Page 1

Harga Eceran Rp3.000,-

MH370 Putari Indonesia Untuk Hindari Radar KUALA LUMPUR (Waspada): Pesawat Malaysia Airlines nomor penerbangan MH370 yang hilang ternyata tidak melintasi wilayah udara Indonesia, melainkan memutarinya. Hal ini diduga untuk menghindari tertangkap radar udara Indonesia. Hal ini disampaikan oleh pejabat senior di pemerintahan Malaysia, kepada CNN, Minggu (6/4). Berdasarkan

Lanjut ke hal A2 kol. 7

Demi Kebenaran Dan Keadilan


Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

SENIN, Legi, 7 April 2014/7 Jumadil Akhir 1435 H

No: 24543 Tahun Ke-68

Terbit 24 Halaman

KAMPANYE ANTI GOLPUT: Aktivis Badan Eksekutif Mahasiswa (BEM) Universitas Syiah Kuala (Unsyiah) Banda Aceh mengkampanyekan anti golput pada Pemilu legislatif 2014 di Banda Aceh, Minggu (6/4).


Semua Alat Peraga Harus Dicopot

Presiden: Tak Ada Ruang Untuk Curang

MEDAN (Waspada): Memasuki minggu tenang, Pemerintah Kota Medan bekerjasama dengan Komisi Pemilihan Umum (KPU) dan Bawaslu menertibkan semua alat peraga kampanye (APK), Minggu (6/4) malam. Sebelum penertiban dimulai, Pelaksana Tugas (Plt) Wali Kota Medan Dzulmi Eldin, Sekda Syaiful Bahri bersama sejumlah satuan kerja perangkat daerah (SKPD) serta seluruh unsur Muspida Plus melakukan apel di depan Kantor Wali Kota Medan. “Saat ini sudah memasuki minggu tenang, karena pada Rabu 9 April kita sudah Pemilu. Oleh karena itu semua APK malam ini mulai ditertibkan. Para petugas supaya benar-benar menertibkan APK ini terutama di tempattempat TPS-TPS yang ada di Medan ini,” kata Eldin saat memberikan arahan. Eldin menegaskan, penertiban APK malam ini supaya semaksimal mungkin supaya minggu tenang tersebut benar-benar terlaksana dengan baik. Jangan ada pilih kasih dalam penertiban APK ini. Kasat Pol PP Kota Medan Sofyan mengatakan, penertiban APK dilaksanakan sesuai rekomendasi dari Panwas. “Penertiban kita lakukan sesuai rekomendasi dari Panwas.

Waspada/Surya Efendi

SURABAYA(Antara): Presiden Susilo Bambang Yudhoyono mengatakan di era reformasi yang terbuka dan demokratis di Indonesia saat ini, tidak ada ruang dan sulit bagi siapa-pun untuk melakukan kecurangan dalam pemilu karena banyak pihak yang mengawasi. Presiden saat pertemuan dengan pimpinan media massa di Surabaya, Sabtu (5/4) malam, mengatakan sistem dan UndangUndang Pemilu yang berlaku saat ini dibuat oleh DPR yang multipartai dan pemerintah, yang juga terdiri dari menteri dari beberapa partai politik, sehingga dipastikan aspirasi dan kepentingan partai sudah terakomodasi dalam sistem dan Undang-Undang Pemilu tersebut. Selain itu, Komisi Pemilihan Umum (KPU), Badan Pengawas Pemilu (Bawaslu) dan Mahkamah Konstitusi (MK) saat ini bersifat independen dan dipilih oleh DPR yang multipartai, sehingga pihak yang terkait dalam penyelengaraan dan pengawasan dan penegakan hukum Pemilu semua sudah independen. “Begitu juga pers yang tentu akan mengontrol jalannya Pemilu dengan independen,” kata Presiden.

Lanjut ke hal A2 kol. 6

BELUM DICOPOT: Poster dan atribut caleg masih melekat di batang pohon Jl. Halat Medan, Minggu (6/4) sore. Semestinya seluruh alat peraga caleg yang menempel di tempat-tempat umum dicopot saat minggu tenang hingga pelaksanaan Pemilu 9 April 2014.

Lanjut ke hal A2 kol. 4

Hindari Politik ‘Wani Piro’ MEDAN (Waspada): Pimpinan Wilayah Muhammadiyah (PWM) Sumatera Utara mengingatkan warga Muhammadiyah yang menjadi calon legislatif (Caleg) harus menghindari kebiasaan-kebiasaan buruk dalam politik praktis seperti wani piro atau politik uang pada Pemilu legislatif 9 April mendatang. Karena moral politik Muhammadiyah tidak boleh bertentangan dengan Quran dan Sunnah. “Politik uang bagian dari suap menyuap. Dan, Allah SWT melaknat penyuap, penerima suap, dan makelar suap,” kata Ketua PWM Muhammadiyah Sumut Prof Asmuni, saat menyampaikan tausiyah pada Silaturahim Akbar dan Pemenangan

Lanjut ke hal A2 kol. 4

H. Amri Tambunan: Waspada/Rudi Arman

KASAT Reserse Narkoba Polresta Medan Kompol Dony Alexander (dua kanan) didampingi sejumlah perwira menunjukkan barang bukti narkoba jenis ekstasi asal Malaysia saat ekspos di Polresta Medan, Minggu (6/4) sore.

Pemasok Ekstasi Dari Malaysia Ditangkap MEDAN (Waspada): Sat Reserese Narkoba Polresta Medan menangkap tiga orang diduga bandar ekstasi yang memasok narkoba dari Malaysia. Ketiganya ditangkap di Jl. Adinegoro depan kantor Kejaksaan Medan dan di kamar Hotel Lubuk Raya Jl. SM Raja Medan, Jumat (4/4) malam. Data diperoleh Waspada di Polresta Medan, Minggu (6/ 4), ketiga orang yang ditangkap yakni DO, 47, warga Desa Bujang Laban, Kec. Bujang Laban, Kab. Tulung Agung, Jawa Timur, RO, 47, warga Dusun Tanjung, Desa Sambijajar, Kec. Subergempol, Kab. Tulung Agung, Jawa Timur dan DW,

22, warga Jl. Pelita I Gang Saudara Medan. Dari ketiganya,polisi menyita barang bukti 380 butir ekstasi warna cream dan bong yang tersambung dengan pipa kaca berisikan sisa sabu. Kasat Reserse Narkoba Polresta Medan Kompol Dony Alexander didampingi Wakasat AKP Viktor Ziliwu, Kanit Idik I AKP Zupri Siregar, Kanit Idik II AKP Azuar dan Kaur Bin Ops Iptu Hariani saat ekspos di Mapolresta Medan, Minggu (6/4) mengatakan, ketiganya merupakan jaringan narkoba internasional. “Pengakuan tersangka, ekstasi di pasok dari Malaysia

oleh B (buron) ke Hotel Lubuk Raya di Medan. Dari sini ekstasi dari Malaysia diedarkan oleh tiga tersangka ke Kampung Kubur Medan, Pekanbaru dan Pulau Jawa,” jelas Dony dan menambahkan, sampai saat ini pihaknya masih melakukan penyelidikan terhadap B yang disebut ketiga tersangka sebagai pemasok ekstasi dari Malaysia ke Medan. Kata Dony, untuk pasar Medan, tersangka menjual Rp120 ribu per butir, sedangkan harga beli di Malaysia Rp90 ribu per butir. “Ini sudah yang kedua kalinya sindikat

Lanjut ke hal A2 kol. 1

‘Saya Tetap Warga Deliserdang’ DELISERDANG (Waspada): Drs H.Amri Tambunan (foto) mengatakan, dia dan keluarganya adalah warga Deliserdang dan tetap mencintai Deliserdang. Hal itu dikatakan H.Amri Tambunan kepada Waspada di rumah dinas Bupati Deliserdang di Lubukpakam, Sabtu(5/4), sebagai ucapan pamit karena berakhirnya masa bakti jabatan sebagai bupati periode 2009-2014 pada 7 April hari ini. Menurut H.Amri Tambunan, sejak pertama mengemban tugas sebagai camat di Tanjungmorawa sekitar tahun 2006, sampai menjadi pejabat eselon II di Pemerintah Kab. Deliserdang sejak masa Bupati H.Wasiman, Bupati H.Ruslan Mansyur hingga Bupati H.Maymaran NS, dia sudah menjadi bagian dari masyarakat Deliserdang. Lanjut ke hal A2 kol. 3

Berita terkait baca halaman B4 dan B5


ZIKIR AKBAR PEMILU DAMAI: Ribuan umat muslim mengikuti zikir akbar dilanjutkan dengan doa bersama di Masjid Raya Baiturrahman, Banda Aceh, Minggu (6/4). Zikir akbar disertai doa bersama dan tausyiah yang diikuti pejabat pemerintah, masyarakat, TNI/Polri dan para caleg itu memohon kepada Allah SWT agar pemilu di Aceh berlangsung damai.

Suhu Keamanan Di Aceh Meningkat JAKARTA (Antara): Kepala Staf TNI Angkatan Darat (KSAD) Jenderal Budiman mengecek kondisi kesiapan Komando Daerah Militer di seluruh Indonesia menjelang Pemilu 2014 melalui teleconference. “Pengecekan terhadap Kodam di seluruh Indonesia dalam rangka membantu KPU dan Kepolisian terkait pelaksanaan Pemilu agar berjalan aman, lancar, umum, bebas, rahasia, jujur dan adil,” kata Budiman di Markas Besar TNI AD, Jakarta, Minggu (6/4). Dalam teleconference itu masing-masing Panglima

Kodam (Pangdam) memaparkan kondisi wilayahnya masing-masing yang secara umum kondisinya kondusif menjelang Pileg 2014. Namun ada beberapa daerah yang dilaporkan ada peningkatan suhu keamanan seperti di Aceh seperti yang dilaporkan Pangdam Iskandar Muda Mayor Jenderal TNI Pandu Wibowo yaitu adanya isu disintegrasi bangsa yang dikemukakan partai lokal dalam kampanyenya. Selain itu ada tindak penyerangan dengan bersenjata sehingga menimbulkan korban meninggal dan luka-luka

Asrin Naim Rp451,3 M Harta Bill Gates Untuk Hak Asasi Manusia Plh Bupati DS Program Kesehatan Di Indonesia Al Bayan

Oleh Tgk. H. Ameer Hamzah Dan Allah tidak menghendaki berbuat kezaliman terhadap hamba-hamba-Nya.(QS. Ghafir:31) Takutlah kalian kepada perbuatan zalim. Sebab kezaliman itu merupakan kegelapan di hari kiamat.(Hadits) KEINGINAN untuk memperpanjang kekuasaan, banyak politikus menghalalkan segala cara. Undangundang yang dibuat secara demokratis ditafsirkan sendiri sesuai nafsu serakahnya. Lewat-tangan besi mereka menindas rakyat, melanggar hak-hak yang paling mendasar dari manusia kecil yang sebenarnya rakyatnya sendiri. Mereka membunuh pria, memperkosa perempuan dan membiarkan yatim anak-anak bangsa. (Kasus Suriyah dan Mesir).

Lanjut ke hal A2 kol. 2 Waspada Daily


MEDAN (Waspada): Pelantikan Bupati dan Wakil Bupati Deliserdang terpilih periode 2014-2019 yang sedianya dilakukan 7 April 2014, ditunda berkaitan dengan pelaksanaan Pemilu. Mendagri menetapkan Sekda Deliserdang Asrin Naim menjadi pelaksana harian (Plh) Bupati sampai dengan dilantiknya Bupati dan Wabup Deliserdang terpilih. Sekretaris Daerah Provinsi Sumatera Utara (Sekda Provsu), Nurdin Lubis menyerahkan Surat Keputusan Mendagri tersebut kepada Sekda Deliserdang Asrin Naim disaksikan, Asisten Pemerintahan Hasiolan Silaen, Staf Ahli Lanjut ke hal A2 kol. 6


PENDIRI Bill and Mellinda Gates Foundation, Bill Gates menyampaikan paparan ketika menghadiri peluncuran The Indonesia Health Fund di Jakarta, Sabtu (5/4).

JAKARTA (Antara): Menteri Koordinator bidang Kesejahteraan Rakyat (Menko Kesra) Agung Laksono mengatakan, Indonesia sangat berterimakasih kepada filantropis dunia William (Bill) Gates yang mendonasikan hartanya senilai 40 juta dolar Amerika Serikat (AS) atau setara Rp451,3 miliar untuk program kesehatan di Tanah Air. “Indonesia sangat berterima kasih kepada Bill Gates yang telah peduli terhadap kondisi kesehatan bangsa Indonesia,” katanya Agung di Jakarta, Minggu (6/4). Agung menjelaskan, pihaknya telah bertemu dengan Bill Gates pada Sabtu (5/4). Pada kesempatan hadir pula Menteri Kesehatan Nafsiah Mboi dan Chairman/CEO Mayapada Group Dato Sri Dr Taher. Kedatangan Bill Gates ke Tanah Air, menurut Agung, terkait dengan peluncuran Indonesia Health Fund. “Donasi dari Bill Gates ditambah donasi dari pengusaha lokal Indonesia akan disalurkan untuk program Indonesia Health Fund,” katanya. Dana itu, dikemukakannya, akan digunakan untuk mengatasi masalah kesehatan, yaitu malaria, tuberculosis (TBC),

Lanjut ke hal A2 kol. 1

dalam kurun waktu Februari hingga April 2014. Pangdam XVI/ Pattimura Mayor Jenderal TNI Eko Wiratmoko mengatakan di wilayahnya ada ancaman dari warga untuk golput. Namun, menurut dia, instansinya sudah berkoordinasi dengan Polda Maluku untuk mengantisipasi hal tersebut dengan pendekatan persuasif. Pangdam XVII/ Cenderawasih Mayjen TNI Christian Zebua mengatakan isu mengenai boikot pemilu masih ada, namun tidak perlu

Lanjut ke hal A2 kol. 7

Ada-ada Saja Bayi Diadili Di Pakistan PUNJAB (CNN): Bayi lakilaki berusia sembilan bulan bersama beberapa anggota keluarganya dihadapkan ke depan sidang di Pakistan, Kamis lalu, atas dakwaan pembunuhan berencana.

Lanjut ke hal A2 kol. 2

Serampang - Wani piro gentayangan - He...he...he...

Harga Eceran: Rp3.000

Jangan Tertipu Popularitas

Demi Kebenaran Dan Keadilan

135 Kasus Politik Uang

JAKARTA (Waspada): Syarikat Islam menghimbau agar umat Muslim jangan memilih calon pemimpin yang tak amanah dan ingkar janji. Umat pun diminta tak tertipu oleh popularitas caleg atau capres tertentu. Ketua Umum Pimpinan Pusat (PP) Syarikat Islam (SI) Rahardjo Tjakraningrat meminta umat mencari informasi mendalam terkait para pemimpin yang ada. Sehingga tak tertipu hingga lima tahun ke depan. “Kita himbau agar umat cerdas memilih pemimpin, bukan hanya populer. Dilihat juga apakah ia pernah mengingkari


JAKARTA (Antara): Lembaga pemantau pemberantasan korupsi Indonesia Corruption Watch (ICW) bersama mitra jaringannya di 15 provinsi menemukan 135 pelanggaran berupa praktik politik uang selama masa kampanye Pemilu 2014. “Dengan rincian pemberian uang 33 buah, pemberian barang 66 buah, pemberian jasa 14 buah, dan sisanya penggunaan fasilitas negara,” kata peneliti bidang korupsi politik ICW Abdullah Dahlan dalam konferensi pers di Jakarta, Minggu(6/4). Abdullah menjelaskan nilai transaksi politik uang yang dilakukan partai dan kandidat anggota legislatif beragam.

Lanjut ke hal A2 kol. 6

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN:0215-3017

SENIN, Legi, 7 April 2014/6 Jumadil Akhir 1435 H

No: 24543 Tahun Ke-68

Lanjut ke hal A2 kol. 6

Terbit 24 Halaman

Waspadai Kerawanan Pemilu JAKARTA (Waspada): Jelang Pemilu Legislatif, 9 April 2014, Badan Pengawas Pemilu (Bawaslu) menerbitkan Surat Edaran nomor 0361/Bawaslu/ IV/2014 berisi data dan informasi terbaru terkait Indeks Kerawanan Pemilu (IKP). Surat edaran tersebut sudah disampaikan ke Bawaslu Provinsi seluruh Indonesia. Sebelumnya, pada Februari yang lalu, Bawaslu sudah merilis Peta Kerawanan Pemilu tingkat Kabupaten dan Kota di seluruh Indonesia. Untuk Indeks Kerawanan Pemilu kali ini, telah mencakup hingga wilayah kecamatan. Bawaslu mengklaim, Minggu (6/4), setidaknya ada tiga variabel penting yang digunakan untuk menentukan tingkat kerawanan suatu daerah, yaitu: Pertama, dampak elektoral. Aspek ini terkait dengan persolan DPT yang sampai ditetapkan oleh KPU masih bermasalah. Kemudian, berkaitan dengan data hasil perolehan suara Pemilu tahun sebelumnya di setiap daerah pemilihan (dapil). “Imbas dari dampak elektoral ini adalah berpindahnya kursi calon tertentu ke calon lain,” tulis Bawaslu. Kedua, akses pengawasan.

Aspek ini berkaitan dengan kondisi geografis suatu daerah. Menurut Bawaslu, semakin sulit jangkauan suatu daerah yang dipengaruhi faktor transportasi maupun sarana komunikasi, maka semakin tinggi tingkat kerawanannya. Ketiga, potensi terjadinya money politic. Hal ini dapat dipengaruhi dari faktor indeks kemiskinan suatu daerah. Bawaslu mencatat, berdasarkan variabel-variabel di atas, dari 6.524 kecamatan yang ada di seluruh Indonesia, ada 729 kecamatan yang tergolong sangat rawan dan 1.422 kecamatan yang tergolong rawan dan selebihnya tergolong aman. Mereka memerintahkan Bawaslu Provinsi beserta aparatur pengawasan di bawahnya menggunakan data dan informasi ini sebagai referensi Lanjut ke hal A2 kol. 3

H.Amri Tambunan:

‘Saya Tetap Warga Deliserdang’ DELISERDANG (Waspada): Drs H.Amri Tambunan mengatakan, dia dan keluarganya adalah warga Deliserdang dan tetap mencintai Deliserdang. Hal itu dikatakan H.Amri Tambunan kepada Waspada di rumah dinas Bupati Deliserdang di Lubukpakam, Sabtu (5/4), sebagai ucapan pamit karena berakhirnya masa bakti jabatan sebagai bupati periode 2009-2014 pada 7 April hari ini. Menurut H.Amri Tambunan, sejak pertama mengemban tugas sebagai camat di Tanjungmorawa sekitar tahun

2006, sampai menjadi pejabat eselon II di Pemerintah Kabupaten Deliserdang sejak masa Bupati H.Wasiman, Bupati H. Ruslan Mansyur hingga Bupati H.Maymaran NS, dia sudah menjadi bagian dari masyarakat Deliserdang. ‘’Sudahlama,lebihtiga-puluh tahun saya di Deliserdang,’’ kata

Masa Tenang, Atribut Kampanye Masih Terpasang


ZIKIR AKBAR PEMILU DAMAI: Ribuan umat muslim mengikuti zikir akbar dilanjutkan dengan doa bersama di Mesjid Raya Baiturrahman, Banda Aceh, Minggu (6/4). Zikir akbar disertai doa bersama dan tausyiah yang diikuti pejabat pemerintah, masyarakat, TNI/Polri dan para caleg itu memohon kepada Allah SWT agar pemilu di Aceh berlangsung damai.

MEDAN ( Waspada): Sat Reserese Narkoba Polresta Medan menangkap tiga orang diduga bandar ekstasi yang memasok narkoba dari Malaysia. Ketiganya ditangkap di Jl. Adinegoro depan kantor Kejaksaan Medan dan di kamar Hotel Lubuk Raya Jl. SM Raja Medan, Jumat (4/ 4) malam. Data diperoleh Waspada di Polresta Medan, Minggu (6/4), ketiga orang yang ditangkap yakni DO, 47, warga Desa Bujang La-

ban, Kec. Bujang Laban, Kab. Tulung Agung, Jawa Timur, RO, 47, warga Dusun Tanjung, Desa Sambijajar, Kec. Subergempol, Kab. Tulung Agung, Jawa Timur dan DW, 22, warga Jl. Pelita I Gang Saudara Medan. Dari ketiganya,polisi menyita barang bukti 380 butir ekstasi warna cream dan bong yang tersambung dengan pipa kaca berisikan sisa sabu. Kasat Reserse Narkoba Polresta Medan Kompol Dony Alexander didampingi Wakasat AKP Viktor Ziliwu, Kanit Idik I AKP Zupri Siregar, Kanit

Idik II AKP Azuar dan Kaur Bin Ops Iptu Hariani saat ekspos di Mapolresta Medan, Minggu (6/4) mengatakan, ketiganya merupakan jaringan narkoba internasional. “Pengakuan tersangka, ekstasi di pasok dari Malaysia oleh B (buron) ke Hotel Lubuk Raya di Medan. Dari sini ekstasi dari Malaysia diedarkan oleh tiga tersangka ke Kampung Kubur Medan, Pekanbaru dan Pulau Jawa,” jelas Dony dan menambahkan, sampai saat ini pihaknya masih melakukan penyelidi-

kan terhadap B yang disebut ketiga tersangka sebagai pemasok ekstasi dari Malaysia ke Medan. Kata Dony, untuk pasar Medan, tersangka menjual Rp120 ribu per butir, sedangkan harga beli di Malaysia Rp90 ribu per butir. “Ini sudah yang kedua kalinya sindikat internasional ini melakukan aksi,” kata Dony. Dijelaskanya, penangkapan ini berawal dari Lanjut ke hal A2 kol. 1

Waspada/Rudi Arman

KASAT Reserse Narkoba Polresta Medan Kompol Dony Alexander (dua kanan) menginterogasi tersanghka RO dan DO, warga Jatim yang merupakan sindikat narkoba internasional saat ekspos di Polresta Medan, Minggu (6/4) sore.

Temuan Baru

Hak Asasi Manusia Oleh H. Ameer Hamzah Dan Allah tidak menghendaki berbuat kezaliman terhadap hamba-hamba-Nya.(QS. Ghafir:31) Takutlah kalian kepada perbuatan zalim. Sebab kezaliman itu merupakan kegelapan di hari kiamat.(Hadits) KEINGINAN untuk memperpanjang kekuasaan, banyak politikus menghalalkan segala cara. Undangundang yang dibuat secara demokratis ditafsirkan sendiri sesuai nafsu serakahnya. Lewat-tangan besi mereka menindas rakyat, melanggar hak-hak yang paling mendasar dari manusia kecil yang sebenarnya rakyatnya sendiri. Mereka membunuh pria, memperkosa perempuan dan membiarkan yatim anak-anak bangsa. (Kasus Suriyah dan Mesir). Sepanjang sejarah kemanusiaan pelanggaran hak-

Lanjut ke hal A2 kol. 2

Untuk Curang Dalam Pemilu SURABAYA(Antara): Presiden Susilo Bambang Yudhoyono mengatakan di era reformasi yang terbuka dan demokratis di Indonesia saat ini, tidak ada ruang dan sulit bagi siapapun untuk melakukan kecurangan dalam pemilu karena banyak pihak yang mengawasi. Presiden saat pertemuan dengan pimpinan media massa di Surabaya, Sabtu (5/4) malam, mengatakan sistem dan Undang-Undang Pemilu yang berlaku saat ini dibuat oleh DPR yang multipartai dan pemerintah, yang juga terdiri dari menteri dari beberapa partai politik, sehingga dipastikan aspirasi dan kepentingan

partai sudah terakomodasi dalam sistem dan UndangUndang Pemilu tersebut. Selain itu, Komisi Pemilihan Umum (KPU), Badan Pengawas Pemilu (Bawaslu) dan Mahkamah Konstitusi (MK) saat ini bersifat independen dan dipilih oleh DPR yang multipartai, sehingga pihak yang terkait dalam penyelenggaraan dan pengawasan dan penegakan hukum Pemilu semua sudah independen. “Begitu juga pers yang tentu akan mengontrol jalannya Pemilu dengan independen,” kata Presiden. Potensi kecurangan dalam Lanjut ke hal A2 kol. 6

Pileg Di LN Berakhir

KPK Diminta Usut Kartel Beras Raskin

Al Bayan

ga kita rekomendasikan kepada aparat Pemda dalam hal ini Pol PP untuk diturunkan,” katanya. “Kami meminta seluruh pengawas Pemilu untuk memastikan tidak ada lagi alat peraga kampanye yang terpasang. Kepada warga masyarakat untuk menginformasikan jika masih ada alat peraga yang terpasang di jalur jalan protokol atau lokasi lainnya,” katanya. Alat peraga kampanye berukuran besar juga masih terlihat di Jl. Perintis Kemerdekaan, Jl. Asia, Jalan Pandu, Jl. Sudirman di Medan. Ketua Divisi Pengawasan dan Humas Bawaslu Sumatera Utara Aulia Andri mengatakan Panitia Pengawas Pemilu (Panwaslu) kabupaten/kota dan aparat pemerintah masih membersihkan alat-alat peraga kampanye. Panwaslu Kota Medan masih memberikan kesempatan bagi partai politik dan calon Lanjut ke hal A2 kol. 6

Polisi Tangkap Pemasok Ekstasi Dari Malaysia Presiden: Tidak Ada Ruang

Lanjut ke hal A2 kol. 1

JAKARTA (Waspada): Menko Kesra Agung Laksono mengaku belum menemukan indikasi adanya kartel dalam program beras untuk warga kurang mampu (raskin). Namun Agung mempersilakan KPK jika hendak mengusut dugaan penyimpangan. “Silakan saja diperiksa jika memang ada indikasi tersebut,” kata Agung Laksono di kediamannya, Jl Cipinang Cempedak 2, Jakarta Timur, Minggu (6/4). Agung mengatakan, kalaupun ada, aksi kartel tidak masif. “Mungkin spot-spot saja. Apalagi sekarang eranya lebih terbuka dan sudah diumumkan, pembelinya adalah bulog,” tutur Agung. Pemerintah menurutnya selalu mengevaluasi program yang dicetuskan sejak tahun 1998 tersebut. Agung mengaku program raskin belum maksimal, namun dirinya tak sepakat jika harus dihilangkan. “Ini merupakan program perlindungan sosial. Pada tahun 1998 keadaannya berubah yang mengharuskan pemerintah bertindak untuk membuat program social safety net,” papar Agung. Program tersebut terus berjalan hingga saat ini. Pemerintah tidak menaikkan harga jual raskin yang kini sebesar Rp 1.600 meski harga belinya selalu meningkat.

JAKARTA (Antara): Atribut kampanye partai politik dan calon anggota legislatif masih terpasang di beberapa daerah seperti Jakarta dan Medan pada hari pertama masa tenang Pemilu 2014, Minggu (6/4). Bendera-bendera partai politik dan spanduk bergambar calon anggota legislatif masih terlihat. Menurut Badan Pengawas Pemilu (Bawaslu) Provinsi Banten, peserta Pemilu juga belum membersihkan alat peraga kampanye yang terpasang di pohon-pohon dan sarana umum di Banten. Ketua Bawaslu Provinsi Banten Pramono U Tantowi mengatakan dia sudah meminta seluruh jajaran pengawas di kabupaten/kota berkoordinasi dengan aparat pemerintah untuk membersihkan atribut kampanye. “Mulai hari ini secara serentak dilaksanakan di semua wilayah Provinsi Banten. Tidak ada toleransi, semua alat pera-

MH370 Hindari Radar Indonesia KUALA LUMPUR, Malaysia (Waspada): Pesawat Malaysia Airlines MH370 diyakini dengan sengaja melakukan penerbangan di sepanjang satu rute yang dijadwalkan guna menghindari deteksi radar, demikian menurut laporan CNN Minggu (6/4). Jaringan pemberitaan itu mengutip keterangan satu sumber seorang pejabat senior pemerintah Malaysia yang mengatakan MH370 terbang di utara Indonesia. “MH370 diyakini terbang di sekitar wilayah

udara Indonesia dalam pengembaraannya ke selatan Samudera India,” lata pejabat tersebut kepada CNN. CNN melaporkan bahwa para penyelidik telah mencapai kesimpulan ini setelah meninjau data jalur radar dari sejumlah negara sahabat. “MH370 tidak terbang di atas Indonesia atau di wilayah udaranya setelah membuat putaran arah ke barat di Laut China Selatan dan terbang melintasi Semenanjung Malaysia. Pakar khusus penerbangan CNN Peter Goelz mengatakan informasi itu hanya mem-

JAKARTA (Waspada): Proses pemungutan suara pemilihan umum (Pemilu) legislatif 2014diluarnegeriberakhir Minggu (6/4). Pemungutan suara di masing-masing tempat atau negara tidak digelar pada waktu yang sama atau serentak, melainkan menyesuaikan kondisi masing-masing negara yakni antara 30 Maret-6 April 2014. Alasannya, agar warga negara Indonesia di sana dapat menggunakan hak pilihnya dengan lebih baik. Pada Minggu, pemungutan suara dilakukan di sejumlah tempat seperti di Ibu Kota Turki, Ankara dan di Ibu Kota Yunani, Athena. Berikut daftar tempat yang menggelar Pemilu pada Minggu: 1. Guangzhou

Warga Muhammadiyah Harus Hindari Politik “Wani Piro”

benarkan apa yang terjadi di kokpit adalah hal yang disengaja. Dia mengatakan kepada CNN bahwa dibutuhkan sejumlah besar keterampilan dan pengetahuan tentang wilayah udara untuk pilot pesawat dengan cara ini . “Itu bukan sesuatu yang hanya dilakukan secara mendadak. Itu telah direncanakan, jadi sangat mengganggu sekali, tapi itu mulai membentuk pola yang menunjuk ke peningkatan penekanan di kokpit,” katanya.

MEDAN (Waspada): Pimpinan Wilayah Muhammadiyah (PWM) Sumatera Utara mengingatkan warga Muhammadiyah yang menjadi calon legislatif (Caleg) harus menghindari kebiasaan-kebiasaan buruk dalam politik praktis seperti wani piro atau politik uang pada Pemilu legislatif 9 April mendatang. Karena moral politik Muhammadiyah tidak boleh bertentangan dengan Quran dan Sunnah. “Politik uang bagian dari suap menyuap. Dan, Allah SWT melaknat penyuap, penerima suap, dan makelar suap,” kata Ketua PWM Muhammadiyah Sumut Prof Asmuni, saat menyampaikan tausiyah pada Silaturahim Akbar dan Pemenangan Kader Muhammadiyah yang berkompetisi pada Pemilu Legislatif 2014, di Hotel Madani Medan, Sabtu (5/4) malam. Silaturahmi yang digelar Lembaga Hikmah dan Kebijakan Publik (LHKP) Pimpinan Daerah Muhammadiyah (PDM) Medan itu, dihadiri 43 Caleg lintas Parpol Dapil Kota Medan dan Deliserdang.

Lanjut ke hal A2 kol. 2

Lanjut ke hal A2 kol. 7

2. Hanoi 3. Ho Chi Minh 4. Istanbul 5. Johor Baru 6. Kota Kinabalu 7. Kuala Lumpur 8.Kuching 9. Lisabon 9. Madrid 10. Manila 11. Marseille 12. Mexico City 13. New Delhi 14. Paris 15. Pyong Yang 16. Roma 17. Singapura 18. Taiwan 19. Tokyo 20. Vatikan 21. Ankara, Turki 22. Athena, Yunani 23. Beirut. (vn/m09)

Ada-ada Saja Bayi Diadili Di Pakistan PUNJAB (CNN): Bayi lakilaki berusia sembilan bulan bersama beberapa anggota Lanjut ke hal A2 kol. 1

Serampang - Wani piro gentayangan - He.. he..he..

Berita Utama


WASPADA Senin 7 April 2014

Banda Aceh Aman Jelang Pemilu BANDA ACEH (Antara): Kapolresta Banda Aceh Kombes Pol Moffan mengatakan secara umum Ibu Kota Provinsi Aceh aman menjelang pemungutan suara Pemilu Legislatif, 9 April 2014. “Secara umum, kondisi Kota Banda Aceh aman. Kondisi aman ini karena kami terus melakukan razia dan patroli-patroli,” ungkap Kombes Pol Moffan di Banda Aceh, Sabtu. Ia meyakinkan masyarakat tidak perlu khawatir untuk ikut melaksanakan pemilu serta menggunakan hak pilihnya tanpa intimidasi atau paksaan dari pihak tidak bertanggung jawab. “Masyarakat tidak perlu ragu dengan polisi. Saya meyakinkan bahwa 99 persen Banda Aceh aman. Personel kami cukup. Kami juga dibantu personel Polda dan Kodam Iskandar Muda,” ungkap Kombes Pol Moffan. Ia mengatakan, walau sempat terjadi riak kecil seperti keributan dua massa partai beberapa lalu di wilayah hukum Polresta Banda Aceh, namun itu tidak mengganggu keamanan di Kota Banda Aceh secara keseluruhan.

Polisi... informasi warga tentang adanya pengedar narkoba menginap di Hotel Lubuk Raya di Jl. SM Raja Medan. “Untuk memancing tersangka, polisi menyaru sebagai pembeli memesan 380 butir ekstasi dan janji bertemu dengan tersangka DO di Jl. Adinegoro Medan. Begitu tersangka menunjukkan ekstasi langsung ditangkap,” jelas Dony. Dalam pengembangan kasus, DO mengaku mereka beraksi tiga orang. Kepada petugas, RO mengaku mendapatkan narkoba dari temannya bernama B, warga asal Malaysia. “Kami dapat barang itu, dari B tinggal di Malaysia yang membawa ekstasi ke Medan,” katanya. Menurut RO, ekstasi dari Medan rencananya dibawa ke Jawa Timur melalui jalan darat. Secara terpisah, Sat Res Narkoba Polresta Medan juga menangkap AM, 37, warga Jl. Kail, Lingk. 4, Sei Mati, Medan Labuhan, AF, 28, warga Jl. Jermal Raya, Lorong 3, Lingk. 10, Sei Mati, Medan Labuhan di Pasar 1 Tengah, Kel. Tanah 600, Medan Marelan, dengan barang bukti 25 gram sabu dibungkus 3 plastik klip transparan. Sedangkan RAR diamankan dari depan diskotik Delta Jl. Ir. Juanda Medan dengan barang bukti 50 butir pil ekstasi. Pengakuan RAR, ia memperoleh ekstasi dari A, warga Aceh Bireuen sebanyak 150 butir dan telah terjual 100 butir kepada pengunjung diskotik Zoone dan Delta dengan harga Rp70 ribu per butir. Polisi juga menangkap SD, 29, warga Jl. Pinang Baris Lingk. I Gang Rasmi, Kel. Sunggal, Kec. Medan Sunggal, dan SJ, 42, warga Jl. Metal, Kel. Tanjung Mulia dalam penyergapan di Jl. Pinang Baris Medan. Dari tersangka disita barang bukti 24 gram sabu dan dua HP. Keduanya ditangkap saat transaksi narkoba dengan polisi yang menyaru sebagai pembeli. (m39)


WARIA TOLAK PENCAPRESAN JOKOWI: Puluhan waria melakukan aksi unjuk rasa menentang pencalonan Joko Widodo sebagai Presiden Republik Indonesia di Jalan I Gusti Ngurah Rai, Klender, Jakarta Timur, Minggu (6/4). Mereka lebih mendukung Megawati Sukarnoputri sebagai Presiden dan meminta Jokowi untuk tetap menjadi Gubernur DKI Jakarta hingga akhir masa jabatannya tahun 2017.

Masa... anggota legislatif membersihkan alat kampanye mereka pada hari pertama masa tenang yang berlangsung 6-8 April. Panwaslu Kab. Gorontalo Utara juga masih menemukan alat peraga kampanye di area publik. Komisioner Divisi Pengawasan dan Humas Panwaslu Gorontalo Utara Jaharudin Umar mengatakan, pembersihan atribut kampanye sudah dilakukan sejak pukul 00.00,

135 Kasus...

‘Saya... H.Amri Tambunan yang kader Partai Demokrat itu. Didampingi, istri Hj.Anita Amri Tambunan, Assisten I H.Syafrullah,S.Sos MAP dan Kadis Cipta Karya M.Haris, H.Amri Tambunan mengatakan, dia dan keluarganya tidak bisa dipisahkan dari warga Deliserdang. Duakui Amri, selama sepuluh tahun memimpin di Deliserdang banyak kenangan yang tersimpan, baik kenangan manis maupun kenangan pahit. ‘’Tetapi warga masyarakat Deliserdang yang beragam etnis telah menunjukkan dukungan moral yang cukup tinggi sehingga saya bisa bekerja membangun daerah ini. Saya mengucapkan terima kasih dan mohon maaf,’’ ujar Amri dan berharap jabatan tidak memutuskan tali persaudaraan. Demikian juga kepada para SKPD, staf dan jajarannya, juga penggantinya sebagai bupati, H. Amri Tambunan berpesan agar fundasi yang telah diletakkannya sebagai dasar membangun Deliserdang secara utuh melalui program Gerakan Deliserdang Membangun (GDSM) selama sepuluh tahun jabatannya, dapat dilanjutkan agar Deliserdang ke depan lebih bermartabat. (m11/a06)

keluarganya dihadapkan ke depan sidang di Pakistan, Kamis lalu, atas dakwaan pembunuhan berencana. Seperti dilansir laman Al-Arabiya, Sabtu 5 April 2014, Mohammad Mosa Khan hadir di depan sidang dengan dipangku kakeknya. Dia terlihat minum susu dari botol. Sang kakek dan beberapa anggota keluarganya menghadapi tuduhan melawan upaya penangkapan dan memukuli sejumlah aparat dengan tongkat hingga luka parah. Peristiwa itu terjadi ketika polisi menyerbu rumah mereka pada Rabu lalu terkait protes mereka terhadap pemadaman listrik yang terjadi terus menerus di Pakistan. Bayi itu berada di dalam rumah saat peristiwa terjadi sehingga ikut diangkut ke kantor polisi dan turut mendapat sidik jari. Kasus ini sontak menuai kemarahan rakyat Pakistan. “Garagara kelalaian polisi, seorang bayi tak berdosa harus dihadapkan ke ruang sidang,” kata pengacara keluarga, Irfan Tarar, seperti dikutip CNN. Menteri Utama Punjab Shahbaz Sharif dimana kasus ini terjadi terpaksa turun tangan dan memerintahkan pembatalan dakwaan terhadap sang bayi. Adapun polisi yang menangani kasus tersebut, Kashif Ahmed, dilaporkan telah diberhentikan sementara. Hakim membebaskan Mosa dengan jaminan dan kasus ini akan dilanjutkan pada 12 April mendatang.


Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ...., Gxc3. 2. Gc4xf7+, BxG. 3. Bd8+, BxB. 4. g4xGf5, Mxb2+mat. (Jika 2. Gc4xMa2, KxG+mat). Jawaban TTS: TTS


Sumber tersebut mengatakan, jalur ini diduga diambil dengan sengaja oleh seseorang di dalam kokpit guna menghindari jangkauan radar Indonesia. Sebelumnya, sempat beredar spekulasi di media Malaysia bahwa Indonesia telah menutupi keberadaan pesawat dengan tidak memberitahu tangkapan radarnya. Hal itu dibantah oleh Menteri Pertahanan Purnomo Yusgiantoro yang mengatakan radar militer RI di Sabang sama sekali tidak menangkap sinyal apapun dari MH370. Misteri mengapa pesawat memutar balik dan menghindari radar baru akan terjawab jika kotak hitam MH370 ditemukan. Diduga, pesawat saat ini jatuh di wilayah Samudera India sebelah barat daya Australia.

Al Bayan...

Jawaban Sudoku: 7 3 6 9 1 4 2 8 5

4 9 2 5 8 6 3 1 7

5 8 1 3 2 7 6 4 9

1 2 4 7 6 5 9 3 8

9 6 5 2 3 8 4 7 1

3 7 8 1 4 9 5 2 6

Waspada/Surya Efendi

BELUM DICOPOT: Poster dan atribut caleg masih melekat di batang pohon Jl. Halat Medan, Minggu (6/4) sore. Semestinya seluruh alat peraga caleg yang menempel di tempat-tempat umum dicopot saat minggu tenang hingga pelaksanaan Pemilu 9 April 2014.

Pada sebelas kasus di antaranya nilai pemberian uang Rp26.000 hingga Rp50.000 dan ada enam kasus pelanggaran dengan nilai pemberian uang antara Rp5.000 dan Rp25.000 per orang. “Dalam temuan kami ada nilai politik uang di atas Rp200.000 sebanyak dua kasus,” ujarnya. Ia menjelaskan praktik politik uang juga dilakukan melalui pemberian barang dan pengobatan gratis. Menurut dia, ICW menemukan 27 kasus pemberian pakaian, 15 kasus pemberian bahan pokok, enam kasus pemberian alat rumah tangga


Ada-ada Saja...

8 4 7 6 9 2 1 5 3

2 1 9 8 5 3 7 6 4

6 5 3 4 7 1 8 9 2

hak asasi manusia (HAM) berlangsung terus. Kejamnya serigala tidak sekejam manusia pembunuh. Pembunuhan pertama adalah Qabil anak Nabi Adam yang membunuh saudaranya sendiri Habil. Kemudian ia memerkosa istri saudaranya itu. Ia juga tercatat sebagai kufur pertama terhadap ajaran Tuhan. Itulah berita kitab suci yang kita baca dalam Taurat, Injil dan Alquran. Semua agama, baik ajaran Ardhy maupun Samawy sepakat bahwa pelanggaran HAM itu perbuatan yang paling biadab. Pelanggar HAM itu akan menerima akibatnya, hukum karma tetap berlaku. Di dunia saja kutukan akan diterima, apalagi di akhirat kelak. Allah menampakkan kekuasaan-

Di depan ratusan warga Muhammadiyah, Asmuni juga mengingatkan, warga Muhammadiyah yang ikut berkompetisi pada Pileg 2014 tidak ikut-ikutkan melakukan black campaigne. Karena secara tegas Alquran surat Alhujrat ayat 12 melarang umat Islam mencaricari kesalahan orang lain dan memburuk-burukan atau menggunjing sebagian yang lain. “Berkompetisilah dengan fair. Sesama sopir angkot (calegRed) jangan saling mendahului,” tandas Ketua PWM Sumut ini. Dalam kesempatan itu, Ketua Pimpinan Daerah Muhammadiyah (PDM) Kota Medan, Adri K SPd dalam sambutannya mengatakan, silaturahmi akbar ini dimaksudkan untuk mendorong seluruh kader Muhammadiyah yang mencalonkan diri menjadi Caleg di berbagai partai politik tetap sukses. “PDM mendorong kaderkader kita memenangi Pileg 2014. Kemenangan kader kita sangat penting. Karena dari sisi

akidah mereka sudah terjamin. Begitu pula dalam sisi moral, mereka amanah, siddiq, tablig dan fathanah,” kata Adri. Dia menegaskan, PDM tidak memihak kepada salah satu partai politik. Sebab yang diinginkan dalam silaturahmi ini adalah memunculkan kebersamaan kepada kader, meski berlainan partai politik. “Kita memandang, perbedaan partai adalah seperti aneka bunga di taman yang indah, dan beragam ikan di aquarium yang indah,” tutur Adri. Ketua LHKP Muhammadiyah Medan, Suheri Harahap, dalam sambutannya mengatakan, silaturahmi akbar ini untuk memperkuat peran politik Muhammadiyah di tengahtengah masyarakat. Bukti dari peranpolitikMuhammadiyahitu, ditunjukkan melalui kaderkadernya yang duduk di legislatif. “Harapan besar tertumpu kepada kader Muhammadiyah. Calegyangberasaldaripartaipolitik, tapi mereka tumbuh dari Muhammadiyah harus kita dukung. Tidak ada alasan kita tidak mendukungkaderkita,”katanya.(h04)

masih fokus di ibu kota kabupaten, yaitu Kec. Kwandang dari ujung Desa Pontolo hingga Pelabuhan Kwandang. Menurut laporan Panitia Pengawas Lapangan (PPL), masih banyak atribut parpol dan alat peraga kampanye terpasang di beberapa kecamatan, termasuk Kec. Tomilito. Panwaslu kabupaten, menurut Jaharudin, sudah berkoordinasi dengan petugas di lapangan untuk membersihkan atribut kampanye dari ujung Buata Kec. Atinggola,

hingga Cempaka Putih Kecamatan Tolinggula. Di Kalimantan Selatan, atribut kampanye masih banyak terpasang di sekitar jalan raya Kabupaten Hulu Sungai Tengah. Petugas terlihat sibuk membersihkan atribut kampanye partai-partai politik di jalan raya Kab. Hulu Sungai Selatan dan Kab. Tapin. Atribut kampanye juga masih terlihat sekitar Sungai Rangas, Kec. Labuan Amas Selatan, dan dekat jalan menuju Kab. Banjar (71 km dari Banjarmasin).

dan lima kasus pemberian hadiah kejutan. Sementara praktik politik uang melalui penyediaan jasa yang ditemukan, kata dia, meliputi delapan kasus pemberian layanan kesehatan. “Momen pengobatan gratis selalu ada ajakan untuk memilih kandidat dan sesuai undang-undang itu dilarang karena mempengaruhi pemilih,” katanya. Selain itu ada lima kasus janji pemberian uang, dua kasus pemberian hiburan atau pertunjukan dan satu kasus pemberian layanan pendidikan. ICW menurut dia juga menemukan penyalahgunaan fasilitas dan jabatan dalam kampanye pemilu seperti

dalam penyediaan alat peraga (16 kasus), penggunaan tenaga aparat pemerintah (11 kasus), penggunaan mobil dinas (enam kasus) dan penggunaan program pemerintah (enam kasus). Selain itu ada lima kasus pemberian bantuan untuk rumah ibadah dan sarana pendidikan serta kampanye tanpa cuti (tiga kasus) dan penggunaan gedung pemerintah (tiga kasus). Abdullah mengatakan politik uang serta penggunaan fasilitas negara dan daerah sebagai instrumen untuk melakukan kampanye pemilihan umum menunjukkan rendahnya integritas para calon anggota legislatif.

gian besar mereka tidak menepati janji tersebut. Sedangkan untuk capres, ia tidak secara secara terbuka mengarahkan pada capres tertentu. “Masyarakat bisa menilai mana bakal capres yang telah mengingkari janjinya,” ujarnya. Ia pun berharap 10 juta anggota SI dapat berperan aktif menjadi pemilih cerdas pada pemilu 2014. Sehingga dapat memperbaiki kualitas para pemimpin sesuai kaidah yang telah disampaikan Alquran dan hadits. Warga SI juga dihimbau tidak terjebak dalam permainan politik uang dan menghindari memilih partai politik

yang menjadi sarang koruptor. Karena jejak korupsi tersebut telah merugikan masyarakat lima tahun lalu. Sehingga bila mereka dipilih kembali mungkin lima tahun mendatang masyarakat kembali dirugikan. “Ini pentingnya melihat caleg muka lama yang pernah ingkar janji agar jangan dipilih,” tegasnya. Selain itu, ia juga meminta agar masyarakat tidak golput pada pemilu mendatang. Karena suara umat Islam sangat menentukan terpilihnya pemimpin bangsa yang berkualitas untuk lima tahun mendatang(rol).

