin Lubis, juga didukung Anggota DPR RI Asrul Azwar, Sekretaris Disporasu

Sakiruddin SE, dan sejumlah pejabat Pemprovsu lainnya. Tim mantan pemain PSMS diperkuat Samsuddin, Sugiar (kiper), H Nobon, Sunardi A, Yongky, Sumardi, Sunarto, Julius Raja, H Sumantraji SH, Amrustian, Musimin, Edy Syaputra,

Adi Sumarno, Yusli, Suwarno, Hamdardi, Syamsir Alamsyah, dan lainnya. PS Pemprovsu unggul lebih dulu lewat gol Asrul Azwar lewat tendangan jarak jauh sekira 30 meter dari gawang mantan PSMS yang dikawal Samsuddin. Namun gol tersebut langsung dibalas tendangan bebas Julius Raja yang gagal diantisipasi Waluyo. Pascajeda babak pertama, kedua tim menggelar doa bersama untuk almarhum Wibisono. Dipimpin mantan pemain

PSMS H Amansyah, pemain kedua tim khidmat berdoa di pinggir lapangan sebelum kembali melanjutkan babak kedua yang gagal melahirkan gol. Dalam kesempatan jeda babak pertama pula, sumbangan senilai Rp15 juta yang berhasil terkumpul dari laga amal tersebut langsung diserahkan oleh Sekda Provsu kepada istri almarhum Wibisono, Hj Asma Hasibuan, didampingi ketiga anaknya. “Pertandingan amal ini kami gelar secara spontan untuk me-

ngenang mantan pemain PSMS dan PSSI, Wibisono. Ini sebagai bentuk apresiasi atas jasa-jasa beliau saat mengangkat prestasi sepakbola Sumut, khususnya PSMS,” ujar Nurdin. Parlin Siagian mengucapkan terima kasih atas kehadiran mantan pemain dalam memeriahkan laga amal tersebut. Juga kepada Pemprov Sumut, terkhusus kepada Sekda Provsu yang turut menggagas acara. Hj Asma Hasibuan mengaku terharu atas perhatian yang diberikan mantan pemain PSMS dan pihak Pemprovsu. Hj Asma merasa terharu almarhum suaminya tetap dikenang rekanrekan seperjuangan di PSMS. “Seperti kita ketahui, selain menjadi pemain, almarhum Wibisono juga dikenal sebagai pelatih PSMS. Beliau bahkan sukses membawa tim Ayam Kinantan menjuarai Piala Perserikatan 1983,” timpal Ketua Panitia, Drs Azam Nasution MAP. (m42)

JAKARTA (Waspada): Pasukan suporter dengan menggunakan blangkon yang merupakan topi khas Yogjakarta menyerbu Stadion Utama Gelora Bung Karno Jakarta, Kamis (25/7), untuk menyaksikan pertandingan BNI Indonesia All Star melawan Chelsea. Meskimemakaiblangkonbukanberartimereka menggunakanbajulurikkhasYogjakarta,melainkan mengenakan kostum kebesaran Chelsea, klub asal Kota London yang berjuluk The Blues itu. Tidak seperti pasukan pada umumnya yang diisi kaum adam, pasukan yang datang langsung dari Kota Gudeg ini juga diperkuat oleh beberapa suporter perempuan yang juga memakai blangkon dengan berbagai corak. Pasukan yang didominasi pemuda ini terlihat cukup mencolok di areal stadion terbesar di Indonesia ini. Bahkan sebelum pintu X dibuka,

pasukan berblangkon telah siap di pintu masuk berikut dengan tiket yang ada di tangan. Selain memakai blangkon dan menggunakan kostum kebesaran Chelsea, para pendukung setia tim asuhan Jose Mourinho ini tidak keting-galan membawa syal dengan tulisan “Chelsea FC Supporter Club Indonesia” serta bendera. “Mumpung Chelsea sedang berada di Indonesia, makanya kami bela-belain datang ke sini,” kata salah seorang pasukan blangkon, Ega yang mengaku datang ke Jakarta tidak sendirian, melainkan dengan sekira 90 temannya yang semuanya berangkat dari Yogjakarta. Selain rombongan dari Yogjakarta, suporter dari berbagai daerah juga mulai memasuki areal Stadion Utama Gelora Bung Karno Jakarta. Mayoritas suporter ini menggunakan atribut klub asal London Inggris itu. (m42/ant)

Indonesia Target Satu Gelar pbsi

JAKARTA (Waspada): Satu gelar juara di ajang World Championships 2013 dipandang sebagai target realistis bagi tim bulutangkis Indonesia. Hal ini diungkapkan Kepala Bidang Pembinaan dan Prestasi PBSI, Rexy Mainaky, di Pelatnas Cipayung, Kamis (25/7). “Kami menargetkan minimal meraih satu gelar juara di World Championships 2013,” kata Rexy yang merupakan juara dunia ganda putra tahun 1995 bersama Ricky Soebagdja. Ganda putra dan ganda campuran meru-

pakan dua nomor yang berpeluang besar menyumbangkan gelar. Sebanyak dua gelar Super Series Premier dan empat gelar Super Series diraih dua sektor ini pada tahun 2013. Hendra Setiawan/Mohammad Ahsan sejauh ini telah mengoleksi gelar di Malaysia dan Singapore Terbuka 2013 serta Djarum Indonesia Open Super Series Premier 2013. Sementara itu, Tontowi Ahmad/Liliyana Natsir (foto) kembali membawa gelar bergengsi All England 2013 ke tanah air setelah tahun lalu juga menjadi juara. Dua gelar lainnya diperoleh pasangan peringkat ketiga dunia ini dari India dan Singapore Terbuka. Untuk mewujudkan target tersebut, Rexy mengatakan bahwa tiap sektor mengadakan program latihan tambahan. “Di tunggal putri, Bellaetrix ditambah latihannya dengan mencoba pukulan-pukulan yang lebih spesifik. Begitu juga di ganda campuran. Masing-masing pelatih memberikan tambahan, dan ada analisis video pertandingan juga,” ujar Rexy. Dua tahun lalu, Indonesia hanya berhasil membawa dua medali perunggu lewat pasangan ganda campuran Tontowi Ahmad/Liliyana Natsir serta Mohammad Ahsan/Bona Septano di ganda putra. (m33/pbsi)

PBSI Sumut Berupaya Jadi Terbaik Waspada/Armansyah Th

FOTO kiri: IJECK (kiri) menyampaikan kata sambutan saat buka puasa bersama IMI Sumut. FOTO kanan: Kabid OR Pengprov IMI Sumut Kisharianto SSos (2 kanan) menyerahkan bantuan sembako didampingi John Ismadi Lubis dan Drs H Zulhifzi Lubis di Medan, Kamis (25/7).

IMI Sumut Bagikan Sembako Buka Bersama Pererat Silaturahim MEDAN (Waspada): Pengprov IMI Sumut menggelar bakti sosial (baksos) menyambut bulan suci Ramadhan 1434 H dengan penyerahan bingkisan sembako kepada kaum duafa dan warga kurang mampu di sekitar Sekretariat IMI Sumut di Jl Taruma, Kel Petisah Tengah, Medan, Kamis (25/7). Penyaluran sembako diserahkan Kabid Olahraga Pengprov IMI Sumut, Kisharianto Pasaribu SSos, mewakili Ketua Pengprov IMI Sumut, Ijeck. Ikut hadir di antaranya Ketua Harian Pengprov IMI Sumut John Ismadi Lubis dan Sekretaris Drs

H Zulhifzi Lubis. Menurut Kisharianto, ada 100 paket sembako yang antara lain berisi beras, gula, dan minyak goreng. Paket sembako itu disalurkan kepada warga kurang mampu, khususnya di Lingkungan III dan IV. “Baksos di bulan Ramadhan merupakan kegiatan rutin yang digelar Pengprov IMI Sumut. Kita ingin berbagi dan sekaligus bersilaturahim dengan warga sekitar yang telah dianggap sebagai bagian keluarga besar IMI Sumut,” ucap Kisharianto. “Ketua Pengprov IMI juga ingin berbagi dalam menyam-

Problem Catur

TTS TOPIK

Putih melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2. 8

7

6

5

4

3

2

1 A

B

C

D

E

F

but Ramadhan yang indah ini dan beliau berharap warga Medan senantiasa dapat menjalankan ibadah puasa dengan nyaman dan lebih khusyuk lagi,” tambah Zulhifzi. Pada Kamis (25/7) malam, Pengprov IMI Sumut menggelar kegiatan buka puasa bersama bertempat di Medan Club, Jl Kartini Medan. Acara buka puasa bersama ini dihadiri Ketua Pengprov IMI Sumut, Ijeck, bersama klub-klub anggota IMI Sumut, klub balap, komunitas roda dua dan empat, wartawan olahraga yang bergabung dalam Siwo PWI Sumut serta unda-

G

H

ngan. Para undangan tersebut di antaranya ada Pangdam I/BB Mayjen TNI Burhanuddin Siagian, Kadispora Sumut Khairul Lubis, Kadispora Medan Abdul Aziz, Kasat PJR Dirlantas Poldasu AKBP Endang, Ketua XTrim Indonesia Doddy, dan lainnya. Dalam acara yang berlangsung penuh keakraban ini, Ijeck mengatakan rasa syukurnya karena bisa kembali berkumpul bersama di bulan Ramadhan sembari mempererat tali silaturahim yang telah terjalin. (m47)

SANT AP AN SANTAP APAN RAMADHAN

MEDAN (Waspada): Pengprov PBSI Sumut berupaya menjadi yang terbaik dari sisi penyelenggaraan sebagai tuan rumah maupun prestasi dalam Kejuaraan Bulutangkis Sirkuit Nasional (Sirnas) Djarum LiNing Piala Gubsu pada 9-14 September mendatang di Gedung Serba Guna, Jl Pancing Medan. Demikian disampaikan Ketua Umum Pengprov PBSI Sumut, Ir Johannes IW, pada acara buka puasa bersama yang digelar PT Sumpratama Juru Enginering di Kompleks Kawasan Industri Medan (KIM) II Mabar, Medan, Kamis (25/7) malam. Menurutnya, Pengprov PBSI Sumut telah bersiap sebagai tuan rumah dengan mempergunakan Gedung Serba Guna dengan 12 lapangan dan berkapasitas 7.500 penonton. PBSI Sumut juga berharap kepada Pengkab dan Pengkot PBSI serta klub se Sumut dapat mengirimkan atlet terbaik da-

lam event nasional yang diikuti atlet-atlet Pelatnas. Pada 1-6 Juli lalu, atlet pelajar PPLP Sumut berhasil meraih runner-up pada Kejuaraan Nasional Pusat Pendidikan Latihan Pelajar (PPLP) di Banyuasin, Sumsel. Pada event beregu putra itu, Sumut di bawah pelatih Hendra Gunawan harus mengakui keunggulan Jawa Timur di final. Atlet yang berhasil meraih runner-up itu adalahYufi Jirganda (Medan), M Bima Akbar (Binjai), dan M Bayu Dhini (Medan). Pada ksempatan itu, PBSI Sumut menyerahkan bantuan berupa peralatan olahraga kepada atlet Pelatda PBSI Sumut serta bantuan kepada sesepuh bulutangkis Sumut era tahun 1960an, Burhanuddin. Ketua Umum KONI Sumut, H Gus Irawan Pasaribu, memberikan aplaus kepada Ketua Umum Pengprov PBSI Sumut yang rutin melaksanakan silaturahim insan olahraga khusus-

MENDATAR

37. Al———, surat ke 18 Al Quran, artinya Gua.

1. Kejadian menyedihkan yang menimpa; Bencana. 5. Sesuatu yang dipakai Tuhan untuk menguji (ketabahan, iman dsb) 8. Bapak; ——Hurairah. 10. Salah satu cobaan yang menghapus dosa. 11. Pertolongan. 13. Agama yang diajarkan Nabi Muhammad SAW. 14. Huruf ke-18 abjad Arab. 15. Cukup waktu satu tahun untuk membayar zakat harta kekayaan; Peringatan hari wafat seseorang. 16. Huruf ke-8 abjad Arab. 18. Sesuatu yang sudah ditentukan oleh Tuhan atas diri seseorang. 20. Puasa. 22. Orang yang berkhotbah. 23. Shalat 40 di Masjid Nabawi selama delapan hari. 25. Al———, Yang Maha Esa, salah satu Asma’ul-Husna. 26. Nama bangsa di Timur Tengah. 27. Nama nabi, surat ke 11 Al Quran. 28. Kekal dalam masa lampau; Tidak bermula (Arab). 30. Pertolongan (Allah); —— dan hidayah. 33. Tuhan. 35. Abdi; Saya (untuk merendahkan diri). 36. Tidak halal.

MENURUN

1. Bangunan tempat shalat. 2. Suci; Keramat. 3. Sesuatu yang terdapat di dalam hati. 4. Hubungan antara manusia dan Allah (dua kata, tulis tanpa spasi). 6. Negara Islam di Asia Barat Daya beribukota Muskat. 7. Kelahiran seseorang; Kelahiran Isa. 9. ——bin Affan, sahabat Rasulullah. 12. Siksa Tuhan. 15. Perhitungan; Ahli——. 17. Beruntung (Arab), disarankan Nabi Muhammad agar tidak dijadikan nama orang. 19. Al———, surat ke-29 Al Quran, artinya Laba-Laba. 20. Kata; Perkataan (nabi, raja dsb). 21. Orang yang taat kepada Tuhan. 24. Huruf ke-10 abjad Arab. 25. Padang luas tempat wukuf. 27. Anak Abu Bakar penyimpan naskah kumpulan Al Quran asli Panitia Zaid. 29. Kejam; Tak adil. 31. Minuman keras. 32. Hakim agama. 34. Huruf ke-27 abjad Arab.

Waspada/Setia Budi Siregar

KETUA Umum Pengprov PBSI Sumut Ir Johannes IW didampingi Penasehat PBSI Sumut Mayjen TNI (Purn) Ricardo Siagian, Ketua Umum KONI Sumut H Gus Irawan Pasaribu sesuai menyerahkan bantuan kepada sesepuh bulutangkis Sumut pada acara buka puasa bersama, Kamis (25/7) malam. nya bukutangkis pada acara berbuka puasa bersama. Penasehat PBSI Sumut, Mayjen TNI Ricardo Siagian, berharap penyelenggaraan Sirnas di di Medan dapat memacu semangat para pebulutangkis Sumut untuk terus mengasah prestasi. Acara tersebut turut menyediakan bingkisan untuk

anak yatim dan bantuan kepada masjid di sekitar Kawasan Industri Medan. Turut hadir Anggota DPRD Sumut Sonny Firdaus SH, Kadispora Sumut diwakili Drs Darwis Siregar, Wakil Ketua II KONI Sumut Prof Agung Surnarno, dan sejumlah Ketua Pengkab Pengkot PBSI se Sumut. (m18)

Sudoku Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.

6 2 1 7 2 5 9 1 2 3 6 9 7 1

9

7 5

8

2 8 7 3

7 1 8 3 6 4 5 *****07


A12

Sport

WASPADA Jumat, 26 Juli 2013

Pasang Iklan

motogp

Pedrosa Patah Tulang Selangka BARCELONA, Spanyol (Waspada): Pebalap Repsol Honda, Dani Pedrosa (foto), mengungkapkan perkembangan terbaru mengenai cederanya. Hal itu diungkapkannya usai menjalani pemeriksaan lanjutan di Barcelona. Pedrosa mengalami kecelakaan di latihan bebas III MotoGP Jerman, 13 Juli lalu. Rider berusia 27 tahun itu didiagnosis mengalami retak tulang selangka dan sakit di bagian kepala. Pedrosa kemudian memutuskan untuk tidak tampil di Sach-

senring. Namun, pemeriksaan lanjutan menyatakan Pedrosa patah tulang lengkap dan cedera bahu. “Tentunya hal yang penting untuk mengetahui bagaimana kondisi tulang selangka saya. Hasil tes terakhir dengan 3D CT scan, menunjukkan lebih banyak dibandingkan tes pertama, karena pembengkakan dan visibilitas cedera. Tes terakhir menunjukkan patah tulang lengkap,” kata Pedrosa, Kamis (25/7). “Hal kunci bukan mengenai patah tulang. Ini tak akan membuat saya keluar perlombaan dan takmembutuhkanoperasi.Iniberita yang cukup baik dan dalam dua minggu ke depan saya akan kembali melakukan check-up. Saya akan melakukan serangkaian terapi selama liburan untuk agar bisa pulih tepat waktu di Indianapolis,” tekadnya. Pedrosa kini menempati posisi kedua klasemen MotoGP, tertinggal 16 poin dari rekan setimnya, Marc Marquez. (m33/mgp)

Modal Hamilton BUDAPEST (Waspada): Lewis Hamilton adalah salah satu pebalap Formula One (F1) musim ini yang tengah mengalami krisis kemenangan. Sembilan seri berjalan, hasil terbaiknya adalah tiga kali finish ketiga di GP Malaysia, China, dan Kanada. Juara dunia 2008 tersebut sementara masih tertahan di peringkat empat klasemen, kalah dari Sebastian Vettel (Red Bull), Fernando Alonso (Ferrari), dan Kimi Raikkonen (Lotus). Jelang GP Hungaria akhir pekan nanti, Hamilton memupuk harapan tinggi untuk naik podium tertinggi. Pasalnya, pebalap Mercedes ini punya sejarah bagus di Hungaroring, yakni tiga kali juara. “Saya selalu menikmati balapan di Hungaroring. Ini lintasan di mana saya cukup beruntung dengan meraih tiga kali kemenangan,” kata Hamilton, Kamis (25/7). “Ini akan jadi akhir pekan yang penting bagi kami. Kami harus melakukan start dengan baik pada sesi kualifikasi saat mendapat kesempatan mencoba ban baru untuk pertama kali,” ucapnya lagi. Pebalap berusia 28 tahun ini juara di Hungaroring pada 2007, 2009, dan 2012, dua di anta-ranya dari pole position. Catatan ini hanya tertinggal satu keme-nangan dari rekor Michael Schu-macher yang meraih empat kemenangan di sirkuit yang memiliki 14 tikungan tersebut. (m33/auto)

Telp. 4528431 HP. 081370328259 Email: iklan_waspada@yahoo.co.id


Sumatera Utara

WASPADA Jumat 26 Juli 2013

Kota

Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:33 12:47 12:34 12:41 12:41 12:38 12:34 12:30 12:37 12:36

15:57 16:10 15:58 16:05 16:04 16:02 15:58 15:54 16:00 16:00

Magrib 18:43 18:59 18:44 18:53 18:52 18:44 18:43 18:38 18:46 18:47

‘Isya

Imsak

Shubuh Syuruq

Kota

19:56 20:12 19:57 20:06 20:05 19:56 19:56 19:51 20:59 20:00

04:53 05:03 04:53 04:58 04:58 04:01 04:54 04:50 04:56 04:54

05:03 05:13 05:03 05:08 05:08 05:11 05:04 05:00 05:06 05:04

L.Seumawe 12:40 L. Pakam 12:33 Sei Rampah12:32 Meulaboh 12:44 P.Sidimpuan12:31 P. Siantar 12:32 Balige 12:32 R. Prapat 12:29 Sabang 12:47 Pandan 12:33

06:22 06:33 06:23 06:28 06:28 06:30 06:24 06:19 06:25 06:24

Zhuhur ‘Ashar 16:03 15:56 15:56 16:07 15:55 15:56 15:56 15:53 16:10 15:57

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur

‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:51 18:42 18:41 18:54 18:37 18:40 18:39 18:36 18:59 18:40

20:04 19:55 19:54 20:07 19:50 19:53 19:52 19:49 20:13 19:52

04:56 04:52 04:51 04:02 04:54 04:52 04:53 04:50 04:02 04:55

05:06 05:02 05:01 05:12 05:04 05:02 05:03 05:00 05:12 04:05

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:33 12:34 12:44 12:37 12:34 12:41 12:29 12:39 12:32 12:32

18:40 18:43 18:56 18:45 18:44 18:51 18:38 18:48 18:40 18:41

19:52 19:55 20:09 19:57 19:56 20:04 19:50 20:01 19:52 19:53

04:55 04:55 05:01 04:58 04:53 04:58 04:49 04:59 04:54 04:51

05:05 05:05 05:11 05:08 05:03 05:08 04:59 05:09 05:04 05:01

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:30 12:37 12:35 12:30 12:32 12:30 12:29 12:39 12:33 12:28 12:29

15:54 16:01 16:59 15:54 15:56 15:53 15:53 16:02 15:57 15:52 15:53

18:35 18:42 18:43 18:39 18:40 18:36 18:35 18:50 18:41 18:35 18:37

19:48 19:54 19:55 19:52 19:53 19:48 19:47 20:04 19:53 19:47 19:50

04:53 04:01 04:56 04:50 04:53 04:52 04:53 04:56 04:55 04:50 04:50

05:03 05:11 05:06 05:00 05:03 05:02 05:03 05:06 05:05 05:00 05:00

06:26 06:21 06:20 06:31 06:23 06:21 06:22 06:19 06:32 06:24

15:57 15:58 16:08 16:01 15:58 16:04 15:53 16:03 15:56 15:55

06:24 06:24 06:30 06:28 06:23 06:28 06:19 06:28 06:23 06:21

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:22 06:30 06:25 06:20 06:22 06:21 06:21 06:26 06:24 06:19 06:20

Kajari Ultimatum DPRD Langkat Ngogesa Santuni Bilal Mayit Rp325 Juta Kembalikan Dana Perjalanan Fiktif Setelah Sekwan, Mantan Sekwan Jadi Tersangka Korupsi Rp27 M STABAT (Waspada): Kepala Kejaksaan Negeri Stabat (Kajari), Hendri, SH, mengultimatum para wakil rakyat, yaitu para anggota DPRD Langkat yang terlibat perjalanan dinas fiktif, untuk mengembalikan kerugian keuangan negara tersebut. “Ini langkah preventif kita, sebab jika tidak, ancaman hukumannyaakanlebihberatdanharta benda terkait hasil korupsi akan disita,”tegasKajariHendri,SH,menjawab Waspada, Kamis (25/7). Sementara terkait korupsi biaya perjalanan dinas para wakil rakyat tahun 2012/2013 senilai Rp27 miliar, pihak penyidik Kejari StabatawalJulilalutelahmenetapkan mantan Sekwan (Sekretaris Dewan), SU, menjadi tersangka, menyusul status tersangka yang ditetapkanKejarikepadaSekwan, SL sebelumnya. “Kita tetapkan SU sebagai tersangka dan tidak tertutup kemungkinan tersangka akan ber-

tambah, tergantung perkembangan penyidikan,” tegas Kajari sambil menjelaskan, SU dinilai turut bertanggungjawab atas pengelolaan dana perjalanan dinas para politisi di DPRD Langkat, sekaligus sebagai peneliti tiket perjalanan kunjungan kerja pada Januari sampai Juli 2012. Sementara peranan SL yang telah ditetapkan tersangka sebelumnya selaku penerus jabatan Sekretaris DPRD, melanjutkan kebijakan yang menyimpang. “Penyidikan terus berlangsung, apakah nantinya sejumlah politisi juga terlibat dan dijadikan tersangka, masih didalami. Beragam bukti penyimpangan telah

kita miliki seperti adanya perjalanan dinas fiktif yang tidak ada dalam database maskapai penerbangan tentang keberangkatan anggota dewan. Ada juga bentuk penyimpangan lain bahkan keterlibatanpihakketigayangbelum dapatdiuraikandemike-pentingan penyidikan,” tambah Kajari. Meskimasihmenungguhasil audit BPKP Sumut terkait kerugiannegara,penyidiksudahdapat menyimpulkan kerugian negara dalam perjalanan dinas tersebut lebih Rp1,5 miliar. Menurut Kajari, sesuai hasil penelusuran, biaya perjalanan dinas DPRD Langkat paling besar dibanding daerah lainnya di Sumut. Penyidik menjadwalkan akan mulai memeriksa para anggota dewan sebagai saksi setelah 12 Agustus mendatang. Berbagai keterangan dihimpunsebagaimanadiakuipenyidik, sebelumnya dalam perjalanan

dinas para politisi ke luar provinsi banyakdiwarnaikritikan.Pasalnya ada anggota dewan yang tidak ikut dalam kunjungan kerja namun tetap mencairkan uang transportasi. Ada juga PNS di sana yang memiliki jadwal ikutserta namun digantikan keluarganya. Selain itu ada pengawal oknum Ketua DPRD yang turut dalam kunjungan kerja ke luar provinsi namun menggunakan identitas PNS di Sekretariat. Sementara versi penyidik, bahkan ada pemotonganbiayatanpamaksud jelas dalam setiap studi banding. Geledah DPRD Dalam kasus ini, pihak penyidik Kejari juga menggeledah sejumlahruangandiDPRDLangkat dan menyita enam kardus berkas terkait laporan pelaksanaan kegiatan hasil kunjungan kerja parawakilrakyat,Kamis(25/7)pagi. Penggeledahandimulaipukul 10:00 dan berakhir pukul 13:00.

PT CPM Bantah Rambah Ribuan Batang Mangrove P. BRANDAN (Waspada): Public Relations (PR) PT CPMSCP Konsorsium membantah perusahaannya merambah ribuan batang pohon mangrove untuk pembuatan pagar gudang penyimpanan pipa di lokasi Kel. Pangkalanbatu, Kec. Brandan Barat, Kab. Langkat. “Itu tidak benar dan manajemen sejak awal telah mengingatkan kepada vendor agar tidak menggunakan kayu bakau atau jenis apa pun meski status kayu itu legal dan dilengkapi dokumen yang sah,” kata Harun Fadilah menyampaikan klarifikasinya

kepada Waspada, Kamis (25/7) di P. Brandan. Ia menjelaskan, jumlah kayu tidak sampai ribuan batang dan yang mengerjakan pembangunan pagar bukan PT Citra Panji Manunggal (CPM), melainkan dipercayakan kepada pemborong (vendor) lokal, karenanya sangat tidak etis kalau perusahaannyaditudingmerambahribuan batang mangrove. Fadilah menegaskan, sekarang ini proses pembangunan pagar telah dihentikan, bahan pagar yang telah berdiri diperintahkan untuk dibongkar. “Meski

punvendortelahmemperlihatkan dokumen kayu, tapi kami tetap membongkar bangunan pagar dan mengganti dengan material besi,” tandasnya. Perusahaan, lanjut Fadilah, sejak awal kehadirannya di Langkat tetap komit menjaga kelestarian lingkungan. Pada 2009-2010, katanya, manajemen melakukan gerakan penanaman mangrove di pesisir Desa Telukmeku. Saya ini pecinta lingkungan,” ujarnya seraya menambahkan, tudingan PT CPM merambah ribuan batang mangrove adalah fitnah. Secara terpisah vendor yang mengerjakan pagar gudang

penyimpanan pipa, Usman, kepada Waspada mengatakan, 600 pohon kayu bakau bukan berasal dari kawasan hutan, melainkan tanaman milik Surya Darma. Kayu ini, lanjutnya, juga dilengkapi dokumen SKAU yang diterbitkanpetugasberkompeten sesuai Permenhut No. P.30/2012. Dengandihentikannyaproses pengerjaan pagar, Usman, mengaku didera kerugian. “Kami telah kehilangan peluang. Kini kelanjutan pembangunan pagar langsung ditangani PT CPM sendiri,” ujarnya seraya berharap warga lokal diberi kesempatan untuk bekerja.(a02)

Wali Kota T. Tinggi Terima Dua Penghargaan TEBINGTINGGI ( Waspada): Walikota Tebing Tinggi Ir. H. Umar Zunaidi Hasibuan, MM menerima penghargaan dari Menteri Negara Pemberdayaan Perempuan dan Anak Linda Amalia Sari Gumelar, pada ‘Peringatan Hari Anak Tahun 2013’, Selasa (23/7), di auditorium KH. M. Rasjidi Kementerian Agama RI di Jakarta. Wali Kota menerima dua penghargaan sekaligus, yaitu Penghargaan Kota Layak Anak (KLA) tingkat Pratama dan Penghargaan Pemberian Akta Kelahiran Gratis/Bebas Biaya tingkat Pratama. Kedua penghargaan diserahkan Linda Amalia Sari Gumelar selaku Menteri Pemberdayaan Perempuan dan Perlindungan

Anak. Terpilihnya Kota Tebing Tinggi sebagai Kota Layak Anak (KLA) Tingkat Pratama terkait keberhasilan melakukan perlindungan, pengayoman dan pengembangan anak. Dengan demikian anak akan dapat memperluas ruang geraknya dalam berekspresi. Sedangkan Penghargaan Pemberian Akta Kelahiran Gratis/Bebas Biaya, karena program innovasi yang dilakukan Wali Kota Tebing Tinggi melalui kegiatan ‘pemberian akta kelahiran gratis/bebas biaya’ dalam upaya percepatan kepemilikan akta kelahiran, sekaligus pemenuhan kebutuhan hak keperdataan anak. “Penerimaan penghargaan kota layak anak dan pengharga-

Pangdam I/BB Minta TNI Bekerja Keras, Jujur Dan Sabar BINJAI (Waspada): Pangdam I/BB Mayjend Burhanudin Siagian minta jajaran TNI senantiasa bersyukur, sabar, jujur dan bekerja keras, bijaksana, serta menghindari hal yang dapat merugikan diri sendiri dan jajaran TNI. “Ramadhan termasuk bulan latihan. Latihan kejujuran dan yang jujur, biasanya iklas dan tulus,” jelasnya saat berbuka puasa bersama di Batalyon Arhanudse II/BS, Selasa (23/7), malam di Markas Arhanudse 11/BA di Binjai. Hadir Wali Kota Binjai HM Idaham, SH, M.Si, Kapolres Binjai AKBP Musa Tampubolon, SH, M.Si, SH, Dandim 0203 Langkat Letkol Tri Sakti, Ketua DPRD Binjai Zainuddin Purba, SH, serta Komandan Batalyon Arhanudse 11/BS, Mayor Cendy Christian Riantory. Pangdam I/BB juga menyerahkan tali asih bagi 50 anak yatim piatu. Sebelumnya Pangdam menanam pohon rambutan di lokasi halaman markas Arhanudse 11/BA di Binjai, serta pertemuan dengan prajurit dan istri. Pangdam I/BB menegaskan, pihaknya akan menindak tegas, dan tanpa ampun bagi prajurit yang terlibat narkoba. Pangdam juga menyebutkan untung ruginya dan pelanggaranpelanggaran yang tidak boleh dilakukan perajurit.(a04)

Waspada/Riswan Rika

PANGDAM I/BB bersamaWali Kota Binjai,Ketua DPRD, Kapolres saat berbuka puasa di Arhaudse 11/BS.

an pemberian akta kelahiran gratis, membanggakan,” ujar Wali Kota usai menerima plakat dan piagam dari Menteri. Menurut Wali Kota, keberhasilan penerimaan dua penghargaan itu bukti adanya kerjasama semua SKPD dan warga masyarakat dalam menyukseskan kedua program. Wali Kota menyatakan terima kasih kepada PNTebingtinggi yang berpartisipasi aktif dalam pelaksanaan akte kelahiran gratis

untuk anak. “Saya berikan apresiasi tinggi untuk jajaran hakim di PN Tebingtinggi,” ujar Umar Z Hasibuan. Ditambahkan, penghargaan yang diperoleh kota Tebingtinggi bukanlah tujuan, tapi sasaran untuk mewujudkan perlindungan dan pemberdayaan bagi tumbuh kembangnya anak di kota lintasan itu. “Kita berharap ke depan prestasi ini bisa dipertahankan dan kian diperkuat,” harapWali Kota.(a09)

Sejumlah berkas penting di ruang kerja Sekwan dan di ruang kerja Bendaharadibawapetugas,termasuk CPU komputer berisi banyak fileperjalanandinas.Selainitudari ruangSekwanturutditemukanbanyakairpotekuntukpenerbangan. Selama penggeledahan berlangsung hasil pantauan Waspada, tidak terlihat seorang pun anggota DPRD Langkat maupun unsur pimpinan dewan. Diperoleh informasi mereka yang tergabungdalamKomisiIIIdanKomisi IVmelaksanakankunjungankerja ke Jakarta. Kajari Stabat Hendri, SH menegaskan penggeledahan untuk melengkapi alat bukti karena sebelumnya ada data-data yang diminta penyidik tidak mereka berikan.“Itusudahtermasukupaya menghalangi penyidikan, karena itu kita lakukan penggeledahan,” tegas Hendri, SH.(a03)

STABAT (Waspada): Bupati Langkat H. Ngogesa Sitepu, SH mengemukakan, pekerjaan bilal mayit merupakan profesi yang mulia, namun tidak semua orang mampu dan mau menjalani profesi yang mengandalkan keikhlasan dalam melaksanakan tugasnya itu. Sebagai apresiasi sekaligus menghormati profesi mulia ini, Pemkab Langkat menyerahkan santunan Rp325 juta bagi 500 orang bilal mayit yang tersebar di wilayah Langkat Hulu (145 orang), Langkat Hilir (195) dan wilayah Teluk Aru 160 orang. “Para bilal menerima Rp650 perorang,”kataH.Ngogesaseraya menambahkan, karena keterbatasananggarantidakseluruhnya menerima tali asih tersebut dan yangbelummenerimahendaklah bersabar menunggu giliran. Ngogesamengemukakan,taliasih santunan secara bergilir ini salah satu komitmen pelaksanaan visi masyarakat religius. Penyampaian tali asih untuk

Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu menyalami para bilal mayit yang memperoleh tali asih. bilal mayit dilakukan serentak di Kec. Selesai (Langkat Hulu), Tanjungpura (Langkat Hilir) dan Sei Lepan (wilayah Teluk Aru) yang langsung dihadiri H. Ngogesa didampingi Ketua MUI Langkat, H. Ahmad Mahfudz, Kakan Kemenag Langkat, HT. Darmansyah serta Kabag Kessos H. Syahrizal.

Sebelumnya Kabag Kessos H. Syahrizal melaporkan, tujuan kegiatan sebagai perhatian atas pengabdian dan keikhlasan bilal mayit membantu masyarakat danmenjadijembatansilaturahim antara Pemkab dengan masyarakatyangmemilikikepedulian terhadap nilai-nilai kemanusiaan.(a01/c01)


Sumatera Utara

B2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Pendidikan Agama Harus Ditanamkan Sejak Dini RANTAU PRAPAT (Waspada): Pendidikan agama harus ditanamkan kepada anak sejak dini, karena anak-anak merupakan generasi penerus kehidupan di masa yang akan datang. Pendidikan agama bagi anak-anak yang dilakukan sejak dini akan memberikan bekal terbaik bagi arah pembentukan karakter di saat nantinya beranjak remaja hingga menuju dewasa. Hal ini disampaikan Bupati Labuhanbatu dalam sambutan tertulisnya dibacakan Kadis Perdagangan Koperasi dan UKM Hamzah SH pada Safari Ramadhan bersama Tim rombongan di Mushollah Al Ikhlas, Lk. Aek Riung, Kelurahan Sigambal, Kec. Rantau Selatan, Senin (22/7) malam. Hamzah SH juga mengajak seluruh jamaah masjid yang hadir untuk terus memelihara kondusifitas sekaligus mewujudkan pribadi yang religius. Serta para ulama diharapkan terus memberikan kesejukan di masyarakat, serta menjaga kerukunan antar umat beragama. Dalam kunjungan, Tim Safari Ramadhan melaksanakan shalat Isya dan Tarawih berjamaah bersama dan menyerahkan bantuan kepada Ketua Badan Kenaziran Masjid Al Ikhlas AmirTanjung berupa uang tunai sebesar Rp6 juta, buah jam dinding penunjuk waktu sholat, buah Alquran, buah tafsir/terjemahan Alquran, buku tentang kisah-kisah nabi, buku khotbah Jumat dan buku surat Yasin. (c07)

WASPADA Jumat 26 Juli 2013

Ratusan Ton LPG Rawan Penyelewengan TANJUNGBALAI (Waspada): Ratusan ton LPG bersubsidi untuk kuota Tanjungbalai, disalurkan tanpa pengawasan intensif sehingga rawan diselewengkan. Hal ini juga diduga menjadi salah penyebab LPG 3 kilogram langka, harga melonjak dan isinya berkurang. Keterangan diperoleh Waspada, kuota LPG bersubsidi untukareaTanjungbalaisebanyak 250.000 kilogram tiap bulan. Hal itu terungkap berdasarkan DO dari Pertamina kepada 4 agen penyalurwilayahkerjaTanjungbalai. “Hanya saja, 4 agen pemegang DO itu tidak menyampaikan laporan kegiatan kepada tim pengawas pendistribusian LPG kilogramKotaTanjungbalai,”sebut sumber Waspada di kantorWali Kota Tanjungbalai, Rabu (24/7). Selainitu,dipangkalanpengecer tabung gas 3 kilogram, pihak agen juga tidak menyertakan kartu kendali sebagai bentuk

pengawasan. Ini terjadi tanpa penindakanatautegurandariPertamina. “Diduga petugas pengawas Pertamina (chekker) di lapangan, sengaja memberi data daninformasifiktiftanpamemberikan tembusan ke tim pengawas diTanjungbalai,” ungkap sumber. Sekretaris tim pengawas pendistribusian tertutup LPG 3 Kg Tanjungbalai Zulkarnaen Amirullah kepada wartawan mengatakan, ada 4 agen penyalur tabung gas 3 kilogram diTanjungbalai. PT Mas Gas Nusantara atau UD Alimin Silalahi (27.440 tabung per bulan), CV. Sukses Teguh Gemilang (21.280 tabung per

bulan), CV Lima Sinar Abadi (14.000 tabung per bulan) dan PT Anugrah Tetap Jaya (21.280 tabungperbulan)hinggatotalnya mencapai84.000tabungperbulan dan jumlah gas mencapai 250 ton per bulan. AktifisTanjungbalai-Asahan, M. Roby MA menyatakan, Pertamina tidak kooperatif menyangkutkeagenandanlemahnya pengawasan penyaluran LPG bersubsidi. Tidak adanya laporan kepada tim pengawas, kata Roby, mengakibatkan LPG bersubsidi gampang diselewengkan, sedangkan Pertamina terkesan membiarkan hal ini terjadi. Oleh sebab itu, Roby menyarankan, Pertamina Medan agar melakukantindakanterhadapagen agen yang bekerja tidak sesuai peraturandanmemberikansanksi tegasagartabunggas3Kginidapat diterimamayarakatsesuaidengan ketentuan. (a14)

Koalisi Kader Parpol Dukung OK LIMAPULUH (Waspada): Koalisi kader dari sejumlah partai politik di Batubara mendukung pencalonan H OK Arya Zulkarnain, SH, MM sebagai Bupati Batubara untuk kedua kalinya periode 2013-2018, sekaligus melanjutkanpembangunankedepan. Hal itu terungkap dalam pertemuan koalisi kader terdiri H Karnes (Partai Golkar), Syahrul (Partai Demokrat), Zainur (PKPI) dan Darmansyah (PPP) di Sekretariat Relawan “OK Jugolah” di Jalan Protokol Desa Padanggen-

ting, Kec.Talawi.“Kami menyatakan dukungan terhadap pak OK, karena kiprahnya sudah jelas,” tukas Karnes, Kamis (25/7). Cabup yang diusung melalui jalur independen ini telah teruji dan terbukti mulai dari tokoh pemekaran, OK juga sosok pimpinan yang dekat dengan rakyat dan bapak pembangunan. “Inikitalihatgeliatpembangunan di berbagai sektor di Batubara dalam kepemimpinan OK Arya sebagai bupati,” tukas Karnes. Mulai dari merubah kawasan

pesisir yang dikenal merupakan kawasan hutan bakau kini menjadi pusat pemerintahan dengan berdirinya sejumlah kantor SKPD di Desa Gambus Laut dan Perupuk, Kec. Limapuluh. Selain merubah kawasan kumuh menjadi“perkotaan” seperti Desa BaganDalamdanBogakSebrang, Kec Tanjungtiram. Belum lagi di sisi infrastruktur maupun sektor lainnya secara bertahapmenunjukankemajuan bila dibanding sebelum dimekarkan. (a13)

Waspada/Rasudin Sihotang

KABUT asap tampak menyelimuti Sungai Asahan tempat bertambatnya ratusan kapal nelayan.

Nakhoda Diimbau Berhati-Hati Kabut Asap Selimuti T. Balai TANJUNGBALAI (Waspada): Kabut asap kebakaran lahan dan hutan di Riau kembali menyelimut Kota Tanjungbalai dan sekitar, khususnya perairan Selat Malaka, Kab. Asahan, Rabu (24/7). Pada kebakaran sebelumnya, ‘kota kerang’ ini juga terkena dampak. Pantauan Waspada, asap putih mulai terjadi sejak Selasa (23/7) siang. Perlahan, sedikit demi sedikit asap terbawa angin dari arah Selat Malaka. Keberadaan asap ini sudah cukup mengganggu lalu lintas di di darat terutama di Jalinsum Simpangempat, karena jarak pandang hanya 1.000 meter,sementarajarakamanminimal1.500hingga 5.000 meter. Asap ini juga dikhawatirkan menyebabkan gangguan pernafasan. Kendati demikian, situasi ini belum memberikan dampak cukup parah yang mengganggu aktivitas masyarakat. “Sudah dua hari Pak. Pertama masih biasa saja, di hari kedua ini asapnya makin pekat,” kata Ulong, 50, saat menikmati pemandangan Sungai Asahan dari atas Jembatan Tabayang (Tanjungbalai-Sungaikepayang). Sementara, seorang tekong (nakhoda) boat ikan yang baru pulang melaut mengatakan, jarak

pandang di laut hanya berkisar 500 meter, padahal seharusnya minimal jarak pandang pelayaran adalah 2000 meter (dua kilometer). Akibatnya, dia harus ekstra hati-hati menjalankan boatnya, jika tidak akan dikhawatirkan terjadi tabrakan. “Parah kali di laut bang, kalau di sini masih mending, satu kilometer masih nampaklah. Kalau di sana, semua tertutup asap,” tutur Nurdin, 55. Dia mengaku terpaksa pulang dari laut karena selain tangkapan minim, juga karena ancaman kabut asap. Boat-boat nelayan lain pula banyak yang memutuskan kembali ke darat dan menunggu situasi normal. Kepala Kantor Kesyahbandaran dan Otoritas Pelabuhan Tanjungbalai Asahan (KSOP-TBA) Tarudy Manalu mengimbau kepada para nakhoda dan pemilik kapal agar ekstra hati-hati. Sebab, kabut asap mulia mempengaruhi lalu lintas jarak pandang perairan Asahan, Selat Malaka. “Sampai saat ini belum ada laporan kecelakaan, sehingga situasi masih aman. Meski demikian, semua pihak kita imbau agar waspada, pergunakan semua alat penanda seperti lampu navigasi,radar,danGPSagarkapallainmengetahui adanya kapal di depan,” kata Manalu. (a32)

Paripurna DPRD Labusel Tentang Hak Angket Tertutup

Waspada/Iwan Has

KOALISI kader dari sejumlah partai politik di Batubara menyatakan dukungan terhadap H OK Arya Zulkarnain, SH, MM sebagai Cabup Batubara periode 2013-2018.

Enam Pasangan Lolos Pilkada Batubara LIMAPULUH (Waspada): Pleno KPU Kab. Batubara, Rabu (24/7) dari tujuh pasangan calon yang mendaftar, memutuskan enam pasangan calon bupati dan wakil bupati Batubara yang dinyatakan memenuhi syarat. Sementara pasangan calon Jenmat Sembiring- Nafiar dinyatakan tidak memenuhi syarat (TMS) untuk ditetapkan sebagai pasangan calon peserta Pemilu Kepala Daerah danWakil Kepala Daerah Batubara 2013. Demikian dikatakan, Ketua KPU Kabupaten Batubara Khairil Anwar SH, MSi didampingi anggota Drs Azhar Tanjung MSi, DonniHuseinHarahapSE,Abdul Masri Purba S.Sos, Taufik Abdi Hidayat S.Sos, di ruang kerjanya, di Limapuluh Batubara. Menurut Khairil, enam

pasangan calon bupati Batubara yang memenuhi syarat yakni, H. Ok Arya Zulkarnain, SH. MM dan H. RM. Harry Nugroho, SE - Drs. H. Gong Matua, M.Si dan H. Achmad Deni, SE - Kurnia Gunawan Darwis Iskandar dan Murlan Alamria Simarmata, SE - Ir. Zahir, MAP dan Suriono, ST - Ir.Yahdi Khoir Harahap dan Drs. Syarkowi Hamid - Zulkarnain, SKM, M.Kes dan Masitah. Terkait, hasil pemeriksaan kesehatan jasmani dan rohani pasangan calon, enam pasangan calon tersebut dinyatakan mampu secara rohani dan jasmani melaksanakan tugas sebagai bupatidanwakilbupatiBatubara. Sementara, Jenmat Sembiring- Nafiar dinyatakan TMS, karena pada masa batas akhir penyerahan berkas syarat doku-

men masa perbaikan tidak dapat melengkapinya. “Formulirpencalonanbupati mulai dari Model B-KWK KPU Partai Politik hingga BB11 KWK KPU Partai Politik, tidak dapat dipenuhi pasangan calon Jenmat Sembiring – Nafiar. Karenanya, pleno menetapkan pasangan tersebut TMS”, ujarnya. Dijelaskannya, setelah enam pasangan calon dinyatakan memenuhi syarat, selanjutnya KPU Kab. Batubara menyampaikan kepada enam pasangan calon untuk dapat hadir dalam rapat pleno terbuka KPU tentang penetapan dan penarikan nomor urut pasangan calon bupati dan wakil bupati Batubara 2013 pada 27 Juli 20013, di Gedung MPH Recreation Hall Tanjung Gading, Sei Suka. (c05)

Banjir Rob Mulai Rendam Sejumlah Tempat TANJUNGBALAI (Waspada): Banjir rob (naiknya permukaan laut) ke daratan mulai melanda sejumlahtempatdiKotaTanjungbalai sejak beberapa hari terakhir. Akibatnya, sejumlah lokasi, jalan, dan fasilitas umum terendam dengan ketinggian bervariasi. Meski belum begitu parah, fenomena alam tahunan yang orang lokal biasa menyebut ‘pasang keling’ ini cukup merepot-

kan warga dan pengguna jalan. Bagaimana tidak, air mulai memasuki kawasan padat penduduk terutama tanah yang relatif rendah sehingga menggangguaktifitassepertiberdagang, mengaji, dan lainnya. Pantauan Waspada, beberapa titik yang mulai digenang banjir seperti pemukiman di Jl. Anwar Idris, Pasar Bengawan, dan RSUD Kota Tanjungbalai.

Waspada/Rasudin Sihotang

SEORANG pengendara menerobos genangan banjir rob di Pasar Bengawan.

Selainituperumahandansekolah diJl.M.Abbas,aksesjalanmenuju Baganasahan, reklamasi Sungai Asahan, dan lainnya. Semua tempatinimerupakanlangganan setiap banjir rob terjadi. “Setiap bulan purnama pasti banjir bang, cukup pusing juga sih karena sayuran ini harus diangkatlebihtinggidaribiasanya,” kata Rosmaida Hutauruk, 45, pedagang sayur mayur di pasar bengawan, Kamis (25/7). Warga lainnya, pemilik warungmiesopdiKelPantaiburung, Kec.TanjungbalaiSelatanmengaku, pendapatannya menurun sejak terjadinya rob. Banyak pelanggan yang enggan datang karena lantai warungnya tertutup air. “Terpaksa tutuplah bang, padahalpendapatanutamakeluarga berasal dari sini,” kata lelaki bertubuh kurus itu. Untuk mengantisipasi banjir ini. kata warga, Pemko Tanjungbalai harus mengambil tindakan agar tidak menimbulkan bencana. Solusinya, Pemko harus membuat saluran pembuangan air yang memadai agar air lancar dan tidak terlalu lama menggenangi warga. (a32)

KOTAPINANG (Waspada): Sidang paripurna DPRD Labusel dengan agenda Penyampaian Laporan Pansus tentang Hak Angket mengenai Kebijakan Bupati LabuselWildan AswanTanjung dalam Menjalankan Roda Organisasi Pemerintahan yang digelar di gedung DPRD, Rabu (24/7) siang, berlangsung tertutup. Pengamatan Waspada, rapat itu berlangsung dalam pengawalan ketat aparat TNI, Polisi, dan SatpolPP-LinmasPemkabLabusel.Puluhanwarga dari sejumlah daerah baik Pendukung dan Anti terhadap Hak Angket tidak dibenarkan masuk. Karena kecewa, sebagian warga memilih meninggalkan tempat itu dan sebagian lain menunggu di halaman kantor DPRD hingga paripurna selesai. Sidang siang itu dipimpin oleh Ketua DPRD Ferry Andhika Dalimunthe dihadiriWakil Ketua DPRD Zainal Harahap, Ketua Pansus Hak Angket Hari Muktasar, dan 9 orang dari anggota Pansus

dan anggota dewan lainnya. Pada pertemuan yang berlangsung selama dua jam sejak pukul 15.15 itu Pansus melaporkan hasil penelitian mereka terkait 16 masalah yang dipersoalkan. PolitisiPartaiDemokratitumengatakan,dalam laporannya Pansus mengusulkan untuk menggunakan Hak Menyatakan Pendapat kepada Bupati. Dijelaskan, pihaknya akan kembali menyusun ulang penjadwalan penggunaan hak itu melalui Banmus. “Pansus menemukan adanya pelanggaran dan diajukan menggunakan Hak Menyatakan Pendapat,” katanya. Sementara usai paripurna terjadi kericuhan di halaman gedung DPRD ketika sejumlah masyarakat Anti Hak Angket berupaya mencecar Ketua DPRD Ferry Andhika Dalimunthe, Ketua Pansus HakAngketHariMuktasardansalahseorangAnggota Pansus Rustam Simbolon dengan sejumlah pertanyaan menyangkut Hak Angket. Beruntung ketegangan itu tidak berbuntut panjang. (c18)

Pemkab Labura Raih WDP MEDAN (Waspada): Pemkab Labura meraih Ketua DPRD Drs H Ali Tambunan, Sekda Drs opini Wajar Dengan Pengecualian (WDP) dari Edi Sampurna Ambey MSi, Kepala Inspektorat Badan Pemeriksa Keuangan Republik Indonesia SurenSitumorangSH,AsistenAdmUmumSaimin (BPK-RI) Perwakilan Sumut, Rabu (24/7). SIP, Kadis Pendapatan Drs Ahmad Fuad MSi, Staf “Kita patut mensyukuri atas upaya dilakukan Ahli Sukisma SSos, dan Kabag Humas Infokom semua pihak, terutama Dispenda, Inspektorat Syahrul Adnan Hasibuan SE, menjelaskan, pada dan Setdakab sehingga tahun 2012 Laporan tahunsebelumnya,LKPDmendapatopinidisclaimer KeuanganPemerintahDaerah(LKPD)Kab.Labura karena lemahnya SDM yang membidanginya. mendapat opini Wajar Dengan Pengecualian “Alhamdulillah, setelah dilakukan pendidikan (WDP). Mudah-mudahan, dengan kebersamaan kepada petugas yang membidanginya, opini dan keuletan, tahun depan, hasilWDP dapat kita tersebut berubah menjadiWDP dan pendidikan tingkatkan menjadi Wajar Tanpa Pengecualian terus akan terus ditingkatkan kepada petugas (WTP),” kata Bupati Labura H Kharuddin Syah agar tahun depan mendapat opini WTP,” Sitorus SE, usai menerima Laporan Hasil tuturnya. (cwan) Pemeriksaan (LHP) oleh BPK RI terhadap LKPD Labura dari Kepala Perwakilan BPK RI Sumut Muktini SH, di ruang pertemuanBPKRIperwakilan Sumut di Medan kepada wartawan. Bupati Labura mengakui, untuk mendapat opini WDP dari 2 tahun sebelumnya disclaimer bukan pekerjaan mudah. “Namun, dengan kebersamaan dan kerja keras, LKPD kita mendapat opini WDP berdasarkan Hasil Laporan Pemeriksaan (LHP) Waspada/Ist BPK RI dan semoga tahun Kepala Perwakilan BPK RI Sumut Muktini SH, menyerahkan depan meningkat menjadi LHP terhadap LKPD Labura kepada Bupati Labura H Kharuddin WTP,” ujarnya. Syah Sitorus SE, di ruang pertemuan BPK RI perwakilan Sumut Kharuddin didampingi di Medan, Rabu (24/7).