Presiden mendorong kepada semua pihak yang menemukan kecurangan dalam pemilu, agar menempuh jalur dan mekanisme hukum yang ada seperti ke Bawaslu dan MK dan tidak diselesaikan dengan kekerasan atau hal-hal yang menciderai martabat demokrasi. Menurut Presiden, demokrasi di Indonesia ini sudah masuk dan menuju ke deretan negara yang sistem demokrasinya mapan. Hal itu dibuktikan dengan keberhasilan bangsa Indonesia pascareformasi menggelar Pemilu tiga kali, dimana dua kali diantaranya Pemilu langsung dipilih rakyat yang berlangsung lancar dan damai. Untuk itu, Presiden me-

minta kepada TNI dan Polri untuk menjamin Pemilu 2014 harus kembali berlangsung damai dan demokratis. “Situasi politik dan keamanan kita harus stabil, agar pembangunan dan investasi terus tumbuh berkembang,” katanya menegaskan. Presiden memprediksi situasi politik setelah Pemilu Legislatif 9 April 2014 akan semakin dinamis dan panas, karena akan ada peta politik baru menuju Pemilu Presiden 9 Juli 2014 hingga dilantiknya Presiden baru 20 Oktober 2014 nanti. “Saya berharap siapapun yang kalah hendaknya menerima dengan jiwa besar, meskipun kalah itu memang menyakitkan,” katanya.


tambahan, guna menindaklanjuti instruksi pengawasan sebelumnya agar melakukan pendataan kerawanan elektoral khususnya soal potensi manipulasi hasil Pemilu. Semua Parpol Lakukan Politik Uang Hasil pemantauan Indonesia Corruption Watch (ICW) bersama jaringannya di 15 provinsi menunjukkan bahwa Partai Golkar paling banyak melakukan praktik politik uang selama kampanye. “Partai Golkar melakukan 23 pelanggaran politik uang berdasarkan pemantauan awal kami,” kata peneliti bidang korupsi politik ICW Abdullah Dahlan dalam konfe-

rensi pers di Jakarta, Minggu (6/4). Partai Amanat Nasional (PAN), lanjut dia, menempati peringkat kedua yaitu dengan 19 pelanggarandi susul Partai Demokrat dengan 17 kasus, PDI Perjuangan dengan 13 kasus, dan Partai Persatuan Pembangunan dengan 12 kasus. “Semua partai politik nasional melakukan pelanggaran politik uang,” kata Abdullah dan menambahkan, pelaku politik uang dan penyalahgunaan jabatan serta fasilitas negara selama kampanye kebanyakan calon legislatif (96 kasus). Selain itu, menurut laporan ICW, politik uang dilakukan oleh tim sukses (49 kasus), aparat pemerintah (16 kasus),

Tim pencar i mencar i MH370 sekarang menjelajahi Samudera India untuk menyelidiki sejumlah suara yang terdeteksi oleh kapal-kapal di kawasan itu. Namun, belum dipastikan apakah ada suara berasal dari MH370 itu perekam penerbangan , atau kotak hitam. CNN melaporkan bahwa sebuah kapal Angkatan Laut Kerajaan Inggris sedang dalam perjalanan ke suatu daerah di mana sebuah kapal China dilaporkan mengambil sinyal elektronik dua kali. Kapal angkatan laut Australia HMS Ocean Shield juga mengejar suara akustik yang terdeteksi di daerah yang berbeda . Pada konferensi pers, Angus Houston mengatakan deteksi yang memimpin penting dan menggembirakan. Namun, Houston, yang meru-

pakan kepala badan koordinasi operasi pencarian Australia, memperingatkan jangan terlalu gembira dengan banyaknya temuan itu . Saat ini, pencarian dilakukan di wilayah tempat kapal China menangkap sinyal ping dari benda yang diduga kotak hitam. Di sekitar tempat itu juga diketahui banyak terdapat benda putih yang mengambang di permukaan laut. Belum diketahui benda apa dan apakah pesawat berada di tempat itu. MH370 berangkat dari Kuala Lumpur menuju Beijing pada 8 Maret bersama dengan 12 awqak ditambah 227 penumpang. Pesawar itu menghilang pada pukul 01:20 dinihari dan sejak itu tidak ada petunjuk yang dapat memastikan di mana MH370 berada. (malaysiainsider/m10)

Nya kepada kita. Bagaimana nasib akhir yang dialami pelanggar HAM. Raja Fira’un terkutuk karena melanggar hak-hak asasi Nabi Musa as. Dia terpaksa menelan air laut dan tewas terhina. Tuhan mendamparkan mayatnya di pantai laut merah. Bangsa Yahudi dan Romawi terkutuk karena melanggar hak-hak asasi Nabi Isa as. Mereka pernah kelaparan dan diusir bangsa lain dengan penuh kehinaan. Kaum Nazi Jerman pernah membantai mereka, sebab Yahudi dianggap pembunuh Isa. Abu Lahab dan Abu Jahal Cs juga terkutuk karena melanggar hak-hak asasi Nabi Muhammad dan umatnya. Pembunuh Umar bin Khattab, Usman bin Affan telah mengalami nasib yang paling menye-

dihkan di akhir hayat mereka. Yaziz bin Muawiyah yang menyuruh panglimanya menghabisi Husein bin Ali, berselang beberapa bulan, ia mati diinjak kudanya. Gubernur Kufah Ubaidillah bin Ziad yang memerintah panglimanya menghabisi cucu Nabi itu, juga mati dibunuh oleh Gerakan at-Tauwabun yang dibentuk rakyat Kufah. Mayat Ubaidillah bin Ziad dicencangdandaging-dagingnya diberikan kepada anjing. Seharusnya manusia mengambil i’tibar dan i’brah dari sejarah masa lalu. Perbuatan yang melanggar hukum pasti akan tertimpa akibatnya kepadanya. Tidak seorangpun bisa lolos dari hukum karma. Karena itu hargailah sesama manusia, sebab manusia itu telah dimuliakan oleh Tuhan yang mencipta kita manusia.


serta partai dan tim kampanye (tiga kasus). “Sistem proporsional terbuka membuat aktor pelaku politik uang bukan dari instrumen partai namun kandidat dan tim suksesnya,” kata Abdullah. ICW menemukan 60 kasus politik uang dalam pencalonan anggota DPRD Kabupaten/ Kota, 37 kasus serupa dalam pencalonan anggota DPR, 31 kasus dalam pencalonan anggota DPRD Provinsi, dan tujuh kasus pencalonan anggota DPD. “Dominan pelanggaran di DPRD Kabupaten/ Kota, menandakan wilayah pertarungan yang ketat dan marak terjadi transaksi politik ada di wilayah tersebut,” ujarnya. Abdullah menambahkan, daerah yang tercatat punya kasus politik uang paling banyak yakni Provinsi Riau (32 kasus), Sumatera Utara (18 kasus), Banten (16 kasus), Sulawesi Utara (14 kasus), dan Jawa Barat (12 kasus). ICW dan mitra jaringannya melakukan pemantauan di Aceh, Sumatera Utara, Sumatera Barat, Riau, Bengkulu, Banten, DKI Jakarta, Jawa Barat, dan Jawa Tengah, Jawa Timur, Kalimantan Barat, Sulawesi Selatan, Sulawesi Tenggara, Nusa Tenggara Barat, dan Nusa Tenggara Timur. (vn/m09)

janji yang sudah disumpahkan kepadanya,” ujar Rahardjo, Minggu (6/4). Dalam Islam, katanya, pemimpin penting untuk memegang janji yang telah diucapkan. Jika terbukti melanggar janji tersebut, maka sudah menjadi kewajiban bagi ormas untuk mengingatkan. Rahadjo mengungkapkan, hal ini tidak untuk merujuk pada satu kasus saja. Tetapi kepada calon wakil rakyat yang hampir sebagian besar merupakan wajah lama. Mereka yang pada pemilu sebelumnya pernah berjanji. Namun seba-

Presiden:... pemilu, lanjut Presiden, terjadi bila sistem dan UndangUdang Pemilu dikooptasi oleh kepentingan mayoritas tunggal partai tertentu dan KPU, Bawaslu serta MK tidak independen atau bekerja dalam pengaruh kekuasaan pihak tertentu. “Di era sekarang ini sangat sulit. Dari pusat sampai daerah, semua partai saling mengawasi. Di TPS ada saksi, dihitung di tingkat PPS, kecamatan, kabupaten, provinsi hingga ke pusat saling diawasi oleh semua partai, apalagi sekarang ini ada IT (Teknologi informasi) yang bisa mengawal penghitungan,” kata Presiden.


Berita Utama

WASPADA Senin 7 April 2014

Pileg Di LN Berakhir JAKARTA (Waspada):Proses pemungutan suara pemilihan umum (Pemilu) legislatif 2014 di luar negeri berakhir Minggu (6/4). Pemungutan suara di masing-masing tempat atau negara tidak digelar pada waktu yang sama atau serentak, melainkan menyesuaikan kondisi masing-masing negara yakni antara 30 Maret-6 April 2014. Alasannya, agar warga negara Indonesia di sana dapat menggunakan hak pilihnya dengan lebih baik. Pada Minggu, pemungutan suara dilakukan di sejumlah tempat seperti di Ibu Kota Turki, Ankara dan di Ibu KotaYunani, Athena. Berikut daftar tempat yang menggelar Pemilu pada Minggu: 12. Mexico City 1. Guangzhou 13. New Delhi 2. Hanoi 14. Paris 3. Ho Chi Minh 15. Pyong Yang 4. Istanbul 16. Roma 5. Johor Baru 17. Singapura 6. Kota Kinabalu 18. Taiwan 7. Kuala Lumpur 19. Tokyo 8.Kuching 20. Vatikan 9. Lisabon 21. Ankara, Turki 9. Madrid 22. Athena, Yunani 10. Manila 23. Beirut.(vn/m09) 11. Marseille Antara

KAMPANYEKAN AGENDA POLITIK PEREMPUAN: Sejumlah perempuan yang tergabung dalam Indonesia Beragam menggelar aksi di kawasan Bundaran HI, Jakarta, Minggu (6/4). Aksi tersebut dalam rangka mengkampanyekan 10 agenda politik perempuan kepada 12 Partai Politik peserta pemilu 2014.

Semua Parpol Lakukan Politik Uang JAKARTA (Antara): Hasil pemantauan Indonesia Corruption Watch (ICW) bersama jaringannya di 15 provinsi menunjukkan bahwa Partai Golkar paling banyak melakukan praktik politik uang selama kampanye.

“Partai Golkar melakukan 23 pelanggaran politik uang berdasarkan pemantauan awal kami,” kata peneliti bidang korupsi politik ICW Abdullah Dahlan dalam konferensi pers di Jakarta, Minggu (6/4).

Pemasok Ekstasi Dari ... internasional ini melakukan aksi,” kata Dony. Dijelaskanya, penangkapan ini berawal dari informasi warga tentang adanya pengedar narkoba menginap di Hotel Lubuk Raya di Jl. SM Raja Medan. “Untuk memancing tersangka, polisi menyaru sebagai pembeli memesan 380 butir ekstasi dan janji bertemu dengan tersangka DO di Jl. Adinegoro Medan. Begitu tersangka menunjukkan ekstasi langsung ditangkap,” jelas Dony. Dalam pengembangan kasus, DO mengaku mereka beraksi tiga orang. Kepada petugas, RO mengaku mendapatkan narkoba dari temannya bernama B, warga asal Malaysia. “Kami dapat barang itu, dari B tinggal di Malaysia yang membawa ekstasi ke Medan,” katanya. Menurut RO, ekstasi dari Medan rencananya dibawa ke Jawa Timur melalui jalan darat. Secara terpisah, Sat Res Narkoba Polresta Medan juga menangkap AM, 37, warga Jl. Kail, Lingk. 4, Sei Mati, Medan Labuhan, AF, 28, warga Jl. Jermal Raya, Lorong 3, Lingk. 10, Sei Mati, Medan Labuhan di Pasar 1 Tengah, Kel. Tanah 600, Medan Marelan, dengan barang bukti 25 gram sabu dibungkus 3 plastik klip transparan. Sedangkan RAR diamankan dari depan diskotik Delta Jl. Ir. Juanda Medan dengan barang bukti 50 butir pil ekstasi. Pengakuan RAR, ia memperoleh ekstasi dari A, warga Bireuen sebanyak 150 butir dan telah terjual 100 butir kepada pengunjung diskotik Zoone dan Delta dengan harga Rp70 ribu per butir. Polisi juga menangkap SD, 29, warga Jl. Pinang Baris Lingk. I Gang Rasmi, Kel. Sunggal, Kec. Medan Sunggal, dan SJ, 42, warga Jl. Metal, Kel. Tanjung Mulia dalam penyergapan di Jl. Pinang Baris Medan. Dari tersangka disita barang bukti 24 gram sabu dan dua HP. Keduanya ditangkap saat transaksi narkoba dengan polisi yang menyaru sebagai pembeli. (m39)

Rp451,3 M Harta Bill Gates ... sindroma merapuhnya kekebalan tubuh (HIV-AIDS), demam berdarah dan keluarga berencana (KB). Untuk itu, ia mengharapkan, kedatangan Bill Gates dapat menginspirasi pengusaha lokal untuk berdonasi di Indonesian Health Fund. Dia mengharapkan, donasi tersebut bersifat sistemik dan akuntabel untuk memberikan kepastian pada penanganan sejumlah penyakit yang kini masih menjadi masalah serius di Indonesia. Meski sebagian besar pengusaha lokal sudah memiliki program kemanusiaan melalui aksi tanggung jawab sosial perusahaan (CSR), ia menilai, belum bersifat sistemik dan akuntabel. “Padahal, masih banyak penyakit menular yang menjadi masalah serius seperti tuberculosis malaria, HIV/AIDS, deman berdarah dengue dan sebagainya,” katanya. Penyakit-penyakit tersebut, kata Agung, tidak mungkin ditangani secara sendiri oleh pemerintah melalui alokasi dana anggaran pendapatan dan belanja negara (APBN). Untuk itu, Agung mengatakan, pengusaha lokal bisa membantu dengan cara melakukan hal yang sama layaknya Bill Gates.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ...., Gxc3. 2. Gc4xf7+, BxG. 3. Bd8+, BxB. 4. g4xGf5, Mxb2+mat. (Jika 2. Gc4xMa2, KxG+mat). Jawaban TTS: TTS


Ada-ada Saja ... Seperti dilansir laman AlArabiya, Sabtu 5 April 2014, Mohammad Mosa Khan hadir di depan sidang dengan dipangku kakeknya. Dia terlihat minum susu dari botol. Sang kakek dan beberapa anggota keluarganya menghadapi tuduhan melawan upaya penangkapan dan memukuli sejumlah aparat dengan tongkat hingga luka parah. Peristiwa itu terjadi ketika polisi menyerbu rumah mereka pada Rabu lalu terkait protes mereka terhadap pemadaman listrik yang terjadi terus menerus di Pakistan. Bayi itu berada di dalam rumah saat peristiwa terjadi sehingga ikut diangkut ke kantor polisi dan turut mendapat sidik jari. Kasus ini sontak menuai kemarahan rakyat Pakistan. “Gara-gara kelalaian polisi, seorang bayi tak berdosa harus dihadapkan ke ruang sidang,” kata pengacara keluarga, Irfan Tarar, seperti dikutip CNN. Menteri Utama Punjab Shahbaz Sharif dimana kasus ini terjadi terpaksa turun tangan dan memerintahkan pembatalan dakwaan terhadap sang bayi. Adapun polisi yang menangani kasus tersebut, Kashif Ahmed, dilaporkan telah diberhentikan sementara. Hakim membebaskan Mosa dengan jaminan dan kasus ini dilanjutkan 12 April mendatang.

Partai Amanat Nasional (PAN), lanjut dia, menempati peringkat kedua yaitu dengan 19 pelanggarandi susul Partai Demokrat dengan 17 kasus, PDI Perjuangan dengan 13 kasus, dan Partai Persatuan Pembangunan dengan 12 kasus. “Semua partai politik nasional melakukan pelanggaran politik uang,” kata Abdullah dan menambahkan, pelaku politik uang dan penyalahgunaan jabatan serta fasilitas negara selama kampanye kebanyakan calon legislatif (96 kasus). Selain itu, menurut laporan ICW, politik uang dilakukan oleh tim sukses (49 kasus), aparat pemerintah (16 kasus), serta partai dan tim kampanye (tiga kasus). “Sistem proporsional terbuka membuat aktor pelaku politik uang bukan dari instrumen partai namun kandidat dan tim suksesnya,” kata Abdullah. ICW menemukan 60 kasus politik uang dalam pencalonan anggota DPRD Kabupaten/ Kota, 37 kasus serupa dalam pencalonan anggota DPR, 31 kasus dalam pencalonan anggota DPRD Provinsi, dan tujuh kasus pencalonan anggota DPD. “Dominan pelanggaran di DPRD Kabupaten/ Kota, menandakan wilayah pertarungan yang ketat dan marak terjadi transaksi politik ada di wilayah tersebut,” ujarnya. Abdullah menambahkan, daerah yang tercatat punya kasus politik uang paling banyak yakni Prov. Riau (32 kasus), Sumatera Utara (18 kasus), Banten (16 kasus), Sulawesi Utara (14 kasus), dan Jawa Barat (12 kasus). ICW dan mitra jaringannya melakukan pemantauan di Aceh, Sumatera Utara, Sumatera Barat, Riau, Bengkulu, Banten, DKI Jakarta, Jawa Barat, dan Jawa Tengah, Jawa Timur, Kalimantan Barat, Sulawesi Selatan, Sulawesi Tenggara, Nusa Tenggara Barat, dan NusaTenggaraTimur.

‘Saya Tetap Warga ... ‘’ Sudah lama, lebih tigapuluh tahun saya di Deliserdang,’’ kata H.Amri Tambunan yang kader Partai Demokrat itu. Didampingi, istri Hj.Anita Amri Tambunan, Assisten I H. Syafrullah,S.Sos MAP dan Kadis Cipta Karya M.Haris, H. Amri Tambunan mengatakan, dia dan keluarganya tidak bisa dipisahkan dari warga Deliserdang. Duakui Amri, selama sepuluh tahun memimpin di Deliserdang banyak kenangan yang tersimpan, baik kenangan manis maupun kenangan pahit. ‘’Tetapi warga masyarakat Deliserdang yang beragam etnis telah menunjukkan dukungan moral yang cukup tinggi sehingga saya bisa bekerja membangun daerah ini. Saya mengucapkan terima kasih dan mohon maaf,’’ ujar Amri dan berharap jabatan tidak memutuskan tali persaudaraan. Demikian juga kepada para SKPD, staf dan jajarannya, juga penggantinya sebagai bupati, H. Amri Tambunan berpesan agar fundasi yang telah diletakkannya sebagai dasar membangun Deliserdang secara utuh melalui program Gerakan Deliserdang Membangun (GDSM) selama sepuluh tahun jabatannya, dapat dilanjutkan agar Deliserdang ke depan lebih bermartabat. (m11/a06)

Al Bayan ...

Jawaban Sudoku: 7 3 6 9 1 4 2 8 5

4 9 2 5 8 6 3 1 7

5 8 1 3 2 7 6 4 9

1 2 4 7 6 5 9 3 8

9 6 5 2 3 8 4 7 1

3 7 8 1 4 9 5 2 6

8 4 7 6 9 2 1 5 3

2 1 9 8 5 3 7 6 4

6 5 3 4 7 1 8 9 2

Sepanjang sejarah kemanusiaan pelanggaran hak-hak asasi manusia (HAM) berlangsung terus. Kejamnya serigala tidak sekejam manusia pembunuh. Pembunuhan pertama adalah Qabil anak Nabi Adam yang membunuh saudaranya sendiri Habil. Kemudian ia memerkosa istri saudaranya itu. Ia juga tercatat sebagai kufur pertama terhadap ajaran Tuhan. Itulah berita kitab suci yang kita baca dalam Taurat, Injil dan Alquran. Semua agama, baik ajaran Ardhy maupun Samawy sepakat bahwa pelanggaran HAM itu perbuatan yang paling biadab. Pelanggar HAM itu akan menerima akibatnya, hukum karma tetap berlaku. Di dunia saja kutukan akan diterima, apalagi di akhirat kelak. Allah menampakkan kekuasaan-Nya kepada kita. Bagaimana nasib akhir yang dialami pelanggar HAM. Raja Fira’un terkutuk karena melanggar hakhak asasi Nabi Musa as. Dia terpaksa menelan air laut dan tewas terhina. Tuhan mendamparkan mayatnya di pantai laut merah. Bangsa Yahudi dan Romawi terkutuk karena melanggar hak-

Presiden: Tak Ada ... Presiden, terjadi bila sistem dan Undang-Udang Pemilu dikooptasi oleh kepentingan mayoritas tunggal partai tertentu dan KPU, Bawaslu serta MK tidak independen atau bekerja dalam pengaruh kekuasaan pihak tertentu. “Di era sekarang ini sangat sulit. Dari pusat sampai daerah, semua partai saling mengawasi. Di TPS ada saksi, dihitung di tingkat PPS, kecamatan, kabupaten, provinsi hingga ke pusat saling diawasi oleh semua partai, apalagi sekarang ini ada IT (Teknologi informasi) yang bisa mengawal penghitungan,” kata Presiden. Presiden mendorong kepada semua pihak yang menemukan kecurangan dalam pemilu, agar menempuh jalur dan mekanisme hukum yang ada seperti ke Bawaslu dan MK dan tidak diselesaikan dengan kekerasan atau halhal yang menciderai martabat demokrasi. Menurut Presiden, demok-

Hindari Politik ... Kader Muhammadiyah yang berkompetisi pada Pemilu Legislatif 2014, di Hotel Madani Medan, Sabtu (5/4) malam. Silaturahmi yang digelar Lembaga Hikmah dan Kebijakan Publik (LHKP) Pimpinan Daerah Muhammadiyah (PDM) Medan itu, dihadiri 43 Caleg lintas Parpol Dapil Kota Medan dan Deliserdang. Di depan ratusan warga Muhammadiyah, Asmuni juga mengingatkan, warga Muhammadiyah yang ikut berkompetisi pada Pileg 2014 tidak ikutikutkan melakukan black campaign. Karena secara tegas Alquran surat Alhujrat ayat 12 yang artinya melarang umat Islam mencari-cari kesalahan orang lain dan memburuk-burukan atau menggunjing sebagian yang lain. “Berkompetisilah dengan fair. Sesama sopir angkot (caleg-Red) jangan saling mendahului,” tandas Ketua PWM Sumut ini. Dalam kesempatan itu, Ketua Pimpinan Daerah Muhammadiyah (PDM) Kota Medan, Adri K SPd dalam sambutannya mengatakan, silaturahmi akbar ini dimaksudkan untuk mendorong seluruh kader Muhammadiyah yang mencalonkan diri menjadi Caleg di berbagai partai politik tetap sukses. “PDM mendorong kaderkader kita memenangi Pileg 2014. Kemenangan kader kita sangat penting. Karena dari sisi akidah mereka sudah terjamin. Begitu pula dalam sisi moral, mereka amanah, siddiq, tablig dan fathanah,” kata Adri. Dia menegaskan, PDM tidak memihak kepada salah satu partai politik. Sebab yang diinginkan dalam silaturahmi ini adalah memunculkan kebersamaan kepada kader, meski berlainan partai politik. “Kita memandang, perbedaan partai adalah seperti aneka bunga di taman yang indah, dan beragam ikan di aquarium yang indah,” tutur Adri. Ketua LHKP Muhammadiyah Medan, Suheri Harahap, dalam sambutannya mengatakan, silaturahmi akbar ini untuk memperkuat peran politik Muhammadiyah di tengahtengah masyarakat. Bukti dari peran politik Muhammadiyah itu, ditunjukkan melalui kaderkadernya yang duduk di legislatif. “Harapan besar tertumpu kepada kader Muhammadiyah. Caleg yang berasal dari partai politik, tapi mereka tumbuh dari Muhammadiyah harus kita dukung. Tidak ada alasan kita tidak mendukung kader kita,” katanya. Jangan Tertipu Popularitas Syarikat Islam mengimbau

hak asasi Nabi Isa as. Mereka pernah kelaparan dan diusir bangsa lain dengan penuh kehinaan. Kaum Nazi Jerman pernah membantai mereka, sebab Yahudi dianggap pembunuh Isa. Abu Lahab dan Abu Jahal Cs juga terkutuk karena melanggar hak-hak asasi Nabi Muhammad dan umatnya. Pembunuh Umar bin Khattab, Usman bin Affan telah mengalami nasib yang paling menyedihkan di akhir hayat mereka. Yaziz bin Muawiyah yang menyuruh panglimanya menghabisi Husein bin Ali, berselang beberapa bulan, ia mati diinjak kudanya. Gubernur Kufah Ubaidillah bin Ziad yang memerintah panglimanya menghabisi cucu Nabi itu, juga mati dibunuh oleh Gerakan at-Tauwabun yang dibentuk rakyat Kufah. Mayat Ubaidillah bin Ziad dicencang dan daging-dagingnya diberikan kepada anjing. Seharusnya manusia mengambil i’tibar dan i’brah dari sejarah masa lalu. Perbuatan yang melanggar hukum pasti akan tertimpa akibatnya kepadanya. Tidak seorangpun bisa lolos dari hukum karma. Karena itu hargailah sesama manusia, sebab manusia itu telah dimuliakan oleh Tuhan yang mencipta kita manusia.

rasi di Indonesia ini sudah masuk dan menuju ke deretan negara yang sistem demokrasinya mapan. Hal itu dibuktikan dengan keberhasilan bangsa Indonesia pascareformasi menggelar Pemilu tiga kali, dimana dua kali diantaranya Pemilu langsung dipilih rakyat yang berlangsung lancar dan damai. Untuk itu, Presiden meminta kepada TNI dan Polri untuk menjamin Pemilu 2014 harus kembali berlangsung damai dan demokratis. “Situasi politik dan keamanan kita harus stabil, agar pembangunan dan investasi terus tumbuh berkembang,” katanya menegaskan. Presiden memprediksi situasi politik setelah Pemilu Legislatif 9 April 2014 akan semakin dinamis dan panas, karena akan ada peta politik baru menuju Pemilu Presiden 9 Juli 2014 hingga dilantiknya Presiden baru 20 Oktober 2014 nanti. “Saya berharap siapapun yang kalah hendaknya menerima dengan jiwa besar, meskipun kalah itu memang menyakitkan,” katanya. agar umat Muslim jangan memilih calon pemimpin yang tak amanah dan ingkar janji. Umat pun diminta tak tertipu oleh popularitas caleg atau capres tertentu. Ketua Umum Pimpinan Pusat (PP) Syarikat Islam (SI) Rahardjo Tjakraningrat meminta umat mencari informasi mendalam terkait para pemimpin yang ada. Sehingga tak tertipu hingga lima tahun ke depan. “Kita imbau agar umat cerdas memilih pemimpin, bukan hanya populer. Dilihat juga apakah ia pernah mengingkari janji yang sudah disumpahkan kepadanya,” ujar Rahardjo, Minggu (6/4). Dalam Islam, katanya, pemimpin penting untuk memegang janji yang telah diucapkan. Jika terbukti melanggar janji tersebut, maka sudah menjadi kewajiban bagi ormas untuk mengingatkan. Rahadjo mengungkapkan, hal ini tidak untuk merujuk pada satu kasus saja. Tetapi kepada calon wakil rakyat yang hampir sebagian besar merupakan wajah lama. Mereka yang pada pemilusebelumnyapernahberjanji. Namun sebagian besar mereka tidak menepati janji tersebut. Sedangkan untuk capres, ia tidak secara secara terbuka mengarahkan pada capres tertentu. “Masyarakat bisa menilai mana bakal capres yang telah mengingkari janjinya,” ujarnya. Ia pun berharap 10 juta anggota SI dapat berperan aktif menjadi pemilih cerdas pada pemilu 2014. Sehingga dapat memperbaiki kualitas para pemimpin sesuai kaidah yang telah disampaikan Alquran dan hadits. Warga SI juga dihimbau tidak terjebak dalam permainan politik uang dan menghindari memilih partai politik yang menjadi sarang koruptor. Karena jejak korupsi tersebut telah merugikan masyarakat lima tahun lalu. Sehingga bila mereka dipilih kembali mungkin lima tahun mendatang masyarakat kembali dirugikan. “Ini pentingnya melihat caleg muka lama yang pernah ingkar janjiagarjangandipilih,”tegasnya. Selain itu, ia juga meminta agarmasyarakattidakgolputpada pemilu mendatang. Karena suara umat Islam sangat menentukan terpilihnya pemimpin bangsa yang berkualitas untuk lima tahun mendatang. (h04/rp)


PRESIDEN NYEKAR: Presiden Susilo Bambang Yudhoyono bersama Ibu Negara Ani Yudhoyono dan kedua putranya melakukan nyekar (mengunjungi makam) ayahandanya almarhum Soekotjo di TMP Nasional Bunga Bangsa Pacitan Jawa Timur, Minggu sore (6/4).

SBY Bicara Soal Jokowi JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono (SBY) untuk pertama kalinya menanggapi keraguan sejumlah pihak terhadap prospek pemerintahan mendatang jika Gubernur DKI Joko Widodo yang menjadi calon Presiden PDIP terpilih menjadi Presiden Republik Indonesia 2014-2019. Dalam laman Sekretariat Negara danYoutube yang disiarkan kemarin, SBY meminta rakyat tidak perlu buru-buru menilai Jokowi tidak mampu, namun dia menyarankan Jokowi bisa menyampaikan pikiran, solusi dan kebijakan-kebijakan yang akan diambilnya untuk

Asrin Naim Plh ... Gubsu, Arsyad Lubis, Kabiro Otda Jimmy Pasaribu di Kantor Gubsu, Minggu (6/4) malam. “Masa jabatan Bupati dan Wakil Bupati Deliserdang periode 2009-2014, berakhir pada 7 April 2014.Keputusan Mendagri tentang pengangkatan Bupati dan Wakil Bupati sudah ditetapkan. Tetapi karena masalah teknis fokus pada Pemilu Legilsatif, pelantikan ditunda dan akan dikoordinasikan waktunya,” ujarnya. Berdasar surat keputusan Mendagri Nomor T.131.12/ 1546/OTDA tertanggal 4 April 2014, menyatakan, sehubungan dengan hal tersebut agar Gubsu memberitahukan kepada Sekda Kab. Deliserdang untuk melaksanakantugassebagaibupatiDeliserdang sejak Bupati danWakil Bupati Deliserdang habis masa jabatannya, sampai dilantiknya Bupati dan Wakil Bupati masa jabatan tahun 2014/2019. Selain itu, pengangkatan Plh Bupati Deliserdang H Asrin Naim, katanya, sesuai pasal 35 ayat (4) UU Nomor 32 tahun 2004 yang menyatakan antara lain dalam hal terjadinya kekosongan kepala daerah dan wakil kepala daerah, Sekda ditunjuk melaksanan tugas sehari-hari sebagai kepala daerah. Sekda Provsu juga mengatakan, tugas yang dilaksanakan oleh Plh Bupati Deliserdang juga harus dikoordinasikan dan dikonsultasikan dengan Gubsu, apabila ada hal-hal yang bersifat prinsip dan strategis. Sementara itu, informasi berkembang di Deliserdang, pelantikan kemungkinan akan dilaksanakan pada 14 April 2014, mengingat warga Deliserdang membutuhkan pemimpin definitif untuk melanjutkan pembangunan di kabupaten itu. (m28)

Semua Alat Peraga ... “Penertiban kita lakukan sesuai rekomendasi dari Panwas. Kalau mereka meminta ditertibkan semuanya, maka kita tertibkan,” kata Sofyan. Dikatakan Sofyan, pada malam itu juga petugas dibagi di seluruh kecamatan untuk menurunkan APK. “Kita harapkan sebelum Pemilu semua APK sudah diturunkan sesuai arahan pak wali,” ujarnya. Penertiban APK ini diawali dengan menurunkan Baleho milik Iskandar,ST calon DPR RI yang berada di Jln. Raden Saleh Medan tepatnya tidak jauh dari KantorWali Kota Medan. (m50)

mengatasi permasalahan bangsa yang begitu kompleks. “Dengan cara beliau menyampaikan itu, berdebat di sana sini, rakyat akan tahu apa yang dimiliki oleh Pak Jokowi dan dimiliki oleh capres-capres yang lain. Dengan demikian, pada saatnya nanti akan bisa menentukan siapa yang dianggap paling baik dan paling tepat untuk menjadi Presiden setelah saya nanti,” kata SBY. SBY juga menilai rakyat tidak keliru jika mengharapkan Jokowi akan mudah didikte pihak lain jika menjadi Presiden RI nanti, karena penting bagi Jokowi atau siapa pun yang terpilih menjadi Presiden nanti untuk tidak tunduk pada diktasi siapapun, entah pemilik modal, pihak-pihak tertentu, atau asing. SBY menyebutkan, selama 10 tahun menjadi Presiden dia tidak bisa didikte siapa pun. “Itu amanat saya. Itu sikap saya, meskipun saya diawasi oleh DPR,

oleh lembaga-lembaga negara, dan rakyat,” katanya. SBY menegaskan, tidak ada yang boleh mengontrol dan mendikte seorang Presiden dalam mengambil keputusan atau bersikap politik, baik urusan dalam negeri maupun luar negeri. “Oleh karena itu, ini jadi tantangan dan harapan saya. Tentu pengganti saya nanti betul-betul mendengarkan apa yang hidup di kalangan rakyat sekarang ini,” pesan SBY. Dalam Youtube, SBY juga ditanyau pendapatnya soal saling serang antara kubu Prabowo Subianto dan kubu Megawati Soekarnoputri terkait perjanjian Batu Tulis, Bogor, yang menyangkut Calon Presiden 2014 yang akan didukung kedua kubu. Saya lebih bagus tidak berkomentar, yang lebih bagus yang menjelaskan Ibu Megawati sendiri. Kalau Pak Prabowo berbicara seperti itu, berikanlah penjelasan kepada publik dengan benar.

Denyut Sinyal Black Box MH370 Diburu PERTH, Australia (AP): Tiga sinyal yang muncul sekilas-sekilas secara terpisah dari arah kedalaman Samudera India memberikan harapan baru bagi perburuan pesawat Malaysia Airlines MH370 yang hilang. Para pejabat segera bergegas untuk menentukan, apakah sinyal tersebut dari kotak hitam pesawat sinyal elektronik tersebut terdiam. Kepala pencarian multinasional MH370 yang dilakukan di lepas pantai barat Australia menegaskan kapal China telah menangkap sinyal elektronik dua kali dalam sebuah patch kecil dari zona pencarian, setelah Jumat dan sekali lagi Sabtu. Minggu (6/4), sebuah kapal Australia yang membawa peralatan canggih pencari suara dari kedalaman laut untuk melacak ‘denyut’ sinyal ketiga di bagian berbeda dari daerah pencarian besar-besaran di lepas pantai Australia. “Ini merupakan satu kemajuan dan memberi dorongan, namun salah satu yang saya desak agar memperlakukannya secara hati-hati,” kata Marsekal Madya (Pensiunan) Angus Houston dari Australia, yang memimpin pencarian itu kepada para wartawan di Perth. (m10)

MH370 Putari Indonesia ... kesimpulang penyidik, kata dia, setelah hilang dari radar dalam perjalanan dari Kuala Lumpur ke Beijing, pesawat Boeing 777200 itu terbang di utara Indonesia. Setelah itu, pejabat Malaysia yang tidak disebutkan namanya ini mengatakan, MH370 terbang memutari Indonesia menuju wilayah selatan Samudera Hindia. Hal ini disimpulkan setelah penyidik melihat data pelacakan radar dari beberapa negara tetangga. “Pesawat tidak terbang di atas Indonesia atau melalui wilayah udaranya setelah terbang ke Barat di Laut China Selatan dan menuju Semenanjung Malaysia,” kata sumber yang dikutip CNN. Sumber mengatakan, jalur ini diduga diambil dengan sengaja oleh seseorang di dalam kokpit untuk menghindari jangkauan radar Indonesia. Sebelumnya, sempat beredar spekulasi di media Malaysia bahwa Indonesia telah menutupi keberadaan pesawat dengan tidak memberitahu tangkapan radar mereka. Hal ini sempat dibantah oleh Menteri Pertahanan Purnomo Yusgiantoro yang mengatakan radar militer RI di Sabang sama sekali tidak menangkap sinyal apapun dari MH370. Diduga, pesawat saat ini jatuh di wilayah Samudera Hindia sebelah barat daya Australia. Saat ini, pencarian dilakukan di wilayah tempat kapal China menangkap sinyal ping dari benda yang diduga kotak hitam. (malaysiainsider/m10)

Suhu Keamanan Di Aceh ... khawatir. Hal itu, menurut dia, karena saudara yang mengeluarkan isu boikot itu menjadi caleg sehingga bisa diredam. Dia juga menjelaskan adanya insiden pengibaran bendera bintang Kejora oleh sekelompok orang namun segera ditindak dengan penurunan bendera tersebut dan pelaku melarikan diri ke Papua Nugini. Selain itu dalam teleconference itu dilaporkan mengenai kontribusi TNI AD dalam distribusi logistik Pemilu 2014 yang secara umum berjalan dengan lancar. Namun ada beberapa daerah terkendala dalam distribusi logistik tersebut. Pangdam VII/ Wirabuana Mayjen TNI Bachtiar melaporkan distribusi logistik sudah berjalan 99 persen dan untuk Kepulauan Miangas sedang dalam perjalanan sehingga diperkirakan pada Senin (7/4) pagi sudah sampai. Teleconference itu juga dihadiri Ketua Komisi Pemilihan Umum Husni Kamil Manik.

Luar Negeri

WASPADA Senin 7 April 2014

Pemilu Afghanistan Sukses Meski Diancam Taliban KABUL, Afghanistan (Waspada): Sejumlah pemimpin dunia memuji pemilihan umum presiden di Afghanistan dengan mendeskripsikannya sebagai pemungutan suara yang sukses.Lebih dari tujuh juta dari 12 juta - yang memiliki hak pilih - ikut ambil bagian dalam Pemilu presiden pertama melalui kotak suara. Antrian panjang terlihat di luar tempat pemungutan suara (TPS) yang dibentuk di kota-kota diseluruhnegeri,meskipuncuaca basah dingin, pada saat pemilih memberikansuaradisekitar6.000 TPS di bawah pengamanan ketat Sabtu (5/4). Sementarapemungutansuaradidaerah-daerahperkotaanberlangsung cepat, tidak jelas seperti

apapemungutansuarayangterjadi di daerah-daerah pedesaan. Talibantelahmenolakpemilu sebagai plot asing dan mendesak para pejuang mereka untuk menyerang staf TPS, pemilih dan pasukan keamanan, tetapi hanya terdapat satu insiden yang dilaporkan dalam beberapa jam pertama pemungutan suara. Namunadasejumlahlaporan

mengenaikurangnyakertassuara dan kekerasan yang sporadis di seluruh negeri. Sebuah operasi besar-besarandiluncurkanuntuk menggagalkan upaya Taliban yang sebelumnya bersumpah Klik untuk mengacaukan pemilu. Hujan lebat mungkin juga membuat sejumlah warga di daerah tertentu mengurungkan niat merekamencoblos.Delapankandidat bertarung untuk menggantikan Hamid Karzai, dengan hasilyangdiharapkanakankeluar dalam beberapa hari ke depan. Setelah pemungutan suara usai, Karzai mengatakan: “Meskipun cuaca dingin dan hujan, serta kemungkinan ada serangan teroris, saudara-saudara telah mengambil bagian dalam pemilu dan partisipasi mereka merupakan langkah maju, dan itu adalah

AS Kirim Kapal Anti-Rudal, Bantu Jepang Hadapi Korut TOKYO, Jepang (Antara/ AFP): Amerika Serikat berencana untukmengirimduakapalperang anti rudal tambahan ke Jepang untuk mengantisipasi ancaman Korea Utara (Korut) yang baru-

baru ini melakukan tindakan “provokatif”, demikian Menteri Pertahanan Chuck Hagel mengatakan Minggu (6/4). “Sebagairesponatastindakan provokatif yang membahayakan

Tingkat Partisipasi Pemilih WNI Di Malaysia ‘Rendah’ KUALALUMPUR,Malaysia(Waspada):Tigajamsebelumtempat pemungutan suara ditutup, baru sekitar 1.000 orang memberikan suaranyadalampemilulegislatifIndonesiadiKualaLumpur,Malaysia, padahal terdapat 322.429 pemilih yang terdaftar untuk mencoblos langsung Minggu (6/4). Daftar pemilih tetap (DPT) untuk kawasan pemilihan Kuala Lumpur dan sekitar mencapai 402.730, sebanyak 322.429 seharusnya mencoblos langsung. Sedangkan sisanya terdaftar memilih melalui pos dan dropbox atau lewat kotak undi yang diantar ke lokasi di dekat tempat kerja pemilih.Namun kenyataannya tingkat partisipasi pemilih langsung sangat rendah. “Memang ini tantangan yang paling besar di Kuala Lumpur khususnya karena walaupun hari Minggu masyarakat kita tetap bekerja. WNI kita adalah WNI pekerja,” kata Ketua Panitia Luar Negeri di Malaysia melalui telefon. “Mereka yang terdaftar dalam DPT tidak datang, yang datang justru yang tidak terdaftar dalam DPT.” Mereka yang tidak terdaftar akhirnya diizinkan untuk memilih setelah proses pencoblosan di Kuala Lumpur sudah berjalan lebih dari separuh dengan menggunakan kertas suara tambahan. Keputusan ini, kata Freddy Panggabean, atas arahan dari KPU pusat di Jakarta.Para pemilih menggunakan suara mereka lewat dropbox di sebuah pabrik di Selangor.(bnm/m10)

Penculik Di Semporna Hubungi Keluarga Sandera Wanita China KUCHING,Serawak(Waspada):Kelompokpenculikyangmenyekap dan melarikan seorang wisatawan China di sebuah resort atas air, Singamata Adventures Reef and Resort di Semporna, telah menghubungi keluarga wanita itu. Ketua Pengarah Kawasan Keselamatan Khas Pantai Timur Sabah (Esscom) Mohammad Mentek mengesahkan perkara itu namun sampai saat ini belum ada tuntutan yang diajukan.”Keluarga sandera sendiri diberi peluang bercakap dengan korban melalui telefon.Kedua-duasanderaberadadalamkeadaansehatdanselamat,” katanya dalam satu kenyataan Sabtu *5/4). Sehubungan itu, beliau berkata pihak Esscom akan melancarkan operasi pemeriksaan ke atas kompleks wisata di sekitar Semporna dalam waktu dekat guna memastikan tidak pekerja asing di kawasan Zona Keselamatan Khas Pantai Timur Sabah (Esszone). Dalamkejadianpadakira-kira10:30malamRabulepas,kelompok tujuhlelakibersenjatamenyusupkekawasanwisataitudanmelarikan Gao HuaYuan, 29, dari Shanghai serta seorang pekerja resort warga Filipina, Marcy Dayawan, 40.(bnm/m10)

Pemerintah Mali Mundur, PM Baru Dilantik BAMAKO, Mali (Reuters): Pemerintah Mali mengundurkan diri dan menteri pengatur kota Moussa Mara akan menjadi PM baru, kata seorang jubir kepresidenan Sabtu (5/4). PM yang mengundurkan diri Oumar Tatam Ly menyerahkan pengunduran dirinya kepada Presiden Ibrahim Boubacar Keita pada Sabtu dan pengunduran diri itu diterima, demikian pernyataan kepresidenan. Penggantinya, Mara, seorang veteran politik yang mencalonkan diri bersaing denga Keita dalam pemilihan presiden Agustus lalu, akan bertanggungjawab memilih menteri-menteri baru.Belum ada ketetapan waktu bagi pelantikannya.Berdasarkan system pemerintahanMali,perombakannormalterjadimenyusulpemilihan legislative. Presiden Ibrahim Boubacar Keita, yang secara universal dikenal dengan singkatan nama IBK, terpilih dengan janji menyatukan Mali dan berupaya membangun negara itu kembali setelah perang terhadap kelompok militan Islam. Negara Afrika Barat itu dilanda kekacauan akibat pemberontakanTuareg awal tahun 2012, menyusul kudeta militer. Militan Islam mengambil kesempatan dan berhasil menguasai kawasan gurun di utara, sehingga pasukan Perancis turun campur tangan di negara bekas jajahannya itu.(m23)

Israel Lancarkan Serangan Udara Terhadap ‘Tempat Teror’ Di Gaza GAZA, Palestina (CNN): Beberapa pesawat tempur Israel menggempur lima sasaran di Gaza Sabtu (5/4) malam sebagai tindakan yang seorang jubir militer sebut ‘pembalasan’ atas agresi teroris. Empat dari‘tempat terror sasaran’ berada di utara Gaza sementara satu di selatan Gaza, menurut Letkol. Peter Lerner, jubir militer Israel,seranganitutelakmengenaisasarandanberdasarkaninformasi dari intelijen.Dr. Ashraf Elkdra dari Rumahsakit Shifa di Gaza kepada CNN mengatakan,tidakadakorbantewasataucideraakibatserangan Israel itu. SeranganmiliterIsraelitudilakukanmenyusulapayangdikatakan pasukan pertahanan militer Israel, ada 131 gempuran roket dari Gaza ke kawasan Israel sejak bulan lalu. “Wajib bagi kami mengejar mereka yang ingin menyerang kami, memusnahkan kemampuan mereka dan mencari mereka di mana pun mereka bersembunyi,” kata Lerner dalam satu pernyataan. Serangan ini pun terjadi di saat usaha untuk mencapai perjanjian damai antara pemimpin Israel dan Palestina berada pada titik terendah. Usaha mencapai perjanjian terkendala minggu lalu, ketika Israel tidak memenuhi janjinya membebaskan tahanan Palestina dan Palestina membalas dengan bergabung ke dalam 15 badan internasional yang mengabaikan komitmennya untuk tidak mengupayakan pengakuan internasional sebagai satu negara.(m23)

stabilitas oleh Pyongyang—termasuk di antaranya uji coba rudal yang bertentagan dengan resolusi Dewan Keamanan PBB—saya mengumumkan bahwa hari ini Amerika Serikat berencana untuk mengirimkan dua kapal anti rudal AEGIS tambahankeJepangpada2017mendatang,” kata Hagel dalam konferensi pers di Tokyo bersama Menteri Pertahanan Jepang Itsunori Onodera. Duakapalperangtambahan anti rudal tersebut akan bergabung dengan lima kapal lainnya yang mempunyai kemampuan sama dan yang sebelumnya telah ditempatkan di Jepang. Bulanlalu,Korutmelakukan uji coba rudal balistik jarak menengah diperkirakan yang mampu mencapai Jepang.Tokyo kemudian dilaporkan memerintahkanpasukannyauntuk menghancurkan rudal milik Korut yang melewati batas wilayah udara Jepang dan menempatkan kapal AEGIS miliknya ke Laut Jepang. Keputusan dariWashington tersebut“didorongolehtindakan agresif dan provokatif dari Korut dan komitmen Amerika Serikat untuk pertahanan Jepang,” kata pejabat Kementerian Pertahanan AS yang tidak disebutkan namanya oleh AFP.

Sekjen PBB Kecam ‘Kekejaman Mengerikan’ Di Afrika Tengah PRAHA, Ceko (Antara/AFP): SekjenPBBBanKi-moonsangat mengutuk konflik berlarut-larut di Republik AfrikaTengah (CAR) dimanaribuanorangtelahtewas dan lebih dari satu juta orang lainnya mengungsi. “Saya sangat terganggu oleh kekejamanmengerikanterha-dap wargasipildisana,”kataSekretaris Jenderal PBB kepada wartawan selama kunjungan ke Praha, ibukota Ceko, Sabtu (5/4). Dia menambahkan bahwa diaberharapUniEropa,UniAfrika dan PBB akan bekerja sama untukmembangunperdamaian dan stabilitas” di negara kaya emas dan berlian itu dengan populasi 4,6 juta orang. Sekitar seperempat dari penduduk mengungsi dan ratusan ribu orang lainnya menghadapi kelaparan karena konflik antara mayoritas Kristen dan minoritas Muslim, menurut badan-badan PBB dan bantuan amal. “Afrika Tengah adalah salah satu prioritas utama saya (dan) akansayalanjutkanprioritasitu,” kata Ban, 69, yang mengunjungi RwandaSabtuuntukmenghadiri upacarauntukmemperingati20 tahungenosidadinegaraitu. Ban mengatakankepadamediaCeko, bahwa dia telah meminta PM BohuslavSobotkauntukmengirim pasukankeRepublikAfrikaTengah sebagai bagian dari misi yang direncanakan terdiri 12.000 tentara dan polisi. Menteri Pertahanan Ceko Martin Stropnický mengatakan bahwa pihaknya menyepakati kesepakatandenganpermintaan ‘tanpa penundaan’ dan bahwa Ban terutama tertarik pada rumah sakit lapangan Ceko dan pesawat angkut. Awal pekan ini, sebuah pernyataan yang dikeluarkan oleh juru bicara Ban mengenai Republik Afrika Tengah menyerukan penyusunan daftar individu yang “tindakannya merusak perdamaian, stabilitas dan keamanan” di negara itu. Pernyataan Ban Senin termasuk mengingatkan bahwa siapa saja yang terlibat termasuk menyebarkan kekerasan langsung atau tidak langsung “akan bertanggung jawab untuk tindakan mereka dan diajukan ke pengadilan.”

keberhasilan bagi Afghanistan.” Keamanan ditingkatkan di beberapa daerah seiring munculnyaancaman.PresidenASBarack Obama, dalam pernyataan yang dirilis oleh Gedung Putih, mengatakan:“Kamimemujiorang-orang Afghanistan, pasukan keamanan, danpetugaspemiludalampemungutan suara hari ini.” “Pemilihaninisangatpenting untuk mengamankan masa depan demokrasi di Afghanistan, serta berlanjutnya dukungan internasional.” Sementara itu, Menteri Luar Negeri Inggris William Hague mengatakan: “Ini merupakan prestasi besar bagi rakyat Afghanistan bahwa begitu banyak pemilih, pria dan wanita, tua dan muda, telah berpartisipasi dalam jumlahyangbesar,meskipunadanya ancaman kekerasan.” Adapun, Kepala Aliansi Militer NATO Anders Fogh Rasmussen menggambarkan pemilu ini sebagai“momen bersejarah bagi Afghanistan,” (bnm/cnn/m10)


Dokter Gleneagles Tak Punya Interest Terhadap Obat PENANG,Malaysia(Waspada): Jumlah pasien Indonesia yang berobat ke Pulau Penang terus mengalami peningkatan dari waktu ke waktu. Salah satu kelebihan rumah sakit di negeri ini adalah karena para dokter di sana cuma fokus pada penanganan penyakit pasien tanpa memiliki interest pada obatobatan yang diberikan. “Semua obat dijual melalui hospital dan dokter tidak punya sembarang self interest. Dokter hanya memberikan obat yang dibutuhkan pasien saja,” kata Aileen Foo, Marketing Manager Gleneagles Penang dalam persentasinyadidepanrombongan dokter dan jurnalis dari Indonesia,Jumat(4/4)diRumahSakit Gleneagles Penang. Para dokter spesialis juga hanya berpraktik di satu rumah sakit saja dan tidak berpraktik di rumah sakit lain. “Kami memiliki lebih dari 700 dokter spesialis. Pada umumnya para dokter spesialis adalah lulusan luar negeri seperti UK (Inggris), US (Amerika Serikat), Australia, Singapura dan Malaysia. Spesialis

tetap tidak praktik di rumah sakit lain,” katanya. Kepada para dokter spesialis tersebut diberikan fee yang ditetapkanmengikutijadwalhargayang ditetapkan. Dengan jadwal harga tersebut,makapenghasilanseorang dokter spesialis yang pakar sudah memadai baginya fokus hanya menangani penyakit pasien saja. “Sebagairumahsakitkamime-miliki keunggulan pusat kanker, pusat jantung, pusat ortopedik, pusat mata,pusatMIS(minimallyinvasive surgery), dan pusat neuro sains dengan kepakaran dokter-dokter spesialisnya,” terang Aileen Foo. Perbedaan lainnya antara dokter di RS ini dengan RS pada umumnya di Indonesia adalah pada struktur pengelolanya. Di RS ini pucuk pimpinan yang merangkat sebagai CEO (Chief Executive Officer) dan jajarannya adalah para profesional yang memang ahli di bidangnya. Mereka bukan para dokter, tetapi orangorang yang memiliki latar belakangpendidikanmanajemendan pemasaran.Sedangkanparadokter ditempatkan secara profesional sesuai pendidikan mereka,

Waspada/Dedi Sahputra

AILEEN Foo, Marketing Manager Gleneagles Penang dalam presentasinya di depan rombongan dokter dan jurnalis dari Indonesia, Jumat (4/4) di Rumah Sakit Gleneagles Penang. yaknimenanganipenyakitpasien. Kalaupun ada dokter yang duduk di jajaran struktur perusahaan, hanya ada di bagian pengawasan kinerja dokter. Karena untuk menjadi pengawas kinerja dokter haruslah orang yang memahami dunia kedokteran juga. SebelumnyaKamaljeetSingh Gill, Chief Marketing Officer International Operation Division

mengatakan pihaknya berkomitmen untuk menjadi rumah sakit tertinggi dalam hal pelayanan pasien. Pihanya telah mengantongi akreditasiinternasionaldariInternational Accreditation Bodies: JCI, MSQH & MS ISO 9001:2000. “Kami merasa bangga untuk bisa menyediakan layanan kesehatan terbaik bagi para pasien kami,” katanya.(m07)

Ekonomi & Bisnis


WASPADA Senin, 7 April 2014

Pilih Demi Perbaikan Ekonomi Catatan Gus Irawan RATA-rata pertumbuhan merataan pendapatan. Menyalurkan hak pilih ekonomi nasional selalu di Kesimpulannya pangkal dengan menentukan persoalan pemberontakan di atas enam persen. Tapi angka partai pilihan akan negara-negara itu adalah kapertumbuhan ekonomi cenmendorong partai rena ketidakmerataan pemderung berbanding terbalik bangunan dan tingginya judengan angka kemiskinan pemenang pemilihan rang pendapatan masyarakat. yang masih berada di level 10 legislatif ini bisa Apakah kita akan mempersen. Kita tidak pernah mengajukan calon biarkan kondisi tersebut juga mendapatkan angka begitu presiden. Saya terjadi di Indonesia? Jawabanpertumbuhan ekonomi tinggi, cenderung beranggapan nya tidak. Itu sebabnya pada angka kemiskinan dan angka apa pun persoalan Pileg 9 April ini adalah masa pengangguran turun. bangsa ini kita hanya bisa yang paling menentukan Intinya adalah dengan dipandang negara lain untuk negeri ini. Bagaimana pertumbuhan ekonomi sebejika sudah memiliki tidak dengan menjadi partisar itu kita belum bisa mengkemandirian. Sekarang sipan dalam pemilihan adalah klaim bahwa rakyat sudah akar untuk menentukan langmendapatkan kesejahteraan semua kita tertinggal. kah bangsa ini ke depan. mereka. Pendapatan per kaPendidikan, ekonomi, Sebab 2014 ini adalah pita penduduk Indonesia seteknologi, disiplin, jauh tonggak pergantian kepepanjang 2013 sudah mencapai lebih rendah dibanding mimpinan. Kita bisa melihat Rp36,5 juta. Atau kalau dibaginegara-negara lain. figur yang akan muncul dalam kan rata-rata penduduk Untuk melihat potret pemilihan presiden menmendapatkan penghasilan kemajuan suatu negara datang. Dengan menyalurkan Rp3,1 juta per bulan. sebenarnya lihat saja dari hak pilih kita berarti sudah ikut Jika melihat angka terdisiplin lalu lintas. menentukan nasib bangsa ini sebut dibanding 2012 tentu ke depan. Jangan hanya saja ada kenaikan karena ada pertumbuhan sebesar 8,88 persen dari tahun memilih berdasarkan iming-iming namun sebelumnya yang sebesar Rp33,5 juta. Angka harus sesuai pertimbangan kepentingan bangsa ini muncul dari PDB (produk domestik bruto). ini ke depan. Negara ini sudah terlalu lama tertinggal. Atau total hitungan seluruh pendapatan dan Bandingkan saja dengan negara-negara sektor-sektor produksi di Indonesia. Angka ini juga naik dibanding tahun sebe- tetangga. Bahkan Thailand sekali pun masih lumnya. Namun kalau dihitung dengan dolar setingkat di atas kita. Masyarakat harus melihat AS tentu saja mengalami kenaikan karena mata bahwa calon pemimpin ke depan adalah yang uang kita terus merosot. Lalu pesan apa yang berorientasi ekonomi. Sehingga ada dasar untuk ingin saya sampaikan dari data-data tersebut? melakukan pemilihan di Pileg 9 April. Adalah berkaitan dengan pemilihan legislatif Menyalurkan hak pilih dengan menentukan per 9 April atau Rabu (lusa). Saya melihat bahwa partai pilihan akan mendorong partai pemeseluruh masyarakat di Indonesia dan tentu saja nang pemilihan legislatif ini bisa mengajukan Sumatera Utara harus menggunakan hak pilih- calon presiden. Saya cenderung beranggapan nya. Tujuannya adalah agar ada perubahan ter- apa pun persoalan bangsa ini kita hanya bisa hadap kondisi yang sekarang tak memuaskan dipandang negara lain jika sudah memiliki kita. kemandirian. Sekarang semua kita tertinggal. Saya berasumsi bahwa pemberontakan di Pendidikan, ekonomi, teknologi, disiplin, jauh Mesir, Libya dan Tunisia tak lepas dari motif lebih rendah dibanding negara-negara lain. ekonomi. Artinya masyarakat yang selama ini Untuk melihat potret kemajuan suatu negara merasa tidak sejahtera kemudian memberontak sebenarnya lihat saja dari disiplin lalu lintas. Bukankah lalu lintas di Indonesia ini begitu karena urusan perut. Walaupun pada perkembangan selanjutnya krisis di Mesir dianggap semrawut. Saya percaya jika itu jadi cerminan, dipicu oleh berbagia hal, tapi pada konteks maka presiden yang bisa menyelesaikan persebenarnya karena masyarakat lapar dan tidak soalan sederhana itu adalah pemimpin yang tegas dan berwibawa. Saya menyatakan masasejahtera. Bagaimana dengan Libya? Bukankah negara lah disiplin lalu lintas sederhana. Tapi itulah itu termasuk salah satu negara makmur. Peme- potret betapa tidak berwibawanya hukum di rintah menjamin kehidupan masyarakat negeri ini. Betapa tidak ada lagi penghargaan sampai tua. Pengangguran diberikan subsidi. para pengemudi terhadap penegak lalu lintas. Bahkan orang tak mampu disekolahkan sampai Akankah hal-hal kecil seperti ini terus kita biarkan? Jadi silakan menyalurkan suara pada pemijenjang tertinggi. Lalu kenapa masih ada pemberontakan? lihan legislatif nanti. Tentu dengan melihat siapa Walaupun kemudian dunia luar melihat Libya calon presiden yang akan diusung partai yang mengalami krisis dan pemberontakan di dalam kita pilih. Kalau sudah melihat ada calon presinegeri akibat kondisi politik namun sebenarnya den yang menjanjikan kesejahteraan dan perrakyatnya juga punya beban atas ketidaksejah- baikan total atas penegakan hukum di Indonesia teraan. Memang secara kasat mata kita bisa maka salurkan saja suara kepada partainya. Otomatis jika partai itu mendapatkan suara melihat kalau sebenarnya awal persoalan adalah ketimpangan pendapatan dan kesejahteraan. minimal 20 persen dari total pemilih sudah bisa Jadi walau terlihat masyarakat sejahtera dan langsung mengusung calon presiden yang kita mendapat subsidi tetapi ter-nyata sumber inginkan. Selamat memilih, jangan golput. Dan kekayaan negara tersebut dikuasai oleh tetaplah memprioritaskan perbaikan ekonomi sekelompok orang saja. Tunisia, tentu saja dan kesehjahteraan daripada melulu berdebat pemberontakan di negaranya karena ketidak- soal politik.