Protes Kejari Atas Penahanan Pengurus Poktan RANTAUPRAPAT (Waspada): Salah seorang warga,HasanuddinHasibuanyangdikenalsebagai Ketua LPPN (Lembaga Pemantau Penyelenggara Negara) Kab. Labuhanbatu, mengamuk di halaman Kantor Kejaksaan Negeri (Kejari) Rantauprapat, Selasa (23/7) sore. Dia protes atas atas penahanan pengurus kelompok tani (Poktan) oleh lembaga penegak hukum tersebut. Aksi protes yang dilakukan Hasanuddin itu memaksa pihak Kejari meminta bantuan aparat kepolisian untuk melakukan pengamanan. Terlihat pasukan Macan yang mengendarai sepedamotor sebanyak 30 personel datang ke lokasi kejadian. “SebelumnyaHasanuddinsudahributdengan Jaksa Erning Kosasih. Mereka sempat dorong-

dorongan di depan sel tahanan sementara Kejari, sehingga dihalau beberapa jaksa keluar,” ujar pegawai Kejari kepada wartawan. Beberapa jaksa memang berhasil menggiring Hasanuddin keluar sampai ke halaman samping kantorKejari.NamunHasanuddintetapbersikeras meminta penjelasan kejaksaan atas penahanan kedua temannya yang merupakan ketua dan sekretaris salah satu Poktan di L.Batu, sedangkan di Polres keduanya tidak ditahan. Sementara Kasi Pidum M Ilham SH didampingi Jaksa Erning Kosasih ketika dikonfirmasi, Rabu (24/7), menjawab, mereka tidak berhak menjawab konfirmasi setiap wartawan karena sudah ada prosedurnya. “Bang konfirmasi saja sama Kasi Intel selaku Humas ya,” jawab M Ilham. (a18)


Sumatera Utara

WASPADA Jumat 26 Juli 2013

B3

Uang Anggota CU BMS Rp6 Miliar Digelapkan Kapolres P. Siantar Diminta Usut Tuntas PEMATANGSIANTAR (Waspada): Pengurus lama koperasi kredit atau Credit Union Bina Mitra Sejahtera (CU BMS) Kota Pematangsiantar diduga menggelapkan uang anggota mencapai Rp6 miliar lebih sejak tahun 2006. Tak ayal, 4.150 anggota menuntut Kapolres menangkap pengurus lama CU BMS. Tuntutan itu disampaikan 4.150 anggota CU BMS melalui 300-an teman-teman mereka yang datang dari Tigaras, Sidamanik, Manik Saribu, Jorlang Huluan, Parhundalian, Sirpang Sigodang atau mencapai 54 desa dankelurahandiKab.Simalungun dan Pematangsiantar serta terlihatkebanyakansudahberusia

lanjut, pria maupun wanita, saat berunjukrasa di depan Mapolres Pematangsiantar, Jalan Jend. Sudirman, Kamis (25/7). Unjukrasa Forum Komunikasi Penyelamat Aset Dana BMS (FKAD BMS) dipimpin Jortua Purba membawa poster dan spanduk tentang tuntutan mereka serta mengikat kepala

mereka dengan kain putih bertuliskanBMS.Didadaditempelkan kartu BMS yang distempel. Mereka tidak dapat masuk ke halaman dan hanya bisa duduk danberdirididepanpintugerbang Mapolres yang ditutup dan dipagar betis personel Polres. “Kami mendesak Kapolres mengusuttuntaslaporananggota yang tidak ditindaklanjuti dalam delapan bulan ini, mengusut tuntas dugaan penggelapan uang anggota CU BMS terhitung mulai tahun 2002-2012 dan menagkap para pelaku penggelapan uang anggota yang sudah merugikan 4.150 orang dengan jumlah

mencapai Rp6 miliar,” teriak nasabah CU BMS yang didampingi para mahasiswa dari USI di hadapan Kasat Binmas AKP T. Sitepu, Kabag Ren Kompol Muslim, Kabag Ops Kompol Dedi, Kasat Reskrim AKP Daniel SomanonasaMarunduri,S.Ikdanlainnya. Dikatakan, manajemen baru sudah mengundang manajemen lama untuk mempertanggungjawabkanperbuatanmerekayang diduga telah menggelapkan uang anggota mencapai Rp6 miliar. “Namun, manjemen lama tidak mampu mempertanggungjawabkannya dan malah saling tudingsesamamereka.”Persoalan

ini pun diadukan ke Polres Pematangsiantar. Kapolres Pematangsiantar AKBP AlbertTB Sianipar, S.Ik, MH saat dikonfirmasi melalui Kasat ReskrimAKPDanielSomanonasa Marunduri,S.Ikdisela-selaunjukrasa, membenarkan laporan anggota CU BMS itu sudah diterima November 2012. Namun, pengaduan mereka secara resmi baru dibuat pada Februari 2013. “Kita sudah berkali-kali meminta barang bukti dugaan penggelapanitu,tapibarukemarin diserahkan hingga penyelidikan baru bisa ditindaklanjuti sesudah ada barang bukti,” katanya. (a30)

Waspada/Edoard Sinaga

ANGGOTA CU BMS berunjukrasa di Mapolres Kota Pematangsiantar di Jalan Jend. Sudirman. Mereka menuntut Polres menangkap pengurus CU BMS yang diduga menggelapkan uang anggota Rp6 miliar.

Ditemukan 39 Terinfeksi HIV/AIDS Di P. Siantar Pilkada Palas, Pasangan SOBAR PEMATANGSIANTAR (Waspada): Peningkatan kasus HIV/ AIDS di Kota Pematangsiantar sangat mengkhawatirkan, karena sesuai laporan Dinas Kesehatan Provsu, sampai April 2013 sudah ditemukan 139 kasus HIV/AIDS. “Laporan itu menunjukkan adanya peningkatan jumlah yang terinfeksi HIV setiap tahun di Pematangsiantar. Peningkatan kasussetiaptahunitutentusangat mengkhawatirkan kita semua. Pada 2012 sampai April ditemukan 130 kasus HIV/AIDS,” sebut WaliKotaHulmanSitorus,SEselaku Ketua Komisi Penanggulangan AIDS Daerah (KPAD) melalui Sekretaris KPAD Iswan Lubis, SH. Kasus mengkhawatirkan itu disampaikan Wali Kota saat pertemuan sosialisasi HIV/AIDS di kalangan pers Pemko Pema-

tangsiantar yang dilaksanakan KPAD dengan pembicara dr Saiden Saragih, MM selaku pengelola Klinik CVT dan CST di RSUD dr Djasamen Saragih, dr Trang Ukur Kembaren selaku dokter fungsional di Puskesmas Martimbang dan Dedi Purwanto selaku pengelola kegiatan KPAD. Wali Kota mengharapkan agar semua pihak, khususnya pers lebih terpanggil menyampaikaninformasidanedukasidalam mencegah dan menanggulangi penularan HIV/AIDS di Pematangsiantar,terutamadalam pemberianinformasiyangkontinu padamediamassamasing-masing. Wali Kota mengakui upaya pencegahan dan penanggulangan HIV/AIDS di Indonesia termasukdiPematangsiantarbelum dapat menghambat secara total

lajunyaepidemiHIV/AIDS,meski berbagai upaya sudah dilakukan. “Salahsatu kendala mendasar dalammenghambatlajuepidemi HIV/AIDS yakni lingkungan masyarakat belum lagi sepenuhnya kondusif dan mendukung dalam pencegahan dan penyelenggaraan pencegahan HIV/AIDS.” MenurutWali Kota, beberapa isu strategis dalam masalah HIV/ AIDS memerlukan pemahaman yang mendalam, kadangkala rumit dan bahkan sensitif seperti masalah promosi kondom dalam mencegah HIV/AIDS tidak hanya menjadi masalah kesehatan, tapi juga menjadi masalah moral dan adat istiadat yang cukup rumit. Di samping itu, ujarWali Kota, peran pers sangat strategis mendidik generasi muda dan

pelajar khususnya agar berperilaku positif dan sehat agar terhindar dari bahaya HIV/AIDS. “Dalam kaitan ini, Pemko mengharapkan kepedulian kita semua di dalam meningkatkan kualitas pembangunan, sekaligus kita semua mengajak kelompok masyarakat yang beresiko untuk mau melaksanakan perubahan perilaku dari kelompok beresiko tertular menjadi tidak beresiko tertular HIV/AIDS serta penyakitpenyakit IMS (infeksi menular seksual),” ujar Wali Kota. Pada kesempatan itu, Dedi Purwanto memaparkan situasi kegiatan dalam pencegahan dan penanggulanHIV/AIDSdiPematangsiantar, penjabaran target millennium development goals (MDGs) dalam RPJMN dan tujuan, sasaran dan target tahun

2010-2014, percepatan pencapaian MDGs, skenario dampak penanggulanganAIDS,kumulatif data kasus HIV/AIDS di kabupaten/kota Sumut. Saiden Saragih memaparkan informasi dasar AIDS (Acquired Immune Deficiency Syndrome) yang merupakan kumpulan penyakit yang disebabkan HIV (Human Immunodeficiency Virus), dimana HIV ditemukan dalam cairan tubuh terutama darah, cairan sperma, cairan vagina dan air susu ibu. Menjawabpertanyaan,Trang Ukur Kembaren menegaskan dari survei yang dilakukan di lima lokalisasi penjaja seks di Kab. Simalungun,dari400lebihpenjaja seks, 12 orang tertular HIV/AIDS dan penyebab utamanya akibat hubungan heteroseksual. (a30)

Massa Formadas Madina Lima Cabup Paluta Sampaikan Visi-misi Minta Kadis Perindag Dicopot GUNUNGTUA (Waspada): syah SE Msi didukung 11 parpol PPP dengan total lima kursi PANYABUNGAN (Waspada): Puluhan masyarakat menamakan diri Forum MasyarakatTertindas MandailingNatal (Formadas Madina) mengadakan aksi unjukrasa di Kantor Diperidag Koperasi dan UKM, Kamis (25/7). Formadas dalam tuntutannya meminta supaya Bupati Madina secepatmungkinmencopotKadisPerindagKoperasidanUKMLismulyadi Nasution yang mereka nilai tidak mampu mengemban amanah. FauzanHelmiselakukoordinatoraksidalamorasinyajugameminta inspektorat mengaudit anggaran, dan aparat penegak hukum melakukan penyelidikan penggunaan anggaran di dinas tersebut yang diduga bermasalah seperti dana sosialisasi ulang pasar tahun 2013 senilai Rp100 juta, dana pemeliharaan kantor Rp165 juta dan anggaran pemeliharaan kendaraan dinas Rp133 juta. Formadas Madina juga meminta Bupati danWakil Bupati Madina agar memperjuangkan harga getah karet di Madina, serta menstop monopoli harga karet yang di duga di mainkan toke-toke karet. MassajugamelakukanaksilangsungkeKantorBupatiMadinaditerima Asisten l, Musaddad Daulay dan Asisten lll, Samad Lubis. (c14)

Wali Kota Padangsidimpuan ‘Bongkar-pasang’63 Pejabat P. SIDIMPUAN (Waspada): Wali Kota Padangsidimpuan Andar Amin Harahap, MSi merombak, membongkar-pasang dan memutasi 63 pejabat eselon II, III dan eselon IV, kemudian merencanakan melakukan pelantikan dan pengambilan sumpah jabatan, Jumat (26/7) hari ini. Acara pelantikan dan pengambilan sumpah jabatan ini menurut jadwal dari Humas dihadiri Wali Kota, Ketua DPRD Kota Padangsidimpuan, H Azwar Syamsi Lubis MM, Sekdako, Forum komunikasiPimpinanDaerah,seluruhSKPDdilingkunganPemerintah Kota setempat, tokoh masyarakat, tokoh agama, tokoh pemuda, mahasiswa dan undangan lainnya. Kabag Humas Drs H Saeful Bahri kepada Waspada, mengungkapkan, kemarin, ada sejumlah pejabat eselon II setingkat kepala dinas diganti. Selain melantik dan mengambil sumpah pejabat eselon II, wali kota juga melantik pejabat eselon III seperti Kabag (Kepala Bagian). Pada kesempatan itu, Wali kota juga melantik sejumlah Camat. (c13)

Lima pasangan calon bupatiwakil bupati Padanglawas Utara (Paluta) menyampaikan visi misi serta programnya dalam rapat paripurna DPRD Kabupaten Padanglawas Utara, Kamis (25/ 7). Pemaparan visi misi dilakukan secara berurutan sesuai nomor urut pasangan calon dengan alokasi waktu masing-masing 30 menit. Tidak ada dialog untuk setiap sesi. Penyampaian visi dan misi didahului Nomor urut 1 yaitu pasanganHRajaAmanHasibuan SE alias H Mokmok -H Darwin-

yakni PBR, PKPI, PMB, PKPB, PIS, Merdeka, PKBIB, PPI, PPDI, PDK dan PKNU dengan total suara 19.959. Disusul pasangan Drs Syahrul Harahap MAP- H Sunggul Lelo Siregar SPdi dengan mengusung Jargon “SyahUnggul” didukung 5 parpol yakni Partai Demokrat, Barnas, PPNUI, PKB dan PNI Marhaenisme dengan total 18.931 suara mendapatkan nomor urut 2. Kemudian pasangan Letkol Kav Purn H Sutan Siregar SHIr Zulkifli Rambe didukung dua parpolyakniPDI-Perjuangandan

mendapatkan nomor urut 3, disusul pasangan incumbent Drs H Bachrum Harahap-H Riskon Hasibuan SE (BARIS) didukung 7parpoldiantaranyaPPRN,Partai Golkar, PAN, Patriot, PKS, Pelopor dan Hanura dengan jumlah 17 jumlah kursi mendapatkan nomor urut 4. Dan terakhir yang menyampaikan visi misi yakni pasangan independent Ali Muda Rambe SH-Muhammad Awal Hasibuan dengan jumlah dukungan14.320suara mendapat nomor urut 5. (a35)

14 Pejabat Karo Dilantik KABANJAHE (Waspada): Bupati Karo Kena Ukur Surbakti diwakili Asisten III Administrasi Jernih Tarigan, SH melantik 14 pejabat, yakni empat pejabat strukturaleselonIIIdan10pejabat struktural eselon IV di lingkungan PemkabKarodiaulaKantorBupati Karo di Kabanjahe, Rabu (24/7). Empat pejabat struktural eselonIIIyangtelahdilantikPetrus Ginting, S.sos sebagai Kepala Bagian Perekonomian pada

Setdakab Karo, Binaria Surbakti, S.IP sebagai Kepala Bagian Protokol pada Setdakab Karo, Drs. Kenan Ginting, M.pd sebagai Kabid MutasipadaBadanKepegawaian, Pendidikan dan Pelatihan, Edward Pontianus Sinulingga, ST sebagai Kabid Perencanaan pada Dinas Pendidikan Kabupaten Karo. Selain itu, juga dilantik 10 pejabat eselon IV. Bupati Karo mengungkapkan, pelantikan pejabat struktural

di lingkungan Pemkab Karo bertujuan menghindari potensi kejenuhan dan kesenjangan operasional dalam pelaksanaan tugas pemerintahan dan pelayanan publik. Dikatakan, berbagai pertimbangandalammenentukanjabatan PNSadalahkapasitasdankompetensinya, integritas, loyalitas, moralitas/pangkat;sertanilaipengabdiandanataukomitmenterhadap tugas dan tanggung jawab. (c10)

Dua Pasang Pemakai SS Diciduk MARDINDING (Waspada): Polsek Lau Baleng, Kec. Mardinding, Kab. Karo berhasil meringkus dua pasang diduga pengguna sabusabu (SS), Selasa (23/7) malam. Polisi menyita barang bukti berupa satu paket kecil SS, satu buah mancis beserta jarum botol , pipet dan tiga unit telepon seluler. Pemakai sabu dan pengedar diamankan personel Polsek Lau Baleng berinisial MSK, 41, EPS, 28, keduanya warga Desa Buluh Pancur, Kec. Mardinding. ZI, 27, warga Aceh, EN, 35, warga Pancurbatu. Kapolres Karo AKBP Marcelino S. Ketika dikonfirmasi Waspada melalui Kasat Narkoba AKP Saripudin Lubis, membenarkan penangkapan tersangka. (c19)

Kemudian bertemu lagi dengan warga Kec. Bandar Huluan dan Dolok Batunanggar juga dalam rangka silaturahmi dan buka puasabersamadigelardihalaman RS Laras, Bandar Huluan. JR Saragih sepertinya tak mau ketinggalan melakukan turba (turunkebawah)menemuikonstituen membagi-bagi ‘rezeki’ kepada anak yatim dan dhuafa serta menyampaikan program danstatemendalamrangkapembangunan Simalungun ke depan. Sebenarnya, kegiatan kunjungan ke kecamatan bertepatan dengan bulan Ramadhan bukan baru kali ini dilakukan. Tahuntahunsebelumnyaacarabukapuasa juga sudah dijalankan. Hanya saja, tahun sebelumnya daerah yang langsung bupati kunjungi hanya daerah tertentu saja, selebihnya dikunjungi oleh tim safari. Sedangkan tahun ini jauh berbeda, semuanya dihadiri bupati. Dalam kunjungannya, JR Saragih mengeluarkan statemen

SOSA (Waspada): Pasangan SOBAR sebutan itu beliau berharap agar masyarakat berpikir untuk pasangan cabup H. Ali Sutan Harahap positif dalam menentukan calon pemimpin yang bersama cawabup drg. Ahmad Zarnawi Pasaribu, terbaik serta tulus membangun Padanglawas. Seperti di sampaikan H. Agussalim Hasibuan CHt merupakan pasangan yang benar-benar mendapat simpatik masyarakat karena ramah alias Gumanti Hasibuan, tokoh masyarakat Kec. Sosa dalam sebuah lirik pantun; dan rendah hati. “Tor Dolok Martimbang Melihat figur dan karakter pasangan TSODi Toru nai Rondaman Palas Zarnawi yang ramah dan perhatian, telah Tole ita Pikir ita Timbang-timbang membuat banyak warga menjadi simpati baik Ise na Pade Pamimpin Padanglawas” di saat sebelum mendapat posisi ataupun jabatan. Semua pasangan calon Bupati dan wakil Menurutsejumlahwarga,figurpasanganSOBAR Bupati Padanglawas merupakan putra terbaik diyakinicukupmelekatdihatimasyarakat,baikwarga daerah Padanglawas, untuk itu mari kita pikir yangadadisekitarlingkungankerjamaupundiluar dan pertimbangkan siapa yang terbaik untuk lingkungan kerja, mereka tetap berlaku ramah dan memimpin Padanglawas. (a33) santun kepada semua orang, baik di kalangan anak muda, maupun alim ulama. Seluruh komponen masyarakat Padanglawas merasa berterimakasihdanbersyukur terhadap pasangan SOBAR ikut sebagai kontestan dalam pemilihan kepala daerah yang akan diselenggarakan 11 September 2013. Menurut H. Muhammad Nasir, mantan kepala desa UjungBatu,melihatsosokdan figur pasangan SOBAR cukup sederhana dan merakyat. Tidak pernah mereka berWaspada/Idaham Butarbutar bangga diri atas apa yang medrg. Ahmad Zarnawi Pasaribu, CHt berbaur dan duduk bersama reka capai, malah mereka masyarakat dalam satu acara silaturahim di Desa Ujung Batu, lebih suka berdiam diri, untuk Kec. Sosa.

Camat Dan Kades Jangan ‘Mainkan’ Dana Raskin PANYABUNGAN (Waspada): Para camat dan kepala desa di Kab. Mandailing Natal diharapkan tidak mempermainkan dana beras miskin (raskin). Pembayaran uang raskin yang diterima dari masyarakat hendaknya disetorkan tepat waktu, sehingga tidak mempersulit realisasi penyaluran beras miskin (raskin) pada jadwal berikutnya. “Program beras untuk keluarga miskin (Raskin) merupakan subsidi pangan yang diperuntukkan bagi keluarga miskin sebagai upaya pemerintah untuk meningkatkan ketahanan pangan dan memberikan perlindungan pada keluarga miskin,” kata Bakhtar Nasution salah seorang pengamat sosial di Madina, Rabu (24/7). Bakhar menjelaskan, selama ini banyak kepala desa di Madina tidak membayarkan uang raskin tepat waktu atau ditunda-tunda, padahal semua warga yang mendapatkan

bantuan beras membayarkannya secara kontan. Kita berharap agar kejadian selama ini tidak terulang lagi karena tujuan penyaluran beras miskin itu untuk mengurangi beban pengeluaran rumah tangga sasaran (RTS) melalui pemenuhan sebagian kebutuhan pangan pokok dalam bentuk beras dan mencegah penurunan konsumsi energi dan protein. Kemudian beras raskin tersebut bertujuan untuk meningkatkan/membuka akses pangan keluarga melalui penjualan beras kepada keluarga penerima manfaat dengan jumlah yang telah ditentukan, katanya. Selain itu, lanjutnya, warga miskin sama sekali jangan dijadikan sebagai kambing hitam terkait tunggakan pembayaran beras miskin seperti selama ini. Pasalnya, warga yang berhak menerima tidak pernah berutang atau tidak membayar sewaktu mendapatkan beras tersebut. (a28)

Kadis Koperindag Meninggal Akibat Serangan Jantung Waspada/Micky Maliki

PARA pejabat eselon III dan IV terlihat sedang mengambil sumpah jabatan di aula kantor bupati Karo Kabanjahe.

‘Blusukan’ JR, Jangan Cuma Tebar Pesona BUPATI Simalungun JR Saragih, memasuki bulan suci Ramadhan 1434 H tahun ini sengaja memboyong pimpinanSKPDdanunsurmuspida berkunjungkesejumlahkecamatan dan nagori (desa) dengan buka puasa bersama. Namun, kunjungan itu diharap tidak hanya sebuah pencitraan atau tebar pesona semata, hanya sebatas janji dan beri sedikit bingkisan kepada anak yatim dan dhuafa, lalu persoalan selesai. Selama Ramadhan ini, JR dan rombongan sudah mengunjungi banyak masjid, di antaranya Masjid Al-Munawwaroh di Perdagangan bertemu dengan warga dua kecamatan, yakni warga Kec. BandardanPematangbandar. Selanjutnya, JR berkunjung ke Masjid Taqwa Bahjambi bertemu dengan warga muslim dari Kec. Jawamaraja BahjambidanHutabayuRaja.

Dinilai Pemimpin Merakyat

tentang pemekaran Simalungun menjadi dua daerah kabupaten. Dalam setiap pertemuannya dengan warga di tiga titik kumpul tersebut, wacana pemekaran terusdisampaikan.Intinya,bupati meyakinkan dengan kata-kata indah bahwa pemekaran bukan hanya mimpi warga, tetapi juga mimpinya bahkan merupakan utang politik kepada masyarakat karena sudah dijanjikan sejak pilkada 2010. Adalah Daudsyah, tokoh masyarakat di Serbelawan dan mantan ketua PD Pemuda MuhammadiyahSimalungunmengkritisi kunjungan JR Saragih dan statemennya tentang pemekaran Simalungun hanya pencitraan dan tebar pesona semata. Dikatakan, sejak tiga tahun lalu, awal kepemimpinan JR menjadi bupati Simalungun, JR sudahsibukmintadukungandan doa untuk terwujudnya pemekaran. Isu itu tidak berubah hingga hari ini, tetap menjanjikan akan

segera mewujudkan pemekaran. Bahkan, beberapa waktu lalu, JR pernah menyumbangkan dana Rp100 juta kepada panitia pemekaran, namun kenyataannya upaya percepatan pemekaran Simalungun semakin tersendat. “Masyarakat sudah bosan dengan janji-janji dan tebar pesona. Bukti yang paling penting,” cetus Daudsyah, yang juga salah satu konseptor badan pemekaran Simalungun. Demikian halnya menyangkut minimnya pembangunan di sejumlah kecamatan. Mantan aktivis Pemuda Muhammadiyah ini menilai JR Saragih telah melakukan pembohongan publik, terutama menyangkut pemerataan pembangunan infrastrukturdiwilayahSimalungun bagian bawah. Contohnya, jelas Daudsyah, infrastruktur jalan di kotaSerbelawan,keadaanyacukup parah tanpa mendapat perhatian dari Pemkab Simalungun. “Kalaujalandisudutkotatidak

tersentuh, saya bisa maklum. Tetapi jalan yang rusak persis di pusat kota, bahkan sudah bertahun, apa maksudnya. Inikan jelas mempertontonkankebohongansemata,”ujar Daud kesal. Pada prinsipnya, lanjut Daud, dia tidak alergi dengan yang namanya kunjungan silaturrahmi atau buka puasa bersama oleh bupati. Tetapi masyarakatbutuhsolusi,bukti konkrit, bukan sekadar pencitraan dengan gaya tebar pesona,sedikitmemberilepasutang. Hal sama dikemukakan Sabar Damanik, warga Kec. Pematangbandar. JR Saragih diharapkan bertindak lebih konkrit mewujudkan pembangunan, tidak hanya sekadar lip service yang menyenangkan hati warga sesaat. “ Buktikanpemekaranitudapat terwujud tahun ini, itu baru paten,” tukasnya. * Hasuna Damanik

SAMOSIR (Waspada): Salah seorang pejabat Pemkab Samosir Ir. Jasmin Limbong MM meninggal dunia di RSU Dr. Hadrianus Sinaga Pangururan akibat serangan jantung, Rabu (24/ 7) sekira pukul 11.00. Jasmin Limbong yang menduduki jabatan Kadis Koperasi, Pertambangan, Perindustrian dan Perdagangan ini dikenal sebagai pejabat yang mampu menggiring dana dari APBN Pusat. Sekretaris Dinas Koperindag SamosirWalson Sagala kepada Waspada, Rabu (25/7) mengatakan, selama tujuh tahun menjabat Kadis beliau dikenal sukses menggiring dana pusat seperti dana dari Kementerian Perdagangan untuk pembangunan PasarTradisionalPangururandengannilaipuluhan miliar rupiah yang diresmikan Menteri Perdagangan RI pada 2011. KemudianmenggiringdanadariKementerian

PertambanganterkaitPembangunanPembangkit Listrik Tenaga Surya dan masih banyak lagi yang telah diperbuatnya untuk Samosir, ujar orang kedua di Dinas Koperindag Samosir. Direktur RSU Hadrianus Sinaga Pangururan Dr Nimpan Karo-Karo menjawab Waspada, Jasmin Limbong terkena serangan jantung, dan setibanya di RSU Pangururan langsung ditangani dr EVA Sidauruk, SP Pd Dokter Spesialis Jantung diRSUPangururandansudahtidakbisalagiditolong. Banyak pejabat datang menjenguk ke RSU Pangururan termasuk Sekda Samosir Ir Hatorangan Simarmata, ujarnya. Belum diperoleh informasi siapa yang akan melaksanakan tugas Kadis Koperindag Samosir. Sekda Samosir yang dihubungi Waspada, tak memberi jawaban rinci. “Maaf Lae, lagi rapat di BPMPOD,” ujarnya. (c11)

Kades Ditangkap Pesta Sabu PEMATANGSIANTAR (Waspada): Kepala Desa (pangulu atau Kades) Marihat Marsada, Kec. Dolok Panribuan, Kab. Simalungun KP, 40, yang memiliki sepucuk senjata softgun, diduga pesta narkotika jenis sabu-sabu bersama dua pria lainnya,ditangkapSatNarkobaPolresSimalungun. Penangkapan terhadap Kades bersama dua rekannya itu dilakukan personel Sat Narkoba di dalam satu rumah kosong di Dusun Pasar Baru, Desa DolokTomuan, Kec. Dolok Panribuan, barubaru ini. Saat dilakukan penangkapan, ditemukan barang bukti dan disita dari KP satu pucuk senjata softgun merk Petro Baretta dan beberapa pelurunya buatan Italia, lima bungkus kecil sabu, satu

plastik klip kosong, tiga pipet, satu jarum, dua mancis, kaca pirex berisi sabu, bong, dua unit HP dan uang Rp50.000. Informasi dihimpun, penangkapan terhadap KP bersama dua rekannya, Her, 38, warga Jalan Pematang, Kel. Simalungun, Kec. Siantar Selatan, Kota Pematangsiantar dan YM, 30, warga Pasar Baru, Desa DolokTomuan, Kec. Dolok Panribuan berdasarkan informasi dari masyarakat. Kapolres Simalungun AKBP Andi Syahriful Taufik,S.Ik,M.SisaatdikonfirmasimelaluiKasubbag Humas AKP H. Panggabean, SH dan Kasat Narkoba AKP Masku Sembiring, SH, Jumat (19/ 7) menyebutkan KP, Her dan YM masih dalam proses pemeriksaan. (a30)


Opini

B4 TAJUK RENCANA

Sikap Tegas Kapolda Sumut Cegah Keresahan Dan SARA

P

eristiwa pemukulan oknum polisi Brigadir Swl, anggota Polres Tapsel yang menyerang/menganiaya imam masjid saat melaksanakan shalat berjamaah di Padangsidimpuan merupakan peristiwa langka. Biasanya, oknum polisi sehat melakukan aksi main hakim sendiri terhadap masyarakat. Tapi, kejadian di Tapsel, oknum polisi mengidap kelainan jiwa memukul imam masjid yang tengah melaksanakan shalat berjamaah. Wajar saja kalau jamaah shalat marah, masyarakat di Tapsel juga marah, bahkan komunitas umat Islam di Sumut merasa resah. Bukannya tugas polisi mengamankan masyarakat, menjaga agar palaksanaan ibadah di bulan Ramadhan berlangsung lancar, tapi perbuatan Brigadir Swl malah membuat onar di masyarakat. Untung saja peristiwa tersebut cepat ditangani aparat keamanan, khususnya lembaga kepolisian segera melakukan penahanan terhadap pelaku yang menurut penjelasan Kapolda Sumut Irjen Pol Syarief Gunawan melalui Kabid Humas Poldasu Kombes Pol Heru Prakoso, pelaku pemukulan Brigadir Swl mengidap penyakit jiwa (skizoprenia paranoid). Upaya menarik Brigadir Swl ke Polda Sumut untuk pengobatan merupakan antisipasi yang pas. Kiranya perintah Kapolda Sumut segera mengobati tersangka Brigadir Swl patut diberi apresiasi. Sebab hanya melalui pemeriksaan ketat oleh tim ahli kejiwaan (dokter) saja pelaku Brigadir Swl dapat dipastikan apakah benar mengidap skizoprenia paranoid. Atau aksi biadab Brigadir Swl dilakukan atas kesadaran sendiri. Kalau disebutkan Brigadir Swl sudah lama diketahui mengidap penyakit jiwa kita patut menyesalkan pimpinan tempat pelaku bertugas di Polres Tapsel. Ada kelalaian dari atasan yang tidak mampu mendeteksi. mengawasi, dan perubahan sifat anggotanya. Sebab, penyakit jiwa jenis skizoprenia paranoid ini sesungguhnya dapat dengan mudah diketahui ciri-cirinya. Dari kliping dan info kesehatan disebutkan, penyebab timbulnya penyakit skizoprenia paranoid yang utama yaitu faktor neurobiologis, di mana terjadi ketidakseimbangan pada dopamine, yaitu salah satu sel kimia dalam otak. Faktor lain yang dapat memicu skizofpenia yaitu genetik, perkembangan janin, juga faktor psikologis Intisari dan sosial. Kalau melihat jenisnya beragam, skizoparanoid biasanya ditandai dengan Skizoprenia paranoid me- prenia sifat rasa curiga, bermusuhan, garang. Hal rupakan gangguan men- ini terjadi karena munculnya halusinasi. Iniyang terjadi pada pelaku Brigadir Swl. tal serius maka Brigadir lah Sedangkan skizoprenia katatonik ditandai Swl harus dirawat di RS dengan berbagai gangguan motorik, termasuk kegembiraan ekstrim dan pingsan. ConJiwa tohnya tidak mau makan, tidak mau minum, mematung, tidak mau berbicara. Jenis berikutnya skizoprenia disorganized dengan ciri utamanya pembicaraan kacau, tingkah laku juga kacau, dan afek yang datar atau inappropriate. Skizoprenia simplek (seperti gelandangan, jalan terus, kluyuran), skizofrenia hebefrenik (seperti anak kecil, merengekrengek, minta-minta), dan skizofrenia residual tidak ada yang menonjol dalam hal delusi, halusinasi, pembicaraan kacau, tingkah laku kacau atau tingkah laku katatonik. Jika memang betul pelaku Brigadir Swl mengidap skizoprenia paranoid, berarti pimpinan polisi di Tapsel maupun Kapoldasu wajib tanggap untuk mengobati anak buahnya sampai benar-benar sembuh. Masalahnya penyakit ini ternyata salah satu penyakit yang berbahaya, karena penyakit ini berhubungan dengan kejiwaan. Secara garis besar skizoprenia merupakan gangguan mental yang serius yang ditandai dengan hilangnya kontak dengan realitas (psychosis), adanya halusinasi, delusi (keyakinan palsu), berpikir, bertingkah laku dan punya hubungan sosial yang kacau. Bisa dibayangkan bagaimana jadinya andai Brigadir Swl kembali ditugaskan tanpa pengobatan intensif. Pastilah bakal menimbulkan keresahan di masyarakat. Apalagi kalau sampai oknum polisi tersebut diberi wewenang, dilengkapi dengan senjata pistol atau senjata tajam. Masyarakat semakin resah. Korban lebih parah bisa berjatuhan. Dan bahaya besar bisa terjadi andai Brigadir Swl dibiarkan bebas dan melakukan tindakan melibatkan etnis lain, agama lain, sehingga menjurus konflik SARA. Justru itu, sebelum jatuh korban jiwa, sebelum masyarakat semakin resah, bahkan dapat menimbulkan konflik tak diinginkan berbau SARA, kiranya Kapolda Sumut tegas menarik Brigadir Swl ke Polda di Medan, dimasukkan ke rumah sakit jiwa untuk ditangani para dokter ahlinya. Andai vonis dokter memang Brigadir Swl mengidap penyakit jiwa berat harus ada tindak lanjut dari lembaga kepolisian untuk member-hentikannya. Harapan kita, statement dari para tokoh ulama di Tapsel dan Sumut mendapat perhatian dari Kapoldasu. Tujuannya baik, kalau memang pelaku Brigadir Swl sakit jiwa harus dirawat di RS jiwa, bukan malah dibebaskan bertugas di lapangan. Itu sama saja dengan merusak citra dan kepercayaan masyarakat pada polisi.+

APA KOMENTAR ANDA SMS 08116141934

Faks 061 4510025

Facebook Smswaspada

+6281265412540 Metode HISAB untuk menentukan 1 Ramadan dicela meng- ada2 & tidak populer oleh ust. Nasir Lc. Lalu bagaimana pula penentuan ‘Imsakiyah Ramadan’ juga pakai metode HISAB. Apakah juga meng-ada2.?. kan sama2 menghitung yang Belum Terjadi. Apabila 1 Ramadan ditentukan pakai metode RUKYAH mestinya menentukan waktu berbuka, imsak, shalat, juga dengan RUKYAH. Yaitu dengan melihat tanda2 alam (terbit pajar sidik, tergelincir bayangan, terbenam matahari, dll). Namun fakta yang populer dikalangan umat adalah mempedomani ‘Imsakiyah Ramadan’. Begitu juga melihat ‘hilal’ harusnya dengan mata telanjang tapi nyatanya pakai teropong. Apakah juga meng-ada2. +6282166762161 Kepada no hp 085373348835. memang klu keberatan dgn rumah yg di jl.st sori pada mulia.dtg aja kerumah saudaramu itu.kami siap melayaninya.jgn di koran aja anda berkomentar.kmi siap melayani anda.Dimanapun kpnpun jga. +6281361787964 Kritik santun media, biasanya tidak didengar. Kalau pejabat tidak usah pala santun yg penting amanah, jangan pula yg doyan ‘ aminah ‘. +6281375411631 Zaman reformasi lebih pelik dari zaman orba. Kalau sekarang menentukan suatu kebijakan semua ngoceh,yang inilah yang itu la. Begitulah kalau sudah orang banyak pintar di Indonesia ini, tapi kok di beri kewenangan yang pintar korupsi, bersatulah kita saling dukung jangan saling menyalahkan, walau ada perbedaan! Kalau di kasi bicara, di buat begini yang lain menyalahkan, di buat bgtu yang lain lagi menyalahkan, semua sok merasa pintar, penulis sendiri kadang2 muak lihat orang2 pih menjadi keputusan saling dukunglah. Semoga waspada selalu sukses. Amiiin.. +6281375411631 Ketua Komisi IV DPR RI apa maksudnya itu,urusan jengkol aja yg dia tau, ngapai masalah jengkol yg dia atur? Atur masalah rakyat yg lebih besar. Jengkol mahalkan se kali2 biar rakyat yang punya pokok jengkol bisa nikmatin sedikit hasilnya, ini sibuk nyuruh rakyat jangan makan jengkol dl. Model kayak pak Herman gak pantas jadi wakil rakyat. Pokok jengkol itu rata2 punya rakyat jadi ada naik sedikit aja harganya pak Herman Khaeron sibuk menghimbau jangan makan jengkol dl. Banyak lagi di negara kita bahan pokok yang melonjak tinggi tapi bapak itu karena lihat diam2 aja. Ini jengkol harga naik dikit wah kicaunya ...tak bonafid. Di media penulis bc dng mengatas namakan DPR: STOP SEMENTARA MKN JENGKOL. +6281375411631 Jadi rahasia umum 99,9% yang ilegal itu di bekingi aparat. Jadi tak usah heran! Sekarang yang di butuhkan, dalam perekrutan menjadi aparat itu jangan pakai uang sogok ratusan juta rupiah. Jadi kalau itu di bersihkan, mudah2an aparatnya pasti berdedikasi, karena betul2 yang berprestasi. Wassalam salam waspada. +6285260088842 “BOLEH BACA SEMUA UMUR” Bagi yang sudah Lanjut Usia (LANSIA) agar tetap segar dan vit serta memperlambat pikun dianjurkan meningkatkan ketaqwaan, amal Ibadah dan terus rajin membaca buku yang bermanfaat serta jangan lupa tiap hari baca harian WASPADA. InsyaAllah lansia tetap sehat dan bugar. He he he. -(z@s)+6285277850101 Fahri H, A.Yani, N.Munir, Bambang S dll pada strees dan panik karena dicemooh RAKYAT dan dibongkar KPK serta diponten/dinilai ICW. He he he...Rasaiiiinn +6281396184826 Kepada komisi 9 DPR RI jangan asal donk dengan tidak ada layanan jamkesda masyarakat sudah sedikit senang dengan layanan itu karena rakyat bisa mencicipi sedikit hasil dari pajak mereka.

WASPADA Jumat 26 Juli 2013

Menanti KPU Lebih Profesional Oleh Yulhasni Pertanyaan besar sekarang terbentang di depan kita ketika proses rekrutmen anggota KPU mulai digelar.

S

ejak Orde Baru lengser dan Soeharto diganti Habibie, maka perubahan politik di Indonesia mendapatkan sebuah gerakan yang cukup drastis. Kita mengetahui bersama, di bawah tekanan reformasi, Presiden Habibie tidak bisa berleha-leha pasca lengsernya Soeharto. Gerakan reformasi menuntut segera digelarnya pemilihan umum yang bebas tanpa campur tangan kekuatan Orde Baru, meski pada saat itu Golkar masih menguasai DPR/MPR. Berbagai keputusan politik pun dilahirkan sejak itu. Sidang Istimewa MPR pada awal November 1998 mengesahkan Tap MPR No.XIV/1998 yang memerintahkan kepada presiden untuk menyelenggarakan Pemilu selambatlambatnya 7 Juni 1999. Selanjutnya pada pada 1 Februari 1999 disahkan Undangundang Nomor 3 Tahun 1999 tentang Pemilihan Umum (UU No. 3/1999). Seperti diketahui, setelah itu maka Lembaga Pemilihan Umum (LPU) sebagai penyelenggara Pemilu kemudian direformasi menjadi Komisi Pemilihan Umum (KPU). Perubahan inilah kemudian yang dipahami sebagai titik awal Pemilu yang lebih demokratis, jujur, dan tentu saja independen. Karena sejak awal sudah jadi rahasia umum jika LPU adalah mesin politik untuk memenangkan Golkar pada tiap Pemilu di tanah air. Reformasi itu bahkan dilakukan sampai struktur paling rendah sebagai bagian dari perubahan struktural jika dilihat dari posisi, peran, dan fungsinya. Proses politik yang panjang yang diikuti dengan pergantian berbagai rezim kekuasaan, melahirkan setidaknya berbagai keputusan politik, terutama terkait penyelenggaraan Pemilu itu sendiri. Dari awal setelah Soeharto lengser, tentu saja proses penyelenggaran Pemilu yang dikerjakan KPU menuai banyak persoalan. Bahkan banyak pihak yang berpendapat, bahwa Pemilu 1999 masih dikategorikan sebagai titisan Orde Baru yang masih ingin berkuasa. Meski Pemilu 2004 adalah satu contoh baik dalam proses awal dari demokrasi, akan tetapi seperti diketahui, keadaannya justru berakhir tragis. Pada Pemilu 2004 ini KPU diberi beban yang untuk pertama sekali harus menyelenggarakan Pemilu presiden secara lang-

sung, sesuatu yang ‘haram’ dilakukan pada masa Orde Baru. Selain itu KPU juga harus mengatur dan melaksanakan Pemilu legislatif yang semakin beragam dan kompleks yakni pemilihan DPR/ DPRD dengan sistem proporsional daftar terbuka dan pemilihan DPD dengan sistem mayoritarian. Pemilu dengan volume pekerjaan yang besar dan kompleks itu berhasil diselenggaran dengan baik dengan mendudukkan Soesilo Bambang Yudhoyono (SBY) dan Jusuf Kalla sebagai presiden pertama yang dipilih secara langsung. Tapi nasib KPU tidak seperti SBY- Jusuf Kalla, ketua, anggota dan staf masuk penjara karena kasus korupsi. Tidak jauh berbeda dengan sebelumnya, pada 2009 dianggap sebagai Pemilu terburuk pasca Orde Baru. Betapa tidak, sejumlah komisioner yang ditunjuk dinilai sebagai ‘bentukan’ pemerintah karena mendudukkan tim seleksi yang dekat dengan kekuasaan. Meski hasilnya diterima, tetapi banyak pihak menganggap KPU gagal karena begitu banyaknya persoalan yang muncul dalam Pemilu kali ini. Imbasnya tidak hanya terjadi di pusat tetapi kemudian merembes ke daerah provinsi, kabupaten/kota yang hendak dan sedang mengadakan Pemilihan Kepala Daerah (Pilkada) langsung sepanjang 2010-2013. Berbagai gugatan ke MK mengalir bah air bah begitu hasil pemilihan kepala daerah selesai digelar. Apalagi kemudian MK memperluas ruang gugatan seperti ketika penggugat menemukan indikasi adanya pelanggaran yang masif, sistematis dan terstruktur, peserta dipersilakan mengajukan gugatan. Tentu saja bermacam persoalan penyelenggaraan Pemilu sejak Soeharto lengser mengarah kepada penyelenggara Pemilu. Tentu saja perubahan ini bertujuan untuk perbaikan penyelenggaraan Pemilu ke depannya. Pasca Pemilu 2009, kredibilitas KPU yang telah jatuh karena kinerjanya yang mengecewakan dan kemandiriannya yang digugat menyebabkan DPR kemudian DPR menggunakan hak interpelasi dalam usaha membongkar satu kasus besar karena ternyata banyaknya warga negara yang tidak bisa memilih. Hasilnya, DPR kemudian mengganti UU No 22/

2007 dengan UU No.15/2011. Langkah DPR ini memang dinilai sebuah tindakan yang blunder karena berharap orang partai masuk menjadi penyelenggara Pemilu. Langkah yang tentu saja kembali ke zaman Orde Baru ketika Soeharto dengan gampang mengotak-atik penyelenggara Pemilu untuk melanggengkan kekuasaannya. Langkah DPR ini akhirnya memang mentok di Mahkamah Konstitusi (MK) dengan menghapus pasal tersebut. Konsekuensinya, terjadi pembengkakan kelembagaan pengawas Pemilu dan penegak kodek etik KPU. Pada Pemilu 2014 ini komposisi lembaga yang terlibat dalam penyelenggaran Pemilu adalah \\t “_blank” KPU, KPU Provinsi, KPU Kabupaten/Kota, \\t “_blank” Bawaslu, Bawaslu Provinsi, Panwaslu Kabupaten/Kota, Dewan Kehormatan Penyelenggara Pemilu.

Pertanyaan besar sekarang terbentang di depan kita ketika proses rekrutmen anggota KPU mulai digelar. Apakah diubahnya UU Pemilu dan diletakkannya seperangkat aturan yang mencoba menjaga independensi KPU, maka penyelenggaraan pesta demokrasi berjalan sesuai dengan yang diharapkan rakyat? Memang seperti anekdot banyak orang, seperti apapun peraturan dibuat, selagi mental penyelenggaranya korup, maka Pemilu tidak akan berbeda jauh dengan masa-masa sebelumnya. Nah, sekarang tinggal kita menunggu apakah mereka yang kelak duduk di KPU adalah petualang-petualang politik atau memang orang yang padanya kita berharap Pemilu bisa berjalan secara demokratis. Penulis adalah Dosen FKIP UMSU, Mantan Ketua Timsel KPU Medan 2009.

KNIA Mimpi Sumut Jadi Kenyataan Oleh Sofyan Harahap Momentum yang menggembirakan itu pun tiba,25 Juli 2013, KNIA dioperasionalkan secara resmi oleh pemerintah.

M

embandingkan Bandara Polonia Medan dengan Bandara Singapura (Changi) atau KLIA (Kuala Lumpur International Airport) perbedaannya mencolok, ibarat siang dengan malam, sehingga usulan pemindahan Polonia sudah muncul sejak tahun 1990an. Namun hal itu masih sebatas wacana dan wacana, sementara realisasinya entah kapan, serba tidak jelas, seperti juga beritanya selalu timbul tenggelam. Setelah terjadi musibah pesawat MandalayangditumpangiGubsuHTRizal Nurdinpadatahun2005pemerintahpusat dan daerah tampak bersungguh-sungguh mewujudkan Bandara baru di Kuala Namu, Kab. Deliserdang. Itu pun tidak mulus. Proyek pembangunan Bandara Kuala Namu berjalan tersendat-sendat sehingga baru selesai tahap soft operation, Kamis (5 Juli 2013). Rencana berikutnya, Presiden Susilo Bambang Yudhoyono baru akan meresmikan KNIA (Kuala Namu International Airport) ini pada 9 September mendatang. Untuk saat ini nama Bandara baru pengganti Polonia Medan disingkat KNIA. Ini jalan tengah, karena jauh sebelumnya sudah muncul puluhan nama pejuang, bergelar pahlawan nasional untuk ditabalkan sebagai nama Bandara baru ini. Mulai dari Sisingamangaraja, H. Adam Malik, HT Rizal Nurdin, T. Amir Hamzah dll. Namun pemerintah pusat dan daerah belumberanimenyimpulkanataumengerucutkannya menjadi satu nama. Takut menimbulkan rasa tidak senang bagi pendukung nama tertentu yang gagal. Sebab, masing-masing tokoh memiliki jasa bagi bangsa dan negara khususnya membangun dan mengharumkan nama Sumut. Modern dan canggih Masyarakat Sumut pasti gembira memiliki Bandara baru yang cukup modern, canggih, dan bertaraf internasional dengan biaya Rp5,8 triliun. Bandara KNIA sungguh membanggakan dan pasti dapat mempercepat pertumbuhan ekonomi di berbagai kabupaten-kota. Masyarakat Sumut pantas bersyukur dengan selesainya KNIA bertaraf internasional, menyenangkan buat pilot untuk pendaratan pesawatkarenapanjangrunwaymencapai 3.750 meter dibuat sesuai standar dunia sehingga dapat menampung kedatangan 33 pesawat per jam, termasuk yang berbadan lebar Boeing seri 747 dan Airbus A-380. KLIA adalah bandara baru pengganti Bandara Polonia yang luasnya terbatas hanya 153 ha dan sudah lama mengalami kelebihan beban ‘’over capacity’’ dengan kapasitas 900 ribu penumpang, melayani

sekitar 7,1 juta pergerakan penumpang per tahun. Sedangkan bandara baru (KNIA) luasnya mencapai 1.365 ha mampumelayani8,1jutapenumpangpertahun dengan areal terminal penumpang seluas 86,000 m2, dan akan terus dikembangkan gunamelayanipertambahanpenumpang untuk jangka panjang, bahkan dengan 2 runway paralel seperti di KLIA dan Changi, areal parkir KNIA mampu menampung 1400 kendaraann roda empat. Bagi masyarakat Sumut memiliki Bandarayangdilengkapidenganteknologi canggih dan fasilitas modern untuk menunjang pelayanan kepada seluruh pengguna jasa transportasi udara merupakan mimpi yang menjadi kenyataan. KNIA modern dan tak kalah jauh dari Bandara di luar negeri. Bandara ini sudah lama diimpikan, namun baru terwujud sekarang ini. Walaulokasinyacukupjauh,mencapai 40 km dari pusat kota Medan, sehingga menempuh waktu satu jam bila kondisi jalan raya tidak macet dan bisa 2 jam bila jalanan macet. Cukup banyak pilihannya. Sayang, jalan tol yang digembar-gemborkan menuju KNIA belum juga dimulai. Padahal, jalan tol Medan – Bandara merupakankeharusanuntukmenunjangkelancaran transportasi penumpang maupun barang. Saat ini tersedia pilihan bus Bandara KNIA di karidor Medan Fair Plaza, karidor Ring Road Jalan Binjai, dan karidor Amplas dengan tarif bervariasi antara Rp10 ribu hingga Rp30 ribu per penumpang tergantung jaraknya. Pilihan transportasi darat lainnya dengan taksi, dengan jarak tempuh tak berbeda jauh dengan bus sekitar 60-90 menit.Tarif resmi rata-rata per sekali jalan dari Kota Medan ke Kuala Namu berkisar Rp 145.000. Yang istimewa dari KNIA dibandingkan Bandara lain di Indonesia adalah fasilitas Kereta Api Bandara. Transportasi yang dikelola PT Railink ini mengantar dan menjemput penumpang dari Stasiun Besar Medan menuju Bandara dengan tarif mahal Rp80 ribu per penumpang. KA Bandara memang bebas macet. Jika perjalanannya tidak dibatasi dapat dipastikan bakal terjadi kemacetan luar bisa di inti kota, karena perjalanan KA Bandara ini berlangsung hampir setiap jam.Tepatnya dari stasiun Medan ke Kuala Namu: 03.30; 04.50; 06.15; 08.20; 11.10; 13.45; 15.15; 17.15; 19.20; dan 20.00WIB. Sementara jadwal dari Kuala Namu ke Medan adalah: 05.50; 06.20; 08.00; 09.25; 12.25; 14.55; 16.25; 18.50; 20.25; dan 24.15 WIB. Konsekuensi logis keberadaan fasilitas kereta api langsung ke Bandara baru ini

dipastikan menimbulkan kemacetan lalu lintasdikotaMedan,khususnyadikawasan perlintasan KA yang dilalui, seperti di Jl. Ani Idrus, SM Raja, Jl.Sutomo, Jl.Thamrin, Jl. AR Hakim dll. Apalagi kalau perjalanan KA ditingkatkan menjadi setiap setengah jam sekali hampir pasti kota Medan bakal lumpuh total. Justru itu, moda KA Bandara ini harus mendapat perhatian besar dari semua pihakterkaitdiPemprovsu,terlebihpejabat Pemko Medan. Bisa saja dipertahankan namun harus ada inovasi membuat jalur KA di bawah tanah atau jalan layang kereta api untuk mengantisipasi kemacetan di inti kota. Inilah menjadi tugas berat Pemko Medan mewujudkannya. Begitu juga ganti rugi kepada masyarakat harus segera dituntaskan. Bandara lama KitapatutbersyukurmemilikiBandara megah dan jauh lebih modern ketimbang Bandara Polonia yang dibangun pemerintahBelandadimasatempodoeloe.Polonia punsudahdikembalikankeLanudMedan, tentunyamasihdapatdipergunakanuntuk penerbangannon-komersialataupesawat kecil. NamuntetapsajaPoloniamenyimpan banyak masalah (dilematis).Tidak hanya areal di sekitarnya saja sudah semakin sempit dengan tumbuhnya bangunan komersial. Ini tidak hanya membuat Polonia semakin rawan kecelakaan tapi juga menghambat perkembangan kota Medan jika Polonia masih tetap dikomersialkan. JustruituBandaralama(Polonia)harus dipikirkanmaudijadikanapakedepannya. Perlu dikaji apakah akan terus dimanfaatkan untuk penerbangan khusus, seperti halnya Bandara Halim Perdanakusumah, Jakarta, atau juga dipindahkan ke lokasi lain alias ditutup total. Pastiadauntungdanruginyamempertahankan Bandara lama yang pernah mengalami musibah fatal saat pesawat Mandala gagal terbang (take off) pada 5 September 2005, menewaskan seratusan orang, termasuk di antaranya Gubsu HT Rizal Nurdin, mantan Gubsu Raja Inal Siregar, anggota DPD Sumut Drs H Abdul Halim Harahap. Sangat mungkin kecelakaan pesawat terulang kembali di sana jika tetap dipertahankan, sementara biaya perawatannya tidak kecil. Apalagi kalau bermunculanbangunanbarudisekelilingnya, seperti perumahan dan pusat bisnis serta pusat hiburan maka Polonia semakin terjepit. Pihak otoritas Bandara lama pasca dikembalikan ke Lanud Medan bersama dengan pihak terkait perlu memperjelas ‘’road map’’ Bandara Polonia untuk kepentingan yang jauh lebih luas manfaatnya bagi masyarakat. Alangkah positifnya jika Polonia dijadikan areal terbuka hijau, atau paru-paru kota Medan mengingat ruang terbuka hijau Medan relatif kecil. Berpuluh tahun pembangunan kota Medan me-ngambil jatah ruang terbuka hijau berupa fasilitas sosial dan umum milik masyarakat (pu-

blik) untuk kepentingan pengembang perumahan dan pertokoan, hotel, plaza dll. KitaberharapPemkoMedanmemperbanyak kawasan taman terbuka hijau untuk paru-paru kota sekaligus mengantisipasi datangnya bencana banjir yang semakin sering mengancam kota Medan. Caranya membujuk instansi terkait merelakan Polonia menjadi‘’icon’’ paru-paru kotaterbaikdiIndonesia.SehinggaBandara baru dan yang lama sama-sama membanggakan Sumut. Penutup Momentum yang menggembirakan itu pun tiba, 25 Juli 2013, KNIA dioperasionalkan secara resmi oleh pemerintah. Walau di sana-sini masih banyak fasilitaspendukungbelumrampungnamun peresmiannya menjadi tonggak sejarah baru buat Sumut. Mimpu Sumut memiliki Bandara modern bertaraf internasional terwujud sudah, mimpi lama itu menjadi kenyataan. KNIA menyamai KLIA. Semoga soft operation KNIA membuahkan kemajuan buat Sumut, khususnya kota Medan dan daerah-derah di sekitar Kuala Namu.*** Penulis adalah Wapenjab Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengandilengkapibiodatapenulisdan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/ tidak diterbitkan di Media manapun. Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Menteri BUMN sambut baik Pansus Kelistrikan - Iyalah, KNIA sudah take off, listrik kelap kelip * Wagubsu: Sumut harus raih predikat WTP - Cuma sayang listrik sering mati, he....he...he * TB Silalahi mengaku mantan Anak Koran Waspada - Bangganya awak!

oel

D Wak


Opini

WASPADA Jumat 26 Juli 2013

B5

Taman Pintar Untuk Medan Surat Terbuka Untuk Presiden Assalamu’alaikum Warrahmatullahi Wabarakatuh. Kepada Yang Terhormat Presiden Republik Indonesia. Bapak Susilo Bambang Yudhoyono. Sudah terlalu lama dan sudah memasuki tahun ketujuh hingga surat ini ditulis. Ketidakjelasan kedudukan yayasan UISU di mata hukum bagi masyarakat kota Medan khususnya dan masyarakat Indonesia secara keseluruhannya. Keadaan lembaga Pendidikan Islam tertua di pulau Sumatera yang bernama Yayasan Universitas Islam Sumatera Utara (Yayasan UISU) dan kedudukan awalnya berada di Jalan Sisingamangaraja Medan. Sangat banyak orang tua, masyarakat dan mahasiswa kecewa, dirugikan dan menderita karena keributan antar pengurus di Yayasan UISU tersebut. Sedangkan para orang tua yang khususnya berada di kota Medan masih sangat banyak berharap agar universitas Islam swasta yang juga PTS pertama di kota Medan ini tetap menghasilkan sarjana, teknokrat dan intelektual Islam. Awalnya Yayasan UISU di Jalan SM.Raja Medan ini dipimpin para ulama yang mewakili Ormas-ormas Islam yang ada. Para pendirinya memiliki nilai dan integritas keislaman yang sangat baik dan sangat taat, patuh dan warak kepada agama dan hukum Islam. Namun keadaan Yayasan UISU hingga saat ini sudah sangat memprihatinkan semua umat Islam, karena terpecahbelah akibat perebutan jabatan atau kekuasaan. Bila dilihat secara kasat mata keributan ini dilakukan oleh para generasi kedua atau anak-anak dari para pengurus pertama, yang disusupi serta diperkeruh dengan masuknya pihak ketiga. Pihak ketiga ini adalah oknum-oknum yang dimasukkan ke dalam yayasan untuk kepentingan masing-masing kubu/kelompok. Merekapun oknum-oknum yang mempunyai ilmu dan sangat mumpuni serta berpendidikan tinggi bahkan ada yang profesor yang keberadaanya (mungkin) belum jelas (bila mereka alumni mungkin masih bisa dianggap mewakili). Mereka tanpa rasa malu mengklaim dirinya adalah pengurus yayasan UISU. Adanya dualisme kubu kepengurusan di Yayasan UISU, yang satu kubu/ kelompok tetap berada di lokasi semula di Jl.SM.Raja Medan dengan menamakan yayasan UISU Al-Munawaroh dan satu lagi kubu/kelompok Yayasan UISU Al-Manar yang berada di Jl.Karya Bakti Pangkalan Masyhur Medan. Kondisi seperti ini sekarang semakin membuktikan kepada kita tidak akan mungkin kedua kubu yang masing-masing mengklaim Yayasan UISU yang benar tersebut akan islah atau berdamai. Sampai kiamat pun pasti tidak mungkin mereka akan dapat disatukan. Ibarat minyak tidak akan dapat bercampur dan menyatu dengan air, karena umumnya mereka lebih mencintai jabatan (tahta) dan mementingkan uang (harta) di dunia, ketimbang nama besar UISU dan kejayaan Islam. Kedua-dua Yayasan UISU ini sama-sama mempunyai kelemahan di sisi hukum yang berlaku. Yayasan UISU Al-Munawaroh yang berada di Jl.S.M.Raja Medan satu sisi berada di lokasi semula (defacto), namun mereka tidak mempunyai surat izin operasional resmi dari Mendiknas. Sedangkan yang satu lagi Yayasan UISU Al-Manar yang berada di Jl.Karya Bhakti Pangkalan Masyhur Medan yang sah secara Hukum (dejure), dan mereka memegang izin operasional resmi dari Pemerintah Republik Indonesia Cq. Menteri Pendikan Nasional Republik Indonesia. Namun mereka tidak berada di lokasi Jl.SM.Raja Medan. Berbagai mediasi dan musyawarah telah dilakukan oleh Mendiknas, Gubsu, MUI dan Kopertis Wilayah I untuk menyatukan kedua pengurus yayasan tersebut. Namun tidak dapat juga menyelesaikannya dengan baik. Bahkan pihak yang resmi dari pemerintah yang mengatur PTS yang berada di lokasinya pun membuat masalah menjadi lebih runyam dengan kebijakan yang dijalankannya. Untuk ini umat Islam di seluruh Indonesia berharap banyak kepada Presiden Republik Indonesia, bapak Susilo Bambang Yudhoyono untuk dapat kiranya turun tangan menjembatani. Karena bila dibiarkan berlarut-larut dan kasusnya tetap diabaikan, mungkin dapat menimbulkan ketidakamanan dan ketidaknyamanan masyarakat dan memungkinkan akan timbulnya konflik baru—pastilah akan tetap terus merugikan umat Islam. Maka dengan telah diselesaikannya kasus Yayasan UISU ini maka akan tercipta beberapa hal sebagai berikut: Memberikan kepastian hukum kepada masyarakat banyak dan para mahasiswa sehingga dapat membuat ketenangan para orang tua dan calon mahasiswa dalam memilih perguruan tinggi yang diakui dan mempunyai status legal dan resmi, karena kondisinya persis bersamaan dengan di awal tahun ajaran baru, Tahun Akademi 2013/2014. Semoga surat terbuka untuk bapak Presiden ini dapat memberikan pencerahan dan pemahaman ke dalam lubuk hati terdalam. Kepada semua pihak yang terlibat langsung maupun tidak langsung, dan kiranya surat terbuka ini dapat pula memberikan solusi atau masukan sehingga ke depannya dunia pendidikan kita semakin baik dengan tingkat kenyaman serta keamanan yang dapat terkendali dengan baik pula. Sehingga Yayasan UISU kembali dapat melahirkan sarjana dan intelektual Islam yang lebih baik, berbobot dan bermutu dalam bidang ilmunya serta berakhlakul kharimah. Amin. Wassalamu’alaikum Warrahamatullajhoi Wabarakatuh Ir Zulkifli AM. Alumni Fakultas Teknik UISU Angkatan Tahun 1982

Dosa Mana Memegang Babi Atau Pacar? Bismillah ... Ada yang becanda bertanya “Malam Minggu ini mau jalan sama pacar atau sama babi? Lalu yang ditanya malah balik nanya “Lho... apa maksudnyaaa? Mari coba baca dan pahami maksud hadis berikut: Hadis Rasulullah SAW: Berkumpul-kumpul dengan hewan babi (khinzir) lebih baik daripada bersentuhan (secara sengaja) dengan wanita yang bukan Muhrim (HR. Ibnu Majah). Coba Anda pikirkan kalau kita tersentuh babi atau anjing kita tidak bakal berdosa, paling disuruh mensucikan dengan tanah. Sedangkan jika bersentuhan dengan wanita bukan mahram secara sengaja ini dihitung sebagai dosa (maksiat). Coba simak dan pahami hadis Ma’qil bin Yasar Radhyiallahu ‘Anhu: Andaikata kepala salah seorang dari kalian ditusuk dengan jarum besi, itu lebih baik baginya daripada menyentuh wanita yang tidak halal baginya. (HR. Ar-Ruyani dalam Musnad-nya no.1282, Ath-Thabrani 20/no. 486-487 dan AlBaihaqi dalam Syu’abul Iman no. 4544). Hadis ini menunjukkan bahwa menyentuh/berjabat tangan dengan selain mahram adalah dosa besar (Nashihati lin-Nisa’ hal.123) Berkata Asy-Syinqithy dalam Adwa‘ Al-Bayan (6/603): Tidak ada keraguan bahwa fitnah yang ditimbulkan akibat menyentuh/berjabat tangan dengan selain mahram lebih besar dan lebih kuat dibanding fitnah memandang. Berkata Abu ‘Abbas Ahmad bin Muhammad bin ‘Ali Al-Makky Al-Haitami (Az-Zawajir 2/4) bahwa: Dalam hadis ini menunjukkan bahwa menyentuh dan berjabat tangan dengan selain mahram adalah termasuk dosa besar. Kalau diperhatikan lagi, babi adalah hewan yang amat sangat kotor, bisa dikatakan hina. Jadi pleaeseeeee jangan lebih menghinakan diri dari pada hewan babi tersebut sahabat. Kalau tidak tahu selama ini, tidak apa-apa, tapi sekarang sudah tahu-kan. Ayo segera hentikan aktivitas pacaran tersebut! Pelaku pacaran, segeralah bertaubat! Putuskan pacarmu sekarang juga! Ibnu Ahmad Amin Al-atsari email: \\t “_blank” abdulghofur88@gmail.com

Dagelan Iblis Sebuah dagelan tentang Iblis dikirimkan teman kepadaku,ia tahu nomorku dari Komentar Waspada.”Yang menarik dari cerita Iblis tersebut tentang keinginan iblis untuk pensiun dini, karena ia selalu menjadi Kambing Hitam. Pezina, koruptor & kejahatan lain yang dilakukan manusia, selalu Iblis yang jadi korban. Hingga iapun menyerah,takut tergoda oleh manusia yang kelakuannya melebihi Iblis. Bahkan dimusim haji sekalipun, berjuta-juta umat didunia melemparinya dengan batu,padahal banyak diantara merek teman2nya juga” Cerita yang indah. Walau cuma dagelan, tapi sipengirim sms mungkin ingin berbagi kisah tentang kerisauan para Iblis,dimana hak2 mereka mulai dikebiri oleh manusia sebagai biang kerok.Jika Iblis menyerah karena takut tergoda lebih jauh,semoga para pendosa segera insyaf. Kalau Iblis memberi inspirasi pada Nazarudin, Aril & CS nya. Apakah ini tidak cukup buat orang2 yang bermasalah segera sadar?.Mungkin hanya dagelan, tapi jika manusia tidak mampu mengambil pelajaran, alamat diri akan celaka” +6281397580242

Oleh Syaiful Hadi J.L Pemerintah kota harusnya menyolusi pemindahan pedagang buku Lapangan Merdeka ke lokasi permanen dengan garansi yang lebih segar dan menjanjikan.

C

arut-marut pemindahan pedagang buku dari kawasan Lapangan Merdeka Medan ke lokasi baru di Jl.Pegadaian, adalah bentuk ketidakjelasan konsep tataruang Medan sebagai kota Metropolitan. Ingin menata ‘Titi Gantung’ untuk dijadikan objek wisata— lalu memindahkan pedagang buku bekas ke kawasan lapangan Merdeka, tahun 2003—hanyalah memindahkan kesemerawutan ke lokasi lain. Karena Lapangan Merdeka pun kemudian menjadi lokasi semerawut baru. Belum lagi kasus Merdeka Walk yang menghapus aura sebagai ikon kota ini. Perkembangan infrastruktur baru kawasan dengan hadirnya bandar udara Kualanamu menjadikan pedagang buku sebagai beban kawasan. Lapak penjualan buku pun direncanakan berubah peruntukan, yakni lokasi parkir guna menampung kendaraan yang akan melakukan chek-in sebelum ke Kualanamu. Pemerintah kota pun melakukan rekayasa transportasi. Dan, pedagang buku pun, mau atau tidak, harus angkat kaki. Tapi upaya pemindahan yang dilakukan pun tak tuntas karena konsep penataan yang tak jelas. Bukan pedagang buku tidak ingin pindah, tapi bagaimana masa depan mereka? Bagaimana pun pedagang buku Titi Gantung dan kini Lapangan Merdeka telah memberi kontribusi yang besar bagi penduduk kota ini dalam penyediaan buku murah. Seharusnyalah, pemindahan pedagang buku Lapangan Merdeka tidak mengulang cerita lama ketika mereka dipaksa pindah dari Titi Gantung. Garansi dan jaminan lokasi–tidak akan tergusur lagi–adalah tututan utama pedagang. Tanpa kejelasan itu mereka akan melakukan perlawanan. Taman Pintar Yogya Belajar dari kota lain, masih seputar pedagang buku bekas boleh kita melihat apa yang dilakukan kota Yogyakarta. Ketika melakukan kegiatan seminar di kota gudeg ini, penulis ditanyai teman, sudah ke taman pintar? Sudah beli buku baru dengan harga murah? Dua pertanyaan yang mena-

rik. Seperti apa taman pintar yang berlokasi di Jl.Panembahan Senopati No.1-3, Yogyakarta, di kawasan Benteng Vredeburg. Penulis pun, melihat dari dekat apa yang dilakukan Pemko Yogya dalam memasilitasi pedagang buku di sana. Selain taman pintar, orang Yogya juga menyebutnya sebagai ‘Wisata Buku’. Taman Pintar Yogjakarta terletak di kawasan pusat kota, sebuah wahana wisata baru untuk anak-anak sebagai wahana ekpresi, apresiasi dan kreasi dalam suasana yang menyenangkan. Dengan moto mencerdaskan dan menyenangkan, taman yang mulai dibangun pada Mei 2006 dan diresmikan pada Juni 2017. Berdiri di atas lahan 12.000 meter persegi, taman ini ingin menumbuhkembangkan minat anak dan generasi muda terhadap sains melalui imajinasi, percobaan, dan pemainan dalam rangka pengembangan Sumber Daya Manusia berkualitas. Taman Pintar juga ingin mewujudkan salah satu ajaran Ki Hajar Dewantara yaitu Niteni: Memahami, Niroake: Menirukan, dan Nambahi. Mengembangkan Taman Pintar ini menyediakan beberapa fasilitas, tidak hanya pedagang buku. Misalnya, ada playground. Fasilitas ini untuk penyambutan dan permainan serta sebagai ruang publik bagi pengunjung. Pada daerah ini disediakan sejumlah wahana bermain untuk anak seperti Pipa Bercerita, Parabola Berbisik, Rumah Pohon, Air Menari, Koridor Air, Desaku Permai, Spektrum Warna Dinding Berdendang, Sistem Katrol, Jembatan Goyang, Jungkat-jungkit, Istana Pasir, Engklek, dan Forum Batu. Ada juga Gedung Heritage. Fasilitas ini diperuntukkan bagi pendidikan anak berusia dini (PAUD), yang terdiri dari anak-anak usia pra-sekolah hingga TK. Gedung Oval, zona ini terdiri dari zona pengenalan lingkungan dan eksibisi ilmu pengetahuan, zona pemaparan, sejarah, ilmu pengetahuan dan teknologi. Gedung Kotak; gedung ini terdiri dari tiga lantai yakni lantai pertama zona sarana pelengkap Taman Pintar yang mencakup ruang pameran, ruang audiovisual, radio anak

Jogja, food court, dan souvenier counter. Lantai dua zona materi dasar dan penerapan Iptek terdiri dari Indonesiaku, jembatan sains, teknologi populer, teknologi canggih, dan perpustakaan. Sedangkan lantai tiga terdiri dari laboratorium sains, animasi dan tv, dan courses class. Fasilitas pelengkap Taman Pintar Yogjakarta ini, antara lain: alat peraga Iptek interaktif, ruang pameran dan audiovisual, food court, mushalka, toko souvenir dan pusat Informasi. Di sebelah taman pintar ini, tersedia pusat shopping buku. Berbagai jenis buku lama dan baru ada di sini. Harganya tentu saja miring habis (untuk buku bekas) dan korting sampai 20 persen untuk buku baru. Yang menarik, kawasan Taman Pintar ini ditata dengan baik. Lingkungan yang asri dan kebersihan yang selalu terjaga. Tentu saja untuk masuk ke lokasi taman pintar pengunjung harus membeli karcis dengan harga yang relatif murah namun bila hanya lokasi shopping buku tentulah gratis. Lokasi Shopping Center yang tak begitu luas dan terdiri dari dua lantai, hanya memiliki sekitar 124 kios buku. Bagi pemburu buku, cukup menyebut judul, nama pengarang dan penerbitnya saja. Buku segera tersaji. Harga?

Pasti lebih murah dari toko buku besar, seperti Gramedia. Menariknya lagi, setiap buku yang dibeli, selalu mendapat fasilitas penyampulan (plastik) gratis (penyampulan plastik gratis ini tidak ada di lapangan Merdeka). Penutup Membangun kawasan Taman Pintar di Medan seharusnya sudah menjadi pemikiran pemerintah kota Medan. Mengambil mode Taman Pintar + Shoopping Buku Yogya tak salah dilakukan. Pemerintah kota harusnya menyolusi pemindahan pedagang buku Lapangan Merdeka ke lokasi permanen dengan garansi yang lebih segar dan menjanjikan. Melakukan koordinasi dengan berbagai instansi, seperti Telkom untuk penyediaan akses ICTnya dapat menjadikan Taman Pintar Medan sebagai kawasan pintar yang full-broandband–kawasan yang benarbenar pintar karena akses informasi tersedian penuh di lokasi ini–yang mencerdaskan. Kapan Medan punya Taman Pintar ? Sesungguhnya tidak sulit bila pemerintah kota ini mau. Penulis adalah Ketua Majelis Pustaka & Informasi Muhammadiyah Sumatera Utara, Wakil Ketua BPC Perhumas Medan, Mantan Wartawan Harian Waspada.

Perspektif Kedaulatan Pangan Oleh Nurismawati Machfira Kedaulatan pangan dalam Islam mencakup jaminan terhadap pemenuhan kebutuhan pokok pangan, ketersediaan, keterjangkauan pangan oleh masyarakat, dan kemandirian pangan negara.

H

arga Sembako kian tidak terkendali. Tidak hanya di Sumut melambung tinggi tapi juga di Aceh dan semua kota dan kabupaten se-Indonesia (Waspada, 17/7). Menteri Hatta Rajasa mengakui adanya spekulan dan kartel yang mempengaruhi harga-harga bahan pangan di pasaran dan meminta Komisi Pengawas Persaingan Usaha (KPPU) melakukan analisis masalah tersebut. Faktanya, praktik kartel digelar sangat rapi memanfaatkan celah sistem ekonomi sehingga hukum sulit mengontrol dalam mekanisme pasar yang sangat bebas ini. KPPU sebatas hanya bisa melakukan deteksi dan menindak adanya pelanggaran yang terbukti secara hukum. Untuk menstabilkan harga, pemerintah melakukan impor. Tentu ini merugikan. Produksi pangan lokal akan makin tergilas pangan impor, devisa negara menipis, dan Indonesia semakin bergantung pada produk pangan impor. Dalam jangka panjang, kedaulatan negara terancam. Pandangan Islam Pangan adalah kebutuhan vital manusia. Karenanya, Islam menjauhkan pangan dari intrik-intrik bisnis. Negara sebagai institusi tertinggi yang ditetapkan Islam sebagai peri’ayah (pengurus) seluruh kebutuhan masyarakat diwajibkan menyediakan pangan secara cukup baik kuantitas maupun kualitasnya. Di sinilah negara harus menjamin kedaulatan pangan bagi warganya. Kedaulatan pangan dalam Islam mencakup jaminan terhadap pemenuhan kebutuhan pokok pangan, ketersediaan, keterjangkauan pangan oleh masyarakat, dan kemandirian pangan negara. Islam mewajibkan negara menjamin pemenuhan kebutuhan pokok pangan setiap individu rakyat. Rasulullah SAW bersabda, “Anak Adam tidak memiliki hak pada selain jenis ini: rumah yang ia tinggali, pakaian yang menutupi auratnya dan roti tawar dan air,” (HR At Tirmidzi). Hadis ini menyatakan tentang kebutuhan pokok yaitu pangan, papan dan sandang yang harus dipenuhi negara

secara bertahap melalui mekanisme non-ekonomi dan ekonomi. Secara non-ekonomi, Islam mewajibkan setiap laki-laki dewasa bekerja untuk memenuhi kebutuhan diri dan orang-orang yang berada dalam tanggungannya (QS. Al Baqarah 233). Jika tidak mampu, maka menjadi tanggungjawab kerabatnya, mulai dari yang terdekat. Bila belum terpenuhi juga, maka beralih kepada negara yang akan memenuhi kebutuhan pokok yang bersangkutan melalui baitul mal. Rasulullah SAW bersabda, “Aku lebih utama dibandingkan orang-orang beriman daripada diri mereka, siapa yang meninggalkan harta maka bagi keluarganya, dan siapa yang meninggalkan hutang atau tanggungan keluarga, maka datanglah kepadaku dan menjadi kewajibanku.” (HR An Nasa’i dan Ibnu Hibban). Warga miskin berhak atas harta zakat dan boleh meminta zakat kepada amil zakat dan baitul mal. Dalam Islam, negara melibatkan partisipasi rakyat dalam aktivitas ekonomi untuk memenuhi kebutuhannya. Ini diwujudkan dalam bentuk penyediaan lapangan dan kesempatan kerja padat karya bagi rakyat. Islam mewajibkan negara untuk mengembangkan sistem birokrasi yang sederhana dalam aturan, cepat dalam pelayanan, dan profesional, sehingga memudahkan membuka usaha dan lapangan pekerjaan. Negara pun wajib menghapuskan pajak yang bersifat tetap, termasuk berbagai pungutan, retribusi, dan cukai. Pemerintah dalam Islam menjaga ketersediaan stok pangan lewat ekstensivikasi dan intensivikasi pertanian. Pemilik tanah wajib mengelola lahannya agar produktif. Bila membiarkannya tidak produktif selama 3 tahun, negara mengambilnya dan bisa memberikan kepada warga lain yang mampu membuatnya produktif. Khalifah Umar ra berkata, “Siapa saja yang memiliki tanah lalu ia telantarkan tiga tahun tidak ia gunakan, lalu orang lain menggunakannya, maka orang lain itu lebih berhak atas tanah itu.” Rasulullah SAW bersabda, “Siapa yang

mempunyai sebidang tanah, hendaknya dia menanaminya, atau hendaknya diberikan kepada saudaranya. Apabila dia mengabaikannya, maka hendaknya tanahnya diambil,” (HR. Bukhari) dan, “Siapa saja yang menghidupkan tanah mati maka tanah itu menjadi miliknya,”(HR. Tirmidzi, Abu Dawud). Sebagai gambaran, saat ini di Indonesia terdapat lahan tidur kering 14,9 juta ha (pelitaonline, 17/5). Belum termasuk lahan rawa 33,4 juta ha yang tersebar di pantai Barat, Selatan, dan Timur Pulau Kalimantan. Dari total lahan itu, 9,53 juta lahan pertanian, sementara yang sudah dimanfaatkan baru 5,4 juta ha. Lahan yang sudah dibuka untuk pertanian berupa rawa pasang surut 4,1 juta ha dan rawa lebak 1,3 juta ha. Masih tersisa 4,13 juta ha yang belum dimanfaatkan alias menjadi lahan tidur (sainsindonesia, 3/12/ 2012). Masalah klasik buruh tani tidak memiliki lahan untuk berproduksi, insyaAllah terjawab dengan menjalankan sabda Rasul ini. Intensivikasi pertanian dilakukan dengan memanfaatkan sains dan teknologi, penggunaan pupuk, obat-obat tanaman, teknik produksi, pola tanam, riset dan pemanfaatan bibit unggul, penggunaan alat dan mesin pertanian, juga teknologi kultur jaringan, rekayasa genetika, dan sebagainya. Kebijakan politik pertanian dipadukan dengan strategi politik perindustrian Islam. Sebab negara juga wajib membangun infrastruktur seperti bendungan, irigasi, dan mekanisasi pertanian yang dihasilkan dari mesin produk industri. Agar komoditi pangan terdistribusi di seluruh wilayah dengan tingkat harga yang wajar, negara wajib memantau kebutuhan pangan di semua wilayah dan memfasilitasi distribusi produk pangan dari daerah yang surplus ke wilayah lain yang kekurangan. Pematokan Harga, Penimbunan, Kartel, Dan Impor Islam mengharamkan pematokan harga. Sahabat Anas ra menceritakan, “Harga melonjak pada masa Rasulullah SAW lalu mereka (para sahabat) berkata, ‘Ya Rasulullah, patoklah harga untuk kami’. Maka Beliau bersabda, “Sesungguhnya Allah-lah yang Maha Menentukan Harga, Mahamenggenggam, Mahamelapangkan dan Mahapemberi Rizki dan aku sungguh ingin menjumpai Allah dan tidak ada seorang pun dari kalian yang menun-

tutku karena kezaliman dalam hal darah dan harta,” (HR. At Tirmidzi, Ibnu Majah, Abu Dawud, Ad Darimi, Ahmad). Secara bersamaan Islam melarang riba, penipuan, monopoli, dan penimbunan Sembako. Dari Ma’mar bin Abdullah; Rasulullah bersabda, “Tidaklah seseorang melakukan penimbunan melainkan dia adalah pendosa.” (HR Muslim). Dari Al-Qasim bin Yazid dari Abu Umamah; beliau mengatakan, “Rasulullah melarang penimbunan bahan makanan.” (HR Hakim, dalam At-Talkhish). Islam juga mengharamkan persekongkolan untuk mengatur dan mengendalikan harga atau perdagangan. Termasuk dalam hal ini praktek kartel yang; (1)Membatasi peredaran barang dengan menahan komoditi tertentu sampai harga naik dan melepasnya ke pasar saat harga tinggi, dan (2)Menerapkan wilayah distribusi, yakni anggota kartel menciptakan ruang operasi di antara mereka. Jika satu daerah kekurangan pasokan, mekanisme pasar sesungguhnya akan mengisi kekosongan tersebut dan menciptakan kestabilan harga. Tapi dengan komitmen pembagian wilayah, kekosongan di suatu wilayah dibiarkan kosong dan dimanfaatkan ‘penguasa’ wilayah itu untuk mendapatkan keuntungan. (suarasurabaya, 16/7). Rasulullah SAW bersabda, “Siapa saja yang turut campur (melakukan intervensi) dari harga-harga kaum Muslimin untuk menaikkan harga atas mereka, maka adalah hak bagi Allah untuk mendudukkannya dengan tempat duduk dari api pada Hari Kiamat kelak,” (HR. Ahmad, Al Baihaqi, Ath Thabrani). Adapun impor pangan, dalam ajaran Islam hanya boleh diambil negara jika dalam kondisi darurat, misalnya terjadi kelangkaan bahan pangan akibat bencana alam nasional. Namun kebijakan impor tetap harus memerhatikan kedaulatan dan kekuatan politik negara. Karena itu impor pangan tidak boleh diberlakukan secara terus menerus karena akan menjadi jalan masuk penjajahan dari negara lain. Demikian sekilas gambaran sistem pertanian Islam yang insyaAllah membebaskan negara dari liberalisasi pangan dan ketergantungan impor pangan kepada negara lain. Allahua’lam bisshawab. Penulis adalah Pengajar Di School of Mathematical Science University of Nottingham, Inggris, Aktivis Hizbut Tahrir


B6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

Bursa Automotive

AC BR CL ND DB

: : : : :

Air Condition Ban Radial Central Lock Nippon Denso Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

SEDAN CHARADE Kalasi Th 94. W. Abu - Abu Tua. Mobil Kaleng Kaleng, Jok Masih Asli, Satu Tangan Dari Baru, Mobil Orisinil. H. Damai. Hp. 0821 6552 2533

JUAL MOBIL TROPEER SOLAR Thn 86. Bk Mdn, Pintu 3, 4 x 4, Cantik, Harga 32 jt Nego. Hub : 081 2639 3235 CHEVROLET OPTRA SEDAN M/T. Thn 2003. Hitam Met, Bk Mdn, Rp 69 Jt. Hub : 0853 7089 9893 PAKET DAIHATSU BARU

- All New Xenia Dp 30 Jtaan...Angs 3 atau 2 Jtan - Terios DP 30 Jtan..... Angs 3 atau 2 Jtaan Proses Cepat : Hub TEDDY Capella 0812 6325 656/77884663

“ PAKET DAIHATSU BERAMAL “

GRAN MAX PICK UP DP 11 Jt’AN Angs 2 Jt’AN GRAN MAX MINI BUS DP 25 Jt’AN Angs 2 Jt’AN LUXIO D DP 30 Jt’AN Angs 3 Jt’AN XENIA D PLUS DP 27 Jt’AN Angs 3 Jt’AN TERIOS TS XTRA DP 38 Jt’AN Angs 3 Jt’AN HUb : ERWIN Hp. 0812 6315 4132

ASTRA DAIHATSU KRAKATAU

Xenia Airbag 1,3 ...................Angs 3 Jtaan Gran Max Pu...........................Angs 2,6 Jt Hub : Andika 0852 7074 7744. Terima Tukar Tambah

BIG PROMO RAMDHAN 100 % BARU

Xenia Dp Mulai 20 Jt-an Pick Up Dp 10 Jtan, Pasti Ok Proses Cepat, Mobil Langsung Keluar. Jeffry 0852 6175 0738 DAIHATSU ESPASS SUPERVAN SILVER MET Th 2000. Mulus Luar Dalam Orisinil, Vr, Br, RTP, Ac Doble Blower, Hrg 44 Jt Nego. Hub : 0812 6063 7823

# LEBARAN BERSAMA DAIHATSU #

GRANMAX Pick Up 1,3 STD, Dp 10 Jt’an ALL NEW XENIA D/MT STD, Dp 26 Jt’an TERIOS TS EXTRIA, Dp 30 Jt 375 Rb Data Dijemput Dalam & Luar Kota. Hubungi : ASTRA DAIHATSU 0813 9778

Angs 2,6 Jt Angs 2,8 Jtan Angs 3,4 Jt

9000

SAHABAT LEBARAN DAIHATSU

Pick Up Cuma 10 Jt Pas. Angs 2 Jt-an Xenia Mulai Dp 27 Jt-an Angs 2 Jt-an Terios Mulai Dp 30 Jt-an Angs 3 Jt-an Hub : 0813 7029 9888. Luar Kotapun...Maenkan !!

# READY STOCK #

NEW XENIA - TERIOS - GRANMAX PU PROSES CEPAT - DATA DIJEMPUT- PASTI OKE - FULL DISKON HUB. FERRY 0821 6736 3637

DAIHATSU TAFT ROCKY Thn 95/96 Merah Maroon, Mobil Mulus, Bk Medan Asli, Gerdang Porsneling Senyap, Peminat Serius Hub. 0852 7630 2013 TP

ASTRA DAIHATSU CAB MEDAN

100 % Baru Paket Special Terios Dp 30 Jtan, atau angs 1,9 Jtan Xenia Dp 27 Jtan atau angs 1.7 Jtan Pu Dp 9 Jtan. Hub. Hafiz 0852 7747 2542

DAIHATSU ROCKY Th 1993. 4 x 4. Wrn Hitam, Bk Mdn Lengkap, Cat Mulus, Mesin Sehat, Ban Baru 30 Inci. H. 76 Jt Nego. Hub. 0813 6139 1011

DAIHATSU ESPAS Th’97. Dijual Segera B.U, Pintu Sorong, Minibus, Supervan, Hub. 0813 7086 5875 DAIHATSU XENIA Xi 2005, Silver Metalic. 1300 cc, Dvd, Central Lock, P.Window, Bk Mdn, Vr. Hub : 0812 6041 8914 DAIHATSU ZEBRA ESPASS ZL Thn 2003. Gold Met, Mulus Sekali. Hub : 061 - 75092121 HONDA JAZZ IDSi Matic Thn 2006. Abu - Abu Met, Bk Mdn, Rp 119 Jt. Hub : 0812 6594 2789 HONDA PRESTICE Thn 88. Silver Cantik, Mobil Komplit, Rp. 30 Jt Nego. Hub. Jl. Utama No. 30/86 Medan. Hp. 0812 6077 6276

5 CM 6 CM

Rp. 65.000 Rp. 78.000

7 CM 8 CM

Rp. 91.000 Rp. 104.000

9 CM Rp. 126.000 10 CM Rp. 140.000

HONDA CITY Z Th 2000. Wrn Merah, Bk Mdn, Ac, Cd, Power, Sabwoper, Br, Vr 16”. Mulus dan Sehat. Siap Pakai. Hub : 0853 5978 2343

SUZUKI SIDEKICK Th 2001. . Silver, Lengkap SUZUKI APV Tipe X Th 2006, Silver, Lengkap Dijual Salah Satu. B.U. Hub 0813 6212 2339

TERCECER

HYUNDAI ATOS OVER KREDIT Th 2005. Mulus Orisinil, Sudah Bayar 9 x Sisa 27 x 3.135.000. Balik Dp 26 Jt Nego. Hub : 0823 6432 0052

TOYOTA KIJANG SUPER MODEL COMMANDO ABU - ABU Th 87. Short 6 Speed Cakram, Lampu Grand, Vr, Br, RTP, Ac Dingin, Siap Pakai, Hrg 37 Jt Terima Hidup Pajak, Hub : 0823 6156 7527

STUK. Bk 8228 BS. No uji : MDN 29047. A/N : H. Subandi. Alamat : Medan. Merk : Ford Renger

HYUNDAI ACCENT GLS 2000. Merah, Plat Mdn Asli, Harga 48 Jt. Hub : 0813 7645 8528 / 0852 6241 1545

DIJUAL TOYOTA KIJANG G EXTRA Thn 95. Hrg 70Jt/nego. Hub. 0813 6234 9602

# ISUZU 100 % BARU = IRIT #

AVANZA Dp 38 Jt-an ; Angs 2,3 Jt-an INNOVA Dp 55 Jt-an ; Angs 3,3 Jt-an TOYOTA RUSH Dp 50 Jt-an ; Angs 2,9 Jt-an BARU Hub. SILALAHI 0813 7057 0061

ISUZU PANTHER Hi-Grade 2004. Bk Asli Medan, Warna Hitam, Kondisi Mulus Sekali (Original). Hub : 0821 6399 3022

TOYOTA KIJANG KRISTA ‘99 Bensin, Silver, Hrg 99 Juta, Hub. 0853 6091 9127

1 Berkas Asli Surat Tanah A/N LINDO SIREGAR No 593.83/130/SPMHAT/ML/1996. Luas Tanah 300 MTR. Terletak di Link 12 Kel. Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl. Yos Sudarso.

Panther Pick Up Turbo............Dp 20 Jtan Panther Lm, Lv, Ls Touring....Dp 60 Jtan Hub. Suprapto 061-77860168/081375070088

KIA CAREN II M/T Thn 2009. Ac, Central, Cd, Vr, Ps, Pw, Cl, Jok Kulit, Hitam, Bangku 3 Baris. Bk Mdn. Rp 83 Jt. Hub : 77863981

KIA SEDAN SPECTRA

Th 2002, Manual, Wrn Coklat Muda, Hrg 68 Juta. Hub. 0853 7267 3866 DIJUAL

MITSUBISHI TRONTON (6X4) Th. 2001. Panjang Bak 9m, Sehat dan jalan. Hub : DIAN 0823 6750 1051 - 0878 6899 2798

BARU

L 300 DP 31 Jt-an ; Angs 3,7 Juta COLT DIESEL Dp 55 Jtan ; Angs 6,3 Juta PAJERO SPORT DP 80 Jtan ; Angs 9,3 Juta. Hub : TOPAN 0821 6131 7359

1) Mercy Smart Fortwo 2 Pt Th’11/’13 Ijo. 2) BMW 318i Th ‘03/’02 Silver 3) Holden Kingswood Station Wagon ‘71, Biru. Serius Hub. 0823 6116 2912 MITUSUBISHI ETERNA 91. Bk 1411 CN, Warna Abu - Abu, Mesin Standart, Kondisi Mulus Sekali (Original). Hub : 0821 6399 3022 MITSUBISHI JET STAR Pick up Thn 87. Merah, Mbl Siap Pakai, Hrg 17,5 Jt. Hp : 0823 6563 4908

* PROMO NISSAN RAMADHAN *

NEW GL, MARCH, JUKE, EVALIA, SERENA. Dapatkan Penawaran Terbaik. Hub : 0852 6132 8682 / 061-7653 2555. Pin BB : 26B392D1 NISSAN BARU / NEW Promo Lebaran New Gl, Evalia, March, Juke, Serena, XTRAIL, Dll. (Hub) : Pin BB : 2973D009. No Hp. 0813 7667 9696 / 061 77056788. Terima Tukar Tambah. Dapatkan Harga Terbaik (Iman Nissan) - NISSAN MARCH 2011. Silver, Bk, 115 Jt Net - Atoz 04, Abu Met, A/N Sendiri, Bk, 65 Jt Net.Hub : 77471599 PROTON GIEN 2 PESONA Wrn Silver Thn 2009. Mobil Ori, Siap Pakai, Mobil Simpanan, Hub Hp : 0852 7500 6552

PROTON SAVVY 2007, Hitam Metalic 1 Tngn Dari Baru sgt Mulus, Bk Pilihan 888. Uk Hrg 69 Jt Nett. Hub : 06177477888 / 081 1651 145 # DEALER RESMI SUZUKI # PROMO LEBARAN

Carry PU 1,5 Dp 13 Jtan atau Angs 2 Jtan Ertiga Dp 35 Jtan atau Angs 3 Jtan Apv Arena Dp 30 Jtan Angs 3 Jtan Hub. ABDUL 0821 6188 5013

SUZUKI BALENO Thn 1999. Bk Mdn SUZUKI KATANA GX Thn 1997. Bk Mdn 0813-7561.6888/77111669

SUZUKI CARRY MB Biru 1999. Bk Mdn MITSUBISHI T120 SS Box 2006. Bk Mdn (061) 77-111-669/ 0813 7561 6888

DIJUAL

TOYOTA INNOVA New Grand 2011. Silver/Bensin/MT/G/KM 17.000.-/ A/N Sendiri/ Seperti Baru. Hp. 0813 6155 5767

DIJUAL

TOYOTA INNOVA G Diesel M/T 2004. Warna Hitam Metalik, Bk Asli Medan, Body Kaleng, Cat Original, Interior rapi, Mesin Bagus. Harga Nego. Hub. 0821 6525 2596 / 0823 6747 5660

TOYOTA STARLET Thn 86. 1000 cc, Hitam Metalic, Vr, Tp. Hub : 0823 6388 5552 DIJUAL TOYOTA KIJANG SUPER Minibus Long Thn 88/ 89. Bk Asli Mdn, Karoseri Rover 5 Speed, Velg Racing, Import, Ban Baru, C. Look Alarm, H. 32 Jt, Mobil Mulus, Cantik, Rapi. Hub. Ibu HAJJAH MUALIMAH 0852 9641 9233, 0812 6596 4197 (Maaf Sms TP)

TOYOTA TWINCAM Thn 88. Silver 1.6, Komplit, Rp 41 Jt Nego. Hub. Jl. Utama No 32/88 Medan. Hp. 0812 6077 6276 TOYOTA KIJANG COMMANDO SHORT Thn 90. 6 Speed. Abu - Abu Met, Ac, Vr, Br, R/T, Plat Panjang, Rp 47,5 Jt. Hub. Jl. Utama No. 32/ 88 Medan. Hp. 0812 6077 6276

TOYOTA KIJANG GRAND EXTRA 96. Short 1.8, Abu - Abu Met, Bk Mdn, Tgn ke 2, Mulus Sekali. Hub. 0813 7000 1968 TOYOTA KIJANG Green Extra Thn 96, Warna Hijau, Long, Harga 66 Juta Nego, Bk Medan. SUZUKI CARRY Thn 95, 10, Warna Merah Custum, Harga 30 Juta Nego. DAIHATSU ESPASS Pick Up Thn 2004. Warna Hitam, Harga 38 Juta Nego. Hub 0853 6261 1521

BUTUH DANA

PINJAMAN DANA RAMADHAN

Spesialis Surat Rumah dan BPKB. Proses 5 Jam Cair, Tanpa Usaha, 3 Juta - 1 Milyar. Jaminan, SHM, SK Camat, HGB. BPKB Mobil, Spd. Mtr, Truk, Mobil kredit. Dan Bantu Pelunasan BPKB. Hub. Family Finance. 0813 7044 6668 - 0813 7044 6633

ANDA BUTUH DANA

Untuk Pelunasan BPKB Mobil, Take Over dan Leasing, Tanpa Bi.Checking. Hub. 0813 7572 5959

TERCECER

TERCECER

TERCECER

1 Berkas Asli Surat Tanah A/N YADI SUARDI No 593.83/214/SPMHAT/ML/1996. Luas Tanah 300 MTR. Terletak di Link 12 Kel. Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl. Yos Sudarso. TERCECER

1 Berkas Asli Surat Tanah A/N WILDAWATI No 593.83/366/SPMHAT/ML/1996. Luas / Letak Tanah = 685 Mtr Di Lk 12 Kelurahan Tangkahan Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl Sudarso Belum Di Temukan.

TERCECER

1 Berkas Asli Surat Tanah A/N ABU BAKAR YACUB No 593.83/215/SPMHAT/ML/1996. Luas Tanah 300 Mtr. Terletak di Link 12 Kel Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 di Sekitar Jl. Kl Yos Sudarso

TERCECER

1 Berkas Asli Surat Tanah A/N MHD. SALIM No 593.83/216/SPMHAT/ML/1996. Luas Tanah 300 MTR. Terletak di Link 12 Kel. Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl. Yos Sudarso.

TERCECER

1 Berkas Asli Surat Tanah A/N MAKDUM No 593.83/364/SPMHAT/ML/1996. Luas Tanah 300 MTR. Terletak di Link 12 Kel. Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl. Yos Sudarso.

TERCECER

1 Berkas Asli Surat Tanah A/N BURNAWARMAN No 593.83/126/SPMHAT/ML/1996. Luas Tanah 300 MTR. Terletak di Link 12 Kel. Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl. Yos Sudarso.

TERCECER

1 Berkas Asli Surat Tanah A/N TIOMINA MAGDALENA No 593.83/365/SPMHAT/ML/1996. Luas Tanah 300 MTR. Terletak di Link 12 Kel. Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl. Yos Sudarso.

TERCECER

1 Berkas Asli Surat Tanah A/N YUSMAHANI No 593.83/125/SPMHAT/ML/1996. Luas Tanah 600 MTR. Terletak di Link 12 Kel. Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl. Yos Sudarso.

TERCECER

1 Berkas Asli Surat Tanah A/N HELENA ADRIYATI No 593.83/132/SPMHAT/ML/1996. Luas Tanah300 MTR. Terletak di Link 12 Kel. Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl. Yos Sudarso.

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

TERCECER

1 Berkas Asli Surat Tanah A/N UTOYO HADI No 593.83/131/SPMHAT/ML/1996. Luas Tanah 300 MTR. Terletak di Link 12 Kel. Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl. Yos Sudarso.

TERCECER

1 Berkas Asli Surat Tanah A/N NEINEL ASWAN No 593.83/136/SPMHAT/ML/1996. Luas Tanah 300 MTR. Terletak di Link 12 Kel. Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl. Yos Sudarso.

Jumat, 26 Juli 2013

FAX.4561347 Info Iklan Hub. 0821 60 126688

HARGA BELUM TERMASUK PPN 10%

SEKOLAH TINGGI TEKNOLOGI IMMANUEL MEDAN

KELUARGA BESAR MTS. N DOLOK MASIHUL

MENERIMA MAHASISWA/I BARU / PINDAHAN T.A 2013/2014 Kelas Reguler Pkl. 16.00 - 19.20 Kelas Executive Pkl. 18.30 - (Malam)

Mengucapkan Selamat

Program Studi: 1. Teknik Mesin (S1) Akreditasi BAN PT No. 044/SK/BAN-PT/AK-XV/S/II/2013 Konsentrasi: - Teknik Otomotif - Struktur dan Material - Rekayasa dan Teknologi Mesin Pertanian 2. Teknik Elektro (S1) Akreditasi BAN PT. No. 030/SK/BAN-PT/AX-XV/S/1/2013 Konsentrasi: - Energi Elektrik - Elektronika Industri - Sistem Kontrol INFORMASI DAN PENDAFTARAN Kampus: Jl. Gatot Subroto No. 325 Medan Telp. (061) 4569548 - 4573158 Fax. 4154154

H.M DAVID SAGARIH, SAG, MM

Atas Dilantiknya Sebagai

KAKAN KEMENAG KAB. SERDANG BEDAGAI Semoga Sukses Mengemban Amanah Dan Selalu Mendapat Bimbingan dan lindungan ALLAH SWT

Dari Dra. ELPI NIRWANA HSB Kepala MTS.N

MASJUKI S.Pdi Kaur TU MTS.N

TERCECER

1 Berkas Asli Surat Tanah A/N EMI NASWITA No 593.83/367/SPMHAT/ML/1996. Luas Tanah 490 MTR. Terletak di Link 12 Kel. Tangkahan. Medan Labuhan. Tercecer Pada Tgl 15 Januari 2013 Di Sekitar Jl. Kl. Yos Sudarso.