Gapkindo: Pertumbuhan Ekspor Karet 2014 Melambat MEDAN (Waspada): Gabungan Perusahaan Karet Indonesia (Gapkindo) memprediksi, pertumbuhan ekspor karet Sumatera Utara (Sumut) 2014 bakal melambat dari tahun sebelumnya. Hal ini mengingat adanya pemangkasan ekspor karet sebesar 10 persen di tahun ini. “Setiap tahun ada pertumbuhan, di 2013 tumbuh sekitar 3,4 persen dan di tahun-tahun sebelumnya di atas 5 persen. Tetapi saat ini, terjadi kecendrungan penurunan harga ditambah pemangkasan ekspor sekitar 10 persen, maka kita memprediksi bakal tidak ada pertumbuhan di tahun ini,” kata Sekretaris Eksekutif Gapkindo Sumut, Edy Irwansyah di Medan, Minggu (6/4). Edy menjelaskan, pengurangan ekspor karet sengaja dilakukan, jika tidak dilakukan nilai karet bisa jatuh lagi dan harga akan tidak terkontrol. Apa yang dilakukan Gapkindo adalah untuk menyeimbangkan supply and demand agar harga karet di tingkat dunia seimbang. “Saat ini, petani karet sudah menjerit. Kita prediksi harga karet di 2014 tidak akan lebih dari 2,5 dolar AS per kilogram. Sementara harga kontrak di Mei sekitar 184,9 Sen per kg atau sekitar Rp18.500 sampai Rp19.000 per kg di tingkat pabrik,” jelasnya. Untuk pasar karet Sumut, lanjutnya, ada sekitar 54 lebih negara tujuan, namun pasar utama karet Sumut ialah Jepang, Tiongkok dan Amerika Serikat. Segmen pasar karet ialah tradisional market, di mana negara pembelinya hanya itu-

itu saja dari tahun ke tahun. “Karet alam banyak diserap oleh industri ban dan harga cendrung buyer market atau dalam penentuan harga ditentukan oleh pembeli. Harga akan kembali normal, apabila tiga negara tujuan ekspor mengalami pemulihan perekonomian,” katanya. Sementara, katanya, karet yang dihasilkan Indonesia semakin melimpah dan yang bisa menyerap terbatas. Jadi akhirnya di ekspor hanya ke negara industri ban, sedangkan konsumsi Indonesia hanya sedikit sekitar 15 persen. “Di Malaysia, konsumsi karet dalam negeri sekitar 50 persen, jadi mereka tidak pusing-pusing kalau terjadi pluktuasi harga karet yang tidak menentu. Jika Indonesia memiliki industri ban, mungkin konsumsi dalam negeri bakal meningkat,” ujarnya. Konsepnya, lanjutnya lagi, jika ada industri yang bisa “melahap” karet, perusahaan karet tidak begitu pusing dengan pluktuasi harga Internasional. Jika semua kebutuhan negara ekspor sudah terpenuhi, maka dianjurkan planning ekspor dikurangi. “Kita berharap, pemerintah Indonesia bisa mengundang investor asing mendirikan industri hilir sehingga bisa melahap bahan baku karet yang kita hasilkan. Dengan begitu, konsumsi dalam negeri meningkat dan berimbas ke pertumbuhan karet yang semakin membaik,” pungkasnya. (m41)

Hatta Akui Penyaluran Raskin Rawan Penyimpangan JAKARTA (Waspada): Menteri Koordinator Bidang Perekonomian, Hatta Rajasa, Jumat ( 4/4), mengakui risiko penyelewengan bantuan beras miskin amat tinggi di penyaluran lapangan, khususnya di daerah. Peran pemerintah daerah dalam pengawasan dan distribusinya dinilai masih minim. Menurut Hatta, pemerintah pusat dalam hal ini bertugas untuk memastikan anggaran dan ketersediaan raskin terpenuhi. peran dan tanggung jawab pemerintah daerah adalah memastikan distribusinya tepat sasaran. Secara struktural, penyaluran raskin menjadi tanggung jawab Kementerian Koordinator Kesejahteraan rakyat. Anggarannya dialokasikan di Kementerian Sosial. Sedangkan penyediaan barangnya menjadi tanggung jawab Badan Urusan Logistik (Bulog). Bulog sebagai kepanjangan tangan pemerintah pusat dan dengan bantuan pemerintahan daerah mendistribusikannya kepada masyarakat. Namun, seringkali permasalahan yang ditemui di lapangan adalah karena pemda tidak becus

dalam pendistribusiannya. “Misalkan, tempatnya sangat jauh, pemda mungkin tidak meyediakan sarana untuk mengantarkan itu. Jadi mungkin berasnya dijual sama yang berhak menerima atau dibagi bagi. Ini yang tidak tepat sasaran juga,” ujar Hatta. Rekomendasi KPK Komisi Pemberantasan Korupsi (KPK) merekomendasikan pemerintah untuk mengkaji kembali kebijakan subsidi raskin secara menyeluruh dengan memperhitungkan berbagai faktor untuk mencapai target program. Menyusul adanya indikasi penyimpangan dalam implementasi program itu. Hatta mengaku sepakat dengan indikasi penyimpangan itu. Menurut Hatta, Kemenko Kesra sebagai koordinator program ini harus meningkatkan pengawasan dalam penyalurannya di masa mendatang. Sehingga resiko penyimpangan yang terjadi dapat dibendung. Apalagi, menurut Hatta, pemerintah telah mengalokasikan anggaran khusus untuk menastikan raskin tepat sasaran (safeguarding).(vvn)


KELANGKAAN BBM Sejumlah kapal nelayan bersandar di Pelabuahan Prigi, Watulimo, Trengglek, Jawa Timur, Minggu, (6/4). Tingginya permintaan solar menjelang musim ikan menyebabkan persediaan solar di SPBDN maupun SPBU sekitar pelabuhan cepat habis dan berpotensi terjadi ketidakseimbangan antara persediaan dengan kebutuhan (langka).

Indonesia Dan Belanda Kerja Sama Pertanian LONDON (Waspada) : Indonesia dan Belanda memperkuat kerja sama di bidang pertanian melalui program peningkatan produksi dan pemasaran sayuran (Program VegIMPACT) melalui pertemuan Duta Besar RI di Den Haag Retno LP Marsudi dengan pihak Universitas Riset Wageningen (WUR) pada Jumat lalu (4/4).

Konsumen Perkirakan Harga Naik 3-6 Bulan Ke Depan JAKARTA (Waspada): Hasil survei konsumen yang dilakukan Bank Indonesia (BI) mengindikasikan adanya kenaikan harga pada 3 sampai 6 bulan ke depan. “Hal tersebut antara lain dipengaruhi meningkatnya permintaan menjelang datangnya bulan puasa pada akhir Juni 2014,” siaran pers Direktur Komunikasi dan Humas BI Peter Jacob di Jakarta, akhir pekan. Meskipun, lanjutnya, pada Maret 2014 menunjukkan keyakinan konsumen masih dalam tren meningkat. Terlihat dari Indeks Keyakinan Konsumen (IKK) Maret 2014 tercatat 118,2, meningkat dari 116,2 pada bulan sebelumnya. Optimisme yang membaik terutama didorong oleh menguatnya persepsi konsumen terhadap kondisi ekonomi 6 bulan mendatang, sebagaimana tercermin pada Indeks Ekspektasi Konsumen (IEK) yang meningkat sebesar 3,2 poin dari bulan sebelumnya menjadi 123,9. Indeks Kondisi Ekonomi (IKE) saat ini juga sedikit meningkat 0,8 poin menjadi 112,5. Dari 18 kota yang disurvei, peningkatan IKK terjadi di 12 kota dengan kenaikan terbesar terjadi di Manado (18,4 poin) dan Banjarmasin (16,6 poin). “BI menilai keyakinan konsumen yang masih dalam tren meningkat dapat berkontribusi positif pada tetap kuatnya konsumsi rumah tangga,” tandas Peter. (J03)

BNI Edukasi Nasabah Gunakan e-Channel Dukung Program BI JAKARTA (Waspada): PT Bank Negara Indonesia/BNI (Persero) Tbk, mengedukasi nasabah menggunakan e-channel sebagai dukungan program Bank Indonesia (BI) yaitu cashless society. Dari setiap transaksi berurutan ke-200 dan kelipatannya melalui e-chanel, BNI menyediakan 46.000 rejeki langsung setiap bulannya berupa cashback. “Pada program Rejeki BNI Taplus 2014 ini, BNI membagikan rejeki kepada 46.000 nasabah setia, yaitu 10.000 rejeki langsung transaksi tertinggi setiap bulan berupa hadiah cashback Rp 1.000.000, Rp 500.000, dan Rp 100.000,” siaran pers Direktur Konsumer dan Ritel BNI, Darmadi Sutanto di Jakarta, pekan kemarin. Hadian itu menurutnya, diberikan bagi nasabah yang melakukan frekuensi transaksi tertinggi di BNI ATM, BNI SMS Banking, BNI Internet Banking, BNI Kartu Debit dan BNI Debit Online. “Ini apresiasi kami yang ke enam kalinya terhadap para nasabah setia dengan nama Rejeki BNI Taplus (RBT) 2014,” ujar Darmadi. Selain itu RBT 2014 juga memberikan rejeki langsung cabang, dimana tersedia 5.000 hadiah langsung dengan mekanisme komitmen blokir saldo fresh fund untuk peserta nasabah perorangan pemegang rekening BNI Taplus. Dengan komitmen saldo blokir minimum Rp 10.000.000 (sepuluh juta rupiah) per rekening akan mendapatkan hadiah langsung sesuai pilihan nasabah. “RBT 2014 menjadikan BNI sebagai pioneer Bank Besar yang tidak lagi memberikan hadiah berupa barang mewah seperti rumah, mobil, motor dan barang-barang elektronik. Hadiah yang diberikan kepada nasabah BNI berupa cashback untuk 46.000 nasabah setiap bulan dengan maksimal cashback Rp 1.000.000 (satu juta rupiah),” tuturnya. (j03)

Buruh Takut Hadapi Pasar Bebas JAKARTA (Waspada): Menyambut Masyarakat Ekonomi ASEAN (MEA) 2015, sektor-sektor industri di Indonesia masih belum menunjukkan kesiapan. Banyak perusahaan masih tertatihtatih untuk dapat bersaing di dalam negeri. Presiden Konfederasi Serikat Pekerja Indonesia (KSPI) Said Iqbal mengatakan, kaum buruh juga masih belum siap dalam momen pasar bebas tersebut. Menurutnya, meski secara fakta perdagangan MEA 2015 baik untuk perekonomian, namun ditilik dari sisi kesejahteraan sangat berbeda. “Pasar tunggal ASEAN secara fakta perdagangan memang dibutuhkan, tapi secara ideologis bertentangan, karena ini bertentangan dengan prinsip kesejahteraan untuk bangun perdagangan,” katanya di Hotel Mega Proklamasi, Jakarta, Jumat (4/4). Menurutnya, jika dilihat dari kesejahteraan, buruh Indonesia masih lemah di beberapa sisi. Banyak masalah menumpuk, mulai dari upah murah, jaminan kesehatan yang tidak ada, dan dana pensiun juga. (okz)

Kerja sama itu merupakan salah satu prioritas kerja sama bilateral, sebagaimana dibahas Presiden RI dan Perdana Menteri Belanda pada November 2013 di Jakarta, kata Sekretaris Pertama Kedutaan Besar Republik Indonesia (KBRI) Den Haag Danang Waskito. Dikemukakannya, Dubes Retno Marsudi di Departemen Penerapan Riset TanamanWUR di Lelystad, Provinsi Flevoland, Belanda, bertemu Direktur Kerja Sama Internasional WUR Dr Huub Loffler, Kepala Departemen Penerapan Riset Tanaman Dr. Herman Schoorlem-

mer, Kepala Proyek VegImpact Dr. Arij Everaarts dan peneliti senior Dr. Herman de Putter. Indonesia dan WUR sudah menjalin kerja sama sejak lama, dan mahasiswa Indonesia yang belajar di sana mencapai 166 orang dari 1.495 mahasiswa RI di Belanda. Mereka menekuni, antara lain ilmu lingkungan hidup, teknologi pangan, kehutanan dan konservasi alam, teknologi pertanian, ilmu pertanahan dan bioteknologi. Program VegIMPACT yang berjalan dalam periode 2013206 penerapannya dilakukan

antara Tim Peneliti Departemen Penerapan Riset Tanaman WUR) Belanda dengan Balai Penelitian Tanaman Sayuran (BALITSA) di Penelitian Pengembangan (Litbang) dan Direktorat Jenderal Hortikultura Kementerian Pertanian Indonesia. Kegiatan Program VegIMPACT juga bertujuan mengurangi pemakaian pestisida yang diharapkan dapat mengurangi biaya produksi sayuran, mengurangi risiko kesehatan kerja dan memberikan pelatihan metode produksi sayuran yang berkelanjutan kepada para petani. (ant)

UU Perdagangan RI Menunjukkan Kemandirian Ekonomi Nasional MEDAN (Waspada): Lahirnya UU Perdagangan Republik Indonesia merupakan momentum bersejarah dalam perekonomian nasional terkait dengan upaya mewujudkan kesejahteraan masyarakat yang seluasluasnya maupun mendorong kemajuan ekonomi bangsa. “Sebenarnya ruh dari UU Perdagangan ini memunculkan nasionalisme, melahirkan kemandirian ekonomi nasional yang tidak tidak berdaulat kepada pasar, serta tidak menghambakan diri kepada globalisasi,” kata pengamat ekonomi dari Universitas Sumatera Utara (USU) Kasyful Mahalli, di selasela Dialog Publik Bedah UU Perdagangan RI digelar Medan Business Forum diketuai Khairul Mahalli, di Medan, Kamis (3/4). Kasyful Mahalli mengatakan, selama ini kita masih menggunakan UU Perdagangan buatan Belanda tahun 34, dimana UU itu hanya bersifat farsial. Artinya hanya memberikan izin-izin saja, tetapi tidak mengatur mekanisme perdagangan baik di dalam negeri maupun di luar negeri, daerah perbatasan dan sebagainya. Sedangkan UU Perdagangan No.7 tahun 2014 ini, lanjutnya, mencakup lebih luas termasuk menyangkut standarisasi, insentif dan sebagainya. “Tapi yang paling penting saya melihat, ruh-nya itu nasiona-

lisme dagang. Ini salah satu komitmen dari pemerintah menghadirkan UU Perdagangan, bahwa kita punya perdagangan nasional. Artinya kita ada nasionalisme perdagangan di situ,” ujarnya. Dia menyebutkan, keberpihakan UU itu bagi pengusaha dalam negeri adalah memberikan perlindungan baik bagi eksportir maupun importir meningkatkan daya saing. “Tidak hanya mengatur perdagangan domestik maupun internasional. Dalam UU Perdagangan RI itu, juga mengatur perdagangan tingkat ritel, bahkan pasar rakyat dan pasar modern pun diatur. Semua itu dilindungi pemerintah. Jadi yang mau diciptakan itu memberikan perlindungan kepada importir maupun eksportir hingga ke tingkat ritel yang mandiri,” jelasnya. Kasyful Mahalli menyebutkan, UU yang berisi 19 Bab itu pengaturannya sangat detail, meskipun masih diperlukan Peraturan Pemerintah (PP), Peraturan Presiden (Perpres), maupun Peraturan Menteri (Permen) sebagai pengaturan pelaksanaan teknisnya. Selama ini, katanya, antara pasar rakyat dan pasar modern tidak diatur sehingga perdagangan masih menggunakan sistem mekanisme pasar. Alhasil, jarak antar pasar rakyat dan modern saling berdekatan,

bahkan antara pasar modern berdiri bersebelahan atau berhadapan. “Kalau sistemnya diserahkan pada mekanisme pasar (siapa yang kuat dia yang menang), maka akan terjepitlah pedagang pasar rakyat atau pedagang tradisional. Nah di dalam UU Perdagangan itu diatur dan teknisnya melalui PP maupun Permen,” ujarnya. Sementara itu, akademisi dari USU Prof. Dr. Ramli SE, MS mengharapkan, lahirnya UU Perdagangan RI itu harus memberikan ketegasan dengan sanksi-sanksi terhadap pelanggaran yang terjadi dalam sistem perdagangan. “Kalau UU sifatnya hanya mengatur, tidak ada sanksi yang tegas, maka UU itu tidak akan efektif. Bahkan, implementasinya di lapangan tidak ada kekuatan hukum bagi pelaksana UU maupun pengawas instansi terkait,” ujarnya. Selain itu, katanya, UU Perdagangan ini harus memberikan penjelasan dari setiap pasalpasal yang ada. Kemudian UU itu harusnya ada mengatur tentang peningkatan status pedagang. “Seharusnya UU Perdagangan dapat merubah status pedagang, dari pedagang informal ke pedagang kecil, pedagang kecil meningkat menjadi pedagang sedang, dan pedagang sedang meningkat menjadi pedagang besar,” ujarnya. (m41)

Indonesia Miliki Tiga Tantangan J A K A RTA ( Wa s p a d a ) : Gubernur Bank Indonesia Agus Martowardojo mengatakan, masih ada tiga tantangan struktural yang harus prioritas diperbaiki Indonesia tahun ini dalam mendorong keseimbangan ekonomi. “Implementasi kebijakan struktural difokuskan pada tiga pilar utama, peningkatan daya saing industri, kemandirian ekonomi domestik, dan pembiayaan yang berkesinambungan,” kata Agus dalam peluncuran buku dan diskusi laporan perekonomian Indonesia 2013 di Jakarta, Rabu (2/4). Peningkatan daya saing, menurutnya, melalui penguatan struktur produksi. Pemerintah juga perlu meningkatkan ruang fiskal melalui optimalisasi pengurangan subsidi energi dan pendalaman keuangan. “FDI juga perlu diarahkan ke sektor berbasis ekspor sehingga tidak menekan defisit

transaksi berjalan. Ini mendesak. Indonesia tidak lagi bisa mengandalkan upah buruh murah dan kegiatan ekonomi ekstraktif tapi harus bergerak,” paparnya. Berkaca dari pengalaman pada 2013, Indonesia telah melewati masa-masa sulit dari sisi perekonomian. Berbagai tekanan yang tidak ringan harus dihadapi, untuk memastikan ekonomi tumbuh namun tetap stabil. Agus menambahkan, ada empat pelajaran dapat dipetik dari situasi itu. Dengan tujuan agar kesalahan yang sama tidak terulang dalam menggenjot pertumbuhan ekonomi. “Mengikuti perjalanan ekonomi yang tidak ringan, ada pelajaran penting yang mengemuka terkait kebijakan untuk kesinambungan ekonomi ke depan,” ujarnya. Pertama terkait dengan pentingnya disiplin dalam menjaga ekonomi makro. Baik fiskal

dan moneter untuk arah ekonomi yang berkelanjutan. “Kebijakan yang kuat 2013, telah memberikan jangka dari espektasi inflasi dan transaksi berjalan ke arah yang lebih sehat,” ujarnya. Kedua pelajaran untuk membuat strategi integrasi dan kebijakan dalam merespon tantangan yang semakin kompleks. Seperti diketahui tantangan terbesar ketika penarikan stimulus quantitative easing (QE) oleh Bank Sentral Amerika Serikat (AS) The Fed. “Untuk menghadapi itu tidak bisa lagi dengan 1 instrumen. Tapi juga harus didukung instrumen lain. Moneter dan fiskal harus saling mengisi,” jelas Agus. Ketiga, adalah pentingnya ketahanan sistem keuangan dalam menopang terkendalinya tekanan ekonomi. Beberapa kebijakan telah dikeluarkan BI secara preventif akhir tahun 2013. (J03)



A5 Akibat TB, 186 Orang Meninggal/Hari

Senin 7 April 2014


PENGIRIMAN LOGISTIK PILEG: Sejumlah petugas bersiap mengirim logistik Pemilu menggunakan kuda di Desa Brambang Darussalam, Tlogosari, Bondowoso, Jawa Timur, Minggu (6/4). Pengiriman logistik itu menggunakan kuda karena kondisi jalan sulit diakses kendaraan bermotor.

Menkes: Masih Banyak Target Kesehatan Dalam MDGs Belum Tercapai JAKARTA (Waspada): Sebanyak 700 orang pemangku kebijakan kesehatan di pusat dan daerah bertemu dalam kegiatan Rapat Kerja Kesehatan Nasional (Rakerkesnas) 2014 Regional Barat di Hotel Bidakara, Jakarta, sejak 31 Maret sampai 3 April 2014. Dalam pembukaan,hadir Wakil Gubernur DKI, Basuki Tjahja Purnama. Rakernas bertema ‘Pemantapan Pembangunan Kesehatan Menuju Masyarakat Sehat Mandiri dan Berkeadilan’ regional barat ini diikuti Provinsi Aceh, Sumatera Utara, Sumatera Barat, Bengkulu, Jambi, Lampung, Sumatera Selatan, Riau, Kepulauan Riau, Bangka

Belitung, Banten, Jawa Barat dan DKI. Dalam sambutannya usai membuka Rakerkesnas, Menteri Kesehatan Nafsiah Mboi mengatakan, pertemuan dimaksudkan meningkatkan koordinasi dan sinergisme antara pusat dan daerah, dalam rangka percepatan pembangunan kesehatan sepanjang 2014. “Selain itu, pertemuan ini juga dimaksudkan untuk mengidentifikasi masalah terkait pelaksanaan MDG’s di bidang kesehatan dan masalah-masalah terkait penerapan Jaminan Kesehatan Nasional,” ujar Nafsiah. Dalam kesempatan itu Menkes mengakui, masih banyak target kesehatan dalam Mille-

nium Development Goals (MDGs) yang belum sepenuhnya tercapai. Seperti kesehatan ibu dan bayi, penyakit tidak menular serta akses masyarakat pada sarana dan pelayanan kesehatan. ”Setelah selesai dengan MDGs pada 2015, seluruh stakeholder kesehatan di daerah harus bersiap merencanakan agenda post MDGs,” tandas Menkes. Selain di regional Barat, Rakerkesnas juga dilaksanakan di wilayah Indonesia tengah dan timur. Di regional tengah dilaksanakan di Bali pada 16 sampai 19 Maret, sedangkan regional timur dilaksanakan di Manado pada 23 sampai 26 Maret. (dianw)

Sabang Ikut Pameran Deep & Extreme 2014

Promosikan Obyek Wisata Selam JAKARTA (Waspada): Sejumlah dinas kebudayaan dan pariwisata (disbudpar) baik kota, kabupten maupun provinsi yang daerahnya memiliki obyek wisata selam (diving) mengikuti pameran Deep & Extreme 2014 di JI-Expo Kemayoran, Jakarta yang berlangsung 2730 Maret 2014. Disbudparkot Sabang, Aceh salah satunya. Maklum, PulauWeh dengan Sabang sebagai ibukotanya memiliki sejumlah lokasi selam (dive site) menawanyangsudahmendunia. Dalam situs, Aceh memiliki 18 dive site di Pulau Weh antara lain Sabang Wreck, Batee Tokong, Rubiah Sea Garden, Arus Balee, dan Iboih Beach dengan kedalaman 8-35 meter. Kepala dinas pariwisata Sabang Zulfi Purnawati menjelaskan tujuan Sabang mengikuti pameran ini untuk lebih memperkenalkan potensi wisata selam di Pulau Weh sekaligus menjaring wisatawan. “Tiap pameran kami selalu ikut, dan terbukti semakin banyak wisatawan baik mancanegara maupun Nusantara yang mengenal Pulau Weh sebagai lokasi terbaik menyelam di Indonesia,” jelasnya di lokasi pameran, belum lama ini. Zulfi menambahkan Sabang merupakan pintu masuk wisatawan mancanegara (wisman) ke Aceh. Total jumlah wisman ke Sabang sekitar 4.900 orang sedangkan wisatawan

JAKARTA (Waspada): Indonesia menyatakan masih terus waspada terhadap penyebaran penyakit Tuberkulosis (TB). Sampai 2012, masih ada 730 ribu kasus TB, dimana 460 ribu di antaranya kasus baru. Dari jumlah itu, sebanyak 67 ribu orang meninggal dunia, atau sama dengan 186 orang setiap harinya. Direktur Jenderal Penanggulangan Penyakit dan Penyehatan Lingkungan (P2PL), Tjandra Yoga mengatakan, walaupun telah diperoleh kemajuan dan keberhasilan yang sangat signifikan dalam program pengendalian TB, tetapi besaran masalah yang dihadapi sampai saat ini masih cukup besar. “Padahal kita punya target global TB pasca 2015 yakni eliminasi kematian dan penderita akibat TB atau Zero TB Deaths,” kata Tjandra Yoga saat seminar ‘World TB Day’ bekerjasama dengan Divisi Pulmonologi RSCM dan Bisolvon di Menara 165 Jakarta, akhir pekan lalu. TB adalah penyakit menular yang disebabkan kuman

Mycobacterium Tuberculosis. Penularannya melalui udara yang membawa kuman dari ludah dan dahak penderita. Perwakilan World Health Organization (WHO) untuk Indonesia, Khanchit Limpakarnjanarat dalam kesempatan yang sama mengatakan, yang sangat membahayakan adalah kasus-kasus resisten TB. Seseorang yang terkena TB dan tidak patuh dalam minum obat, membuatnya kebal terhadap jenis obat regular dan menjadikannya sebagai pasien Multi Drug Resistant Tuberculosis (MDR TB). “Diperkirakan 3 juta orang di dunia terinfeksi TB. Yang memprihatinkan, diperkirakan 80 persennya adalah pasien MDR TB,” kata Khanchit. Ahli paru dari RSCM, Telly Kamelia mengatakan, dalam menanggulangi peroslan TB dan MDR TB, perlu peran serta aktif para dokter umum, khususnya dokter-dokter yang bertugas di puskesmas. Selama ini, banyak dokter umum yang belum pernah mendapat pengetahuan lebih mengenai


Nusantara (wisnus) hampir 400.000 selama tahun 2013. Jumlah turis ke Sabang paling banyak dari Malaysia dan Singapura serta negara-negara Eropa terutama Jerman, Perancis, dan Italia serta dari Australia. “Target 2014 jumlah wisman dan wisnus ke Sabang tentu lebih dari itu. Kalau bisa 10.000 karena secara keseluruhan, Aceh menargetkan kunjungan 1 juta orang wisatawan pada tahun 2017,” jelasnya. Untuk menaikkan jumlah kunjungan wisman dan wisnus ke Sabang, Zulfi berharap pemerintah pusat dalam hal ini Kementerian Pariwisata dan Ekonomi Kreatif (Kemenparekraf) kembali menggelar event berskala internasiomal seperti

lomba yacth dan perahu layar Sabang International Regatta dan Sabang Jazz Festival. Pemeran bertajuk ‘Adventure for Nature ini diikuti 128 peserta. Beberapa booth peserta ada yang tampil beda untuk menarik pengunjung. Booth WWF Indonesia misalnya tampil dengan atmosfir laut, lengkap dengan ikan dan terumbu karang. Pengunjung boleh berfoto di booth yang sekaligus berkampanye penyelamatan hiu. Ada juga booth yang mengadakan kegiatan atraksi, di booth Aquarium SCUBEX misalnya, pengunjung dapat mencoba peralatan selam yang sudah dibeli. Di booth lain, pengunjung bisa mencoba rope climbing. (adjik)

JAKRTA (Waspada): Ketua Badan Akuntabilitas Keuangan Negara (BAKN) DPR yang sekaligus sebagai anggota Komisi VIII DPR RI, Sumarjati Aryoso menilai cukup rasional jika KPK khawatir akan dana bantuan sosial (bansos) yang kurang transparan. Hal tersebut terlihat dari meningkatnya pencairan dana sosial di 14 Kementerian menjelang pemilu, termasuk di Kementerian Agama. “Cukup rasional kekhawatiran KPK tersebut karena meningkatnya pencairan dana bantuan sosial di Kementeriankementerian. Kami hanya bisa berharap agar jangan sampai dana bansos itu digunakan untuk pencalegan atau pencapresan. Karena pada dasarnya bansos itu untuk rakyat tanpa ada embel-embel partai terten-

tu di dalamnya,”ungkap Sumarjati, Kamis (3/4) di Jakarta. Khusus untuk di Kementerian Agama yang notabene menjadi mitra kerjanya di Komisi VIII DPR RI, Sumarjati malah mempertanyakan bantuan sosial yang sudah dicairkannya mengingat masih banyak masyarakat atau siswa yang belum menerima BSM (Bantuan siswa miskin). Bahkan tunjangan guru di bawah Kementerian Agama pun belum juga dibayarkan. Padahal sejak 2013 Dirjen Pendidikan Islam Kemenag berjanji kepada DPR akan menyelesaikan hal itu dan membayar tunjangan guru. Namun hingga saat ini, menurut Sumarjati, hal tersebut belum juga dilakukannya. “Saya sampai malu lho kalau ketemu masyarakat di daerah-

MEDAN (Waspada): Melihat potensi bencana yang begitu besar di Indonesia, khususnya di Sumatera, Aksi Cepat Tanggap (ACT) Cabang Medan dan Masyarakat Relawan Indonesia (MRI) Sumut melaksanakan konsolidasi dan evaluasi bencana tahap pertama pada 2-3 April lalu. Konsolidasi tersebut juga antara MRI daerah (Medan, Kabanjahe, Deli Serdang, Serdang Bedagai, Labuhan Batu) dan MRI unit kampus (USU, IAIN, UMN, Microskill). Ketua Umum MRI Sumut, Zulham Fffendi, mengatakan seperti diketahui ACT Medan bersama MRI Sumut terus melakukan aktivitas kemanusiaan di Sinabung serta pemberdayaan masyarakat di Sumut. “Konsolidasi juga untuk memanfaatkan program recovery bagi korban erupsi Sinabung dan menyiapkan tim tanggap bencana di seluruh daerah Sumut,” katanya, Minggu (6/4). Dikatakan, posisi geogragfis Indonesia yang berada di cincin api (ring of fire) serta memiliki potensi bencana tektonik, menjadikan negeri ini berada di lingkaran api yang sewaktuwaktu bisa meletus. “Indonesia juga tercatat sebagai pemilik gunung berapi terbanyak di dunia yakni sebanyak 130 gunung berapi dan dari jumlah tersebut 17 di antaranya masih aktif,” terangnya. Dijelaskan, ring of fire, berarti sebuah rangkaian lempeng atau patahan besar yang menjadi ancaman potensial gempa. Posisinya mengepung perairan Indonesia mulai dari Laut Andaman menjalar dari atas pesisir Sumatera hingga timur. “Lempeng ‘Semangka’ di sepanjang daratan pantai barat Sumatera berakhir di Selat Sunda. Kemudian, bersambung dengan rangkaian puluhan gunung berapi aktif di Jawa-Bali-LombokSumbawa-Flores hingga Pulau Alor,” ujar Zulham. Melihat kenyataan tersebut tambah Zulham tidak ada jaminan bagi wilayah Indonesia bebas gempa mengingat semua lempeng di bumi ini saling berkaitan dan saling mempengaruhi. “Fakta tersebut menjelaskan kenapa gempa besar dan letusan gunung berapi terus beruntun terjadi,” pungkas Zulham.(m45)

Sampai Maret, Wholesales Daihatsu Capai 51.448 Unit JAKARTA ( Waspada): Wholesales (penjualan dari pabrik ke dealer) Daihatsu mencapai 51.448 unit meningkat 21,9 persen dibandingkan dengan periode yang sama 2013 sebesar 42.197 unit, Sabtu (5/4). Hasil ini tercatat di akhir kuartal pertama, Januari – Maret 2014 yang dicapai PT Astra Daihatsu Motor (ADM) selaku Agen Pemegang Merek (APM) Daihatsu di Indonesia. Wholesales Daihatsu triwulan pertama 2014 ditopang tiga kontributor utama yakni Gran Max, Xenia dan Ayla. Gran Max mencapai penjualan 16.726 unit atau 32.5 persen, yang terdiri dari Gran Max Pick Up sebanyak 13.440 unit (26,1 persen) dan Gran Max Minibus 3.286 unit (6,4 persen). Kontributor terbesar kedua adalah MPV All New Xenia sebanyak 13.413 unit atau 26,1 persen. Astra Daihatsu Ayla menduduki tempat ketiga dengan kontribusi 12.697 unit atau 24,7 persen. Selanjutnya adalah SUV Daihatsu Terios menyumbang 5.734 unit atau 11,1 persen. Disusul Daihatsu Sirion sebanyak 1.710 unit (3,3 persen) dan New Luxio 1.168 unit (2,3 persen). Sementara retailsales (penjualan dari dealer ke konsumen) Daihatsu mencapai

47.323 unit atau meningkat 14,2 persen dibandingkan dengan periode yang sama 2013 sebesar 41.441 unit. Perincian retailsales Daihatsu Triwulan Pertama 2014 tidak berbeda dengan wholesales, dengan penopang utama Gran Max, Xenia dan Ayla. Gran Max terjual 15.734 unit atau 33,3 persen, yang terdiri dari Gran Max Pick Up sebanyak 12.154 unit (25,7 persen) dan Gran Max Minibus 3.580 unit (7,6 persen). Disusul MPV All New Xenia sebanyak 12.286 unit atau 26,0 persen. Astra Daihatsu Ayla di tempat ketiga berkontribusi 12.147 unit atau 25,7 persen. Sementara produk Daihatsu lainnya yaitu Terios menyumbang 5.296 unit atau 11,2 persen; New Luxio 993 unit (2,1 persen); dan Sirion sebanyak 867 unit (1,8 persen). “Daihatsu telah menutup Triwulan Pertama tahun 2014 dengan pencapaian yang baik.

Kami mengucapkan terimakasih atas kepercayaan masyarakat dan sahabat Daihatsu di seluruh Indonesia. Daihatsu akan terus meningkatkan pelayanan penjualan dan purna jual, termasuk renovasi dan penambahan jumlah outlet dalam waktu dekat,” ungkap Amelia Tjandra, Direktur Marketing PT Astra Daihatsu Motor. Tahun ini adalah momentum 10 Tahun keberadaan Xenia di tengah keluarga Indonesia. Daihatsu menyelenggarakan 10 aktivitas di 10 kota dalam 10 bulan, dan terbuka bagi seluruh sahabat Daihatsu khususnya para pengguna setia Xenia di Indonesia. Pada bulan April 2014, Daihatsu menyelenggarakan kompetisi digital “Mejeng Bareng Xenia” sebuah aktifitas digital berupa kontes foto dengan tema kekompakan keluarga Xenia dengan mengupload minimal 5 dari 10 foto

tata cara diagnosis pasien yang dicurigai TB. “Padahal ujung tombak pengobatan TB ada di tangan para dokter dan petugas kesehatan di puskesmas. Mereka yang menentukan lewat sejumlah diagnosis dan tata laksana pengobatan. Para tenaga kesehatan di puskesmas juga yang harus meyakinkan pihak ke-

luarga untuk teguh membantu pengawasan minum obat pasien TB,” kata Telly. Dalam kaitan itu, Senior Brand Manager Bisolvon, Dewi Isnaniar mengatakan, pihaknya tergerak membantu pemerintah dengan memfasilitasi pelatihan penanganan penyakit paru, khususnya TB kepada sedikitnya 3500 dokter-dokter

di Indonesia. “Kami juga mengedukasi masyarakat agar mengantisipasi persoalan kesehatan paru. Jangan sampai menyepelekan kebersihan rumah dan lingkungan, karena biasanya di rumah atau lingkungan yang tidak sehatlah kuman TB dan kuman penyakit lain bersarang,” kata Dewi. (dianw)

Kekhawatiran KPK Cukup Rasional

ACT Dan MRI Konsolidasi

BOOTH Disbudparkot Sabang di Pameran Deep & Extreme 2014 di JI-Expo Kemayoran, Jakarta.


PERWAKILAN World Health Organization (WHO) untuk Indonesia, Khanchit Limpakarnjanarat (pertama dari kiri) didampingi Dirjen P2PL Kementerian Kesehatan, Tjandra Yogya Aditama (kedua dari kiri) serta dua ahli paru dari RSCM Jakarta, dalam Diskusi TB di Menara 165, akhir pekan lalu.

tantangan bahagia bersama Xenia sesuai tema yang telah ditentukan di “Kami mengajak para Xenia Mania atau Sahabat Daihatsu pengguna setia Xenia, untuk bergabung dalam berbagai aktifitas. Hadiah Grand

Prize 1 (satu) unit All New Xenia akan diperebutkan bagi peserta setelah mengikuti tiga kompetisi digital selama 2014.” sambung Amelia Tjandra.(m07/rel)

daerah, karena sesuai janji Dirjen Pendis akan membayar tunjangan guru di bawah Kemenag, juga menyalurkan BSM ke masyarakat miskin, namun pada kenyataanya sampai sekarang belum juga

dilakukan. Kalau sudah begini, masyarakat yang menagih janji pemerintah tersebut kepada kami,”ujar politisi dari Fraksi Partai Gerinda ini. Oleh karena itu seusai masa reses DPR, Komisi VIII akan

memanggil Dirjen Pendis Kementerian Agama untuk menjelaskan hal tersebut. Bahkan tidak tertutup kemungkinan hal tersebut juga akan disampaikan kepada Menteri Agama.(aya)

MTQN Di Batam Perlukan Dana Rp75 M JAKARTA (Waspada): Gubernur Kepulauan Riau, H. Muhammad Sani mengatakan, penyelenggaraan MTQ tingkat nasional yang ke- 24, memerlukan dana sebesar Rp 75 miliar yang diperoleh dari Anggaran Pendapatan dan Belanja Daerah (APBD) dan pemerintah pusat. MTQ nasional ke- 24 akan berlangsung 5-14 Juni mendatang dipusatkan di Islamic Center kota Batam, akan diikuti sekitar 5.000 kafilah putra-putri dari 34 daerah tingkat satu di antaranya Sumut, Aceh, Sumbar, Bengkulu, Jambi, Sumsel, Banten, DKI Jakarta, Jabar, Kalteng serta daerah lainnya. “Rencananya MTQN akan dibuka Presiden Susilo Bambang Yudhoyono dan ditutup oleh Wakil Presiden Boediono,

“tutur H.M Sani yang didampingi Menteri Agama, H. Suryadharma Ali kepada wartawan di kantor Kementerian Agama, Jakarta, Kamis (3/ 4). Adapun cabang yang akan diperlombakan adalah cabang Saritilawah untuk anak-anak, remaja dan dewasa, cabang Tartil, Qira’at dan cacat netra, cabang Syarhil Quran, cabang Fahmil Quran, cabang tafsir bahasa Inggris dan bahasa Indonesia, cabang Hifzil 10 juz dan 20 juz, cabang tafsir bahasa Arab dan Hifsil 30 juz, cabang Khat Alquran, cabang hifzil satu juz dan lima juz serta cabang M2IQ/ penulisan karya ilmiah kandungan Alquran. Selain itu, juga dimeriahkan dengan berbagai pameran dari 20 Kantor Wilayah (Kanwil) Kemenag. Selama berlangsungnya

MTQ, kata H.M Sani, seluruh peserta akan ditampung di berbagai hotel di kota Batam dan mendapat kesempatan untuk melakukan wisata religius seperti ke pulau Penyengat. “Sampai saat ini sudah 95 persen persiapan yang dilakukan, baik transportasi, sarana dan prsarana maupun akomodasi untuk peserta sudah rampung,” tutur H.M Sani.“ Kami siap untuk memberikan pelayanan yang terbaik bagi para kafilah MTQ nanti,”ujarnya. Sementara Menteri Agama, H. Suryadharma Ali berharap, MTQ tingkat nasional yang ke25 di Ambon nanti, lebih baik dari penyelenggaraan MTQ ke24, tidak saja sukses dalam penyelenggaraan, tapi sukses dalam hal kerukunan sesama umat beragama. (j06 )

Therapedic Dikenal Sebagai Produk Premium Terpercaya JAKARTA (Waspada): Event Plaza Indonesia Fashion Week 2014 yang disponsori oleh Therapedic Indonesia yang digelar 22-25 Maret lalu di Function Hall Level 2, Plaza Indonesia berlangsung sangat meriah dan mendapat respon yang sangat positif dari masyarakat luas. Selain mengusung tema “24 Years of Style” ini dan event ini juga menggandeng beberapa brand besar yang turut ambil bagian dalam memperagakan koleksinya yaitu, Num8erEight, Red Sebastian’s, Huntingfield, (X).S.M.L, Mango, Karen MIllen, Hengki Kawilarang, Iwan Tirta, Valentino, R e d Va l e n t i n o , F a r a h K h a n , D K N Y, BCBGMAXAZRIA, dan Bebe. Plaza Indonesia Fashion Week merupakan acara tahunan yang rutin diadakan disetiap tahunnya dalam rangka memperingati ulang tahun Plaza Indonesia. Acara tersebut bukan sekadar acara Fashion Week biasa yang menampilkan koleksi butik biasa pula, namun justru menghadirkan berbagai koleksi butik besar seperti koleksi catwalk yang didatangkan langsung dari negara dimana merek tersebut lahir seperti Paris, Milan, dan New York. President Direktur Massindo Group yang menaungi Therapedic Indonesia, Jeffri Massie saat ditemui wartawan beberapa waktu lalu di Medan mengungkapkan, konsumen premium menyadari pentingnya kualitas produk untuk memaksimalkan kualitas hidupnya. Therapedic hadir di fashion show Plaza Indonesia sebagai merek yang sangat berhubungan dengan kualitas hidup konsumen premium. “ Therapedic hadir sebagai salah satu matras yang mampu menyesuaikan kenyamanan saat tidur karena melindungi tulang belakang. Dengan serangkaian teknologi yang diciptakan, Therapedic mampu menjawab kebutuhan tidur sehingga menjadi matras yang super nyaman dua kali lipat lebih baik ketimbang produk kasur lainnya.


PRESIDENT Director Massindo Group Jeffri Massie bersama Menteri Pariwisata dan Ekonomi Kreatif Republik Indonesia Mari Elka Pangestu. Jeffrie mengatakan, pihaknya mengharapkan konsumen premium Indonesia lebih mengenal Therapedic sebagai produk premium terpercaya untuk meningkatkan kualitas tidur dan kualitas hidupnya. Sementara itu Event and Promotions Senior Manager Plaza Indonesia, Ria Juwita menambahkan, pihaknya melihat ada banyak kesamaan antara Plaza Indonesia FashionWeek 2014 dengan Therapedic. “Melalui Plaza Indonesia Fashion Week 2014 ini dapat terlihat persamaan Therapedic dan Plaza Indonesia.(rel/m44)



WASPADA Senin 7 April 2014

Barca Hemat Bahan Bakar


BEK Kepler Pepe menaiki tubuh rekan-rekannya ketika merayakan gol Gareth Bale ke gawang Sociedad di Anoeta Stadium, San Sebastian, Minggu (6/4) WIB.

Ganas Minus Mesin Gol MADRID (Waspada): Minus mesin gol Cristiano Ronaldo yang cedera, Sabtu (Minggu WIB), Real Madrid masih mampu mengganas pada jornada 32 La Liga Primera. Anak asuh entrenador Carlo Ancelotti bahkan pesta gol menggasak tuan rumah Real Sociedad 4-0 di Stadion Anoeta, San Sebastian. Menurut Ancelotti yang akrab disapa Don Carlo, Ronaldo disimpan demi menghindari cedera. Sebab besok malam, El Real mesti melakoni leg dua perempatfinal Liga Champions di markas Borussia Dortmund. “Gareth Bale terlihat nyaman dimainkan di sisi kiri, terkadang antara dia dan Ronaldo kerap bertukar posisi. Saya senang dia tetap cemerlang saat Ronaldo absen,” ucap An-

celotti melalui Football Espana, Minggu (6/4). “Saya mengapresiasi laga secara keseluruhan, karena kami bermain dengan sangat baik dan cerdas. Saya sangat senang, kemenangan ini membuat kami semakin kuat,” tambah mantan pelatih PSG, Chelsea, AC Milan dan Juventus tersebut. Tetapi El Merengues memerlukan waktu 45 menit untuk membuka aliran golnya. Asier Illarramendi yang membuka pesta tim tamu dengan menyambar bola pantul dari upaya Karim Benzema. Di awal babak kedua, Bale

memerlukan perawatan pada lututnya sebelum mencetak gol. Winger Wales itu mengubah skor menjadi 2-0 pada menit 67 dengan gol yang indah. Mampu mengontrol bola sapuan kiper Sociedad Claudio Bravo, Bale kemudian melesakkan bola ke sudut bawah gawang tuan rumah. Bek tengah Kepler Pepe mencetak gol ketiga El Real menit 85. Menit 86 pemain pengganti Alvaro Morata menutup pesta Los Blancos, hanya dua menit setelah dirinya masuk menggantikan Bale. “Ini bukan laga yang mudah, tapi saya memiliki tim yang senang bertarung. Saya bangga menjadi pelatih tim ini,” klaim Don Carlo. Sedangkan Illarramendi mengaku selalu istimewa untuk pulang ke rumah dengan kemenangan, apalagi dirinya kerap disiuli para pendukung

Sociedad setiap kali menyentuh bola. “Kami mendapati bahwa situasinya begitu berat pada babak pertama. Namun pertandingan terbuka pada babak kedua dan kami memaksimalkan ruang ekstra,” jelasnya. “Tidak banyak pertandingan tersisa. Kami harus memenangi semuanya jika kami ingin memiliki peluang juara,” beber Illarramendi. Pada laga lainnya, Rayo Vallecano terus meninggalkan zona degradasi berkat kemenangan 3-0 atas tamunya Celta Vigo. Hasil ini mendongkrak posisi klub Galicia itu ke peringkat 11 dengan 36 poin. Rayo telah unggul 3-0 di Stadion Vallecas, pinggiran Kota Madrid, ketika bek kiri Razvan Rat diusir keluar lapangan karena pelanggaran kerasnya menit 60. (m15/ant/rtr/cp)

Derita Die Roten Demi Red Devils BERLIN (Waspada): Bay e r n Mu n i c h menderita kekalahan perdana di Bundesliga Jerman sejak Oktober 2012, setelah menyerah 0-1 pada spieltag di markas Augsburg. Hasil itu sekaligus memutus rekor Bayern 53 pertandingan tidak terkalahkan, tetapi pelatih Pep Guardiola (foto) tetap tidak kecewa. Pep sengaja menurunkan tim lapis kedua untuk derbi Bavaria itu, karena Die Roten ingin memburu kemenangan atas Manchester United pada leg kedua perempatfinal Liga Champions, 9 April mendatang. “Cepat atau lambat kami akan kalah. Kami menerimanya dan kami mesti mempersiapkan diri secepat mungkin untuk MU,” papar Pep, seperti dilansir Reuters, Minggu (6/4). Duel melawan The Red Devils di Allianz Arena, menurut Pep, bagaikan final setelah hasil 1-1 pada leg pertama pekan lalu di Old Trafford.