TERCECER

Sertifikat Hak Milik (SHM) no. 597 a/n. Hj. Nilawati. Luas. 35473 M2 Di Desa Deli Tua Dusun V (dekat Jl. Eka Surya, Simpang Jl. Karya Wisata). Tercecer di Sekitar Jl. Karya Wisata Mdn. Penemu Diberi Hadiah Sepantasnya dan Hub. 0813 6119 9723 TERCECER

STUK. Bk 9821 CL. No uji : AB. 01.013068. A/N : Karya Agung Sejati. Alamat : Jl. Perwira I No. 115 Medan. Merk : Mitsubishi

BURSA LOWONGAN LOWONGAN KERJA

Kami Perusahaan BINA SEHAT Membutuhkan Satu Orang Karyawan Dengan Syarat : -Laki - Laki -Umur 18 - 25 Tahun -Pendidikan SMA Bagi yang berminat langsung datang ke BINA SEHAT. Jln Brig Katamso No. 37 Medan atau Hubungi Telp : 061 4511 032 Hp . 0821 6477 5229 KOST KARYAWAN /Ti

Fas : Ac/ Non Ac, Kmr Mandi di dlm, Tmpt Tidur, Lemari, Tv. Hub : Si Sei Arakundo gang tula No 19 ( Darusalam) 0821 6777 0009 / 0823 2777 0009

VACANT POSITION

Job Title : Field Assistant (FA) Departemenet : Operations

General Job Descriptions : * Melakukan rekrutment panel TAM * Mengupdate semua data yang berhubungan dengan panel TAM * Melakukan wawancara dengan para panel sesuai dengan list pertanyaan yang sudah ditentukan * Melakukan perbandingan atas setiap penerimaan siaran televisi yang diterima responden (dari segi kualitas ) Job Requirements : * Minimal Lulusan D1-D3 segala jurusan * Male/Female * Usia Maksimal 20-30 tahun * Memiliki kendaraan bermotor dan SIM C * Bersedia bekerja di lapangan * Memiliki kemampuan berkomunikasi yang baik dan mampu bekerja sama dalam team * Lebih disukai yang berpengalaman sebagai marketing / Sales Apabila anda memenuhi kualifikasi di atas, silahkan kirimkan Curriculum Vitae, Surat Lamaran, Fotokopi KTP, Fotokopi SIM yang masih berlaku, Fotokopi ijazah, Ditujukan kepada : PT. Neilsen Audience Measurement (NAM) Jl. Anugrah Mataram No. 26 Kelurahan Binjai Kec. Medan Denai (Pasar Merah ) Kode Pos. 20228 Medan

BURSA

PENDIDIKAN TERAKREDITASI BAN PT DAN DEPKES RI

STIKES/AKBID WIDYA HUSADA

Jl. Pancing/ Wilem Iskandar 116 Tel. (061) 6621202 MEDAN IZIN DIKNAS No. 249/D/O/2002 dan 73/E/0/2013 IZIN DEPKES No. BK 03.2.4.1.2203

KLINIK TERAPY/ ALAT VITAL

BURSA

MAK EROT YANG TERUJI

PROPERTY

Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

*AKUISISI PROPERTI TUA DI CHINA*

Mohon Perhatian : Jika leluhur anda di Tiongkok masih punya properti tua, ingin dijual/memulihkan kepemilikannya dengan Pemerintah setempat, semua bisa diserahkan kepada kami untuk akuisisi & kami dapat bantu dalam pengurusannya. Hub. CP : (Atik) 0813 6771 1753 DIJUAL RUMAH

Baru Rehap 10x12 Over Kredit SHM, KT 3, KM 2, RT, RD, Teras, Grasi, Pakai Jerjak Besi, Pagar Minimalis, Full Kramik, Flapon Full Gibsun, Bebas Banjir, Balik Dp 130 Jt, Perbulan 4 Jt x 25 Bln, Pelunasan 80 Jt, DP Bisa Tukar Dengan Mobil, Letak Di sungggal Belakang PDAM Tirtanadi, Perumahan Suka Maju Indah Blok EE 23.Hub : 0823 6634 4335

DIKONTRAKKAN

1 Ruko Uk 4,20 x 20 Jln Baru No. 19 Psr I Ring Road. Dikontrakkan 25 Jt/Thn. Min 2 Thn.Hp. 0821 6709 1775 RUMAH DIJUAL

Uk : Tanah 10 x 40 M. Di Jl. Tuar I/No 21 G Amplas Medan. Hub : 0812 6870 4377 TP

KOMP. CEMARA HIJAU

2 Tingkat, 8 x 20, 4 KT, 3 KM, Full Perabot, Siap Huni, Harga Nego. Hub : 0877 6826 3988, Maaf TP RUMAH DIJUAL

Perumahan Puri Tanjung Mulia Kawat 7 Type 55, 2 KT, RT, DP, Sudah Ada Pagar & Kanopy. Hp. 0812 6001 5252

RUMAH DISEWAKAN

Komplek Villa Mutiara Jl. Bajak V. Amplas. 2 Tkt, 3 KT, 2 Km, Lengkap Prabot/Kitchen Set, Ac, Tlp, Garasi, Siap Huni. Hub. 0853 6096 5270 dan 0852 9722 0511

DAN TERBUKTI

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG

Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna KHUSUS WANITA: KHUSUS PRIA: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DIJAMIN 100% KONSULTASI UMUM: HANYA TEMPAT - Buka aura KAMI KLINIK - Cari jodoh MAK EROT - Pelaris - Mencari orang hilang JL. LAKSANA NO. 55 J MASUK DARI JL. AMALIUN YUKI SIMPANG RAYA MEDAN (PRAKTEK TETAP) HP: 0812 4038 333 - www.terapialatvitalmakerot.com

DIJUAL RUMAH DI Jl. Mandor Krakatau LT : 650 M2, LB : 250 M2, SHM. Hub : 061-75092121

DIJUAL TANAH

Uk : 12 x 60 M. SHM, Depan Villa Mutiara Johor II Pangkalan Angkot Medan Bus 36 Jl. Sidodadi Ujung. Hub : 0812 6870 4377 TP DIJUAL MURAH

TANAH CANTIK & DATAR Ukr : 20 x 40 Mtr, SK Camat, Di Batang Kuis, Hanya 135 Jt/Net. Butuh Uang. Hub : 0852 9777 7979 DIJUAL TANAH 862 M2 Di Jl. Kamp Banten Desa Manunggal Kec. Labuhan Deli Kabupaten Deli Serdang, SHM. Hub : 061-75092121

DIJUAL TANAH

Uk. 11 x 26 M. SHM. Jl. Pembinaan/ Pelaksanaan II. Sudah Ditimbun Strategis, Bandar Setia Kec. Percut Sei Tuan. Hubungi : 0813 6169 6963

DIJUAL

1 Kavling Tanah Sudut (Khusus Muslim) UT. 15 x 20 M2, SHM, Komplek Mareland Indah Pasar III Mareland Medan. Peminat Serius (Tanpa Perantara). Hub. 0815 1748 9196 0813 9606 0770

BURSA

ALAT MUSIK

Dengan melengkapi: * Surat Lamaran * Daftar Riwayat Hidup * Fotocopy KTP * Pasfoto warna 3x4 cm = 2 lembar * Sertifikat seminar / Pelatihan * Ijazah Terakhir (Legalisir) * Transkrip Nilai (Legalisir) Lamaran ditujukan ke: STMIK Potensi Utama Jl. KL. Yos Sudarso Km. 6,5 No. 3 A Tanjung Mulia - Medan 20241 Paling lambar kami terima pada: Senin / 5 Agustus 2013

KUSUK LULUR TERAPHY

MBAK ALIN BISA DIPANGGIL 0813 7739 9508

BAKTERI SEDOT LEMAK

Turun 15 KG - 2 Gratis 1. 0813 3207 7899 ANDA BUTUH

ALAT BANTU DENGAR ? HUB.

MELTRA HEARING AID JL. KEDIRI NO. 36 MEDAN TELP. 451.6161

URAT SYAHWAT

1. Impotent L. Syahwat (gula), kurang gairah/ keras, tambah besar & panjang 2-3-5 cm, ejakulasi dini, mani encer, telor turun, mandul, terbukti di tempat, permanen, aman, tanpa efek samping mahar 100 ribu 2.Urat terjepit, otot persendian kaku, mati rasa, angin duduk, mahar 50rb 3. Pagar badan, pelet, penglaris mahal 50rb 4.Pengobatan ghaib (ruqyah), membuang hasad dengki manusia, ilmu2 hitam, dll. 100rb 5. Buka aura, kewibawaan, penunduk, awet muda, murah jodoh/kerja, buang sial, dgn minyak panas, air raksa, samber lilin mahar 200rb 6. Ramuan “ Keperawanan agar rapat, legit, wangi, kesat, keputihan 300rb 7.Patah tulang, terkena guna, santet, narkoba, stress, siplis (raja singa), medis/ non medis, lainnya. 8.Memisahkan WI/PIL 9. Buka pintu ghaib, pandangan ghaib, silat ghaib, komunikasi dengan seluruh ghaib.

PA YONG SIKUMBANG

BURSA

PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Informasi lengkap : 1. DR.Dr.H.Wirsal Hasan, MPH HP. 0812 639 88388 2. Dr.Hj.Sundari Syarif, HP. 0811 61 8011

Syarat: * Lulusan S-2 � Magister Komputer � Magister Desain � Magister Seni � Magister Teknik Industri � Magister Teknik Mesin � Magister Teknik Elektro * Disiplin dan memiliki komitmen untuk memajukan dunia pendidikan

BURSA

KESEHATAN

Jl. Pertahanan / Patumbak Taman Jasmin Mas No. A4 Amplas. Hp : 0812 604 1050 Flexy 061-7769 8634 Izin Kejatisu B-23/DSP 5/001/2008

-----------------------------

REKRUTMEN DOSEN S2

Media yang Tepat untuk Iklan Anda

TANAH

1. AKBID angkatan ke XII t.a 2013/2014 bagi tamatan SMA/SMK/ALIYAH/SPK 2. STIKES : P.S KESEHATAN MASYARAKAT A.JALUR REGULER Bagi tamatan SMU sederajat. B. JALUR KHUSUS bagi tamatan D-3 Bidang kesehatan Testing Gel I: 1 Juli 2013

BURSA

WASPADA

JUAL Sebidang Tanah, SHM, Ukuran 30,5 M x 77 M. Jln. Bunga Raya/Jln. Nusa Indah Sudut GG : Melati Asam Kumbang. Hub : 0821 6046 8807

Menerima mahiswa baru :

PENDIDIKAN

Ingin Promosikan Produk Anda Harian

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

BURSA

PELUANG BISNIS BAKSO KOTAK

Asli Daging Sapi ( Halal ) Tanpa Pengawet dan Pengenyal.Rp. 85.000,- / 1 Kg, Rp. 20.000,- / 200 Gr. Hub. 0813 6139 7120 ( Medan), 0813 7553 4344 ( Binjai)

KUE BAWANG KUE BAWANG PEDAS NABILA Berkualitas Enak & Gurih. LP POM : 0910000459213 DINKES : P-IRT 2.06.1275.01.184. Pesan Hub. Pak HUSNI M. Hp : 0853 7288 8679 SERVICE

KONSTRUKSI

WC WC

Jl. P. BRAYAN MEDAN

HP. 0813 7035 7291 Ada Garansi

TUMPAT/ SAL. AIR

845.8996 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243


Agenda

WASPADA Jumat 26 Juli 2013

07.00 Dahsyat 09.00 Sinema Pagi 11:00 Infotainment : INTENS 12:00 Seputar Indonesia Siang 12:30 Si Doel Anak Sekolahan 14.30 Cek & Ricek 15.00 Silet 15.30 Yang Muda Yang Bercinta 16.30 Seputar Indonesia 17.00 Tangan Tangan Mungil 18.15 Berkah 19.30 Layar Drama I ndonesia Tukang Bubur Naik Haji 22.30 Mega Sinema RCTI

CATATAN

07:00 Inbox 09:00 Liputan 6 Terkini 09:03 Halo Selebriti 10.00 SCTV FTV 12.00 Liputan 6 Siang 12.30 SCTV FTV 14.30 Eat Bulaga Indonesia 16.00 Liputan 6 Terkini 16.03 Eat Bulaga 16.30 Liputan 6 Petang 17.00 Heart Series 18.15 Monyet Cantik 19.30 Love In Paris 21.00 Ustad Fotocopy 22.30 Liputan 6 Terkini 22.33 SCTV FTV Utama

07.00 Upin Ipin 07.30 Pose 08.00 Layar Unggulan 09:30 Kisah Unggulan 11:00 Di Antara Kita 12:00 Layar Kemilau 13.30 I Drama 15:00 Top Pop 16.00 Lintas Petang 16.30 Tuntas 17.00 Animasi Spesial 18:00 Bola Bolu 19.00 Tendangan Si Madun 20.30 Raden Kian Santang 22:00 Hidayah 00.00 Lintas Malam 00:30 Sidik

07:30 Perempuan Hebat 08.00 Seleb On Seleb 09.00 Klik! 10:00 Ngobrol Asik 11.00 New Friends 11:30 Topik Siang 12:00 Seputar Obrolan Selebritis 13.00 Seleb Tolong Dong 13.30 Chhota Bheem Aka Bima Sakti 14:00 Panda Fanfare Aka Kungfu Panda 14:30 Duckula 15.00 Tom & Jerry 15.30 Curious George 16.00 Mr Bean 16:30 Topik Petang 17.00 Suka Suka Nizam 18.00 Pesbukers 19:30 RT Sukowi 20.30 Mel’s Up Date 21:30 Sinema Spesial 23:30 Cakrawala

07:00 KISS Pagi 08:00 Kuis : Pagi Pagi Bagi Bagi 09:30 Sinema TV 10.30 Sinema TV Spesial 11:30 Live Patroli 12:00 Sinema Pintu Taubat 14:00 Hot KiSS 15.00 Live Fokus 15.30 Penolong Misterius 16.00 Drama Korea : Rooftoop Prince 17.00 Best Of The Best The Voice Indonesia 18:00 Bukan Mawar Tapi Melati 19.00 Sinema Indonesia 21:00 Drama Seri Keluarga 23:00 Sinema Unggulan

07.05 Bedah Editorial Media Indonesia 08:05 8 Eleven Show 11:05 Sisi Berita 13:05 Wideshot 17:05 Metro Hari Ini 18.05 Primetime News 20:05 Indonesia Bersuara 21:30 Otoblitz 22.05 Angkat Bicara 22:30 Stand Up Comedy 23:05 Melawan Lupa 23:30WIB Metro Sports

B7 07:30 Ranking 1 08:30 Spektakuler 10.00 CInta Istimewa 10:30 Reportase Siang 11:00 Insert Siang 12:00 Bioskop Indonesia 14:00 Sketsa 15:15 Show Imah 16:30 Reportase Sore 17:00 Insert Investigasi 18:00 Super Trap 19:00 Oh Ternyata 20:00 Bioskop TransTV 22.00 Bioskop TransTV 00.00 Soccer Fever

07.00 Live News Kabar Pasar Pagi 09.00 Aku Bangga 09.30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Ruang Kita 14.30 Live News Kabar Pasar 15.00 Indonesia Super League 17:30 Live News Kabar Petang 19:30 Indonesia Lawyers Club 22:30 Live News Kabar Malam 23:20 Live News Kabar Malam

07.30 The Penguins Of Madagascar 08:00 Auto B Good 08:30 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Serasi 13.00 Dimas Dan Raka 14:00 100% Ampuh 15:30 Fokus Selebriti 16.00 Arjuna 16.30 Si Kriwil Jadi 2 17.30 Spongebob Squarepants 18.00 Big Movies 20:00 Big Movies 22.30 Big Movies

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:30 Selebrita Pagi 08:00 Makan Besar 08:30 Ga Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Dunia Binatang 14:00 Brownies 14:30 Tau Gak Sih 15:00 Fish N Chef 15:30 Jejak Petualang 16:00 Redaksi Sore 16:30 Indonesiaku 17.00 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Kuku Bima Energ – G! **m31/G

Konser Di Jakarta, Chris Brown Minta Cadillac Hitam

Chris Brown/people.com

Penyanyi Chris Brown meminta disediakan dua mobil Cadillac untuk transportasi selama mereka konser di Jakarta. “Bingung juga sih, dia minta mobil Cadillac Escalade hitam, 2 buah,” kata Bobby Alatas dari Avant Garde selaku penyelenggara, saat menggelar jumpa media. Mobil itu akan digunakan masing-masing oleh Chris Brown dan manajer turnya selama di Jakarta. Menurut Bobby, permintaan Brown yang satu ini cukup sulit untuk dipenuhi, tetapi akhirnya dia berhasil memenuhi permintaan penyanyi R&B itu. Selain meminta disediakan Cadillac, Brown juga meminta dua buah ruang ganti di belakang panggung yang salah satunya akan digunakannya untuk berganti pakaian secara cepat.“Satu lagi dia minta dressing room ka-

yak lounge,” katanya. Chris Brown akan mengadakan konser di Ecopark, Ancol, 14 September mendatang. Menurut Bobby, proses mendekati Brown agar mengadakan konser di ibukota cukup lama. “Sudah dari bulan Februari 2012. Akhirnya bilang oke bulan Mei lalu,” jelasnya. Usai konser di Jakarta, Brown segera bertolak ke Jepang masih dalam rangka tur Fine China - Asia Tour. Kedatangan Brown untuk pertama kalinya ke Jakarta sekaligus untuk mempromosikan album terbarunya “X” akan segera dirilis. Rubianka Atmadja, dari Mirica Entertainment selaku promotor, mengatakan konser Chris Brown ini menggabungkan tari dan musik. Brown akan tampil bersama band dan 20 penarinya.

Bobby Alatas dari Avant Garde menambahkan sesuai dengan judul tur, Fine China - Asia Tour, juga menjadi judul single Brown, panggung akan kental dengan nuansa China dan Asia. “Tim Chris Brown bawa sendiri spesial LED dan konten multimedia sendiri,” kata Bobby. Sebagai pembuka dan penutup konser Chris Brown, penyelenggara akan mendatangkan disk jockey (dj) dari dalam negeri. Peraih Grammy Awards 2012 untuk album FAME tiket konsernya harga normal dijual dengan harga Rp 810.000 (Festival), Rp 1.510.000 (Dancing), Rp 2.010.000 (Tribune VIP). Kelas Dancing akan berada dekat dari panggung sehingga penonton dapat menari dan melihat Brown dari dekat.(ant)

Natalie Portman Awali Ali Ridho Solois Orbitan Baru Opick Kiprah Sebagai Sutradara Aktris peraih Oscar, Natalie Portman untuk pertama kali melangkah menjadi sutradara dalam film A Tale of Love and Darkness menceritakan kisah hidup novelis Amos Oz. Bintang Amerika keturunan Israel meraih piala Oscar tahun 2011 untuk peran sebagai balerina dalam drama Black Swan juga akan merangkap bermain menjadi ibunda Oz, yang bunuh diri ketika Oz berusia 12 tahun. “Dia (Portman) membaca kisah ATale of Love and Darkness dan meminta izin untuk menyadur kisah itu dalam film, sekitar lima atau enam tahun yang lalu,” kata Oz kepada Reuters melalui telepon.“Saya setuju karena merupakan penghargaan tertinggi bagi karya saya. Ia seorang aktris hebat.” A Tale of Love and Darkness merupakan kilas balik masa kanak-kanak Oz di kota Jerusalem yangtercabik-cabikantarata-hun 1940-1950 an, kematian ibunya dan perjalanannya melewati Kibbuts dan Israel, pergantian politik setelah lahirnya negara. Ozmengatakanbahwaiamembantu menyiapkan naskah dan Portman kemungkinan akan per-

KOMITMEN Opick menjadi magma sekaligus lokomotif kebangkitan lagu-lagu religi Isgi ke Israel pada September untuk lami, tampaknya bukan sebatas persiapan dan mulai mengambil wacana belaka. Buktinya, setelah awal Juli gambar pada Januari mendatalalu melansir album terbaru ng. Juru bicara Portman belum bertajukYa Maulana dan mengbisa dihubungi untuk memberi gandeng Adiba – putri sulung komentar. Natalie Portman,32 di- almarhum Uje – patner duetlahirkan di Jerusalem dari ayah nya mengusung lagu Terimaseorang warga Israel dengan ibu kasih Ayah, bos Tombo Ati Reasal Amerika, tetapi ia dibesarkan cord ini, kembali mengorbitkan Ali Ridho – solois pop religi pria di Amerika Serikat. Peran pertamanya di layar lewat mini album bertitel Ibu. “Blantika musik nasional lebar adalah dalam film laga Leon: The Professional tetapi pe- belakangan masih langka akan ran yang mengangkat nama- solois pop religi. Karenanya renya adalah sebagai Ratu Padme generasi penyanyi belia – yang Amidala dalam Star Wars: Epi- memiliki potensi besar menjadi penyanyi profesional harus sesode I - The Phantom Menace. gera mungkin digulirkan. Ali RiSelain karirnya di Hollywood, dho memenuhi segala persyalulusan Harvard yang juga ma- ratan didukung dan diorbitkan hir berbahasa Yahudi itu juga kendati musik Nasyid lagi koterlibat dalam film Israel.(ant) laps” papar Opick kepada Waspada menjelang peluncuran mini album Ali Ridho bertajuk Ibu di Aria Café – Jl. Sudirman Jakarta Pusat, baru-baru ini. Menurut mantan Rocker bernama asli Aunur Rofikq Lil Firdaus kelahiran Jember – Jatim, 16 Maret 1974 ini, semangatnya mengorbitkan Ali Ridho kian menggebu lantaran remaja kelahiran Jakarta, 22 DeNatalie Portman/blogspot.com sember 1989 ini sangat religius

Ali Ridho dan Opick alias remaja sholeh dalam kesehariannya. “AliRidho keponakanalmarhum Uje juga jebolan pesantren Daar El-Qolam Tangerang dan Universitas Antar Bangsa Malaysia. Selain menjadi penyanyi pop religi yang berdakwah lewat lagu – dia sangat layak menjadi panutan kaula muda di tanah air dimasa datang,” harap Opick mendukung pe-nuh debut Ali Ridho juga menggelontorkanempatlagukaryanya yakni Ibu, Shalawat Ramadhan, Maha Sempurna danTanpaMu dikemasdalammusikpop religi modern. Tentang keputusannya memulai debut di jalur pop religi, Ali Ridho menyatakan hal tersebut sejalan dengan niat awalnya turut

menambah semarak penyanyi religi remaja yang masih relatif minim. “Saya berbulat tekad konsisten di jalur musik pop religi atau Nasyid setelah menyaksikan langsung konser Mas Opick di Malaysia ketika masih kuliah di sana. Semoga dengan menekuni jalur musik ini, saya akan tumbuh menjadi pribadi lebih baik di masa datang,” harap Ali Ridho berpotensi mengorbit lewat satu lagu lain bertajuk Taubat karya Danang – sahabat karibnya. * (AgusT)

Profil di halaman Facebook Syu Shu, merek produk sepatu Vicky Shu/Syu Shu

Sepatu Vicky Shu Pernah Dibeli Lenka Dan Ashley Tishdale SEPATU karya desainer sekaligus penyanyi Vicky Shu ternyata pernah dibeli penyanyi asal Australia, Lenka dan aktris Amerika, Ashley Tisdale. “Waktu itu tahun 2009, Lenka datang ke Indonesia dan ada pemotretan di sebuah majalah. Dia melihat sepatu buatan saya dan tertarik,” kata Vicky di Jakarta, Kamis. Desain sepatu berlabel Syu Shu milik Vicky juga disukai Ashley Tishdale. “Semua berkat kekuatan sosial media, saya dari dulu lebih gencar di sosial media dalam memasarkan produk meski dulu online shopping belum sebooming sekarang, dulu saya cuma pakai Facebook,” katanya. Untuk menunjang bisnisnya, Vicky tidak pernah bisa lepas dari peralatan seperti telepon pintar, kamera digital dan tablet. “Semua untuk kepentingan bersosial media, dan surat menyurat melalui e-mail dengan rekanan atau asisten desainer,” kata Vicky..(ant)

Gonzales bersama anak panti asuhan As-Surur Kebon Jeruk-Jakarta Barat

Bila Gonzales Menyenangkan Anak Panti Asuhan Ditengah kesibukannya sebagai selebriti dan pesepakbola profesional, Christian Gonzales punya cara sendiri mendulang sebanyak mungkin pahala – selain melaksanakan serangkaian ibadah puasa Ramadhan. Karenanya, kendati kini membela klub Arema Indonesia dan menetap di Malang, pria kelahiran Montevideo – Uruguay, 30 Agustus 1976 yang sejak 1 November menjadi WNI ini, tetap ringan langkahnya berbagi ilmu tehnik dasar sepakbola sambil menunggu berbuka puasa bersama gelaran SCTV di panti asuhan As-Surur Kebon Jeruk-Jakarta Barat. “Sejak memeluk Agama Is-

lam tahun 2003 silam, saya merasakan kehidupan penuh hidayah dan berkah. Nah, salah satu wujud kongkret mensyukuri nikmat tersebut - sesibuk apa pun saya selalu menyempatkan diri bertemu dan menyenangkan anak yatim piatu para penghuni panti asuhan atau pesantren,” papar Gonzales kepada Waspada selepas mendampingi Mutia Nandika – GM Marketing SCTV menyerahkan sumbangan satu set gawang Futsal dan bola ke Panti Asuhan As-Surur di Kobon Jeruk – Jakarta Barat, baru-baru ini. Ditambahkan suami Eva Nurida Siregar ini, baginya bisa menyenangkan anak yatim dan kaum duafa memberi kepuasan

bathin tersendiri. Apalagi, lanjut striker handal haus gol berjuluk El Loco dalam kunjungan ke panti asuhan atau pesantren dirinya bisa berbagi ilmu tehnik dasar sepakbola yang baik dan benar. “Bukankah, bisa menurunkan ilmu yang bermanfaat khususnya bagi umat muslim itu sangat besar pahalanya – apalagi di bulan Ramadhan. Semoga dimasa datang salah satu dari anak panti asuhan ini, ada yang menjadi pesepakbola Timnas Indonesia,” harap Mustafa Habibi demikian nama muslim Gonzales yang menikmati betul bermain bola bersama puluhan penghuni panti menggunakan sarung dan peci jelang berbuka Puasa. (AgusT)

Empire of Gold Hadirkan Konflik Keluarga, Cinta dan Kekuasaan Awal tahun 1990 merupakan era pergolakan ekonomi Korea yang penuh dinamika dan gejolak. Banyak perusahaan konglomerat berbasis bisnis keluarga muncul sehingga terciptalah intrik persaingan dan perebutan kekuasaan. Fenomena ini yang menjadi ide cerita serial drama terbaru Korea, Empire of Gold. Tapi tak melulu soal ekonomi dan politik, serial produksi SBS ini juga menawarkan kisah cinta tak kalah menarik tayang mulai 29 Juli 2013 Setiap Senin dan Selasa pukul 19.55 di saluran TV berlangganan khusus tayangan hiburan Korea, ONE dapat diakses melalui Indovision ch. 164 dan Groovia ch. 507. Adalah Jang Tae Joo (Go Soo) menjadi tokoh utama. Sekilas, ia gambaran sempurna seorang pria: tampan, cerdas, dan pekerja keras. Namun ada satu hal tak dimilikinya: uang. Kemiskinan bahkan membuatnya kehilangan sang ayah. Tumbuh dewasa, ia tak ingin bernasib sama. Ambisinya untuk sukses membuncah. Ia kemudian bergabung di perusahaan Sungjin Group dan berharap bisa mengukir kisah suksesnya di sana. Ambisi dan keserakahan pun mengubahnya jadi petualang berdarah dingin yang rela berbuat apa saja termasuk membuat manuver dan rencana berbahaya, semua demi membangun kerajaan emas untuk dirinya. Presiden Direktur Sung Jin Group, Choi Dong Sung, salah satu dari 10 orang terkaya di Korea sebenarnya memiliki empat penerus. Sayang hanya putrinya Choi SeoYoon (LeeYoWon) dan putra terakhir Choi Seong Jae (Lee Hyeon Jin I) bisa diandalkan. Choi SeoYoon wanita pemberani dan berharga diri tinggi. Tadinya ia tak ingin terlibat di perusahaan karena ia tahu meski publik menganggap Sungjin Group merupakan Golden Enterprise (perusahaan sukses), kenyataannya terlalu banyak

konspirasi politik, intrik, dan pengkhianatan terjadi. Ia hanya ingin hidup sederhana ketimbang berurusan dengan hal-hal tak menyenangkan di perusahaan Tapi dengan kondisi kakaknya yang kekanakkanakan dan kurang cerdas, ia terpaksa turun tangan. Mengurus perusahaan tanpa bantuan berarti dari kedua kakaknya membuat Seo Yoon kelelahan. Di ambang kelelahan, kehadiran Tae Joo yang kharismatik memberi angin segar membuatnya tanpa sadar jatuh cinta. Konflik yang ditimbulkan Tae Joo membuatnya harus memilih antara cinta dan keluarga.

Empire of Gold yang baru mengudara di Korea tanggal 1 Juli 2013 merupakan kolaborasi antara penulis Park Kyeong Soo dan produser Jo Nam Gookyang sebelumnya sukses dengan serial ‘The Chaser’. Aktor Park Geun Hyeong mengungkapkan harapannya karena dibesut orang-orang hebat. “Anda bisa merasakan cerita yang mengalir dengan natural tanpa dibuat-buat dari Park Kyeong Soo, dan pastinya memberikan rasa dekat dan familier dengan kehidupan sekitar Anda. Jadi ini pasti akan lebih terkenal dari serial drama mereka sebelumnya.”(m19)


B8

BANDARA Polonia Medan Tempo Doeloe.

Polonia Dalam Gambar

Waspada/net

BANDARA Polonia Medan diabadikan beberapa hari lalu, sebelum ditutup.

WASPADA Jumat 26 Juli 2013

Waspada/Surya Effendi

Waspada/Surya Efendi

MENDARAT TERAKHIR: Warga ramai menyaksikan pesawat AirAsia yang mendarat terakhir di Bandara Polonia Medan, Rabu (24/7) tengah malam. Bandara Polonia resmi ditutup dan diganti dengan Kualanamu International Airport (KNIA). Sementara Bandara Polonia digunakan sebagai Bandara Lanud Soewondo.

Waspada/Hendrik Prayetno

LION AIR: Pesawat Lion Air mendarat di Bandara Polonia Medan, Rabu (24/7) tengah malam, sebelum bandara tersebut resmi ditutup.

Waspada/Surya Efendi

DIBERI ULOS MENDARAT TERAKHIR: Wagubsu HT Erry Nuradi (tengah), Kapoldasu Irjen Pol Syarief Gunawan (dua dari kiri), Pangdam I/BB Mayjen TNI Burhanuddin Siagian (kiri), Pangkosek Hanudnas III Marsekal Pertama TNI Sungkono (dua dari kanan) dan Danlantamal I Laksamana Pertama Didik Wahyudi (kanan) memberi ulos kepada pilot dan co pilot pesawat AirAsia yang mendarat terakhir di Bandara Polonia Medan, Rabu (24/7) tengah malam.

Waspada/Hendrik Prayetno

DIBERI ULOS: Menteri Negara BUMN Dahlan Iskan didampingi Wagubsu HT Erry Nuradi memberi ulos kepada pilot dan co pilot pesawat Lion Air yang mendarat di Bandara Polonia Medan, Rabu (24/7) tengah malam.

Waspada/Surya Efendi

HARUS ADA MELAYU: Menteri Negara BUMN Dahlan Iskan bersama Wagubsu Erry Nuradi,Wapemred Harian Waspada H. Teruna J Said dan Zaki Abdullah berbincang tentang ornamen Melayu yang harus dipasang di Kualanamu International Airport (KNIA) sebagai simbol Desa Kualanamu dihuni mayoritas masyarakat Melayu. Perbincangan dilakukan di VIP Room Bandara Polonia Medan, Rabu (24/7) tengah malam.

Waspada/Surya Efendi

FOTO BERSAMA: Kapoldasu Irjen Pol Syarief Gunawan diabadikan bersama Kapolresta Medan Kombes Pol Nico Afinta Karokaro, Kasat Intelkam Kompol Faisal Napitupulu, Kasat Res Narkoba Kompol Dony Alexander, Kapolsek Medan Baru Kompol NasrunPasaribu dan perwira jajaran Poldasu dengan latar belakang pesawat AirAsia yang mendarat terakhir di Bandara Polonia Medan, Rabu (24/7) tengah malam.


Aceh

WASPADA Jumat 26 Juli 2013

50 Ton Hasil Illegal Logging Disita Penjual Makanan Buka Lapak Siang Hari LANGSA (Waspada): Meski telah ada imbauan dari Dinas Syariat Islam Kota Langsa agar pedagang makanan tidak berjualan di siang hari pada bulan Ramadhan, namun masih ada pedagang yang berani berjualan sejak pukul 12:00. Pantauan Waspada, Kamis (25/7), sejumlah pedagang makanan terlihat membuka lapaknya di depan Masjid Raya Darul Falah, Kota Langsa, jejeran gerobak makanan tersebut mulai terlihat sejak dari jembatan Gampong Sidorejo sampai di depan masjid, aneka makanan ditawarkan yang tersusun rapi digerobak tersebut diantaranya mie, pecal, anek macam kue serta minuman. Para pedagang berkilah mereka hanya menyusun dagangan sebelum dibawa ke pasar untuk dijual, namun mereka tetap melayani bila ada pembeli yang datang acap sekali terlihat dagangan mereka habis sebelum dibawa ke tempat berjualan di sepanjang jalan pasar baru, Kota Langsa. Sejumlah kalangan meminta Dinas Syariat Islam Kota Langsa menindak tegas para penjual makanan tersebut. “Para pedagang tersebut harus ditindak, Dinas Syariat Islam dan Polisi Wilayatul Hisba jangan hanya duduk manis di kantor,” ujar Ridha, Ketua Badan Komunikasi Pemuda Remaja Masjid Indonesia (BKPRMI) Kota Langsa. (b22)

Kuala Bagok Mendangkal NURUSSALAM (Waspada): Tidak kurang dari 4.000 meter daerah aliran sungai (DAS) Krueng Inong Kuala Bagok, Kecamatan Nurussalam, Kab. Aceh Timur mengalami kedangkalan. Akibatnya, puluhan boat (kapal—red) nelayan ketika keluar masuk harus menunggu air pasang. “Kondisi dangkalnya sungai tersebut sudah berlangsung dalam kurun waktu 10 tahun terakhir, diperkirakan kedangkalan terjadi akibat tsunami tahun 2004 yang terjadi hamper diseluruh Aceh, termasuk pesisir wilayah Aceh Timur,” kata Dinur, 37, salah seorang petani tambak asal Gampong Kuala Bagok, Kamis (25/7). Dikatakan, dangkalnya sungai tidak mengakibatkan kesulitan para nelayan, namun ratusan hektare areal tambak budidaya ikan bandeng dan udang di kawasan Kecamatan Nurussalam juga sulit mendapatkan air pasang yang maksimal. “Selaku petani tambak, kita sulit mendapatkan air yang maksimal saat terjadinya pasang purnama, sementara untuk pasang biasa air laut tidak maksimal masuk ke tambak,” tambah Dinur. Dinur bersama petani tambak lainnya mengaku butuh butuh sikap Pemerintah Kabupaten Aceh Timur atau Provinsi Aceh untuk dapat melakukan pengurukan Sungai Kuala Bagok. “Sehingga aktivitas nelayan dan petani tambak lancar dalam meningkatkan hasil produksi perikanan darat dan perikanan laut di kawasan itu,” imbuh Dinur lagi. (b24)

Pengendara Mio Tewas Dilindas Mobil LANGSA (Waspada): Seorang pengendara sepeda motor Yamaha Mio Soul, Asmawati, 35, warga Gampong Matang Panyang, Kec. Langsa Timur, tewas di jalan negara Medan-Banda Aceh tepatnya di Gampong Kapa, kecamatan setempat, setelah sepedamotor yang dikendarainya diserempet mobil yang tidak diketahui jenisnya, Rabu (24/7) sekira pukul 06:00. Informasi dihimpun, Asmawati, Rabu (24/7) selepas waktu shalat subuh atau sekitar pukul 06:00 menggunakan Yamaha Mio Soul berangkat dari rumahnya menuju Gampong Kuala Langsa, untuk menjual udang hidup kepada pemancing. Saat tiba di sekitar jalan negara Gampong Kapa, dari arah belakang melaju mobil yang mengarah dari Medan–Banda Aceh. Setahu bagaiamana Asmawati diserempet, sepeda motornya terpelanting ke pinggir jalan dan korban terjatuh di tengah jalan sehingga kepalanya dilindas mobil tersebut. Sementara pelaku meninggalkan korban. Korban dilaporkan tewas di tempat kejadian dan sempat dibawa ke RSUD Langsa. Kemudian kembali ke rumahnya untuk dikebumikan. (m43)

Pelanggan Keluhkan Distribusi Air PDAM Lhoknibong LHOKNIBONG (Waspada) : Sebagian besar pelanggan air bersih PDAM Tirta Peusada cabang Lhoknibong, Kabupaten Aceh Timur mengeluhkan macetnya distribusi air bersih yang lebih kurang hampir sepekan ini. Berdasarkan informasi, Rabu (24/7) dari warga mengatakan, dalam beberapa hari belakangan ini sejumlah pelanggan air bersih PDAM Lhoknibong merasa kecewa dengan lambannya penanganan pihak perusahaan terhadap persoalan yang terjadi. Menurut warga, semestinya pihak perusahaan harus memberitahukan kepada pelanggannya jika terjadi sesuatu hal. Para pelanggan mengharapkan pihak perusahaan bisa secepatnya mengatasi ataupun memperbaiki sarana yang rusak sehingga air bersih dapat dinikmati dengan baik. Kepala PDAM Cabang Lhoknibong yang berada di bawah naungan PDAM Tirta Peusada Aceh Timur Tarmizi yang dikonfirmasi mengakui pendistribusian air bersih untuk wilayah Lhoknibong mengalami kemacetan karena terjadinya kerusakan salah satu mesin penyedot air dari sungai. (cri)

SMPN 10 Langsa Gelar PKR LANGSA (Waspada): Sesuai instruksi Kadis Pendidikan Kota Langsa, SMP Negeri 10 Langsa melaksanakan Pesantren Kilat Ramadhan untuk mengisi kegiatan selama Ramadhan 1434 H di sekolah mulai dari kelas VII, VIII dan IX secara bergiliran. Demikian diutarakan Kepala SMPN 10 Langsa, Tarmizi Putra kepada wartawan, baru-baru ini. Menurutnya, pesantren kilat Ramadhan ini merupakan agenda rutin tahunan yang diikuti seluruh siswa mulai dari kelas VII, VIII dan IX. “Dengan adanya PKR ini siswa dapat menerima ilmi-ilmu dari gurunya untuk meningkatkan ilmu keagamaan, disiplin di bidang keagamaan dan lain-lain,” katanya. Dikatakan Tarmizi Putra, dengan kegiatan ini diharapkan siswa bisa menjadi di barisan terdepan dalam setiap melaksanakan kegiatan keagamaan. Apalagi, Insya Allah SMPN 10 akan menjadi sekolah umum berbasis Islami. Pemateri untuk PKR ini merupakan guru-guru agama di SMPN 10 yakni, Muksidul Ikhwan, Muni, Muhammad Yusuf, Nayimah dan dibantu guru-guru yang lain. (m43)

Untuk Banda Aceh & Sekitarnya Jumat, 17 Ramadhan 1434 H/26 Juli 2013 M BERBUKA 18.59 IMSAK 05.03 Jadwal ini berlaku untuk Banda Aceh Dan Sekitarnya Jadwal untuk kota-kota lainnya : Calang (-1 menit), Jantho (-2 menit), Sigli dan Meulaboh (-3 menit), Meureudu, Sukamakmue dan Sinabang (-4 menit), Bireuen (-5 menit), Sp. 3 Redelong, Takengon dan Blangpidie (-6 menit), Lhokseumawe dan Tapaktuan (-7 menit), Lhoksukon dan Blang Keujeuren (-8 menit), Idi, Kutacane dan Singkil (-10 menit), Langsa, Kuala Simpang dan Subulussalam (-11 menit). (b04)

IDI (Waspada): Hasil operasi yang dipimpin Kasat Reskrim Polres Aceh Timur, petugas kepolisian berhasil menyita 50 ton illegal loging di luar Hak Guna Usaha (HGU) Mopoli Raya dan Sri Mulya, Kecamatan Peunarun, Kabupaten Aceh Timur, Rabu (24/7) sekira pukul 18:00. Kapolres Aceh Timur, AKBP Muhajir, S.Ik.MH kepada Waspada, Kamis (25/7) menjelaskan, penangkapan puluhan ton berawal dari informasi masyarakat, dimana di luar HGU Mapoli Raya dan PT Sri Mulya kerap terjadi aksi illegal logging, bahkan masyarakat melihat adanya truk bermuatan kayu hutan keluar dari kawasan itu. “Berdasarkan informasi masyarakat, sehingga kita lakukan pengemba-

ngan dan penelusuran ke lokasi sejak pagi hingga sore hari oleh personil gabungan dari Polres,” kata Muhajir. Kayu yang ditemukan, lanjut Muhajir, jenis Krueng dan Rimba Campuran. Selain petugas kepolisian dari Satuan Reskrim Polres Aceh Timur, operasi juga ikut serta jajaran Pengamanan Hutan (Pamhut) yang dipimpin Pabin Polhut serta Kepala Dinas Kehutanan dan Perkebunan Kab. Aceh Timur, Ir Saifuddin Ishak, MP. “Kayu yang ditemukan berukuran diameter besar dan sebagian lainnya masih seperti balok,” katanya. Ditambahkan, operasi dilakukan dengan cara Letter ‘S’. Hal tersebut dilakukan untuk mengelabui pemilik kayu dan para pekerja sebagai buruh kasar. “Alhasil, 50 ton kayu di beberapa lokasi yang terpisah berhasil kita temukan,” kata Kapolres Muhajir sembari menyebutkan, mengingat hari sudah terlalu sore

dan medan yang jarak tempuh mencapai 45 kilometer ke arah selatan jalan negara sehingga petugas memberikan police line guna pengusutan dan penyelidikan selanjutnya. Ketika disinggung tersangka, AKBP Muhajir mengaku pihaknya belum berhasil menangkap dan mengidentifikasi nama-nama pelaku yang terlibat dalam aksi perambahan hutan di pedalaman AcehTimur tersebut. Pasalnya, kedatangan petugas tercium pelaku, sehingga pelaku yang diduga saat itu sebagai pekerja langsung melarikan diri dari lokasi. “Kita akan terus buru pelaku illegal logging ini, karena disebut-sebut aksi penebangaan hutan dengan berbagai alasan kian marak di sana, sehingga perlu ketegasan dari aparat penegak hukum demi menjaga kelestarian hutan dan isi didalamnya,” tandas Kapolres Muhajir, S.Ik. MH. (b24)

Waspada/M. Ishak

PETUGAS kepolisian menemukan 50 kayu hutan yang diduga hasil perambahan hutan di kawasan PT Putri Hijau, Kecamatan Peunarun, Kabupaten Aceh Timur, Rabu (24/7).

Khasanah Ramadhan

C1 Liputan Mudik Lebaran

Waspada/yusri

SALAH satu jalan negara Medan-Banda Aceh yang masih dalam perbaikan, tepatnya di kawasan Desa Alubu, Kecamatan Peureulak Barat dan ruas jalan kawasan Alue Rangan - Alue Tho, Kecamatan Peureulak Timur. Foto direkam, Selasa (23/7)

Jalan Negara Rusak Di Aceh Timur Masih Dalam Perbaikan PEUREULAK (Waspada): Sejumlah titik ruas jalan negera Medan-Banda Aceh dalam wilayah Kabupaten AcehTimur yang mengalami kerusakan parah saat ini masih dalam tahap pengerjaan perbaikannya. Diperkirakan pengaspalan badan jalan tersebut tidak akan rampung keseluruhannya pada saat Hari Raya Idul Fitri nantinya. Pengamatan di lapangan, adapun titik ruas jalan yang kini masih dalam masa pelaksanaan pekerjaannya yaitu di kawasan Idi Cut, Kecamatan Darul Aman, kawasan Desa Alubu, Kecamatan Peureulak Barat dan ruas jalan kawasan Alue Rangan - Alue Tho, Kecamatan Peureulak Timur. Selain itu juga, untuk ruas jalan negara wilayah Aceh Timur ada pembangunan dua buah jembatan yang sedang dalam pelaksanaan pekerjaannya yakni jembatan di Kota Peureulak dan jembatan di kawasan desa Kongseng, Kecamatan Ranto Seulamat. Meskipun, ruas jalan serta jembatan yang sedang dibangun tersebut tidak mengalami kemacetan kendaraan dengan waktu berjam-jam. Dikarenakan pada kedua belah sisi jembatan ada petugas yang memberikan isyarat agar kendaraan melewatinya secara bergantian dari masing-masing arah, baik menuju Banda Aceh maupun menuju Medan- Sumatera Utara. Begitu juga halnya dengan ruas jalan yang masih dalam pengerjaan di lapangan, tidak sempat

membuat kemacetan yang berarti. Sementara itu, Kapolres Aceh Timur AKBP Muhajir melalui Kasat Lantas Iptu Tesyar Rhofadli kepada Waspada, Selasa (23/7) menjelaskan, titik kerawanan jalan lintas di wilayah Aceh Timur meliputi Desa Paya Naden, Kecamatan Madat KM 324-323, Kecamatan Pante Bidari KM 332-331, Desa Teupin Pukat, Kecamatan Nurusslam KM 352-351, Desa Kuta Lawah, Kecamatan Idi Rayeuk KM 360-364. Kemudian kawasan Desa Seunebok Muku, Kecamatan Idi Timur pada KM 375-376, Desa Alubu Tuha, Kecamatan Peureulak Barat KM 380-381, Desa Blang Bitra, Kecamatan Peureulak Kota yaitu pada KM 387-388 serta di lintasan Desa Alue Lhok, Kecamatan Peureulak Timur yakni pada KM 402-403. Disebutkannya lagi, sementara itu untuk jumlah kecelakaan lalulintas tahun 2012 terjadi sebanyak 110 kasus, dengan korban meninggal dunia berjumlah 81 orang, luka berat 75 orang, luka ringan 121 orang dan ditambah kerugian material berkisar Rp510 juta. “Kami mengharapkan kepada pengguna jalan agar dapat mematuhi rambu-rambu lalulintas serta tidak ugal-ugalan saat mengemudi terutama pada saat lebaran nantinya,” harap Kasat Lantas Polres Aceh Timur. (cri)

Masjid Baitul Musyahadah

Berbudaya Khas Aceh Dan Berkubah Kupiah Meukutop DARI sekian banyak masjid di Aceh, mungkin tak banyak yang memiliki arsitektur unik berciri khas budaya Aceh. Salah satunya adalah Masjid Teuku Umar yang memiliki kubah berbentuk kupiah meukutop (topi Aceh dahulu kala-red). Karena berkubah berbentuk kupiah meukutop, maka masjid ini pun disandang n a m a M a s j i d Ku p i a h Meukutop atau lazim juga disebut Masjid Teuku Umar. Bahkan masjid yang ter-letak di Jalan Teuku Umar, ka-wasan Seutui Banda Aceh me-miliki banyak nama lain, di mana pengunjung juga sering menyebutkan dengan nama Masjid Baitul Musyahadah. Hampir dapat dipastikan dari sekian banyak masjid di Aceh atau umumnya di Indonesia, jarang sekali dijumpai yang bararsitektur seperti mas-jid ini, kubah berbentuk topi tradisional Aceh, yang dulunya kerap dipakai para

raja termasuk dipakai Pahlawan Nasional Teu-ku Umar Djohan Pahlawan, ter-nyata memiliki daya tarik ter-sendiri bagi setiap pengunjung. Karena penampilannya yang unik itulah sehingga pengunjung yang datang bukan hanya dari wilayah Aceh, namun juga dari luar Aceh. Menurut salah seorang pengunjung, Selasa (23/7), keunikan masjid ini di antaranya dari keunikan kubah berbentuk topi khas budaya Aceh tempo dulu yang membuat penasaran untuk melihat langsung keberadaan Masjid Teuku Umar di Bumi Serambi Mekkah ini. Padahal bentuk kubah masjid di Aceh terdiri berbagai ragam dan motifnya, tergantung selera panitia/pengurus dan warga di wilayah kemasjidan. Ketergantungan bentuk kubah dan model masjid juga sangat tergantung dari perkembangan zaman serta peristiwa bencana alam yang terjadi, seperti gempa dan tsunami Desember 2004

melanda Provinsi Aceh. Telah banyak masjid berubah bentuk aslinya di Aceh, setelah bangunan rumah ibadah itu runtuh dan dibangun kembali, tapi lain halnya dengan Masjid Kupiah Meukutop, tetap seperti sedia kala karena masih berdiri tegak seperti aslinya. Masjid dibanggun di atas tanah seluas 1,5 hektare berlokasi di kawasan permukiman padat penduduk di salah satu bagian kompleks Taman Ghairah, yang merupakan bagian Taman Istana Kerajaan Darussalam. Taman Ghairah dahulu merupakan sebuah taman tempat bercengkerama Keluarga Sultan Aceh, sebut Tgk Abdullah, pengurus masjid setempat. Disebutkan Tgk Abdullah, ikhwal pembangunan Masjid Teuku Umar yang juga diberi nama Masjid Baitul Musyahadah serta lebih dikenal dengan sebutan Masjid Kupiah Meukutop itu, dimulai pada 1988 diprakarsai beberapa tokoh masyarakat Aceh dan salah

satunya Ali Hasjmy, Gubernur Aceh kala itu. Dalam usia pelaksanaan pembangunan lima tahun masjid ini diresmikan penggunaannya oleh Gubernur Aceh, yang kala itu dijabat Syamsuddin Mahmud, tepatnya pada 9 Jumadil Awal 1414 Hijriah atau 25 Oktober 1995 Masehi. Sejak diresmikan hingga sekarang masjid ini tidak banyak terjadi perubahan, meskipun panitia dan pengurus masjid terus melakukan berbagai perbaikan dan penyempurnaan baik bentuk maupun bangunannya. Menurut Abdullah, selain bentuk kubahnya yang berbeda jauh dari kebanyakan masjid lainnya di Aceh dan Indonesia, bentuk masjid ini juga terdiri dari lima sudut yang bermakna Islam itu dibangun di atas lima dasar, yaitu rukun Islam. Kelima rukun itu diibaratkan sebagai tiang-tiang penyangga bangunan keIslaman seseorang. Artinya Islam itu bu-

Waspada/Rusli Ismail

MASJID KUPIAH MEUKUTOP berkubah khas budaya Aceh dan berbentuk lima sudut yang menggambarkan rukun Islam itu dibangun atas lima perkara atau lima dasar. kan hanya shalat sebagai tiang agama, tapi juga zakat, dan haji adalah tiang agama. Semua rukun Islam itu digambarkan di masjid yang satu ini melaui sudut-sudutnya. Sejak dulu hingga sekarang, sebut Abdullah, Masjid Kupiah Meukutop tetap dilakukan berbagai kegiatan keagamaan, tidak hanya terfokus sebagai tempat ibadah semata, tapi juga

dijadikan sebagai pusat kehidupan komunitas muslim lainnya, seperti kegiatan hari besar Islam, diskusi, kajian agama, ceramah dan belajar Al-quran. Bahkan jika di bulan Ramadhan selalu dilakukan tadarus Alquran dan pelaksanaan ‘Itikaf di 10 yang akhir Ramadhan. Rusli Ismail


Aceh

C2 LHOKSUKON (Waspada): Akibat kelebihan kapasitas atau over load, Rumah Tahanan Negara (Rutan) Lhoksukon, Aceh Utara, rentan terjadi kerusuhan. “Hingga Juli 2013, warga binaan kita mencapai 236 orang. Padahal, kapasitas standarnya hanya 90 orang,” kata Kepala Rutan Lhoksukon M Saleh, kemarin. M Saleh merincikan, dari 236 warga binaan tersebut, 9 orang di antaranya perempuan.Warga binaan kebanyakan kesandung kasus narkoba. Sementara selebihnya akumulasi macam-macam kasus, antara lain, trafficking, pembunuhan, penggelapan, pemerasan dan pengancaman, kepemilikan senjata api, KDRT dan kasus asusila. “Kita sudah mengajukan proposal renovasi sekaligus perluasan gedung Rutan. Tapi, belum terealisasi. Sementara, penghuni Rutan, semakin lama semakin banyak,” imbuhnya. Untuk mensiasati kondisi tersebut, sambung Saleh, pihak rutan telah menerapkan sejumlah kebijakan sesuai prosedur. Di segi keamanan, misalnya, pihak Rutan selalu berkoordinasi dengan Polres Aceh Utara. Sementara di sisi pelayanan, para napi yang telah berhak mendapat pembebasan bersyarat, cuti bersyarat serta cuti menjelang bebas, diberi haknya sesuai UU Nomor 12 Tahun 1995, tentang pemasyarakatan. (b19)

LHOKSUKON (Waspada): Pasar kecamatan di Kabupaten Aceh Utara selama Ramadhan selalu ramai, terutama pada sore hari. Kondisi itu mengakibatkan volume sampah meningkat sampai 40 persen, dibanding hari biasa. KadisPasar,KebersihandanPertamananAcehUtara,MDahlan, Kamis (25/7) mengakui selama Ramadhan keramaian di pasar kecamatan meningkat drastis.“Setiap pasar kecamatan selalu ramai pada sore hari,” jelasnya. Kondisi tersebut memaksa armada angkutan sampah bekerja ekstra agar bisa mengangkat seluruh sampah di 27 kecamatan yang masuk dalam Kabupaten Aceh Utara. Selain itu, tambah dia, pasar kecamatan sepanjang jalan negara juga terjadi kemacetan menjelang waktu berbuka. Pasar lintasan jalan Medan-Banda Aceh, yaitu Pantonlabu (Kecamatan Tanah Jambo Aye), Pasar Lhoksukon, Pasar Geudong (Samudera) dan Pasar Krueng Geukueh (Kecamatan Dewantara).“Volume sampah di kawasan pasar ini juga lebih banyak,” tambahnya. Menurut dia, pada hari biasa sampah dari seluruh pasar kecamatan di Aceh Utara rata-rata 250 meter kubik. Namun selama bulan puasa meningkat sampai 40 persen. Kendati volume meningkat, namun dinas pasar tidak melakukan penambahan armada angkutan sampah. Akan tetapi pihaknya mensiasati dengan cara mengatur rute angkutan. “Setiap armada akan melintasi beberapa pasar sehingga semua sampah bisa terangkut,” ungkap Dahlan.(b15)

Rujak Manis Dominasi Menu Lain LHOKSEUMAWE (Waspada): Salah satu makanan khas Aceh yang sangat menjamur di jajan menu berbuka di ruas jalan Kota Lhokseumawe adalah rujak manis. Rujak manis merupakan salah menu favorit masyarakat yang memiliki perpaduan rasa yang khas yaitu pedas juga manis. Tidak seperti jenis rujak biasanya dengan menggunakan bumbu, rujak ini dibuat dengan cara seperti sajian es teller ataupun es doger. Ada pun harganya Rp5 ribu per plastik atau satu gelas ukuran sedang. “Selama puasa rujak manis lumayan laku. Banyak orang membeli untuk buka puasa,” kata, Razali,34, salah seorang pedagang rujak di Lhokseumawe, Kamis (25/7). Proses pembuatan jenis minuman ini tidak jauh berbeda dengan membuat minuman dari es, buah-buahan berbagai jenis diracik kecil-kecil, baru diolah dengan bumbu pedas dan diberi es.(b14)

Kuota BSM-SMA Di Aceh Utara 8.383 Orang PANTONLABU (Waspada): Kuota bantuan siswa miskin atau BSM untuk SMA di Kabupaten Aceh Utara mencapai 8.383 orang. Masing-masing sekolah mendapat kuota 30 persen dari total siswa. “Ini termasuk kuota tambahan sebanyak 4.883 orang, yang didanai dengan APBN-P 2013,” kata Kamaruddin, Kasi SMA Disdikpora Aceh Utara usai meghadiri acara penutupan kegiatan ektrakurikuler Ramadhan di SMAN 1, Tanah Jambo Aye, Aceh Utara, kemarin. Menurut Kamaruddin, kuota tambahan tersebut diutamakan untuk siswa-siswi yang keluarganya mengantongi kartu BLSM atau Kartu Perlindungan Sosial (KPS). Namun, jika kuota 30 persen belum terpenuhi, sekolah bersangkutan dibolehkan memasukkan nama siswa miskin yang lain walau tidak mengantongi KPS. “Hari ini (kemarin-red) batas akhir pendataan. Alhamdulillah, datanya hampir final. Tinggal 5 sekolah lagi. Target kita, Kamis (25/7) malam sudah selesai dan langsung kita email ke Jakarta,” kata Kamaruddin. Kamaruddin menambahkan, pencairan BSM kouta tambahan sangat tergantung pada pembahasan APBN-P oleh DPR. Jika pembahasan cepat kelar, maka BSM pun cepat cair. “Yang jelas, dana bantuan itu nanti akan disalurkan langsung ke rekening siswa penerima. Nilainya sekitar Rp1 juta per siswa,” papar Kamaruddin. Kepala SMAN 1 Tanah Jambo Aye M Isya menjelaskan, sesuai instruksi Disdikpora Aceh Utara, kegiatan ekstrakurikuler Ramadhan di sekolah itu digelar 10 hari, 15-25 Juli 2013. Kegiatan fokus pada pendalaman ilmu agama dan turut diisi dengan aneka lomba, yakni lomba shalat jenazah, lomba membaca doa sesudah shalat wajib dan lomba menghafal ayat-ayat pendek. (b19)

BIREUEN (Waspada): Bupati Bireuen Ruslan M Daud memerintahkan dinas terkait agar lebih selektif lagi dalam melakukan pendataan masyarakat calon penerima bantuan sehingga bantuan yang disalurkan nanti benar-benar kepada yang paling berhak menerimanya. Demikian antara lain disampaikannya ketika membuka rapat koordinasi antar dinas dan instansi terkait dengan penanganan pengaduan masyarakat terkait pembagian Kartu Perlindungan Sosial (KPS) di Oproom Setdakab setempat, Kamis (25/7). Dia mengatakan, bantuan yang disalurkan pemerintah pusat seperti Bantuan Langsung Sementara Masyarakat (BLSM) adalah untuk membantu masyarakat miskin akibat kenaikan harga BBM. “Untuk itu perlu juga dilaksanakan program kompensasi lainnya, berupa program percepatan dan perluasan perlindungan sosial yang

Waspada/M. Ishak

PUTUS SEKOLAH: Anak-anak setingkat SMP bersuka ria ketika disapa oleh Bupati Aceh Timur Hasballah M.Thaib atau Rocky (kanan) di sebuah kawasan pinggiran persisnya di Desa Punti Payong, Kecamatan Ranto Peureulak, Kabupaten Aceh Timur, Selasa (23/7) petang. Ketika itu Rocky meninjau proses pengerjaan pembangunan jalan Program Percepatan Pembangunan Pedesaan disana, namun tiba-tiba bertemu dengan anak-anak yang sedang bermain dipinggiran perkebunan, sayangnya seluruh anak-anak setelah lulus SD mengalami putus sekolah, karena jarak tempuh menuju SMP mencapai belasan kilometer perjalanan jalan kaki. Rocky berpesan, ke depan tidak ada lagi anakanak yang putus sekolah mulai SD hingga SMA sederajat.

Kasus Calhaj Plus

Penggugat Minta Hakim Tolak Eksepsi LHOKSEUMAWE (Waspada): Penggugat PT Iskandaria Tour dan Travel Cabang Lhokseumawe meminta majelis hakim menolak eksepsi (sanggahan) tergugat seluruhnya. Sidang beragenda penyampaian kesimpulan ini berlangsung di Pengadilan Negeri Lhokseumawe, Kamis (25/7). Tiga hal yang disampaikan PT Iskandaria melalui kuasa hukum Sofian Adami, setelah di-

simpulkan dari uraian penggugat Dalam Konveksi (DK) atau tergugat Dalam Rekonveksi (DR), mereka meminta hakim supaya menolak eksepsi tergugat untuk seluruhnya. Dalam Konvensi (gugatan awal) agar mengabulkan gugatan penggugat untuk seleruhnya. Kemudian Dalam Rekonvensi (gugatan balasan), dimohonkan kepada majelis hakim supaya menolak gugatan rekonvensi dari penggugat DR/tergugat DK, menghukum penggugat DR/tergugat DK untuk membayar seluruh biaya yang timbul dalam perkara ini. Sementara tergugat Muza-

kir Didoh melalui kuasa hukumnya Efendi Idris yang diwakilkan Maimun Idris tetap bertahan dengan dalil-dalil yang telah dikemukakan. Disebutkan juga, gugatan dari penggugat sebuah bentuk perlawanan hukum yang merugikan mereka. Kemudian, gugatan PT Iskandaria juga tidak ada relevansinya dengan pencemaran nama baik. Sidang yang dipimpin Inrawaldididampingiduahakimanggota Zulfikar dan Nasri berlangsung tidak lama, karena hanya penyerahan masing-masing berkas kesimpulan. Selanjutnya, sidangakandilakukanKamispekan depan, 1 Agustus 2013. (cmk)

Syakir Daulay, Mutiara Asal Bireuen BIREUEN (Waspada) : Syakir Daulay,11, mantan pelajar SDN-, mutiara asal Dusun Komes, Desa Meunasah Capa, Kecamatan Kota Juang, Bireuen meraih prestasi gemilang dalam bulan Ramadhan menjadi Da’i Cilik Trans TV dan Muazzin magrib Trans-7. Putra bungsu empat bersaudara pasangan M Hasan – Nazariah saat ini belajar di Pesantren Tahfidz Darul Qur’an Tangerang pimpinan ustadz Yusuf Mansur dan belajar azan pada Syeih Kholilul Rahman dan Syeih Ali Jaber, keduanya Imam Masjid Nabawi Madinah. Selama libur Ramadhan Syakir Daulay tinggal bersama ustadz Taufik Akbar Hasibuan asal Rantauprapat (Sumut) di Cipinang (Jakarta) sebagai gurunya untuk memperdalam ilmu tilawah/qari dan ceramah. M Hasan, ayah Syakir Daulay, Rabu (25/7) menjelaskan, putranya dalam bulan Ramadhan 1434 hijriah meraih prestasi mendapat undangan sebagai Da’i cilik di Trans TV dan azan magrib di Trans-7. Dikatakan, Syakir Daulay

Da’i cilik Syakir Daulay mendapat undangan sebagai da’i cilik untuk memberikan ceramah pada acara ceria Ramadhan Trans TV pukul 18:00 –19:00 mulai (6–28/7), dan (34/8). Semantara azan magrib waktu Jakarta di Trans-7 (12-29/ 7). Ceramah perdana putranya Syakir Daulay di Masjid An Nida 2011 dalam acara nikmatnya sedekah. Mulai saat itu Syakir mulai tenar mendapat undangan sebagai da’i untuk me-

ngisi ceramah seputaran Jabodetabek, Bandung,Tasikmalaya, Jogyakarta dan pada tahun 2011-2012 sudah dua kali mendapat undangan ceramah ke Hongkong bersama ustadz Yusuf Mansur, pimpinan Pesantren Darul Qu’an Tangerang. Menurut M Hasan, putranya Syakir Daulay selama ini tinggal bersama orangtua asuh di Jakarta Timur, sudah menghafal Quran 12 Juz, bercita- cita akan melanjutkan pendidikan ke Mesir untuk memperdalam ilmu Qiraat, Tahfidz Quran dan bahasa Arab. Syakir Daulay pernah mengikuti eksebisi MTQ Provinsi Aceh 2009, juara harapan I Cabang Tartil MTQ DKI Jaya 2010. Menyusul juara-I audisi azan anak Indonesia 2010, azannya ditayang Global TV selama setahun, juara II MTQ Cabang Taril Jakarta Timur 2012, juara I MTQ Cabang Tartil Kota Tangerang 2012, peserta MTQ Cabang Tartil Kota Tangerang 2012, peserta MTQ Cabang Tartil Provinsi Banten 2012, muazzin langsung buka bersama Trans7 2012-2013. (b12)

Hayatun Kamila, Anak Nelayan Bernasib Malang Waspada/Musyawir

SISWA juara lomba shalat jenazah, lomba baca doa dan lomba menghafal Quran, diabadikan bersama guru di Mushalla SMAN 1 Tanah Jambo Aye, Aceh Utara, Kamis (25/7)

Tiba (flight, asal, waktu)

Garuda Indonesia

GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Berangkat (flight, tujuan, waktu)

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35

12:50

SJ 011 Medan/Jakarta

13:35

12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45

14:00

FY 3400 Penang*

14:20

Jumat 26 Juli 2013

Selektif Data Penerima Bantuan

Rutan Lhoksukon Rentan Rusuh

Pasar Kecamatan Ramai, Volume Sampah Meningkat

WASPADA

NELAYAN dengan kondisi ekonomi sekarat mendapat cobaan yang benar-benar harus dijalankan dengan penuh kesabaran. Anak semata wayang yang dinamai Hayatun Kamila, 3,2 tahun oleh A Gani Ismail dan Nurhayati mengalami penyakit aneh, leher dan tangannya mengecil serta urat-urat di bagian tangan terus menonjol keluar. Balita perempuan mungil yang lahir 13 Mei 2010 lalu di Kuala Keurto, Kecamatan lapang, Aceh Utara ini memiliki nasib malang. Umurnya yang terus bertambah, tapi dia tidak memiliki tubuh atau membesar seperti balita normal lainnya. “Mulai umur tujuh hari, ia sering nangis, lalu kami sembur ke dukun. Tapi tidak kurang juga. Saat memasuki umur tujuh bulan, baru kami bawa ke Rumah Sakit Cut Meutia,” ujar Nurhayati, Ibu Kandung, Hayatun Kamila, Rabu (24/7). Setelah menjalani perawatan di rumah sakit milik Pemkab Aceh Utara itu, Kamila begitu penggilannya divonis dokter yang menanganinya menderita kelainan. Kamila menangis karena mengalami kelainan pada tubuhnya. Namun Nurhayati tidak mengerti, kelainan seperti apa dimaksud dokter.

Waspada/Mustafa Kamal

HAYATUN Kamila, berbaring dalam pangkuan ibunya saat di Rumah Sakit Cut Meutia Aceh Utara di Bukit Rata, Lhokseumawe, Rabu (24/7) Seperti biasa, setelah menjalani perawatan, dokter memberi Kamila obat dan diperbolehkan pulang. Tapi balita malang itu tetap tak bisa tenang, ia terus menangis hingga harus kembali dilarikan ke RSUCM dan kemudian dirawat inap. Sementara sisi lain, ayah Kamila bernama A Gani Ismail dengan profesi nelayan, harus mengorbankan alat kerjanya guna membiayai penopang pengobatan dan kebutuhan lain untuk anaknya yang merupakan asa dari buah keluarga

mereka. Gani terpaksa menjual sebuah perahu yang dimilikinya. Hasil penjualan ini digunakan untuk membeli susu. Kamila membutuhkan biaya sekitar Rp68.000 untuk membeli susu. Susu tersebut bisa bertahan hingga lima hari. Sementara untuk mengais rezeki sebagai nelayan, kini A Gani hanya bisa menumpang pada boat kecil milik temannya. Per hari mendapat uang Rp5.000-Rp20.000. Mustafa Kamal

dikucurkan pemerintah pusat yang mencakup pemberian raskin dan Program Keluarga Harapan (PKH),” kata Ruslan. Kepala BPMP dan KS Bireuen Amir Addani mengatakan, menyikapi permasalahan yang terkait dengan program bantuan ini, dinas yang dipimpinnya telah membentuk Unit Pelayanan Masyarakat (UPM). Melalui UPM ini, diharapkan masyarakat mengetahui dan memahami mekanisme penyaluran program bantuan dan masyarakat juga mengerti tentang menyampaikan laporan ketika mendapat masalah dalam hal penyaluran berbagai bantuan tersebut. Kegiatan ini digelar Badan Pemberdayaan Masyarakat Perempuan dan Keluarga Sejahtera (BPMP dan KS) Kabupaten Bireuen, diikuti para kadis terkait, para camat serta pegawai PT Pos Indonesia Cabang Bireuen dan dari Badan Pusat Statistik (BPS). (b17)

Arah APBK-P Aceh Utara Percepat Pembangunan LHOKSEUMAWE (Waspada): Arah kebijakan perubahan belanja daerah Kabupaten Aceh untuk peningkatan infrastruktur dasar, sektor pendidikan, kesehatan serta bidang pertanian. “Hal ini sesuai dengan prioritas pembangunan daerah yang lagi mendesak,” kata Bupati Aceh Utara Muhammad Thaib dalam rapat Paripurna ke-4 masa persidangan II dengan agenda penyampaian kebijakan umum anggaran perubahan APBK (KUPA) dan prioritas plafon anggaran sementara perubahan (PPAS-P) tahun 2013 baru-baru ini. Perubahan belanja daerah terjadi pada biaya tidak langsung, dari semula sebesar Rp799,4 miliar bertambah menjadi Rp830,2 miliar lebih. Sedangkan biaya langsung sebesar Rp558,5 miliar menjadi Rp718,1 miliar lebih. Perubahan mendasar ini, sebut Thaib, terjadi pada kondisi pendapatan daerah dari rencana Rp 1,36 triliun meningkat menjadi Rp1,5 triliun lebih.

Sementara penerimaan PAD yang semula Rp113,7 miliar meningkat menjadi Rp119,8 miliar, dana perimbangan Rp1,1 trilyun meningkat menjadi Rp1,2 triliun lebih. Penerimaan dana bagi hasil pajak dan bagi hasil meningkat menjadi Rp529,2 miliar lebih. Penerimaan lain-lain pendapatan daerah yang sah meningkat dari 96,4 miliar menjadi 112,6 miliar. Berdasarkan anggaran APBK Aceh Utara tahun 2013, asumsi yang telah ditetapkan dalam Kebijakan Umum Anggaran (KUA) tidak semuanya sesuai, ini disebabakan adaya peningkatan perolehan pendapatan daerah dan pergeseran alokasi belanja daerah serta penambahan penerimaa pembiayaan daerah. “Mengacu pada kondisi peningkatan pendapatan daerah dan sumber tambahan penerimaan pembiayaan, memberi peluang mengakomodir program dan kegiatan yang mendukung visi kepala daerah yang belum terealisasi pada APBK tahun 2013,” pungkas Thaib. (b14)

Pemblokiran Menjadi Tiga Titik LHOKSEUMAWE (Waspada): Pasca penghadangan tim safari Ramadhan Pemkab Aceh Utara di Kecamatang Nibong, hingga kemarin pemblokiran jalan terus berlanjut menjadi tiga titik. Masing-masing di Keude Simpang Paya, Simpang Mamplam dan Meunje Lhee. Geuchik Meunje Lhee, Nasruddin, Rabu (24/ 7) menyebutkan, jalan Kemukiman Simpang Paya yang meliputi beberapa desa itu telah dilakukan pengerasan sejak 2009 sampai 2010. Namun karena pengerjaan asal-asalan, akhirnya kembali berlubang dan rusak parah sehingga sulit dilintasi. Pemblokiran dan penghadangan tim safari Ramadhan, kata geuchik, dilakukan warga dari lima desa, meliputi dari Desa Mamplam Paya

Terbang, Keude Simpang Paya, Meuje Lhee, Ranto dan Seulunyok. “Warga mendengar kabar terkait kedatangan Bupati Aceh Utara untuk berbuka puasa di Desa Madi. Maka atas inisiatif bersama mereka memblokir jalan untuk menghentikan rombongan. Mereka ingin berbicara langsung dengan bupati terkait janji pengaspalan jalan desa sepanjang 5 kilometer. Namun terkait penyanderaan mobil milik anggota DPRK Aceh Utara, Geuchik Meuje Lhee membenarkan kejadian itu. “Mobil itu sempat ditahan, namun dilepas atas permintaan Muspika. Awalnya masyarakat menolak, namun karena tidak ingin ada provokasi pembakaran mobil, akhirnya dilepas juga,” jelasnya. (cmk)

LAP Gelar Seminar Pembangunan LANGSA (Waspada): Lembaga Analisis Pembangunan (LAP) Kota Langsa menggelar seminar pembangunan dengan tema, potensi Pelabuhan Kuala Langsa dan objek wisata bahari Telaga Tujoh di aula SMK Negeri 3 Langsa, Kamis (25/7). Hadir Kepala Kesbang Pol dan Linmas, Razali A Karim dan ratusan peserta dari berbagai gampong di wilayah Kota Langsa serta pemateri dari Kadis Perhubungan, Informasi dan Komunikasi Suyetno, Kasie Promosi dan Pemasaran pada Dinas Pemuda Olahraga, Kebudayaan dan Pariwisata, Bahtiar, Ketua PWI Perwakilan Aceh Timur Agusni AH. Ketua panitia Munawir menyebutkan, acara yang diselenggarakan selama satu hari dihadiri oleh unsur akademisi, mahasiswa, tokoh masyarakat, pemuda, LSM dan OKP serta pelaku dunia

usaha di Kota Langsa, mahasiswa dan LSM Kota Langsa. “Seminar ini merupakan program kerja LSM Lembaga Analisis Pembangunan (LAP) tahun 2013 yang bertujuan untuk melakukan konstribusi terhadap pembangunan daerah, khususnya pada aspek pemberdayaan ekonomi masyarakat melalui kegiatan seminar potensi Pelabuhan Kuala Langsa dan objek wisata bahari Telaga Tujuh. Wakil Wali Kota Langsa yang diwakili Kepala Kesbang Pol dan Linmas, Razali A Karim, menyampaikan terima kasih kepada panitia khususnya LAP yang telah melaksanakan kegiatan ini. Dimanapelabuhanmerupakananugrahyangharus disyukri karena termasuk pelabuhan regional yang dipersiapkan menjadi salah satu pintu masuk untuk pantai timur di Provinsi Aceh. (m43)

Kasus Sabu-sabu 6,5 Kg

Lima Warga Aceh Tamiang Disidang Tanpa Alat Bukti LANGSA (Waspada): Perdimasukan ke dalam flashdisk sidangan terhadap lima warga telah diterima Majelis Hakim Aceh Tamiang (Atam) yang dan JPU atas nama Fathur. didakwa membawa sabu“Tapi tidak menjadi persabu seberat 6,5 kg sesuai surat timbangan JPU. Lantas, anehtuntutan No Rek.PERK: PDMnya lagi, JPU mengaitkan ba35-III/STBAT/03/2013 dan rang jenis sabu-sabu itu dengan kini sedang menjalankan siseorang napi dalam kasus hedang di PN Stabat hanya didaroin 2,5 kg atas nama Azharudsarkan petunjuk (fatur) tanpa din alias Zaha yang sekarang di alat bukti yang jelas berupa LP kelas I A Binjai. Dia pun tidak sabu-sabu seberat 6,5 kg. dihadirkan dalam persidangan, Demikian dikatakan Penapadahal perjalanan menghasehat Hukum kelima terdakdirkan Zaha itu hanya butuh wa, Muslim A Gani didamwaktu 30 menit menuju PN StaMuslim A Gani pingi asistennya Dian Yuliani, bat,” sebutnya. SH di kantor Acheh Legal ConOleh karena itu, Muslim sult di Jalan A Yani Kota Langsa, Kamis (25/7). berharap kepada Majelis Hakim untuk memuMenurut Muslim, kelima terdakwa kasus tuskan perkara ini tanpa melihat institusi mana narkotika golongan 1 yakni Mohammad Azwar yang mengajukan perkara ini ke PN Stabat. Kalau alias Yahwa, Mohammad Agus alias Mamat, memang tidak bisa dibuktikan untuk menegakAhmad Fauzi alias Negon, Payyed alias Gembung kan supremsi hukum di negeri ini, kita semua dan Rustam Efendi alias Pak Tam didakwa harus berani menyatakan tidak dan membedengan tuntutan terbukti bersalah melakukan baskan kelima terdakwa. tindak pidana “Tanpa hak dan melawan hukum Kemudian, berkaitan dengan barang bukti melakukan permufakatan jahat menjadi peran- jenis sabu-sabu sebanyak 6,5 kg milik Fathur sama tara dalam jual beli, menukar atau menyerahkan sekali tidak ada hubungannya dengan terdakwa. narkotika golongan 1 jenis sabu sebagaimana Itu telah kita buktikan di dalam persidangan dari diatur dalam Pasal 114 Ayat (1) jo Pasal 132 Ayat semua keterangan saksi-saksi dikecualikan saksi (2) UU No. 35 tahun 2009 tentang narkotika se- BNN RI yang menghubung-hubungkan terdakwa perti dalam dakwaan primair. dengan barang bukti tersebut. Kemudian, menjatuhkan pidana terhadap Selanjutnya, kuasa hukum terdakwa kepada kelima dengan pidana penjara selama 20 tahun Majelis Hakim supaya mobil Suzuki Swift yang dikurangi selama terdakwa berada dalam taha- dirampas beserta barang milik terdakwa lainnya nan dengan perintah terdakwa tetap ditahan dan seharusnya dimasukan dalam berita acara sita denda sebesar Rp2 miliar subsidair 6 bulan penjara. dan diserahkan kepada pengadilan. Tapi apa yang “Tuntutan Jaksa Penuntut Umum (JPU) ini terjadi hari ini, mobil beserta barang berharga penuh dengan asumsi dan terkesan tendensius. raib entah di mana, yang diperlihatkan hanya Hal ini dibuktikan lewat tuntutan JPU yang telah 5 HP murahan dan KTP yang diperlihatkan JPU melebihi batas maksimum 20 tahun penjara. melalui Majelis Hakim. “Tidak ada barang bukti Ini sebuah tuntutan sangat emosional dan belum lainnya, lantas kalau JPU menuntut terdakwa hanya pernah terjadi di peradilan mana pun. Dikare- sebuah pengakuan Fathur dan kelima ter-dakwa nakan tuntutan itu hanya berdasarkan petunjuk, akan dihukum, kami tidak bisa mem-bayangkan tanpa alat bukti dan bertentangan dengan Pasal bagaimana nasib hukum di negeri ini ke depan. 10 dan 12 KUHPidana,” katanya. Akan banyak terdakwaterdakwa yang tak bersalah Bahkan, terang Muslim, saksi mahkota atau memenuhi lembaga pemasyarakatan di semua pengakuan JhoniWardi alias Amaq Kamaruddin daerah di Indonesia,” cetusnya. alias Fathur yaitu nara pidana LP Cirebon (berkas Muslim kembali berharap kepada Majelis terpisah) yang menjadi pedoman JPU, tidak Hakim dalam memberikan putusan untuk kelima pernah dihadirkan oleh JPU ke hadapan sidang warga Aceh Tamiang ini agar melihat dengan peradilan. Padahal kuasa hukum terdakwa, telah jernih fakta hukum dan nurani. Kami yakin dan mengajukan surat secara tertulis kepada Majelis percaya Majelis Hakim PN Stabat akan memberiHakim tentang transkrip pembicaraan ke- kan putusan yang terbaik kepada lima terdakwa mudian gambar dalam bentuk video yang yang terjalimi ini. (m43)


Aceh

WASPADA Jumat 26 Juli 2013

Ramadhan Momen UKM Musiman Raup Untung

Peringatan Nuzul Quran Kabupaten Dipercepat PULAU BANYAK (Waspada) : Peringatan Nuzul Quran Kabupaten Aceh Singkil yang dipusatkan di Masjid Baitul Muhtadin, Kecamatan Pulau Banyak dipercepat. Nuzul Quran yang seharusnya diperingati pada malam ini Kamis (25/7) untuk Kabupaten Aceh Singkil sudah dilaksanakan pada Selasa (23/7) lalu . Wakil Bupati Aceh Singkil Dulmusrid dalam sambutannya pada acara Nuzul Quran yang dihadiri Dandim 0109/Singkil Letkol Inf . Puguh B mengatakan, Nuzul Quran ini dipercepat mengingat lokasi pelaksanaan jauh dan harus menyeberangi lautan sehingga disesuaikan dengan jadwal pelayaran ferry. Ustadz Ramadani Batubara dalam tausiahnya mengatakan saat ini Alquran hanya dijadikan hiasan, sehingga banyak kaum muslim yang tidak mampu membaca dan mengamalkan isi kandungan Alquran .Padahal kata dia Alquran merupakan pedoman hidup untuk bisa selamat di dunia dan selamat di akhirat. Camat Pulau Banyak Ridwan mengucapkan terima kasih kepada Pemerintah Kabupaten Aceh Singkil yang telah menunjuk Kecamata Pulau Banyak lokasi berlangsungnya kegiatan Nuzul Quran tingkat kabupaten. Acara juga dirangkaikan dengan penyerahan bantuan kepada muallaf dari bagian Kesmasy Setdakab Aceh Singkil dan kipas angin dari Dinas Syariat Islam kepada Masjid Baitul Muhtadin yang diserahkan Wakil Bupati dan Dandim 0109/Singkil .(cdin)

MEUREUDU (Waspada) : Ramadhan selalu dimanfaatkan warga sebagai ajang merintis usaha. Hal ini sudah menjadi alternatif tepat bagi sebagian warga yang ingin mendatangkan untung besar di bulan Ramadhan. Tidak heran bila pelaku Usaha Kecil Menengah (UKM) musiman pun bermunculan meramaikan penjuru nusantara, khusus Aceh, seiring dengan mengisi kemeriahan Ramadhan. Sehingga para pelaku UKM itu memenuhi setiap ruas jalan dan pelataran toko di berbagai kota provinsi, kabupaten/kota dan kecamatan bahkan hingga ke pelosok desa. Kondisi itu sebagaimana juga diakui Kadis Perindustrian, Perdagangan, Koperasi dan Usaha KecilMenengah(DisperindagkopdanUKM)Kabupaten Pidie Pidie Jaya, M Puteh, Kamis (25/7). “Bulan Ramadhan dapat disebut sebagai bulan UKM, karena menjamurnya berbagai kegiatan ekonomi masyarakat. Tentunya semua

Polisi Tenggelam Ditemukan Tewas SINGKIL (Waspada) : Brigadir Fazar, anggota Polres Aceh Singkil yang dinyatakan hilang tenggelam sejak Minggu (21/ 7) lalu, di Sungai Cinendang kawasan Desa Gambir ditemukan dengan kondisi tak bernyawa sekira pukul 16:10 pada Selasa (23/7). Kepala Badan Penanggulangan Bencana Daerah (BPBD) Kabupaten Aceh Singkil Sulaiman kepada Waspada, Rabu (24/ 7) melalui ponselnya mengatakan, korban ditemukan didasar sungai sekitar lokasi tenggelam setelah dilakukan pencarian dengan cara menyelam selama dua hari. Jenazah langsung diotopsi di Puskesmas Simpang Kanan dan selanjutnya dibawa ke rumah duka di Panda Sari untuk kemudian dikebumikan. Sementara itu di hari yang sama Pimpinan Suluk Pondok Pesantren Darussalam, Selok Aceh, Kecamatan Singkil Tgk Fakih Bawahi, juga menghembuskan nafas terakhir sekira pukul 14.45 di perjalanan menuju salah satu RSU di Medan setelah sebelumnya terserang stroke. Ustadz Tarmizi, adik kandung alm kepada Waspada Kamis (25/7) mengatakan, almarhum meninggalkan satu orang istri bernama Syahminar dan lima orang anak. Almarhum dimakamkan di dekat makam orangtuanya yaitu Abuya Syech Tgk M Khalil di TPU Kampong Ujung . Selama hidupnya alm pernah menjabat beberapa posisi penting di antaranya, Ketua DPC PPP Kabupaten Aceh Singkil dan pimpinan Pondok pesantren Suluk Darussalam Selok Aceh. Aslia, Sekretaris DPC PPP Kabupaten Aceh Singkil mengaku kehilangan seorang figur, seorang guru dan seorang pemimpin yang begitu bersahaja . (cdin)

MTA Bantu Rumah Korban Gempa REDELONG (Waspada): Kelompok pengajian Majelis Tafsir Alquran (MTA) Sumatera Utara direncanakan akan membantu memperbaiki sebagian rumah warga Kabupaten Bener Meriah yang terkena musibah gempa bumi. Hal tersebut dikatakan Koordinator lapangan MTA Sumatera Utara Supono, SP, Kamis (25/7). “Kemungkinan MTA juga akan membantu beberapa rumah yang rusak untuk dibangun kembali usai Hari Raya Idul Fitri nanti,” ujar Supono. Ia juga menambahkan, kepastian perbaikan bantuan rumah warga yang tekena gempa tersebut setelah mendapat data yang akurat dari Pemkab Bener Meriah. Selain itu, Majlis Tafsir Alquran yang berpusat di Solo, Jawa Tengah, mengirim relawan di bawah koordinator Supono SP dan memberikan bantuan sembako kepada korban bencana gempa di Bener Meriah dan Aceh Tengah. “Hal ini, sebagai bentuk empati terhadap musibah yang menimpa warga yang berada di Bener Meriah dan Aceh tengah dan kegiatan ini dipusatkan di Desa Suka Makmur, Kecamatan Wih Pesam, Bener Meriah. Selain pembagian sembako, juga dilaksanakan trauma center secara kesinambungan kepada korban gempa dalam bentuk penyuluhan dan pengajian,” ungkap Supono. (b33)

itu tidak terlepas dari tujuan untuk mendapatkan keuntungan, apalagi untuk para UKM yang bergerak di bidang makanan, “ujarnya. Menurutnya, kondisi itu dapat dilihat dari penjualan berbagai jenis makanan berbuka pua-sa yang menjamur hampir di seluruh daerah. Uniknya, kegiatan yang menggerakkan UKM seperti itu tidak pernah berlangsung pada bulan-bulan sebelumnya, meski menjelang hari besar nasional. Sebagian besar makanan yang dijual tersebut merupakan produk UKM yang dimasak langsung oleh masyarakat. Bukan produksi perusahaan tertentu. Demikian juga dengan penjualan berbagai jenis pakaian, baik di pasar tradisional maupun pusat perbelanjaan modern yang semakin marak ketika mendekati berakhirnya Ramadhan. Berbagai jenis pakaian yang diperjualbelikan pada Ramadhan sebagian besar berasal dari aktivitas “home industry” masyarakat. (b09)

Pembangunan Nagan Raya Terfokus Pada Satu Titik

Gedung Pertemuan Susoh Tak Terawat BLANGPIDIE (Waspada) : Gedung pertemuan milik Pemkab Abdya di Gampong Padang Baru, Kecamatan Susoh, tidak mempunyai peraturan baku dalam pengelolaan gedung dimaksud. Akibatnya, gedung pertemuan yang digunakan untuk berbagai kegiatan pemerintah dan swasta itu saat ini kondisinya sangat memprihatinkan. Amatan Waspada, Kamis (25/7), gedung serba guna yang terletak bersebelahan dengan rumah dinas Camat Susoh itu terkesan jauh dari perhatian dan perawatan, mulai dari lantai hingga plafon gedung tersebut tampak rusak parah. Padahal, hampir setiap ada acara instansi pemerintah dan swasta menggunakan fasilitas gedung tersebut. Camat Susoh, Mirsal kepada Waspada, Kamis (25/7) di ruang kerjanya terkait kondisi gedung tersebut mengakui belum pernah ada perbaikan maupun perawatan sejak gedung tersebut digunakan beberapa tahun silam. Mirsal menyebutkan, selama ini bangunan tersebut hanya dipinjampakaikan kepada yang berkepentingan dengan hanya membayar uang sewa gedung. “Sejak gedung itu mulai digunakan, tidak ada ketentuan dan patokan terkait pembayaran sewa gedung serta fasilitas lain oleh Pemkab Abdya sehingga kita susah mengambil sewanya,” sebut Mirsal. (b08)

C3

Waspada/Rusli Ismail

NELAYAN beraktivitas kembali setelah menghabiskan masa libur menyambut Ramadhan 1434 Hijriyah selama 10 hari. Mereka mengaku tak mungkin berlama-lama di daratsementara kebutuhan biaya hidup keluarga yang semakin mendesak. Foto direkam di Kuala Krueng Pante Raja, Kecamatan Pante Raja, Kabupaten Podoe Jaya, Rabu (24/7)

Ketua Kobar-GB Aceh Bantah Mau Memukul Korban BANDA ACEH (Waspada) : Ketua Kobar-GB Aceh, Sayuti Aulia yang menjadi terdakwa dalam kasus perbuatan tidak menyenangkan terhadap seorang guru di Banda Aceh membantah mengeluarkan kata-kata akan memukul (kupohkah-red) terhadap korban. “Saya tidak pernah mengeluarkan kata-kata “kupohkah” terhadap korban Asni. Begitu juga, saya tidak pernah mengangkat tangan ke hadapan korban untuk memukulnya,” ujar terdakwa Sayuti, membantah keterangan saksi korban Asni di Pengadilan Negeri Banda Aceh, Kamis (25/7). Sidang terhadap Ketua Kobar-GB,itu dihadiri ratusan guru. Bahkan, majelis hakim diketuai Said Husein sempat meminta agar guru ini lebih baik mengajar saja, tidak harus datang ke pengadilan. Namun, para guru ini mengatakan bahwa mereka tidak ada jadwal me-

ngajar dan ada yang sudah selesai mengajar. Dalam persidangan yang kedua kali itu majelis hakim memeriksa tiga orang keterangan saksi yakni saksi korban Asni (guru SMK di Banda Aceh), Nyanyak (pengacara) dan Sekretaris Kobar-GB Aceh Husniati Bantasyam. Dua orang keterangan saksi dibantah terdakwa dan satu lagi saksi Husniati dibenarkan terdakwa. Saksi korban Asni dalam keterangannya mengatakan bahwa terdakwa Sayuti Aulia pernah mengeluarkan kata-kata “Kupohkah” (ku pukul kau) terhadap saksi ketika terjadi pertengkaran di kantor PTUN Banda Aceh, saat saksi korban akan menjadi saksi dalam kasus gugatan kepada Wali Kota Banda Aceh. Bahkan, sebut Asni, suara terdakwa kala itu nadanya keras, yang bisa didengar hingga lima meter. Penasihat hukum terdakwa Mukhlis Mukhtar sempat mempertanyakan keterangan saksi poin 6 dalam BAP, apakah terdakwa mau memukul korban itu sekali atau dua kali. Namun,

korban mengatakan bahwa setelah terjadi kali pertama dan telah dilerai,kemudian terdakwa datang lagi ke hadapan korban dengan emosi. Saksi Nyanyak malah mengaku melihat dan mendengar terdakwa Sayuti dengan tangan menggenggam menyatakan “Kupohkah” yang diarahkan ke korban. “Saya waktu itu berada di belakang pak Sayuti. Suara terdakwa besar yang bisa didengar oleh pegawai di sekitar itu,” tegas Nyanyak. Kemudian, sebut saksi, ia memisahkan dengan cara memegang tangan terdakwa. Menurut saksi, akibat perbuatan terdakwa korban menangis dan merasa malu dan kemudian korban melaporkan ke polisi. Sedangkan saksi Husniati mengatakan, terdakwa tidak pernah untuk memukul korban, tapi yang dilakukan terdakwa hanya mengangkat-ngangkat tangannya yang merupakan ciri khas terdakwa dalam berbicara. Untuk mendengarkan keterangan saksi lain, majelis hakim menunda sidang hingga, Rabu (31/7). (b02)

Penanganan Gempa Gayo Tak Transparan BANDA ACEH (Waspada): Hasil monitoring elemen masyarakat sipil menemukan adanya ketidakjelasan dana dan penggunaan dana yang tidak transparan dalam penanganan gempa di AcehTengah dan Bener Meriah sebesar Rp64,9 miliar. Hal ini disampaikan Direktur Koalisi NGO HAM, Zulfikar Muhammad, Selasa (23/7), setelah melakukan pemantauan di kawasan bencana selama beberapa hari. Tidak hanya masalah anggaran, data korban dan kerusakan juga masih simpang siur. “Di posko bencana, kami mendapatkan dua versi data, yakni data Badan Penanggu-

langan Bencana Aceh (BPBA) dan Badan Nasional Penanggulangan Bencana (BNPB), keduanya berbeda,” kata Zulfikar. Sebagai contoh, jumlah korban tewas menurut versi BNPB sebanyak 42 orang, sedangkan versi BPBA sebanyak 34 orang. Begitu juga kerusakan rumah dan bangunan, versinya berbeda-beda. Belum lagi soal penyaluran bantuan yang kerap mengundang protes akibat birokrasi yang berbelit. Pemerintah Aceh bahkan sama sekali tidak pernah terbuka tentang data bantuan yang masuk ke Posko dan yang sudah didistribusikan ke masyarakat korban.

Begitu pula dengan penggunaan dana tanggap darurat dan dana masa transisi sebesar Rp64,9 miliar yang akan dimanfaatkan hingga 10 Agustus mendatang, juga tidak transparan. Makanya, tidak heran jika sejumlah pejabat di Aceh Tengah dan Bener Meriah turut mempertanyaan pemanfaatan dana tersebut karena dikhawatirkan overlapping dengan bantuan yang masuk dari pihak swasta. Untuk itu, Koalisi NGO HAM Aceh berencana mengajukan permohonan informasi kepada Pemerintah Aceh, sekaligus meminta agar penggunaan anggaran itu disampaikan secara terbuka kepada publik. (b04)

NAGAN RAYA (Waspada): Saat ini usia Kabupaten Nagan Raya sudah 11 tahun. Pembangunan di Nagan Raya disebut-sebut cukup berhasil. Seperti saat ini, pembangunan fisik di sejumlah titik di komplek perkantoran masih terus dikerjakan. Kemudian, yang tidak kalah penting dan hingga saat ini masih belum difungsikan yakni terminal terpadu Desa ujong Fatihah. Jika ter-

minal dapat dikelola dan difungsikan, tentu akan memberi masukan untuk Pendapatan Asli Daerah (PAD). Namun, faktanya sejak diresmikan hingga saat ini terminal masih belum berfungsi. Menurut Ruslem, Kamis (25/7), pembangunan yang dilakukan di Nagan Raya terfokus pada satu titik. Yaitu, komplek perkantoran saja. Sedangkan di tingkat kecamatan dan desa masuk dalam kategori minim. (cda)

Tolak Bendera Aceh, Ibarat Pelihara Limpan Dalam Ketiak SIGLI (Waspada): Pemedal pada saat Pemerintah Indorintah pusat diibaratkan menesia dengan Gerakan Aceh melihara Limpan dalam keMerdeka (GAM), menandatatiak sendiri, apabila menolak ngani MoU di Helsinki dan dijabendera bulan bintang. Karebarkan dalam UU Nomor 11 na bendera itu dimanfaatkan Tahun 2006 tentang pemerintapihak yang tidak pro perdahan Aceh sudah sangat sepakat maian untuk kembali dijadidan berkomitmen menyelesaikan ikon penyemangatan perkan konflik Aceh secara damai, lawanan terhadap Indonesia. menyeluruh, berkelanjutan dan “ Apabila bendera bulan bermartabat bagi semua. bintang sudah berkibar di ”Kita patut mempertanyaAceh, maka tidak ada satu pikan kepada pemerintah pusat hak pun lagi yang bisa mesecara terbuka alasan mendasar mamfaatkan bendera Aceh menolak bendera Aceh yang untuk alat provokasi dan persudah dimaktub dalam Qanun Suadi Sulaiman, anggota Aceh Nomor 3 Tahun 2003. Alapecahan” demikian disamDPRK Pidie dari F PA san bertentangan dengan PP paikan Suadi Sulaiman, anggota Dewan Perwakilan RakNomor 77 tahun 2007 itu bukan yat Kabupaten (DPRK) Pidie Fraksi Partai Aceh, alasan, karena PP tersebut tetap saja inkonstitukepada Waspada, Kamis (25/7). sional untuk Aceh karena tidak berdasarkan pada Menurut dia, bagi Aceh, penetapan bendera point 1.1.2 huruf c MoU Helsinki” papar Suadi. tersebut dalam qanun Aceh No 3 tahun 2013 Berkaitan dengan bendera alam pedang merupakan mandat dari MoU Helsinki dan Un- yang ditawarkan Pemerintah Indonesia, itu medang-undang Pemerintahan Aceh (UUPA). Kata rupakan bendera Aceh dalam suasan merdeka Suadi, sikap kekhawatiran pemerintah pusat dengan sistem kerajaan. terhadap bendera Aceh (bulan bintang-red), “ Jika yang kita tawarkan maka harus disatu merupakan bentuk sikap apriori. Padahal, ben- paketkan dengan penyerahan kembali kedaudera Aceh hanya sebatas identitas Aceh yang latan dan kemerdekaan Aceh. Seandainya ini tidak mengurangi keutuhan dan kedaulatan yang terjadi maka perdamaian yang ada sudah Negara Kesatuan Republik Indonesia (NKRI). kita khianati bersama. Tentunya Aceh tidak akan Suadi, menyampaikan penolakan pengiba- berkhianat terhadap perdamaian dan terus ran bendera Aceh, bukti nyata pemerintah Indo- berupaya untuk menjaganya,’’ demikian Suadi nesia tidak sama sekali menghargai Aceh. Pada- Sulaiman. (b10)

Tanggul Pengaman Kebun PT Nafasindo Ancaman Bagi Warga SINGKIL (Waspada) : Tanggul pengaman banjir yang dibangun PT Nafasindo sebagai upaya revitalisasi sungai disepanjang jalur evakuasi tsunami Singkil enjadi ancaman bagi warga Kecamatan Singkil apabila terjadi banjir . Pasalnya Perusahan hanya membangun tanggul pengaman untuk kebunnya tanpa membangun saluran pembuangan dimana areal yang diamankan berbatasan langsung dengan pemukiman warga. Demikian disampaikan Azmi, mantan Pj Bupati Aceh Singkil kepada Waspada baru-baru ini di Singkil. Seharusnya, menurut Kepala Dinas Pekerjaan Umum Kabupaten Aceh Singkil, PT Nafasindo membangun saluran pembuangan air dari arah kebunnya langsung ke laut. Hal ini guna mencegah banjir menerjang ke pemukiman warga yang ada di sekitar kebun perusahaan.“Pembuatan tanggul hanya menguntungkan perusahaan lantaran kebunnya aman dari banjir, sementara rumah penduduk terancam terkena banjir lebih parah dari biasanya,” ujar mantan Kepala BRR Regional 10 Aceh – Nias itu. Azmi menyebutkan, ketika musim penghu-

jan kawasan yang sedang dibangun tanggul oleh perusahaan merupakan daerah sebaran air banjir, dimana banjir akan dibagi ke kebun dan pemukiman warga sehingga efeknya tidak begitu terasa. Namun setelah dibangunnya ditanggul oleh PT Nafasindo disekeliling kebunnya maka air bah akan langsung menghantam pemukiman penduduk. Hal itu terjadi lantaran tanggul penahan banjir tidak dilengkapi dengan saluran pembuangan air ke arah laut. Azmi mendesak agar perusahan juga membangun saluran pembuangan air hingga keluat sehingga masyarakat tidak merasa dirugikan. Anggota DPRK Aceh Singkil dari Komisi A Safril harahap yang dihubungi Waspada melalui ponselnya Minggu (21/7) meminta PT Nafasindo meninjau ulang pembangunan tanggul pengaman banjir dengan memperhatikan keuntungan terhadap masyarakat sekitar kebun. Sementara itu Pimpinan PT Nafasindo Kota Bahagia melalui humas Yudi yang dikonfirmasi Waspada hingga berita ini dikirimkan belum berhasil . (cdin)

Korban Gempa Lebih Butuh Kurma Daripada Beras ? DALAM suasana panik, diamuk gempa, apakah korban lebih membutuhkan sirup, tepung, kurma, jeket, daripada beras? Kalau masih ada beras, walau harus mengungsi para korban dapat memasak, masih bisa makan. Namun bagi pemerintah Aceh korban gempa di Gayo justru lebih membutuhkan sirup, tepung, kurma, jeket, agar-agar, daging lembu dan lainnya. Dalam paket proyek dana tanggap darurat senilai hampir Rp65 miliar, tidak ada anggaran buat beras, walau itu kebutuhan pokok. Persoalan dana tanggap darurat bersumber dari APBA, semakin santer dibahas. Bukan hanya persoalan mengapa dijadikan paket proyek? Sehingga bila ada kebutuhan mendesak sulit merevisinya. Baru bisa direvisi kalau ada tanda tangan gubernur. Namun yang menjadi pembahasan ada yang tak logis. Ada kebutuhan mendesak dan urgen, dimasukkan dalam paket proyek, sementara kurang mendesak justru dijadikan paket proyek besar. Catatan Waspada, ada perbedaan teknis penggunaan dana darurat antara BNPB, Pemda Aceh Tengah dan Bener Meriah,

bila dibandingkan dengan Pemda Aceh. Pemerintah pusat melalui Badan Penanggulangan Bencana Pusat (BNBP) menyediakan dana siap pakai (DSP) untuk musibah gempa Gayo Rp800 juta. Dana segar itu dapat digunakan kapan pun sesuai kebutuhan lapangan. Urusan pertanggungjawaban menyusul, namanya saja dana darurat. Pemda Aceh Tengah menyediakan Rp300 juta dalam bentuk dana segar dan siap pakai yang mana urgen itu yang diutamakan. Berbeda dengan pemerintah Aceh, justru menjadikan tanggap darurat di Gayo sebagai paket proyek. Bukan DSP tetapi dana tak terduga. Paket proyek dana Pemda Aceh senilai Rp64.960.175.000 buat gempa Gayo ternyata menimbulkan persoalan. Ada yang mendadak di lapangan yang harus disegerakan, ternyata pekerjaannya terlantar karena kekurangan dana. Dana tersebut setelah 9 hari gempa baru masuk ke rekening bendahara. Itu juga belum jelas, apakah sudah disalurkan sesuai pos yang dipaketkan? Gempa yang melanda negeri Gayo itu, 2 Juli 2013. Dana APBA baru ada 10 Juli.

Waspada/Bahtiar Gayo

MERUBUHKAN bangunan yang tak layak, seperti sarana pemerintah, masjid dan perumahan, membutuhkan dana dan alat. Sayang anggaran tanggap darurat untuk itu sangat minim Akibatnya, bagi yang memiliki semangat tanggungjawab terpaksa “meminjam dan mencari dana sendiri” terlebih dahulu. Hal itu diakui Jarwansyah, Kepala Badan Penanggulangan Bencana Aceh (BPBA). Bagaimana bila ada kebutuhan mendesak di lapangan, se-

mentara dana tanggap darurat pemerintah Aceh sudah dipaketkan. Ada satu item yang nilai Rp21 miliar lebih, tetapi tidak digunakan, apakah dana ini bisa digunakan secepatnya untuk kegiatan mendadak? Jangan sembarangan, sebelum direvisi dan disahkan oleh

gubernur. Bisa menimbulkan masalah. Dana hampir Rp65 miliar itu sudah diplot gubernur dalam enam paket. Walau sudah diusulkan revisi 4 hari lalu, sampai Rabu (24/7) belum jelas apakah sudah disetujui. “Saya belum dapat kabar, apakah sudah disetujui,” kata Jarwansyah.