LEG II PEREMPATFINAL LIGA CHAMPIONS Selasa, 8 April (GMT) 18:45 Borussia Dortmund (Jerman) v Real Madrid (Spanyol) 0-3 18:45 Chelsea (Inggris) v Paris Saint-Germain (Prancis) 1-3 Rabu, 9 April (GMT) 18:45 Atletico Madrid (Spanyol) v Barcelona (Spanyol) 1-1 18:45 Bayern Munich (Jerman) v Manchester United (Inggris) 1-1 “Rabu depan merupakan final bagi kami. Itu masalah hidup atau mati,” tegas mantan pelatih Barcelona tersebut. Dengan mata sudah tertuju pada persiapan menyambut kunjungan Red Devils, Pep memainkan tiga debutan, yakni bek sayap Ylli Sallahi dan Mitchell Weiser, serta PierreEmile Hoejbrerg di sektor sayap kiri. Perjudian itu berakhir buruk ketika Weiser kehilangan penguasaan bola. Pemain Augsburg Daniel Baier berhasil merampasnya dan memberi umpan kepada Sascha Molders untuk membobol gawang kiper Manuel Neuer menit 31. Namun kekalahan ini tidak berpengaruh bagi Die Roten, yang sudah memastikan diri

mempertahankan mahkota Bundesliga sejak pertengahan Maret lalu. “Kami melawan Augsburg dengan serius. Tapi hal terpenting untuk kami adalah tak ada yang cedera,” beber Neuer. Duta Jerman lainnya di Liga Champions, Borussia Dortmund, mendapatkan kemenangan pendongkrak moral untuk menyambut Real Madrid di Signal Iduna Park. Dortmund menundukkan tuan rumah VfL Wolfsburg 2-1, Sabtu (Minggu WIB), sehingga memantapkan posisinya di peringkat dua Bundesliga. Pemain Kroasia Ivica Olic membawa Wolves unggul lebih dahulu. Tandukan striker Robert Lewandowski mem-

Klasemen Palsu


Chelsea 51% 3 18 8 7 2 8 1 0 0


Penguasaan Bola 49% 0 Skor Akhir 4 Tembakan Total 2 Tembakan Tepat 3 Tembakan Pojok 5 Penyelamatan 18 Pelanggaran 1 Offsides 0 Kartu Kuning 0 Kartu Merah *Sumber ESPN

LONDON ( Waspada): Manajer Jose Mourinho (foto), tetap curiga Chelsea hanya sekejap saja memimpin klasemen Liga Premier pasca menggasak Stoke City 3-0 di Stamford Bridge, London. Menurut pria Portugal itu, klasemen saat ini masih palsu. Sebab, Liverpool maupun Manchester City berpeluang segera menggeser lagi The Blues, karena masih akan memainkan pertandingan sisa yang berpotensi menghasilkan poin penuh. “Lagi, klasemen palsu. Anda melihat di papan atas, di mana ada beberapa tim yang memiliki sisa laga lebih banyak. Jika Anda melihat di zona degradasi, hal sama terjadi,” tuding Mou melalui Sky Sports, Minggu (6/4). “Kami punya lima partai sisa di Liga Premier dan harus mencoba untuk memenangi semuanya. Setelah itu pada akhirnya kami hanya akan melihat berapa poin yang kami dapatkan dan di mana posisi kami,” tambahnya. Namun Mou mengaku puas dengan kesuksesan London Blues menggunduli Stoke di Stamford Bridge, Sabtu (Minggu WIB). Menurutnya, John Terry cs telah menunjukkan performa baik usai dua kekalahan beruntun dari Crystal

Palace dan Paris SG. “Tim tidak memulai duel dengan rasa percaya diri pasca dua kekalahan. Tapi saya pikir ini kemenangan bagus dan kami harus meraih hasil serupa sampai akhir musim,” pinta mantan pelatih Real Madrid, Inter Milan dan Porto tersebut. Mohamed Salah yang membuka keunggulan Si Biru menit 32, memanfaatkan umpan silang Nemanja Matic. Meski mendapatkan lagi peluang melalui Andre Schurrle dan Frank Lampard, Chelsea tidak bisa menambah gol hingga turun minum. Baru menit 60 Lampard dengan kaki kanannya mencetak gol kedua bagi Chelsea dari jarak dekat, memanfaatkan bola pantul hasil tendangan penaltinya yang diblok kiper Asmir Begovic. Setelah kegagalan memaksimalkan tiga peluang lewat Fernando Torres, Lampard dan Eden Hazard, Willian kemudian melengkapi kemenangan telak Biru lewat gol indahnya menit 72. “Kami akan menghadapi Liverpool, mungkin kami bisa mengharapkan tiga poin dari sana. Tetapi karena kami tak menghadapi ManCity, maka keuntungan ada di tangan mereka,” ucap Mou. (m15/ant/rtr/sky)


buat Dortmund menyamakan kedudukan, sebelum pemain sayap Jerman Marco Reus mencetak gol penentu kemenangan menit 77. (m15/ant/rtr/dpa)

Sociedad 43% 0 13 4 7 3 13 1 3 0


Penguasaan Bola 57% 4 Skor Akhir 21 Tembakan Total 7 Tembakan Tepat 8 Tembakan Pojok 4 Penyelamatan 10 Pelanggaran 4 Offsides 3 Kartu Kuning 0 Kartu Merah *Sumber ESPN

MADRID (Waspada): Barcelona tidak menampilkan permainan terbaiknya di Camp Nou Stadium, Sabtu (Minggu WIB), saat melibas Real Betis 3-1 pada jornada 32 La Liga. Menurut entrenador Gerardo ‘Tata’ Martino, skuadnya tampil demikian karena menghemat ‘bahan bakar’ untuk menghadapi Atletico Madrid pada leg kedua perempatfinal Liga Champions, 9 April mendatang. “Perasaan yang saya miliki adalah laga ini mencuat di antara dua duel maha penting pada Selasa lalu dan Rabu mendatang,” tutur Tata, seperti dilansir Reuters, Minggu (6/4). Lionel Messi yang kembali tajam setelah sempat absen dua bulan karena cedera, membuka keunggulan El Barca melalui titik penalti menit 15, setelah bek Jordi Figueras melanggar Alexis Sanchez di kotak 12 pas Betis. El Catalan mendominasi penguasaan bola dalam kurun waktu lama, tapi gagal mengkonversinya menjadi gol demi gol. Pasukan Tata beruntung dapat unggul dua ketika Figueras secara tidak sengaja membelokkan bola ke gawangnya sendiri menit 67. Betis kemudian menimbulkan rasa cemas bagi tim tuan dua menit berselang, ketika mencetak gol balasan melalui pemain pengganti Ruben Castro. Menit 86 Messi menyarangkan gol keduanya gara-ga-


BOMBER Barca Lionel Messi (atas) menjinakkan kiper Betis Antonio Adan di Camp Nou Stadium.

Senin, 7 April


Levante v Ath Bilbao


Minggu, 6 April Malaga v Granada


Sabtu, 5 April Atl Madrid v Villarreal Barcelona v Real Betis Sociedad v Real Madrid Vallecano v Celta Vigo

1-0 3-1 0-4 3-0

Jumat, 4 April Almería v Osasuna


ra tangan bek Antonio Amaya mengenai bola di kotak terlarang tim tamu. Kiper Adan sempat menggagalkan tembakan awal Messi, namun mesin gol asal Argentina itu mampu menyambar bola pantul untuk mencetak gol ke-25nya musim ini di liga. Si Kutu pun kini memiliki koleksi gol sama dengan striker Atletico Diego Costa, namun mereka masih tiga gol lebih sedikit di bawah pencetak gol

terbanyak Cristiano Ronaldo dari Real Madrid. “Kami mesti menang untuk menjaga tekanan terhadap sang pemuncak klasemen. Kami menghargai hasil setinggi mungkin sebisa yang kami mampu, tapi tidak dengan cara bermain kami,” tutur Tata. Akibat menghemat bahan bakar, Xavi Hernandez cs sampai disoraki pendukungnya sendiri di Camp Nou. Winger Pedro Rodriguez memahami kondisi tersebut. “Mereka tahu apa yang mereka inginkan. Mungkin kami kurang intensitas di babak kedua, tapi kami senang dengan kemenangan ini. Betis bermain bagus dan membuat semua menjadi sulit,” jelasnya. “Terpenting adalah hasilnya, karena perjuangan kian berat hingga akhir musim. Jarak untuk melakukan kesalahan sangat kecil. Setiap partai terasa seperti final, ini akan sangat sulit,” pungkas Pedro. (m15/ant/rtr/fe)

Colchoneros Langsung Fokus Los Cules MADRID (Waspada): Atletico Madrid digaransi setidaknya finis di peringkat ketiga La Liga dan lolos otomatis ke Liga Champions musim depan, setelah mengatasi Villareal 1-0 pada jornada 32. Sang pemimpin klasemen kini unggul 23 angka di atas tim peringkat empat Athletic Bilbao, sehingga tidak mungkin tergeser lagi kendati Bilbao masih menyisakan tujuh pertandingan lagi. Entrenador Diego Simeone pun menegaskan, Los Colchoneros langsung fokus menyambut kedatangan Barcelona pada leg kedua perempatfinal Liga Champions, 9 April mendatang. “Sekarang kami harus fokus di Liga Champions, itu penting bagi klub. Mudah-mudahan kami dapat memulihkan diri dengan baik dalam empat hari ini,” jelas Simeone, seperti dikutip dari AFP, Minggu (6/4). Los Rojiblancos tidak diperkuat pencetak gol terbanyak Diego Costa dan pengatur permainan Arda Turan ketika menjamu Villarreal di Stadion Vicente Calderon. Keduanya dililit cedera ringan, namun sepertinya siap untuk menghadapi Los Cules. Tiago Mendez cs masih mampu mengalahkan pasu-

Klasemen La Liga At Madrid 32 25 4 Barcelona 32 25 3 Real Madrid 32 24 4 Ath Bilbao 31 16 8 Sevilla 31 14 8 Sociedad 32 14 8 Villarreal 32 14 7 Valencia 31 11 7 Espanyol 31 11 7 Levante 31 10 10 Malaga 32 10 8 Celta Vigo 32 10 6 Vallecano 32 11 3 Granada 32 10 4 Osasuna 32 9 6 Elche 31 7 11 Getafe 31 8 7 Valladolid 31 6 12 Almeria 32 8 6 Real Betis 32 5 7 AP

GELANDANG Atletico Tiago Mendez (kiri) mengatasi pemain Villarreal Tomas Pina di Vicente Calderon. kan Kapal Selam Kuning berkat permainan efisien di depan para pendukung fanatiknya, yang menikmati perjalanan terbaik Colchoneros sejak terakhir kali menjuarai La Liga tahun 1996 silam. Raul Garcia menjadi bintang kemenangan dengan mencetak gol tunggal ke gawang tim tamu menit 14. Garcia menanduk bola tendangan sudut Koke, setelah itu tuan

rumah tidak terlalu mengalami kesulitan untuk menahan tekanan The Yellow Submarines. “Saya kehabisan kata-kata untuk terus memberi selamat kepada para pemain atas upaya dan komitmen mereka,” sanjung Simeone. Pelatih asal Argentina itu sepertinya telah mengubah Atletico menjadi kandidat juara Spanyol dan Eropa sejak

3 70-22 79 4 92-26 78 4 90-32 76 7 53-34 56 9 55-46 50 10 54-48 50 11 51-38 49 13 44-45 40 13 34-36 40 11 29-38 40 14 35-40 38 16 34-47 36 18 37-68 36 18 29-46 34 17 28-53 33 13 25-42 32 16 29-48 31 13 32-50 30 18 34-60 30 20 28-64 22

mengambil alih tim itu pada akhir 2011. Pasukannya juga mampu menahan Barca 1-1 pada leg pertama pekan lalu di Camp Nou, sehingga dijagokan untuk lolos semifinal Liga Champions. “Kami akan menatap duel demi duel dengan fokus penuh. Mulai sekarang, kami akan menderita memasuki akhir dari La Liga, tapi kami harus bisa melaluinya,” tegas Thibaut Courtois, penjaga gawang Atletico pinjaman dari Chelsea. (m15/ant/afp/fe/as)

Transfer Hazard Tergantung Istri LONDON (Waspada): Bintang muda Chelsea, Eden Hazard, mengaku masa depan transfernya ke Paris SaintGermain musim panas mendatang, tergantung kepada Natasha (foto), istri yang telah memberinya dua putra. “Apabila istri saya mengatakan kepada saya untuk pergi ke Paris, maka saya harus mempertimbangkannya,” beber Hazard, seperti dilansir Interieur Sport, Minggu (6/4). PSG sendiri kabarnya siap menggelontorkan dana besar demi melabuhkan Hazard ke Parc des Princes. Bintang Bel-

gia berusia 23 tahun itu dianggap solusi lanjutan bagi Les Parisiens untuk menjadi tim superior di pentas Ligue 1 dan Eropa. “Parc des Princes merupakan stadoin nyata dan tempat spesial di mana saya mengetahui sensasi pertama saya sebagai seorang pesepabola profesional,” ucap Hazard, yang pernah mengungkapkan impian terbesarnya adalah main bersama PSG. Bagi Hazard, klub yang bermarkas di kota mode itu merupakan tim kuat dan hebat. Asa Hazard kemudian disambut

Lagi Inter Buang Peluang

PSG, sebagaimana diungkapkan gelandang anyarnya, Yohan Cabaye. Pelatih Timnas Belgia, Marc Wilmots, pun turut mendukung penuh jika bintang andalannya untuk Piala Dunia 2014 itu menerima tawaran dari Les Parisiens. “Bila dia benar-benar ingin masuk dalam kategori pemain yang ingin membuat sejarah, pindah ke Paris Saint Germain adalah kesempatan bagus yang sayang bila diabaikan,” jelas Wilmots lewat Football Direct News. “Ini waktu yang tepat untuk R O M A (Antara/Reuters): Inter Milan menyianyiakan dua keunggulannya melalui gol-gol Mauro Icardi, Sabtu (Minggu WIB), saat ditahan imbang 2-2 oleh Bologna di Stadion Giuseppe Meazza. Hasil ini menambah tekanan terhadap allenatore Walter Mazzarri yang timnya dicemooh di depan presiden klub Erick Thohir. Buruknya benteng pertahanan Inter membuat Kone Panagiotis dapat menyamakan kedudukan, sebelum tim tuan rumah gagal GELANDANG Inter Anderson Hernanes (kanan) dihadang penyerang Bologna Lazaros Christodou di Stadion Giuseppe Meazza, Milan. -AP-

pindah ke tingkat yang lebih tinggi. Hazard dan (Zlatan) Ibrahimovic, mereka dua pemain

yang berbeda, tetapi mereka bisa saling melengkapi,” pungkas Wilmots. (m15/okz/is/fdn)

memaksimalkan penalti. “Ini keempat kalinya kami kehilangan angka meski bermain sangat baik, yang saya rasa layak mendapatkan kemenangan. Entah bagaimana, saya harus menaksir ulang para pemain,” sesal Mazzarri, Minggu (6/4). Icardi membawa tuan rumah unggul menit keenam, namun disamakan oleh tembakan Jonathan Cristaldo menit 35. Gol kedua Icardi menit 63, dibalas lagi oleh Kone menit 73. Tapi La Beneamata sepertinya bakal menang, setelah mendapat hadiah tendangan 12 pas menit 84. Namun kemudian para pendukung tuan rumah merasa perih, setelah penalti lemah Diego Milito dapat digagalkan kiper Gianluca Curci. “Masuk akal bahwa Diego Milito yang mengambil penalti, sebab selalu dia yang mengambilnya dan dia memiliki

kaki-kaki segar,” ujar Mazzarri. I Nerrazzurri mendapat hadiah penalti setelah Rodrigo Palacio dijatuhkan oleh Andrea Mantovani. “Mungkin kami kurang latihan sehingga kami tidak pernah mencetak gol dari situasi itu,” dalih Mazzarri. Inter bahkan bisa saja kalah, namun Samir Handanovic dua kali melakukan penyelamatan gemilang untuk menggagalkan peluang Robert Acquafresca pada masa tambahan waktu.

Inter 65% 2 17 6 5 6 15 2 1 0

Bologna Penguasaan Bola 35% 2 Skor Akhir 12 Tembakan Total 8 Tembakan Tepat 5 Tembakan Pojok 4 Penyelamatan 16 Pelanggaran 2 Offsides 2 Kartu Kuning 0 Kartu Merah *Sumber ESPN


WASPADA Senin 7 April 2014


Bobcats Rebut Tiket Playoff LEVELAND, AS (Waspada): Charlotte Bobcats dipaksa bekerja keras untuk mengalahkan Cleveland Cavaliers hingga overtime. Namun, kemenangan itu sekaligus memberi Bobcatts satu tiket ke babak playoff kompetisi basket NBA musim ini. Dalam pertandingan di Quicken Loans Arena, Cleveland, AS, Minggu (6/4), Bobcats harus melewatibabak overtime sebelum menang 9694 atas Cavaliers. Ini adalah kemenangan keempat yang

dicatat secara beruntun oleh tim arahan Steve Clifford itu. Kemenangan ini mengantar Bobcats lolos ke babak playoff untuk pertama kalinya sejak 2010. Mereka kini menempati posisi ketujuh kla-

semen Wilayah Timur. “Ini adalah prestasi signifikan untuk tim kami, dan pencapaian ini menempatkan kami di tempat yang berbeda di liga,” sahut Clifford seperti dikutip ESPN. “Anak-anak di ruang ganti sangat bersemangat — dan sudah seharusnya seperti itu — karena kami punya tim yang bagus dan kelompok yang berisi orang-orang yang layak mendapatkannya.”

Sementara itu, kekalahan ini membuat asa Cavaliers untuk lolos ke playoff makin menipis. Cavaliers masih tertinggal 3 1/2 gim dari Atlanta Hawks yang ada di peringkat delapan untuk satu tempat terakhir di babak playoff dari Wilayah Timur. Al Jefferson tampil sebagai top performer dari kubu Bobcats dengan menyumbang 24 poin, 15 rebound, dan empat assist. Sementara dari kubu

Hasil Minggu (6/4) Orlando v Minnesota Chicago v Washington Charlotte v Cleveland Detroit v Boston Brooklyn v Philadelphia Toronto v Milwaukee

100-92 96-78 96-94 115-111 105-101 102-98

Cavaliers, Kyrie Irving mencetak 44 poin, tujuh rebound, dan delapan assist untuk jadi penampil terbaik. (esp/m47)

Final Petkovic CHARLESTON, AS (Waspada): Andrea Petkovic (foto), berhasil melaju ke partai final turnamen Family Circle Cup. Sempat kalah di set pertama, Petkovic mampu bangkit untuk menutup pertandingan dengan kemenangan atas Eugenie Bouchard dengan skor 1-6, 6-3, 7-5 di Charleston, AS, Minggu (6/4). Permainan cemerlang diperlihatkan Bouchard sejak set pertama. Petenis belia asal Kanada itu berhasil merebut set pertama dengan skor 6-1. Tapi, Petkovic mampu bangkit pada set kedua

Ricciardo Hanya Fokus Poin

dengan meraih kemenangan 6-3. Pada set ketiga, Petkovic kembali mendapatkan perlawanan dari Bouchard. Genie, sapaan akrabnya, sempat memimpin dengan skor 4-2, tapi Petkovic yang baru sembuh dari cedera mampu bangkit dan memenangkan pertandingan. “Saya sangat lega dan saya bangga saya bisa kembali bermain setelah sembuh dari cedera. Saya tidak pernah berpikir akan ke final sebuah turnamen lagi,” ujar Petkovic, yang tidak pernah melewati babak perempatfinal di

enam turnamen musim ini, Berkat hasil buruk itu, Petkovic harus rela turun ke peringkat 40 WTA. Dia dengan tenang berhasil menganalisa pertandingan set pertama dan mencoba bermain lebih baik di set berikutnya. “Saya tidak kesal karena saya merasa Genie bermain tenis sangat luar biasa. Saya hanya bermain sekitar 10 persen saja,” lanjutnya, dilaporkan CBCSports, Minggu (6/4/2014). (cbs/m47)


Pemain Charlotte Bobcats, Al Jefferson, kanan, melepaskan tembakan saat timnya bertemu Cleveland Cavaliers di lanjutan kompetisi NBA di Cleveland, AS, Minggu (6/4).

Button Keluhkan Pembatasan BBM

SAKHIR, Bahrain (Waspada): Tampil oke dalam sesi kualifikasi, driver Red Bull, Daniel Ricciardo, tetap menyebut podium GP Bahrain adalah target kurang realistis. Hal itu tak lepas dari hukuman yang harus ia jalankan di sini. Ricciardo mencatat waktu terbaik ketiga dalam sesi kualifikasi GP Bahrain,. Tetapi ia takkan start dari posisi itu dalam balapan, Minggu (6/4) malam WIB, karena harus menjalani sanksi turun 10 posisi start selepas GP Malaysia. “Aku tentu ingin merangsek ke depan dan naik podium setelah sekitar 57 lap, (tapi) aku pikir secara realistis kami pada awalnya cuma harus memikirkan cara meraih poin. Musim berjalan cukup baik tapi sejauh ini aku tak memiliki poin sebagai buktinya,” ucap Ricciardo . Ricciardo mengawali musim ini dengan tampil oke di GP Australia dan melintasi garis finis di posisi dua, meskipun pada prosesnya ia didiskualifikasi dari balapan tersebut. Sedangkan di GP Malaysia ia harus retired di lap 49 akibat masalah teknis yang dialami mobilnya. (crs/m47)


SAKHIR, Baharain (Waspada): Pebalap kawakan McLaren, Jenson Button (foto), mengeluh tentang isu penghematan bahan bakar minyak jelang berlangsungnya seri ketiga balap mobil Formula Satu (F1) di sirkuit Internasional Bahrain (BIC). Sebenarnya apa yang diraih oleh Button selama dua sesi latihan bebas di BIC tidaklah begitu buruk. Walaupun pebalap asal Jerman tersebut mengalami sedikit penurunan

Yamaha Ingin Amankan Lorenzo, Rossi GERNO DI LESMO , Italia (Waspada): Kontrak dua pebalap andalan, Jorge Lorenzo dan Valentino Rossi akan berakhir. Karenanya, Yamaha Movistar sangat berharap dapat mempertahankan kedua rider tersebut tahun depan. Yamaha menyadari banyak pesaing yang mengincar pebalap andalannya itu, salah satumya Honda yang sudah mengakui pada bulan lalu ingin merekrut pembalap asal

Spanyol tersebut untuk musim 2015. Yamaha akan bergerak dengan cepat. Pabrikan motor asal Jepang itu telah menawarkan kontrak dua tahun kepada Lorenzo. Selain dua kali juara dunia MotoGP itu, Yamaha juga berniat untuk memperpanjang kontrak Rossi. Meski demikian, pebalap veteran asal Italia itu baru mau memperpanjang kontraknya bersama Yamaha, jika dia ma-

sih bisa bersaing dengan para pebalap muda Marc Marquez, Dani Pedrosa dan Lorenzo. Dengan kontrak empat pebalap teratas akan berakhir pada musim 2014, Yamaha memang berniat untuk memberikan kontrak baru kepada Rossi dan Lorenzo. Praktis, hal itu akan menutup peluang Pol Espargaro dan Bradley Smith promosi ke tim pabrikan musim depan. “Tahun yang sangat pen-

ting dengan proses pembahasan kontrak bersama Lorenzo dan Rossi. Skenario utama kami adalah memperbarui kontrak keduanya dan proses itu akan segera terjadi,” kata bos Yamaha, Lin Jarvis dilansir dari MCN. Sebelumnya, Rossi berbicara mengenai hubungannya dengan Lorenzo. Bahkan, Rossi sangat berharap Lorenzo tetap bertahan di Yamaha. Di masa lalu, Rossi memang sempat memiliki hubungan yang tidak sedap dengan Lorenzo. Tepatnya, ketika pebalap asal Spanyol itu dipromosikan ke kelas MotoGP oleh Yamaha. Hal itu yang memutuskan

Rossi untuk hengkang ke Ducati dan membalap selama dua musim di sana. Kini, The Doctor telah kembali memperkuat Yamaha, dan hubungannya dengan Loren-zo semakin baik dari hari ke hari. “Sangat baik. Kami sudah tumbuh bersama, hubungan kami sangat menjijikkan di masa lalu, tapi sekarang ada saling respek. Ini membuat kami berdua bekerjasama untuk meningkatkan per for ma motor Yamaha,” ujar Rossi, dalam wawancara dengan Sky Italia. “Tentu, saya akan menjadi lawan utamanya dan dia adalah lawan pertama saya. Tapi, saya ingin sekali menjadi rekan

setim Lorenzo, saya berharap dia bertahan dengan Yamaha,” sambung pembalap asal Italia itu. Begitu Rossi memutuskan untuk berhenti berkarier sebagai pebalap, The Doctor sangat yakin ada pembalap dari negaranya yang akan bersinar di MotoGP. “Menurut pendapat saya, ada pebalap asal Italia yang sangat tangguh. Saya ingin mengatakan Fenati, Antonelli, Bagnaia, Morbidelli, dan adik saya yang akan berlaga di CEV, Bulega dan saya lupa beberapa di antaranya. Namun, paling tidak ada 10 pembalap yang bisa menjadi suksesor saya,” tutupnya. (mcn/sit/m47)

pada latihan bebas kedua. Di mana pada latihan bebas pertama Button duduk ditempat kelima dengan waktu tercepat 1menit 38.636 detik di bawah pebalap tim Force India, Nico Hulkenberg. Sedangkan pada latihan kedua driver kawakan tersebut turun satu peringkat menjadi posisi enam berjarak 1.203 detik dari Lewis Hamilton di peringkat teratas. Button sendiri mengaku cukup puas dengan performa mobil jika menilik performa mereka di GP Malaysia Minggu lalu. Namun, dirinya tak mengelak bahwa masih harus melakukan beberapa perbaikan di tambah dengan isu pengehematan bahan bakar. “Ini (hasil latihan bebas) tidak begitu buruk, dalam hal konsistensi mobil ini lebih baik dari Malaysia. Saya rasa semua driver akan merasakan hal tersebut. Namun jarak lebar dengan Mercedes masih terlihat,”ujar Button. “Kami baik-baik saja tapi masih ada beberapa kelemahan yang harus diperbaiki. Ka-

mi harus menghemat banyak bahan bakar dan itu sangat menggangu,”tambahnya, sebagaimana dilaporkan Crash, Sabtu (5/4). Lebih jauh lagi, Button merasa akan sangat sulit bagi McLaren bertarung memperebutkan podium pada seri ketiga F1 GP Bahrain jika melihat dua pembalap Mercedes berada di depan. Tidak hanya Mercedes, Red Bull dan Force India pun berada di depan mereka. “Red Bull terlihat sangat cepat dan Force India masih terlihat terlalu cepat seperti biasa. Jadi, tidak akan mudah untuk mengalahkan mereka di lintasan tapi anda tidak pernah tahu apa yang akan terjadi. Kita akan lihat bagaimana perlombaan berjalan,”lanjut Janson. “Saya rasa ini akan memakan waktu yang lama (mengejar Mercedes). Tim terdekat dari Mercedes adalah Red Bull. Untuk kami ini adalah gap yang besar. Lebih besar dari yang kami perkirakan,”tutup pebalap senior F1 itu. (crs/m47)

Mengucapkan selamat dan semoga berbahagia dalam menempuh hidup baru kepada kedua mempelai:

Adnin Maududy Lubis, SE Putra Kel. H. Taslim Adnan Lubis dan Ibu Hj. Ratna Maulidar dengan

Mutia Zahara Putri Kel. Bapak Safudin dan Ibu Dwi Heny Herawati Pada Minggu, 6 April 2014 pukul 11.00 s.d 17.00 WIB Bertempat di Hotel Asean International Lt. 8 Royal Ballroom - Medan Dari: net

Hang Tuah Jasa Said & Keluarga

Jorge Lorenzo dan Valentino Rossi.

Problem Catur




Hitam melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2. MENDATAR


1 4 9


10 12 14 16 19



21 4

22 25 26 27 28 29 30



Event nasional Rabu lusa. Perkumpulan seasas dan setujuan (bidang politik). Gelar kaisar Rusia (pra Revolusi 1917). Bakat luar biasa pada umur lebih dini daripada sebayanya. Negeri. Kegiatan dilakukan calon legislatif. Benda yang bervalensi satu. Bata berongga, lebih besar dari batu bata. Kenderaan roda empat berbadan panjang untuk angkutan umum atau barang. Kepala pemerintahan perebut kekuasaan dengan cara tidak demokratis dan berkuasa mutlak. Gitaris (Inggris). Alat tulis. Lapisan; Stratum. Pecandu morfin. Kismis (Inggris). Nama kantor berita nasional.



1 A








Jawatan atau tempat kirim-mengirim surat.

2 3 5 6 7 8

9 11

13 15 17 18 20 23 24 26

Markah. Kusta. Lepas lelah. Tiga pihak (misal pemerintah, pengusaha dan buruh). Ilmu Pengetahuan Alam. Sistem ekonomi antara lain mengumpulkan cadangan emas dan memegang monopoli perdagangan luar negeri. Usungan untuk mengangkut orang dengan dipikul. Lambang huruf yang disepakati pemakaiannya terutama di bidang kesekretariatan untuk menulis cepat. Riang; Gembira. Men In Black. Orang yang mengamati cuaca untuk mengatur haluan kapal atau arah pesawat. Lubang udara keluar masuk. Tempat penampungan manusia atau hewan untuk mencegah penularan wabah. Hasil menatar; Tingkatan. Putusan wewenang Mahkamah Agung. Sangat baik; Utama.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, atau di kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan tak sampai lima menit. Jawabannya di halaman A2 kolom 1.

8 9 2 6 7 1 3 4 5 8 3 7 1 6 8 2 9 5 7 7 5 9 2 3 9 4 5 8 3 7 2 6 9 3 1

5 9 6 5 1 8 6 2 1



WASPADA Senin 7 April 2014


Komunitas Honda Antusias Regional Community Safety Riding 2014


SALAH seorang peserta demo teknik menikung pada “Regional Community Safety Riding 2014” yang digelar CV Indako Trading Co.

Segera Dapat Izin Main pbsi

Natsir gagal India Terbuka. Sebaliknya, Rijal/ Vita mempersembahkan gelar pertama mereka sejak kembali diduetkan awal tahun 2014. Gelar lainnya didominasi tuan rumah. Juara tunggal putri direbut Yui Hashimoto yang menang atas Anna Doi juga dari Negeri Matahari Terbit 21-13, 21-14. Di final ganda putra, Kenta Kazuno/Kazushi Yamada mengalahkan Bong Chan Jun/Duck Young Kim (Korsel) 2119, 21-11. Pemenang final ganda putri jatuh ke tangan Shizuka Matsuo/Mami Naito yang memenangi All Japanese Final melawan Kugo Asumi/Yui Miyauchi 24-22, 21-6. Sementara itu, Ng Ka Long (Hong Kong) memupuskan mimpi Riichi Takeshita (Jepang) 21-13, 21-12. (m33/tsw)

Timnas U-19 Makin Kompak JAKARTA (Waspada): Pelatih Timnas U-19, Indra Sjafri, menyatakan skuad besutannya semakin kompak, tidak hanya di dalam lapangan pertandingan, akan tetapi di luar lapangan juga. Kekompakan tersebut, masih kata Indra, bisa terlihat begitu semua pemainnya yang beragama Islam usai ibadah umrah bersama di tanah suci. Semua pemain pun tampak semakin akrab dan diharapkan berlanjut pada penampilan di lapangan. “Alhamdulillah, Timnas

U-19 baru saja selesai melaksanakan ibadah umroh dengan rasa kebersamaan dan keakraban,” tulis Indra dalam pesan singkatnya kepada Waspada, Minggu (6/4). “Tadi malam jam 24.00 waktu setempat, kami tiba di Oman untuk mengawali rangkaian tur Timur Tengah. Semoga kekompakan semakin terjalin. Mohon doanya,” sambung Indra lagi. Masih tulis Indra, sama dengan agenda ujicoba di Uni Emirat Arab, di mana Garuda Jaya sesuai rencana akan me-

mainkan dua laga uji tanding melawan Timnas Uni Emirat Arab U-19 di Dubai dan Oman. “Sebagai konsekuensinya, pihak FA Oman bersedia membantu perubahan jadwal penerbangan ke Dubai. Bagi kami, semakin banyak laga uji tanding, tentunya akan semakin baik,” tutup Indra. (yuslan)

MEDAN (Waspada): Legiun asing PS Kwarta asal Argentina, Jorge Alberto, sudah mulai beradaptasi dengan pemain lainnya setelah sepekan bergabung. Hal tersebut ditunjukkan dengan peningkatan grafik permainan di setiap laga ujicoba dan latihan intensif. Di laga ujicoba perdananya, mantan pemain Divisi B Argentina, CA Sarmiento itu hanya sanggup bermain 25 menit. Namun, Jorge terus mengalami peningkatan di setiap kesempatan hingga laga terakhir melawan Persatuan Sepakbola Kwala Tanjung Putra (PSKTP) bermain 65 menit. Melawan PTPN III Sei Karang, Jorge bahkan mencetak gol. Kepada Waspada, Jorge mengaku sangat menikmati proses adaptasinya. Hal tersebut, menurutnya, berkat keberadaan tim pelatih, rekan setim maupun manajemen yang kerap membantunya dalam proses adaptasi dengan lingkungan. “Aku perlahan sudah mulai beradaptasi dengan iklim di sini. Untungnya saya bertemu dengan beberapa teman yang baik, karena mereka mau membantu saya menyesuaikan diri dengan cepat,” kata Jorge, Minggu (6/4). Selain itu, dirinya juga menikmati gaya permainan possesion play skuad Burung Su-

matera yang lebih mengutamakan penguasaan bola untuk membongkar pertahanan lawan. “Saya suka dengan gaya permainan tim ini, makanya saya merasa nyaman dan selalu mencoba untuk bermain dengan penguasaan bola yang baik. Kami semua gembira dan mulai berbicara untuk mencapai gelar,” jelasnya. Pelatih PS Kwarta, Slamet Riyadi, mengatakan gembira dengan peningkatan kondisi fisik Jorge dan kemampuannya dalam menyerap instruksi dengan baik. Meskipun komunikasi masih menjadi kendala, Slamet menilai sang pemain tetap profesional dan cepat adaptasi. “Pemain Amerika Latin biasanya cepat adaptasi. Bagi saya, dia (Jorge) pemain bagus dan gampang menyesuaikan diri dengan gaya permainan tim,” kata Slamet juga memberikan sejumlah catatan perbaikan yang harus dibenahi Jorge. “Alur bolanya harus lebih

World Junior Championships 2014 Championships 2014, Indonesia punya kans besar untuk kembali menang atas Hong Kong. Saat itu, junior Indonesia menang 4-1. Menghadapi Sri Lanka, Indonesia optimis mampu memenangkan pertandingan dengan menyapu bersih lima nomor yang dimainkan. Hal ini disampaikan langsung oleh Manajer Tim Indonesia, Maria Fransisca. “Kami yakin dapat memenangkan pertandingan melawan Sri Lanka dan mudahmudahan kami sapu bersih. Para pemain sudah dalam keadaan siap untuk bertanding di nomor beregu,” ujar Maria, Minggu (6/4). “Soal pemain-pemain yang akan diturunkan, saya dan tim pelatih masih akan mendiskusikan soal ini, apakah kami akan menurunkan tim terbaik atau belum. Kalau melihat lawan-lawan di pool X1, kami optimis bisa menjadi


TIM junior Indonesia latihan persiapan jelang pertandingan nomor beregu Kejuaraan Dunia Junior 2014, Senin (7/4) ini. juara grup,” tambah Maria. Ditambahkan Maria, semifinal menjadi target tim junior Indonesia di perebutan Piala Suhandinata ini. Berdasarkan daftar unggulan yang dirilis oleh BWF (Badminton World Federation), Indonesia berada di peringkat ketiga di bawah Korea dan Tiongkok. Pada BWF World Junior Championships 2013 di Bangkok, Indonesia berhasil melaju ke final setelah mengalahkan juara bertahan Tiongkok. Pencapaian ini sementara menjadi prestasi terbaik tim junior Indonesia sepanjang BWF World Junior Championships. (yuslan)


Problem Catur

Waspada/Arianda Tanjung

PEMAIN asing PS Kwarta Jorge Alberto (kanan) berlatih dengan serius untuk meningkatkan grafik permainannya. cepat lagi. Pasalnya, kadang dia ambil resiko dengan sering bermain individu. Dengan begitu saya khawatir, karena pemain di Indonesia kebanyakan melakukan pelanggaran berbahaya. Apalagi dia belum

JAKARTA (Waspada): PSSI terus melakukan pembenahan organisasi pada level daerah. Seiring itu, Djohar Arifin Husin selaku Ketua Umum PSSI mengukuhkan Pengurus Asosiasi PSSI Kalimantan Timur di aula Kantor Gubernur Kalimantan Timur di Samarinda, Jumat (4/4) malam. Kepengurusan pimpinan Yunus Nursi yang terpilih pada Musprovlub PSSI Kaltim Desember lalu itu dikukuhkan untuk masa bakti lima tahun mendatang. Acara tersebut turut dihadiri Gubernur Kaltim, Dr Awang Faroek.

Mutia Zahara Putri Kel. Bapak Safudin dan Ibu Dwi Heny Herawati Pada Minggu, 6 April 2014 pukul 11.00 s.d 17.00 WIB Bertempat di Hotel Asean International Lt. 8 Royal Ballroom - Medan Dari:

Hang Tuah Jasa Said & Keluarga



1 4 9 10 12 14 16 19


21 4

22 25 26 27 28 29 30



Event nasional Rabu lusa. Perkumpulan seasas dan setujuan (bidang politik). Gelar kaisar Rusia (pra Revolusi 1917). Bakat luar biasa pada umur lebih dini daripada sebayanya. Negeri. Kegiatan dilakukan calon legislatif. Benda yang bervalensi satu. Bata berongga, lebih besar dari batu bata. Kenderaan roda empat berbadan panjang untuk angkutan umum atau barang. Kepala pemerintahan perebut kekuasaan dengan cara tidak demokratis dan berkuasa mutlak. Gitaris (Inggris). Alat tulis. Lapisan; Stratum. Pecandu morfin. Kismis (Inggris). Nama kantor berita nasional.



1 A








jian kepada Assosiasi PSSI Kaltim atas terlaksananya dengan sukses dan lancar, ujicoba timnas U-19 di Stadion Palaran, Samarinda. “Padahal waktu itu, penonton sangat ramai dan cukup antusias. Tapi pertandingan tetap berjalan sesuai harapan,” beber Djohar. (yuslan)

Adnin Maududy Lubis, SE



“Kami meminta PSSI Kaltim mempelopori kebangkitan sepakbola nasional, khususnya di bagian timur Indonesia. Sebab Kaltim mempunyai fasilitas terbaik saat ini di tanah air,” kata Djohar kepada Waspada, Minggu (6/4). Ditambahkan, pihaknya memberikan apresiasi dan pu-

Putra Kel. H. Taslim Adnan Lubis dan Ibu Hj. Ratna Maulidar dengan

Jawaban di halaman A2.


PSSI. Sekretaris Tim Kwarta tersebut mengungkapkan segala administrasi sudah lengkap dan pihaknya tinggal menunggu berita dari PSSI dan keluar International Transfer Certificate (ITC). (cat)

Mengucapkan selamat dan semoga berbahagia dalam menempuh hidup baru kepada kedua mempelai:

Hitam melangkah, mematikan lawannya empat langkah.


tahu karakter wasit dan permainan di sini,” ujarnya. Terkait izin bermain, Rudi Helmiawan mengatakan berkas lengkap pengurusan Transfer Matching System (TMS) sudah dikirimkan ke

Djohar Kukuhkan Asosiasi PSSI Kaltim

Sri Lanka Ujian Perdana Indonesia ALOR STAR, Malaysia (Waspada): Tim bulutangkis Indonesia tengah bersiap menghadapi Kejuaraan Dunia Junior BWF ( World Junior Championships 2014) di Alor Star, Malaysia. Pertandingan nomor beregu akan dimulai Senin (7/4) ini hingga 11 April nanti disusul nomor perseorangan pada 13-18 April 2014. Melihat hasil undian, Indonesia yang menghuni Grup X1 bersama Jerman, Kanada, dan Sri Lanka, berpeluang besar menjadi juara. Jika ingin lolos ke perempatfinal, Indonesia harus menjadi juara grup karena hanya satu negara yang berhak lolos. Di perempatfinal nanti, Indonesia kemungkinan besar bertemu dengan Hong Kong yang berada di Grup X2 bersama Bulgaria, Hong Kong, Makau, Filipina, dan Republik Ceko. Melihat pertemuan sebelumnya di Asia Junior

turut unjuk kebolehan dalam kompetisi yang berlangsung di Pekan Raya Sumatera Utara tersebut. Pesertanya datang dari Honda Tiger Club Medan (HTCM), Tiger Independent Medan Club (TIME-C), D’ BeATTELLS, Community Honda Supra Xpression (CAS-X), Vario Honda Matic Club (VANATIC), Honda Cup 70 Medan (HC 70 M), Honda Super Cup Community (HSCC), Honda Streetfire Club Medan (HSFCM), Honda Revo Club (HRC), Revolution Supra X 125 Motor Club (RSMC), Honda Mega Pro Club (HMPC) Chapter Medan, dan Ras Kijang 90. Dengan tertib mereka mengikuti kompetisi Teknik Pengereman (Braking), Teknik Menikung, dan Teknik Keseimbangan (Narrow Plank). Akhirnya terpilih dua bikers terbaik untuk mengikuti kompetisi safety riding tingkat nasional yang akan diselenggarakan PT Astra Honda Motor (AHM), Juni mendatang. Bro Anggi sebagai sang juara mengungkapkan kebahagiaannya setelah terpilih menjadi yang terbaik. “Pastinya saya akan berupaya semaksimal mungkin untuk melakukan yang terbaik pada kompetisi nasional nantinya,” tekadnya. (m15/adv)

Jorge Cepat Adaptasi

Rijal/Vita Sumbang Gelar OSAKA, Jepang (Waspada): Gagal di India Terbuka, wakil Indonesia akhirnya menuai sukses di kejuaraan Osaka International Challenge 2014. Gelar tersebut dipersembahkan ganda campuran Muhammad Rijal/Vita Marissa (foto). Pada laga final di Moriguchi City Gymnasium, Osaka, Minggu (6/4), Rijal/Vita mampu menyudahi perlawanan Choi Sol Kyu/Chae Yoo Jung. Unggulan utama asal Korea Selatan itu kalah dalam pertarungan tiga set selama 1 jam 5 menit. Status lawan sebagai unggulan teratas menjadikan partai final sebagai pusat perhatian. Pasalnya, Rijal/Vita diplot sebagai unggulan kedua. Tak mau mengecewakan penonton, kedua pasangan mengeluarkan kemampuan terbaiknya. Pada set pembuka, Rijal/Vita menang 2118. Namun, pasangan Indonesia ini lengah pada set kedua dan menyerah 17-21. Di set penentu, Rijal/Vita kembali menemukan bentuk permainan terbaiknya dan membungkam pasangan Korea itu dengan keunggulan 21-18. Gelar ini setidaknya menjadi pelipur lara bagi Indonesia setelah Tontowi Ahmad/Liliyana

MEDAN (Waspada): CV Indako Trading Co selaku main dealer Honda di wilayah Sumatera Utara, baru-baru ini menggelar kompetisi bertajuk “Regional Community Safety Riding 2014” untuk seluruh komunitas Honda yang ada di Sumut. Kompetisi bertujuan mengasah pengetahuan dan kemampuan para bikers Honda tentang keselamatan berkendara itu, mendapat sambutan antusias dari para komunitas Honda yang sudah lama menantikannya. Gunarko Hartoyo, Corporate and Marketing Communication Manager Indako Trading Co, mengaku kompetisi ini bentuk konsistensi Honda sebagai pelopor safety riding dengan selalu menunjukkan kepedulian terhadap keselamatan berkendara sepeda motor. “Melalui kompetisi ini kami mengharapkan lahirnya duta safety riding dari masing-masing klub Honda yang dapat berbagi pengetahuan, agar selalu mengutamakan keselamatan berkendara dan menjadi teladan bagi pengguna jalan lainnya,” ujar Gunarko di Medan, Minggu (6/4). Setidaknya 12 klub motor Honda tergabung dalam Sumut Honda Bikers

Jawatan atau tempat kirim-mengirim surat.

2 3 5 6 7 8

9 11

13 15 17 18 20 23 24 26

Markah. Kusta. Lepas lelah. Tiga pihak (misal pemerintah, pengusaha dan buruh). Ilmu Pengetahuan Alam. Sistem ekonomi antara lain mengumpulkan cadangan emas dan memegang monopoli perdagangan luar negeri. Usungan untuk mengangkut orang dengan dipikul. Lambang huruf yang disepakati pemakaiannya terutama di bidang kesekretariatan untuk menulis cepat. Riang; Gembira. Men In Black. Orang yang mengamati cuaca untuk mengatur haluan kapal atau arah pesawat. Lubang udara keluar masuk. Tempat penampungan manusia atau hewan untuk mencegah penularan wabah. Hasil menatar; Tingkatan. Putusan wewenang Mahkamah Agung. Sangat baik; Utama.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, atau di kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan tak sampai lima menit. Jawabannya di halaman A2 kolom 1.

8 9 2 6 7 1 3 4 5 8 3 7 1 6 8 2 9 5 7 7 5 9 2 3 9 4 5 8 3 7 2 6 9 3 1

5 9 6 5 1 8 6 2 1




WASPADA Senin 7 April 2014

Jorge Cepat Beradaptasi Segera Dapat Izin Bermain MEDAN (Waspada): Legiun asing PS Kwarta asal Argentina, Jorge Alberto, sudah mulai beradaptasi dengan pemain lainnya setelah sepekan bergabung. Hal tersebut ditunjukkan dengan peningkatan grafik permainan di setiap laga ujicoba dan latihan intensif.

Di laga ujicoba perdananya, mantan pemain Divisi B Argentina, CA Sarmiento itu hanya sanggup bermain 25 menit. Namun, Jorge terus mengalami peningkatan di setiap kesempatan hingga laga terakhir melawan Persatuan Sepakbola Kwala Tanjung Putra (PSKTP) bermain 65 menit. Melawan PTPN III Sei Karang, Jorge bahkan mencetak gol. Kepada Waspada, Jorge mengaku sangat menikmati proses adaptasinya. Hal tersebut, menurutnya, berkat keberadaan tim pelatih, rekan setim maupun manajemen yang kerap membantunya dalam proses adaptasi dengan lingkungan. “Aku perlahan sudah mulai

beradaptasi dengan iklim di sini. Untungnya saya bertemu dengan beberapa teman yang baik, karena mereka mau membantu saya menyesuaikan diri dengan cepat,” kata Jorge, Minggu (6/4). Selain itu, dirinya juga menikmati gaya permainan possesion play skuad Burung Sumatera yang lebih mengutamakan penguasaan bola untuk membongkar pertahanan lawan. “Saya suka dengan gaya permainan tim ini, makanya saya merasa nyaman dan selalu mencoba untuk bermain dengan penguasaan bola yang baik. Kami semua gembira dan mulai berbicara untuk mencapai gelar,” jelasnya.

Timnas U-19 Makin Kompak JAKARTA (Waspada): Pelatih Timnas U-19, Indra Sjafri, menyatakan skuad besutannya semakin kompak, tidak hanya di dalam lapangan pertandingan, akan tetapi di luar lapangan juga. Kekompakan tersebut, masih kata Indra, bisa terlihat begitu semua pemainnya yang beragama Islam usai ibadah umrah bersama di tanah suci. Semua pemain pun tampak semakin akrab dan diharapkan berlanjut pada penampilan di lapangan. “Alhamdulillah, Timnas U-19 baru saja selesai melaksanakan ibadah umroh dengan rasa kebersamaan dan keakraban,” tulis Indra dalam pesan singkatnya kepada Waspada, Minggu (6/4). “Tadi malam jam 24.00 waktu setempat, kami tiba di Oman untuk mengawali rangkaian tur Timur Tengah. Semoga kekompakan semakin terjalin. Mohon doanya,” sambung Indra lagi. Masih tulis Indra, sama dengan agenda ujicoba di Uni Emirat Arab, di mana Garuda Jaya sesuai rencana akan memainkan dua laga uji tanding melawan Timnas Uni Emirat Arab U-19 di Dubai dan Oman. “Sebagai konsekuensinya, pihak FA Oman bersedia membantu perubahan jadwal penerbangan ke Dubai. Bagi kami, semakin banyak laga uji tanding, tentunya akan semakin baik,” tutup Indra. (yuslan)

Djohar Kukuhkan Asosiasi PSSI Kaltim JAKARTA (Waspada): PSSI terus melakukan pembenahan organisasi pada level daerah. Hal tersebut sesuai amanah yang telah ditetapkan dalam statuta terbaru induk sepakbola nasional, terkait keberadaan kepengurusan PSSI di tingkat provinsi. Seiring itu, Djohar Arifin Husin selaku Ketua Umum PSSI mengukuhkan Pengurus Asosiasi PSSI Kalimantan Timur di aula Kantor Gubernur Kalimantan Timur di Samarinda, Jumat (4/4) malam. Kepengurusan pimpinan Yunus Nursi yang terpilih pada Musprovlub PSSI Kaltim Desember lalu itu dikukuhkan untuk masa bakti lima tahun mendatang. Acara tersebut turut dihadiri Gubernur Kaltim, Dr Awang Faroek. “Kami meminta PSSI Kaltim mempelopori kebangkitan sepakbola nasional, khususnya di bagian timur Indonesia. Sebab Kaltim mempunyai fasilitas terbaik saat ini di tanah air,” kata Djohar kepada Waspada, Minggu (6/4). Ditambahkan, pihaknya memberikan apresiasi dan pujian kepada Assosiasi PSSI Kaltim atas terlaksananya dengan sukses dan lancar, ujicoba timnas U-19 di Stadion Palaran, Samarinda. “Padahal waktu itu, penonton sangat ramai dan cukup antusias. Tapi pertandingan tetap berjalan sesuai harapan. Begitu pula seusai laga, semua penonton kembali ke rumah masingmasing dengan tertib. Ini mestinya menjadi contoh di kota lain,” beber Djohar menambahkan PSSI akan memberikan kesempatan kepada Stadion Palaran menjadi tempat pertandingan internasional. (yuslan)

Piala Wagub Aceh Milik Pambers VC BANDA ACEH (Waspada): Pambers VC Beurawe akhirnya tampil sebagai juara turnamen voli Piala Wagub Aceh, setelah menundukkan Buraq VC Bireuen 3-1 di GOR KONI Aceh, Sabtu (5/4) malam. Dengan hasil tersebut, klub voli dari Gampong Beurawe Banda Aceh ini berhak memboyong piala bergilir Wagub Aceh serta dana pembinaan Rp15 juta yang diserahkan Plt Kadispora Aceh, Asnawi SPd MPd. Sebagai runner-up, Buraq VC menerima dana pembinaan Rp10 juta. Adapun NNVC dan PJVC sebagai juara III dan IV masingmasing membawa pulang Rp7,5 juta dan Rp4 juta. Selain dana pembinaan, para pemenang juga mendapatkan piala tetap dan sertifikat. Asnawi mengatakan, tahun ini turnamen voli Piala Wagub Aceh levelnya masih se-Aceh. Di masa mendatang, kemungkinan levelnya akan ditingkatkan menjadi se-Sumatera. “Kita menggelar event ini juga sebagai upaya untuk ikut dalam pembinaan olahraga voli di Aceh,” kata Asnawi. Partai final antara Pambers VC melawan Buraq VC berlangsung ketat. Kedua tim terlihat begitu berambisi merebut gelar hingga mengeluarkan segala kemampuannya. Pambers VC, diperkuat Kaswandi, Jet Li, Sofyan, Agus, dan Suryadi cs, tampil lebih tenang dan merebut dua set pertama 25-17 dan 25-15. Di set ketiga, Buraq yang mengandalkan Deri, Darman, Dek Yus, Jefri, dan Tito cs berusaha bangkit dan berhasil unggul 25-23. Pada set keempat, Pambers lebih menguasai permainan dan menutup set tersebut 25-21. Sebelumnya, NNVC Ie Masen Kaye Adang menundukkan PJVC Punge Jurong 30 (25-16, 25-22, 25-19). (b04)

Pelatih PS Kwarta, Slamet Riyadi, mengatakan gembira dengan peningkatan kondisi fisik Jorge dan kemampuannya dalam menyerap instruksi dengan baik. Meskipun komunikasi masih menjadi kendala, Slamet menilai sang pemain tetap profesional dan cepat adaptasi. “Pemain Amerika Latin biasanya cepat adaptasi. Bagi saya, dia (Jorge) pemain bagus dan

gampang menyesuaikan diri dengan gaya permainan tim,” kata Slamet juga memberikan sejumlah catatan perbaikan yang harus dibenahi Jorge. “Alur bolanya harus lebih cepat lagi. Pasalnya, kadang dia ambil resiko dengan sering bermain individu. Dengan begitu saya khawatir, karena pemain di Indonesia kebanyakan melakukan pelanggaran berbaha-

ya. Apalagi dia belum tahu karakter wasit dan permainan di sini,” ujarnya. Terkait izin bermain, Rudi Helmiawan mengatakan berkas lengkap pengurusan Transfer Matching System (TMS) sudah dikirimkan ke PSSI. Sekretaris Tim Kwarta tersebut mengungkapkan segala administrasi sudah lengkap dan pihaknya tinggal menunggu berita dari PSSI dan keluar International Transfer Certificate (ITC). (cat)

Sri Lanka Ujian Perdana Indonesia World Junior Championships 2014 ALOR STAR, Malaysia (Waspada): Tim bulutangkis Indonesia tengah bersiap menghadapi Kejuaraan Dunia Junior BWF (World Junior Championships 2014) di Alor Star, Malaysia. Pertandingan nomor beregu akan dimulai Senin (7/ 4) ini hingga 11 April nanti disusul nomor perseorangan pada 1318 April 2014. Melihat hasil undian, Indonesia yang menghuni Grup X1 bersama Jerman, Kanada, dan Sri Lanka, berpeluang besar menjadi juara. Jika ingin lolos ke perempatfinal, Indonesia harus menjadi juara grup karena hanya satu negara yang berhak lolos. Di perempatfinal nanti, Indonesia kemungkinan besar bertemu dengan Hong Kong yang berada di Grup X2 bersama Bulgaria, Hong Kong, Ma-

kau, Filipina, dan Republik Ceko. Melihat pertemuan sebelumnya di Asia Junior Championships 2014, Indonesia punya kans besar untuk kembali menang atas Hong Kong. Saat itu, junior Indonesia menang 4-1. Menghadapi Sri Lanka, Indonesia optimis mampu memenangkan pertandingan dengan menyapu bersih lima nomor yangdimainkan.Halinidisampaikan langsung oleh Manajer Tim Indonesia, Maria Fransisca. “Kami yakin dapat memenangkan pertandingan melawan Sri Lanka dan mudah-mudahan kami sapu bersih. Para pemain sudah dalam keada an siap untuk bertanding di nomor beregu,” ujar Maria, Minggu (6/4). “Soal pemain-pemain yang akan diturunkan, saya dan tim pelatih masih akan mendisku-

Waspada/Arianda Tanjung

sikan soal ini, apakah kami akan menurunkan tim terbaik atau belum. Kalau melihat lawanlawan di pool X1, kami optimis bisa menjadi juara grup,” tambah Maria. Ditambahkan Maria, semifinal menjadi target tim junior Indonesia di perebutan Piala Suhandinata ini. Berdasarkan daftar unggulan yang dirilis oleh BWF (Badminton World Federation), Indonesia berada di peringkat ketiga di bawah Korea dan Tiongkok. Pada BWF World Junior Championships 2013 di Bangkok, Indonesia berhasil melaju ke final setelah mengalahkan juara bertahan Tiongkok. Pencapaian ini sementara menjadi prestasi terbaik tim junior Indonesia sepanjang BWF World Junior Championships. (yuslan)


TIM junior Indonesia latihan persiapan jelang pertandingan nomor beregu Kejuaraan Dunia Junior 2014, Senin (7/4) ini.

Pidie Jaya Siapkan 77 Atlet Pasang Persiapan Popda Aceh MEUREUDU (Waspada) : Kabupaten Pidie Jaya mempersiapkan 77 atlet pelajar yang direkrut untuk delapan cabang olahraga (cabor) yang dipertandingkan dalam Pekan Olahraga Pelajar Daerah (Popda) Tingkat Provinsi Aceh di Kota Lhokseumawe, Juni mendatang. Kabid Olahraga Dinas Pemuda dan Olahraga (Dispora) Kabupaten Pidie Jaya, Saifuddin ZA MPd (foto), mengatakan ke77 atlet yang bakal diberangkatkan ke Popda itu ditargetkan masih kelompok 8 Besar. “Untuk bisa mencapai target yang telah ditetapkan guna meraih prestasi terbaik, setidaknya bisa masuk kelompok 8 Besar dari23kabupaten/kota.Jauh-jauh hari kami telah mempersiapkan tim yang solid dan menjalani pemusatan latihan secara kontiniu,” jelasnya, Minggu (6/4). Disebutkan, para atlet itu berlatih secara terpisah di lokasi yang berbeda. Selain ada yang berlatih di Pidie Jaya, sebagian atlet berkonsentrasi di luar daerah, terutama di Banda Aceh. Puluhan pelajar tersebut terus digembleng sampai berlangsungnya event dua tahunan di kota petro dolar itu. Khusus cabang taekwondo, karate, tenis meja, sepaktakraw, dan pencak silat, para atlet berla-

Iklan Telp. 4528431 HP. 081370328259 Email:

PEMAIN asing PS Kwarta Jorge Alberto (kanan) berlatih dengan serius untuk meningkatkan grafik permainannya.

Rijal/Vita Sumbang Gelar OSAKA, Jepang (Waspada): Gagal di India Terbuka, wakil Indonesia akhirnya menuai sukses di kejuaraan Osaka International Challenge 2014. Gelar tersebut dipersembahkan ganda campuran Muhammad Rijal/Vita Marissa (foto). Pada laga final di Moriguchi City Gymnasium, Osaka, Minggu (6/4), Rijal/ Vita mampu menyudahi perlawanan Choi Sol Kyu/ Chae Yoo Jung. Unggulan utama asal Korea Selatan itu kalah dalam pertarungan tiga set selama 1 jam 5 menit. Status lawan sebagai unggulan teratas menjadikan partai final sebagai pusat perhatian. Pasalnya, Rijal/Vita diplot sebagai unggulan kedua. Tak mau mengecewakan penonton, kedua pasangan mengeluarkan kemampuan terbaiknya. Pada set pembuka, Rijal/ Vita menang 21-18. Namun, pasangan Indonesia ini lengah pada set kedua dan menyerah 17-21. Di set penentu, Rijal/ Vita kembali menemukan bentuk permainan terbaiknya dan membungkam pasangan Korea itu dengan keunggulan 21-18. Gelar ini setidaknya menjadi pelipur lara bagi Indonesia setelah Tontowi Ahmad/Liliyana Natsir gagal India Terbuka.

Waspada/Rusli Ismail

tih sejak sebulan terakhir. Saifuddin berharap anak-anak cabor tersebut bisa mendulang medali agar kontingennya dapat memperbaiki peringkat. Di Popda kali ini, Pidie Jaya memasang target memperbaiki peringkat Popda 2012 lalu di Banda Aceh. Kala itu, Pidie Jaya harus puas berada di posisi sembilan dari 23 kabupaten/kota hasil merebut dua medali emas, empat perak, dan enam perunggu. Kini, Pidie Jaya berharap daerahnya bisa bertengger di posisi delapan besar. Cabor yang diikuti kontingen Pidie Jaya nantinya adalah atletik (12 atlet), taekwondo (5), karate (5), bola voli (10), sepakbola (18), sepaktakraw (5), tenis meja (6), dan pencak silat (16). (b09)

PENGUMUMAN RENCANA PENYUSUNAN AMDAL Sesuai dengan ketentuan peraturan perundang-undangan yang berlaku, dengan ini diumumkan sebagai berikut: Pemrakarsa : PT Sawit Solok Indah Alamat Kantor : Jalan Pulau Pinang, Kawasan Industri Medan II, Mabar - Saentis 20371, Kecamatan Percut Sei Tuan, Kabupaten Deliserdang Provinsi Sumatera Utara. Lokasi Kegiatan : Desa Poldung Kecamatan Aek Natas, Kabupaten Labuhanbatu Utara, Provinsi Sumatera Utara. Rencana Kegiatan : Budidaya Tanaman Perkebunan Kelapa Sawit seluas 2.374 Ha. Jenis Dampak : 1. Mempengaruhi ekosistem, hidrologi dan bentang alam. 2. Peningkatan lapangan kerja. 3. Peningkatan kegiatan ekonomi masyarakat. Saran, Pendapat, danTanggapan (SPT) atas Rencana kegiatan tersebut dapat disampaikan secara tertulis paling lama 10 (sepuluh) hari sejak tanggal pengumuman ini dengan persyaratan sebagai berikut: 1. Fotocopy KTP. 2. Menggunakan Bahasa Indonesia. 3. SPT ditujukan kepada: ● Badan Lingkungan Hidup Kabupaten Labuhanbatu Utara Jalan Koptu Mahmun Lubis Blok C No. 13-14 Aek Kanopan. ● Badan Lingkungan Hidup Provinsi Sumatera Utara, Jalan T. Daud No. 05 Medan ● Pemrakarsa dengan alamat kantor di atas dan Tel. (061) 6871464 ; Fax 061-6871462. Medan,

April 2014

PT Sawit Solok Indah Direksi

Sebaliknya, Rijal/Vita mempersembahkan gelar pertama mereka sejak kembali diduetkan awal tahun 2014. Gelar lainnya didominasi tuan rumah. Juara tunggal putri direbut Yui Hashimoto yang menang atas Anna Doi juga dari Negeri Matahari Terbit 21-13, 21-14. Di final ganda putra, Kenta Kazuno/ Kazushi Yamada mengalahkan Bong Chan

Jun/Duck Young Kim (Korsel) 21-19, 21-11. Pemenang final ganda putri jatuh ke tangan Shizuka Matsuo/Mami Naito yang memenangi All Japanese Final melawan Kugo Asumi/Yui Miyauchi 24-22, 21-6. Sementara itu, Ng Ka Long (Hong Kong) memupuskan mimpi Riichi Takeshita (Jepang) 21-13, 21-12. (m33/tsw)




WASPADA Senin 7 April 2014

Tuah Gerrard WEST HAM, Inggris (Waspada): Dua gol penalti kapten Steven Gerrard mengangkat Liverpool kembali ke puncak klasemen Liga Premier. Melawan West Ham United di Upton Park, Minggu (6/4), Liverpool menang 2-1. AP

Hamilton Luar Biasa SAKHIR, Bahrain ( Waspada): Lewis Hamilton (foto) tampil fantastis pada GP Bahrain di Sirkuit Sakhir, Minggu (6/4). Pebalap Mercedes itu meraih sukses kedua musim ini setelah bersaing ketat dengan Nico Rosberg sepanjang lomba. Layaknya GP Malaysia, duet Mercedes kembali tampil dominan dan menguasai jalannya lomba. Bedanya, kali ini Hamilton dan Rosberg benar-benar saling adu kecepatan hingga garis finish. Dari posisi dua, Hamilton melakukan start dengan baik melewati peraih pole yang ditempati Rosberg. Salip menyalip tersaji di lintasan antara kedua pebalap yang sempat membuat kru Mercedes sendiri panik. Pasalnya, mereka khawatir persaingan Hamilton dan Rosberg akan berujung negatif. Ternyata, keduanya saling dukung dan ini terlihat ketika Rosberg langsung mendatangi Hamilton untuk memberi ucapan selamat. Melaju kencang sebanyak 57 lap, Hamilton mencatat waktu 1 jam 39 menit 42.743 detik. Rosberg, jawara GP Australia, hanya terpaut 01.0 detik dari rekannya. Pebalap Force India, Sergio Perez, yang gagal naik podium di dua seri balap sebelumnya kali ini berada di posisi ketiga. Nasib sial Daniel Ricciardo pun mulai menjauh, setelah driver Red Bull asal Australia

ini menempati peringkat empat. Pada dua seri perdana Formula One (F1) musim ini, Ricciardo gagal mendapat poin. Komposisi lima besar dihuni Nico Hulkenberg yang melengkapi sukses Force India. Sebastian Vettel, empat kali juara F1, bangkit dengan menduduki posisi keenam. Jagoan Red Bull asal Jerman ini terpaut 29.6 detik dari Hamilton. Di belakang Vettel ada Felipe Massa yang kini mengemudi mobil Williams. Valtteri Bottas yang juga driver Williams menempel Massa di urutan delapan. Duet Ferrari, Fernando Alonso dan Kimi Raikkonen, tampil kurang maksimal. Dengan selisih lebih dari 30 detik, baik Alonso maupun Kimi harus puas berada di posisi sembilan dan sepuluh. Menjadi runner-up di seri perdana, Kevin Magnussen (Denmark) kali ini gagal melewati finish. Mengikuti nasib rookie McLaren adalan Esteban Gutierrez, Adrian Sutil (Sauber), Magnus Ericsson (Caterham), dan Jean Eric-Vergne (Toro Rosso). Menang di Bahrain, Hamilton belum berhasil menggeser Rosberg dari puncak klasemen pebalap. Driver asal Inggris itu masih bertahan sebagai runner-up dengan 50 poin, tertinggal 11 angka dari Rosberg. (m33/auto)

Klasemen Liga Serie A


Juventus 31 AS Roma 32 Napoli 31 Fiorentina 32 Inter Milan32 Lazio 32 Parma 31 Atalanta 32 Hellas 32 Torino 32 AC Milan 31 Sampdoria32 Genoa 31 Udinese 32 Cagliari 32 Chievo 32 Bologna 32 Livorno 31 Sassuolo 32 Catania 32

26 23 19 16 12 13 12 14 14 12 11 11 10 11 7 7 5 6 6 4

3 7 7 7 14 9 11 4 4 9 9 8 9 5 11 6 12 7 6 8

2 2 5 9 6 10 8 14 14 11 11 13 12 16 14 19 15 18 20 20

67-22 81 65-17 76 59-32 64 51-34 55 51-35 50 42-40 48 51-41 47 37-41 46 47-52 46 47-41 45 47-43 42 40-45 41 34-39 39 35-44 38 29-44 32 26-47 27 26-50 27 34-58 25 31-61 24 24-57 20

Sukses Serigala Roma ROMA (Waspada): AS Roma sukses memangkas jarak poin dengan Juventus. Tim besutan Rudi Garcia hanya berjarak lima poin setelah menekuk Cagliari 3-1, Minggu (6/ 4). Kemenangan Roma tersebut berkat hatrik Mattia Destro (foto). Tampil di kandang lawan, Roma tetap menguasai permainan dan membuka keunggulan pada menit 32. Umpan silang Gervinho berhasil diselesaikan dengan sempurna oleh Destro yang kemudian mencetak gol keduanya pada menit 56. Gol ini lahir hasil kerjasama dengan Radja Nainggolan yang notabene mantan pemain Cagliari. Tak puas dengan dua gol, Il Giallorossi terus melancarkan tekanan. Hasilnya, gol kembali tercipta pada menit 73 lagi-lagi lewat aksi Destro.

Kali ini, pemain berusia 23 tahun tersebut memanfaatkan umpan Alessandro Florenzi. Menit 89, Cagliari menipiskan ketertinggalan lewat eksekusi penalti Mauricio Pinilla. Berkat hasil ini, Serigala Roma menempati urutan kedua dengan 76 poin dari 32 pertandingan, tertinggal lima angka dari Si Nyonya Tua. Namun, Juve masih menyisakan satu pertandingan. Sementara itu, Cagliari masih terpuruk di urutan 15 dengan 32 poin. Sebelumnya, Lazio memelihara peluang tampil di kompetisi Eropa musim depan. Tampil dengan 10 pemain sejak menit 57, Biancoelesti sukses menekuk Sampdoria 2-0. Antonio Candreva membuka keunggulan Lazio pada menit 42. Lazio kemudian harus bermain dengan 10 orang di me-

Petkovic Terkejut Final CHARLESTON, AS (Waspada): Andrea Petkovic (foto) berhasil melaju ke final Family Circle Cup, Senin (7/4) ini. Sempat kalah di set pertama, Petkovic mampu bangkit untuk menutup pertandingan dengan kemenangan atas Eugenie Bouchard (Kanada), Minggu (6/4). Permainan cemerlang diperlihatkan Bouchard sejak set pertama. Petenis belia itu berhasil merebut set pertama 6-1. Tapi, Petkovic mampu bangkit pada set kedua dengan meraih kemenangan 6-3. Pada set ketiga, Petkovic kembali mendapatkan perlawanan dari Bouchard. Genie, sapaan akrabnya, sempat memimpin 4-2, tapi Petkovic yang baru sembuh dari cedera mampu bangkit dan memenangkan set penentu 7-5. “Saya sangat lega dan bangga bisa kembali bermain setelah sembuh cedera. Saya tidak pernah berpikir akan lolos ke final sebuah turnamen lagi,” ujar Petkovic yang tidak pernah melewati perempatfinal dalam enam turnamen terakhir musim ini.

Di final, petenis Jerman itu akan meladeni tantangan petenis Slowakia, Jana Cepelova. Penakluk Serena Williams ini meraih tiket laga puncak dengan menyingkirkan Belinda Bencic (Swiss) 6-4, 5-7, 9-7. (m33/ap)

Minggu, 6 April Inter Milan v Bologna Lazio v Sampdoria Atalanta v Sassuolo Cagliari v AS Roma Catania v Torino Fiorentina v Udinese

2-2 2-0 0-2 1-3 1-2 2-1

Sabtu, 5 April Chievo v Hellas Verona


nit 57 ketika Lucas Biglia menerima kartu kuning kedua akibat melanggar Nenad Krsticic. Meski demikian, Lazio masih bisa memperbesar keunggulan pada menit 73 melalui Senad Lulic. Kini tim besutan Eduardo Reja menempati peringkat enam dengan 48 poin, batas akhir tampil di Liga Europa. (m33/ap/ls)

Bermain di hadapan pendukungnya sendiri, West Ham otomatis mendapat dukungan penuh dari penonton. Sadar akan situasi tersebut, The Reds bermain sabar dan mempelajari permainan Andy Carroll cs. Pada menit 44, wasit menunjuk titik putih setelah James Tomkins handsball di dalam kotak terlarang. Gerrard yang maju sebagai algojo dan mampu menuntaskan tugasnya dengan sempurna. Tak berselang lama, West Ham menyamakan kedudukan lewat gol Guy Demel. Usai turun minum, tim tuan rumah terus menekan pertahanan Liverpool yang digalang Martin Skrtel. Menit 61, Andy Carroll nyaris membawa timnya berbalik unggul lewat sundulannya. Namun bola hanya mengenai mistar gawang Simon Mignolet. Melihat penetrasi Jon Flanagan, Adrian keluar dari sarangnya untuk merebut bola. Kiper West Ham tersebut berhasil menghalau bola, namun wasit melihatnya sebagai pelanggaran. Akibatnya, wasit kembali menunjuk titik putih. Untuk kedua kali, Gerrard


KAPTEN Steven Gerrard (8) selebrasi gol penaltinya yang membawa Liverpool meraih kemenangan atas West Ham United dalam lanjutan Liga Premier, Minggu (6/4). menjadi eksekutor dan memaksa Adrian memungut bola dari sarangnya. Alhasil, tim asuhan Brendan Rodgers berhak menggeser Chelsea dari puncak klasemen Liga Premier dengan kumpulan 74 poin, unggul dua angka atas The Blues. West Ham sendiri harus puas tertahan di peringkat 11 dengan 37 poin. Di Goodison Park, Everton tampil perkasa. Secara tak terduga, skuad arahan Roberto Martinez tersebut mengalahkan Arsenal 3-0. Kekalahan ini pun mengancam peluang The Gunners tampil di Liga Champions musim depan. Menit 14, Everton sudah membuka pundi-pundi gol lewat aksi Steven Naismith. Romelu Lukaku lalu menggandakan keunggulan tuan ru-

mah pada menit 34. Menerima umpan Kevin Mirallas, Lukaku mengecoh Nacho Monreal dan Thomas Vermaelan sebelum tendangannya menaklukkan kiper The Gunners, Wojciech Szczesny. Terlalu asyik mengejar ketinggalan, gawang Arsenal malah kemasukan untuk ketiga kali. Pahitnya bagi skuad Arsene Wenger, gol ketiga Everton yang tercipta di menit 62 tersebut malah dihasilkan pemainnya sendiri, yakni Mikel Arteta. Raihan poin penuh membuat The Toffees hanya terpaut satu angka dengan pasukan Meriam London. Arsenal masih menempati peringkat empat klasemen dengan 64 poin dari 33 pertandingan, sedangkan Everton berada satu tingkat di bawah mereka de-

Bobcats Rusak Kans Cavs CLEVELAND, AS (Waspada): Charlotte Bobcats dipaksa bekerja keras untuk mengalahkan Cleveland Cavaliers hingga overtime dalam lanjutan kompetisi NBA, Minggu (6/4). Bobcats akhirnnya menang sekaligus memastikan tiket playoff musim ini. Menjadi tim tamu bagi Cavs di Quicken Loans Arena, Bobcats harus melewati babak tambahan waktu sebelum menang 96-94. Ini menjadi kemenangan keempat beruntun bagi tim besutan Steve Clifford itu. Kemenangan ini juga mengantar Bobcats lolos ke playoff untuk pertama kalinya sejak 2010 silam. Di klasemen Wilayah Timur, Bobcats yang sahamnya dimiliki Michael Jordan menempati posisi tujuh. “Ini adalah prestasi signifikan untuk tim kami, dan pencapaian ini menempatkan kami di tempat yang berbeda di liga. Anak-anak di ruang ganti sangat bersemangat dan sudah seharusnya seperti itu, karena kami punya tim yang bagus,” ujar Clifford. Sebaliknya, kekalahan ini membuat asa Cavs meramaikan playoff makin menipis. Cavaliers masih tertinggal 3,5 game dari Atlanta Hawks dan New York Knicks yang berada di peringkat delapan untuk satu tempat tersisa. Al Jefferson tampil sebagai bintang Bobcats dengan 24 poin 15 rebound dan pemain muda Cody Zeller menambah

12 angka 11 rebound. Dari Cavs, Kyrie Irving mencetak 44 poin tujuh rebound, dan delapan assist. Masih di Wilayah Timur, Detroit Pistons mencapai comeback gemilang saat menghadapi Boston Celtics. Tertinggal 19 poin di akhir kuarter ketiga, Pistons pantang menyerah hingga kemudian membalikkan keadaan untuk unggul 105-101. Kendati menjadi pemain pelapis, Rodney Stuckey menjadi penyelamat dan motivator Pistons. Total, Stuckey menoreh 26 angka bagi timnya yang juga mendapat donasi 21 poin dari Greg Monroe. Andre Drummond tak mau ketinggalan dan menyumbang 19 poin 20 rebound bagi Pistons yang gagal lolos playoff. Hasil lain, Orlando Magic menang atas Minnesota T’wolves 100-92. Lalu, Chicago Bulls mengalahkan Washington Wizards 96-78, Brooklyn Nets mengatasi Philadelphia 76ers 105-101, dan Toronto Raptors mengungguli Milwaukee Bucks 102-98. (m33/ap)


DUA poin berhasil disumbangkan forward Charlotte Bobcats Cody Zeller (kanan) saat dikawal center Cleveland Cavaliers Anderson Varejao dalam laga NBA, Minggu (6/4).

PENGUMUMAN RENCANA PENYUSUNAN AMDAL Sesuai dengan ketentuan peraturan perundang-undangan yang berlaku, dengan ini diumumkan sebagai berikut: Pemrakarsa : PT Sawit Solok Indah Alamat Kantor : Jalan Pulau Pinang, Kawasan Industri Medan II, Mabar - Saentis 20371, Kecamatan Percut Sei Tuan, Kabupaten Deliserdang Provinsi Sumatera Utara. Lokasi Kegiatan : Desa Poldung Kecamatan Aek Natas, Kabupaten Labuhanbatu Utara, Provinsi Sumatera Utara. Rencana Kegiatan : Budidaya Tanaman Perkebunan Kelapa Sawit seluas 2.374 Ha. Jenis Dampak : 1. Mempengaruhi ekosistem, hidrologi dan bentang alam. 2. Peningkatan lapangan kerja. 3. Peningkatan k egiatan ekonomi masyarakat. Saran, Pendapat, danTanggapan (SPT) atas Rencana kegiatan tersebut dapat disampaikan secara tertulis paling lama 10 (sepuluh) hari sejak tanggal pengumuman ini dengan persyaratan sebagai berikut: 1. Fotocopy KTP. 2. Menggunakan Bahasa Indonesia. 3. SPT ditujukan kepada: ● Badan Lingkungan Hidup Kabupaten Labuhanbatu Utara Jalan Koptu Mahmun Lubis Blok C No. 13-14 Aek Kanopan. ● Badan Lingkungan Hidup Provinsi Sumatera Utara, Jalan T. Daud No. 05 Medan ● Pemrakarsa dengan alamat kantor di atas dan Tel. (061) 6871464 ; Fax 061-6871462. Medan,

April 2014

PT Sawit Solok Indah Direksi

Minggu, 6 April Everton v Arsenal West Ham v Liverpool

Klasemen Liga Premier 3-0 1-2

Sabtu, 5 April Man City v Southampton Aston Villa v Fulham Cardiff v C Palace Hull City v Swansea Norwich v West Bromwich Newcastle v Man United Chelsea v Stoke City

4-1 1-2 0-3 1-0 0-1 0-4 3-0

ngan 63 poin hasil 32 laga. Hasil ini juga meneruskan trend negatif Arsenal yang tidak pernah meraih kemenangan sejak dikalahkan Chelsea dan ditahan imbang oleh Swansea City serta Manchester City pada laga sebelumnya. (m33/espn/ls)

Liverpool Chelsea Man City Arsenal Everton Man United Tottenham Southampton Newcastle Stoke City West Ham Hull City Aston Villa C Palace Swansea West Brom Norwich Fulham Cardiff Sunderland

33 23 5 5 90-40 74 33 22 6 5 65-24 72 31 22 4 5 84-29 70 33 19 7 7 56-40 64 32 18 9 5 52-31 63 33 17 6 10 56-38 57 32 17 5 10 40-44 56 33 13 9 11 50-44 48 33 14 4 15 38-51 46 33 10 10 13 37-48 40 33 10 7 16 37-44 37 33 10 6 17 34-40 36 32 9 7 16 35-48 34 32 10 4 18 23-39 34 33 8 9 16 45-49 33 32 6 14 12 37-48 32 33 8 8 17 26-52 32 33 8 3 22 33-74 27 33 6 8 19 29-64 26 30 6 7 17 28-48 25

Medan Metropolitan

WASPADA Senin 7 April 2014


Logistik Pemilu Daerah Terpencil Ditangani Serius MEDAN (Waspada) Gubsu H. Gatot Pujo Nugroho, ST, MSi mengingatkan penyelenggara Pemilu legislatif agar logistik untuk sejumlah tempat pemungutan suara (TPS) di daerah terpencil dan sulit akses geografis maupun transportasi, mendapat perhatian khusus dan ditangani serius. “Hal ini untuk mengantisipasi kendala yang dapat terjadi saat penyalurannya, yang dapat mengganggu pelaksanaan Pemilu. Kita tidak ingin pengalaman Pemilu tahun 2009, yakni adanya Pemilu ulang seperti di Nias Selatan, terjadi lagi tahun ini. Karena itu, kawasan terpencil harus ditangani serius,” pesan Gubsu melalui Sekretaris Daerah Provinsi Sumut (Sekdaprovsu) H. Nurdin Lubis, SH, MM di Teluk Dalam Kabupaten Nias Selatan, Sabtu (5/4). Selama dua hari di kawasan Pulau Nias, rombongan Sekdaprovsu Nurdin Lubis yang juga Ketua Tim Pemantau Pemilu Sumut, memonitor langsung pergeseran logistik ke daerahdaerah kecamatan terpencil, setelah logistik itu berada di ibukota kabupaten. Di Teluk Dalam, Nias Selatan, Nurdin bersama Ketua KPU Sumut Mulia Banurea dan Ketua Bawaslu Sumut Syarida R Rasahan secara cermat mengamati mekanisme pergeseran logistik di gudang penampungan logistik di Km 1 Teluk Dalam. Turut serta Kepala Badan Intelijen Negara (BIN) Daerah Provinsi Sumut Brigjen TNI Cucu Soemantri dan AKBP Hanung T mewakili Kapoldasu. Sekda Nias Selatan Faduhusi Daely, SPd yang mendampingi Sekdaprovsu di lapangan menuturkan, pihak Pemkab membantu sepenuhnya KPU setempat dalam mendorong pergeseran logistik. Sebab, di kabupaten ini masih banyak daerah terpencil yang membutuhkan penanganan khusus seperti di Kecamatan Pulaupulau Batu yang jarak ibukota kecamatannya saja, yaitu Pulau Telo, 6 jam pelayaran dengan kapal dari ibukota kabupaten di Teluk Dalam. “Kami terus berkoordinasi dengan KPU dan Panwaslu termasuk melibatkan kepolisian dan aparat keamanan untuk memberhasilkan tugas pergeseran logistik ke daerah-daerah terpencil sesuai kewenangan yang ada. Tentu dalam implementasinya tetap mengacu pada ketentuan dan peraturan yang ada, karena pihak KPU yang harus berada di depan,” ujarnya didampingi Muspida setempat. Ketua KPU Nias Selatan Fansolidarman Dachi didampingi Ketua Panwas Nias Selatan Titoni Manno juga mengakui kondisi geografi yang cukup sulit di beberapa daerah dan masih banyaknya kawasan terpencil terutama di daerah kepulauan dengan gugusan pulau-pulau kecilnya, maka KPU membutuhkan bantuan

dari Pemkab setempat. “Sejauh ini, pihak Pemkab cukup membantu,” ujarnya seraya menginformasikan logistik untuk kawasan Pulau-pulau Batu telah diberangkatkan dari Teluk Dalam menuju Pulau Telo menggunakan kapal dengan pengawalan aparat kepolisian. Diharapkan pendistribusian ke desa-desa hingga ke TPS berjalan lancar sehingga dapat digunakan pada hari H, 9 April 2014. Dari dialog di lapangan terungkap kotak kuara yang terbuat dari karton memang riskan rusak untuk daerah-daerah basah atau kawasan pedesaan tepi pantai dan kepulauan. Meski kertas suara dan dokumen penting lainnya di dalam kotak itu dibungkus plastik, namun apabila kotak suaranya rusak, maka berkas itu riskan hilang. Di gudang logistik Teluk Dalam juga tampak sejumlah kotak suara mulai rusak akibat terkena air. Bupati Nias Selatan Idealisman Dachi saat menerima Sekdaprovsu dan rombongan setelah meninjau lapangan mengemukakan, secara umum pendistribusian logistik di Nias Selatan berjalan baik, namun masih terus diawasi ketat agar tidak terjadi kendala di lapangan. ”Secara umum Nias Selatan sudah siap menggelar Pemilu pada 9 April mendatang,” ujar Bupati. Sekdaprovsu menyampaikan apresiasi dari Gubsu atas keseriusan Pemkab Nias Selatan membantu penyuksesan Pemilu Legislatif. Dia berharap tahapan selanjutnya dapat dipantau serius sehingga tidak terjadi kendala di lapangan terutama di daerah terpencil. Dengan begitu diharapkan semua kebutuhan logistik yang akan dipakai pada saat pencoblosan, tidak terlambat tiba di lokasi. “Ini semua hanya untuk kelancaran dalam pelaksanaan pencoblosan, sekaligus mengikuti perintah aturan bahwa H1 pelaksanaan pencoblosan, logistik sudah harus berada di tempat pemungutan suara,” katanya. Ketua KPU Sumut juga mengambil kebijakan memprioritaskan logistik daerah terpencil dengan mempertimbangkan kondisi geografis wilayah Pulau Nias yang merupakan kepulauan tersebut. Sedangkan untuk tempat pemungutan suara di daerah yang mudah dijangkau dan akses transportasi yang lancar akan disalurkan ke setiap TPS melalui panitia pemungut-an suara (PPS), paling lambat H1 pencoblosan. Sehari sebelumnya di Kota Gunungsitoli, Sekdaprovsu dan rombongan juga mengadakan Rakor dengan pihak Pemko Gunungsitoli dan Pemkab Nias beserta Muspida masing-masing dan Ketua KPU serta Panwas bersama tokoh-tokoh strategis setempat di Pendopo Bupati Nias. Pada Rakor yang dihadiri Wakil Bupati Nias Arosokhi Waruwu SH, MH, danWakilWali Kota Gunungsitoli Drs. Aroni Zendrato ini terungkap, Kepulauan Nias secara umum telah siap menggelar Pemilu Legislatif pada 9 April mendatang. Selain itu, diperoleh informasi bahwa kabupaten lainnya di Pulau Nias juga sudah melakukan persiapan secara baik.(m28)

Waspada/Amir Syarifuddin

SEKDAPROVSU H. Nurdin Lubis, SH, MM (empat kanan) didampingi Ketua KPU Sumut Mulia Banurea dan Ketua Bawaslu Sumut Syarida R Rasahan meninjau mekanisme pergeseran logistik di gudang penampungan logistik di Km 1 Teluk Dalam Kabupaten Nias Selatan. Turut serta Kepala Badan Intelijen Negara (BIN) Daerah Provinsi Sumut Brigjen TNI Cucu Soemantri (dua kanan) dan AKBP Hanung T mewakili Kapoldasu (tiga kiri) serta Sekda Nias Selatan Faduhusi Daely, SPd (lima kanan).

Perampok Sepedamotor Diamuk Massa MEDAN (Waspada): Satu dari empat perampok sepedamotor diringkus dan dihajar massa hingga babak belur di jalan dekat gerbang tol Haji Anif, Desa Sampali, Kec. Percut Seituan. Sedangkan tiga pelaku lainnya berhasil meloloskan diri. Tersangka berinisial Zul, 28, warga Jln. Aluminium, Kel. Tanjung Mulia, Kec. Medan Deli, yang berusaha kabur memba-

wa sepedamotor milik Muliadi, 27, warga Jln. Gurila, Kel. Sei Kera Hilir I, Kec. Medan Perjuangan, ditabrak warga yang melihat aksi kejahatan mereka. Informasi yang diperoleh di kepolisian, Minggu (6/4), malam itu korban Muliadi bersama teman wanitanya Anita Purnama Sari berboncengan naik sepedamotor Yamaha Mio BK 3364 XJ melintas di jalan baru

dekat gerbang tol Haji Anif, Desa Sampali, Kec Percut Seituan. Di tengah jalan yang sepi dan gelap, tiba-tiba empat pelaku yang mengendarai sepedamotor memepet korban. Seorang di antara pelaku menodongkan senjata tajamnya ke tubuh Muliadi, sedangkan seorang lagi merampas sepedamotor korban. Selain itu juga, kawanan

Polisi Tangkap Mahasiswa Malaysia Miliki Ganja M E D A N ( Wa s p a d a ) : Memiliki dua amplop berisi daun ganja kering, seorang mahasiswa Warga Negara Malaysia, yang kuliah di salah satu perguruan tinggi di Medan, diringkus petugas Reskrim Polsek Medan Helvetia dari tempat kosnya di kawasan Kec. Medan Helvetia, Minggu (6/4). Informasi yang diperoleh di

kepolisian, WN Malaysia yang belum diketahui identitasnya itu diduga baru saja membeli daun ganja kering dan hendak dikonsumsi di dalam kamar kosnya. Petugas Polsek Medan Helvetia yang mendapat informasi langsung menggerebek kamar kos tersebut dan menemukan dua amplop daun ganja kering.

Kanit Reskrim Polsek Medan Helvetia AKP Hendrik Temaluru yang dikonfirmasi membenarkan penangkapan oknum mahasiswa salah satu perguruan tinggi di Medan tersebut. “Oknum mahasiswa itu masih diperiksa. Barang buktinya 2 amplop daun ganja,” sebutnya. (m36)

Sosialisasi Penerimaan Anggota Polri Di Plaza Dan Pasar M E D A N ( Wa s p a d a ) : Polresta Medan melalui Sat Lantas melakukan sosialisasi penerimaa anggota Polri tahun 2014 di lokasi keramaian diantaranya Plaza Medan Fair, Hermes Palace dan Pasar Petisah,

Minggu (6/4). “Tujuan sosialisasi ini agar masyarakat mengetahui adanya penerimaan anggota Polri. Dengan demikian, animo masyarakat makin besar dalam mendaftar sebagai calon anggota

Polri,” jelas Kasat Lantas Polresta Me d a n Ko m p o l M . Bu d i Hendrawan. Menurutnya, dengan animo yang besar diharapkan terpilih calon-calon anggota Polri yang bermutu dan berkualitas.

Waspada/Rudi Arman

TIGA remaja putri berdialog dengan anggota Polwan dari Sat Lantas Polresta Medan yang melakukan sosialisasi penerimaa anggota Polri tahun 2014 di Plaza Medan Fair, Minggu (6/4).

Budi menjelaskan, selain di Plaza dan pasar tradisional, pihaknya juga melakukan pemasangan spanduk penerimaan anggota Polri di seluruh wilayah hukum Polresta Medan. “Ada 50 spanduk yang kita pasang,” katanya. Selain itu, lanjutnya, menggelar kegiatan sosialisasi dengan mendatanggi sekolah-sekolah dan memberikan arahan terutama kepada siswa kelas XII agar mendaftar sebagai angota Polri tanpa dipungut biaya. Sebelumnya, Kapolresta Medan Kombes Pol Nico Afinta Karokaro melalui Kabag Humas Polresta Medan AKP Riama Siahaan mengatakan, Polresta Medan atas nama Kepolisian Negara Republik Indonesia, memberi kesempatan kepada putra-putri WNI Kota Medan dan sekitarnya, untuk mendaftarkan diri menjadi anggota Polri melalui seleksi dan pendidikan pembentukan Brigadir Polri TA 2014. Dengan kuota didik Polisi lelaki (Polki) 10.750 orang dan Polisi wanita (Polwan) sebanyak 7000 orang untuk seluruh Indonesia. Dijelaskannya, masa pendaftaran mulai 26 Maret hingga 19 April 2014 di biro SDM Poldasu, gedung Mapoldasu lantai III Bag Dalpers, Jln. Sisingamangaraja Medan atau bisa

melalui website www.penerim a a n . p o l r i . g o. i d t a n p a dipungut biaya. Syarat pendaftaran, berijazah serendah-rendahnya SMU/SMA dan SMK semua jurusan, dengan nilai akhir (gabungan nilai UN dan nilai sekolah) minimal 6,0. Bagi yang masih duduk di kelas XII atau yang akan lulus tahun 2014, menggunakan nilai raport semester terakhir. Tinggi badan minimal pria 163 cm dan Polwan 155 cm, membawa surat keterangan bebas narkoba dari instansi kesehatan (rumah sakit) setempat, tidak pernah dipidana karena melakukan suatu kejahatan (surat keterangan dari Polres/ ta/tabes setempat berupa SKCK), belum pernah menikah dan bersedia menjalani ikatan dinas minimal 10 tahun terhitung mulai diangkat menjadi Bripda. Selain itu, calon tidak terikat perjanjian ikatan dinas dengan instansi lain, bersedia ditempatkan di seluruh wilayah Negara Kesatuan Republik Indonesia (NKRI), mengikuti dan lulus pemeriksaan dengan sistem gugur, yang meliputi pemeriksaan administrasi awal, kesehatan, psikologi, kesamaptaan jasmani, akademik, mental dan kepribadian. (m39)

perampok tersebut mengambil dompet dan handphone milik korban. Usai menjarah barang berharga milik korban, para pelaku berusaha kabur. Namun, saat tersangka Zul membawa kabur sepedamotor korban, dipergoki salah seorang warga yang sedang melintas dan langsung menabraknya. Akibatnya, tersangka Zul terpental ke

badan jalan. Kemudian korban dibantu warga menangkap tersangka Zul dan memukulinya hingga babak belur, sedangkan tiga lagi pelaku langsung kabur. Petugas Reskrim Polsek Percut Seituan yang tiba di lokasi kejadian segera mengamankan tersangka Zul dari amuk massa yang semakin ramai berdatangan ke

lokasi. Kepada petugas, tersangka Zul mengaku sudah beberapa kali melakukan perampokan bersama tiga temannya yang melarikan diri itu. Seluruh hasil kejahatannya digunakan untuk berfoya-foya. “Sudah beberapa kali kami lakukan. Uang hasil rampokan kami bagi rata,” sebutnya. (h04)

Parlindungan Purba Dukung Hubungan Sumut Dan Polandia MEDAN (Waspada): Anggota DPD RI Parlindungan Purba, SH, MM mendukung hubungan Sumatera Utara dengan Polandia. Sebab, hubungan ini dinilai dapat memberikan keuntungan bagi masyarakat Sumatera Utara terutama di kalangan pelaku bisnis. Demikian disampaikan Parlindungan Purba yang juga Ketua APINDO (Asosiasi Pengusaha Indonesia) Sumatera Utara kepada wartawan usai melakukan pertemuan dengan Duta Besar Polandia HE Tadeusz Szumowski di Medan, Sabtu (5/4). Duta Besar Polandia HE Tadeusz Szumowski mengatakan, Polandia sedang menjajaki pembentukan sister province dengan Sumatera Utara. Hal ini terungkap dalam acara Business Lunch di salah satu restoran di Medan, yang dihadiri Duta Besar Polandia dan para pengusaha dari Sumatera Utara. Menurut Szumowski, Sumatera Utara sebagai salah satu provinsi besar di Indonesia memiliki potensi di berbagai sektor. Dia mengaku sangat tertarik untuk memperat kerjasama terutama di bidang investasi dan perdagangan. “Kami sedang mengumpulkan berbagai informasi seputar potensi masing-masing.

Polandia sangat tertarik untuk berinvestasi dan meningkatkan kerjasama perdagangan dengan Sumatera Utara khususnya di sektor elektronik, teknologi dan informasi, serta keamanan,” ujar Szumowski. Sektor lainnya yang cukup menarik bagi Polandia seperti infrastruktur, pengelolaan limbah, teknologi ramah lingkungan, serta proses dan pengemasan makanan serta kosmetik. Sumatera Utara merupakan provinsi pertama yang dikunjungi Szumowski. Kunjungan tersebut merupakan tindak lanjut dari kunjungan Presiden Susilo Bambang Yudhoyono ke Warsawa pada September tahun lalu. Sementara itu, Parlindungan menyambut baik rencana penjajakan sister province dengan Sumatera Utara yang berupaya menciptakan hubungan budaya dan ekonomi. Dia mengaku bangga karena Duta Besar Polandia mengagendakan Medan sebagai kota pertama dalam kunjungannya. “Ada keterkaitan historis Indonesia dengan Polandia. Yakni nama Polonia yang digunakan sebagai kawasan perumahan dan bandar udara,” tambahnya. Menurut Parlindungan,

Sumatera Utara sudah menjadi perhatian ekonomi Eropa karena sumber daya alam dan sumber daya manusia yang sangat potensial. Selain itu, Polandia telah menunjuk Jonner Napitupulu sebagai Konsul Kehormatan di Medan sehinga akan mendukung persahabatan kedua negara. Apalagi Polandia dinilai sangat maju di bidang perikanan dan kelautan. Hadir pada acara Business Lunch tersebut antara lain Dubes Polandia HE Tadeusz Szumowski beserta istri Agata Szumowski, Wakil Konsul Denmark di Medan Hendra Kesuma, Asosiasi Konstruksi TM Pardede, Rikardo Manurung dari INKINDO, Wakil Ketua KADIN Sumut Tohar Suhartono, Eksportir Wakil Distrik 1 Dalbir S. Kapoor, Ketua APINDO Rusmin Lawin, Konsul Kehormatan Polandia di Medan Jonner Napitupulu beserta istri Emma Napitupulu. “Para pengusaha Sumatera Utara di bidang kesehatan, pendidikan dan bidang lainnya menyatakan siap bekerjasama dengan para pengusaha dari Polandia guna meningkatkan perekonomian kedua negara khususnya perekonomian Provinsi Sumatera Utara,” demikian Parlindungan.(m25)


DUTA Besar Polandia HE Tadeusz Szumowski foto bersama dengan Anggota DPD RI Parlindungan Purba, SH, MM dan pengusaha Sumatera Utara pada acara Business Lunch.

Medan Metropolitan


WASPADA Senin 7 April 2014

Lima Pembobol Gudang FKG USU Ditangkap MEDAN (Waspada): Petugas Rekrim Polsek Medan Baru meringkus lima dari enam pencuri empat dental unit (kursi gigi) milik Fakultas Kedokteran Gigi (FKG) USU dalam penyergapan secara berbeda. “Para tersangka yang ditangkap berinisial SS alias Adi, 39, (pegawai administrasi di Fk. Gigi USU) penduduk Jln. Belanga Medan, Pyt, 37, PNS (Satpam) penduduk Jln. Luku I, Lingk. XIV, Kel. Kwala Belaka, Kec. Medan Johor, MS, 39, (tukang gigi) penduduk Jln. Cinta Karya Gang Agung, Medan Polonia, R, 38, (tukang gigi) penduduk Jln. Roso Gang Melati VI, Marendal, dan Sgt, 51, (tukang gigi) penduduk Jln. Lestari, Dusun IV, Kel. Mekar Sari, Kec. Delitua,” ujar Kapolsek

Medan Baru Kompol Nasrun Pasaribu SH, SIK, MH, kepada Waspada, Minggu (6/4) sore. Nasrun didampingi Kanit Reskrim Polsek Medn Baru Iptu Alexander P, SH dan Panit Reskrim Ipda Harjuna Bangun, S.Sos mengatakan, dari para tersangka disita barang bukti empat dental unit (kursi gigi) kondisi diduga rusak dan lainnya. Sedangkan, satu pelaku lagi berinisial Spd, 40, penduduk Marendal, masih diburon. Kata dia, para tersangka ini merupakan buronan dan sudah masuk Daftar Pencarian Orang (DPO) atas pengaduan Rektor USU melalui Pembantu Dekan III USU drg Zulkarnaen atas pembobolan gudang Fak.

Kedokteran Gigi USU Medan, Kamis (20/2) pukul 13:00. “Hasil penyelidikan dilapangan, akhirnya pada Sabtu (5/ 4) malam, empat pelakunya ditangkap, sekaligus mengamankan empat dental unit (kursi gigi) masing-masing dari rumah tersangka R, dari rumah tersangka MS, dari rumah adik tersangka MS di Jln. Luku, Pasar Mati depan Carefour Jln. Letjen Jamin Ginting – Padangbulan, dan dari rumah tersangka Sgt,” kata Nasrun. Berdasarkan pengakuan tersangka SS alias Adi, dia mengambil kursi gigi dari dalam gudang Fak. Kedokteran Gigi USU Medan pada Mei 2013. Kemudian pada 9 Februari 2014, tersangka SS bersama Spd

mengambil kembali kursi gigi. Mereka dalam aksinya dengan cara merusak engsel gembok pintu gudang. Mereka mengangkut dental unit tersebut dengan mobil pick up atas persetujuan petugas satpam Pyt. Selanjutnya, barang bukti itu dijual kepada MS dua dental unit dengan harga Rp6.900.000, satu dental unit kepada R seharga Rp4.500.000, satu lagi dijual kepada Sgt seharga Rp4.500.000. Sedangkan uang hasil penjualannya dibagi bertiga yakni SS alias A, Pyt, dan Spd. Selesai menjalani pemeriksaan, tersangka SS alias Adi mengatakan, mereka mengambil dental unit dari dalam gudang itu sudah direncanakan. “Dental

unit yang kami ambil itu sudah bertahun-tahun tidak digunakan karena rusak,” tuturnya. (m36)

Waspada/Ismanto Ismail

KAPOLSEK Medan B aru Kompol Nasrun Pasaribu SH, SIK, MH (dua kiri) didampingi Kanit Reskrim Iptu Alexander P SH (kanan), dan Panit Reskrim Ipda Harjuna Bangun SSos (kiri) menginterogasi pembobol gudang FKG USU tersangka SS (pegawai administrasi Fakultas Kedokteraan Gigi USU) disaksikan tersangka lainnya (jongkok).