Gubernur dalam SK no.360/ 574/2013 tertanggal 4 Juli menjelaskan dana tak terduga itu diperuntukkan bagi enam item pekerjaan besar. Untuk Badan Penanggulangan Bencana Aceh (BPBA) Rp1.963.810.000. Dana ini untuk operasional mulai dari pangan dan air minum. Di dalam paket ini ada minyak, gula, mi instan, sampai bubuk kopi, sayur mayor, ikan kaleng dan lainnya (Rp972 juta lebih). Disusul dana untuk ops pos komando, pendukung operasional, sampai kelengkapan pendukung petugas pelaksana. Paket kedua, Dinas Pendidikan Aceh Rp13.884.600.000. Dana ini untuk penyediaan ruang belajar sementara. Satu unit Rp10 juta dari 824 unit, serta bantuan baju seragam sekolah, plus sepatu untuk 13.996 siswa. Paket ketiga, Dinas Bina Marga Aceh, nilainya relatif kecil hanya Rp721.575.000. Ini yang menimbulkan persoalan. Pihak Bina Marga menjelaskan, pihaknya dengan dana minim kesulitan membersihkan bangunan yang hancur. “Bila mengandalkan sarana yang ada, tiga bulan baru bisa dibersihkan,” sebut Staf Bina Marga, saat memberikan penjelasan, kepada kepala BPBA da-

lam temu pers. Di lapangan, PU Aceh Tengah, dengan dukungan dana yang minim dari daerah, terus bergerak membersihkan bangunan yang tak layak. Dinas Sosial, ini yang menarik dan menjadi sorotan. Nilainya Rp21.380.750.000. Ada yang menggelitik dalam bantuan sosial ini. Ternyata pengungsi lebih membutuhkan kurma, agar-agar, tepung terigu, daripada beras. Nilainya sangat besar. Untuk sirup mencapai Rp510 juta. Kurma Rp50 juta, tepung terigu Rp142 juta, agar-agar Rp300 juta dan mentega Rp810 juta. Para korban seperti mau menghadapi pesta besar dengan sejumlah paket Dinas Sosial ini. Untuk kurma 2 ton, anggaran Rp50 juta, itu juga tumpang tindih dengan bantuan pemerintah Arab Saudi yang mengirimkan kurma 10 ton. Namun walau pemerintah Saudi mengirimkan kurma 10 ton, ditambah dua ton disediakan Dinas Sosial, angka pasti kurma itu tidak jelas, berapa ton yang sudah disampaikan ke posko. Dinas Kesehatan, nilainya Rp1.840. juta. Dana ini untuk obat kamar operasi, bahan habis pakai, makanan tambahan balita, susu bayi, susu balita, ibu

hamil. Dinas Cipta Karya mencapai Rp25 miliar lebih. Dana ini tidak jadi digunakan, karena pemerintah di dua kabupaten ini tidak menyetujui diadakan bangunan hunian sementara (Huntara). Seharusnya dana Huntara ini dapat dialihkan secepatnya kepada kebutuhan lain yang mendadak. Namun karena dana ini tak terduga dan bukan DSP, serta telah dijadikan paket, dalam revisi harus ada persetujuan gubernur. Mengapa BNPB dan Pemda tempat musibah, menyediakan DSP? Sementara gubernur menyediakan tak terduga dan sudah dipaketkan? Uniknya, mengapa Dinsos Aceh lebih mengutamakan, sirup, kurma, tepung, jeket. Sementara beras tidak dimasukkan dalam anggaran. Tetapi pengungsi di sana, lebih membutuhkan beras buat makan, dari pada sirup, tepung dan kurma. Namun paket proyek Dinsos Aceh itu mengubah harapan korban. Para korban menerima bantuan apa yang diberikan, karena mereka tidak punya hak untuk menentukan kebutuhan vital. Bahtiar Gayo


C4

Daftar Khatib Shalat Jumat

MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Matsum II Ar-Rahim Ranting Halat Kota Matsum Al-Chairat Jl. A.R. Hakim Gg. Sederhana No. 22 Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Huda Jl. Gedung Arja Gg. Jawa No. 46 Lingk. III Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Istiqomah Jl. Seto No. 33 Kel. Tegal Sari II Al-Mukhlishin Jl. Sutrisno Gg. Sehati No. 8 Al-Manar Jl. Laksana No. 47 Al-Makmur Gg. Langgar/Bahagia No. 25 Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al-Wathan Jl. A.R. Hakim Gg. Langgar No. 53 Darul Ikhlas Jl. Batu No. 13 Kel. Sei Rengas Permata Hidayatul Islamiyah Jl. Gajah No. 39 Istiqlal Jl. Halat No. 36 Kel. Kota Matsum IV Jamik Jl. Medan Area Selatan No.289 Kel.Sukaramai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Khalid Ibnul Walid Jl. Rahmadsyah No. 366 Khairiyah Jl. Rahmadsyah/Puri Gg. Subur No. 192 Muslim Jl. Gedung Arca No. 3 Muslimin Jl. Dr. Sun Yat Sen No. 71 Nurul Huda Jl. Denai Gg. Pinang No. 12 Tegal Sari-I Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Rahmat Jl. Denai Gg. I No. 2 Kel. Tegal Sari I Quwwatul Muslimin Jl. H.M. Jhoni No. 69-D Silaturrahim Jl. Emas No. 10 Silaturrahim Jl. Bromo Gg. Silaturrahim No. 11 Syekh Hasan Maksum Jl. Puri Gg. Madrasah No. 181 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. Bromo Gg. Salam No. 26 Taqwa Jl. A.R. Hakim Gg. Langgar No.8-A. Tegal Sari III Taqwa Jl. Puri No. 183 Kompleks Mesjid Taqwa Taqwa Lalang Jl. Gedung Arca Gg. Sehat No. 8

Drs. Efnedi Arief, MA Sutikno Drs. Selamat Hamzah, S.Pd.I Drs. H. Mustamam Batubara,MA Drs. Suramin Hadi M. Yahya Drs. H. Usman Batubara H. Syamsuddin Panarik H. Mhd. Su’ud Tambunan H. Abdurrahman Sofyan, Lc, MA H. Zuhri Nasution, Lc Drs. Asroruddin Saidi Drs. Mukhsin Harahap, S.Pd.I DR. H. Pagar Hasibuan, MA H. Abd. Latief Khan, S.Ag Drs. H. Abd. Jalil Tanjung Drs. H. Legimin Syukri H. Nurdin Muhammad M. Siddiq, S.HI Drs. H. Tarmizi Lubis H. Rumalis H.M. Nasir, Lc, MA Khoiruzzaman, S.HI, S.Pd.I Zulham Efendi, S.Pd.I Khairi Zilazan, S.Ag H. Arif M. Erde, S.Pd.I H. Halomoan Lubis, Lc Drs. Arman Azizi H. Jasmi Sayuti, Lc Mashul, M.Ag Drs. H. Nizar Idris Drs. Astra Wahyudi, SH Drs. H. Agus Taher Nasution Drs. Ibnu Hajar Harahap Drs. Asnan

MEDAN AMPLAS Ar-Rahmat Jl. Bajak II-H Harjosari II Al-Huda Jl. Bajak I No. 2 Kel. Harjosari II Al-Hidayah Mapolda Sumut Jl.S.M.Raja Km.10,5 No.60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Hikmah Jl. Garu II B Kel. Harjosari I Al-Muslimin Jl. Pangilar No. 35-A Kel. Amplas Baiturrahman Jl. Bajak III Kel. Harjosari II Daarul Azhar Jadid Jl. Bajak II Gg. Cengkeh No. 1 Ikhlashiyah Jl. Garu I No. 69 Kol. Harjosari I Jami’Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Jamik Jl. Panglima Denai No. 23 Kampus UNIVA Jl. S.M. Raja No. 10 Kompl. UNIVA Nurul Barkah Jl. Selambo IV No. 7 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Bali Ramadhan Jl. Garu VI Kel. Harjosari I Salman Jl. STM Kel. Sitirejo II Taqwa Jl. S.M. Raja Gg. Pulau Harahapan No. 1-B

Drs. Fakhruddin Rokan Drs. H. Yahya Tambunan Drs. H. Yahya Samsuddin Drs. H. Musaddat Lubis, M.Ag Drs. Sofiyan Daulay H.M. Arsyad Ibrahim Drs. Amri Zaiman Drs. H. Sahlan Harun H. Amru Pulungan, S.Pd Muhammad Rohim, S.Ag Drs. H. Syamsul Rizal Pulungan Drs. Kasran Ahmad Deily M. Ridwan, S.Pd.I Drs. H. Abdul Razak Drs. M. Idris Hasibuan, MA M. Yusuf Parlaungan Nasution, S.HI Drs. H.M. Hafiz Ismail Robie Fanreza, S.Pd.I

MEDAN BARU Agung Jl. P. Diponegoro No. 26 Al-Amanah Jl. Diponegoro No.30A Kom.Gd.Keuangan Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Ikhwanul Ikhlas Jl. Batu Gingging No. 12 Muslimin Jl. Sei Batang Serangan No. 93 Nurul Muslimin Jl. DR. Pardede No. 42

Drs. H. Arifin Umar Drs. H. Abdullah Jamil, M.SI Dr. H. Ahmad Zuhri, MA Horasman Purba Nirwan Matondang, Sos, S.Pd Mustofa, S.Pd.I H. Khairul Ahamdi, Lc Maksum Harahap, S.Ag

MEDAN BARAT Akmal Jl. Putri Merak Jingga No. 19 At-Taqwa Jl. Puteri Hijau No. 14 Al-Ikhlas PT. Kereta Api Indonesia Jl. Prof.HM Yamin 14 Al-Jihad Jl. Kom. Laut Yos Sudarso/Jl. Pertempuran Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Musaabiqiin Jl. Kapten Maulana Lubis Al-Massawa Jl. Temenggung (Arab) No. 2-4-6 Al-Wiraji Jl. Karya Ujung Gg. Sosro Lingk. XVI Kel. K.B. Baitusy Syifa Jl. Putri Hijau No. 15 Jami’ Jl. Merdeka No. 3 P. Brayan Kota Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Maraset Jl. Sei Deli No. 139 Kel. Silalas Nurul Hidayah Jl. Danau Singkarak Gg. Masjid No. 6 Nurul Islam Jl. Karya Lingk.VIII No.203 Kel.K.Berombak Rabithatul Muslimin Jl. K.L. Yos Sudarso Lorong 14-A Syuhada Jl. Danau Toba No. 2 Kel. Sei Agul Taqwa Jl. Karya Gg. Madrasah No. 24

Drs. H. Bahrum Hasibuan, MA Drs. H. Saliman Tarigan H. Ramsyah AR, BA Drs. Zulkarnaein Hasibuan Drs. H. Mahyuddin Nst., MA DR. H.M. Sofyan Syah, MA Drs. Sunaryo Rajudin Sagala, S.Kom, S.Pd.I H. Muhammadin Angkasa, Lc Drs. Abdul Majid Drs. H.M. Sazli Nasution H. Samsuddin Lubis, SH Miftahuddin, S.Pd.I Abdul Muthalib Daulay, MA Drs. H. Bahran Tanjung Drs. Komaruddin Dr. Muhammad Qorib, MA

MEDAN BELAWAN As-Sa’adah Kel. Belawan Bahagia Jamik Belawan Jl. Selebes Belawan Taqwa Jl. Veteran Belawan Raya Taqwa Belawan Salam Jl. Pelabuhan I No. 1 Kp. Salam Belawan-II

Junaedi Husda, S.Ag H.Mahmud Sholeh, MA Drs. Abdul Kodir Jailani DR. Nahar Abdul Gani H. Mhd. Nur Wahabi, S.Pd.I

MEDAN DELI Amaliyah Jl. Pancing Pasar IV Amalyatul Huda Jl. Nusa Indah No. 22-A Kel. Tg. Mulia Ar-Rahim Jl. Simpang Tanjung No. 1-A Ar-Ridha Komp. TNI-AL Jl. Alumunium Raya Tg. Mulia As-Sa’adah Jl. Alumunium IV Gg. Tawon Tg. Mulia Abu Qosyim Jl. Mangaan VIII Lingk. I Mabar Hilir Al-Amin Jl. R.P. Hewan Lingk. III Kel. Mabar Hilir Al-Amanah Jl. K.L. Yos Sudarso No. 638 Kel. Tg. Mulia Al-Qurqaan Jl. Alfaka Raya/Sp. Alfaka VIII Lingk. VI Al-Fithriyah Jl. Kawat II Kel. Tg. Mulia Hilir Al-Ikhlas Jl. Alumunium III Lingk. XII Kel. Tg. Mulia Al-Munawwarah Jl. Pulau Batam No. 1 Al-Syarifah Jl. Metal Gg. Rukun No. 06 Lingk. XVIII Darussalam Jl. Suasa Selatan Lingk.IX Kel. Mabar Hilir Jamik Jl. K.L. Yos Sudarso Km. 6,2 Tg. Mulia Jam’iyyatush Shoolihiin Kel. Tg. Mulia Nurul Iman Lingk. 27 Tg. Mulia Nurul Ikhsan Jl. Mangaan I Lingk. VIII Mabar

Andi, S.Pd.I Bahuddin Lubis, S.Ag Drs. Naharman Azhar Rohani Drs. Waizul Qarni, MA Drs. H. Darma Bakti Toharuddin H. Ahmad Hasan, SE Drs. Nazaruddin Panjaitan, MA Ajran Tanjung, S.Pd.I Fahrul Rizal, M.SI Drs. H. Milhan Yusuf, MA Sahran Saputra, S.Ag H. Darma Bakti, S.Ag Drs. H. Saleh Adri Shofyan Nurhadi Edy Sukamto

MEDAN DENAI Arafah Jl. Pertiwi No. 22 Kel. Binjai Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Ar-Ridha Jl. Camar 18 Blok II Perumnas Mandala At-Thoharah Jl. Raya Medan Tenggara Kel. Binjai Al-Anshor Jl. Raya Medan Tenggara Gg. Anshor Al-Falah Jl. Rawa Ujung No. 298 Lingk. XIII Tegal Sari Al-Hidayah Jl. Bromo Gg.Masjid Al-Hidayah Kel. Binjai Al-Hasanah Perumnas Mandala Al-Mukhlishin Jl.Enggang I Perumnas Mandala Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Muhajirin Jl. Garuda II Perumnas Mandla Al-Muqorrobin Jl. Raya Menteng Kel. Binjai Al-Ridha Jl. Jermal VII Baiturrahman Jl. Medan Tenggara VII No. 42 Baiturrahim Jl. Pelajar Timur Gg. Darno No. 5 Darul Ilmi Murni Jl. Terusan Dalam/Simp. Jl. Tapanuli Hijraturridha Jl.Selamat Ujung Gg. Subrah S. Limun Jannatul ‘Alim/Musholla Al-Muttaqim Jl. Pancasila Muslimin Jl. Selam II No. 47 Tegal Sari Mandala I Nurul Islam Jl. M. Nawi Harahap Nurul Iman Jl. Rawa I Lr. Sedar Nur Hidayah Jl. Datuk Kabu No.17BGg.Masjid No.11-C Nurul Hidayah Jl. Tangguk Bongkar 2 Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Taqwa Jl. Jermal III No. 10 Taqwa Jl. Pancasila Gg. Masjid No.1 Kel.T.S.Mandala III

M. Nursyam, S.Pd.I Drs. H. Zamhir Mustafa Drs. H. Ramli Mansyur Drs. Ibrahim Noor Abdul Halim, S.Ag Rizal Effendi Nasution Drs. H. Ramli Asmuni H. Ali Sati Nasution, Lc Drs. H. Ahmad Azizi Drs. H. Aswan Lubis Drs. H. Mulim Lubis, SH, MA Khairuddin Daulay Drs. H. Mulkan Daulay Daliman Siregar, S.Ag Achmad Wazir, S.Ag Harizal Daudd, S.Pd.I Drs. Dahrul MK Asmanuddin Damanik, MA Drs. Mas’ud Panjaitan Drs. Daud Efendy Drs. Amri Susanto Harun Ar Rasyid Anwar Syahadat Ahmad Zaini, S.Ag Drs. Tenerman Drs. Khaidir Sulaiman

Taqwa Jl. Mandala By Pass No. 140 Taqwa Jl. Seksama Gg. Rela No. 10

Drs. Rafdinal, MAP Drs. H. Khudri Lubis

MEDAN HELVETIA Ar-Raudhah Jl. Persatuan No. 22 Helvetia Timur Ar-Ridho Jl. Pembangunan No. 128 Helvetia Timur As-Syakirin Jl. Gaperta I Kompl. TNI-AD Gaperta As-Syarifah Jl. Pembangunan Kompl. Pondok Surya At-Taubah Jl. Pasar II Kel. Cinta Damai Aththolibin Husni Jl. Veteran Gg. Utama Desa Helvetia Al-Falah Jl. Palem Raya Perumnas Helvetia Al-Falah Jl. Cendana Blok 17 Perumnas Helvetia Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Al-Hasanah Jl. Setia No. 41 Tg. Gusta Al-Hasanah Jl. Istiqomah Helvetia Timur Al-Ikhlas Jl. Bakti Luhur No. 13 Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Al-Ikhlas Jl. Jongkong Kompl. Dolog SU Lingk.I, II, III Al-Mustaqim Jl. Kapten Muslim No. 226 Al-Masturah Jl. Binjai Km 7,8/Jl. Sekolah No. 29 Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Tg. Gusta Bahrul Ulum P4TK Jl. Setia Budi No. 75 Darussalam Jl. Asrama No. 11 Istiqomah Jl. Amal Luhur No. 65 Kel. Dwikora Ikhlasiyah Jl. Amal Luhur No. 29 Kel. Dwikora Khasyiim Jl. Karya Ujung Pasar III Nurul Iman Jl. Sumarsono Dusun V Shilaturrahmi Jl. Perkutut Lingk. XXII Kel. Helv. Tengah Tjut Nyak Dhien Jl. Gatoat Subroto/Jl. Rasmi No. 28 Taqwa Jl. Kamboja Raya No.319 Blok 4 Perum. Helvetia Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadono Taqwa Jl. Setia No. 30 Tanjung Gusta Taqwa Jl. Kapten Sumarsono Gg. Safar Pasar II Taqwa Jl. Kapten Muslim Gg.Jawa Lr. Muhammadiyah Umar Bin Khattab Jl. Kalpataru Kel. Helvetia Timur

M. Hasan, S.Ag Mukhlis Almawardi, S.Pd.I Mayor Caj Drs. Zakaria Ansori Drs. Hasrat Effendi, S. Awaluddin, S.Sos T.A. Saladin, M.Ag Drs. Syamsuri Drs. H. Najamuddin Lubis Maksum Harahap, S.Ag Drs. Akhmad Suhail, S.Ag Marhaimin Tanjung, S.Ag Abdul Karim, S.Ag Drs. M. Yusuf Tanjung H. Ahmad Mufti An Nasihin, Lc Khoimaini, S.Ag Yusrizal, S.Ag Drs. Khairul Anwar, MA Drs. H.M. Yusril Fuat Hakimudin Saragih, S.Ag H. Suryanda, S.Ag Drs. H. Irwan Sulaiman Lubis Drs. Syamsul Bahri Drs. A. Muin Drs. H. Muchtar Baijuri Dr. H. Azhari Akmal Tarigan Hazburrohman, S.Pd.I Drs. Syaufi, MA Syaiful Bahri, M.Ag Drs. H. Suprapto Asrizal Tanjung, S.HI, MA K.H. Nazaruddin Lubis

MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Annazhirin Jl. Karyawisata, Gedung Johor Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Ar-Raudhah Kompl. Rispa I Blok V Kel. Gedung Johor Assyafi’iyah Jl. STM - Suka Tari No. 9 Kel. Suka Maju Al-Amin Jl. Eka Surya Gg.Kencana Lingk. XI Kel.Gd.J. Al-Badar Jl. Karya Dharma No.19 Kel. Pangk. Masyhur Al-Firdaus Jl. Karya Jaya Gg. Eka Jaya II Lingk. II Al-Furqon Jl. Karya Perbatasan Lingk. XII P. Masyhur Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Al-Ikhlas Jl. STM Suka Ikhlas Kel. Gedung Johor Al-Ikhlas Jl. Eka Suka Raya No. 18-A Kel. Ged. Johor Al-Ikhlas Jl. Karya Tani Lingk. VII Kel. Pkl. Masyhur Al-Ihsan Jl. Suka Tabah No. 15 Al-Muslimin Jl. STM Suka Luhur Al-Muharram Jl. Eka Budi Kel. Gedung Johor Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Al-Mukhlishin Jl. Karya Sehati No. 14 Kel.Pkl. Masyhur Baiturrahmah Jl. Karya Jaya No. 101 Pkl. Masyhur Baitussholihin Jl. Karya Bakti No. 71 Kel. P. Masyhur Baitul Iman Jl. Karya Jaya Asrama Arhanus P. Masyhur Daurun Nur Jl. Suka Eka No.221 Lingk.XI Kel. S.Maju Fajar Ramadhan Perumahan Johor Indah Permai II Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Muslimin Jl. Karya Jaya, Kel. Pangk. Masyhur Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Aldys Jl. Karya Bakti No. 34 Pangk. Masyhur Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Nurul Huda Jl. M. Basir No. 9-A Kel. V Kel. P. Masyhur Nurul Iman Jl. Stasiun No. 75 Kel. Kedai Durian Nurul Ikhwan Jl. Karya Kasih Kel. P. Masyhur Sholihin Jl. Karya Jaya No. 160-C Taqwa Jl. Brigjen Zein Hamid Gg. Sado Titi Kuning

Drs. H. Jalaluddin Hasibuan Drs. H. Muhiddin Gurning Dr. H. Ardiansyah, MA Drs. H. Ahmad Saukani, Hrp. Drs. Ali Imron Rokan Drs. H. Syamsuddin Hasan Abd. Aziz T., S.Pd.I Drs. Abidin Azhar Lubis Drs. Nazaruddin Sutan Gembira Hasibuan Drs. Sarifuddin Hasan H.M. Sueb Saragih Drs. H. Zulham Efendi Batubara Drs. H. Syahroni Husein Drs. Rusli, MR. Mukhyaruddin Hasibuan, S.Pd.I Drs. Syahridan Lumban T. Drs. H. SyarbainiTanjung, MA Drs. Syofyan Ahmad H. Khairuddin Effendi Harahap M. Yusuf Marpaung, S.HI Budiman Tanjung, S.Ag Indra Laksamana Muda, S.Pd.I Drs. H.A. Sanadi Sitorus Drs. Jalil Al Husin Drs. H. Mauddin Nasution H. Alfan Arbudy, S.Ag Zulkifli Harahap, S.Pd.I Mhd. Budiman, S.Pd.I Zamhir Asnawi, SH H. Sugianto, Lc Drs. Sholahuddin Lubis Drs. Agus Bastoni H.M. Irfan Said Batubara Alhuda Yusuf, S.Pd.I, S.HI Indra Budiman, S.Ag M. Hardiyatno, SE

MEDAN KOTA An-Nazhafah Jl. Rumah Sumbul No. 4 Lingk. I Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Ikhlas Jl. Salak No. 9 Al-Muttaqin Jl. Amaliun/Paduan Tenaga Gg. Tengah Al-Muhajirin Jl. Bajak II H. Gg. Nasional Lingk. IX Da’wah Jl. Sakti Lubis Gg. Amal No. 19-B Hikmah Hongkong Plaza Jl. Cerebon Islamiyah Jl. Jati III No. 85 Kel. Teladan Timur Jami’ Teladan Jl. Gembira No. 2 Teladan Barat Mu’allimin Jl. S.M. Raja Kp. Keluarga No. 33 Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Ridho Bakti Jl. Air Bersih Lingk. IX Kel. Sudirejo-I Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Silaturrahim Jl. Pelajar No. 58 Kel. Teladan Timur Setia Amal Jl. Sakti Lubis Gg. Pegawai No. 87-C Taqwa Jl. Demak No. 3 Taqwa Jl. Turi Gg. Sepakat No. 5 Kel. Teladan Timur Thawalib Jl. S.M. Raja Gg. Thawalib No. 11 Yayasan Zending Islam Indonesia Jl.S.M.Raja No. 11

Drs. H. Akhdar Bunayya Drs. Abd. Jalil Husin, S.Pd.I Drs. H.M. Basyir Yahya Prof. DR. H. Asmuni, MA Syahril Basyra, S.HI, S.Pd.I Drs. A. Sani Sinaga Fahrurozy, M.Ag Drs. Asfan Bahri Drs. Asroluddin S. Sagala Mhd. Jamil, S.Pd.I Drs. H. Kemal Fauzi Prof. DR. Amroni Derajat, MA Drs. Usman Hsb., SH, M.Hum Dr. H. Hasan Mansur Nst., MA Drs. H. Masaluddin Berutu Ahmad Zuhri, MA Drs. H.M. Joyo Drs. H. Burhanuddin, MA Jamaluddin, Lc H. Nurdin Rustam, Lc Zul Arwan Lubis, S.Pd.I

MEDAN LABUHAN Al-Husain Jl. Raya Griya Martubung Kel. Besar Al-Istiqomah Blok IV Griya Martubung Kel. Besar Al-Mukarramah Kampung Besar Darat Kel. Martubung Baitul Ikhwan Jl. T.Lestari 12/198 Blok V Gr. Martubung Nurul Hidayah Jl. Veteran Lr. Sukoharjo No.27-A Psr. V Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal Raya Al-Osmani Labuhan Deli-Medan Silaturrahmi Jl. Tangguk Damai Blok III Gr. Martubung

H. Husain Ali, Lc Drs. M. NIzar Rangkuti, MM Drs. H. Sofyan Sulaiman, S.Ag Drs. H.M. Fauzi Sunara, MA H. Abu Dzar, Lc, MA H. BasukiSaid Drs. Adlansyah

MEDAN MARELAN Ar-Ridha Jl. Platina Raya Lingk. 21 Kel. Rengas Pulau Al-Barokah Jl. Kapt. Rahmad Buddin Gg. Mangga Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Muslimin Jl. Masjid Pasar V Marelan Jami’atul Khairiyah Jl. Marelan VII Kel. Tanah 600 Taqwa Jl. Penghulu Lama Gg. Famili Paya Pasir Taqwa Kampung Tengah Lingk. IX Terjun Taqwa Pasar 3 Timur Regas Pulau Marelan

Syahruddin, S.Pd.I Muhammad Jihad, S.Pd.I Drs. H. Ilyas Halim, M.Pd Amin Utomo, S.Ag H. Akhyar Nasution, Lc, MA Drs. Akyar Syam M. Iqbal, S.Pd.I Jamaluddin Albathani

MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Ar-Rahman Jl. Brigjen Katamso Gg. Perbatasan Baru Al-Mukhlish Jl. Bahagia No. 14 Kel. Sukaraja Al-Mujtahidin Gg. Lori Kampung Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Nurul Huda Jl. Birgjen Katamso Gg. Netral Nurul Muslimin Jl. Juanda (Bundaran) Kel. Jati Jami’ Al-Fajar Jl. Brigjen Katamso Gg. Al-Fajar Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ Kampung Baru Jl. B. Katamso Gg.Masjid No. 53 Jami’ Aur Jl. Brigjen Katamso No. 32-D Kel. Aur

Drs. Ahmad Azizi Prof. Dr. Drs. Ahmad Qorib, MA Drs. H. Khairul Anwar Hendrik Purnama Drs. Darfikri, MD. Asmuin Nasution, MA Son Haji Harahap, S.Ag Drs. Agus Salim Syahruddin Napitupulu, S.Pd.I, Med H.M. Safiar, Lc, MA Drs. Muhammad Nurdin

MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Ar-Rahmah Jl. Gurilla Gg.Melati No.5 Kel. S.Kerah Hilir Ar-Ramlah Jl. Sejati No. 16 Kel. Sidorame Barat Ar-Ridho Jl. Rakyat No. 33 Kel. Sidorame Timur Al-Amin Jl. Prof. H.M. Yamin SH, No. 482 Al-Falaah Jl. Ibrahim Umar (Gg. Sado) No. 3 Al-Fajar Jl. Prof. H.M. Yamin SH Gg. Kelambir Al-Huda Jl. Malaka No. 117 Al-Hidayah Jl. Pahlawan Gg. Anom No. 12 Lingk. III Al-Hikmah Jl. Malaka Gg. Saudara

Khairudzil Azan, S.Sos Ahmad Supriadi, S.Ag Fuji Rahmadi P., MA Drs. M. Zukhri Pulungan Drs. H. Musa Yahya Drs. H. Usman, MA Drs. Musa Yahya Drs. Ali Imran Drs. H. Sulaiman M. Amin, MA Drs. H. Ade Fifan

Al-Ikhlas Jl. Setiajadi Kel. Tegalrejo Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Al-Muslimin Jl. Gerilya No. 1 Al-Mukhlishin Jl. G.B. Josua No. 8 Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Aman No. 5 Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir I Ikhwaniyah Jl. M. Yacub No. 3 Istiqomah Jl. Bambu Runcing/Pahlawan Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Jamik Al-Ikhwan Jl. HOS Cokroaminoto Kel. S.K. Hulu Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Syuhada Jl. Pahlawan No. 11 Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat I Taqwa Asrama TNI-AD Glugur Hong Kel. S. Barat I

WASPADA Jumat 26 Juli 2013 Drs. Mhd. Zuhri Pulungan Drs. Sodikin Ahmad Sumardi Alfarabi, M.Ag Mahmuddin, MA Suhendra, S.Pd.I Mustafa Lubis, S.Pd.I Drs. H. Amrin Siregar Herman, S.Ag M. Syafii Umar Drs. H. Romsil Harahap Imamul Muttaqin, S.HI, MA Ahmad Suhaili Lubis, S.HI Drs. Fahruddin Nasution Jamain Dahlan, S.Pd.I

MEDAN PETISAH Amaliyah Jl. M. Idris No. 22 Kel. SPT II Annas Jl. Ibus Raya/Jl. Rotan Kompleks Diskes Ar-Ridhwan Jl. Abd. Hamid No. 28 As-Syahaadah Jl. Sikambing Belakang No. 18 Asy-Syura Jl. Surau No. 18 Kel. Sei Putih Timur Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Al-Mukhlisin Jl. Sei Rokan No. 2 Al-Mukarram Jl. Sikambing Gg. Patimura No. 9 Al-Yasamin Jl. PWS Istiqamah Pasar Petisah Jamik Jl. Kejaksaan Kebun Bunga Nurul Islam Jl. Kertas No. 2 Raya Aceh Sepakat Jl. Mengkara No. 2 Petisah Tengah Tagarrub Jl. Darussalam No. 24 Ubudiyah Jl. Kebun Bunga Kel. Petisah Tengah

Drs. M. Sukri Asda Nst. DR. Ali Amran Sinaga H.M. Jafar Matondang, S.HI Drs. H. Munawar Khalil H. Anshori Lubis A. Junaidi H. Najib Sanusi Lubis Drs. H. Ilyas Purba M. Ikram Alwalad Dr. Abdurrahim Gea, MA Drs. H.M. Abu Sammah Pulungan Drs. H. Saleh Umar, S.Ag Drs. H. Ilyas Ismail Drs. H. Khairuman Arsyad, M.Hum Prof. DR. Abdul Mukti, MA Drs.H. Ramlan Yusuf Rai

MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Rajab Munthe, S.Pd.I Al-Hidayah Jl. Starban Kel. Polonia A. Majid, S.Ag Al-Hidayah Jl. Komodor Udara Adi Sucipto Azman Nasution, S.HI Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Drs. Abdul Azis Al-Ikhlas Jl. Sejati No. 08 Kel. Sari Rejo Razali Ta’at Bakti Jl. Mongonsidi I Baru No. 11 Kel. Anggrung Al-Hafiz H. Sudirman Lubis, Lc Dirgantara Jl. Imam Bonjol No. 52 P. TNI AU Soewondo M. Nasir Anshori, S.HI Hidayatullah Jl. Dc. Musi Lingk. I Kel. Sukadamai Drs. Khairuddin, S.Pd.I Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Drs. H. Hisyam Dalimunthe, SH Sabilillah Komp. TNI-AU Karang Sari-I Kel. Sari Rejo Drs. H. Asbin Nasution Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D H. Jamaluddin, Lc MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Drs. Zulkifli Ahsan Al-Furqon Jl. Setiabudi Pasar I Tanjung Sari Drs. Azizon, SH Al-Ghufron Jl. Suka Baru No. 21 Kel. PB Selayang I Drs. Agus Suhaidy Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Drs. H.M. Nasib Selmi Al-Ikhlas Pasar V Tg. Sari H. Mualim Ahmad Al-Ikhlas Pasar 7, Padang Bulan Mahluddin Hasibuan Al-Istiqomah Jl. Sei Asahan Gg. Masjid No. 3 Drs. H.M. Anwar Sayuthi Jami’ Jl. Pasar I Lingk. VIII Tg. Sari Drs. H. Suparmin Sareh Muslimin Jl. Setia Budi Kel. Tg. Sari Heri Fitrian, S.Sos.I Nabawi Jl. Bunga Mawar XIV Edi Syahputra, S.Pd.I Nurussalam Jl. Bunga Cempaka Pasar III Drs. H. Lukman Hakim Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Drs. H. Khairul Akmal Rangkuti Nurul Iman Jl. Penerbangan No.77 Komp.Perhubungan H. Mhd. Thohir Ritonga, Lc Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. P. Bulan Sugeng Raharjo, S.Ag Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Haidir Lubis, M.Pd Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Asmuri Lubis, S.Ag Taqwa Jl. Bunga Wijaya Kesuma Gg. Masjid No. 1 PCM Tj. Sari Taqwa Jl. Abdu Hakim No. 2 Pasar I Tg. Sari DR. Faisar Ananda, MA Taqwa UMA Kampus II Jl. Setia Budi No. 79 79-B Drs. Suprayetno, MA MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia As-Saajidiin Jl. Prasetya I Komp. BTN Dusun III Sei. S. At-Taqwa Makodam I/Bukit Barisan Jl. Binjai Km. 7 Al-Badar Jl. Binjai Km. 6,8 Al-Falah Jl. Murni No. 27 Tg. Rejo Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sikambing-B Al-Ikhlas Jl. Beo Indah No. 15 Sei Sikambing-B Al-Ikhlas Jl. Binjai Km. 16,5 Dusun I Aman Damai Al-Islamiah Jl. Binjai Km. 14,5 Gg.Gembira DS. V Diski Al-Ikhwan Jl. Gatot Subroto Km. 8,5 Pasar 5 Al-Istimomah Dusun I Desa Pujimulio Al-Irma Jl. Rajawali Sei Sikambing-B Al-Jihad Jl. Sunggal No. 129 Al-Muttaqin Jl. Hanura No. 10 Tanjung Rejo Al-Mujahirin BBLKI Medan Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Dermawan Jl. Rajawali No. 19 Sei Sikambing-B Ikhwanul Muslim Dusun VII Gg. Damai Desa Paya Geli Isti’adah Jl. Amal No. 4 Kel. Sunggal Istiqamah Jl. Perwira Utama No. 20 Kampung Lalang Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg Rejo Jami’ Jl. Masjid No. 6 Tg. Rejo No. 6 Jamik Jl. Pinang Baris No. 19 Kel. Lalang Jamik M. Jayak Jl. Jend. Gatot Subroto Km.5,5 No.184 Lama Raudhatussuffah Jl. TB. Simatupang (P. Baris) Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Hikmah PT. Perkebunan Nusantara-III Kandir Nurul Ikhsan Jl. Kelambir Lima No. 53-B Kel. Lalang Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Silaturrahim Jl. Perintis Kemerdekaan Km.13,7 P.Besar Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Syafinatus Salamah Perum Bulog Jl.Gatot Subroto 180 Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B Taqwa Sugengrejo Jl. Merpati Gg.Mushola Sei. S-B

Irwansyah Daulay, S.Pd.I, MA Syamsul Arifin, SH Drs. H. Dalail Ahmad, MA Suhendri HS, MA Drs. Khamaini Hamyar Syarifuddin Sinaga, S.Ag Drs. Hasanul Arifin H. Raden Taufiq Ilyas Zuhri Drs. Ibrahim Nasution Drs. H. Poniman, S. Susanto, STHI Prof. Dr. Ir. H. Basyaruddin, MS Nur Azmi Hamsyar, S.Ag Drs. Ahmad Muttaqin Nst., S.HI M. Nasir, S.Ag H. Ali Amran Zakaria, Lc Drs. Anshori Ahmad Drs. H. Mahmuddin Sirait Drs. H. Abd. Rasyid Siregar Drs. H.M. Yazid Mufti Lubis Hamdani Rokan, MA DR. H. Akhyar Zein, MA Drs. Tohiruddin Pohan Drs. Abdul Wahab Ismail, SH Drs. Saleh Rambe Drs. Asman Ali Nur Harahap Drs. H. Sholahuddin Drs. Aminuddin Drs. Habibi Siregar Drs. Azrai Ahmad H. Misto, AR Prof. Dr. H. HasballahThaib, MA Syaukani Muda, M.Ag Gunawan, S.Ag Drs. Khalidin Musa

MEDAN TIMUR Arrahim Jl. Purwosari Gg. Masjid/Puskesmas P. Brayan Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara, Puro Brayan Bengkel As-Sholah Jl. Pendidikan No. 39 Glugur Darat-I Al-Barkah Jl. Setia Jadi Kel. Glugur Darat I Al-Furqan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Hidayah Jl. Karantina Gg. Pasaman No. 2 Kel.Durian Al-Iman Jl. Sidang Raya, Kompl. DPRD Tk.I P.B.Bengkel Al-Ikhlas Jl. Muara Sipongi Kel. Gaharu Al-Ikhlas Jl. Madiosantoto No. 197 Lingk. 14 P.B. Darat Al-Ikhwan Jl. Prajurit No. 28 Lingk. XI Gg. Bali Al-Ittihad Pulo Brayan Bengkel Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Baiturrahman Jl. Simpang 6 P. Brayan Bengkel Bustanul Huda Jl. Perwira I Lingk. VII P.B. Bengkel Baitul Mukminin Lingk. VIII Pulo Brayan Darat I Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Nurul Iman Jl. Bambu VI Kel. Durian Nurul Yaqin Jl. Bukit Barisan I No.74 Kel.Glugur Darat II Syuhada Jl. Budi Pengabdian No. 2 P. Brayan Kota Taqwa Jl. Bilal Gg.Keluarga No.74 Kel. P.Brayan Darat I Taqwa Jl. Kapten Mukhtar Basri No. 3 Taqwa Ubudiyah Jl. Bambu III Kel. Durian

Rijal Sabri, M.Ag M. Yusuf Siregar, BA Drs. H. Ibrahim Isa Rahmat Rifai Lubis, S.Pd.I Drs. Ediyanto, MA Drs. Ahmad Yani Syarifuddin Syam, MA Drs. Kastok Nadir Drs. Aminan Drs. Chairial Ashadi Prof. Dr. Lahmuddin Lbs., Med Drs. Hasbi Dasopang Drs. Syahrin, AW H.A. Perdana Indra, M.Ag Drs. H. Dahron Hasibuan Drs. H. Harmyn Tanjung Ikrar Anshori, S.Pd.I H.M. Rajab Asri Maswail, Lc M. Ali Akbar, MA Drs. H. Fadli Siad, MA H.M. Syahnun Hutagalung Manaon Batubara, M.Ag Drs. Bahari Ahmad Drs. H. Zulkidli Nasution K.H. Abdul Syukur Husni Mubarak Nasution, S.Ag Mahmud Yunus Daulay, MA Drs. Jamaluddin Pohan

MEDAN TEMBUNG Akbar Baitus Sujud Jl.Metereologi Raya Gg.Karya No.1 Ar-Rahman Jl. Durung Gg. Aspin Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Ar-Ridho Jl. Jati Psr VIII Dusun X Gambir Desa B.Klippa

Drs. H. Sudirman Da’i Paidi, S.Ag Drs. H. Nasrun Zakaria, Lc Drs. Nadran Jamal (Bersambung ke hal.C5 )


Mimbar Jumat

WASPADA Jumat 26 Juli 2013

C5

Puasa Dan Kesabaran Jama’ah Haji Membuka Tabir Rahasia Puasa Ramadhan Oleh H. Iwan Zulhami, SH, MAP

Oleh H. Sugeng Wanto, MA.

Kepala Kantor Kementerian Agama Kota Medan

Ketua Umum IKatan Da’I Muda Cendikiawan (Idaman) SU dan Dosen Tafsir Hadis Fak. Ushuluddin IAIN-SU

P

uasa Ramadhan merupakan Rukun Islam diterimanya. Tawakkal atau berserah diri ke 5 yang wajib dilaksanakan bagi setiap kepada Allah salah satu sifat kesabaran muslim yang mukallaf. Ramadhan sebasetelah Ikhtiyar ( Usaha Dan Doa). gaimana dalam Hadist dikatakan ada tiga fase Para calon jama’ah haji sudah mendaftar keistimewaan didalamnya, pertama bulan yang dan bahkan sudah melunasi BPIH, namun penuh Rahmat dari Allah SWT, kedua bulan yang ada sesuatu hal sehingga keberangkatannya penuh Ampunan Dari Allah SWT, dan ketiga bulan tertunda. Sebagaimana yang kita ketahui yang terbebasnya dari belenggu api neraka. Inilah bahwa pada tanggal 06 Juni 2013 dan Perakenikmatan-kenikmatan yang ada didalam bulan Rama- turan Menteri Agama (PMA) No 121 Tahun 2013 Tendhan yang harus kita raih dan kita gapai agar keberkahan, tang Penetapan Kuota Haji Tahun 1434 H yang isinya kemuliaan dan amalan ibadah lainnya dapat diterima dan adannya kebijakan dari pemerintah Saudi Arabiyah diberikan ganjaran berlipat-lipat kali lipat dari Allah SWT. yang berlaku untuk seluruh dunia yaitu adanya Berbagai dalil baik dari Alquran dan Hadist telah banyak pengurangan kuota jama’ah haji seluruh dunia yang memberikan isyarat maupun penjelasan tentang seputar akan berangkat tahun ini sebesar 20 %, 3027 – 2208 keutamaan puasa Ramadhan, seperti dibukanya pintu orang dan adanya penundaan bagi jama’ah haji yang surga dan ditutupnya pintu neraka, setan dibelenggu dan sudah pernah melaksanakan ibadah haji. bau mulut orang yang berpuasa itu lebih wangi dari minyak Khususnya Provinsi Sumatera Utara yang kuota kesturi, amalan akan dilipat-gandakan pada bulan ini dan dasarnya tahun lalu sebanyak 8.160 jama’ah, maka kuota terdapat dida-lamnya tahun ini sebesar malam lailatul Qadr 6.544 jama’ah seyang lebih baik dari Orang yang sabar itu selalu ber- hinggah terdapat peseribu bulan. ngurangan sebafikiran yang positif bahwa apa nyak 1.636 jama’ah. Ada tiga faktor penyebab mengapa Allah karena itu deyang diberikan Allah SWT itu se- Oleh SWT melipatgandakan ngan kondisi kebijaganjaran pahala untuk kan ini maka sebamuanya baik untuk diterimanya. kita. Pertama, Syarrafal gian calon jama’ah Makan ( Allah Memuhaji dan bahkan peliakan Tempat), tidak sama ganjaran yang diberikan Allah tugas haji seperti TPHI, TPIHI. TKHI dan TPHD sedikit kepada orang yang melakukan Shalat di Masjid tempat agak meng-ganggu pikiran karena segala persiapan tinggalnya dengan orang yang Shalat di Masjid Nabawy untuk me-ngunjungi Baitullah sudah dipersiapkan Madinah Al-Munawwarah. Kedua, Syarrafal Waktu ( Allah semaksimal mungkin. Bahkan yang sudah pernah Memuliakan Waktu), Ramadhan adalah zaman yang berhaji, apalagi yang belum pernah melaksanakna haji dimuliakan Allah SWT, jadi beramal di bulan ini tidak dan di usia yang sudah RESTI (Resiko Tinggi) patutlah pernah sama pahalanya jika kita beramal di bulan lain. tidak tertahankan kerinduan dengan Baitullah. Oleh Ketiga, Syarrafal Amil (Allah Memuliakan Pelaku), sebab itu Provinsi Sumut terdapat lebih kurang 776 yang pertanyaannya adalah sama tidak simiskin yang berinfaq/ sudah melunasi BPIH tetapi terkena pengurangan kuota besedekah dengan sikaya yang berinfak/ bersedekah?. Ini haji sehingga tertunda keberangkatannya. Kita sudah tentunya pasti bisa kita jawab. berencana namun Allah SWT yang menentukan. Kesabaran Bagi Calon Jama’ah Haji Secara nasional jumlah jemaah haji Indonesia yang Kata sabar dalam Bahasa Arab secara etimologi me- waiting list (daftar tunggu) per 31 Januari 2013 tercatat rupakan salah satu akar kata Sha-Ba-Ra yang berarti sebanyak 2.125.378 jamaah, sedangkan untuk Provinsi mencegah kesempitan, mengendalikan diri dari menahan Sumatera Utara per 30 Januari 2013 tercatat sebanyak keluhan ( al-Raghib al-Isfahani : 281). Dalam terminologi 83.868 jemaah, dan untuk Kota Medan per 30 Juni 2013 Islam sabar diberi pengertian sebagai kemampuan me- tercatat sebanyak 27.169 jemaah. Daftar Tunggu untuk ngendalikan diri dari berbagai hal yang oleh akal dan syara’ Provinsi Sumatera Utara sudah mencapai sebelas dituntut untuk dikendalikan atau ditahan, juga mengen- tahun. Semestinya mendaftar hari ini berangkat tahun dalikan diri dari keluh kesah dan mengadukan segala 2024 dan angka ini terus bertambah melihat antusias pengaduan atau permasalahan hanya kepada Allah SWT. masyarakat yang rata-rata pendaftar di Kota Medan Dalam Alquran kurang lebih 105 kali penyebutan kata setiap harinya mencapai 40 sampai 50 jemaah. sabar, 62 diantaranya bentuk kata kerja dan 29 di antaUntuk itu, kami harapkan kepada seluruh calon rannya muncul dalam bentuk kata kerja perintah ( Fi’il jama’ah haji agar bersabar dan dapat memahami Amr). Perintah sabar diulang sebegitu banyaknya, hal ini situasi dan kondisi kebijakan pemerintah sehumengindikasikan betapa signifikannya sikap sabar dalam bungan masih direnovasi Masjid al-Haram. Marilah hidup dan kehidupan ini. Puasa yang kita lakukan pada kita mengambil hikmah dibalik dari peristiwa dan bulan ini merupakan manifestasi peningkatan kualitas kehidupan ini yang di isyaratkan di dalam Alquran dan kuantitas ketaqwaan kita pada Sang Pencipta, dan Surah al-Baqarah ayat: 216 yaitu; “Boleh jadi kita salah satu esensi ketaqwaan kita pada Sang Pencipta menganggap sesuatu itu tidak baik bahkan memadalah kesabaran terhadap ujian dan cobaan yang dibe- bencinya namun baik menurut Allah, dan boleh jadi rikan Allah kepada hambanya. Orang yang sabar itu kita mencintai sesuatu tetapi menurut Allah tidak baik termasuk orang yang mampu mengendalikan keluh ke- untuk kita, Allah Maha Mengetahui sedangkan sahnya terhadap apa yang diberikan Allah kepadannya. manusia tidak mengetahuinya”. Oleh karena itu kita Orang yang sabar itu selalu berfikiran yang positif bahwa sebagai hamba Allah harus siap diatur oleh Sang apa yang diberikan Allah SWT itu semuanya baik untuk Pengatur yakni Allah SWT. Wallahu a’lam Ash-Shobirin Jl. Pukat Banting II (Mestika) No. 45 An-Nurul Hakimiyah Tembung Jl. M. Ya’kub No. 51 At-Tawwabin Jl. Pimpinan No. 1 Attholab Man-1Jl. Willem Iskandar No. 7-B Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Al-Bayan Jl. Gurilla No. 10 Al-Falah Jl. Perbatasan Bandar Khalipah-Bandar Setia Al-Falah Jl. Kemenangan 151 Kel. Indra Kasih Al-Falah Jl. Pukat Banting IV No. 10 Al-Furqan Islamic Centre Sumut Jl. Williem Iskandar Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir Al-Hikmah Jl. Letda Sujono Gg. Amal No. 5-B Al-Ikhlas Jl. Mandala By Pass Gg. Tengah Lingk. II Al-Ikhlas Jl. Ambai Ujung No. 15-B. Kel. Sidorejo Hilir Al-Ikhlas Sukamaju Pasar VII Desa Bandar Klippa Al-Ihsan Jl. Suluh No. 148 Al-Ishlah Jl. Bustamam Dusun X/XI Bandar Khalipah Al-Ishlah Jl. Pukat V Kel. Bantan Timur Al-Ijtima’iyah Jl. Letda Sujono No. 152 Kel. Tembung Al-Muslimun Jl. Pertiwi No. 94-C Ke. Bantan Al-Mubiin Dusun VII/Selasih Desa Bandar Khalipah Al-Muqorrobin Jl. Pukat II/52 Kel. Bantan Timur Baiturrahman Kampus UNIMED Jl. Williem Iskandar Babussalam Jl. Bersama Ujung No. 260 Kel. Bantan Baitul Muslimin Jl. Datuk Kabu Pasar III Gg. Mesjid Darul Amin Jl. Letda Sujono Ujung No. 1 Hidayatul Muslimin Jl. Bersama No. 105 Lingk. V Ikhlashiyah Jl. Tempuling/Suluh No. 20 Kel. Sidorejo Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr. Setia Jamik Al-Jihad Jl. Besar Tembung Dusun I No. 17 Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Taqwa Jl. Pimpinan Gg. Delima No.11 Sei Kerah Hilir Taqwa UMA Kampus I Jl. Kolam No. 01 Medan Estate Ubudiyah Jl. Taduan 109 Kel. Sidorejo

Aminuddin Yahya, S.HI Nur Hidayat Harun, S.Pd.I Drs. H. Amhar Nasution, MA Drs. Hamdah Syarif H. Fazrul Haq, Lc, MA H. Abu Bakar Adnan, MA Dr. H. Arifinsyah, M.Ag Muchtaruddin Dalimunthe, M.Ag Drs. H. Nurman Almi H. Tongku Alamsyah Siregar Buchori Muslim Lubis, S.Ag Drs. Kasto Nadir, N.K. Khairullah Sani, S.Ag Drs. K.H. Mahyuddin Nst., MA Syarwan Nasution, S.Ag Drs. Supardi Lubis Mhd. Irham H. Ruslan Batubara, S.Pd.I Drs. H. Syamsul Bahri Drs. Anshoruddin Nasution Drs. A. Irma Harahap Mesiono, S.Ag, M.Pd Drs. H. Muslim Azhari Prof. Dr.Yacob Matondang, MA Drs. Asmanuddin Damanik Drs. Syahridan Lumban, T. Hasanuddin Hasugian Mahyuddin Lubis, SE Drs. Agen Irma Harahap Syafaruddin, S.Ag H. OK. Mas’ud Drs. Marwan Nasution Isa Ansori, S.Pd.I Drs. Zulkarnain Lubis, MA Drs. Qudri Lubis Drs. Zainun, MA Fahrurozi

MEDAN TUNTUNGAN Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Hidayah Jl. Seroja Raya Lingk. VI Kel. Tg. Selamat Al-Hikmah Jl. Tali Air Lingk.IV Kel.Mangga K. R.S.Jiwa Al-Ikhlas Jl. Bunga Kardiol Kel. Baru Ladang Bambu Al-Ikhlash Jl. Cengkeh No. 24 Kel. Mangga Al-Muhajirin Perumnas Simalingkar Al-Muhtadin Jl. Kemiri Raya No. 1 Blok-G Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Baitul Rahman Jl. Rami 2 Perumnas Simalingkar Iklab Jl. Letjen. Jamin Ginting Km. 12,7 Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Silaturrahim Jl. Kapas No. 13 No. 49 P. Simalingkar Taqwa Jl. Sawit Raya, Perumnas Simalingkar

Masri Tanjung, S.Pd.I Ismail Toni Dwifan, S.S. Ghozali Mar’i, S.Ag H. Solihin Adin, S.Ag H.M. Husni Saar H. Solihin Adin, S.Ag Drs. M. Yusuf Arhad Drs. H. Ismail Dahban Ibrahim Fansuri, S.Pd.I Drs. Suardi Affandi Soleman Lubis, MA Iriansyah, SH Bechta Perkasa Asky, MA Drs. A. Sofyan Drs. Abdul Kadir Jailani

DELISERDANG Amal Islamiyah Jl. Sudirman No. 4 Lubuk Pakam Afwan Helmi, Helmi, M.Ag Aisyah Abdullathif Farah Jl. Mama Suka No. 1 Per.TPD Maskam Ash-Sholah Jl. Roso Marindal 1 Irianto At-Taubah Blok Gading Kelambir Lima Kebun H. Perak M. Ridwan, S.Pd.I Al-Furqan Perum. Bumi Tuntungan SejahteraDesa SC Jumar Ali, S.Pd.I Al-Hidayah Jl. Pembangunan Desa Sekip Lubuk Pakam Amas Muda Lubis Al-Hafiz Hamparan Perak Kec. Hamparan Perak H. Zulkarnain Al-Ikhlas Jl. Delitua Km. 8,5 Dusun Desa Suka Makmur Drs. Sudarno Al-Ikhlas Lingk. XIII Dusun Durian Kec.Percut Sei Tuan Drs. Abdul Wahab Al-Ikhlas (YAMP). Pomplek Perkantoran Pemkab. DS MuhammadYahya Hsb., S.Ag Al-Issyah Hakim Jl. Karya Jaya Kel./Kec. Deli Tua Rustam Harahap Al-Muhajirin Perum. Pondok Nusantara Ds Marindal-II Drs. MuhammadYusuf Marpaung Al-Muttaqien Jl. Besar Deli Tua Gg.Kolam Kec. Deli Tua Drs. Poltak Harahap Al-Mukhlisin Jl. Terusan Dusun II Bandar Setia Drs. H. Ahmad Riadi, MA Baiturrahman Jl. Merica Raya Blok F Per. Simalingkar Drs. M. Syarawi M., S.Ag

R

amadhan adalah bulan yang penuh keberkahan, keistimewaan dan merupakan lautan hikmah serta samudera rahasia. Alangkah meruginyalah kita kalau menyia nyiakannya. Pelaksanaan ibadah puasa adalah salah satu kewajiban yang diperintahkan Allah SWT di bulan ini. Kita melakukan ibadah puasa ini karena Allah. Kita katakan demikian karena yang mewajibkan puasa ialah langsung dari Allah SWT, sebagaimana tersebut dalam firman-Nya: “Wahai orang-orang yang beriman, diwajibkan atas kamu berpuasa sebagaimana juga telah diwajibkan kepada orang-orang sebelum kamu, agar kamu menjadi orang yang bertaqwa”. (QS. Al-Baqarah: 183). Puasa yang kita lakukan adalah untuk melatih diri, menempa diri, memperbaiki diri untuk menjadi yang lebih baik dalam hal fisik atau pun mental (ruhani). Untuk itu, memaksimalkan ibadah puasa di bulan Ramadhan ini sangat penting untuk terus diusahakan agar rahasia yang tersembunyi di balik pensyari’atan ibadah puasa itu akan tercapai. Rahasia Puasa Ramadhan Sungguh berbahagia orang yang mendapatkan seruan dengan panggilan kasih sayang oleh orang-orang yang dipandang dan disegani. Lebih-lebih kalau panggilan itu datangnya dari Allah SWT Yang Maha Pengasih lagi Maha Penyayang, yang dengan bijaksana memanggil orang-orang Islam dengan seruan ya ayyuhalladzina amanu (Hai orangorang yang beriman). Sepatutnya umat ini merasa senang dengan menjadi kelompok orang-orang yang memperoleh seruan-Nya. Namun, bila kita lihat realitasnya ternyata tidak semua orang Islam mampu memenuhi panggilan-Nya Itulah rahasia panggilan Allah SWT. jelas bahwa bila kita terpanggil untuk memenuhi seruan-Nya itu berarti kita tergolong dengan orang mukmin, atau sebaliknya. Allah SWT mewajibkan kita melaksanakan ibadah puasa di bulan Ramadhan dengan menyertakan beberapa rahasia yang bisa kita peroleh. Semuanya bermuara untuk mengarahkan kita menjadi orang yang bertaqwa (la’allakum tattaqun). Pertama, puasa mendidik kita untuk mengendalikan hawa nafsu. Ketika kita melaksanakan ibadah puasa, terhadap yang halal pun kita diperintahkan untuk tidak mem-