Diduga Disekap

PRT Lompat Dari Lantai II RS Eva MEDAN (Waspada): Diduga disekap oleh majikannya, seorang pembantu rumah tangga nekad melompat dari lantai II Rumah Sakit Ibu dan Anak Eva di Jln. Bakaran Batu III, Kec. Medan Area. Akibatnya, Noni, 20, asal Pekanbaru, Riau, menderita patah tulang kakinya.

Kepada wartawan, Sabtu (5/ 4) sekira pukul 21:00, Noni mengaku, aksi nekadnya itu terjadi

pada Selasa lalu. Sebelumn, dirinya mendaftar di Yayasan Empat Saudara yang berada di Jakarta. “Sebenarnya aku diminta kerja di rumah anak pemilik rumah sakit ini yang berada di Jln. Cemara,” kata Noni. Karena anak pemilik rumah sakit pergi keluar negeri, sementara waktu Noni dibantarkan untuk menjadi PRT di Rumah Sakit Ibu dan Anak Eva yang sekaligus dijadikan tempat tinggal itu. Selama berada di rumah sakit tersebut, barang-barang berharga milik Noni seperti handphone dan perhiasan disita oleh pemilik rumah sakit. Bahkan, korban juga tidak diberi keluar dari rumah sakit tersebut. “Hapeku disita. Gimana aku ngabari keluargaku yang di

Pekanbaru? Aku juga gak dikasih keluar,” sebutnya. Karena itu, pada Selasa (1/ 4), Noni nekat melompat dari lantai II untuk mengelabui security. Namun, setelah melompat, dirinya tidak bisa berjalan lagi

karena kaki kirinya mengalami patah tulang. “Setelah jatuh, barulah hape dan barangbarangku dikasih,” ujarnya. Noni dirawat selama dua hari di Dukun Patah Kem-Kem yang terletak di Gang Amal.

Setelah dirawat, dia menghubungi orangtuanya dan menceritakan kejadian yang dialaminya. Mendapat kabar itu, orangtua Noni langsung bergegas menuju Kota Medan. Kedua orangtuanya yang

Cabuli Siswi SD Ditangkap MEDAN (Waspada): Tersangka Ja, 47, warga Jln. Denai Gang Galon, Kel. Tegal Sari Mandala III, Kec. Medan Denai, yang mencabuli siswi SD berusia 8 tahun, diringkus petugas Reskrim Polsek Percut Seituan, saat nongkrong di warung tak jauh dari rumahnya, Kamis (3/ 4) sekira pukul 22:00. Informasi yang diperoleh di kepolisian, penangkapan terhadap tersangka Ja, berawal dari pengaduan Fadli, 46, warga Pasar III, Desa Tembung, Kec. Percut Seituan, ke Polsek Percut Seituan, beberapa hari lalu. Fadli dan istrinya curiga melihat kondisi putrinya selalu merintih

kesakitan saat hendak buang air kecil. Setelah ditanyai, korban mengaku bahwa kemaluannya telah diraba-raba oleh tersangka Ja, bahkan memasukkan jemarinya ke kemaluan korban. “Selama ini tersangka Ja makan, minum, dan tidur dirumahku. Jika dia tidak memiliki uang, selalu kuberikan, karena sudah kuanggap sebagai keluarga. Tetapi tersangka tega berbuat begitu kepada putri saya, dan atas perbuatannya, tersangka harus dihukum seberat-beratnya,” sebut Fadli. Kepada petugas, tersangka Ja mengakui perbuatannya. “Su-

dah 4 kali saya mencabuli korban pak. Saya nekat melakukannya karena hingga kini saya masih melajang. Sebelum berbuat, terlebih dahulu saya memaksa dan mengancam tersangka,” katanya. Sementara itu, Kapolsek Percut Seituan, Kompol Ronald Sipayung ketika dikonfirmasi membenarkan penangkapan tersangka cabul tersebut. “Tersangka Ja masih menjalani pemeriksaan. Tersangka Ja ditangkap berdasarkan keterangan dari korban dan saksi-saksi, serta dari hasil visum yang menyatakan ada luka robek di kemaluan korban,” ujarnya. (h04)

PWI Sumut Imbau Wartawan Proaktif Awasi Pemilu Legislatif


BRILIAN Moktar (kiri) saat menurunkan alat peraga kampanye miliknya di Jln. Letda Sujono Medan, Minggu (6/4).

Brilian Moktar Tertibkan APK MEDAN (Waspada): Calon anggota legislatif (caleg) DPRDSU Brilian Moktar menertibkan sendiri alat peraga kampanye (APK) miliknya setelah tahapan kampanye berakhir pada Sabtu (5/4). Penertiban itu diawali dari penurunan APK di dekat kediamannya Jln. Letda Sujono Medan, Minggu (6/4) sekira pukul 09:00. Usai menertibkan alat peraga kampanye di sekitar rumahnya, Brilian Moktar yang dibantu sejumlah kader salah satu partai politik menertibkan atribut yang ada di sekitar Jln. Letda Sujono, Jln. Aksara, Jln. Willem Iskandar dan Jln. Suasa. Brilian mengatakan, penertiban alat peraga kampanye secara mandiri tersebut merupakan wujud kepatuhan dan ketaatan atas aturan kampanye yang ditetapkan penyelenggara Pemilu. Dia menyadari bahwa pemerintah dan Panitia Pengawas Pemilu (Panwaslu) memiliki keterbatasan, baik anggaran maupun personel untuk menertibkan alat peraga kampanye yang jumlah sangat banyak. Karena itu, Brilian mengambil inisiatif menertibkan sendiri alat peraga kampanye miliknya dengan melibatkan simpatisan dan tim pemenangan dengan harapan dapat meringankan tugas pemerintah dan Panwaslu Kota Medan.(m08)

MEDAN (Waspada): Ketua Persatuan Wartawan Indonesia (PWI) Sumatera Utara (Sumut) Drs. Muhammad Syahrir mengimbau anggota PWI dan rekanrekan wartawan lainnya yang bertugas di lapangan agar proaktif melakukan pengawasan terhadap tahapan Pemilu Legislatif. Terutama menjelang pelaksanaan pemungutan suara pada 9 April 2014. Imbauan itu disampaikan Ketua PWI Sumut agar seluruh tahapan pelaksanaan Pemilu Legislatif (Pileg), terutama pada masa rawan terindikasi terjadinya pelanggaran Pemilu dapat terawasi secara optimal. “Dengan dukungan pengawasan yang dilakukan anggota PWI yang tersebar di seluruh wilayah Provinsi Sumut, diharapkan pelanggaran dapat diantisipasi,” kata Syahrir dalam keterangan pers di Gedung PWI Sumut Jln. Adinegoro No.4 Medan, kemarin. Menurut Syahrir, pengawasan seluruh tahapan Pemilu sudah menjadi kewenangan Badan Pengawas Pemilu (Bawaslu) atau Panitia Pengawas Pemilu (Panwaslu) di semua tingkatan hingga ke tempat pemungutan suara (TPS). Namun peran wartawan tetap diperlukan untuk mengawasi semua pihak yang

terlibat dalam pelaksanaan Pemilu, termasuk mengawasi tugas penyelenggara Pemilu di jajaran Komisi Pemilihan Umum (KPU) dan Bawaslu. Beberapa titik r awan pelanggaran yang perlu secara ekstra diperhatikan, kata Syahrir, antara lain berupa serangan fajar (money politics), netralitas Kelompok Panitia Pemungutan Suara (KPPS) di TPS, intimidasi pemilih ketika menuju TPS dan kekurangan surat suara. Kemudian, ketidakkonsistenan dalam menentukan surat suara sah atau tidak sah, pemilih menggunakan hak pilih lebih dari satu kali, intimidasi terhadap pemilih ketika menuju TPS, manipulasi hasil pemungutan dan penghitungan suara, serta penggunaan surat suara cadangan tidak disertai berita acara. Undang-undang Nomor 40 Tahun 1999 Pasal 3 Ayat 1 menjelaskan, fungsi pers yang di dalamnya ada wartawan adalah sebagai media informasi, pendidikan dan pengawasan. “Melalui amanah undang-undang ini sangat diharapkan peran wartawan dapat dijalankan sebagai pengawas di segala lini kehidupan bermasyarakat, berbangsa dan bernegara, termasuk dalam pengawasan Pemilu,” kata

Syahrir. Dengan dukungan pengawasan yang optimal dari wartawan, diharapkan seluruh tahapan pemilu legislatif dapat berjalan lancar, tertib serta berlangsung secara jujur, adil ( Jurdil), demokratis dan tentunya menghasilkan wakil rakyat yang berkualitas. Khusus dalam pemberitaan Pemilu, Ketua PWI Sumut mengimbau agar penyajiannya di media massa dilakukan secara akurat, menggunakan data dan fakta yang dapat diverifikasi dan dipertanggungjawabkan, melakukan check dan recheck, menjaga netralitas, bersikap independen, tidak mencampuradukkan fakta dan opini, tidak menghakimi, tidak beritikad buruk, serta senantiasa berpegang teguh pada hati nurani atau kebenaran. Terkait peliputan Pemilu, Muhammad Syahrir mengharapkan agar setiap anggota PWI mematuhi dan mengikuti segala aturan yang telah digariskan dalam perundang-undangan dan anggota PWI harus menaati Kode Etik Jurnalistik (KEJ). “Sepanjang menaati KEJ, tidak akan ada masalah dan saya pastikan tidak satu pihak pun yang bisa menggugat,” tegasnya. (m08)

bekerja sebagai sopir dan perawat itu tiba di Medan, Sabtu (5/4). Kejadian ini langsung dilaporkan ke pihak kepolisian. Mendapat laporan, petugas Polsek Medan Area dan Sat Reskrim Unit Judi/Sila (VC) Polresta Medan, mendatangi rumah sakit tersebut. Selanjutnya, orangtua Noni,

pihak kepolisian, dan pemilik rumah sakit yang diketahui bernama Eva berunding menyelesaikan masalah tersebut. Tak lama, seorang petugas kepolisian mengaku kalau orangtua Noni tidak keberatan atas kejadian tersebut. Ketika kejadian itu hendak dikonfirmasikan kepada pe-

milik rumah sakit tidak berhasil. Sebab, seorang pria etnis keturunan yang mengaku anak pemilik rumah sakit tidak mengizinkan wartawan bertemu dengan Eva. “Udah bang, gak ada apaapa,” katanya seraya menunjukkan kartu ID Card yang tidak jelas. (h04)

Korban Pencabulan Ngadu Ke Komnas Perlindungan Anak MEDAN (Waspada): Muhammad Husin Wijaya, 50, warga Jln. Titi Pahlawan Simpang Kantor, Kel. Pekan Labuhan, Kec. Medan Labuhan, mendatangi Kantor Koordinator Komnas Perlindungan Anak di Medan, Kamis (3/4) sore. M Husin mengadukan kasus pencabulan secara berulang-ulang yang dialami anaknya berinisial NSW, 17. Ironisnya, dalam menjalankan aksinya, pelaku mengiming-imingi akan memasukkan korban sebagai model dan berjanji akan menikahinya. Pencabulan itu berawal saat korban diterima bekerja di salah satu Plaza dan berpacaran dengan pelaku berinisial ASS, 21, alias Acil. Kemudian korban dibawa pelaku untuk tinggal serumah dengannya di Jln Bliton Kompleks PJKA Belawan, dari tanggal 4 Juli 2013-1 April 2014. Orangtua korban M Husin yang kehilangan anaknya selama hampir setahun mencoba mencari keberadaan anaknya, namun tidak juga ditemukannya. Namun, tiba-tiba Rabu (26/ 3), dia menerima telepon dari pelaku yang membawa lari anaknya. Takut terjadi sesuatu terhadap anaknya, M Husin melaporkan kasus itu ke Polres Pelabuhan Belawan dengan No: STTLP/ 223/III/2014/SPKT II pada Jumat (28/3). Namun, oleh petugas Polres Pelabuhan Belawan, pelaku dibebaskan dengan alasan tidak memenuhi unsur. Kemudian M Husin yang mendengar keterangan anaknya telah dicabuli, langsung melaporkan kembali ke Polres Pelabuhan Belawan dengan Nomor : STTLP/229/IV/2014/ SPK Terpadu dengan kasus tindak pidana persetubuhan terhadap anak dibawah umur dengan Pasal 81 UU No.23 Tahun 2002. Menurut korban NSW, dirinya pergi dan tinggal bersama di rumah Acil di Jln. Bliton Komplek PJKA. “Kami uda lama pacaran, saya tinggal dirumah


KORBAN pencabulan NSW (tengah) didampingi Ketua Komnas Perlindungan Anak Arist Merdeka Sirait (kiri) dan Ketua Pokja Perlindungan Anak Kota Medan Dr T Amri Fadli MKes, di Kantor Koordinator Komnas Perlindungan Anak di Medan. Acil, kami memang ada berhubungan badan. Namun, Acil berjanji akan bertanggungjawab dan menikahi saya,” ujarnya. Selain itu, kata NSW, pelaku Acil juga ada menjanjikan korban akan dijadikan model. “Acil itu model, pernah kami lomba model peragaan baju muslim di Palladium dan Acil juara I, sedangkan saya juara II,” sebutnya. Sedangkan M Husin menjelaskan, kepergian anaknya tidak diketahui olehnya. Pasalnya, anaknya selama beberapa hari menginap dirumah ibu kandungnya. “Saya tidak tahu kapan anak saya pergi dari rumah, tapi tiba-tiba saja saya dapat informasi dari tetangga bahwa anak saya pergi sama laki-laki, hampir 1 tahun anak saya tidak pulang-pulang,” katanya. Selain itu, menurut Husin, tiba-tiba ada telepon dari pelaku mengatakan akan datang ke rumahnya dengan maksud untuk melamar korban. “Pernah datang mereka ke rumah, tapi saat datang pelaku membentak istri saya Elvi Suryani dengan mengatakan istri saya mamak tiri dan tidak ada hak. Padahal, dari umur 4 tahun, anak saya

(NSW) dirawat istri saya,” tutur Husin. Dijelaskannya, pelaku pernah diamankan pihak kepolisian dengan surat penahanan membawa lari anaknya. “Pelaku kemudian dibawa ke Polres Pelabuhan Belawan, tapi pelaku sekarang sudah bebas. Kata Kanitnya tidak memenuhi unsur, dan sekarang saya kembali melaporkan kasus pencabulan yang dilakukan pelaku. Soalnya menurut pengakuan anak saya, anak saya sudah dicabuli berulangkali, awal pencabulan itu saat korban dibawa pelaku,” sebutnya. Husin berharap agar pelaku dapat diganjar dengan hukuman yang setimpal. “Saya hanya ingin pelaku segera ditangkap dan diproses sesuai hukum berlaku,” sebutnya. Ketua Komnas Perlindungan Anak Indonesia Arist Merdeka Sirait didampingi Ketua Pokja Perlindungan Anak Kota Medan Dr T Amri Fadli MKes, ketika dikonfirmasi mengatakan, pihaknya akan terus mendampingi kasus pencabulan tersebut. “Komnas Medan yang akan tangani kasus ini, kita akan terus memantau perkembangannya,” ujarnya. (m21)

Medan Metropolitan

WASPADA Senin 7 April 2014

Jadwal Penerbangan Di Bandara KNIA No. Penerbangan Ke Flight


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-280 12 Palembang GA-266 13. Batam GA-270 14. Penang GA-804 15. Pekanbaru GA-276 16. Tanjungkarang GA-270

05.20 09.05 11.00 12.20 13.25 14.05 17.00 18.35 20.35 09.40 10.45 06.00 10.25 10.55 06.00 10.25

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Palembang Batam Penang Pekanbaru Tanjungkarang

GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-143 GA-281 GA-267 GA-271 GA-805 GA-277 GA-271

08.00 08.55 10.15 11.20 13.05 16.00 17.30 19.35 22.10 12.35 19.05 15.45 18.00 13.20 08.45 18.00

CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

QG-831 QG-837 QG-833 QG-835 QG-882

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Bangkok 9 Bandung 10 Surabaya 11 Bandung 12 Penang 13 Pekanbaru 14 Singapura 15 Kuala Lumpur

QZ-8050 06.20 QZ- 8054 17.40 AK- 1351 08.00 AK-1355 17.55 QZ-8072 14.25 AK-1581 18.45 AK-1357 21.20 QZ-8084 14.15 QZ-7987 08.45 QZ-7611 13.15 QZ-7981 17.10 QZ-8078 06.25 QZ-8028 11.30 QZ-664 07.45 QZ-8052 13.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Penang Pekanbaru Singapura Kuala Lumpur

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-1580 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8079 QZ-8029 QZ-665 QZ-8053

08.30 10.55 07.35 17.00 16.35 18.30 21.05 16.40 11.30 09.55 19.55 08.35 12.50 10.35 15.55

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT-207 JT- 301 JT-395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.40 08.05 13.35 2010 18.00 20.40 19.30 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.05 17.20 17.50 19.45 10.25 15.55 09.20 18.25. 21.05 22.20 23.50 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur

MH-861 MH-865 NH-841

09.40 15.45 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur

MH-860 MH-864 MH-840

08.50 15.00 06.15

SILK AIR 1 Singapura 2 Singapura 3 Singapura

MI-233 MI-237 MI-235

08.40 20.35 13.15

Singapura Singapura Singapura

MI-234 MI-238 MI-236

07.35 19.50 12.20

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang 9 Jakarta

SJ-021 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021 SJ-017

13.15 15.55 16.50 10.20 17.20 12.50 07.20 16.00 08.05

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang Jakarta

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020 SJ-016

18.10 16.20 14.55 11.50 15.45 14.20 09.50 14.10 17.20

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55





MANDALA AIRLINE 1 Singapura RI-861

Tiba Dari



Jadwal Perjalanan Kereta Api No KA

U28 A U30 A U32 A U34 A U27 A U29 A U31 A U33 A U37 A U38 A U39 A U40 A U41 A U42 A U43 A U44 A U35 A U36 A U45 A U46 A U47 A U48 A U49 A U50 A U51 A U52 A U53 A U54 A U55 A U56 A U57 A U58 A U59 A U60 A

Nama KA









07.47 10.17 15.44 23.03 07.52 14.58 17.18 23.13 08.08 14.30 07.50 06.49 13.06 13.11 19.36 17.33 05.42 18.44 05.46 05.02 07.14 06.30 09.15 08.30 12.18 10.00 13.53 13.09 16.49 14.37 19.00 18.16 21.40 20.56


13.56 15.46 22.02 04.38 14.04 10.17 22.55 04.47 11.54 18.24 12.54 11.11 18.01 17.45 00.29 22.24 07.42 20.57 06.15 05.31 07.43 06.59 09.44 08.59 12.47 10.29 14.22 13.38 17.18 15.06 19.29 18.45 22.09 21.25

Jadwal Keberangkatan KA Bandara Medan –Kuala Namu

Kuala Namu- Medan

No. KA

No. KA



Berangkat KNIA Tiba Medan

U62 04:00 04:37 U61 05:05 06:50 U2A 04:50 05:27 U65 07:33 08:15 U4A 06:15 06:52 U1A 08:00 08:46 U6A 07:16 07:53 U3A 09:05 09:49 U8A 08:20 08:57 U5A 09:25 10:10 U10A 09:10 09:47 U7A 10:20 11:07 U12A 10:40 11:17 U9A 11:50 12:37 U14A 11:10 11:47 U11A 12:25 13:09 U16A 12:10 12:47 U13A 13:25 14:12 U18A 13:45 14:22 U15A 14:55 15:42 U20A 14:15 14:52 U17A 15:30 16:14 U22A 15:15 15:52 U19A 16:25 17:12 U24A 16:45 17:22 U21A 17:55 18:42 U26A 17:15 17:52 U23A 18:30 19:14 U66 18:15 18:52 U25A 19:56 20:40 U68 19:17 19:54 U67 20:40 21:17 U70 20:01 20:38 U69 21:15 21:59 U72 21:10 21:57 U71 23:30 00:07 NB: Tiket dapat dibeli di stasiun KA Bandara Medan dan Kuala Namu. Pembayaran dapat menggunakan Kartu Prabayar, Debit dan Kredit Card. Tiket dapat dipesan 7 hari sebelum berangkat. (m32)


Siram Wajah Caleg Pakai Saus

Istri Anggota DPRDSU Diadukan Ke Polisi MEDAN (Waspada): Istri anggota DPRD Sumut berinisial An, 47, warga Kec. Medan Marelan, yang mencakar dan menyiram wajah seorang caleg perempuan dengan menggunakan saus cabai saat kampanye, dilaporkan korban Nur Asiyah Tanjung, 43, warga Jln. Bromo Ujung, Kec. Medan Denai, ke Polsek Medan Timur, Sabtu (5/4) sekira pukul 20:00. Akibat penganiayaan tersebut, caleg Nur Asiyah menderita luka cakar di pipi kanannya dan matanya nyaris buta akibat disiram pakai saus cabai di Lapa-

ngan Gajah Mada Jln. Krakatau, Kec. Medan Timur. Penganiayaan tersebut terjadi, Sabtu sekira pukul 16:00, saat korban sedang mengikuti

kegiatan kampanye Partai Amanat Nasional di Lapangan Gajah Mada. Korban bersama sejumlah caleg lainnya sedang bernyanyi di atas panggung, tiba-tiba pelaku An menerobos naik ke atas panggung. Lalu pelaku mendekati korban dan terus menyiram wajah korban pakai saus botol yang sudah dipersiapkan pelaku. Bukan itu saja, pelaku juga mencakar wajah korban hingga tergores dan berdarah. Akibat serangan mendadak itu korban mengalami kesakitan. Selain mengalami luka cakar, mata korban juga terkena sira-

man saus cabai dan sempat pingsan beberapa saat. Dalam suasana tidak menentu itu, seorang kader partai menolong dengan membasuh wajah korban dengan air bersih, sehingga mata korban normal kembali. Sementara itu, pelaku An diamankan caleg dan kader partai lainnya. Usai kampanye, korban yang datang bersama suaminya saat mau mengambil sepedamotor kembali didatangi oleh pelaku. “Mau apa kau, nggak beraninya kau disini,” kata pelaku. Meski ditantang oleh pelaku, namun korban tak melaya-

ninya. Malam harinya korban melapor ke Polsek Medan Timur sesuai dengan surat bukti lapor bernomor LP/402/IV/14/resta Medan/Sektor Polsek Medan Timur tertanggal 5 April 2014 yang diterima Ka SPK Aiptu T Hutapea. Nur Asiyah Tanjung saat dikonfirmasi, Minggu (6/4) mengakui, dirinya dianiaya dan disirim saus cabai oleh pelaku. Sebelum penganiayaan ini dirinya sering diteror pelaku melalui pesan singkat (sms). “Saya tidak tahu, kenapa pelaku menyerang dan menganiaya saya saat kampanye.

Tindakan istri seorang wakil rakyat ini sangat memalukan partai dan harus diusut tuntas oleh aparat kepolisian,” ujar korban. Sementara itu, Kapolsek Medan Timur Kompol Juliani Prihartini yang dikonfirmasi usai melakukan pengamanan kampanye tersebut, menganjurkan agar kasus itu diselesai secara internal partai. “Sebaiknya diselesaikan saja secara internal partai. Namun, bila tidak ada jalan keluarnya, silakan saja membuat laporan pengaduan ke polisi,” tuturnya. (h04)

Appikando Tidak Edarkan Ikan Impor Ke Pasar BELAWAN (Waspada): Asosiasi Pengusaha Pindang Ikan Indonesia (Appikando) Sumut me-negaskan, pihaknya tidak edarkan ikan impor ke pasar. Sehingga Appikando tidak ber-tang-gung-jawab terhadap maraknya isu beredar berbagai jenis ikan impor di sejumlah pasar. “Bahkan kami juga tidak menjamin kelayakan ikan ter-sebut dan perusahaan importir ikan yang tergabung dalam Appikando, selama ini tidak pernah sekalipun mengedarkan ikan limpor langsung ke pasar,” sebut Ketua DPW Appi-kando Sumut So Huan, Minggu (6/4). Pihaknya berharap pemerintah me-ngusut kebenaran isu tentang berbagai jenis ikan impor yang dijual bebas di pasar. Mengingat izin impor hanya untuk satu jenis yang di-per-bolehkan. “Itu sebabnya kami heran munculnya importir yang mampu mengimpor ikan jenis lain selain jenis mackerel atau ikan kem-bung kuring,” katanya. Menurut So Huan, DPW Appikando sa-ngat selektif da-lam mengajukan rekomendasi impor kepada Ditjen Pe-ngo-lahan dan Pemasaran Hasil Perikanan (P2HP). Sehingga ikan yang diimpor dalam kondisi baik atau layak dimakan. “Kami me-ngimbau, ma-syarakat le-bih berhati-hati dalam memilih ikan untuk dikonsumsi,” ujarnya. Se-bagaimana isu yang di-terima, saat ini be-redar ikan selain jenis mackerel seperti tong-kol, cencaru, kerapu, dan jenis lainnya. Terpisah, Ke-pala Stasiun Karantina Ikan Belawan Felix L Tobing me-mas-tikan bahwa izin impor ikan masih satu jenis yakni mackerel atau ikan kembung kuring. (h03) Waspada/Andi Aria Tirtayasa

TERSANGKA perampokan berinisial IU (tengah) didampingi dua penadah hasil rampokan memperlihatkan barang bukti di Polsek Percut Seituan, Minggu (6/4).

Perampok Kantor Disbudpar Diringkus Puluhan Barang Elektronik Disita MEDAN (Waspada): Setelah dua bulan diburon usai merampok kantor Dinas Kebudayaan Dan Pariwisata (Disbudpar) Provinsi Sumatera Utara, satu dari empat pelaku diringkus petugas Polsek Percut Seituan di Jln. Meteorologi Raya, Desa Laut Dendang, Kec. Percut Seituan, Sabtu (5/4) sekira pukul 21:00. Selain menangkap tersangka berinisial IU, 34, warga Jln. Sidomulyo Gang Merak, Desa Bandarkhalipah, Kec. Percut Seituan, polisi juga meringkus dua penadah barang-barang elektronik hasil curian berikut barang buktinya. Dua penadah masing-masing berinisial RG, 25, warga Jln. Rakyat, Kel Sidorame Timur, Kec. Medan Perjuangan, danYL, 42, warga Jln. Medan-Batangkuis, Pasar X, Desa Bandarklippa, kini menjalani pemeriksaan di Polsek Percut Seituan. Informasi yang diperoleh di kepolisian, Minggu (6/4), tertangkapnya seorang pelaku perampokan tersebut berawal dari kecurigaan petugas Reskrim Polsek Percut Seituan saat melihat mobil Xenia warna hitam sedang berhenti di pinggir jalan, tak jauh dari lokasi pertokoan. Petugas melihat seorang pria berjalan tergesa-gesa dan hendak masuk ke dalam mobil tersebut. Polisi mendekati pria itu dan tiba-tiba mobil tersebut langsung meninggalkan lokasi, sedangkan tersangka IU ditinggalkan begitu saja.

Merasa curiga, petugas Polsek Percut Seituan mengejar pengemudi mobil, sedangkan tersangka IU langsung diboyong ke Polsek Percut Seituan. Meski sudah mengejar mobil tersebut, tapi tak berhasil menangkapnya karena menghilang di jalan sepi dan gelap menuju Desa Bandarsetia. Kepada petugas, tersangka IU mengaku pada malam itu bersama 5 temannya berencana melakukan perampokan di satu ruko kawasan Jln. Meteorologi Raya. Selain itu, tersangka IU juga mengaku telah merampok kantor Dinas Kebudayaan dan Pariwisata Sumut yang berlokasi di komplek kantor Gubsu Jln. Pancing, Desa Medan Estate, pada Senin (27/1) lalu. Tersangka IU mengaku dirinya hanya sebagai sopir sekaligus yang merental mobil Xenia saat melakukan perampokan di kantor Disbudpar. “Mobilnya aku yang merental dan aku hanya sebagai sopir dan menunggu di pinggir Jln. Rumah Sakit Haji. Tiga kawan yang beraksi di kantor Disbudpar,” sebutnya. Kata dia, ketiga temannya masing-masing berinisial Zul, Bed, dan San (mantan anggota TNI) telah menyekap security kantor Disbudpar. Setelah melumpuhkan petugas security dengan menodongkan senjata api dan merusak kamera CCTV, mereka membawa puluhan peralatan elektronik seperti komputer dan televisi yang

harganya mencapai ratusan juta rupiah. Saat ditanya sudah berapa kali melakukan aksi perampokan, tersangka IU mengaku sudah 10 kali melakukan aksi perampokan di Medan, Deliserdang, Serdangbedagei, dan Asahan. Sementara itu, Kapolsek Percut Seituan Kompol Ronald Sipayung didampingi Kanit Reskrim, AKP Zulkifli Harahap dan Panit Reskrim Ipda P Lumbanbatu ketika dikonfirmasi menjelaskan, setelah melakukan pemeriksaan terhadap tersangka IU, komplotan perampok ini ternyata sudah melakukan aksinya lebih dari 10 kali di wilayah hukum Polsek Percut Seituan dan kota di Sumatera Utara. Kata Ronald, barang-barang hasil curian tersebut sudah dijual kepada dua penadahnya dengan harga murah. “Barangbarang hasil curian sudah berhasil ditemukan berikut menangkap dua penadahnya, sedangkan tiga lagi pelaku lainnya masih diburon,” ujarnya. Barang bukti yang disita, sebut Ronald, berupa 11 CPU, 2 unit TV plasma 42 Inci merk LG (home theater), 2 DVD player, 8 unit loudspeaker, 2 kipas angin, 10 stik PS, 2 mesin kompresor, 1 unit mesin penghisap debu, 50 kartu GSM Perdana Telkomsel, 6 kartu GSM XL, 1 obeng, dan 2 unit wireless microphone. (h04)

Banyak Usaha Merek Dagang Tidak Miliki NPWP MEDAN (Waspada): Banyaknya usaha merek dagang yang belum memiliki Nomor Pokok Wajib Pajak (NPWP), membuat Dinas Pendapatan (Dispenda) Kota Medan harus bekerja ekstra. Terutama pasca pengalihan pajak reklame yang melekat di dinding toko dari Dinas Pertamanan ke Dispenda Medan. “Kami mengimbau kepada seluruh pemilik usaha merek dagang dan jasa advertising agar memiliki NPWP. Sebab, selama ini masih banyak usaha merek dagang yang tidak memiliki NPWP,” kata Kadispenda Kota Medan H.Muhammad Husni kepada Waspada di Medan, Minggu (6/4). Husni menjelaskan, berdasarkan temuan BPK RI Perwa-

kilan Sumut, di Kota Medan masih banyak usaha merek dagang yang belum memiliki NPWP. Karena itu, pihaknya mengimbau agar segera mengurus NPWP sebagai dasar pengenaan pajak di Kantor Dispenda Kota Medan. “Saya sangat mengharapkan agar segera mengurusnya sebagai dasar pengenaan pajak, kami juga akan mendata mana jasa iklan yang sudah memiliki dan mana yang belum memiliki NPWP. Karena itu, kami mengajak yang belum agar segera mengurusnya dan kami siap untuk melayaninya,” ujar Husni. Mantan Kabag Aset dan Perlengkapan Pemko Medan ini mengatakan, upaya itu dilakukan untuk meningkatkan PAD pasca pengalihan fungsi pajak

reklame ke Dispenda Medan dan TRTB Medan sesuai Perwal No. 17, maka pelaksanaan pajak reklame yang melekat di dinding toko dan poster, stiker, grombong dan pajak reklame yang berneon boks pada dinding toko dikelola Dispenda. Sedangkan papan reklame bilboard, bando, megatron, videotron juga LED dikelola oleh Dinas TRTB Medan. “Bagi yang mau mendaftar NPWP, kami siap melayani di kantor Dispenda. Kami akan melakukan pendataan. Jika masih ditemukan ada usaha merek dagang yang belum terdaftar, maka akan kami berikan sanksi sesuai hukum pajak. Karena itu, kami imbau agar mau mendaftarkan NPWPm,” ujarnya. (m50)

Pencuri Kaca Spion Dihajar Massa MEDAN (Waspada): Dipergoki sedang mencongkel kaca spion mobil, seorang pria bertato yang belum diketahui identitasnya, nyaris dibakar massa di Jln. Gaperta, Kec. Medan Helvetia, Minggu (6/4) sekira pukul 10:00. Dalam kondisi tubuh berlumuran darah, pelaku dievakuasi oleh petugas Polsek Medan Helvetia ke Rumah Sakit Bhayangkara Medan. Informasi yang diperoleh di kepolisian, pagi itu korban bernama Budi, 35, warga Jln. Gaperta Medan, memarkirkan mobil Avanza BK 1314 KT di samping rumahnya tepat di depan SPBU. Dari layar monitor CCTV, korban melihat pelaku berdiri di dekat mobil sembari

melihat kiri-kanan sekaligus memantau situasi. Tidak berselang lama, pelaku mendekati mobil dan berusaha mencongkel kaca spion sebelah kiri mobil dengan menggunakan obeng. Namun, sebelum membawa kabur kaca spion tersebut, korban bergegas keluar dari rumah seraya berteriak maling. Pelaku langsung melarikan diri. Sejumlah massa mengejar dan menangkap pelaku. Massa yang emosi memukuli pelaku hingga babak belur dan berlumuran darah. Petugas Polsek Medan Helvetia yang tiba di lokasi langsung mengamankan pelaku. Namun, massa coba meng-

halangi sembari berteriak agar pelaku dibakar hidup-hidup. Petugas dengan cepat memasukkan pelaku ke mobil patroli dan kemudian memboyong pelaku ke RS Bhayangkara guna mendapatkan perawatan medis. “Pelaku sudah sempat mengambil kaca spion mobil. Tapi sebelum dia pergi aku lihat dari CCTV. Tak mau kecolongan lagi langsung aku kejar,” ujar Budi mengaku sudah empat kali kaca spion mobilnya dicuri. Menurut dia, baru kali ini langsung kulihat setelah pasang CCTV. “Jadi aku tidak mau kecolongan lagi,” tutur Budi usai membuat laporan pengaduan di Polsek Medan Helvetia. (h04)

Korupsi Alkes Labusel

Empat Terdakwa Dituntut 13,5 Tahun Penjara MEDAN (Waspada): Empat terdakwa korupsi pengadaan alat kesehatan (Alkes) dan Keluarga Berencana (KB) pada Dinas Kesehatan Kabupaten Labuhanbatu Selatan (Labusel), dituntut 13,5 tahun penjara dengan rincian 3 terdakwa masing-masing dituntut 3,5 tahun, dan 1 terdakwa dituntut 3 tahun. Keempatnya dinyatakan terbukti melakukan tindak pidana korupsi pengadaan Alkes tahun 2012 yang merugikan negara Rp12,275 miliar. Keempat terdakwa masingmasing mantan Kadis Kesehatan Labusel Rusman Lubis dituntut 3,5 tahun penjara. Dia juga dibebani denda Rp500 juta subsider 3 bulan kurungan dan membayar uang pengganti kerugian negara Rp475 juta. Bila tidak dibayar Rusman harus menjalani hukuman 1 tahun 9 bulan penjara. Terdakwa Syahrul’an selaku Pejabat Pembuat Komitmen (PPK) dituntut 3 tahun penjara dan denda Rp500 juta subsider 3 bulan kurungan. Dia juga dikenakan uang pengganti Rp150 juta. Namun, uang pengganti tersebut telah dititipkannya kepada Kejaksaan untuk diserahkan ke kas Pemkab Labusel. Dua terdakwa lainnya adalah rekanan proyek yakni Johan Winata dan Johan Tancho, dituntut masing-masing 3,5 tahun

penjara dan denda masingmasing Rp500 juta subsider 3 bulan kurungan. Selain dituntut kurungan badan dan denda, keduanya juga dibebani uang pengganti. Johan Winata sebesar Rp2,2 miliar dan telah dikembalikannya ke kas daerah. Sedangkan Johan Tancho dibebani uang pengganti Rp3,77 m. Dari jumlah itu, Johan Tancho baru menitipkan kepada Kejaksaan sebesar Rp2,35 miliar untuk diserahkan ke kas Pemkab Labusel. Terhadap sisa yang belum dikembalikan Johan Tancho sebesar Rp1,42 miliar, tidak disebutkan jaksa agar dikembalikan. Tuntutan tersebut dibacakan Jaksa Penuntut Umum (JPU) dari Kejati Sumut pada sidang di Pengadilan Tipikor Medan, Jumat (4/ 1) malam, dipimpin majelis hakim diketuai Jonner Manik. Keempat terdakwa dinyatakan JPU terbukti bersalah melanggar Pasal 3 jo Pasal 18 UU No 31 Tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi jo Pasal 55 ayat (1) ke1 KUHP. Mereka menyalahgunakan wewenang untuk menguntungkan diri sendiri atau orang lain atau suatu kooperasi dan merugikan negara. Khusus terdakwa Johan Tancho, selain melanggar UU Pemberantasan Tindak Pidana Korupsi, juga terbukti melang-

gar Pasal 3 UU Tindak Pidana Pencucian Uang (TPPU). JPU menyebutkan, Rusman Lubis bersama PPK Syahrul’an mengatur agar Tono alias Asia dan Johan Tancho yang menggunakan CV Cahaya memenangkan tender proyek pengadaan 32 jenis Alkes di Dinas Kesehatan Labusel. Padahal. mereka diketahui tidak berpengalaman dalam pengadaan ini. Na m u n , b a r a n g y a n g diadakan rekanan, di antaranya 3 unit refrigerator centrifuge MSP 4650 R Plus merek Presvac, tidak sesuai kontrak. Ditemukan sejumlah kekurangan, seperti baut rotor yang sudah aus dan goresan pada sisi cover. Jaksa menilai harga yang ditetapkan terlalu mahal. Bahkan, terdapat selisih signifikan antara harga pada faktur penjualan dengan harga pada kontrak dan harga perkiraan sendiri. Berdasarkan audit, nilai barang yang diterima Dinas Kesehatan Labusel hanya Rp5,777 miliar, sedangkan nilai yang dibayarkan Rp18,052 miliar. Akibatnya negara dirugikan Rp12,275 miliar. Menanggapi tuntutan JPU tersebut, keempat terdakwa dan penasihat hukumnya masingmasing menyatakan akan menyampaikan pembelaan (pledoi) pada sidang yang digelar pekan depan. (m38)

Laporan Khusus


WASPADA Senin 7 April 2014

H. Amri Tambunan Mengakhiri Masa Bakti Dengan Kepala Tegak Laporan H. Husni Siregar dan Rudhy Faliskan


APRIL 2014, Drs H.Amri Tambunan resmi mengakhiri masa bakti jabatannya sebagai bupati Del Serdang dua periode (2004- 2014). Periode pertama, H. Amri Tambunan- putra tertua mantan Gubernur Jambi H. Jamaluddin Tambunanitu dipilih sebagai bupati oleh anggota DPRD Deli Serdang pada sidang paripurna yang digelar di Gedung DPRD di Lubuk Pakam pada 3 Maret 2004, dan memperoleh 36 dari 45 suara anggota dewan. Dia berpasangan dengan Drs Yusup Sembiring (alm). Periode kedua, H.Amri Tambunan yang berpasangan dengan H.Zainuddin Mars menyabet sekitar 63 persen suara dari 1,2 juta pemilih di Deli Serdang. Bagi masyarakat luar Deli Serdang, suara yang diperoleh H.Amri Tambunan baik pada Pilkada periode pertama maupun Pilkada periode kedua sangat menakjubkan, tetapi bagi warga Deli Serdang, kemenangan yang diraih H.Amri Tambunan dengan perolehan suara yang fantastis adalah harapan mereka terhadap seorang pemimpin yang berjiwa membangun. Jika kita tilik ke belakang, sejak Kabupaten Deli Serdang dipimpin 12 bupati, pembangunan untuk mensejahterakan masyarakat jauh tertinggal. Infrastruktur jalan untuk melayani 1,7 juta jiwa penduduk dirasakan sudah tidak memadai. Apalagi Kabupaten Deli Serdang yang dikelilingi oleh daerah tingkat dua lainnya, seperti Kabupaten Serdang Bedagai, Kabupaten Simalungun, Kabupaten Tanah Karo, Kabupaten Langkat dan Kota Binjai memerlukan akses yang permanen. Oleh karena itu, kehadiran H. Amri Tambunan sebagai bupati yang berpasangan dengan DrsYusup Sembiring (2004-2009), disambut dengan tangan terbuka. Dan, bagi H. Amri Tambunan, jabatan bupati bukan hanya sekadar mencari popularitas seorang birokrat, tetapi ia membawa marwah dan nama keluarga besar H. Jamaluddin Tambunan. Sehingga dia tidak boleh gagal, apalagi warga Deli Serdang menganggap alumni APDN Medan Angkatan X itu bukan orang baru, tetapi lebih dari saudara dan sahabat. Niat tulus H. Amri Tambunan, ia datang dengan kepala tegak, ia harus pula mengkahiri masa bakti jabatannya sebagai bupati dengan kepala tegak. Tidak dengan kepala tertunduk. ‘’ Jika daerah yang saya pimpin hancur, bukan hanya rakyat yang hancur tetapi martabat keluarga besar saya ikut hancur’’. Itulah prinsip yang dipegang Drs. H. Amri Tambunan. Kalimat tersebut kerap diucapkan mantan Sekda Medan itu kepada staf , baik ketika rapat resmi maupun dalam acara - acara biasa. Bahkan, kepada para wartawan yang menjadi sahabat H.Amri Tambunan, kalimat itu juga selalu diucapkan pria kelahiran Tanjung Balai 23 Januari 1949 itu. Dengan makna yang dalam, jika dicermati, kalimat yang diucapkan H.Amri Tambunan itu bukanlah bentuk kesombongan , melainkan gambaran kebanggaannya setelah memimpin satu kabupaten yang besar yang di dalamnya hidup beragam etnis serta menjadi barometer Provonsi Sumatera Utara di segala bidang.

Pada hari ini, 7 April 2014, setelah 10 tahun memimpin (2004-2014) Deli Serdang, H. Amri Tambunan boleh bangga. Kalimat yang diucapkan bisa dibuktikannya. Mantan Kadis Infokom Provinsi Sumatera Utara itu mengakhiri masa bakti jabatannya sebagai kepala daerah di Deli Serdang dengan kepala yang tegak dan meninggalkan banyak prasasti pembangunan yang ditorehkannya bagi kemajuan warga yang mendiami tanah agraris ini. Selama sepuluh tahun memimpin, H. Amri Tambunan telah meletakkan fundasi pembangunan yang kokoh di Deli Serdang. Dalam kurun waktu 10 tahun, dari kondisi Kabupaten Deli Serdang yang nyaris kolaps karena belanja pembangunan dalam APBD tahun 2004, hanya tersisa Rp5 miliar setelah dipotong belanja pegawai, akibat terkuras oleh pemekaran Kabupaten Serdang Bedagai tahun 2003,H. Amri Tambunan mampu tampil sebagai seorang manajer yang sukses dalam mengurusi 1,7 juta jiwa penduduk. Pada periode pertama tahun kedua menjabat bupati 2004-2009, H. Amri Tambunan bekerja sendiri setelah Wakil Bupati Deli Serdang Drs Yusup Sembiring, meninggal dunia. Dia menata 22 kecamatan dan 403 desa/kelurahan dan tidak pernah surut. Sebagai manajer tunggal yang selalu dijuluki one men show, H. Amri Tambunan selalu melahirkan inovasiinovasi baru untuk menata 2.394,62 Km2 luas wilayah. Ia melahirkan Konsep Cerdas untuk pendidikan, melahirkan program Ceria untuk kesehatan, sehingga tersedia 20 unit Puskesmas Rawat Inap, Puskesmas Pembantu 106 unit, Poskesdes 108 unit, menurunkan angka kematian ibu melahirkan, menurunkan angka kematian balita dan meningkatnya usia harapan hidup masyarakat menjadi 70,8 tahun. Kesejahteraan lainnya adalah bedah sepuluh ribu rumah untuk warga miskin. Dari inovasi-inovasi itu, H. Amri Tambunan melahirkan GDSM (Gerakan Deli Serdang Membangun) untuk mempercepat pembangunan dan mengejar ketertinggalan selama ini. Sehingga dalam kurun waktu relatif singkat, Pemerintah Kabupaten Deli Serdang mampu membangun ruas jalan sepanjang 2000 kilometer lebih, sehingga panjang jalan Deli Serang saat ini sekitar 3700 kilometer. Sebagian besar sudah diaspal hotmiks dan sebagain lagi masih perkerasan.

BUPATI H. Amri Tambunan sedang memberikan arahan kepada Wakilnya H. Zainuddin Mars.Duet keduanya selama 5 tahun berjalan mulus tanpa intrik dan konflik.

Tak Ada Jual Beli Jabatan

Puluhan warga datang ke rumah dinas untuk mengucapkan terima kasih karena H. Amri Tambunan yang juga kader Partai Demokrat itu telah menorehkan sejarah pembangunan Deli Serdang. Menurut Kepala Dinas Cipta Karya Deli Serdang M Haris, dalam memimpin kabupaten yang cukup luas atau 3,34 persen dari luas Provinsi Sumatera Utara, H Amri Tambunan tidak lagi meletakkan kerangka tetapi sudah meletakkan karya nyata yang langsung dinikmati masyarakat .Pembangunan dilakukan merata. Sebagai ‘one men show’, banyak yang mengakui, gaya kepemimpinan H.Amri Tambunan dan kepribadiannya sama. Yakni sama-sama sulit dibaca. Buktinya, awal ketika dia ‘melahirkan’ Konsep Cerdas, program itu banyak mendapat tantangan. Setelah terlihat hasilnya, dukungan semua elemen mengerucut . Sehingga Konsep Cerdas tidak sekadar jargon atau motto atau simbol bagi satu seperti sekarang ini. ‘’ Tetapi, keberhasilan Konsep Cerdas membuat semua orang ikut dekat dan melibatkan diri tanpa diundang. Karena Konsep Cedas adalah gagasan yang luar biasa,’’ kata Prof. Ridwan Rangkuti dari USU. Demikian juga GDSM, yang semula dianggap tidak akan berhasil dan hanya iming-iming murahan seorang H.Amri Tambunan kepada warganya, justru dipuji dan dielu-elukan oleh kawan maupun lawan yang semula bersuara sumbang. Bayangkan saja, bagaimana bisa mempercepat pembangunan kalau dana APBD lebih besar untuk belanja pegawai dari-

pada belanja pembangunan. Ternyata, pembangunan infrastruktur jalan dan jembatan yang diprogram melalui GDSM dan didukung dengan sistem pengerjaan pola swakelola dengan melibatkan tiga pilar kekuatan telah dinikmati manfaatnya tidak hanya oleh warganya sendiri , tetapi juga bagi warga luar kabupaten. Lahirnya GDSM yang bertujuan membuka akses infrastruktur jalan untuk memudahkan dan menggerakkan roda perekonomian warganya merupakan niat tulus H.Amri Tambunan, yang kemudian disahuti Kadis PU Deli Serdang Ir.Faisal. Seperti membangun jalan di kolong rel kereta api di perlintasan Kelurahan Mandala, Kecamatan Percut Sei Tuan yang menjadi akses warga menuju Kota Medan. Selama ini akses di sana kerap macat jika kereta api melintas sehingga warga yang bekerja di Medan termakan waktu. Nah, dengan ditembusnya kolong rel kereta api, akses warga menjadi lancar. H.Amri Tambunan juga menggelontorkan APBD-nya untuk membangun jembatan yang menghubungkan Desa Tembung dan Kel. Mandala, untuk memudahkan warga yang hendak berurusan di kantor kecamatan di DesaTembung yang selama ini harus memutar sejauh 10 kilometer. Lalu, mengganti jembatan gantung yang membentang di Sungai Belumai kawasan Desa

BUPATI Deli Serdag H.Amri Tambunan didampingi Ketua PKK Hj. Anita Amri Tambunan saat meninjau pasar menjelang puasa.