Baitussalam Dagang Kerawan Tanjung Morawa Baitur Rohim Jl. Purwo Desa Suka Makmur Graha Deli Permai Jl. Sidodadi Istikmal Jl. K.E. Tandean Lingk. III Bandar Sakti Jami’ Asysyakirin Deli Tua Jami’ Kel. Galang Kota Jami’ Al-Hisan Desa Silemak Kec. Hampran Perak Jami’ Lubuk Pakam Khairul Fatihin Dusun II Kec. Tg. Morawa Lahmuddin Jl. Besar Deli Tua Km.8,3 Ds Suka Makmur Misbahul Munir Jl. P. Siantar No. 1 Desa Pagar Jati Nurul Ikhwan Jl. H.A. Dahlan No. 38 Tg. Morawa Pekan Nurul Hikmah Balai Penelitian Sungai Putih Nursa’adah Jl. Raya Medan- Tanjung Morawa Km. 12 Raya Lubuk Pakam Jl. T. Raja Muda No. 26 Raya Syuhada Kec. Galang Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam Taqwa Lubuk Pakam

perbuatnya. Ini menunjukkan, hidup di dunia bukan hanya untuk makan, minum, sex. Sampai pada akhirnya tidak memperhatikan ramburambu ajaran Tuhan. Jangan hanya karena urusan perut pejabat menjadi korupsi, pedagang berlaku curang. Jangan hanya karena urusan biologis seksual menyalurkan nafsunya lewat pergaulan bebas, gratifikasi sex dan zina. Kondisi tersebut akhirnya menenggelamkan potensi kebertuhanan kita. Puasa mengarahkan kita untuk totalitas mampu mengendalikan diri. Hal yang sangat penting adalah membangun spritualitas yang baik lewat pengendalian nafsu. Keberhasilan kita untuk mengendalikan hawa nafsu maka kita akan merasakan ketentraman baik di dunia maupun di akhirat. Sebagaimana janji Allah SWT: “Dan adapun orang-orang yang takut kepada kebesaran Allah dan menahan dari hawa nafsunya. Maka sesungguhnya surgalah tempat tinggalnya”. (Q.S. An-Nazi’at (79): 40-41). Di bulan Ramadhan ini kita dilatih untuk mampu mengendalikan diri dan menahan nafsu yang dapat membatalkan ibadah puasa seperti makan, minum, bersetubuh di siang hari dan juga menahan nafsu dari halhal yang dapat mengggugurkan pahala ibadah puasa kita seperti yang dijelaskan oleh Rasulullah SAW: “Ada lima hal yang dapat membatalkan pahala ibadah puasa kita yaitu: dusta, mengumpat, mem-fitnah, sumpah palsu, dan melihat dengan syahwat (rangsangan) “. Jadi jelas bahwa pengaruh ibadah puasa terlihat pada sejauh mana seseorang bisa mengendalikan nafsunya. Kedua, orang yang berpuasa termotivasi untuk bersikap perduli terhadap kehidupan sosial di sekitarnya, terutama terhadap fakir miskin. Karena orang yang berpuasa juga merasakan apa yang yang telah dirasakan oleh orang-orang yang kelaparan selama ini. Tidak makan dan tidak minum yang dilakukan walaupun hanya sehari itu dapat menumbuhkan rasa empati terhadap penderitaan yang selama ini dirasakan oleh orang-orang fakir miskin. Rasa empati tersebut dapat diimplementasikan melalui amal bakti sosial, baik untuk jangka pendek maupun jangka panjang. Zakat, infak dan sedekah adalah pilar pembangunan ekonomi umat yang harus terus disosialisasikan agar kaum dhu’afa (fakir dan miskin) da-

Syamsul Rizal, S.Pd.I H. Sofyan Nur Sipahutar H. Alfan Arbudy, S.Ag Yusnul Adhary, SE H.M. Syafiar, Lc H. Syahrial Helmi, S.Pd.I M. Yusuf, Lc Drs. H.A. Taufik Lubis Drs. Ngadimen, S.Pd.I Erwin Drs. Syahdan Drs. H. Sangkot Saragih, M.H. H. Ramlan Drs. H. Asro, SH, M.Ag Saifullah, S.Pd.I T. Radian, S.Ag H. Surya Putra Drs. H. Lukman Hakim, M.Pd

BINJAI Agung Kota Binjai Ramadhan Amal Jl. T. Imam Bonjol Gg. Cempaka Asmuri Hafiz, S.Pd.I An-Nur Jl. Veteran No. 7 Lingk. 1 Kel. Tangsi Drs. H. Syamsuddin Daulay Ar-Rahmah Turiam Jl. Ikan Kakap No.1 Kel. Tanah Tinggi H. Amin Nasution, MA Ath-Thohirin Jl. T. Amir Hamah Km.24 Kel. Jati Makmur Irwansyah, S.Pd.I Al-Hidayah Jl. Talam No. 28 Kel. Nangka Binjai H. Farhan Rawi, BA Al-Hilal Jl. Ikan Arwana No. 17 Kel. Dataran Tinggi H.M. Effendi, MA Al-Mukhlishin Jl. Timba No. 3 Lingk. II Nangka Drs. H. Muslim Rawi Al-Qadar Komplek Griya Payaroba Indah Binjai Edi Syahputra Darussalam Jl. Cut Nyak Din No. 2 Kel. Tanah Tinggi Irhamuddin Siregar, S.Ag Istiqomah Jl. T. Amir Hamzah Kel. Jatinegara Putra Sakti, S.Ag Nurul Falah Jl. S.M. Raja No. 60 Kel. Tanah Tinggi Drs. H.A. Yunani Harahap Nurul Yaqin Jl. S.M. Raja No. 94 Kel. Tanah Tinggi Drs. lYahya LANGKAT Azizi Tanjung Pura Ar-Raudhah Dusun VII Desa Kebun Balok Al-Furqan Stabat

Drs. H.M.Yusuf Abdullah, MA Sudarman Achmad Jaiz

TEBING TINGGI Amal Muslim Kp. Rao Annamirah Perum. Griya Prima Lingk.IV Kel. T. Marulak At-Taqwa Jl. Dr. Kumpulan Pane No. 58 Lingk. I Al-Huda Lingk. III Kel. Berohol Kec. Bajenis Al-Hidayah Jl. Nenas Kel. Rambung Kota Al-Hasanah Jl. Kartini No. 16-A Al-Hasanah Jl. Merbau Perumnas Bagelen Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Kota Al-Muthmainnah Kel. D. Sundoro Lingk. I Al-Qomar BTN. Purnama Deli Lingk. V Kel. Bulian Darul Jihad Brimob Jl. Ahmad Yani Nurul Islam Jl. P. Irian Lingk. 04 Kel. Persiakan Nurul Iman Jl. K.L. Yos Sudarso Lingk. 02 Kel. R. Laban Nurul Ikhwan Rumah Sakit Sri Pamela Raya Nur Addin Kota Tebing Tinggi Syuhada Jl. Iskandar Muda No. 79-A Tafakkur Jl. Sei Padang Lorong Batu Sangkar Kota

Zulham Zulkarnain, S.Ag Drs. Abd. Hafizun, SH, MA H. Wijaya, D. M. Amin, SH Drs. H. Hamdani Rahmat Halim Batubara Drs. Daulat P. Sibarani, MA Zulkipli M. Syafi’i, S.Ag Masrisyah, S.Pd.I Suratman, S.Ag Drs. H.P. Gultom Lahmanuddin Ridwan Syam, S.Ag Drs. Abdul Khalik, M.AP Turman Hasibuan

INDRAPURA Jami’ Indrapura

H. Lukman Yanis

KISARAN Agung Jl. Imam Bonjol No. 182 Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Al-Huda Jl. K.H. Ahmad Dahlan No. 1 Al-Husna TKel. Kisaran Barat Al-Husna Kel. Sidomukti Al-Hidayah Kisaran Baru Al-Inayah Kel. Siumbut-umbut Kota Kisaran Timur Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer Ikhwaniyah Jl. Merpati No. 44 Kel. Gambir Baru Jami’ Baiturrahim Jl. Prof. H.M. Yamin SH

H. Syalman AbdullahTanjung Drs. H. Adlan Lubis,S.Pd Imron Ariadin, MA Abd. Hakim Lubis Bambang Harmoyo H. Dahmul Daulay, S.Ag H. Ahmad Bin Yasir Drs. H. Edy Sucipno H. Abdul Wahab Hadira Fitra, S.Ag, MA

Dengan puasa kita diajak untuk menyelami langsung bagaimana rasanya lapar dan dahaga yang dialami simiskin. Sehingga kita bisa merasakan penderitaan saudara-sauda-ra kita yang terkapar di pojok-pojok kehidupan. pat terbantu. Mendidik orang untuk mencintai fakir dan miskin tidak bisa cuma lewat seminar, kongres, penataran, indoktrinasi, dan fenomena keilmiahan lainnya. Dengan puasa kita diajak untuk menyelami langsung bagaimana rasanya lapar dan dahaga yang dialami simiskin. Sehingga kita bisa merasakan penderitaan saudara-saudara kita yang terkapar di pojok-pojok kehidupan, beratap langit dan berlantai bumi tanpa punya harapan nasibnya akan berubah. Dan terketuklah pintu hati kita untuk hidup tidak buat kepentingan diri sendiri, terpanggillah kita untuk merasa butuh memberikan pertolongan sesuai dengan kemampuan kita kepada mereka yang memerlukannya. Rasulullah menjelaskan: “Sayangilah orang-orang yang ada di bumi supaya yang di langit menyayangimu”. (HR Thabrani). Ketiga, puasa mendidik dan menumbuhkan persatuan umat. Hal itu didasarkan banyaknya aktivitas yang dilakukan dengan penuh kebersamaan. Seperti berbuka puasa bersama-sama, shalat tarawih di Masjid, Musholla secara berjamaah, dan melakukan imsak (menahan) tidak makan dan minum sejak terbit fajar sampai terbenamnya matahari juga secara bersama-sama. Persatuan umat seperti inilah yang sangat dianjurkan oleh ajaran Islam. Alangkah indahnya apabila segenap orang-orang Islam dapat bersatu dalam segala hal. Keempat, puasa melatih kita untuk hidup jujur dan disiplin. Karena selama berpuasa kita tidak dibenarkan berbuka sebelum datangnya waktu maghrib (saat berbuka) kecuali bila ada uzur syar’i. Kedisiplinan seperti itu hendaknya dapat menjadi kebiasaan dalam keseharian bagi masyarakat. Karena bisa saja bila tidak ada kejujuran, kedisiplinan di bulan puasa terjadi kebohongan. Contoh, saat tengah hari di bulan Ramadhan kita mengunci diri di dalam kamar lalu makan sekenyangnya. Dijamin tidak ada seorangpun yang tahu. Tapi kenapa

tidak kita lakukan? Ada semacam self-control yang sandarannya langsung kepada Allah SWT. Ada keyakinan bahwa meski orang tidak tahu tapi Allah mengetahuinya. Manusia bisa dibohongi tapi Allah maha suci dari segala akalakalan dan tipu daya kita. Dengan demikian, puasa akan membimbing kita terus untuk semakin dekat dengan Allah SWT. Merasakan bahwa Allah SWT senantiasa hadir dalam setiap kehidupannya. Karena, orang yang berpuasa tidak makan dan tidak minum tanpa pengontrol langsung selain dari Allah. Itulah yang disebut dengan muraqabah (pendekatan diri kepada Allah SWT di mana orang yang berpuasa itu selalu merasakan sedang diawasi dan dikontrol langsung oleh Allah Azza wajalla). Kelima, Puasa dapat memberikan kesehatan kepada badan secara medis. Kesehatan tubuh yang diakibatkan oleh puasa itu mengakibatkan kepada kesehatan mental dengan terkontrolnya nafsu sehingga membentuk keseimbangan dan ketenangan jiwa yang sangat diperlukan oleh kehidupan manusia modern. Demikianlah setetes dari lautan rahasia yang terkandung dalam ibadah puasa Ramadhan. Jika kita merenungkan dan menghayatinya dengan seksama, maka hidup kita akan selalu dinaungi curahan rahmat dan kasih sayang dari Allah SWT hingga pada akhirnya predikat orang orang yang bertaqwa akan mampu kita sandang. Puasa yang dilakukan oleh umat Islam bertujuan “untuk membentuk pribadi-pribadi yang bertaqwa”. Tujuan tersebut bisa tercapai dengan menghayati arti puasa dan menggali rahasia yang tersembunyi di dalamnya. Dengan demikian upaya maksimalisasi dalam melaksanakan ibadah puasa di bulan Ramadhan ini sudah menjadi sebuah kemestian. Pada akhirnya apa yang kita citacitakan dan harapkan menjadi orang yang bertaqwa akan kita dapatkan. Amin. Wallahu a’lamu.

Nurul Huda Jl. Malik Ibrahim No. 37 Arif-Al Azhim Polres Asahan

Drs. H. Abdul Azissyah, SH Drs. H. Usman Effendi, Lc

BATUBARA Jami’ Al-Mukhlisin PT. Moeis Kec. Sungai Suka Deras Nurul Huda Desa Tanah Tinggi Kec. Air Putih Syuhada Sukaraja Desa Sukaraja Kec. Air Putih

Irpan Ansori Musum Amanto

PEMATANGSIANTAR Al-Abrar Jl. Aru Kel. Bantan Al-Amin Jl. Brigjen Rajamin Purba Kel. Bukit Sofa Al-Falah Jl. Pane No. 1 Kel. Karo Al-Falah Jl. Rakutta Sembiring No. 5 Kel. Naga Pita Al-Furqon Jl. Tekukur No. 2 Kel. Sipinggol-pinggol Al-Hanif Jl. Ade Irma Suryani Nasution No. 28 Al-Hidayah Jl. Bazoka No. 6 Kel. Bukit Sofa Al-Hidayah Jl. MelanthonSiregar No. 36 Sukamakmur Al-Hikmah Jl. Sibatu-batu Kel. Bah Kapul Al-Hilal Jl. Melanthon Siregar No. 218 P. Marihat Al-Huda Jl. Medan Km. 7,5 Kel. Tambun Nabolon Al-Huda Rindam Jl. Bangau Kel. Setianegara Al-Ihsan Gang Kapuk Kel. Tanjung Tengah Al-Ihsan Jl. Rajawali No. 26 Kel. Simarito Al-Ikhlas Jl. Ampi No. 17 Kel. Bantan Al-Ikhlas Jl. Bakung No. 44 Kel. Simarito Al-Ikhlas Blok II Sibatu-batu Makmur Al-Ikhlas Gg. Air Bersih No. 22 Kel. Naga Pitu Al-Ikhlas Jl. Mawar Karang Sari Permai Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba Al-Ikhlas Jl. Silou Raya No. 2 Kel. Siopat Suhu Al-Ikhlas Jl. Tangki Kel. Naga Pita Al-Jihad Jl. Jenderal Ahmad Yani Kel. Asuhan Al-Jihad Jl. Melati No. 11 Kel. Simarito Al-Jihad Jl. Tongkol No. 86 Kel. Pardomuan Al-Khairiyah Jl. Jorlang Hataran No. 1 Kel. Simarito Al-Khoirot Tambun Timur Kel. Tambun Nabolon Al-Mukminun Jl. Sang Nawaluh Kel. Siopat Suhu Al-Musyawarah Jl. Flores II Kel. Bantan Al-Muttaqin Jl. Patuan Anggi Gg. Emas Kel. Baru Baitul Abrar Jl. Meranti Kel. Kahean Baiturrahmah Jl. Tanah Jawa No. 75 Kel. Melayu Bakti, Jl. Singosari Kel. Bantan Bhakti Jl. Serdang Kel. Martoba Dakwah Jl. Jawa No. 23 Kel. Bantan Darul Aman Jl. Enggang No. 4 Kel. Sipinggol-pinggol Darul Maimanah Jl. Sriwjaya Gg. Mesjid Kel. Baru IlhamJl. Jenderal Ahmad Yani No. 43 Kel. Pardomuan Istiqomah, Jl. Bolakaki Kel. Banjar Jamik As-Saidah Jl. Siatas Berita Kel. Tomuan Jamik Jl. Medan Km. 4 Kel. Naga Pitu Mualifatul Bilad Jl. Setianegara II Kel. Setianegara Mujahidin Jl. Kabu-kabu No. 22 Kel. Kahean Nurul Hikmah Jl. Dr. Cipto No. 122 Kel. Simalungun Nurul Huda Blok III Kel. Bah Sorma Nurul Huda Jl. Melanthon Siregar Pematang Marihat Nurul Ihsan Jl. Nagahuta Gg. Mesjid Kel. Setianegara Nurul Iman Jl. Rakoetta Sembiring Kel. Naga Pitu Nurul Iman Tambun Timur Kel. Tambun Nabolon Rahmad Jl. Madura Bawah Kel. Bantan Rahmat Jl. Singosari No. 30 Kel. Martoba Raya Jl. Mesjid Kel. Timbang Galung Syafaat Jl. S.M. Raja Barat Kel. Bah Kapul Taqwa Ash-Sholeh, Jl. Silimakuta No. 30 Kel. Simarito Taqwa Jl. Dr. Wahidin Kel. Melayu Taqwa Jl. K.H. Ahmad Dahlan No. 18 Kel. Bukit Sofa Taqwa Jl. Merdeka No. 271 Kel. Dwikora Taqwa Jl. Patuan Anggi Gg. Perak Kel. Baru Ubudiyah Jl. Melur No. 11 Kel. Simarito

Samantio Sinaga, S.Pd.I H.M. Thamrin Nasution H. Ahmad Syuthury, S.Ag Drs. H. Khoiruddin Nasution Rahmat Lubis, BA H. Abdul Halim Lubis, S.HI Ahmad Hanafi Lubis, S.Ag Iswadi Lubis, S.Ag H. Miswan, SH Agus Pandapotan Nst., S.Pd.I Hanizar, S.Ag Drs. H. Mustafa Kamal Siregar H. Bahaluddin, S.Pd.I Drs. H. Mhd. Asli H. Sofyan Han Drs. Salahuddin, MD Muhammad Rusli, S.Ag H. Aslam Al-Huda Nst., S.Pd.I Drs. Badaruddin Dalimunthe Albar Suheri, S.Ag Drs. H. Rasyid Nasution Drs. Alhafif Syahputra, M.Pd. Drs. Rustam Asy’ari, MA H. Sardjono, S.HI Drs. H. Asy’ari Sitompul Zulfakar Ramlan Purba Zulhamri Siregar, S.HI Hasyrul Syahrial Siregar, S.HI H. Zulkarnain Nasution, S.Ag Rasyidan Mansur Sinaga, S.Pd.I Drs. H. Mustafa Kamal Siregar Wajir Caniago Sudarwin, S.Pd.I Irwansyah Nasution, S.Pd.I Yusri Nasution Muhammad Zein H.M. Thamrin Nasution M. Ridwan Al Islamy, S.Pd.I Drs. Paisri, MM Drs. Tajussalim Drs. H. Ali Usman Nasution Maulana Arham KI A.H. Mugiono Zer Abdul Rahman Saragih, S.Pd.I Iswadi Lubis, S.Ag Drs. H. Yusri Batubara, MH Warsono Drs. Iman Nainggolan, MA Drs. H. Ammar Lubis Drs. H. Marham, M.S. Drs. Borkat Pandiangan, M.M. Tagor Muda Hasibuan Husnul Arifin, M.Pd. Zulfahri Nasution Hamdan Nasution, S.Ag Fakhruddin Sagala, S.Pd.I H. Hasan Basri Siregar,MA

SIDIKALANG Agung Jl. Mesjid No. 2 Sidikalang Al-Muhajirin Perumnas Simbara Sidikalang

Karimin Silalahi, S.Ag Anwar Efendi Piliang


Mimbar Jumat

C6

WASPADA Jumat 26 Juli 2013

Keistimewaan Angka 7 Dalam Alquran Ramadhan; Indah, Bahagia (3)

Oleh H.M. Nasir, Lc, MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara, Wakil Sekretaris Dewan Fatwa Pengurus Besar Al Washliyah.

S

egala sesuatu yang diciptakan Allah SWT, mulai

dari hal-hal yang terkecil sampai pada jagad raya yang luas ini memiliki keistimewaan antara satu dengan yang lain, antara seorang rasul dengan rasul yang lain Allah memberi kelebihan seperti kelebihan pada rasul-rasul Ulul ‘Azmi (Nuh, Ibrahim, Musa, Isa, Muhammad SAW). Rasul itu kami lebihkan sebagian mereka dari sebagian yang lain (QS. Al-Baqarah: 253). Siang dan malam silih berganti memiliki keistimewaan tersendiri, malam lailatul qadar lebih mulia 1000 bulan dari malam lainnya (QS. Al-Qadr: 3). Siang hari wuquf di Arafah memiliki kelebihan pula dari hari-hari biasa. Demikian pula tempat-tempat ibadah yang ada di permukaan bumi ini, Allah SWT memuliakan Mesjidil Haram, Mesjid AnNabawy dan Mesjid Al-Aqsha, dari sekian mesjid yang ada di permukaan bumi ini. Alquran yang menjadi sumber informasi terhadap kemuliaan tersebut diceritakan oleh Nabi Muhammad SAW kepada kita tidak sama nilai antara satu surah dengan surah yang lain. Surah paling mulia adalah Al-Fatihah, sehingga surah ini diulang-ulang membacanya setiap hari ketika melaksanakan shalat, surah AlIkhlas sebanding dengan sepertiga Alquran dan ayat Kursi ayat yang paling mulia dalam Alquran, dan seterusnya. Jika kita meneliti lebih lanjut dalam bahasa angka dalam Alquran, tentu akan menimbulkan pertanyaan besar, apakah Allah SWT juga memuliakan angka 7 dari angka-angka yang lainnya? Dan apa pula hikmah yang terkandung di balik kemuliaan angka ganjil ini?, sehingga Allah SWT menyebutnya pertama kali dan

terakhir di dalam Alquran, yaitu di dalam surah Al-Baqarah ayat 29: Dia-lah Allah, yang menjadikan segala yang ada di bumi untuk kamu dan Dia berkehendak (menciptakan) langit, lalu dijadikan-Nya “tujuh” langit dan Dia Maha mengetahui segala sesuatu. Dan di dalam hadis-hadis Nabi

Dalam konteks sejarah kenabian, Alquran juga menyebut angka 7 terhadap kisah Nabi Nuh As, ketika mengajak umatnya. Allah berfirman: Tidakkah kamu perhatikan bagaimana Allah telah menciptakan 7 langit bertingkattingkat? (QS. Nuh: 15). Penyebutan angka 7 dikisahkan juga di

penyebutan angka 7 di dalam hal-hal tertentu seperti dikemukakan di atas tidak secara kebetulan, sebab menurut logika ilmiah, sesuatu yang terjadi secara kebetulan tidak mungkin selalu terulang Muhammad Saw, angka 7 sering disebut, seperti sabdanya: Jauhilah tujuh dosa-dosa besar (HR. Bukhari Muslim). Dan ketika Nabi SAW berbicara tentang kezaliman, Nabi mengatakan: Siapa saja yang berbuat kezaliman sepanjang satu jengkal tanah, maka dia akan dibebani seberat tujuh lapisan bumi (HR. Bukhari Muslim). Di dalam masalah ibadah Rasul SAW telah memberitahukan kepada kita untuk sujud dengan tujuh anggota badan. Rasul SAW bersabda: Aku diperintahkan untuk bersujud dengan tujuh tulang (yaitu dua ujung jari kaki, dua lutut, dua tangan dan satu dahi) (HR. Bukhari Muslim). Di dalam pelaksanaan Haji, sebagai rukun Islam yang kelima, seorang mukmin disuruh untuk bertawaf 7 kali, sa’i antara Safa dan Marwa 7 kali, dan ketika melontar jumroh Nabi Muhammad SAW melempar jumroh dengan 7 butir batu setiap jumroh, dan di dalam Alquran Allah menyebut angka 7 dalam ibadah Haji Tamattu’, yaitu puasa 7 hari ketika pulang ke tanah air dan 3 hari di Mekkah sebagai pengganti dan Tamattu’ bagi yang tidak mampu membayarnya. (lihat surah Al-Baqarah ayat 196).

dalam surah Yusuf As ketika menafsirkan mimpi seorang raja melihat 7 ekor sapi gemuk memakan 7 ekor sapi kurus di dalam mimpinya (lihat surah Yusuf ayat 43). Dan dalam kisah Nabi Hud ketika berdakwah kepada kaum ‘Ad muncul lagi angka 7 di saat Allah membinasakan kaumnya dengan angin yang sangat dingin selama 7 malam 8 hari, dan di dalam kisah As-Habul Kahfi Allah SWT menyebut angka 7 dalam jumlah penghuni gua Kahfi, yaitu 7 orang pemuda dan delapan dengan anjingnya. Dan dalam penyebutan kata kiamat di dalam Alquran sebanyak 70 kali yang merupakan hasil perkalian dari 10x7=70, dan penyebutan neraka jahannam sebanyak 77 kali, dan pintu neraka jahannam sebanyak 7 pintu. Allah berfirman: Jahannam itu mempunyai 7 pintu, dan tiap-tiap pintu telah ditetapkan untuk golongangolongan tertentu (QS. Al-Hijr: 44). Dan masih banyak lagi penyebutan angka 7 di dalam Alquran yang berkaitan dengan sedekah, tasbih, surah-surah yang terpanjang, 7 surah yang selalu diulangulang, dan sebagainya. Diyakini bahwa, penyebutan

angka 7 di dalam hal-hal tertentu seperti dikemukakan di atas tidak secara kebetulan, sebab menurut logika ilmiah, sesuatu yang terjadi secara kebetulan tidak mungkin selalu terulang dalam sebuah buku terkecuali si penulisnya mengurutkan tulisannya dengan sebuah metode tertentu. Menurut penulis, hikmah yang teramat mahal dari penggunaan angka pada ayat-ayat Kauniah (alam semesta) dan dalam waktu yang sama digunakan untuk angka ibadah bagi manusia, adalah keselarasan dan keharmonisan antara alam semesta dan makhluk yang berinteraksi dengan alam semesta tersebut. Dengan kata lain, jika alam jagad raya ini begitu harmonis dengan Sang Pencitanya, mengapa manusia tidak menjaga keharmonisan hubungannya dengan alam sekitarnya?, malah kerusakan di bumi dan di laut bahkan di udara disebabkan oleh ulah tangan manusia itu sendiri (lihat surah Ar-Rum ayat 41). Jadi, dapat disimpulkan, kehadiran angka 7 dalam kehidupan kita telah menempati angka terpenting dalam peribadatan dan interaksi kita kepada sesama makhluk, setelah angka 1 sebagai lambang keesaan zat Allah SWT yang Maha Esa, dan lebih mengagumkan kita ternyata angka 1 lebih sering disebut di dalam Alquran ketimbang angka 7, karena pemilik semua alam semesta ini adalah Dia yang Maha Satu (Esa) tidak ada sekutu bagi-Nya. Sekaligus merupakan informasi kepada umat manusia bahwa Allah itu Tunggal (ganjil) dan dari beberapa bilangan ganjil yang paling di-senangi oleh Allah SWT adalah bilangan tujuh , dan terahir sekali Nabi Muhammad SAW yang membawa informasi itu sendiri lewat Alquran dan sunnahnya beliau hanya diberi usia 63 tahun, yang artinya sama dengan 9 kali kelipa-tan 7. Wallahua’lam bil ash-shawab.Wallaikum sallam

Peran Puasa Ramadhan Dalam Aktualisasi Anti Terorisme OlehDiah Widya Ningrum, S.Pd.I Penulis adalah Staf Pengajar di Perguruan Al-Jam’iyatul Washliyah Perbaungan

I

su global tentang terorisme yang senantiasa dikaitkan dengan Islam harus diluruskan bahwa Islam bukan agama teroris. Islam tidak pernah men-support umatnya untuk menteror, menakut-nakuti apalagi sampai menghilangkan nyawa orang lain. Tidak ada ajaran Islam yang menyuruh umatnya berdakwah dengan jalan menebar kekerasan dan kekejaman. Makna jihad dalam Islam harus diluruskan kembali agar orang tidak salah memahami tentang Islam. Makna jihad jangan sampai dikebiri dalam lingkup yang sangat sempit. Akibatnya, penerapan konsep jihad dilakukan secara kaku. Jihad memiliki makna yang luas (universal). Universalitas jihad inilah yang harus kita pahamkan sehingga penerapannya menebar kemanpaatan bagi umat manusia. Puasa Ramadhan ternyata sejatinya adalah aktualisasi jihad bahkan jihad akbar

kata Rasulullah SAW. Puasa Ramadhan sebagai Jihad Akbar “Jihad akbar” adalah istilah lain dari puasa Ramadhan yang langsung dari nabi Muhammad SAW., ketika beliau menyebutkan di saat usai perang Badar: “Setelah kita kembali menyelesaikan “jihad kecil”, mari kita hadapi “jihad besar”. Lalu sahabat bertanya, ya Rasul mengapa anda menyebut perang dahsyat ini sebagai jihad kecil? Rasul kembali mengatakan, perang,-betapapun besarnya- dijalankan dengan menggunakan senjata dan musuhnyapun terlihat secara kasat mata. Hingga strateginya lebih mudah untuk dirumuskan. Akan tetapi perang yang paling dahsyat, kata Rasul adalah perang melawan hawa nafsu yang disembulkan syetan yang mewujud dalam egoisme, keakuan, ketamakan dan kejahatan.” Dengan demikian, the real Jihad

Konsultasi Alquran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan)

KONSULTASI AL-QURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Ustadz, Dalam shalat taraweh ada makmum yang lihat mushaf sudah pernah saya lihat di telivisi, tapi sekiranya imam yang melihat mushaf, kira-kira bagaimana ustadz? Mohon penjelasan. Dari seorang Hamba Allah. Jawab : Terima Kasih atas pertanyaannya. Dalam buku Al-Ahkam Fiqhiyyah khossah Alqur’an, DR. Ahmad Salim menyatakan bahwa Ulama berbeda pendapat: Pertama. Sah dan tidak makruh. Ini adalah pendapat Syafi’i. dalilnya, Abu Hurairah meriwyatkan dari Aisyah, ia berkata “Aisyah bermakmum kepada budaknya Dzakwan dengan melihat mushaf”. Kedua. Merusak shalat. Ini adalah pendapat imam Hanafi. Dalil mereka adalah Abdullah bin Aufa meriwayatkan ada seseorang yang mendatangi Rasulullah dan berkata: “Aku tidak mampu membaca Alqur’an sedikitpun maka ajarkan bacaan yang mencukupi kepadaku”. Beliau bersabda: “katakanlah Subahanallah, walhamdulillah, lai ilahalillah, Allahu Akbar dan walahaula wa la quwwata illa billah” (HR Abu Daud). Hadis menunjukkan bahwa Nabi memerintahkan kepada yag tidak hafal untuk mengganti dengan zikir dan tidak memerintahkan untuk melihat mushaf. Ini berarti melihat mushaf itu tidak sah dan merusak shalat. Ketiga. Makruh tapi tidak merusak shalat. Ini pendapat Abu Yusuf dan Muhammad Hasan, dua sahabat Abu Hanifah. Alasannnya melihat mushaf ketika shalat menyerupai ahli kitab. Keempat. Makruh dalam shalat fardhu, tidak dalam shalat sunnah kecuali bagi orang yang hafal Al-qur’an, ia tetap dimakruhkan membaca melihat mushaf, baik dalam shalat fardhu maupun shalat sunnat. Dalilnya seperti pendapat pertama hanya saja hadis Dzakwan itu difahami mereka untuk shalat sunnat tidak untuk shalat fardhu. Kelima. Membatalkan shalat fardhu, bukan shalat sunat. Ini pendapat lain Ahmad. Kami sependapat dengan pendapat yang menyatakan sah dan tidak dimakruhkan. Wallahu A’lam Al-ustadz H. Ismail Hasyim, MA.

Manakala puasa Ramadhan sebagai jihad yang lebih besar dari perang mampu diaktualkan maka terorisme berbajukan agama akan mampu diatasi sejak dini oleh umat Islam. ada pada bulan penuh dengan keberkahan ini. Puasa Ramadhan akan mengembalikan kita kepada pemahaman Islam yang benar. Puasa Ramadhan akan membimbing kita untuk berpikir dan bertindak penuh kearifan demi menjadikan hidup lebih baik dan bermoral. Puasa Ramadhan juga bermakna jihad melawan ketidakadilan dan penindasan dengan cara yang bijaksana. Manakala puasa Ramadhan sebagai jihad yang lebih besar dari perang mampu diaktualkan maka terorisme berbajukan agama akan mampu diatasi sejak dini oleh umat Islam. Universalitas Jihad Dalam Islam Ada kesalahpahaman tentang pengertian jihad. Ini mungkin disebabkan oleh seringkalinya kata itu baru terucapkan pada saat perjuangan fisik, sehingga diidentikkan dengan perlawanan bersenjata. Allah SWT. berfirman: “Sesungguhnya orang-orang yang beriman hanyalah orang-orang yang beriman kepada Alah dan Rasul-Nya, kemudian mereka tidak ragu-ragu dan berjihad dengan harta dan jiwa mereka pada jalan Allah, mereka itulah orang-orang yang benar.” (QS. Al-Hujurat:15) Kata anfus sering kali diterjemahkan dengan “jiwa”, jarang sekali dengan “diri”. Walaupun ada, seperti: “Tetapi rasul dan orang-orang yang beriman bersama dia, mereka berjihad dengan harta dan diri mereka. Dan mereka itulah orangorang yang memperoleh kebaikan, dan keberuntungan. (QS.At-Taubah:88) Dengan demikian kata “anfus” memiliki banyak arti, nyawa (jiwa), hati, jenis, diri. Dalam artian bermakna “totalitas manusia” di mana terpadu antara jiwa dan raganya. Satu catatan penting buat kita dalam meluruskan arti jihad ini adalah memahamkan kata “anfus/ nafs” dengan totalitas manusia. Berarti, tidak meleset jika kata itu dalam konteks jihad dipahami dalam arti “totalitas manusia”. Sehingga, kata “anfus/nafs” mencakup nyawa, emosi, pengetahuan, tenaga dan pikiran, bahkan juga waktu dan tempat, karena manusia tidak bisa memisahkan diri dengan keduanya. Pengertian ini dapat diperkuat dengan adanya perintah berjihad tanpa menyebutkan nafs atau harta benda. Allah

swt. berfirman: “Dan berjihadlah kamu di jalan Allah dengan jihad yang sebenar-benarnya.” (QS. Al-Hajj:78) Menurut Quraish Shihab: Lentera Hati, sekitar 40 kali kata jihad disebut Alquran dengan berbagai bentuknya. Maknanya bermuara pada “mencurahkan seluruh kemampuan” atau “menanggung pengorbanan”. Mujahid adalah orang yang mencurahkan seluruh kemampuannya dan berkorban dengan nyawa, tenaga, pikiran, emosi dan apa saja yang berkaitan dengan diri manusia. Sedangkan jihad adalah cara untuk mencapai tujuan. Jihad tidak mengenal putus asa, menyerah, bahkan kelesuan, dan tidak pula pamrih. Beragam jihad, beragam pula buahnya. Buah jihad seorang ilmuwan adalah pemanfaatan ilmunya menuju kemaslahatan. Buah jihad seorang guru adalah pendidikannnya yang sempurna. Buah jihad seorang pemimpin adalah keadilannya. Buah jihad seorang pengusaha adalah kejujurannya dan kedermawanannya, demikian seterusnya. Berarti, peluang jihad sangat luas, bisa tergantung kepada profesi masing-masing sebagai ladang jihad kita. Kuncinya adalah: Pertama, mencurah-kan segenap kesanggupan diri untuk meraih cita-cita yang diridhai Allah. Kedua, dilakukan dengan kesadaran diri bukan didasarkan ketidaktahuan atau paksaan orang lain. Ketiga, semata-mata karena Allah (tanpa pamrih). Keempat, rela berkorban. Kelima, untuk kemaslahatan umat manusia (limaslahatinnas). Untuk disebut sebagai syahid/ syuhada’ al-Islam bisa dilakukan secara totalitas hidup kita sebagai teladan, dan patron bagi umat manusia (syuhada al al-nas). Syahid tidak hanya diperuntukkan untuk merekamereka yang gugur di medan juang. Tetapi, syahid adalah yang dipersaksikan lewat mata kepala dan juga mata hati sikap hidupnya, guna dijadikan teladan dalam kehidupan ini. Mengaktualkan Puasa Ramadhan melalui totalitas dalam pengendalian diri adalah solusi menghadapi terorisme yang berkembang di Indonesia saat ini. Terlebih, pemahaman jihad yang benar dapat terlihat melalui ibadah puasa Ramadhan yang kita lakukan. Wallahu a’lamu.

Nabi Muhammad SAW mengingatkan dalam sabdanya: “Shalat lima waktu & Jumat ke Jumat lainnya, Ramadhan ke Ramadhan lainnya akan menggugurkan dosa antara keduanya selama menjauhi dosa besar.” (Muslim). Dalam hadits lain disebutkan: “Barangsiapa bergembira dengan datangnya bulan Ramadhan, diharamkan Allah jasadnya menyentuh api neraka.” (An-Nasa’i). Pada hadits lain juga disebutkan: “Seandainya umatku tahu keutamaan bulan puasa, tentu mereka akan meminta supaya bulan yang ada dijadikan puasa selamanya…’’ (Ibnu Majah). Rasulullah SAW selain mengucapkan doa ketika memasuki bulan Rajab seperti yang termaktub di atas, menjelang Ramadhan tiba beliau juga menyampaikan basyarah (kabar gembira) sekaligus pengarahan dan motivasi kepada para sahabatnya terkait dengan bulan Ramadhan. Seperti yang diriwayatkan oleh Sayyid bin Thawus & syeikh Shaduq, dengan sanad dari Amirul Mukminin Umar bin Al-Khattab ra, dia berkata bahwa Rasulullah SAW pada suatu hari menjelang bulan Ramadhan tiba berpidato di hadapan kami: ‘’Wahai manusia! Sungguh telah datang pada kalian bulan Allah SWT dengan membawa berkah rahmat dan magfirah. Bulan yang paling mulia di sisi Allah SWT. Hari-harinya adalah hari-hari yang paling utama. Malam-malamnya adalah malam-malam yang paling utama. Jam demi jamnya adalah jam-jam yang paling utama. Inilah bulan ketika kamu diundang menjadi tamu Allah SWT dan dimuliakan oleh-Nya. Di bulan ini nafas-nafasmu menjadi tasbih, tidurmu ibadah, amal-amal mu diterima dan doa-doamu diijabah. Bermohonlah kepada Allah SWT, Rabbmu dengan niat yang tulus dan hati yang suci agar Allah SWT membimbingmu untuk melakukan shiyam (puasa) dan membaca kitab-Nya. Celakalah orang yang tak mendapat ampunan Allah SWT di bulan yang agung ini. (Sumber: buku hadits/ www.al-ikhwan.net Allah SWT).

Sanksi Bagi Orang Yang Tidak Puasa Oleh Drs.H.As’ad Marlan M.Ag Dosen FTIK IAIN SU dan STAIS AlL-Ishlahiyah Binjai

B

erpuasa di bulan suci Ramadhan adalah salah satu dari rukun islam yang ke lima dan mengerjakannya merupakan kewajiban bagi setiap muslim yang baligh,berakal,serta tidak boleh meninggalkannya kecuali bila terdapat uzur atau halangan yang telah ditetapkan oleh hukum syara’ seperti sakit,musafir,haid,nifas dan tidak mampu berpuasa karena usia tua. Kewajiban berpuasa di bulan Ramadhan adalah rukhsah (keringanan) untuk meninggalkan. Allah SWT menjelaskan dengan firman-Nya. “Hai orang-orang yang beriman ,diwajibkan atas kamu berpuasa sebagai mana diwajibkan atas orang –orang sebelum kamu agar kamu bertaqwa,yaitu dalam beberapa hari tertentu. Maka jika diantara kamu ada yang sakit atau dalam perjalanan(lalu ia berbuka) maka wajiblah baginya berpuasa sebanyak hari yang ditinggalkannya itu pada hari-hari yang lain. Dan wajib orang yang berat menjalankannya(jika mereka tidak berpuasa) mambayar fidyah,yaitu memberi makan seorang miskin. Dan berpuasa lebih baik bagimu jika kamu mengetahui”,(Al-Baqarah: 183-184). Berdasarkan ayat diatas dapat di ambil pelajaran sebagai berikut : Pertama, Allah mengisyaratkan bahwa puasa adalah suatu ibadah yang sudah ada sejak zaman dahulu di mana Allah telah mewajibkan terhadap umat-umat sebelum umat Nabi Muhammad SAW,namun sebagian umat terdahulu ada yang menukar dan merubahnya. Dahulu kala apabila puasa bertepatan pada musim panas atau pada musim dingin,orang ahli kitab mengalihkan pelaksanaan puasa itu ke musim semi yaitu antara musim panas dan musim dingin dan mereka menambah jumlah harinya menjadi lima puluh hari. Penambahan hari ini mereka lakukan dengan maksud menutupi kesalahan mereka karena merubah waktu. Kedua,bagi mereka-mereka yang kebetulan pada bulan Ramadhan uzur karena sakit atau dalam musafir(perjalanan jauh) diperbolehkan berbuka (tidak berpuasa). Tapi di hari lain di luar Ramadhan mereka wajib mengkhadanya (mengganti) sejumlah hari yang mereka tidak berpuasa. Ketiga,Allah akan memberikan nilai takwa bagi orang yang berpuasa. Dengan menjalankan ibadah puasa akan mendapat faedah yang sangat besar. Karena orang yang berpuasa itu hakikinya untuk meraih takwa,dia rela maninggalkan dorongan syahwatnya yang diperbolehkan di luar Ramadhan. Dan ini dilakukan dalam rangka melaksanakan perintah Allah SWT dengan iman dan ikhlas untuk mengharapkan ridha Allah SWT. Dengan demikian orang yang berpuasa itu terdidik untuk meninggalkan dorongan nafsu syahwat yang haram agar menjadi insan yang benar-benar bertaqwa. Ketentuan hukum syara’ di sekitar Ramaadhan Menurut syariat islam ada beberapa hal yang ada hubungannya dengan ibadah puasa Ramadhan antar lain: Pertama,apakah di wajibkan Allah terhadap kaum muslimin berpuasa sebelum bulan Ramadhan ? Melihat kepada zahir ayat “ayyamam ma’dudat” menunjukkan bahwa yang diwajibkan terhadap kaum muslimin yang berpuasa yaitu pada hari-hari di bulan Ramadhan. Ini pendapat mayoritas ulama tafsir yang bersumber dari Ibnu Abbas, Hasan dan Imam Ibnu Jarir ath-Thabrani memilih pendapat ini. Kemudian berikutnya Allah menjelaskan “syahru Ramadhan” maksudnya ayat ini merupakan dalil yang jelas dan kuat yang menunjukkan puasa yang di wajibkan Allah kepada kaum muslimin adalah bulan Ramadhan sebulan penuh. Kedua,sakit dan musafir bagaimanakah memperbolehkan seseorang tidak berpuasa? Allah SWT mamperbolehkan bagi orang yang sakit dan musafir tidak baerpuasa pada bulan Ramadhan. Ini merupakan rahmat dari Allah dan memudahkan bagi hamba-Nya. Ulama Fiqh berbeda pendapat dalam manentukan jenis penyakit dan musafir yang memperbolehkan untuk tidak berpuasa sebagai berikut : a). Semata-mata sakit dan musafir bagi seorang berbuka, sekalipun musafirnya itu dekat dan sakitnya hanya sakit ringan. Ini menurut pendapat Ahluz

Orang yang berpuasa itu terdidik untuk meninggalkan dorongan nafsu syahwat yang haram agar menjadi insan yang benar-benar bertaqwa. Zahir(sekelompok ulama yang hanya memandang lahiriah nash ayat Alqur’an dan Hadits. b). Mayoritas ulama Fiqh berpendapat penyakit yang memperbolehkan berbuka itu adalah penyakit parah yang bisa membahayakan jika si penderita,atau menambah parah penyakit itu sendiri atau juga dikhawatirkan ia akan lambat sembuh bila ia berpuasa. Begitu juga musafir yang jaraknya jauh yang biasanya akan menyulitkan bisa berpuasa. Ini merupakan pendapat Imam Mazhab yang empat yaitu Maliki,Syafi’i, Hambali dan Hanafi. Ketiga,jarak musafir yang memperbolehkan untuk berbuka. Ulama Fiqh sepakat musafir yang membolehkan berbuka adalah musafir yang jarak jauh. Namun mereka berbeda pendapat untuk menentukan batas jarak jauhnya. Dalam hal ini ada beberapa pendapat yaitu : 1. Menurut Imam Al-Auza’i Musafir yang memperbolehkan berbuka bagi orang yang berpuasa ialah musafir sejauh satu hari perjalanan. 2. Menurut Imam Syafi’i dan Imam Ahmad. Boleh berbuka puasa bagi orang musafir sejauh perjalanan dua hari dua malam dengan jalan kaki atau naik unta. 3. Menurut Imam Abu Hanifah dan Ats-Tsauri boleh berbuka bagi orang yang musafir sejauh perjalan tiga hari tiga malam. Keempat, bagi orang yang sakit dan musafir mana yang lebih baik puasa atau berbuka? Ulama Fiqh berpendapat berbuka itu hanyalah merupakan keringan (rukhsah) namun mereka berbeda pendapat mana yang lebih baik berbuka atau berpuasa. Dalam hal ni ada dua pendapat: 1.Menurut Imam Abu Hanifah,Imam Syafi’I dan Imam Malik. berpuasa lebih baik bagi yang kuat berpuas. Dan bagi yang tidak kuat atau tidak sanggup,berbuka lebih utama. 2. Pendapat Imam Ahmad bin Hanbal, berbuka lebih baik. Ini dalam rangka mengambil dan menikmati keringanan yang Allah SWT berikan terhadap-Nya.Sebab Allah juga suka jika segala yang diwajibkannya dikerjakan. Siksa bagi orang yang tidak berpuasa Jika seorang muslim tetapi dia tidak mau berpuasa Ramadhan sementara mencukupi syarat untuk berpuasa, namun ia tidak melaksanakannya, atau tanpa uzur yang diperbolehkan dalam hukum syara’ atau membatalkan puasanya alasan syara’ walaupun hanya satu hari, hukumnya adalah haram. Ia dianggap telah melakukan dosa besar dan kelak akan disiksa dengan siksa yang amat pedih di dalam neraka. Rasulullah SAW bersabda:”Barang siapa berbuka(tidak berpuasa)satu hari di bulan Ramadhan tanpa adanya uzur(alasan yang diperbolehkan syara’)tidak bisa diganti dengan puasa sepanjang tahun meskipun dilaksanakannya”.(HR IbnuHuzaimah,dari AbuHurairah). Dalam hadits lain,Rasulullah bersabda yang diriwayatkan oleh AbuYa’la Ad-Dailami,dan dishahihkan oleh Adz-Dzahabi dan Ibnu Abbas,bahwa Rasulullah SAW bersabda :”Sendi-sendi dan dasar-dasar islam itu ada tiga.barang siapa yang meninggalakan satu dari tiga itu,hukumnya kafir(Mantaraka wa hidataan min hunna fahuwa biha kaafirun),yaitu syahadat,shalat,puasa Ramadhan”(HR Abu Ya’la). Dengan demikian maka orang yang sengaja tidak puasa tanpa alasan yang diperbolehkan dalam hukum syara’ bisa menjadi kafir,solusi utama bagi orang yang tanpa uzur hanya bertaubat kepada Allah SWT, memohon ampunan-Nya dan ia menyesal dan merasa bersalah dan tidak akan mengulanginya pada hari-hari berikutnya dan berniat tidak akan mengulanginya pada bulan Ramadahan berikutnya. Wallahu a’lamu bissahawab


WASPADA Jumat 26 Juli 2013

Mimbar Jumat

C7

Lima Pesona Alquran Tak Mencium Bau Surga Berpikir 1000 Kali Bercerai (1) Dewasa ini, kasus-kasus penceraian di kalangan umat Islam meningkat dari tahun ke tahun jumlahnya kian banyak saja sehingga perlu upaya pembelajaran dalam berumah tangga, khususnya buat pasangan yang akan berumah tangga. Memutuskan berumah tangga, menikah, memang mudah. Namun mem-pertahankan dan membentuk keluarga sakinah, mawaddah dan warahmah tidak semudah yang diperkirakan pasangan baru menikah maupun yang sudah cukup lama menikah. Biasanya tahun-tahun pertama hingga tahun kelima merupakan batu ujian terberat. Jika setelah melewati usia lima tahun cobaan berumah tangga terasa semakin ringan karena kedua belah pihak (suami dan isteri) sudah saling mengenal kebiasaan dan karakter pasangannya. Suami mengalah jika isterinya marah atau sebaliknya isteri mengalah dan meminta maaf jika suaminya marah. Berbagai cara dan kajian dijalankan untuk menurunkan angka perceraian oleh pemerintah dan ulama, namun begitu angka perceraian tak kunjung turun. Terlebih di kalangan selebriti. (Dikutip dari kumpulan hadits shahih dan sumber lain).

Menikmati Hidangan Alquran Oleh Heri Firmansyah, SH.I, MA Kepala KUA Kec. Sirandorung Kab Tapanuli Tengah, Dosen STIT Hasiba Barus & Alumni PPMDH-TPI Medan: risyah83@gmail.com.