Dalu X B, Kecamatan Tanjung Morawa, yang lebarnya 1,5 meter panjang 60 meter, dengan jembatan konstruksi beton lebar 4 meter panjang 60 meter. Jembatan gantung (kabel) tembus ke Kecamatan Lubuk Pakam, Kecamatan Tanjung Morawa dan Kecamatan Batang Kuis yang hanya bisa dilalui kendaraan roda dua itu merupakan peninggalan Belanda yang membuka perkebunan di Kecamatan Tanjung Morawa dan Kecamatan Batang Kuis dan sudah 12 bupati memimpin Deli Serdang, namun tidak seorang bupati pun yang memperhatikan sulitnya akses masyarakat dengan jembatan tersebut. Tetapi, alumni Institut Ilmu Pemerintahan (IIP) itu, melihat kesulitan warga.Apalagi dia pernah menjadi camat di Tanjung Morawa. Maka, dalam dua tahun mengemban jabatan bupati (tahun 2006), Amri mengganti jembatan gantung itu dengan konstruksi beton yang mampu mengurai kemacatan yang ini menjadi jalan alternatif dari dan menuju Bandara Kualanamu. Demikian juga jembatan lintas pesisir sepanjang 264 meter yang membentang di Sungai Ular antara Desa Denai Kuala, Kecamatan Pantai Labu, Deli Serdang- Desa Kota Pari, Kec. Pantai Cermin, Serdang Bedagai, yang dibangun dengan dana APBD Deli Serdang Tahun Anggaran 2010-2011, tidak hanya menjadi akses bagi warga kedua kabupaten tersebut, teta-

H. AMRI Tambunan dalam memimpin Kabupaten Deli Serdang telah menunjukkan sikap sebagai seorang birokrat dan pamong. Misalnya dalam mengangkat seorang staf. Seperti Kepala Dinas, Camat maupun lainnya selalu melihat dedikasi dan prestasi yang akan didudukkan. Sebab untuk memimpin Deli Serdang yang luas diperlukan staf dan mempunyai dedikasi, prestasi dan kemampuan. Satu hal yang sangat diharamkan oleh kader Partai Demokrat itu, yakni menerima imbalan dari jabatan atau istilahnya menjual jabatan.Oleh karena itu tidak ada istilah di Deli Serdang, tawar menawar jabatan atau berapa harga untuk satu kursi camat atau kursi kepala dinas. Hal ini diakui Prof. Ridwan Rangkuti dari USU. ‘’ Gaya kepemimpinan H.Amri Tambunan itu lain dari yang lain,’’ kata Prof Ridwan. Terutama dalam hal merekrut staf yang akan didudukkan sebagai pejabat eselon. ’’ Belum tentu orang yang dekat dengan dia diangkat seabagi staf,’’ kata Prof Ridwan dan menambahkan,dia akan melihat ke-profesionalan seseorang itu, kemudian dedikasi dan loyalitasnya.’’Semua menjadi tolak ukur,’’ katanya. Assisten I Pemerintah Kabupaten Deli Serdang H.Syafrullah S.Sos.MAP tidak membantah hal itu. ’’ Sebagai seorang birokrat, H. Amri Tambunan telah membawa suasana sejuk bagi para PNS di Deli Serdang,’’ katanya. Menurut Syafrullah, tata pemerintahan berjalan baik dan perekrutan staf yang akan didudukkan pada jabatan eselon II,III maupun eselom IV dilakukan secara professional dengan minta masukan dari Tim Baperjakat . ‘’ Ini jarang terjadi.Bahkan, berapa pun uang kita, kita tidak bisa membayar jabatan,’’ katanya. Hal yang sama dibenarkan H. Erwin NP. Ketua KONI Deli Serdang itu mengatakan, uang kita tidak akan laku kepada H.Amri Tambunan jika untuk membeli jabatan.Artinya, harga satu kursi eselon di Deli Serdang hanya dinilai dengan profesioanlisme staf yang akan didudukkan. H.Amri Tambunan juga tidak begitu saja lepas tangan untuk terus memantau kinerja stafnya. Dia akan tetap sebagai ‘ayah’ yang mengayomi dan membimbing serta mengasuh bawahannya untuk menjadi seorang staf yang benar-benar staf. Ironisnya, jika seseorang mencoba menawarkan uang untuk ‘membayar’ satu jabatan, jangan harap akan dapat jabatan sampai kapan pun. Begitu juga dengan perpindahan PNS dari Deli Serdang ke luar daerah, H.Amri Tambunan sebagai bupati tidak akan buru-buru menyetujuinya tetapi ia akan memberikan pandanganpandangan serta saran. Bahkan, jika belum pasti penempatannya, dia tidak akan member izin perpindahan bagi PNS tersebut. pi menjadi lintas pesisir yang menghubungkan Kab. Batubara dan Kabupaten Asahan. Karya-karya besar H.Amri Tambunan untuk daerahnya telah menuai banyak penghargaan secara nasional. Bahkan puluhan warga datang ke rumah dinas untuk mengucapkan terima kasih karena H. Amri Tambunan telah menorehkan prestasi dan sejarah pembangunan Deli Serdang yang akan tetap tercatat bagi masyarakat. Hal ini diakui, Ketua DPC HNSI (Himpunan Nelayan Seluruh Indonesia) Kabupaten Deli Serdang H.Rahmadsyah SH.’’ Bupati H.Amri Tambunan cukup peduli kepada rakyatnya. Lihat saja akses infrastruktur di kantong-kantong nelayan ditata dan dibangun.Ini tidak pernah kita temui dari pemimpin terdahulu,’’ kata Rahmadsyah yang juga anggota DPRD Deli Serdang dari Partai Kebangkitan Bangsa. Sebagai pamong, H.Amri Tambunan selalu menyapa

warganya dengan ‘tepuk bahu’. Kehadirannya selalu dieluelukan dan disambut meriah. Ini tak lain karena semangat membangun H.Amri Tambunan mampu merangkul tiga pilar kekuatan yakni, warga masyarakat, pengusaha dan pemerintah. Demikian juga kepada staf. ‘’ H. Amri Tambunan adalah seorang ayah, seorang guru dan seorang sahabat yang setia. Dia adalah seorang birokrat yang tidak tertandingi,’’ kata H. Syafrullah, S.Sos. MAP, Assisten I Pemerintah Kab. Deli Serdang. Hal yang sama diakui Zulkarnain Nasution, mantan Asisten II Pemerintah Kab. Deli Serdang.’’ H. Amri Tambunan (dalam memimpin) tidak bias dilawan. Kalau kita satu langkah, dua sudah empat langkah’’. Keberhasilan Deli Serdang juga ditunjukkan dari peranan PKK yang diketuai Hj.Anita Amri Tambunan, yang telah banyak memberikan motivasi bagi kemajuan kabupaten itu.

BUPATI Deli Serdang H.Amri Tambunan meninjau kehidupan nelayan di Hamparanperak.

Pemberdayaan bagi kaum perempuan serta pembenahan Dewan Kerajinan Nasional Daerah Deli Serdang telah menuai banyak penghargaan baik dari pusat maupun provinsi. Pada periode kedua kepemimpinannya, ketika banyak kepala daerah memimpin dari belakang meja. Tidak demikian dengan pasangan H.Amri Tambunan dan Wakilnya H.Zainuddin Mars. Keduanya terus bergerak. Bahkan, menjelang akhir masa jabatannya, H. Amri Tambunan terus mengunjungi desadesa, mengunjungi warganya. Jika Amri berhalangan, dia mengutus wakilnya H.Zainuddin Mars dan jarang sekali kunjungan ke desa diwakilkan kepada staf. Ini juga menunjukkan kekompakan keduanya dalam memimpin untuk tetap dalam bingkai kebersamaan tidak cuma slogan tetapi adalah bukti. Sehingga suasana Deli Serdang dalam kurun waktu sepuluh tahun ini cukup kondusif. Setelah sepuluh tahun memimpin Deli Serdang, Drs H. Amri Tambunan yakin fundasi yang dibangunnya dilanjutkan oleh pasangan Azan (H.Ashari TambunanH.Zainuddin Mars) yang maju dengan motto: Deli Serdang Yang Maju Dengan Masyarakatnya Yang Relijius dan Bersatu Dalam Kebhinnekaan. Jika sepuluh tahun lalu H.Amri Tambunan datang dengan kepala tegak dan membusungkan dada, hari ini ia mengakhiri masa jabatan dan meninggalkan kantor yang dibangunnya dengan sikap yang sama. Semua itu adalah makna bahwa saat ia datang mengucapkan salam dan pergi juga mengucapkan salam.(###)

Laporan Khusus

WASPADA Senin 7 April 2014


GDSM Adalah Program Pro Rakyat S

UKSES dengan Konsep Cerdas, ternyata belum puas bagi H. Amri Tambunan. Sebagai seorang pamong, ia ingin berbuat lebih banyak. Terutama untuk meningkatkan kesejahteraan masyarakat yang dianggapnya bukan lagi sebagai rakyat tetapi lebih sebagai kerabat atau saudara. Dan, hal ini harus dia wujudkan. Wilayah Deli Serdang yang sangat luas, terdiri dari daerah pertanian, perkebunan, kelautan dan industri, tidak mungkin mengandalkan infrastruktur seperti yang ada. Infrastruktur (jalan dan jembatan serta irigasi) harus dibangun permanen. Banyak warga Deli Serdang mencari nafkah ke Medan. Dari mulai tenaga pendidik, pekerja bangunan, pedagang, pegawai perkantoran swasta, pegawai negeri sampai pekerja rumah tangga maupun buruh pikul menumpukan hidup mereka ke Medan.Tentu, mereka memerlukan akses jalan yang baik dan permanen untuk mempercepat waktu tempuh. Juga hasil pertanian, peternakan, kelautan dan lainnya yang dihasilkan dari Deli Serdang, yang pasarnya adalah Medan sebagai ibu kota Provinsi Sumatera Utara. Bagaimana mungkin warga dari Kecamatan Batang Kuis, Kecamatan Tanjung Morawa, Patumbak, Delitua, yang bekerja atau memasarkan hasil ke Medan, yang berjarak belasan

BUPATI Deli Serdang H. Amri Tambunan saat menerim Piala Adipura dari Presiden Susilo Bambang Yudhoyono di Istana Negara tahun 2012. kilometer, bisa cepat jika hanya dilayani dengan satu ruas jalan yang sempit,padat dan sering macat berjam-jam. Dari kepadatan arus lalu lintas itu, kerap terjadi kecelakaan yang sering menelan korban jiwa. Belajar dari kondisi ini, seki-

tar pertengahan 2007, H. Amri Tambunan selaku bupati menggelontorkan GDSM (Gerakan Deliserdang Membangun). Tujuannya untuk percepatan pembangunan di Deli Serdang, yang sudah jauh tertinggal. Percepatan pembangunan

SALAH seorang warga nampak terharu saat menerima hadiah bedah rumah dari Bupati H.Amri Tambunan.

yang dipacu melalui GDSM telah menghidupkan semua sektor. Harga Tanah yang semula hanya puluhan ribu rupiah permeter, kini melonjak tajam bahkan melebihi harga tanah di Medan. Apalagi Kab. Deli Serdang

diuntungkan dengan hadirnya Bandara Kuala Namu (Kualanamu International Airport), sehingga ekonomi masyarakat di wilayah lingkungan Bandara naik secara signifikan. GDSM juga memacu sektor pertanian. Tahun 2013, luas iri-

gasi yang ditangani, yakni saluran irigasi primer sekitar 104,118 Km, saluran skunder 56,290 Km dan saluran pembuang 9,97 Km dengan luas areal persawahan 23 hektar. Para tokoh masyarakat, seperti H.Waluyo yang juga ketua

SELAMA kepemimpinan H.Amri Tambunan, penataan RSUD Lubuk Pakam semakin baik sehingga dapat memberikan pelayanan maksimal.

DPD Muhammadiyah Deli Serdang, Eksponen ’66 Sulaiman Nasution, H. Bahana Siregar dari Tanjung Morawa, H. Erwin NP dan tokoh muda H. Ibnu Hajar maupun H. Tarmuji dari Desa Nogorejo, Kec. Galang, mengakui keberhasilan GDSM

karena terbukti mampu meningkatkan perekonomian warga. GDSM pun bergulir.Jalan lingkar dan jalan tembus sebagai akses ke semua daerah yang mengelilingi Deli Serdang, serta ruas jalan yang menghubungkan antar kecamatan, antar desa atau antar dusun dibuka. Seperti yang dikatakan Kadis PU Deliserdang Ir. Faisal kepada Waspada di Lubuk Pakam, belum lama ini. ‘’Untuk meningkatkan ekonomi masyarakat Kab. Deli Serdang, idealnya panjang jalan yang ada sekitar 4.000 kilometer’’. Saat ini akses jalan yang tersedia sekitar 3.700 kilometer. Dengan terbukanya akses jalan tersebut, pertumbuhan ekonomi terlihat pesat. H.Amri Tambunan berharap banyak dari GDSM untuk menjawab ketertinggalan Deli Serdang . Dan, saat ini H. Amri Tambunan telah melihat geliat ekonomi warga telah bangkit. Menggebunya sambutan terhadap GDSM untuk infrastruktur jalan, membuat warga merelakan tanah mereka diambil secara cuma-cuma untuk pelebaran atau pembangunan jalan tanpa diberi ganti rugi. Dan, jika dihitung nilainya mencapai Rp225 miliar. Sesuatu yang langka pada zaman ini. GDSM adalah program pro rakyat untuk merupakan percepatan pembangunan yang merata . Tidak ada anak kandung atau anak tiri, baik daerah pesisir, pegunungan atauperkotaanporsinyasama.

BUPATI Deli Serdang H Amri Tambunan turun langsung menyaksikan gotong royong pembukaan jalan poros desa di Kec. Namorambe.

Membangun Dari Kas Yang Kosong 7 APRIL 2004, sepuluh tahun silam Drs H.Amri Tambunan- Drs Yusup Sembiring dilantik oleh Gubernur Sumatera Utara atas nama Presiden sebagai Bupati dan Wakil Bupati Deli Serdang periode 2004-2009. Pelantikan yang digelar dalam sidang paripurna DPRD setempat disambut sukacita oleh warga kabupaten dengan luas 2.394,62 Km2, tersebut, karena sosok H.Amri Tambunan, diyakini mampu membawa warga kea rah yang lebih baik. Apalagi, H.Amri Tambunan yang memulai karir dari bawah itu telah didaulat oleh warga menjadi penduduk Tanjung Morawa, di mana dia pernah mengemban jabatan camat di daerah itu sekitar tahun 1986. Banyak harapan warga yang ditumpahkan di pundak H.Amri Tambunan. Antara lain infrastruktur jalan sebagai akses warga untuk meningkatkan ekonomi dirasakan sudah tidak layak bagi warga yang mencari nafkah ke Medan. Sebagai daerah pertanian, perkebunan dan kelautan, kondisi jalan yang ada membuat banyak kendala pemasaran hasil bumi dan hasil laut.Hal ini memberi peluang pedagang pengumpul atau tengkulak menetapkan harga sesuka mereka. Ketika H. Amri Tambunan menduduki jabatan Assisten II/Ekonomi dan Pembangunan Pemerintah Daerah Deli Serdang pada zaman Bupati H. Ruslan Mansyur (alm) sekitar tahun 1990-an, gaga-

san besar pernah ditorehkan putra pejuang itu, yakni membenahi jalan lintas pesisir dari Kec. Hamparan Perak hingga perbatasan Kab.Asahan sebelum pemekaran Deli Serdang dan Serdang Bedagai tahun 2004, melalui alokasi dana Bantuan Daerah Bawahan (BDB). Terbukti akses tersebut memperpendek jarak tempuh masyarakat pesisir dan memberikan peluang yang menjanjikan. Dan, ketika H. Amri Tambunan – Drs Yusup Sembiring (alm) yang politisi Partai Golkar itu dilantik menjadi pemimpin di Deli Serdang, impian keduanya dan impian warga hampir sama, yakni membuka akses untuk pertumbuhan ekonomi, pendidikan dan kesehatan. Ternyata, pada tahun pertama menjabat, semua bertolak belakang. Dana Anggaran Pendapatan dan Belanja Daerah (APBD) Deli Serdang, yang tersisa hanya Rp5 miliar setelah dipotong belanja pegawai. Apa yang bisa dibanggakan dengan uang sebesar itu bagi kabupaten yang cukup besar seperti Deli Serdang? Terkurasnya APBD karena pemekaran Kab. Serdang Bedagai dan Kabupaten Deli Serdang sebagai kabupaten induk harus pontang panting menutupi keuangannya. Tetapi bagi seorang H.Amri Tambunan tidak begitu saja menyerah. Sesuai visi dan misinya: membangun dalam kebersamaan, H.Amri Tambunan akan tetap tegar dan berjalan. Dia tidak menyerah. Dia harus sukses sebagai seorang manajer. Kelak, jika masa jabatannya berakhir, H.Amri Tambunan akan meninggalkan kantornya dengan

SALAH satu ruas jalan yang dibangun melalui program GDSM untuk memudahkan akses masyarakat.

kepala tegak. Langkah pertama adalah membenahi dunia pendidikan atau sekolah.Karena dari sekolah akan lahir seorang petani yang tangguh, dari sekolah akan lahir seorang prajurit pemberani dan dari sekolah akan lahir seorang pemimpin bangsa yang berkualitas dan mampu menjadi panutan bangsa dan negaranya. Itulah kalimat yang selalu diucapkan H.Amri Tambunan. Tetapi, bagaimana bisa membenahi gedung-gedung sekolah yang tidak lagi layak digunakan jika belanja pembangunan hanya tersisa Rp 5 miliar?. Saat itu, muncul riak-riak yang menuding kepemimpinan H.Amri Tambunan lamban dalam membenahi Deli Serdang. Di tengah riak-riak itu,ketegaran H.Amri Tambunan bangkit dan tak bisa ditawar. Birokrat sejati dan bukan orang asing di Deli Serdang itu punya banyak sahabat. Dan, teman-teman lama yang dahulu hilang dirangkul kembali. Lalu, dari sana timbul ide-ide yang brilian sehingga lahirlah Konsep Cerdas (Percepatan Rehabilitasi dan Apresiasi terhadap Sekolah),yang awalnya dimulai dari sebuah SD Negeri di Desa Bandarklippa,Kecamatan Percut Sei Tuan. Melalui gotong royong pendidikan, Konsep Cerdas sukses dengan melibatkan tiga pilar kekuatan.Yakni warga masyarakat yang tidak terbatas, pengusaha dan pemerintah (Pemkab Deli Serdang).Lalu, diciptakan satu wadah permanen: Gerakan Masyarakat Peduli Pendidikan (GMPP). Tentang Konsep Cerdas ini, ada yang paling sulit dilupa-

kan H.Amri Tambunan sebagai bupati, yakni ketika diadakan gotong royong pendidikan merehab dan membangun satu lokal di salah satu SDN di Desa Bagan Percut,Kec.Percut Seituan, seorang penjaja sayur keliling tergerak untuk menyumbangkan beberapa ikat sayur setiap hari untuk makan para tukang. Hal ini dia lakukan karena dia tidak punya uang untuk menyumbang dalam Gotong Royong Pendidikan itu tetapi simpatinya muncul terhadap sosok H.Amri Tambunan, karena selama ini perempuan penjaja sayur itu belum pernah bertemu dengan pejabat (Bupati-Red), yang dengan ikhlas mengajak warganya untuk bergandeng tangan membangun untuk rakyat. Keikhlasan hati seorang pedagang sayur itu membuat H.Amri Tambunan makin tegar, sehingga ia tidak lagi berkeluh kesah tentang dana pembangunan yang minim. Dalam kebersamaan itu, Amri banyak dipuji. Semua elemen terlibat dalam Konsep Cerdas. Seperti Pertamina, PTPN III, Jamsostek, dan para pengusaha seperti H. Anif dan Datuk Ferry dari Kecamatan Sunggal. Dan, ketika pemerintah menargetkan rehabilitasi semua SD Negeri di Indonesia tahun 2009, H. Amri Tambunan menggaransi semua SD Negeri di Deli Serdang siap pakai tahun 2007.


B6 Kita Kawal Masa Tenang Tangkap Serangan Fajar



Faks 061 4510025

Facebook Smswaspada

+6285260088842 Hallo WASPADA. -(z@s)- Mengapa menjelang pemilu di Aceh rusuh dan anarkis ?. Karena prajurit teri/pion di kasih satu stel seragam loreng pakai kacamata +6283194817681 TERKENANG- KENANG AWAK KEPADA PASSANGER DAN PLANE MARK “ADAM AIR” YANG “MENYELA M” DI LAUT SULAWESI , jika di syi’ ar kan Berita ikhwal “MH -370 “ kerajaan Mal aya punya , yan g hingga kini , beritanya masih serba MAY BE... !# turut berduk a nestapa ~ ttd. kr.sikameng # +6281375296443 PBB menyatakan pisahnya Krimea dari Ukraina tidak sah, kenapa pencaplokan Israel atas tanah Palestina kok malah di backup dgn deklarasi Balfour, kenapa TimTim begitu mudah nya lepas dari Indonesia, kenapa dulu ketika Irak dgn rencana menganeksasi Kuwait kok cepat sekali ditumpas? Jelas lah PBB masih terus dibawah kendali AS +6281375644954 Malaysia sangat berhati-hati memberikan statement dalam suatu masaalah beda dengan Indonesia semuanya pandai becakap +62819648607 Iklan di tv; “KOQ BABLAS JIN”...JUJUR KAN..? +6282167170674 Saya sangat sedih sekali kenapa Provinsi ACEH tidak pernah jauh dari konplik padahal ACEH manusianya agamis.kekerasan dalam ajaran agama tidak boleh.kalau hanya sekedar di bibir nanti menjadi munafik.mulai saat ini ACEH manusia kembali ke ajaran agama ingat bala akan datang kembali dari ALLAH/Tsunami. +6281360633309 Saya pembaca setia WASPADA tolong muat segera. Kami dari masyarakat ACEH mau Tanya kepada POLISI jajaran ACEH kenapa teror OTK di ACEH tak bisa terungkap apabila kena angota partai atau rakyat biasa. Tapi apabila kena angota kepolisian dalam semingu bisa terungkap tak kira OTK atau TERORIS mengapa begitu..(SIGLI) +6281265956978 Pembela2 satinah cuma mencari popularitas di negara demokrasi ini yg tengah musim kampanye, coba pikir, ngapain di bela seorang pembunuh, dgn harus bayar diat sampai 1 M lebih, kalau di bayar, besok 1000 satinah lain akan meminta hal yg sama. Lebih bagus dananya untuk fakir seperti Aisyah, dan anak2 gelandangan indonesia! +6285372860019 Kepada,kanwil kementerian agama sumatera utara,kenapa pesantren modren nurul hakim tembung,sudah jelas 2, yayasannya ilegal (tidak terdaptar),tidak memili ki ijin operasional,dan ijin domisili,namun kanwil bukannya menutup,malah membiarkannya,apakah uu no,16tahun2001/uu no28 tahun2004,sudah tidak berlaku,se hingga kanwil tidak mengambil tindakan utk yayasan tersebut +6285260464487 Pmadaman listrik di mulai lagi meski hanya sesekali karena krisis listrik. Sudah saatnya indonesia sebagai negara maju di asia tenggara menggunakan nuklir sebagai pemasok energi listrik di bumi nusantara tercinta. +6282141681498 Hei TRTB apa kerja kelian. Bangunan 4 unit di Jl. Tangguk Bongkar II tidak ada IMBnya kenapa tidak ditindak ? Sudah terima duit ? Percuma kalian digaji dengan uang rakyat, tapi lebih senang terima latknat Allah. +6285262896270 Masukan buat KPU : untuk menghindari money politik dan tingginya biaya kampanye para caleg, sebenarnya KPU bisa ambil peran, yaitu dgn menerbitkan buku yg berisi profil dan track record tiap caleg, kemudian dibagikan kepada tiap kepala keluarga, biayanya minta aja dari partai atau caleg. Jadi gak perlu l agi baliho2 bertebaran di jalan. Bikin sakit mata melihatnya. +6285260969792 Mari kita pilih wakil wakil penipu rakyat.

Senin 7 April 2014

Dekonsentrasi Kehutanan 2014


Berakhir sudah kampanye terbuka pemilu legislatif, Sabtu (6/4), dan kini semua parpol wajib menjaga situasi keamanan di masa tenang supaya kondusif menuju hari pencoblosan, Rabu (9/4). Pemerintah berharap seluruh parpol bisa mempertahankan situasi aman yang selama kampanye berlangsung, sudah terjaga dengan baik. Tapi, kalau ada parpol yang masih tetap melakukan aktivitas kampanye –walau secara diam-diam atau sembunyi-sembunyi—situasi aman akan sulit terwujud. Sebab, parpol lainnya akan melakukan aksi serupa. Justruitu,perananKPUdanBawaslu/Panwaslumenjadipentinguntukmenindaklanjuti setiap pelanggaran yang terjadi di masa kampanye maupun di masa tenang selama tiga hari. Jika KPU dan Panwas tegas kita yakin kondisi keamanan bisa terjaga dengan baik. Hal serupa juga harus dilakukan pemerintah pusat dan daerah untuk bertindak netralterhadapsemuaparpol.DanbersamaTNIsertaPolribahu-membahumengupayakan seluruh logistik pemilu sudah sampai di semua daerah. Harapan pemerintah sebagaimana diutarakan Menko Polhukam Djoko Suyanto kemarin setiap partai politik suIntisari: dah berupaya maksimal untuk mengam‘Serangan fajar dan politik panyekan visi dan misinya dan mengawal untuk tetap menjaga keuang merusak demokrasi, konstituennya amanan dan ketertiban. Kondisi serupa kita harap seharusnya mengancam masa depan juga dilakukan di masa tenang hingga 240 juta rakyat Indonesia’ pasca pemungutan suara Rabu (lusa). Walaupunpartainyakalah,walaupunjagojago calegnya kalah, tetap menghargai hasil pemilu karena sudah berjalan dengan baik. Hal ini juga dikatakan Presiden SBY agar semua parpol dan caleg siap menang dan siap kalah. Jangan marah, jangan ngamuk jika kalah karena dalam pesta demokrasi yang menentukan adalah rakyat. Hematkita,mengharapkanmasatenangbenar-benartenangsehinggasemuapengurus parpol menaati aturan main yang sudah digariskan KPU sepertinya sulit tercapai, mengapa? Sebab, sebagian masyarakat kita belakangan ini cenderung berpikiran irasional, tidak kritis, dan cenderung pragmatis dalam menentukan pilihannya. Tapi, rakyat juga tidak bisa disalahkan karena situasi dan kondisi perpolitikan kita memang masih belum dewasa. Aturan mainnya sudah dibuat namun pengawasannya lemah sehingga masuk ke areal abu-abu. Kalau bermunculan aksi money politics dalam masa kampanye lalu hal itu sepertinya biasa-biasa saja. Terbukti, KPU dan Bawaslu/ Panwaslu tenang-tenang. Hanya sebagian kecil saja kasus money politics ditindaklanjuti. Padahal, membuktikan politik uang tidak sulit karena sudah menjadi pemandangan biasa di masyarakat, baik di kota maupun di daerah pedesaan. Lihat saja di masa kampanye pada umumnya para peserta dibayar. Kalau tidak berani membayar massa risikonya kampanye sepi. Mengharapkan masyarakat umum mau datang, sepertinya sulit kecuali ada aksi hiburan artis. Justru itu, rata-rata massa yang datang meramaikan kampanye menerima uang walaupun disebut untuk biaya transportasi, dapat kaos, dapat makan-minum dan rokok. Pemberiannya juga terang-terangan, bisa difoto. Tidak sulit mengorek pengakuan massa. Saat parpol dan caleg melakukan blusukan juga diwarnai pemberian uang, pemberian barang, makanan-minuman dll. Semuanya dilakukan terbuka dan masiv untuk mengajak massa mencoblos dan memenangkan parpol dan caleg tertentu. Di masa tenang ini pun bisa terjadi hal serupa. Di permukaan terlihat tenang, namun di bawah secara diam-diam parpol dan caleg ‘’sibuk’’ melakukan aksi serangan fajar, langsung mendatangi pemilih secara ‘’door to door’’ agar tidak lari dan tidak golput. Maraknya aksi politik uang dan serangan fajar dalam pesta demokrasi pilkada dan pemilu erat kaitannya dengan munculnya sikap kecewa dari masyarakat terhadap hasil pilkada dan pemilu selama ini, termasuk pilpres yang tidak memberi makna dan perubahan buat mereka. Bahkan di sejumlah daerah warga membuat spanduk yang isinya‘’membuka diri untuk serangan fajar’’ saking marahnya pada hasil pilkada dan pemilu lalu. Para wakil rakyat hanya peduli saat kampanye, setelah duduk malahan korupsi dan memperkaya diri pribadi dan kelompok maupun partainya saja. Kita harapkan KPU, Panwas, dan Kepolisian benar-benar siaga di masa tenang ini. Mari kita kawal jalannya masa tenang dan hari pencoblosan nanti. Kalau tidak, kondisi keamanan kondusif bisa berubah panas dan membahayakan saat hari pencoblosan, 9 April nanti. Kuncinya ada di tangan kita, khususnya aparat keamanan harus sigap dan bertindak tegas melakukan penangkapan jika melihat aksi-aksi serangan fajar dan politik uang di masa tenang menuju hari-H pemilu 2014. Sebab, aksi tersebut merusak demokrasi, mengancam masa depan 240 juta rakyat Indonesia.+


Oleh Henri Manik Gubernur selaku wakil pemerintah, hendaknya melaksanakan kegiatan identifikasi dan inventarisasi permasalahan tenurial kawasan hutan


ulisan kecil ini ditujukan kepada 33 Gubernur Pemprov di Indonesia.Secaradefakto,dekonsentrasi kehutanan sudah dilaksanakan 6 kali mulai 2008 sampai dengan 2013. KemenhutmembuatPermenhutsetiaptahun tentang dekonsentrasi kehutanan. Untuk tahun 2014, diterbitkan Permenhut No.P.1/ Menhut-II/2014 tanggal 6 Januari 2014. Isinya tentang pelimpahan sebagian urusan pemerintahan (dekonsentrasi) bidang kehutanan 2014, kepada 33 Gubernur selaku wakil pemerintah. Mengevaluasi kegiatankegiatan yang lalu, dirasakan belum optimal pelaksanaan dan hasil-hasilnya. Sehingga banyakpemikiranmengatakan,dekonsentrasi kehutanan 2014 sepertinya antara “das sollen das sein”. Merupakan secercah harapan dan kenyataan. Ada ungkapan teori ilmu hukum mengatakan, kesenjangan itu sebenarnya di antara harapan dan kenyataan. Das sein adalah sebuah realita yang telah terjadi, sedangkan dassollenadalahapayangsebaiknyadilakukan sehubungan dengan kesenjangan. Seperti sebuahimpiandalamduniautopiayangmenjadi keinginan atau harapan setiap manusia, kelompok atau organisasi. Das sein sebagai sebuah realita yang telah terjadi, semestinya melaporkan realita kebijakan dekonsentrasi kehutanan yang sudah dilaksanakanbeberapatahunlalu.Sedangkan das sollen seharusnya dapat menguraikan, apa yang sebaiknya dilakukan pada dekonsentrasi kehutanan 2014. Dapat diartikan, implementasi das sollen, mestinya memperhatikan isi das sein. Kenyataan, fungsi das sollen hanya dilakukan Kemenhut. Bukti realitanya, setiap tahun diterbitkan Permenhut pelaksanaan dekonsentrasi kehutanan. Isinya mengenai jenis-jenis kegiatan yang dilimpahkan ke gubernur. Mestinya penentuan jenis kegiatan, secara penuh diberikan wewenang kepada gubernur selaku wakil pemerintah. Namun tentu saja harus menguasai permasalahan kehutanan di daerahnya. Dekonsentrasi bidang kehutanan sudah dilaksanakan mulai tahun 2008 sampai 2013.

Semua kelihatannya masih bersifat keproyekan dengan bentuk dana alokasi khusus (DAK). Secara numerik tolok ukur keproyekan, realisasi penyerapan DAK Kehutanan untuk seluruh Indonesia sangat fantastik. Contoh mulai 2008 sampai 2013, realisasi rata-rata penyerapan DAK kehutanan daerah di seluruh Indonesia antara 76,38 - 89,92%. Nilainominalrata-rataDAKyangdianggarkan antara100miliarsampaidenganRp600miliar. Namun bila dilihat dari sisi capaian output fisiknya, belum terlihat nyata—seperti apa bentuk hasilnya di lapangan. Hal ini terlihat dalam sajian progres capaian output (fisik), tidak dilaporkan dengan jelas dan penyampaian laporan sering terlambat. Di tahun 2014 ini, Kemenhut kembali melimpahkansebagianurusanpemerintahan di bidang kehutanan kepada 33 gubernur. Bukti perwujutannya telah diterbitkan Permenhut No.P.1/Menhut-II/2014 tanggal 6 Januari 2014, yang ditujukan kepada 33 gubernur. Besarnya DAK bidang kehutanan yang dikucurkan Rp558,46 miliar (naik 3,5 persen) dari tahun 2013 (Rp539,42 miliar). Jumlah jenis kegiatan yang dilimpahkan sebagaimana Permenhut di atas, bervariasi untuk 33 gubernur. Aceh 31 jenis kegiatan, Sumut 36, Sumbar 35, Riau 36, Kepri 27, Jambi 34, Sumsel 33, Bangka Belitung 35, Bengkulu 36, Lampung 35, Banten 21, DKI Jaya 22, Jabar 28, Jateng 35, DIYogyakarta 25, Jatim 31, Bali 29, NTB 29, NTT 29, Kalbar 38, Kalteng 36, Kalsel 33, Kaltim 34, Sulawesi (Utara) 36, Sulawesi (Tengah) 38, Sulawesi (Tenggara) 36, Sulawesi (Selatan) 36, Sulawesi (Barat) 36, Gorontalo 33, Maluku 34, Maluku Utara 35, Papua 32, dan Papua Barat 28 jenis kegiatan. Jumlah jenis kegiatan tersebut menunjukkan banyaknya permasalahan kehutanan di Indonesia. Menganalisa hal tersebut, mestinya gubernur secara bijak dapat menentukan skala prioritaskegiatandenganmenyesuaikanjumlah anggaran yang diterimanya. Karena sudah dipastikan, jumlah anggaran setiap gubernur, tidakakansebandingdenganbanyaknyajenis kegiatan yang dilimpahkan. Sebab itu, jenis

kegiatan yang dipilih, mestinya dilakukan prioritas secara selektif dan transparan. Gubernur selaku wakil pemerintah, hendaknya melaksanakan:(1).“Kegiatan identifikasi dan inventarisasi permasalahan tenurial kawasan hutan”. Kegiatan ini bermaksud, mengumpulkan informasi secara langsung di lapangan, terhadap permasalahan tenurial kawasan hutan. Dan mengidentifikasi permasalahan yang terjadi saat ini di lapangan. Kegiataninisangatpenting,karenadisamping menyangkut persoalan hidup masyarakat, juga terkait kejelasan esensial dan spesifik “tataruanghutan”,dalamrangkapenanaman investasi; (2).“Kegiatan sosialisasi batas kawasan hutan di daerah”. Dimaksudkan memberikan informasi publik, mengenai perkembangan proses tata batas pengukuhan kawasan hutan (dapat berupa penunjukan, hasil tata batas, dan hasil penyelesaian penetapan suatu kelompokhutan/arealkawasanhutan).Diharapkan hasil sosialisasi, menjadi media untuk mendapatkan aspirasi, tanggapan dan masukan dari stakeholder. Hal ini dapat dilakukan dengan forum diskusi dan tanya jawab. Kesepakatan dan kesepahaman menjadi tujuan akhir ; Urutan prioritas berikutnya; (3).Identifikasikondisitapakkawasanhutan;(4).Monitoring/evaluasi penggunaan kawasan hutan; (5). Pengamanan hutan; (6).Penyusunan neraca sumber daya hutan (NSDH) yang akuntabel dan seterusnya. Selanjutnya, terkait permasalahan pemberdayaan masyarakat sekitar hutan, gubernur hendaknya melakukan urutan prioritas:(1).Kegiatan fasilitasi penetapan areal kerja dan Perizinan Hutan Kemasyarakatan (HKm). Kegiatan ini bertujuan, untuk membantu proses penetapan areal kerja dan perizinan HKm oleh kabupaten/kota. Indikator keberhasilan kegiatan ini adalah:(a).terfasilitasinya pembentukan kelompok masyarakat dan pembuatan usulan areal kerja HKm oleh bupati/wali kota kepada Menhut;(b).terbitnya izin usaha pemanfaatan Hkm oleh bupati/wali kota pada kawasan yang sudah ada penetapan areal kerjanya; (2).Sosialisasi kebijakan HKm. Kegiatan ini bertujuan untuk membantu proses penyebarluasan informasi kebijakan HKm di kabupaten/kota. Indikator keberhasilan kegiatan ini adalah:(a).meningkatnya pemahaman para pihak terhadap kebijakan HKm; (b).meningkatnya usulan HKm oleh bupati/wali kota. Urutan prioritas berikutnya; (3).Pembinaan dan pengendalian

HKm;(4).Fasilitasi dan penetapan areal kerja dan perizinan hutan desa; (5).Pembinaan dan pengendalian hutan desa;(6).Sosialisasi kebijakan hutan desa;(7).Fasilitasi pengembangan kemitraan hutan rakyat;(8).Fasilitasi penetapan dan pengembangan hasil hutan bukankayu(HHBK)unggulan;(9).Pembinaan penyuluhan kehutanan, di antaranya : penyelenggaraan kampanye Indonesia menanam, pelatihanketerampilanmasyarakat,pelatihan peningkatankapasitasSDMpenyuluhankehutanan, koordinasi dan konsultasi penyuluhan kehutanan, administrasi kegiatan dekonsentrasi penyuluhan kehutanan, dan seterusnya. Melihat banyaknya jenis kegiatan yang dilimpahkan, dan memperhatikan ke depan kesibukan kegiatan Pileg dan Pilpres di tahun 2014 ini, mestinya gubernur segera melakukan koordinasi yang sinergis. Dengan sistem koordinasi sinergis dan transparan, kegiatan dibagi habis pada masing-masing SKPD/ Satker, sesuai tupoksinya. Contoh butir-butir jenis kegiatan yang dilimpahkan, terkait masalah tata ruang kehutanan. Dinas Kehutanan Provinsi sebagai peran utama yang bertanggungjawab. Selanjutnya terkait permasalahan pemberdayaan masyarakat sekitar hutan, harus dikaji secara selektif, mana yang harus ditanganiBakorluh,danmanapulayangharus ditangani oleh Dinas Kehutanan. Intinya, harus jelas pada masing-masing tugasdanfungsinya.Koordinasisinergisterkait jenis kegiatan peran Unit Pelaksana Teknis (UPT) Pusat yang ada di daerah—tentu sangat membantu dalam setiap tahapan penyelesaian masalah. Contoh UPT Pusat: BPKH, BPDAS, BBKSDA/BBTN, Badan Diklat/Balai Diklat Kehutanan. Permenhut No.P.1/Menhut-II/2014 tentang Pelimpahan Sebagian Urusan Pemerintahan Bidang Kehutanan Tahun 2014 ini, mestinya menjadi tolok ukur kinerja kepada 33 Gubernur Pemprov di Indonesia. Aturan main, Permenhut No.P.1/Menhut-II/2014 dan Permenhut No.P.3/Menhut-II/2014 Tentang Juknis Dekonsentrasi Bidang Kehutanan Tahun 2014 cukup jelas. Amanah pada visi misi Kemenhut dengan visi misi Pemprov diseluruhIndonesia, mestinyamenjaditujuan “das sollen das sein”. Dengan demikian pertanyaan:“Siapkahmelaksanakanamanah dekonsentrasikehutanan2014?”.Jawabannya ada di tangan gubernur selaku wakil pemerintah. Masyarakat akan menunggu hasilnya.. Penulis adalah Pengajar/Widyaiswara Madya BDK Pematangsiantar.

Kemiskinan Di Peta Politik 2014 Oleh Rahmat Syarif Anggaran kemiskinan 2014 Rp14 T, bila tidak dibingkai komitmen kuat,berpotensi membuat masyarakat terperosok ketergantungan—mengingat dana ini bersumber pinjaman luar negeri


ahun 2014 digadang-gadang menjadi tahun yang penuh dinamika, baik dari dimensi politik, sosial, ekonomibahkanmerambahkedimensi keamanan. Gambaran tahun 2014 ini menjadi begitu menyeramkan sekaligus menjanjikan. Menyeramkan ketika kita membayangkan bila “kekacauan” terjadi pada pelaksanaan Pemilu (yang menjadi ikon 2014) baik dari aspek proses apalagi hasil yang tidak diharapkan. Menjanjikan bila kita berimajinasi bahwa prosesPemilutersebutberjalansangatdemokratis yang pastinya bermuara pada hasil yang dapat diterima semua pihak. Ditambah lagi, pada pra kondisi Pemilu biasanya bermunculan“kebaikan-kebaikan”sosialsepertijamur di musim hujan. Karena tiba-tiba saja banyak orang yang begitu peduli terhadap sesama, memperjuangkan kepentingan rakyat, dan lain-lain. Intinya, di musim ini semua aspek positif dari perilaku manusia seperti sedang diekspos ke luar sebagai sebuah penegasan sekaligus promosi. Anehnya orang-orang yang mengaku peduli ini sering bergesekan dengan orang-orang yang mengaku peduli lainnya. Makna Pemilu pun akhirnya begitu relatif, terjemahannya sesuai selera masing-masing. Kaburnya makna Pemilu ini sejalan dengan tingginya dinamika yang mengiringinya. Di beberapa kalangan Pemilu dianggap “bulan hidupmati”mengingatinvestasiyangdikeluarkan sudah mengalahkan prinsip ekonomi kapitalis versi Adam Smith. Di kelompok lain, Pemilu merupakan sarana bergeraknya ekonomi meski sifatnya sporadis. Karena bermunculan lahan-lahan baru meski sifatnya tidak berkesinambungan. Tetapi, di luar penilaian subjektif tersebut, tetap saja Pemilu merupakan sarana penting menentukannasibbangsa,palingtidak5tahun ke depan. Untuk itu, gambaran apapun yang diidentikkan dengan Pemilu, tetap saja kita harus menyikapinya dengan serius. Karena, proses Pemilu akan terus berlanjut meski tak satupun warga negara ini yang optimis hasilPemilumampumemberikankehidupan lebih layak. Maka tidak ada ruginya kita tetap berharap sekaligus berbuat untuk berkontribusi terhadap perbaikan bangsa ini meski (mungkin satu-satunya) hanya melalui sarana Pemilu. Kemiskinan Pemilu bukan saja akan melahirkan pimpinan eksekutif dan legislatif baru, tapi juga dipastikan akan melahirkan kebijakan-kebijakan yang berstandar pada partai pemenang dalam pemerintahan. Kesalahan kita dalam memilih anggota legislatif maupun Presiden RI hampir dipastikan akan berdampak terhadapkesalahanpenangananpersoalan-persoalan sosial di masyarakat saat ini, seperti persoalan kemiskinan. Bayangkan saja, anggaran dana untuk program penanggulangan kemiskinan 2014 sebesar Rp14T. Dana ini bila tidak dibingkai dengan komitmen kuat, maka juga akan berpotensi membuat masyarakat terpe-

rosok ke jurang ketergantungan—mengingat dana ini bersumber dari pinjaman luar negeri, meski katanya sudah dimixed di dalam APBN. Contoh lain misalnya anggaran Bansos 2014 yang awalnya Rp55,8 triliun membengkak ke angka Rp91,8 triliun. Berarti sekitar Rp34 triliun rawan tidak tepat sasaran—meski telah diklarifikasi bahwa beberapa mata anggaran sebelumnya mempunyai kemiripan dengan anggaran Bansos. Ketergantungan akan peran pemerintah terhadap penanggulangan kemiskinan di Indonesia masih sangat besar. Bahkan dapat dikatakan bahwa pemerintah masih merupakan satu-satu pihak yang mampu menyinergikan berbagai potensi untuk upaya penganggulangan kemiskinan. Hal ini berbanding lurus dengan ketidakberdayaan masyarakatnya dalam menyelesaikan persoalanpersoalan sosial. Bukan saja warga miskinnya, tetapi seluruh komponen sosial masyarakat yang belum mampu memobilisasi gerakan penanggulangan kemiskinan secara mandiri. Walaupun hal tersebut dianggap wajar pada negara yang masih terlilit berbagai masalah sosial. Peran pemerintah yang begitu besar ini dapat saja menjadi boomerang terhadap upaya penanggulangan kemiskinan. Sebuah jurnal ekonomi dari asosiasi professor ekonomi Universitas George Mason menyebutkan bahwa program-program pemerintah dalam menanggulangi kemiskinan sangat rawan diselewengkan demi kepentingan politik. Karena mainstream-nya adalah politik maka programnya pun pada akhirnya akan terjebak pada kepentingan politik. Program-program seperti IDT, P2DT, PDM-DKEtelahmenguakberbagaianggapan di atas, karena masyarakat dianggap hanya menjadi objek tidak berdaya. Program ini bukan saja merusak citra pemerintah tapi juga telah mengikis sebagian besar modal sosial di masyarakat, sekaligus memupuk sifat konsumtif dan ketergantungan pada pihak lain, yang dalam hal ini adalah pemerintah. Pemerintah sebenarnya telah melakukan berbagaievaluasi,yangpadapuncaknyatahun 2007 meluncurkan Program Nasional Pemberdayaan Masyarakat (PNPM) yang mengakomodir seluruh program penanggulangan kemiskinan di bawah satu atap dan berfokus pada usaha pemberdayaan masyarakat. Dengan skema social learning (pembelajaran sosial) dimana masyarakat dimana masyarakat diberi kesempatan untuk bertanggungjawab dalam merencanakan, merumuskan, menggunakandana,memantaudanmelakukan evaluasi partisipatif.Yang dianggap merupakanlangkahmajudarikebijakansebelumnya yang bersifat top-down. Perjalanan PNPM pun bukan tanpa cela. Kebocoran masih terjadi di sana-sini. Proses pemberdayaan masyarakat yang seharusnya berjalan se-alami mungkin akhirnya buyar dihantam target proyek.Yang lebih parahnya lagi, penangangan PNPM ditenderkan pada perusahaan,yangtentusajaberorientasiprofit. Bahkan seorang anggota DPR-RI dari komisi

V sewaktu reses ke Kota Binjai mengatakan, bagaimana mungkin program yang berorientasi sosial di-support oleh perusahaan yang berorientasi profit. Lagi-lagi kritikan tersebut tidak berdaya dilindas kebijakan yang telah ditetapkan. Semua rangkaian kebijakan terhadap penanggulangan kemiskinan ini bermuara pada mainstream pemerintah dalam membingkai persoalankemiskinanitusendiri.Karenameski pemerintah memiliki komitmen dalam upaya penanggulangan kemiskinan pun, masih harus berhadapan dengan arus dan kultur masyarakat yang begitu rumit dalam melihat program-program plat merah. Penutup Pemilu2014sejatinyamenjadiajangunjuk kekuatan (show of powers) bagi seluruh warga masyarakat, terutama warga kurang mampu. Karena berdasarkan beberapa penelitian mengungkapkanbahwapartisipasikelompok masyarakat menengah kebawah lebih dominan memberikan hak pilih dibanding masyarakat kelas menengah ke atas. Hal ini mengingat minimnya akses bagi mereka untuk menyalurkan aspirasi sekaligus kerentanan yang melekat pada masyarakat kurang mampu yang potensial dieksploitasi. Oleh Karena itu, hakikatnya Pemilu 2014 merupakan hajatan masyarakat banyak, bukan hanya sekedar kenduri Caleg maupun Capres. Jadi subjeknya adalah masyarakat dan objeknya adalah Caleg dan Capres. Paradoksnya, saat ini objeknya bergentayangan, sementara subjeknya lebih memilih menjadi objek. Untuk itu, menjadi tugas kita bersama untuk saling mengingatkan seluruh elemen masyarakat untuk menjadikan Pemilu 2014 sebagai momentum strategis bagi perbaikan bangsa, sekaligus memberikan punishment terhadap perwakilan yang telah dipilih dan gagal membuktikan keberpihakannya terha-

dap kesejahteraan masyarakat terutama warga miskin. Semoga… Penulis adalah Koordinator Kota PNPM-MP Binjai-Langkat.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau email: Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata dan kartu pengenal (KTP) penulis. Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di media manapun. Isi tulisan menjadi tanggung jawab penulis.