A

lquran sebagai kalam Allah yang mulia, meruTidak ada seorang pun dalam seribu lima pakan undang-undang ratus tahun ini telah memainkan ‘alat’ umat Islam. Kitab ini terjaga dari segala bentuk manipulasi dan bernada nyaring yang demikian mampu kerusakan zaman. Sesungguhnya Kami telah menurunkan dan berani, dan demikian luas getaran Adz-dzikr (Alquran) dan Kami jiwa yang diakibatkannya, seperti yang yang menjaganya. Q.S. al-Hijr: 9. Kita umat Islam, harus mengadi baca Muhammad Saw, yaitu Alquran. malkannya di dalam kehidupan sehari-hari. Langkah awal yang dapat kita lakukan adalah mampu untuk membaca perbuatan itu digambarkan sebagai sebuah dan mengkaji maknanya. Membaca Alquran adaperniagaan yang tidak akan pernah merugi, selah termasuk ibadah, mempelajarinya ibadah dan perti yang tercantum dalam surah Al-Fathir ayat mengamalkan ajaran-ajarannya merupakan ke29: “Sesungguhnya orang-orang yang selalu memwajiban bagi setiap muslim. Tentang keutamaan orbaca Kitab Allah dan mendirikan shalat dan meang yang mahir membaca Alquran, Rasulullah nafkahkan sebahagian dari rezki yang kami anumenyatakan “Adapun orang-orang yang pandai gerahkan kepada mereka dengan diam-diam dan membaca Alquran (dengan ilmu tajwid yang benar), terang-terangan, mereka itu mengharapkan permaka sesungguhnya kelak ia akan dikumpulkan di niagaan yang tidak akan merugi”. Dalam menafdalam surga bersama dengan para orang mulia yang sirkan surah Al-Mukmin 69, “Apakah kamu tidak banyak melakukan kebajikan”. ( H.R. Bukhari). melihat kepada orang-orang yang membantah Hal ini selaras dengan wahyu pertama Alquran ayat-ayat Allah? bagaimanakah mereka dapat yang diturunkan, yaitu Iqra’ bacalah. Menurut dipalingkan ?” ada mufassir yang menyatakan Quraish, Perintah membaca merupakan sesuatu termasuk bagian orang yang membantah adalah yang paling berharga yang pernah dan dapat orang yang tidak mau atau enggan diberikan kepada umat manusia. untuk membaca Alquran paMengulang-ngulang membaca dahal dia mampu untuk Alquran menimbulkan pemelakukannya. Bahkan nafsiran baru, pengembalebih jauh dinyatakan, jika ngan gagasan, dan menamsatu hari seseorang tidak bah kesucian jiwa serta mau membaca Alquran kesejahteraan batin. Memkarena kesibukan dan baca dalam aneka makpekerjaan-pekerjaannya nanya adalah syarat perkeduniawiyaannya, tama dan utama peberarti dia termasuk ngembangan ilmu pengemembantah ayat-ayat tahuan dan teknologi Alquran, karena dia serta pengembangan peberarti telah menolak radaban. Peradaban Ishidangan istimewa yang lam lahir dengan mundisediakan oleh Allah SWT. culnya Alquran. Dan peuntuknya. Siapapun, terleradaban itu akan tetap bih orang-orang yang berterus bertahan dan mekecimpung dalam dakwah nyokong kemashlahatan yang memberikan pencerakehidupan manusia, selahan agama bagi umat, jangan ma tetap terus dibaca, dipepernah melepaskan diri dari lajari, dimaknai dan diamalkan pembacaan Alquran. oleh setiap manusia, utamanya kaum muslimin. Quraish Shihab dalam bukunya wawasan AlRasulullah menyatakan “sebaik-baik orang di quran, dia menulis seorang orientalis H.A.R Gibb antara kamu adalah orang yang mau belajar dan meberpendapat “Tidak ada seorang pun dalam seribu ngajarkannya kepada orang lain”. Kita mempelajari lima ratus tahun ini telah memainkan ‘alat’ berAlquran jika kita belum mampu membacanya dan nada nyaring yang demikian mampu dan berani, karena itu kita mendapatkan predikat manusia terdan demikian luas getaran jiwa yang diakibatbaik, apa tah lagi jika kita mampu membaca Alquran kannya, seperti yang di baca Muhammad SAW, dan mengajarkannya kepada orang lain. yaitu Alquran. Demikian terpadu dalam Alquran, Gema kalam ilahiy jika di hayati secara baik, akan keindahan bahasa, ketelitian, dan keseimbanganmasuk ke dalam relung jiwa bagi orang yang beriman nya, dengan kedalaman makna, kekayaan dan dan menambah keyakinan mereka untuk senantiasa kebenarannya serta kemudahan pemahaman dan beriman kepada Allah SWT dan melakukan amal kekehebatan kesan yang ditimbulkannya. Hal ini bajikan. Hal ini sesuai dengan firman Allah SWT di membuktikan bahwa Alquran benar datang dari dalam Alquran surah al-Anfal ayat 2 : “Sesungguhnya Allah swt, Tuhan pencipta semesta alam. Firmanorang-orang yang beriman ialah mereka yang bila Nya “Katakanlah: “Sesungguhnya jika manusia disebut nama Allah gemetarlah hati mereka, dan dan jin berkumpul untuk membuat yang serupa apabila dibacakan ayat-ayat-Nya bertambahlah Al Quran ini, niscaya mereka tidak akan dapat iman mereka (karenanya), dan Hanya kepada membuat yang serupa dengan Dia, sekalipun Tuhanlah mereka bertawakkal.” Untuk itulah umat sebagian mereka menjadi pembantu bagi sebagian Islam di seluruh dunia ini tidak pernah merasakan yang lain”. [Q.S. Al-Isra’: 88]. kebosanan untuk terus membaca dan mempelajari Alquran adalah jamuan dan hidangan terinAlquran, bahkan jika dia telah berkali-kali khatam dah Allah SWT kepada umat Islam. Tentu merugi sekalipun. Malah yang ada adalah kesejukan hati, siapa yang tidak mau dan mencicipi hidangan ketenteraman jiwa, dan kebahagiaan yang tak dapat istimewa tersebut di dalam kehidupannya. Siapa dilukiskan kata-kata saat menikmati dan merasakan yang me-nikmati hidangan tersebut, dengan setiap bait pembacaan Alquran. Dalam surah al-Isra merutinkan pembacaannya setiap hari dengan ayat 82; “Dan Kami turunkan dari Al Qur’an suatu target-target pembacaan semisal satu hari satu juz yang menjadi penawar dan rahmat bagi orang-ordengan tiga puluh hari telah mengkhatamkannya ang yang beriman dan Al Qur’an itu tidaklah meatau target-target lainnya, tentu akan merasakan nambah kepada orang-orang yang zalim selain kerukedamaian jiwa, ketentraman rohani dan penawar gian. Dalam surah Yunus ayat 57 disebutkan: Hai mapenyakit hati. Ini semua hanya akan dapat dilanusia, Sesungguhnya Telah datang kepadamu pelakukan dan dirasakan oleh orang-orang yang berjaran dari Tuhanmu dan penyembuh bagi penyakitiman yang merutinkan bacaan dan kajiannya penyakit (yang berada) dalam dada dan petunjuk terhadap Alquran. Ya Allah berikanlah kami keserta rahmat bagi orang-orang yang beriman. berkahan de-ngan Alquran dan jadikan Alquran Bahkan orang-orang yang membaca Alquran sebagai pem-bawa cahaya, hidayah dan petundisamakan dengan orang yang gemar berinfak, dan juk bagi kehidupan kami.

Oleh Junaidi, M.Si Dosen UMSU Dan IAIN, Sekretaris Majelis Tarjih PDM Medan.

A

llah SWT berfirman dalam surat Albaqarah ayat 185 yang artinya: Bulan Ramadhan bulan yang di dalamnya diturunkan Alquran sebagai petunjuk bagi manusia dan penjelasan mengenai petunjuk itu dan pembeda antara yang hak dan yang bathil. Alquran adalah kitab suci yang memiliki pesona yang kalau digali, maka akan semakin banyak pesona yang terungkap. Dalam kamus bahasa Indonesia, pesona. Pesona Alquran berarti daya tarik yang terdapat dalam Alquran. Di antara pesona yang dimiliki Alquran adalah muncul dari sususan bahasanya. Susunan bahasa Alquran memiliki nilai seni yang tinggi dan indah. Keindahan tersebut dapat disaksikan pada kefasihan bahasa, diskripsi, penggunaan kata kiasan, dan penyampaian alur cerita. Dengan kata lain, keindahan Alquran terlihat pada pesona ayat, keserasian dan irama setiap susunan kalimat, keluwesan setiap kalimat dan kejelasan pesan yang disampaikannya. Di samping susunan bahasanya yang memesona, banyak lagi pesona yang dimiliki Alquran, di antaranya adalah: Pertama:Alquran mampu mencairkan hati yang keras. Pesona ini muncul karena memang susunan bahasa Alquran yang indah mampu menjadikan hati yang keras dan kasar menjadi lembut dan cair. Mungkin kita masih ingat bagaimana kisah masuk Islamnya Umar bin Khattab. Dalam beberapa literatur sejarah dipaparkan bahwa suatu hari Umar bin Khattab dengan pedang terhunus ingin menikam Rasulullah dengan para sahabatnya yang masih sedikit, yang sedang dibina Rasulullah di rumah Arqam bin Abil di Shafa. Di tengah jalan dia ditegur seseorang bahwa sebelum menindak orang lain lebih baik dia menyelesaikan urusan keluarganya sendiri terlebih dahulu. Orang itu menyampaikan kepada Umar bahwa adik kandungnya sendiri bersama suaminya telah menganut Islam menjadi pengikut Nabi Muhammad SAW. Umar lantas berbelok ke rumah adiknya, Fati-

mah, dan kebetulan sedang membaca Alquran. Dengan serta merta Umar menunjukkan kemarahannya dengan memukul adik dan iparnya sendiri. Kebetulan di tangan Fatimah ada lembaran Kitab Suci Alquran yang baru saja dibacanya. Umar merenung adiknya dan meminta supaya lembaran itu diberikan kepadanya. Tetapi Fatimah menolak dengan alasan “Anda adalah najis, yang haram menyentuh lembaran suci ini, jawab Fatimah. Karena rasa ingin tahunya sangat besar, maka dia mandi dan kemudian lembaran suci itu diberikan adiknya, Fatimah, kepada Umar kemudian membaca beberapa ayat dari surah Thaha, “Kami bukan menurunkan Alquran kepadamu untuk menyusahkan dirimu. Melainkan menjadi peringatan bagi orang yang takut Tuhannya. Dia turun dari dzat yang menciptakan bumi dan langit yang tinggi Ar-Rahman (Allah) itu bersemayam di atas singgasana ‘arsy. Kepunyaan-Nya segala apa yang ada di antara keduanya, dan apa-apa yang ada di bawah petala bumi. Jika engkau keraskan perkataan, Dia mengetahui apa yang dirahasiakan dan apa yang lebih tersembunyi. Allah, tidak ada tuhan kecuali Dia. Bagi-Nya ada beberapa nama yang indah.” Setelah membaca ayat tersebut hati Umar menjadi lembut dan tersentuh dengan ayat-ayat tersebut. Ia kemudian masuk Islam. Kedua: Alquran bisa mengangkat derajat seseorang. Pesona kedua ini tentunya bisa dirasakan untuk orang-orang yang senantiasa mempelajari Alquran, baik membacanya, menghafalnya dan lain-lain. Perhatikan hadis Rasulullah SAW riwayat imam Muslim yang artinya: Dari Amir bin Watsilah, dia menuturkan bahwa suatu ketika Nafi bin Abdul Harits bertemu dengan Umar di Usfan (sebuah wilayah diantara Mekah dan Madinah). Pada waktu itu Umar mengangkatnya sebagai gubernur Makkah. Maka Umar pun bertanya kepadanya, Siapakah yang kamu angkat sebagai pemimpin bagi para penduduk lembah?. Nafi menjawab, Ibnu Abza. Umar

Lima pesona Alquran tidak mungkin kita dapatkan, kalau kita hanya sekedar menjadikan Alquran sebagai pajangan di lemari, atau hanya sekedar membanggakan Alquran tapi tidak dipelajari dan diamalkan. kembali bertanya, Siapa itu Ibnu Abza?. Dia menjawab, Salah seorang bekas budak yang tinggal bersama kami. Umar bertanya, Apakah kamu mengangkat seorang bekas budak untuk memimpin mereka?. Maka NafiÕ menjawab, Dia adalah seorang yang menghafal Kitab Allah azza wa jalla dan ahli di bidang faraidh/waris.Umar pun berkata, Adapun Nabi kalian shallallahu alaihi wa sallam memang telah bersabda,Sesungguhnya Allah akan mengangkat dengan Kitab ini sebagian kaum dan dengannya pula Dia akan menghinakan sebagian kaum yang lain. Ketiga: Alquran akan menjadi penolong dan pembela para pembacanya. Hal ini berdasarkan hadts Nabi Muhammad SAW yang diriwayatkan oleh imam Muslim yang berasal dari Abu Umamah, yang artinya: Aku mendengar Rasulullah SAW bersabda, “Bacalah Alquran sesungguhnya ia akan datang di hari Kiamat menjadi syafaat (penolong) bagi pembacanya.” Perhatikan juga hadis Rasulullah riwayat Imam Muslim yang artinya: Dari Nawwas bin Sam’an ra. telah berkata: Aku mendengar Rasulullah saw. bersabda, “Di hari Akhirat kelak akan didatangkan Alquran dan orang yang membaca dan mengamalkannya, didahului dengan surat Albaqarah dan Surah Ali ‘Imran, kedua-duanya menjadi hujjah (pembela) orang yang membaca dan mengamalkannya.” Pesona ini bisa didapatkan karena orang yang membaca Alquran tidak akan tersesat. Sebagaimana ungkapan Ibnu Abbas Allah memberikan jaminan kepada siapa saja yang

membaca Alquran dan mengamalkan ajaran yang terkandung di dalamnya, bahwa dia tidak akan tersesat di dunia dan tidak celaka di akhirat. Keempat: Alquran menjadikan orang yang membacanya mendapat penghargaan. Perhatikan hadis Rasulullah SAW riwayat Bukhari yang artinya; Dari Jabir bin Abdullah ra. bahwasanya; Ketika Nabi Muhammad SAW. mengumpulkan dua mayat laki-laki di antara korban perang Uhud kemudian beliau bersabda, “Siapa di antara keduanya yang lebih banyak menghafal Alquran?” Dan ketika ditunjuk salah satunya beliau mendahulukannya untuk dimasukkan ke dalam liang lahad. Kelima: Alquran bisa mengantarkan seseorang menjadi yang paling baik. Hal ini berdasarkan hadis Rasulullah SAW yang diriwayatkan imam Bukhari yang artinya: Dari Usman bin ‘Affan ra. telah berkata: Rasulullah SAW bersabda, “Sebaikbaik manusia di antara kamu adalah orang yang mempelajari Alquran dan mengajarkannya.” Penutup Lima pesona Alquran sebagaimana disajikan di atas tidak mungkin kita dapatkan, kalau kita hanya sekedar menjadikan Alquran sebagai pajangan di lemari, atau hanya sekedar membanggakan Alquran tapi tidak dipelajari dan diamalkan. Mudah-mudahan Ramadhan 1434H ini bisa menjadikan cemeti bagi kita untuk lebih giat lagi mempelajari dan mengamalkan Alquran. Sehingga lima pesona tersebut dapat kita gapai. Wallahu Alam.

Shalat Tahajjud Sesudah Taraweh? Oleh dr Arifin S.Siregar Dokter Spesialis Kulit Dan Kelamin

S

halat malam, shalat Taraweh, shalat Tahajjud, apakah berbeda? Hal ini perlu dikaji, meskipun sifatnya sunat. Namun bila pemahamannya salah, berakibat salah pengamalan, akan menimbulkan dosa. Adalah ketetapan kaifiyat shalat sunat dengan shalat fardhu sama saja. Salah kaifiyat, tidak sah shalat dan menimbulkan dosa, karena melanggar ajaran (petunjuk) Rasul-Nya Muhammad SAW. Adapun bedanya hanya, shalat fardhu bila dikerjakan (sesuai petunjuk Nabi SAW) akan berpahala, tidak dikerjakan akan berdosa. Sedangkan shalat sunat (Taraweh) dikerjakan berpahala, tidak dikerjakan tidak berdosa. Tapi bila hendak dikerjakan, kerjakanlah yang benar sesuai petunjuk Nabi SAW. Jadi walaupun namanya shalat sunat Taraweh, ikuti petunjuk Nabi SAW. Nama shalat Taraweh tidak dikenal dimasa Nabi SAW dan sahabat. Di masa itu namanya shalat malam (shalatul Lail/qiyamul lail), tapi belakangan kita nama-kan shalat Taraweh. Karena shalat malam itu di masa Nabi SAW dan sahabat, pengamalannya santai (tarwiyah), ayat-nya panjang, gerakannya tenang, tidak terburuburu, sehingga bisa sampai tiga jam. Maka karena santainya itu, kita sebut shalat Taraweh (shalat santai). Namun kalau kita kerjakan, terburu-buru, maka tidak sesuai dengan pemberian nama Taraweh itu. Nama shalat Taraweh itu tidak dikenal dulu, coba periksa semua Hadis dan atsar tidak ada berbunyi shalat Taraweh, tapi shalatul lail. Beda Shalat Tahajjud Dengan Taraweh Shalat Taraweh rujukan perta-ma adalah HR. Bukhari dan Muslim berbunyi : “Dari Abi Salamah bin Abdurrahman bahwasanya ia bertanya kepada Aisyah RA tentang shalat Rasulullah SAW di bulan Ramadhan. Maka ia menjawab: Tidak pernah Rasulullah SAW kerjakan (tatawwu’) di bulan Ramadhan dan tidak pula di luar Ramadhan, lebih dari 11 (sebelas) rakaat, yaitu ia shalat (4 rakaat), jangan engkau tanya tentang bagus dan panjangnya, kemudian ia shalat 4 (rakaat), jangan engkau tanya panjang dan bagusnya, kemudian ia shalat 3 rakaat”. Rujukan kedua: Dari Muhammad bin Yusuf dari as-Saaib bin Yazid bahwasanya ia berkata: Umar RA telah memerintahkan

Ubay bin Ka’ab dan Tamim adDaary meng-imami orang-orang dengan 11 (sebelas) raka’at. Ia berkata : Imam pada waktu membaca ratusan ayat, sehingga kami bersandar dengan tongkat karena lamanya berdiri, dan kami tidak selesai kecuali menjelang fajar. (H.R Malik-al Muwath-tha’ 1 : 137138). Inilah rujukan yang sahih untuk shalat Taraweh 11 rakaat. Kemudian timbul pertanyaan, shalat Tahajjud apa rujukannya? Jawabnya: Shalat Taraweh dengan shalat Tahajjud adalah sama, yaitu sama-sama shalat malam. Rujukannya sama, kaifiyatnya sama. Bedanya hanya dalam waktu pengamalannya. Hal ini diutarakan oleh Hadis (HR. Ahmad, Abu Daud, Hakim, Syarah Muslim); berbunyi: dari Jabir RA bahwa Rasulullah SAW bersabda kepada Abu bakar: “Bilakah engkau berWitir?” Abu Bakar menjawab: Pada permulaan malam sesudah shalat Isya. Beliau Nabi SAW lalu bersabda kepada Umar: Engkau Umar, bilakah berWitir? Umar menjawab: Pada akhir malam. Kemudian Rasulullah SAW bersabda: “Engkau ini wahai Abu Bakar suka berlaku hati-hati, sedang engkau wahai Umar menunjukkan keteguhanmu”. (Di-riwayatkan oleh Ahmad, Abu Daud, Hakim). Jadi shalat malam Abu Bakar RA adalah setelah selesai shalat fardhu Isya. Dan shalat malam Umar RA adalah setelah tidur (kira-kira pukul 2 malam sampai waktu Subuh). Kenapa disebut shalat Tahajjud ? Jawabnya: rujukannya QS AlIsra’ 79, Allah berfirman yang artinya: “Dan pada sebagian malam hendaklah kamu shalat Tahajjud (shalat sesudah tidur), sebagai ibadah sunnah (tambahan) bagimu. Mudah-mudahan (dengan shalat Tahajjud itu), Tuhan mengangkat engkau ke tempat terpuji”. Kemudian QS Al-Muzzamil: “Sesungguhnya beribadat malam hari lebih khusuk dan bacaan waktu itu lebih berkesan”. Lagi pula bila shalat Taraweh berbeda dengan shalat Tahajjud, mana rujukan kaifiyat shalat Tahajjud? Kemudian Nabi mengatakan: tidak boleh dua Witir dalam satu malam, bila Taraweh punya Witir dan Tahajjud punya Witir. Variasi Mengerjakan Shalat Taraweh Cara pertama dilakukan empat rakaat diakhiri salam. Disambung

Bila shalat Taraweh berbeda dengan shalat Tahajjud, mana rujukan kaifiyat shalat Tahajjud? Kemudian Nabi mengatakan: tidak boleh dua Witir dalam satu malam, bila Taraweh punya Witir dan Tahajjud punya Witir. empat rakaat dan diakhiri salam. Disambung Witir 3 rakaat dan salam. (Rujukannya H.R Muslim di atas). Cara kedua dlakukan dua rakaat salam, dua rakaat salam dua rakaat salam, dua rakaat salam dan diakhiri dengan Witir tiga rakaat dengan satu salam. Bolehnya dengan dua rakaat lalu salam, sesuai riwayat berbunyi; Rasulullah SAW bersabda : “Shalat malam itu dua dua rakaat. Tetapi sekiranya takut terburu masuknya shalat Subuh, maka berWitir saja satu rakaat yaitu untuk meWitir rakaat-rakaat yang dilakukan”. Cara ketiga ada orang melakukan shalat Taraweh 8 rakaat di masjid, lalu disambungnya dengan tiga rakaat Witir di rumah— apakah sebelum tidur atau sesudah tidur. Cara keempat shalat Taraweh dilakukan maksimal 11 rakaat atau bila terburu-buru waktu maka cukup lakukan minimal satu rakaat (Witir). Cara kelima bila waktu terdesak bisa dua rakaat atau satu saja (Witir). Cara keenam Witir bisa satu rakaat saja, tiga rakaat saja, lima rakaat saja, tujuh rakaat saja, bisa Sembilan rakaat saja, bisa 11 rakaat. Semua dengan sekali salam. (Rujukannya: H.R Turmudzi: “Diriwayatkan dari Nabi SAW, bahwa beliau berWitir 11 rakaat, sembilan, tujuh, lima, tiga atau 1 rakaat saja”). Cara ketujuh cara yang salah bila dilakukan: empat rakaat disambung empat rakaat diakhiri dengan Witir satu rakaat atau empat rakaat dengan Witir tiga rakaat atau satu rakaat. Timbul pertanyaan apakah shalat Taraweh hanya 11 rakaat ? Memang selain 11 rakaat shalat Taraweh, di kalangan umat Islam ada juga yang 23 rakaat, 26 rakaat, 28 rakaat, 36,40,70 rakaat. Rujukan ang-kaangka itu adalah ijtihad dari ulama. Shalat Taraweh yang lebih dari 11 rakaat tapi rujukannya dikaitkan Umar bin Khattab dengan 23 rakaat, semua atsarnya lemah, palsu (lihat: kitab “Kelemahan Riwayat

Taraweh 20 Rakaat” oleh Syeikh Nasiruddin Albani). Berpedomanlah pada QS An-Nisa’ 80 Allah berfirman yang artinya: “Barang siapa yang mengikut Rasul (Muhammad) berarti ia telah mentaati Allah SWT”. Bila shalat malam (shalat Taraweh) itu, ada yang mengatakan tidak ada batasan rakaatnya, maka ditanya : “kenapa ditetapkan 23 rakaat?” Seharusnya setiap malam rakaatnya bebas ber-variasi, 11, 23, 26, dan sterusnya. Menetapkan tetap 23 rakaat itu adalah hak Nabi SAW sebagai pencipta ibadah (shalat) sekaligus kaifiyatnya. Tidak ada hak ulama mengubah ibadah. Rujukannya: “Shallu kama roatumuni ushalli = Shalatlah kamu seperti kamu melihat aku shalat”. Shalat Taraweh Di Luar Ramadhan? Rujukannya HR. Bukhari dan H.R Muslim: Dari Abi Salamah bin Abdurrahman bahwasanya ia bertanya kepada Aisyah RA tentang shalat Rasulullah SAW di bulan Ramadhan. Maka ia menjawab : “Tidak pernah Rasulullah SAW kerjakan di bulan Ramadhan dan tidak pula di luar Ramadhan lebih dari 11 rakaat”. Kemudian pertanyaan apakah shalat Witir itu harus satu salam ? Benar shalat Witir hanya satu salam. Rujukannya; “Bahwasanya Rasulullah SAW itu juga berWitir 7 atau 5 rakaat bersambungan, tidak dipisahkan dengan salam atau bicara”. (Diriwayatkan oleh Ahmad, Nasa’i dan Ibnu Majah dengan sanad yang baik). Kesimpulan Shalat malam, shalat Taraweh, shalat Tahajjud, dan Qiyamul Ramadhan adalah satu bentuk shalat malam yang sifatnya sunat, yang hanya namanya berbeda. Bila sudah shalat malam atau Taraweh, jangan shalat Tahajjud lagi, karena Taraweh adalah shalat Tahajjud, bedanya shalat Tahajjud dilakukan sesudah tidur. Shalat Taraweh (shalat malam) dilakukan maksimal 11 rakaat atau bila terburu-buru waktu, lakukan minimal satu rakaat (Witir) saja.


Mimbar Jumat

C8

WASPADA Jum’at 26 Juli 2013

Maryam Jamilah, Penulis Wanita Terkenal Di Dunia Islam Maryam Jamilah dilahirkan di Westchester, NewYork, pada tahun 1934. Ia dilahirkan dengan nama Margret Marcus.Waktu kecil ia mempunyai nama panggilan Peggy. Gadis yang berasal dari satu keluarga Yahudi bermukim di New York ini memang lain dari para gadis seusianya. Demi memuasi dahaganya akan kebenaran hidup, sejak masa-masa remaja ia telah sekian kali berpindah dari satu pusat kerohanian ke pusat kerohanian lainnya. Dari yang sepenuhnya bersifat keagamaan hingga tak kurang dari yang bersifat agnostik atau ateistik. Ketertarikan Margret pada Islam dimulai ketika ia berumur 10 tahun. Pada umur itu, ia mengikuti Sekolah Minggu yang diadakan oleh seorang Yahudi Reformis.Ia sangat terkagum-kagum dengan hubungan sejarah antara ArabYahudi. Dari buku-buku teks Yahudi, Margret mempelajari bahwa Ibrahim adalah nenek moyang bangsa Arab sekaligus bangsa Yahudi. Margret membaca buku-buku sejarah pada abad pertengahan, di Eropa, umat Kristen tidak mempunyai toleransi terhadap orangorangYahudi. Orang-orang Kristen juga menyiksa, membunuh bahkan membantai umat Yahudi. Hal ini sangat berbeda dengan yang terjadi di negara Islam Spanyol (Andalusia) kala itu. Di sana umat Islam sangat toleransi dengan berbagai agama. Toleransi kaum muslimin sangat mengagumkan dalam sejarah. Orang-orang Yahudi boleh bekerja, bebas dalam perdagangan atau bahkan di jajaran pemerintahan. Di mata Peggy kecil, ini adalah keluhuran budi dan peradaban yang tinggi. Dalam sejarah diketahui bahwa peradaban Islam mengalami kejayaan tertinggi pada masa negara Islam Andalusia yaitu Spanyol sekarang. Kenyataan ini membuat Margret terkagum-kagum pada Islam. Margret berfikir bahwaYahudi datang ke Palestina untuk memperkuat ikatan keluarga mereka dengan sepupu dekatnya sesama Semit yaitu bangsa Arab. Hal ini

Ia melihat kecurangan-kecurangan PBB yang disogok gerakan zionisme melalui lobi Yahudi Amerika. Margret menjadi sangat malu sebagai orang Yahudi. wajar malahan bagus, menurut Margret, karena mereka keluarga dekat dalam agama dan budaya. Margret meyakini bahwa Yahudi dan Arab akan bekerjasama guna mencapai masa kejayaan yang berikut seperti yang terjadi di negara Islam Andalusia. Masa kejayaan kedua peradaban itu menurut keyakinan Margret akan diwujudkan di Timur Tengah. Kemudian terjadilah pembantaian besar-besaran terhadap Yahudi oleh Nazi Jerman. Margret terkejut dan sangat marah ketika tak seorang pun anggota masyarakat Yahudi bereaksi terhadap pembantaian itu. Menurut keyakinan Margret, masalah persaudaraan Yahudi adalah masalah agama yang sangat penting. Ternyata tak ada orang Yahudi yang peduli dengan tragedi kemanusiaan itu. Sejalan dengan kedewasaan dan kematangan Margret secara intelektual, ia mulai tidak puas dengan kelompok ateis yang dimasukinya. Margret merasa ada sesuatu yang kurang. Wanita ini kembali mencari identitas diri. Ia pun memasuki kelompok Baha’iyah atau Baha’i di New York. Karena kecewa, kemudian Margret keluar dari kelompok Baha’i . Kemudian Margret menjadi anggota cabang gerakan keagamaan zionis remaja. Gerakan ini dikenal dengan nama Mizrachi Hatzair. Beberapa bulan kemudian ketika Margret mengetahui seperti apa zionisme sebenarnya, Margret keluar dengan muak dan jijik. Selama ini Margret menyangka bahwa zionisme adalah gerakan persaudaraan dan kerja sama Arab-Yahudi menjadi kecewa. Ia akhirnya mengetahui borok zionisme yang hanya membuat-buat dan mencari-cari permusuhan serta peperangan dengan bangsa Arab. Pada umur 20 tahun Margret kuliah di Universitas New York. Salah satu mata kuliahnya adalah “Judaisme in Islam” (Ajaran Yahudi dalam Islam). Dosen Margret, Rabbi

Abraham Issac Katsh, ketua jurusan studi-studi Hebrew sering meyakinkan mahasiswanya bahwa Islam mencontek dariYahudi. Buku teks di kuliah itu ditulis oleh sang dosen dengan judul ‘Took each verse from the Qur’an’ menyatakan tanpa bukti bahwa ayat-ayat Qur’an bersumber dari ajaran-ajaran Yahudi. Meskipun maksud Profesor Katsh sebenarnya ingin membuktikan kepada mahasiswa superioritas Yahudi atas Islam, Margret malah menjadi yakin akan hal yang sebaliknya. Justru Islam dan Yahudi bersumber dari Tuhan yang sama. Tapi karena Islam lahir belakangan, maka ia merevisi ajaran-ajaranYahudi. OrangYahudilah yang harus mengikuti Islam, begitu menurut Margret. Usaha-usaha zionisme yang menyuruh orang-orang Yahudi berimigrasi ke Palestina adalah kolusi antara kekuatan politik dengan pengusaha-pengusaha real estate, demikian dalam benak Margret. Tidak ada landasannya dalam kitab Talmud. Kalaupun ada, itu adalah distorsi disebabkan kolusi. Menurut Margret, fusi antara nasionalisme Yahudi dengan agama ternyata malah memiskinkan orang-orang Yahudi secara spiritual. Melihat ketidakadilan yang dilakukan PBB dalam mengatasi hubungan Arab-Yahudi di Palestina, Margret menjadi tambah tidak yakin dengan agama Yahudi. Ia tidak betah dan tidak kuat lagi mengaku sebagai orangYahudi. Ia melihat kecurangankecurangan PBB yang disogok gerakan zionisme melalui lobi Yahudi Amerika. Margret menjadi sangat malu sebagai orang Yahudi. Semakin Margret mengikuti kuliah Profesor Katsh, semakin Margret tidak meyakini agamanya. Apalagi sudah beberapa bulan Margret membaca Alquran dan Hadits. Margret membandingkan Alquran dengan Talmud. Ia merasa Alquran lebih sempurna, logis dan argumentatif dibanding Talmud. Pada November 1954, Margret

Maryam Jamilah masuk Islam. Keluarga Margret menghalang-halangi keinginannya masuk Islam. Dengan banyak argumen mereka menyuruh Margret keluar dari Islam. Keluarganya memperingatkan bahwa Islam akan menyulitkan hidup Margret. Mereka berpendapat bahwa Islam tidak seperti Yahudi dan Kristen yang menjadi bagian sejak Amerika berdiri. Orangtua Margret mengatakan bahwa Islam akan membuatnya terasing. Jauh dari keluarga dan terisolasi dari masyarakat. Pada masa itu keyakinan Margret

akan Islam belum terlalu kuat. Ia pun tidak tahan terhadap tekanan-tekanan dari keluarga dan masyarakat sekitarnya. Sebagai hasil dari kekacauan dalam diri Margret, jiwa dan pikirannya terganggu. Ia pun harus DO dari kuliahnya. Selama dua tahun Margret tinggal di rumah di bawah perawatan medis. Tetapi kesehatan jiwanya semakin memburuk. Dalam keputusasaan sejak tahun 1957-1959 orang tua Margret memasukkan Margret ke rumah sakit jiwa. Margret berjanji apabila ia benar-benar

sembuh akan memeluk Islam dengan seyakin-yakinnya. Pada tahun 1961 di usianya yang ke-27, Margret masuk Islam lagi. Ia bersyahadat disaksikan oleh Syekh Daud Ahmad Faisal dan berganti nama menjadi Maryam Jamilah. Maryam juga mulai menulis banyak artikel untuk pers Islam di Amerika. Sebelum berkenalan dengan tokoh-tokoh Islam Maryam selalu menderita. Penderitaan wanita ini baru berakhir ketika ia berkenalan dengan Sayyid Abul A’la al-Maududi, seorang ulama besar Pakistan. Mulai dari surat-menyurat yang mengharukan antara seorang bapak dengan putrinya, antara seorang muslimah intelektual dengan ulama besar yang ternyata bersesuaian pendapat ini akhirnya jadilah gadis ini seorang Maryam Jamilah yang tegar. Ternyata sebelum mengemukakan pendapat mereka masingmasing, cara berpikir kedua cendikiawan ini sudah sama. Berkat ketekunan, semangatnya dan hidayah Allah SWT, nama Maryam Jamilah telah bisa disejajarkan dengan ilmuan dan cendikiawan terkemuka di dunia Islam seperti sahabat-sahabat Jamilah sesama muallaf lain yaitu Marmaduke Pickthall, Muhammad Asad dan T.B. Irving. Sebelum masuk Islam Maryam sudah merasa bahwa integritas keagamaan di dunia kontemporer mempunyai ancaman yang sangat besar. Ancaman ini disebut gerakan modernisasi Barat. Gerakan ini bermaksud mencampur pengajaran agama dengan reformasi dan filsafat buatan manusia. Ketika masuk Islam lagi Maryam terkejut pula melihat kenyataan bahwa banyak sarjana muslim didikan Barat yang raguragu dengan ajaran Islam. Maryam Jamilah ingin memerangi ini melalui tulisan. Abul A’la alMaududi sangat mendukung rencana Maryam ini. Maryam menulis banyak artikel di majalah The Islamic Review dan The Muslim Digest. Di antara artikel itu terdapat tulisan berjudul “Sebuah kritikan terhadap buku Islam in Modern History” (buku itu dikarang oleh Wilfred Cantwell Smith). Artikel lain berjudul “Kritik terhadap buku Reinterpretation of

Spirit Puasa Membangun Etos Kerja

Cermin Kejujuran

Oleh Watni Marpaung

Oleh Buya KH. Amiruddin MS

Ketua Divisi Litbang Forum Kajian Islam Dan Masyarakat (FKIM)

Penulis adalah pendiri Majelis Zikir Tazkira Sumatera Utara

R

bukan Ramadhan disebabkan karena faktor iman dan amadhan merupakan bulan yang penuh tingkat kesungguhan dalam beribadah kepada Allah. berkah dan ampunan sehingga selalu dijadikan Di antara tradisi yang terjadi di negara tercinta ini momen yang tepat untuk mendekatkan diri adalah peliburan anak sekolah atau perguruan-perkepada Allah. Hampir tidak ada waktu yang terlewatkan guruan tinggi. Sedangkan dari sisi waktu berapa banyak kecuali hanya untuk memperbanyak ibadah dalam haripelajaran dan ilmu pengetahuan yang dapat digali hari Ramadhan. Bahkan tidak sedikit orang yang seandainya Ramadhan tetap melakukan aktivitas menyedikitkan tidur pada malam hari hanya untuk belajar seperti biasa. menghidupkan malam-malam Ramadhan dengan Belum lagi kita lihat pengurangan jadwal yang penuh hikmat dan syahdu. dilakukan instansi pemerintah atau swasta terhadap Demikianlah mereka yang melihat dan menjadikan jam kerja maupun selesai kerja. Jam kerja yang biasanya Ramadhan sebagai medan untuk meningkatkan akan diperlambat setengah atau satu jam dan demikian kualitas diri dan ibadah kepada Allah. Sehingga juga pada jam selesai kerja. Ini satu bukti yang mekehadiran Ramadhan memberikan dampak positif nunjukkan bahwa etos kerja umat Islam melemah atau kepada mereka dalam meningkatkan kuantitas serta menurun, padahal sejatinya agama menuntut tidak kualitas ibadah kepada Allah. seperti demikian. Namun, bagi sebahaMemang beribadah gian yang lain tidak deTerkadang menjadikan Rama- di bulan Ramadhan samikian. Mereka tidak mengat dianjurkan sampai rasa gembira dengan dadhan sebagai alasan dan dalih pada malam harinya. Natangnya Ramadhan. Katidak dengan alasan rena Ramadhan menguntuk kepentingan tertentu yang mun, itu pula melemah pada halangi mereka untuk sifatnya negatif. Misalnya untuk bidang etos kerja kita semerokok, sarapan pagi, Padahal yang makan dan minum setidak bekerja tepat waktu, le- hari-hari. diinginkan dari semakin suka hati dan lain sebabanyaknya latihan ibagainya. Bahkan tidak semah, tidak bersemangat. dah di bulan Ramadhan dikit pula yang menjadisebagai spirit dan motivakan Ramadhan sebagai si untuk lebih giat dan serius dalam aktivitas yang lainnya. dalih untuk tidak melakukan sesuatu yang semestinya Selain itu, pada hakikatnya Ramadhan merupakan dilakukan pada saat di luar Ramadhan. Sehingga bulan yang mendidik umat Islam agar menjadi manusia terkadang menjadikan Ramadhan sebagai alasan dan yang produktif dan punya semangat kerja yang tinggi. dalih untuk kepentingan tertentu yang sifatnya negatif. Apabila kita lihat hasil karya para ulama-ulama Misalnya untuk tidak bekerja tepat waktu, lemah, tidak terdahulu banyak di antara mereka yang menghasilkan bersemangat dalam bekerja, semangat belajar mekarya-karya berupa kitab-kitab dalam berbagai bidang nurun, dan sebagainya. keilmuan seperti tafsir, fikih, tauhid, dan lain sebagainya Dengan kata lain, terjadi fenomena penurunan etos diselesaikan pada bulan Ramadhan. Padahal setiap satu kerja di dalam segala dimensi kehidupan. Fenomena disiplin ilmu karangan mereka mencapai puluhan jilid seperti ini menjadi sebuah pemandangan kita keseharian atau volume buku. pada bulan Ramadhan. Jika demikian, apakah sebenarnya Dengan kata lain, ada sebuah spirit yang puasa menjadikan penurunan etos kerja?. mendorong para ulama untuk menyelesaikan karyaApabila kita lihat sejarah Rasulullah dan para karya mereka monumental pada bulan Ramadhan. sahabatnya pada peristiwa perang Badar merupakan Bahkan, hasil yang mereka dapatkan sangat luar biasa suatu peristiwa yang luar biasa. Padahal jumlah umat bagusnya hebatnya jika dibanding dengan hasil-hasil Islam dibanding kafir Quraisy sangat tidak seimbang karya modern belakangan ini. antara tiga ratus orang melawan hampir seribu orang Oleh karena itu, tidak sedikit kita mengetahui di antakafir Quraisy. Belum lagi dengan kondisi padang pasir ra para ulama klasik melakukan puasa-puasa sunat seyang begitu panasnya, paling tidak mengeringkan daperti puasa senin-kamis, puasa Daud dan lain sebagainya. haga dan menguras tenaga. Tetapi umat Islam dapat Jadi, tradisi puasa yang disyariatkan bagi umat Islam memenangkan peperangan itu dengan gemilang. adalah spirit yang kuat dalam meningkatkan etos kerja. Ironisnya, bahwa kondisi umat Islam pada waktu itu Sebab tingkat konsentrasi dan kesungguhan akan lebih sedang melaksanakan puasa Ramadhan. bertambah terlebih keberkahan yang diberikan Allah. Secara rasional kita akan berfikir bahwa puasa akan Dengan demikian, umat Islam harus dapat medapat melemahkan fisik dan menguras tenaga. Namun mahami Ramadhan sebagai upaya untuk menjakarena sprit (semangat) yang membara dan panggilan dikan kita sebagai orang yang profesional dan disipiman untuk berjihad sehingga puasa yang dilaksanakan lin dalam berbagai bidang yang sedang kita geluti. menjadi sebuah pendorong yang kuat dalam berperang Karena fenomena di tengah-tengah masyarakat cenuntuk mencapai kemenangan. derung Ramadhan menjadi alasan dan dalih untuk Bercermin dari sejarah di atas ternyata puasa butidak menjadi orang yang produktif dan kreatif. kanlah menjadi suatu alasan bagi umat Islam untuk Penutup mengurangi etos kerjanya dibanding dengan hari-hari Ramadhan dijadikan Allah bagi umat Islam adalah biasa di luar Ramadhan. Oleh sebab itu, umat Islam harus sebagai ladang untuk beramal saleh. Maka umat Islam dapat menyadari bahwa puasa sebagai suatu peluang harus mampu memanfaatkannya dengan sebaik-baik yang berharga diberikan Allah untuk melihat siapa yang mungkin agar kiranya dapat keluar menjadi orang yang akan keluar menjadi pemenang setelah selesai Ramamuttaqin. Tetapi menjadi suatu hal yang keliru jika etos dhan sekaligus dapat eksis bertahan dalam iman. Jadi, kerja keseharian berkurang atau menurun dibanding bukan memahaminya sebagai suatu perintah yang memdengan hari-hari di luar Ramadhan. Pada Ramadhan ini beratkan apalagi menyusahkan umat manusia. diharapkan tingkat semangat dan praktek beribadah seApabila kita lihat lebih jauh bahwa persoalan adanya makin tinggi dengan tanpa mengurangi tingkat etos kerja. kecenderungan melemahnya etos kerja umat Islam pada

S

alah satu akhlak terpuji yang dijelaskan dalam Islam adalah sikap jujur, termasuk terhadap diri sendiri. Kejujuran ini menuntut keberanian yang maksimal, karena tidak semua orang mampu melakukannya. Karena itu, Rasulullah menyebutnya sebagai jihaadun nafs (jihad melawan diri sendiri). Menyebutkan diri memiliki berbagai kelebihan, tentulah sangat mudah dibandingkan dengan menyebutkan kelemahan diri sendiri. Syair yang didendangkan seniman alam, Ebiet G. Ade, “Kita mesti telanjang dan benar-benar bersih. Suci lahir dan di dalam batin…,” mengisyaratkan kepada kita untuk berkata apa adanya, dan tidak ada yang harus ditutup-tutupi. Kecerdasan dan kekesatriaan seseorang bukan terletak pada kemampuannya menyusun strategi agar noda hitam dirinya tertutupi, melainkan terletak pada sikap bijak dan berani mengatakan diri apa adanya dan seperti apa. Mencari Alasan Jujur bermakna keselarasan antara berita dengan kenyataan yang ada. Jadi, kalau suatu berita sesuai dengan keadaan yang ada, maka dikatakan benar/jujur, tetapi kalau tidak, maka dikatakan dusta. Kejujuran itu ada pada ucapan, juga ada pada perbuatan, sebagaimana seorang yang melakukan suatu perbuatan, tentu sesuai dengan yang ada pada batinnya. Ada sebuah kisah jenaka tentang serigala yang kehausan. Satu ketika, ia mendengar ada sebuah kebun anggur yang siap untuk dipanen. Rasa haus yang mencekik menyebabkan ia berjalan lebih cepat mencapai tempat tujuan. Di tengah jalan ia bertemu banyak binatang yang menanyakan kemana ia pergi. Serigala itu menjelaskan dengan penuh semangat bahwa ia akan menikmati buah anggur yang lezat. Sesampainya di kebun tersebut, tanpa basa basi, ia meraih buah anggur yang bergelantungan beberapa kali. Setiap ia ingin meraihnya, setiap itu pula ia jatuh. Begitu seterusnya. Akhirnya, ia merasa jenuh dan letih. Ia pun putus asa dan meninggalkan kebun anggur itu. Beberapa binatang lain mena-

nyakan kepadanya bagaimana rasa anggur yang baru ia rasakan, sebab mereka juga akan menuju ke sana. Tanpa berpikir panjang serigala itu menjawab, “Anggurnya pahit dan masam.” Padahal bukannya anggur itu yang pahit dan masam, tapi karena ketidakmampuan serigala itu untuk meraihnya. Untuk menutupi kelemahan dan kekurangan dirinya, ia menjelek-jelekkan buah anggur itu. Demikianlah, kita selalu saja menemukan orang yang berjubah apologi. Kesalahan dan kelemahan pribadinya ditutupi dengan cara menyalahkan keadaan, persis seperti serigala tersebut. Sikap seperti ini tidak akan mendewasakan seseorang, melainkan hanya melahirkan manusia-manusia yang berjiwa kerdil (timid soul). Rasulullah menjelaskan kepada para sahabat, bahwa agama itu adalah kejujuran. Jika kejujuran tidak ada, maka rasa saling curiga akan menerpa. Pada akhirnya kekacauan sosial (chaos) akan muncul pula. Kejujuran adalah keberanian. Tidak ada kejujuran tanpa keberanian. Hanya petarung-petarung sejatilah yang siap bergelut dengan kejujuran itu. Sementara itu, para pecundang lebih memilih menampilkan sosok mempesona, padahal di dalam dirinya terpendam berbagai kebohongan yang besar. Filsafat hidupnya menyerupai buah kedondong, luarnya halus namun dalamnya berserabut. Banyak kenyataan pahit yang merupakan bukti kasat mata betapa sebuah kejujuran amat mahal dan langka di negeri ini. Ketidak jujuran sudah menjadi budaya tersendiri. Ketika hal tersebut kerap terjadi, maka ketidakjujuran merupakan sesuatu yang ma’ruf (dikenal/ dianggap biasa). Jika orang jujur, ia dianggap sesuatu yang aneh. Jika seseorang tidak jujur, maka hal itu dianggap lumrah. Lihatlah bencana kemanusiaan akibat tragedi lumpur Lapindo, kasus Bank Century yang merugikan uang negara dalam jumlah yang amat besar, istana megah yang dibangun di beberapa rumah tahanan dan sebagainya, adalah beberapa kasus

Islam” berisi kritikan atas bu-ku karangan Asaf A. Fyzee (wakil rek-tor Universitas Kashmir). Buku ini berbicara tentang Islam yang diungkapkan menjadi etika kosong yang tidak memberi dampak kepada pembentukan masyarakat dan kebudayaan (terbit tahun 1960). Sama seperti Maududi, Maryam juga mengkritik sosiolog Turki Ziya Gokalp yang mengatakan nasionalisme dan sekularisme cocok dengan Islam. Maryam juga membantah pendapat Sir Sayyid Ahmad Khan yang sangat mengagung-agungkan ilmu pengetahuan dan filsafat Eropa. Ia juga mengkritik para pembaru Mesir seperti Muhammad Abduh dan Taha Husain. Maryam menentang pula Presiden Tunisia Habib Bourguiba (memerintah 1957-1987). yang menyatakan bahwa puasa Ramadhan merupakan penghalang pembangunan ekonomi Tunisia. Pada tahun 1962, atas tawaran Al-Maududi, Maryam pindah ke Pakistan dan menetap di Lahore sebagai anggota keluarga AlMaududi. Setahun kemudian ia menikah dengan Yusuf Khan, seorang pengurus harian Jami’at Islami, gerakan Islam yang didirikan Maududi pada tahun 1941. Maryam Jamilah adalah penulis wanita terkenal di dunia Islam dan meruapakan salah satu dari dua wanita yang namanya tercatat dalam buku berjudul‘100 Great Muslim Leaders of the 20th Century’ yang terbit tahun 2005. Maryam menulis lebih 30 judul buku yang sekaligus digunakannya sebagai media penyaluran aspirasinya untuk mengkritik sekularisme, materialisme, modernisme dan Barat. Para pakar menyebutnya sebagai wanita terke-nal yang menyuarakan ider-ide konservatif dan fundamentalisme Islam. Buku karangannya diterjemahkan dalam berbagai bahasa termasuk Bengali, Persia, Turki dan Urdu. Buku Maryam yang sudah diterjermahkan ke dalam bahasa Indonesia adalah ‘Islam Dalam Kancah Modernisasi’, ‘Menjemput Islam’, ‘Para Mujahid Agung’ dan ‘Di Tepian Jalur Gaza’. Maryam Jamilah wafat pa-da 31 Oktober 2012 pada usia 78 tahun. Nurhayati Baheramsyah/mzc

Kita selalu saja menemukan orang yang berjubah apologi. Kesalahan dan kelemahan pribadinya ditutupi dengan cara menyalahkan keadaan. yang terjadi akibat kebohongan sosial. Pengaruh yang ditimbulkan juga tidak sedikit, melahirkan penderitaan fisik materil dan moril yang jumlahnya tidak terkira. Ironisnya, kenyataan seperti itu masih digunakan oleh pihak-pihak tertentu untuk membela diri. Padahal kesalahan terletak di pundak mereka, namun mereka malah saling lempar tanggung jawab. Demikianlah, negeri ini belum mampu melahirkan sosok-sosok ksatria, yang mana sosok itu tampil ke permukaan untuk mempertanggungjawabkan segala sesuatu yang dilakukannya. Masing-masing pihak merasa benar sendiri, dan yang fatal tidak sedikit diantaranya bersembunyi di balik baju agama. Ingatlah, semakin banyak kebohongan tersebar di negeri ini, semakin dalam pula negeri ini menggali lubang kuburnya sendiri. Kejujuran ini amat sulit dilakukan, apalagi di depan orangorang yang berkuasa, atau berjasa dalam hidup kita. Biasanya, kita hanya membenarkan apa yang ia ucapkan dan lakukan, meskipun hal itu salah. Kita lebih mengedepankan perasaan ketimbang sebuah kejujuran yang bernilai luhur. Rasulullah sendiri menjelaskan bahwa jihad yang terbaik diantaranya menyampaikan situasi yang jujur di hadapan para penguasa, para pemimpin, orang-orang yang berjasa, namun dalam keadaan salah. Pada sebuah kesempatan, Rasulullah juga menyebutkan, “Senantiasalah kalian jujur, karena sesungguhnya kejujuran itu membawa kepada kebajikan, dan kebajikan membawa kepada surga. Seseorang yang senantiasa jujur dan berusaha untuk selalu jujur, akhirnya ditulis di sisi Allah sebagai seorang yang selalu jujur. Dan jauhilah kedustaan karena kedustaan itu membawa kepada kemaksiatan, dan kemaksiatan membawa ke nera-

ka. Seseorang yang senantiasa berdusta dan selalu berdusta, hingga akhirnya ditulis di sisi Allah sebagai seorang pendusta.” Alangkah malunya jika setiap kita bercermin pada perilaku Brennan Breene dari Penynslavia. Dalam sebuah perjalanan, ia menemukan sebuah amplop berisi uang senilai 3.600 dolar (36 juta) di sebuah jalanan yang sibuk. Breene memungutnya. Beberapa hari kemudian, lewat sebuah situs berita lokal, ia mendengar ada sepasang pengantin yang tertimpa sial karena kehilangan uang hasil dari pemberian teman-teman mereka pasca pesta perkawinan. David dan Ashley Marasco, pasangan pengantin itu, meletakkan album perkawinan mereka dan amplop berisi uang di bagasi mobil mereka, namun tanpa di sadari amplop itu terjatuh. Setelah alamat sang pengantin dan namanya sesuai pula, Breene segera meluncur menuju alamat mereka. Setelah bertemu, dengan perasan ikhlas, Breene menyerahkan amplop itu. Breene merupakan cermin kejujuran di negeri ini. Sungguh bijak sekiranya para pejabat publik dan seluruh masyarakat belajar dari Breene. Tentu saja, negeri kita tidak akan sekacau ini. Menengok ke Dalam Benar apa yang diungkapkan Ebiet, kita mesti telanjang dan melakukan pembersihan diri. Bersih lahir dan batin. Jangan ada dusta. Hanya dengan cara itu, kita akan mencapai kehidupan yang baik dan bermartabat, tidak saling menyalahkan. Jauhkan perilaku apologi serigala seperti pada fabel di atas. Jujur akan menjadikan jiwa kita tenang, setenang Brennan Breene mengembalikan uang yang bukan haknya. Untuk semua itu mari kita mulai dari diri kita sendiri. Wa Allaahu a’lam.

Waspada,jumat 26 juli 2013  
Read more
Read more
Similar to
Popular now
Just for you