SUDUT BATUAH * PAN konsisten perjuangkan penuntasan tenaga honorer - Asal jangan bahasa kampanye * SK Mendagri sahkan pasangan AZAN - Selesai perjuangan tu, he...he...he * Kasus cerai meningkat di Pengadilan Agama Medan - Banyak janda dan duda keren neh! o k D Wa



WASPADA Senin 7 April 2014


Pemilu: Apa Agama Anda? PemimpinYang Dirindukan Rakyat Penduduk Indonesia, dari Sabang sampai Merauke sedang merindukan seorang pemimpin, baik dalam jabatan politik, pemerintahan, swasta dan organisasi kemasyarakatan. Dari sekian banyak calon pemimpin itu, ada kreteria atau syarat, seperti yang lazim berlaku dalam kepemimpinan Islam, yang telah dicontohkan oleh Nabi Muhammad SAW yakni Siddiq, Tabligh, Amanah dan Fathonah. Dari sekian banyak pemimpin itu setidaknya ada lima kriteria yang sangat dirindukan dan dinantikan oleh banyak orang,yaitu: Pertama, banyak mendengar. Seorang pemimpin harus rajin dan sering menerima keluhan, kritikan dan masukan dari orang yang akan di pimpinnya, sehingga program yang dijalankan sesuai dengan keinginan orang yang dipimpinnya. Kedua, banyak melihat. Seorang pemimpin harus rajin dan sering meninjau atau mengunjungi tempat-tempat yang akan menjadi target pekerjaan atau program. Lihatlah penderitaan masyarakat/rakyat yang akan yang pimpinnya, jangan hanya mendengar laporan orang lain. Catatlah setiap kejadian, renungkan dan perbuatlah di kemudian hari. Ketiga, banyak merasakan. Seorang pemimpin harus rajin dan sering mengumpamakan bahwa penderitaan mereka (masyarakat/rakyat) adalah menimpa diri pemimpin atau keluarga keluarga. Jangan sepelekan mereka dan jangan rendahkan mereka. Keempat, banyak memikirkan.Seorang pemimpin harus dan sering memikirkan bagaimana cara penyelesaian terbaik atas semua persoalan yang dihadapi oleh orang yang pimpinnya. Kelima, banyak berbuat. Seorang pemimpin harus dan sering menerjemahkan semua keluhan, kritikan atau bahkan mungkin cemoohan dari orang yang dipimpinnya. Berikan perhatian khusus dan buat rancangan program terbaik, jadikan semua itu pemicu dan pemacu semangat kerja.Berbuat semaksimal dan seoptimal mungkin. Kita semua tentu mendambakan pemimpin bermartabat. Martabat pemimpin harus disertai juga moralitas yang mapan. Moralitas tersebut mesti melekat dalam diri seorang pemimpin,sikap, tutur kata, dalam aktualitas hidupnya. Pemimpin itu harus memiliki kualitas sebagai berikut: Pertama, pemimpin yang bermartabat, menggambarkan sikap atau perilaku yang mementingkan orang lain. Kata lainnya, orang yang tidak egois. Pemimpin harus memiliki semangat untuk mementingkan kepentingan masyarakat. Kedua, pemimpin yang bermartabat herois. Herois dalam arti memiliki etos kepahlawanan. Dalam pepatah jawa terdapat ajaran ing madya mbangun karsa, tut wuri handayani. Artinya, pemimpin harus berada di depan untuk memberi arah kepada masyarakat, harus berada di tengah untuk membangun komitmen, harus berada di belakang untuk membangun motivasi. Pemimpin sejati berarti dia yang selalu dan senantiasa berada bersama masyarakat. Ketiga, pemimpin yang bermartabat humanis. Seorang pemimpin yang selalu menyoal tentang kemanusiaan. Respon terhadap setiap penderitaan dan musibah yang dihadapi masyarakat. Pemimpin harus turun langsung ke basis akar rumput dan terlibat aktif dalam persoalan kemanusiaan yang terjadi di tengah masyarakat. Kita semua pasti berharap agar pesta demokrasi kita ini dapat berjalan lancar. Selain itu, tidak ada bentrok antara masyarakat sipil setelah pesta demokrasi ini berakhir. Pemimpin yang kita nantikan pasti akan hadir dengan aktualisasi diri yang mantap. Siapa pun dia yang terpilih, dia itulah yang perlu kita beri ruang untuk mempimpin masyarakat. Tongat, SPdI Pengasuh Taman Pendidikan Islam AL FAZWA Kec.Delitua Mahasiswa PPs.IAIN SU

Dedi Sahputra


Oleh Shohibul Anshor Siregar Mengapa di negara yang dianggap raja demokrasi (Amerika) isu agama tetap penting dalam politik dan di negara mayoritas Islam seperti Indonesia selalu dianggap harus ditabukan? ayapernah mencatatkali-mat “My vote is my faith atau My faith is my vote”. Itu kejadian di Amerika, justru pada Pilpres mereka kemaren yang mengantarkan Obama menjadi Presiden untuk kedua kalinya. Di bawah ini akan saya salin pokok pikiran dari dua orang dengan agama berbeda terhadap Pemilu 2014. Saya dapatkan keduanya dari darim media sosial. Pendapat pertama ditayangkan sebagai status di dinding facebook, sedangkan pendapat kedua dikirim secara tertutup kepada saya (dan mungkin juga kepada banyak orang) melalui inbox. Agamaku Pilihanku, pendapat pertama mengurai tentang Kasus Serdangbedagai (Sergai). Ia katakan demikian “Pengalaman 2009 dari 11 kursi yang diperebutkan di daera pemilihan (Dapil) 3 Sergai ini, diisi 6 orang anggota DPRD beragama Islam dan 5 orang aggota DPRD dari nonmuslim. Mayoritas (83 persen) penduduk di sini Muslim. Di semua daerah terjadi hal seperti ini. Kenapa bisa seperti ini? Ini iktibar, janganlah terulang lagi untuk tanggal 9 April nanti. Bantulah kami, kawan”. Penulis status ini menyebut dirinya dengannamaImanAbiMahid.Sayakenalorangnya. Ia sebetulnya terlihat berpikir agak lokalistiksaja(Sergai,daerahyangditinggalkan oleh HT.Erry Nuradi dan kini dipimpin oleh Soekirman) sehingga lupa bahwa fakta serupa terdapat di Medan dan daerah-daerah lain. Bahkan ia melupakan bahwa untuk Sumut dengan perolehan dua kursi untuk anggota DPDbagikalangannon-muslim.Itusangatlah besar di luar proporsi perimbangan jumlah agama berpenduduk non muslim di daerah ini. Pendapat kedua tentang agenda Kristen dalam PDI-P. Ia nyatakan dengan struktur berpikir yang runtut, demikian: “Sudah lama orang Kristen diperlakukan sebagai waga negara kelas dua di negeri ini. Karena itu saudaraku, marilah kita bersatu menjadikan Pemilu Legislatif (Pileg) dan Pemilu Presiden (Pilpres) 2014 sebagai momentum untuk jadi warga negara kelas satu. Tidak ada cara lain selain memenangkan PDI-P agar pak Jokowi dapat dijadikan Capres berpasangan dengan salah satu kader terbaik HKBP, yakni Jenderal (purn) Luhut Panjaitan. Percayalah, kalau kita bersatu kita akan menang, apalagi kelompok-kelompok minoritas agama lain mendukung perjuangan kita. Kalau umat Kristen


saja membuka peluang orang untuk bebas beraktivitas, bahkan memaki-maki—tetapi juga bebas untuk sibuk dengan dirinya sendiri tanpa perlu khawatir terganggung orang lain. Sesungguhnya rakyat mengapresiasi gerakan mahasiswa sebagai aspirasi mereka,tapikebanyakanmerekatakpunyawaktu untuk terlibat di dalamnya. Ini seperti ketika engkau berkendara di tengah jalan melihat orang yang kecelakaan terkapar bersimbah darah. Sungguh hatimu miris, jantungmu bedegup kencang, empatimu muncul meluap-luap, seketika harapanmupuntuimbul:ayo-lahadaorang yang membantu, tolong dia segera, selamatkan nyawanya, larikan dia segera ke rumah sakit. Ohh.., please. Tapi segala kerisauan itu tak juga menggerakkanmu untuk bergegas menyentuh hangatnyadarahsikorban;menggotongnya ke rumah sakit. Paling hebat Anda sekedar berhenti di tengah jalan, melihat apa yang terjadi kemudian— kalau tak sekedar menoleh tanpa menghentikan kendaraanmu. Begitulah kesibukan otonom itu menjadi tuhan-tuhan baru. *** Ketika kampanye kemarin, saya melihat betapa asyiknya orangorang itu berjoget ria. Di depan sana, orangorang berpakaian seragam partai itu tersenyum ceria. Mereka senang karena begitu banyak massa menghadiri kampanyenya. Kegembiraan itu juga milik kumpulan orang yang dihibur keramaian, juga miliki abang becak yang dapat rezeki carteran. Mereka boleh jadi berada di dalam satu momen yang sama, tapi tak ada jaminan kesibukannya selalu sama. Mereka adalah kumpulan orang yang punya pamrihnya sendiri-sendiri. Inilah kesalahan terbesar para Caleg dan partai politik. Mereka menduga bahwa otonomi kesibukannya itu sebagai kepentingan rakyat. Padahal mereka yang disebut rakyat juga punya kesibukan otonomnya sendiri. Dan ini pulalah pangkal rapuhnya bangunan kebangsaan kita. Bukankan pihak yang tersingkirkan dari kehidupanadalahorangyangtakpunyasedikit waktunyabuatoranglain?Itusebab-nya,untuk menjadi pihak yang besar, syarat utamanya adalah hidup untuk orang lain, dan menyisihkan sedikit saja untuk dirinya sendiri. Adakah pihak yang besar seperti itu? Saya merasa yakin mereka ada. Dalam Pemilu seperti ini, tugas Anda adalah menemukan mereka secara diam-diam.(Vol.455, 7/4/2014)

Kolom foliopini dapat juga diakses melalui

Tersamar Dan Transparan Kita tahu di Indonesia stigma Islam sebagaiantinasionalismekerapdisuarakan.Hanya karena ia memang berlabel Islam dan terangterangan memperjuangkan Islam. Sebaliknya polesannasionalisdariluara(kulitdanpermukaan) kerap dimanfaatkan untuk menyembunyikanagendaantiIslamdalamkelompokkelompok yang secara formalistik bertekad mengkampanyekandirinyasebagainasionalis namun dengan agenda yang sangat berbeda. Kedua status sama-sama memperjuangkan kemenangan agama dalam rivalitas politik. Agama adalah inspirasi penting untuk apa sajadansangatmewarnaijalannyakehidupan individual maupun kolektif. Sebuah negara begitu kentara mengadopsi ajaran agama tertentu, katakanlah Indonesia, pada umumnya,mengindikasikancatatan-catatanpenting perjuangan yang tak dapat diabaikan dalam sejarah negara itu. PancasiladanUUD1945danterminologiterminologikenegaraanlainnyasepertidewan, musyawarah, mufakat dan lain-lain adalah aromatic Islam yang kental tak sekadar pupur luar. Jika disadari, hal itu memberikan data yang sarat kaitan dengan keislaman. Lantas dengan itulah terkadang umat Islam di Indonesia merasa dirinya harus berhenti menjadi Islam dalam ranah politik, dan memilih Islam dalam ranah terbatas (ibadah).

Snouck Hurgronje memang mengagendakan polarisasi itu sejak lama. Jauh lebih berbahaya (bagi kolonial) Islam dengan muatan ideologis (Islam politik) ketimbang Islam kultural yang secara sekularistik menerapkan agamanya sesuai perkembangan dalam dunia Kristen, yakni sekular. Di Indonesia, pasca kejatuhan Soeharto, bukan saja umatIslamyanggiatmendirikanpartaiagama. Kristen juga membangun kekuatan dalam PDS (Partai Damai Sejahtera). Jika kini partai itu sudah tereliminasi oleh ketentuan yang ada, maka cerita tentang perjuangan umat Kristenuntukmempengaruhijalannyapemerintahan Indonesia tidak lantas disimpulkan usai dan berhenti.Tereliminasinya PDS bukan hanya cerita tentang bagaimana agama tak dapatdifahamisecarabaikataubahkandiselewengkan untuk tujuan-tujuan di luar kehendak agama.Tetapi juga harus dilihat diaspora para pentolannya mengisi ruang-ruang partisipasi politik yang terbuka, apalagi dengan munculnya partai baru. Penutup Mengapadinegarayangdianggapsebagai raja demokrasi (Amerika) isu agama tetap penting dalam politik dan ketika di negara mayoritasIslamsepertiIndonesiaselaludianggap harus ditabukan? Ini kekalahan besar. KetikanantiJokowiberhasildengandukungan kekuatan anti Islam menjadi Presiden dan Ahok akan menggantikannya kelak di Jakarta—maka sesungguhnya apa yang dilaku-

kan Ketua Umum PP Muhammadiyah yang kini juga merangkap Ketua MUI Dien Syamsuddin—menjadi kerisauan besar ketika ia mencuci image Jokowi sebersih yang ia kehendaki dengan memberi mihrab kepada Capres PDIP versi Megawati ini untuk memimpin shalat berjamaah (imam) meskipun itu untuk waktu Ashar yang tak akan menerangkan apa-apa kecuali satu hal: jumlah rakaat. Sejumlah orang yang selalu didukung media untuk bicara negatif tentang Islam keraphanyaberseleramengupasIslamsebagai masalah terutama dalam arena politik. Disudutkan bahwa Islam adalah sebuah kecenderungan kuno jika akan hadir dalam urusan modern seperti politik. Mereka seakan yakin dalam kebenaran mengajarkan faham bahwa konsepsi negara tak ada dalam Islam dan jika akan berpolitik, tinggalkanlah agama di masjid. Walaupun demikian, partai Islam tidak etis dan tidak berhak memanfaatkan isu ini untuk keuntungan dirinya kecuali ia terlebih dahulu bertobat nasuha jauh-jauh hari sebeluminidanberusahasekuattenagatampil menjadi tauladan dalam gagasan, perjuangan dan perilaku yang rahmatan lil alamin.

Penulis adalah Dosen FISIP UMSU, Koordinator Umum Pengembangan Basis Sosial Inisiatif & Swadaya (‘nBASIS)

Momentum Fundamental Aceh

Kesibukan Otonomi MenjelangPemiluinisayaterbiasamendengar perdebatan tentang perlu tidaknya ikut berpartisipasi. Kalau yang menolak ikut terlibat menganggap Pemilu tak berarti banyak bagi perubahan, menilai orang yang dipilih hanya pencari kerja, dan sekedar memperjuangkan kepentingannya sendiri saja. Kepada para penganjur partisipasi berpendapatbahwaPemiluadalahmomentum sejarah yang punya nilai strategi. Oleh karena ia penting, maka ia harus dimanfaatkan—bukankah setiap keputusan individu akan punya konsekuensi tanggung jawab? Di antara dua kubu ini, saya justru menyaksikan kesibukan masing-masing yang bergegas-gegas. *** Ada jenis kesibukan yang membuat rapuh suatu bangunan kebersamaan. Sebuah keluarga misalnya, kalau di hari libur ayahnya cuma sibuk nonton bola atau kongkow-kongkow di warung kopi, si ibu lebih suka bergosip dengan tetangga, maka anak-anak cuma tekun bersama hanphonenya; SMS-an, BBM-an, ataupun main game. Kalau di waktu luang saja mereka tak ber-temu, apalagi di waktu sibuk. Kesibukan yang otonom ini pula yang kiranya melandasi kehidupan berbangsa kita. Ketika Pemilu pertama pascareformasi di tahun 1999 Partai Golkar adalah partai “tersangka”, bahkandituntutuntukdibubarkan oleh mahasiswa. Saya melihat dari dekat hal ini, bahkan ikut terlibat dalam beberapa aksi. Gerakan mahasiswa waktu sangat massif di seluruh kota di Indonesia. Tapi dari hasil Pemilu yang demokratis, Partai Golkar justru bertengger di posisi kedua pemenang Pemilu dengan perolehan 22 persen suara nasional, di bawah PDI-P. Apa yang terjadi sebenarnya? Apakah gerakan mahasiswa tidak mengakar ke rakyat? Apakah gerakan mahasiswa sekedar gerakan politik tanpa dilambari nilai-nilai moral yang berangkat dari kegelisahan di zamannya? Apakah gerakan mahasiswa sekedar letupan keadaan tanpa tersambung pada rentetan sejarah? Sungguh saya tidak meyakini kecurigaan tersebut. Karena sebagai manusia produk Reformasi, saya merasakan nuansa bathin ketika itu. Keresahan itu sungguh terjadi di mana-mana, dan terdakwanya adalah pemerintahan masa itu yang dipilot Soeharto, dengan pesawat yang bernama Golkar. Saya menduga karena kesibukan otonom itulah sebabnya. Era Reformasi bukan

gagal memenangkan Pileg dan Pilpres 2014 ini, maka kesempatan kita untuk memimpin negeri ini jangan harap akan pernah ada. Jadi hanya ada satu kata, kepalkan tangan, mari kita bersatu memenangkan PDIP. Haleluya puji Tuhan. Hidup PDI P. Hidup Jokowi. Hidup Megawati. Mulialah Gereja. Pendapat ini dikirim oleh Pardomuan Sipahutar, malam minggu. Pada dinding facebookSipahutarinimasihdapatditemukan banyak status bernada sama, yakni seruan konsolidasi Kristen untuk agenda tunggal: menangkan PDI-P sebagai prasyarat untuk rencana menggolkan Jokowi menjadi Presiden RI 2014-2019. Pertanyaannya, mengapa ia mengirimkan secara tertutup pesan rahasia (via inbox) pesan ini kepada saya yang beragama Islam? Tentulah karena ia semberono, hanya dengan melihat marga saya lantas menyimpulkansayabukanMuslim.Memang kini banyak juga orang Batak dengan nama yang lazimnya untuk orang Muslim namun sesungguhnya beragama non-muslim.

Oleh Kamaruddin Hasan Momen penting transformasi konflik menuju proses damai yang lebih stabil dan berkelanjutan telah dilalui. Kini bagaimana mengikat komitmen damai bagi semua orang


udah menjadi kebiasaan bahwa tensi politik, sosial, ekonomi di wilayah bekas konflik seperti Aceh selalu memanas seiring munculnya rivalitas kekuatan politik, sosial dan ekonomi jelang Pemilu 2014. Politik kerap kali didefinisikan sebagi who gets what and when. Sebuah upaya mencapai kekuasaan, yang sejatinya memang menarik minat banyak orang. Sudahsepatutnyakitamengingat,memahami, menganalisa kembali beberapa proses penting sebagai momentum fundamental bagi Aceh. Momentum pertama, musibah gempa dan tsunami 26 Desember 2004 berkekuatan 8,9 Skala Richter disusul gelombang tsunami melanda hampir seluruh daerah AcehdanNias,SumateraUtaraserta11negara lainnya. Momentum ini mesti menjadi landasandalamsetiapgerakpembangunanAceh. Momentum kedua, proses komunikasi dialogis, yang diawali Gerakan Aceh Merdeka (GAM) secara sepihak menyatakan gencatan senjata berkaitan musibah tsunami pada 27 Desember 2004—berlanjut tanggal 29 Januari 2005 antara RI-GAM yang difasilitasi yayasan Crisis Manajement Initiative (CMI). Dialog kedua berlansung pada 21-23 Februari 2005, pada 12-16 April 2005 sebagai dialog ketiga dan dilanjutkan 26 - 31 Mei dialog keempat RI - GAM di Helsinki. Momentum ketiga, MoU Helsinky 15 Agustus 2005. Pada 12-17 Juli dialog kelima RI-GAM di Helsinki berlanjut pada 15 Agustus 2005RI-GAMmelaksanakanperjanjiandamai ditandatangani Malek Mahmud (GAM) dan Hamid Awaluddin (RI) di Helsinki. Proses perdamaian yang ditandai lahirnya MoU Helsinki tahun 2005 telah mentransformasi Aceh dari medan perang menjadi arena pertarunganpolitikpalingdinamissekaliguslaboratorium demokratisasi yang melahirkan terobosan inovatif dalam politik Aceh dan Indonesia. Laga senjata berubah menjadi adu argumen,hutanbelantara,berubahmenjadihamparan meja perundingan. Komunikasi emosionalmenjadirasional,lawanmenjadikawan, egois menjadi humanis. Dalam konteks ini, politik,negosiasi,komunikasi,diplomasisecara santun menjadi taruhan yang tidak mungkin dinafikan. Walaupun perjanjian ini menimbulkan pro dan kontra pada kalangan elit politik di Jakarta dan Aceh, namun dari segi keberanian, tampaknya pemerintah SBYJK telah melampaui batas kekhawatiran beberapa presiden sebelumnya. SBY-JK saat itutetapkonsistenmemilihcaradamaisebagai resep mengakhiri konflik Aceh. Momentum keempat, adalah damai bersemi, bahwa setelah perjanjian damai ini tidak ada lagi perang. Bumi Serambi Makkah menjadi aman, rakyat bebas melakukan berbagai

aktivitas tanpa ancaman dan teror. Nafas persengketaan dan permusuhan yang telah berakar lebih dari 30 tahun lebih di Aceh mulai berhenti. Ia tergantikan angin perubahaan yang lebih signifikan dan makin melegakan. Simpul penting transformasi konflik menuju proses damai yang lebih stabil dan berkelanjutantelahdilalui. Momenpentingtransformasi konflik menuju proses damai yang lebih stabil dan berkelanjutan telah dilalui. Kini bagaimana mengikat komitmen damai bagi semua orang, bukan hanya pihak yang bertikai, demi upaya merajut kehidupan khususnya Aceh dan Indonesia pada umumnya. Momentum kelima, Pemilukada 11 Desember 2006. Cahaya perdamaian itu makin bersinar ketika Pemilukada yang berlangsung 11 Desember 2006 berjalan secara demokratis telah mampu memberi ruang baru bagi sirkulasi kekuasaan di Aceh. Pemilukada pun melahirkan pemimpin yang beragam, mulai dari kelompok yang selama ini terbuang dari siklus kekuasaan/outsider hingga masyarakat sipil yang dianggap berprestasi untuk menjaga momentum membangun Aceh. Pemilukada menunjukkan besarnya keinginan dari rakyat sipil Aceh untuk menyongsong perubahan politik pemerintahan dan mengharapkan adanya visi pembangunan yang lebih mengakar pada kepentingan rakyat luas. Pemilukada menggembirakan semua pihak; Jakarta, para stakeholders rehabilitasi dan rekonstruksi, kelompok sipil demokratis, dan akar rumput. Suksesnya Pemilukada 2006 menjadi tonggak demokratisasi, pascaterpilihnya gubernurwagub kemudian bupati-wabup/wali kotawalkot di Aceh. Momentum keenam, lahirnya partai politik lokal (Parlok). Parlok sebagai alat penyaluraspirasimasyarakatAcehdiharapkandapat membawa Aceh ke arah yang lebih baik, mandiri dan modern. Parlok diharapkan mampu membangun pencitraan diri dalam konteks keAcehan. Hal tersebut sangat tergantung pada landasan ideologis, strategi-taktik, dan program-program yang diusung. Di samping itu, juga memiliki kemampuan menerjemahkan kondisi objektif keAcehan. Dalam konteks keAcehan dan sistem politik nasional, bagaimana membangun kanal politik secara nasional, karena arah proses perdamaian abadi masih sangat bergantung konstelasi politik di nasional. Parlok hanya menjangkau saluran aspirasi masyarakat di tingkatan DPRA dan DPRK. Eksistensi Parlok di Aceh memang tidak menjadi perdebatan yuridis lagi ketika UU No.11/2006 (UU Pemerintahan Aceh) dan PP No.20/2007 tentang Partai Politik Lokal di Aceh telah mengamanatkannya. Kehadirannya juga merupakan bagian dari road map to peace process di Aceh seperti yang tertuang dalam kesepakatan

Helsinki. Beberapa kemajuan dalam tahapan perdamaian dan rekonstruksi memang memberikannilaiyangmampumemperpendek jaring transisi Momentum ketujuh, Pemilu legeslatif 9 April 2009, merupakan arena pembuktian kekuatan bagi Parlok dan alat ukur seberapa kuat parnas masih bisa bertahan untuk merebut kursi-kursi di DPRA dan DPRK-DPRK diAceh.DenganUUNo.11tahun2006,Pemilu 2009 menjadi lain, kepesertaan kontestan Parlok membawa nuansa baru dalam sistem demokrasi di Aceh dan Indonesia. Kehadiran Parlok menjadi titian penting bagi proses transisi politik Aceh. Keberhasilan Parlok yaitu Partai Aceh (PA) bentukan mantan kombatan GAM meraih lebih dari 45 persen suara pemilihdiseluruhAcehdalamPemilulegeslatif 2009, dapat dikatakan keberhasilannya menguasaiparlemendiAcehjugakeberhasilan transformasi politik. Momentum kedelapan, Pilpres 8 Juli 2009, saat itu terdapat tiga kandidat pasangan Capres Cawapres (SBY-Boediono, MegawatiPrabowo dan JK-Wiranto). Masing-masing pasangan mempunyai kelemahan namun juga telah memiliki sejumlah kelebihan. Memang akhirnya rakyat Aceh dominan memilih pasangan SBY–Boediono. Sebenarnya sebelumnya peran SBY dan JK dalam proses damai Aceh lebih dominan, lewat tangan merekalah sehingga mampu menghentikan konflik berkepanjangan di bumi tanah Iskandarmuda dengan adanya perjanjian MoU Helsinki. Mereka sama-sama berjasa dalam proses damai Aceh. Sehingga pada tataran praktis aktivis, politisi sipil PA/KPA sebagai mesin politik yang kuat di Aceh saat itu, masih terjadi perbedaan dukungan tehadap Capres dan Cawapres. Satu sisi ada yang mendukung sosok SBY tapi sisi lain ada yang cenderung mendukung JK. Pihak PA-KPA cermat melihat pasangan mana yang akan lebih berpeluang untuk dapat dijadikan rekan kerja di Jakarta. Ke mana arah angin PA-KPA saat itu kesitu pula arah rakyat Aceh. Politik memang susah diprediksi, terutama di Aceh. Hasil prediksi diatas kertas selalu meleset dari perhitungan sebenarnya. Momentum kesembilan, Pemilukada 9 April 2012 yang serentak di 17 dari 23 kabupaten/kota se Aceh. Berbeda dengan Pemilukada lainnya yang diselenggarakan Komisi Pemilihan Umum Daerah (KPUD), di Aceh diselenggarakan Komisi Independen Pemilihan (KIP) Aceh. Hal lain yang membedakanadalahcalonkepaladaerah/wakilkepala daerah boleh diikuti calon independen. Selain itu setiap calon kepala daerah mengikuti tes baca Alquran. Berdasarkan data KIP Aceh, jumlah pemilih Pemilukada Aceh saat itu tercatat sebanyak 3.250.000 orang, tersebar di 23 kabupaten/kota, yang memilih di 10.361 tempat pemungutan suara (TPS). Momentum kesepuluh, Pemilu legislatif (Pileg)9April2014.Pemilulegislatiftelahdilalui sebanyak 3 kali dengan 4 presiden berbeda pascapemerintahan Presiden Soeharto. Dalamperiode10tahunkebelakangtelahbanyak perubahan, di antaranya amandemen UUD

1945, kebebasan pers, pemisahan yang jelas antara militer dan sipil, kebebasan mengeluarkan pendapat, munculnya berbagai partai politik bahkan partai lokal khususnya Aceh.Namunkitasayangkandemokrasisepertinya berhenti sebagai pesta gaduh, dan pengabaian etika. Jelang Pileg 9 April 2014, kekerasan demi kekerasan politik dalam setiap proses tersebut dengan mengatas namakan demokrasipun berlansung terus menerus. Kita tidak tahu siapa yang “bermain” di Aceh diatas altar Pemilu ini. Komunikasai gaya totaliterisme, kekerasan simbolik, politik tanpa etika, mobilisasimassayangberingas,mediakekerasan, kekerasan media, ingin menang sendiri, penganiyaan, teror, intimidasi, bahkan pada taraf membunuh dan lain-lain sudah menjadi ciri khas setiap event pesta demokrasi. Kekerasan, tidak saja meneror hati nurani, tetapi juga semakin mendorong kita pada batas krusial antara zona kehidupan dan kematian peradaban bangsa dan negara. Namun momentumPileg2014,menjadisangatpenting bagi kelangsungan proses demokrasi Aceh ke arah lebih baik. Momentum kesebelas, Pemilu Presiden 9 Juli 2014, menjadi momentum penting bagi keberlansungan cita-cita rakyat Aceh untuk hidup damai, sejahtera dan bermartabat. Siapapun yang jadi presiden dan wakil presiden,rakyatAcehtetapmenancapkanharapan besar. Rakyat Aceh membutuhkan strategi jitu menentukan pilihan presiden dan wakil presiden. Memang kita sedang berdemokrasi di tengah kemiskinan dengan keterbatasan sumber daya manusia, terkadang yang diperdebatkan bukan substansial visi misi yang realistis namun yang dipertontonkan kegagalan. Sehingga bagi Aceh adalah siapapun presiden dan wakil presiden, mesti dapat memertahankan perdamaian Aceh, pembangunan Aceh berkelanjutan secara besar-besaran. Terkait dengan itu, mendesak dilakukan sebagai langkah proaktif dan preventif untuk penyadaran publik dengan pendidikan politik yang baik dan benar. Penyadaran ini penting untuk tidak terpancing situasi dan kondisi yang cenderung provokatif, yang memiliki potensi chaos, dengan berbagai motivasi baik politis,ekonomi,sosial,sejarahmaupunpsikologis. Harapannya agar semua menyadari betapa mahalnya harga perdamaian, perdamaian mesti permanen di Aceh, Aceh mesti bisa sesegera mungkin meninggalkan masa transisi. Selain itu, perlu di sadari bahwa politik menjadisalahsatupoinpentingyangmemberi warna wajah kita, ini ditentukan oleh warna politik yang kita jalankan sekarang. Warna putih atau hitam, bergatung pada kita baik sebagai aktor politik maupun rakyat.

Penulis adalah Dosen Ilmu Komunikasi, Fisip, Unimal Aceh, Ketua Development for Research and Empowerment - DeRE-Indonesia (Sekolah Menulis & Kajian Media –SMKM-Atjeh dan Atjeh Analyst Club-A2C) Email:


B8 06:00 GO SPOT 07:30 Dahsyat 10:30 INTENS 11:00 SILET 12:00 SEPUTAR INDONESIA SIANG 12:30 BUKA - BUKAAN 14:00 Indonesian Idol 16:00 CEK AND RICEK 16:30 SEPUTAR INDONESIA 17:00 CINTA ANAK CUCU ADAM 19:15 ANAK - ANAK MANUSIA 21:00 TUKANG BUBUR NAIK HAJI THE SERIES 22:30 Box Office Movie


06:30 SL Inbox 08:45 Halo Selebriti 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:30 Liputan 6 Petang 17:00 Get Married The Series 2 18:15 Diam-Diam Suka 19:45 Tiba-Tiba Cinta 21:00 Emak Ijah Pengen Ke Mekah 22:30 I Like This

07:00 Animasi Spesial 07:30 Animasi Spesial 08:30 Mister Maker Comes To Town 1 09:00 Pose 09:30 Layar Unggulan 11:00 Diantara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 14:00 Tuntas 14:30 Lintas Petang 15:00 Animasi Spesial 16:30 Animasi Spesial3 17:30 Tendangan Si Madun Returns 18:30 Mnctv Sport Platinum-1 21:00 Raden Kian Santang 22:00 Suka-suka Uya 23:30 Cerita Pilihan 00:30 Midnite Great Sale 01:00 Lintas Malam

08:25 Curious George 08:55 Gon 09:25 Little Krisna 11:25 Topik Siang 11:55 Seputar Obrolan Selebriti 12:55 Mr. Bean 13:25 Tom & Jerry 13:55 Bima Sakti 14:25 Little Krishna 14:55 Bernard Bear 15:25 Curious George 15:55 Gon 16:25 Marsha & The Bear 16:55 Pesbukers 19:25 Campur-Campur 20:25 Pesbukers Best Of The Best 21:55 Sinema Spesial 23:55 Cakrawala

07:30 Semarak Sinema Spesial 08:30 Sinema Pagi 10:30 Live Kiss Pagi 11:30 Live Patroli 12:00 Sinema Pintu Taubat Siang 14:00 Hot Kiss 15:00 Live Fokus 15:30 Trending Topic 16:30 Berani Nekat 17:00 New Famili 100 18:00 Audisi D’Academy 20:00 Sinetron Unggulan : Bara Bere 21:00 Sinetron Unggulan 22:00 Sinema Unggulan

08:05 8 Eleven Show 12:00 Metro Siang 13:00 Wideshot 17:00 Metro Hari Ini 18:00 Prime Time News 19:30 Lebih Dekat 20:05 Mata Najwa 21:30 Otoblitz 22:00 Top 9 News 2 2 : 3 0 St a n d Up Comedy Show 23:05 Realitas 23:30 Metro Sport

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

WASPADA Senin 7 April 2014

07:30 Saatnya Kita Joged 09:30 Sinema Indonesia Pagi 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 14:45 Insert Investigasi 15:15 Show Imah 16:45 Reportase Sore 17:30 Oh Ternyata 18:30 Slide Show 19:30 YKS 22:30 Bioskop TransTV 01:00 Reportase Malam

07:00 Live News Apa Kabar Indonesia Pagi 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Ruang Kita 14:30 Live News Kabar Pasar 15:30 Live News Kabar PEMILU 16:30 Sorotan Kasus 17:00 Live News Kabar Petang 19:00 Meja Bundar 20:00 Live News Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Menyingkap Tabir 22:30 Kabar Arena

08:00 Kungfu Panda 08:30 Chuggington 09:00 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Siang Seru Sama Sule 14:00 Seleb On Cam 14:30 Spot On 15:00 Fokus Selebriti 15:30 Lawan Tawa 16:30 Ada Ada Aja 17:30 Spongebob Squarepants 19:00 Big Movies 21:00 Big Movies 23:00 Big Movies

07:30 Selebrita Pagi 08:15 Spotlite 09:15 Syafa’at 10:00 Ceplas Ceplos LIVE 11:30 Redaksi Siang 12:00 Selebrita Siang 12:45 Laptop Si Unyil 13:15 Bocah Petualang 13:45 Dunia Binatang 14:15 Tau Gak Sih 14:45 Mancing Mania 15:15 Jejak Petualang 15:45 Orang Pinggiran 16:15 Redaksi Sore 17:00 Opera Van Java 18:30 Hitam Putih 19:30 On The Spot 20:30 CCTV 21:15 ILK (Indonesia Lawak Klub) 22:15 Bukan Empat Mata 23:30 Dua Dunia 01.00 Redaksi Malam **m31/G

Beat The System Luncurkan Lagu Berbahasa Indonesia


Windy Tersisih Dari Indonesian Idol Windy Yunita tersisih dari Indonesian Idol 2014 pada pertunjukan spektakuler ketujuh berlangsung Jumat malam hingga Sabtu dini hari. Kontestan asal Jakarta itu berada di posisi dua terbawah dalam daftar perolehan dukungan suara setelah membawakan lagu hits dari John Legend yang berjudul All of Me. Lagu California King Bed dia nyanyikan pada kesempatan kedua juga tak bisa menarik banyak dukungan penonton, tak bisa menyelamatkan dia dari eliminasi. Dan meski Titi DJ ingin menggunakan hak veto untuk mempertahankan perempuan yang sejak kecil ingin menjadi penyanyi profesional itu di kompetisi, tiga juri lainnya tidak sepakat. “Terima kasih banyak untuk semua dukungannya, doanya, semangatnya, yang membuat Windy bisa bertahan di sini,” kata Windy dengan air mata berli-

nang pada saat terakhirnya di panggung Indonesian Idol. Sementara Yuka Tamada, berada di posisi terbawah bersama Windy, bisa terus mengikuti kompetisi bersama lima kontestan yang lain. “Saya akan berikan yang lebih baik, itu janji saya,” kataYuka sebelum pemandu acara Daniel Mananta mengumumkan nama kontestan tereliminasi. Tak Mencengangkan Ahmad Dhani mengatakan penampilan para kontestan menyanyikan lagu-lagu hits tidak istimewa, tidak ada kontestan yang tampil mencengangkan. Juri menyebut Giofanny Elliandrian tampil kurang prima saat membawakan lagu Lumpuhkan Ingatanku dari Geisha dan menilai penampilan Yuka kurang maksimal saat membawakan lagu Demons dari Imagine Dragon. Penampilan Windy, Di Muhammad Devirzha dan MYusuf

Nur Ubay juga tidak mendapat banyak pujian dari para juri. Hanya Nowela Elizabeth dan Husein Alatas yang mendapat cukup banyak pujian dari para juri. Dhani dan Anang Hermansyah memuji aksi panggu-ng Nowela ketika menyanyikan lagu Team dari Lorde sementara Tantri Kotak menyebut dia selalu menyajikan penampilan yang tak terlupakan. Penampilan Husein saat menyanyikan lagu Peterpan berjudul Di Belakangku juga mendapat pujian dari semua juri. Dhani menyebut Husein mampu memberikan warna baru pada lagu yang dia nyanyikan. “Mungkin malam ini akan membuatmu jadi penyanyi dengan kemampuan interprestasi terbaik... Lagu ini benar-benar keluar dari aransemen dan cara bernyanyi penyanyi aslinya,” kata dia. (ant)

Beat The System, band heavy rock asal Malaysia turut serta dalam memeriahkan dunia musik rock di Asia. Setelah berbagai awards dikantonginya selama ini lewat lagu-lagunya dalam album kompilasi di negeri Jiran Malaysia, dalam waktu dekat Beat The System akan meluncurkan album terbarunya juga mengikutsertakan lagu liriknya berbahasa Indonesia sebagai bonus track. Album akan di rilis di Amerika Serikat dan Asia, khususnya Indonesia sendiri digarap dan diluncurkan lewat label ternama dunia Monster Hits Music dibawah asuhan Diana Meltzer membesarkan Creed, Alter Bridge, Evanescense, Drowning Pool, Nickelback dan masih banyak lagi band raksasa dunia lainnya. Hal ini ditujukan agar pencinta musik rock di Asia khususnya Indonesia dapat lebih menikmati kualitas musik yang mereka hadirkan. Beat The System yakin bahwa lagu mereka usung akan mendapat perhatian masyarakat Indonesia dan juga pasar penikmat musik di Amerika. Band digawangi Stewart pada Guitar, Ian pada Bass, dan Gerald pada drums, telah malang melintang di dunia musik rock MalaysIa dan sekitarnya. Penghargaan-penghargaan dan kerjasama degan label musik raksasa pernah mereka raih me-

mbuktikan bahwa kualitas musik yang mereka bawakan tidak dapat dipandang sebelah mata, salah satunya adalah pada tahun 2010 Beat The System berhasil mendapatkan Special Recognition awarded Tipped To Be The Next Big Thing AsianVoice Independent Music Awards (AVIMA) 2010. Sampai saat ini Beat The System telah mengeluarkan beberapa single tergabung di 4 album kompilasi berbeda dijagokan pihak label rekaman untuk menjadi single utama dalam album-album tersebut. Lagu paling dijagokan dan berhasil mendapatkan deretan awards adalah, lagu dengan judul Shine berkolaborasi dengan JaclynVictor, sang pemenang Malaysia Idol. Di sisi lain, Band resmi berdiri pada tahun 2001 menyebut dirinya “ambassador for the struggling teens and youth in this generation”, karena mereka meyakini bahwa lagu mereka bawakan mengandung semangat dan ambisi untuk memberikan dan menyebarkan energy positif bagi pendengarnya terutama bagi kalangan muda di seluruh dunia. “Kami optimis dengan kualitas musik dan tujuan baik tersebut kami akan mendapatkan tempat spesial di hati para pendengar. Dengan lagu terbaru

dengan Bahasa sengaja kami ciptakan dan kami orbitkan untuk menempati pasar dunia, kami harap lagu tersebut selain bisa dinikmati muda mudi dunia, juga dapat menambah semangat persaudaraan di negaranegara di Asia, khususnya Asia Tenggara,”ujar Gerald, Composer & Drummer, Beat The System. Adalah Diana “The Golden Ear” Meltzer, founder of Monster Hits Music melirik demo Beat The System. Diana telah dikenal dengan popular sebagai The Mother of Rock Bands di USA membesarkan Creed, Alter Bridge, Evanescence, Drowning Pool, Seether, dan masih banyak lagi band ternama lainnya yang menjadi asuhannya. Dan tanpa diduga sambutan positif datang dari Diana kepada Beat The System. Setelah beberapa proses akhirnya Monster Hits Music dan Beat The System menyepakati kontrak sebagai salah satu artisnya beberapa waktu lalu. Hadirnya Beat The System di blantika musik dunia juga diharapkan dapat meningkatkan kreatifitas musisi rock Asia Tenggara untuk turut bersaing di kancah musik international, yang tentunya akan mengundang label-label raksasa di level internasional melirik Band-band lokal di Asia Tenggara.(m19)

Beat The System/

Dwayne Johnson dalam film Hercules

Dwayne Johnson Prajurit Bayaran Dalam Film Hercules:TheThracianWars Dwayne Johnson sangat menonjol dalam poster film Hercules : The Thracian Wars. Pahlawan film aksi itu sengaja memasang posternya di situs Facebook. Diangkat dari cerita novel grafik film Hercules menceritakan kembali mitos klasik dan menempatkan sosok Hercules sebagai prajurit bayaran. Seperti dilansir digitalspy, Ian McShane, Rufus Sewell, Joseph Fiennes, Peter Mullan, John Hurt, Rebecca Ferguson, Ingrid Bolsø Berdal, Aksel Hennie, Reece Ritchie and Tobias Santelmann juga membintangi film dirilis pada Juli mendatang. Film Hercules : The Thracian Wars disutradarai Rush Hour dan Brett Ratner mengarahkan film Red Dragon. Produksi ini hampir bersamaan dengan meluncurnya film The Legend of Hercules digawangi Kellan Lutz menceritakan mitos klasik Yunani dengan Hercules sebagai serdadu bayaran. The Legend of Hercules didasari buku komik karangan Steve Moore dan Admira Wijaya diterbitkan pada Maret lalu. Aktor film Hercules ini mengkonfirmasi, ia akan memainkan karakter DC yang tidak pernah dilakukannya sebelumnya. Hal ini disampaikan Dwayne selama sesi Q& A dengan fan. Ditanya sosok superhero apa ingin ia mainkan dalam produksi DC atau Marvel, Dwayne menjawab, ia dan DC sudah menyetujui karakter sangat komplek dan terkenal. Aktor berusia 41 tahun ini menyatakan bahwa dalam negosiasi dengan proyek DC/Warner Bros sebelumnya ia dihubungkan Lobo Film. Nur

FilmTidakPernahMeraih Oscar

Para alumni SMEA2-SMK6 saling melepas rindu dengan melakukan gerakan tarian bersama

Reuni Akbar SMEA 2 – SMK 6 Medan Meriah Acara Reuni Akbar dan Deklarasi Ikatan Alumni SMEA 2-SMK-6 Medan telah dirancang sekitar dua bulan sukses dilaksanakan. Pasalnya, 650 alumni hadir di Ballroom Madani Hotel, Minggu, 30 Maret 2014 menjadi begitu meriah karena sudah bertahun-tahun tidak saling bertemu setelah tamat dari sekolah. Mereka tampak saling melepas rindu, bercengkrama, menyapa, foto bersama dan banyak ekspresi yang mereka tunjukkan ketika bertemu dengan para alumni. Diawali menyanyikan lagu Indonesia Raya diikuti seluruh alumni yang hadir, selanjutnya dilaksanakan deklarasi Ikatan Alumni SMEA 2 – SMK 6 Medan disahkan Penasehat Ikatan Alumni SMEA 2 – SMK 6 Medan, Bongsu Edison Panggabean, khusus hadir ke Medan menghadiri acara ini, karena saat beliau berdomisili di Jakarta juga merupakan Ketua Alumni SMEA2-SMK6 di Jabodetabek. Banyak alumni saat ini sudah tidak berdomisili di Medan, tetapi tetap masih saling berkomunikasi, mereka sangat antusias mengikuti

acara ini karena memang sangat sulit berkumpul karena kesibukan masing-masing, tetapi dengan adanya acara ini, maka mereka berkesempatan bertemu dan bertatap muka kembali setelah bertahun-tahun tidak ketemu, banyak yang telah berubah dibandingkan dengan dulu semasa sekolah. Acara dipandu MC (Master of Ceremonies), The Hits Jimmy dan Uya‘Gokil’, membuat suasana dalam ruang semakin riuh tertawa dengan celoteh-celotehan dan kegokilan MC. Menurut Ketua Pelaksana Reuni Akbar Alumni SMEA 2 – SMK 6 Medan 2014, Angguntur SE, bangga atas kerja keras dan kerjasama dilakukan panitia reuni, karena jangka waktu dua bulan bukan waktu yang begitu panjang, tetapi panitia berhasil mengumpulkan sekitar 650 alumni untuk saling bertemu dan melepas rindu. Diakhir acara juga didukung XL ini, para alumni melakukan foto bersama dan dilanjutkan dengan penarikan doorprize telah dinanti-nanti alumni serta beberapa games yang asik-asik dan gokil.(m19)

Biasanya film mendapat Oscar bertema drama, perang atau produksi musikal cenderung menarik perhatian pemilih Academy Award. Dibawah ini disebut karakter dan tema film tidak pernah meraih Oscar. Film superhero. Meskipun film The Dark Knight Christopher Nolan menjadi film paling laris dan digemari pada tahun 2009, Nolan tidak mendapat Oscar. Malah ia masuk nominasi penghargaan untuk kategori gambar terbaik karena film Inception dua tahun kemudian. Watchmen adalah film superhero bergengsi diangkat dari novel grafik arahan Paul Greengrass dan film Superman dibintangi Christopher Reeves gagal mencomot Oscar. Film imajinasi petualangan. Film trilogi Lord of the Rings Peter Jackson ini masuk nominasi

Oscar, namun tidak mendapat Oscar. Walaupun digemari banyak penonton sekuel petualangan Harry Potter tidak pernah mencomot Oscar . Begitu juga dengan film petualangan Deathly HallowsPart 2. Film The Hunger Games menonjolkan sosok pahlawan cewek Katniss Everdeen diperankan Jennifer Lawrence juga tidak meraih Oscar. Film James Bond. Meskipun sudah lebih setengah abad film bersandi 007 ini diproduksi, namun film ini tidak mampu menarik perhatian Oscar termasuk film James Bond terakhir berjudul Skyfall yang menonjolkan soundtrack alunan penyanyi top Adele dan dibintangi Daniel Craig. Produksi animasi. Walaupun ada yang dapat Oscar kategori film animasi terbaik, tapi umumnya film-film animasi su-

lit meraih Oscar termasuk film bonafid Disney terbaru berjudul Frozen dengan soundtracknya dilantunkan Idina Menzel. Sederetan film animasi Disney lainnya seperti The Lion King, Snow White and the Seven Dwarfs serta klasik Pixar macam Toy Story, Finding Nemo dan Wall-E, Toy Story 3 pernah dapat nominasi Oscar untuk kategori gambar terbaik, tapi tidak meraih Oscar. Film komedi. Film-film bertema ini sering masuk nominasi Oscar untuk kategori gambar terbaik, tapi tidak meraih Oscar. Sederetan produksi mengundang tawa termasuk Little Miss Sunshine, Juno, The Full Monty tidak mendapat Oscar. Sementara Annie Hall, Driving Miss Daisy, Shakespeare in Love dan The Artist masuk menjadi pemenang Oscar kategori Best Picture.

Film Bridemaids memenangkan penghargaan Original Screenpaly dan Supporting Actress tahun 2012. Film horor. Seperti film komedi, produksi bertema horor juga ada yang mencomot Oscar, namun sebahagian besar gagal mendapatkan penghargaan bergengsi perfilman Amerika itu. Film horor The Exorcist dirilis tahun 1973 mampu masuk nominasi Oscar, namun tidak

Film Animasi produksi Disney memenangkan Academy Award itu. Begitu juga dengan film The Sting. Hampir 20 tahun ke-mudian film The Silence of the Lambs mampu menyapu bersih lima kategori Oscar termasuk gambar dan sutradara terbaik. Film horor Pan’s Labyrinth memenangkan tiga Oscar tahun 2007, namun produksi bertema horor lainnya sulit mendapat Oscar, demikian Digitalspy. Nur

Julie Estelle Menyukai Film Action Terlibat dalam film action membuat Julie Estelle menggandrungi genre tersebut.“Aku lagi menikmati genre yang baru ini,” kata Julie saat ditemui di peluncuran The Raid 2 Berandal. Kebetulan, Julie juga sedang mengerjakan film action keduanya, The Night Comes For Us karya sutradara Timo Tjahjanto. Ia tidak menjelaskan perannya dalam film itu, tetapi ia mengaku tidak takut untuk terlibat lagi dalam genre action. Terlibat dalam film itu antara lain Joe Taslim dan Yayan Ruhian.

Julie pertama kali bermain dalam film action dalam arahan sutradara Gareth Evans, The Raid 2 Berandal. Ia mendapat peran menjadi Hammer Girl, satu-satunya tokoh perempuan dalam film itu. Ia mengaku banyak berdiskusi dengan sang sutradara untuk menghidupkan karakter tersebut. Sesekali, ia melihat aksi Uma Thurman dalam Kill Bill. “Tapi, kalau untuk referensi benar-benar Hammer Girl nggak ada sih. Hammer Girl tokoh unik yang dikarang Gareth.

Lebih banyak diskusi dengan Gareth,” katanya. Julie kebagian peran sebagai pembunuh bayaran bernama Hammer Girl. Ia mengaku mengalami kesulitan apalagi ia tidak memiliki kemampuan bela diri sebelumnya. “Sulit sekali harus melawan fighter berpengalaman,” katanya. The Raid 2 Berandal menampilkan Iko Uwais, Yayan Ruhian, Cok Simbara, Oka Antara, dan Arifin Putra. Sebelum diputar di Indonesia, film ini diputar terlebih dulu di Festival Film

Sundance, AS, bulan Januari lalu. Latihan keras Aktris Julie Estelle berlatih keras bela diri untuk bermain dalam film karya Gareth Evans, The Raid 2 Berandal. Julie menjadi seorang pembunuh bayaran yang dijuluki Hammer Girl dengan senjata andalan palu. Adik dari pembawa acara Cathy Sharon ini mengaku tidak memiliki latar belakang bela diri sebelumnya. Ia pun menghabiskan wak-

Julie Estele tu selama enam bulan untuk latihan fisik dan bela diri. Dalam film ini, Julie mendapat porsi dua adegan berkelahi. Julie berlatih intensif hampir setiap hari untuk mempersiapkan film ini. “Biru-biru, kena pukul, sih biasa,” kata Julie tentang film actiom pertamanya.(ant)

Sumatera Utara

WASPADA Senin 7 April 2014

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:30 12:44 12:31 12:38 12:38 12:34 12:31 12:27 12:33 12:33

‘Ashar 15:34 15:45 15:35 15:39 15:40 15:42 15:36 15:31 15:37 15:35

Magrib 18:36 18:50 18:36 18:44 18:43 18:39 18:36 18:32 18:39 18:39



Shubuh Syuruq


19:44 19:58 19:45 19:53 19:52 19:47 19:45 19:40 19:47 19:47

04:58 05:10 04:59 05:05 05:05 05:03 04:59 04:55 05:01 05:00

05:08 05:20 05:09 05:15 05:15 05:13 05:09 05:05 05:11 05:10

L.Seumawe 12:36 L. Pakam 12:30 Sei Rampah12:29 Meulaboh 12:40 P.Sidimpuan12:28 P. Siantar 12:29 Balige 12:29 R. Prapat 12:26 Sabang 12:43 Pandan 12:30

06:23 06:35 06:23 06:30 06:29 06:28 06:23 06:19 06:26 06:25

Zhuhur ‘Ashar 15:37 15:33 15:32 15:43 15:35 15:34 15:35 15:32 15:46 15:37





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq







Shubuh Syuruq

18:42 18:35 18:34 18:46 18:32 18:34 18:34 18:30 18:50 18:35

19:51 19:43 19:43 19:55 19:41 19:42 19:42 19:39 19:58 19:43

05:03 04:57 04:56 05:08 04:57 04:57 04:57 04:54 05:10 04:58

05:13 05:07 05:06 05:18 05:07 05:07 05:07 05:04 05:20 05:08

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:30 12:31 12:41 12:34 12:31 12:38 12:26 12:36 12:29 12:28

18:34 18:36 18:47 18:39 18:36 18:43 18:31 18:41 18:34 18:34

19:43 19:45 19:56 19:47 19:45 19:52 19:40 19:50 19:42 19:42

04:58 04:59 05:08 05:02 04:58 05:05 04:54 05:04 04:58 04:56

05:08 05:09 05:18 05:12 05:08 05:15 05:04 05:14 05:08 05:06

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:27 12:34 12:32 12:28 12:29 12:27 12:26 12:36 12:30 12:25 12:27

15:34 15:42 15:37 15:31 15:34 15:33 15:33 15:37 15:35 15:31 15:31

18:31 18:38 18:37 18:33 18:34 18:31 18:31 18:42 18:35 18:29 18:31

19:40 19:46 19:45 19:41 19:43 19:40 19:39 19:50 19:43 19:38 19:40

04:56 05:03 05:00 04:55 04:58 04:55 04:55 05:03 04:59 04:53 04:55

05:06 05:13 05:10 05:05 05:08 05:05 05:05 05:13 05:09 05:03 05:05

06:28 06:22 06:21 06:32 06:21 06:21 06:21 06:18 06:35 06:23

15:36 15:36 15:42 15:40 15:34 15:40 15:31 15:40 15:35 15:33

06:23 06:24 06:33 06:27 06:23 06:29 06:18 06:29 06:22 06:21

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:20 06:27 06:25 06:20 06:22 06:20 06:20 06:28 06:23 06:18 06:19

Nelayan Dan Pengusaha Masih Kewalahan Cari Es Batangan P. BRANDAN (Waspada): Nelayan, pedagang es dan pengusaha ikan masih kewalahan akibat langkanya es batangan yang masuk Pangkalanbrandan. Beberapa nelayan daerah itu juga menunda berangkat ke laut kerena tidak adanya es sebagai bahan pengawet ikan. Pantauan Waspada di lokasi penjualan es batangan Jalan Babalan, Pangkalanbrandan, beberapa konsumen menunggu kedatangan truk pengangkut es. Beberapa peti tempat menyimpan es batangan terlihat kosong. Salah satu nelayan yang baru pulangmelautketikadikonfirmasi mengeluhkan hal tersebut sebab

harus menunggu tiga hingga empat jam kedatangan pasokan es batangan. Akibat menunggu berlarut-larut,kondisiikan,udang dan lainnya menjadi kurang bermutu. Menanggapi itu, Ketua Persatuan Nelayan Tradisional Indonesia (PNTI) Kab. Langkat prihatin terhadap nasib para

nelayan di daerah itu yang tidak melaut. “Gara-gara tidak ada es batangannelayanmengurungkan niat melaut dan sudah jelas banyak nelayan menganggur,” ucapnya prihatin. Dikatakan, aparat pemerintahan melalui Diskalanla Langkat seharusnya mencari solusi yang tepat dalam menanggulangi hal tersebut. “Kelangkaan es bantangan sudah berlangsung lama, seharusnya pemerintah melalui Diskanlasigapmeresponmasalah tersebut,” ujarnya. Akibatnya, lanjut Adhan, nelayan yang berkontribusi besar dalam mendongkrak perekono-

mian di Langkat menjadi dirugikan. “Beberapa nelayan tidak mendapatkan hasil belakangan inikarenatidakmelaut.Kalaupun melaut hasilnya minim. Sebab, hasil tangkapan dijual murah karena rusak akibat kurang es pengawet,” imbuhnya. Dia minta pemerintah dalam hal ini Diskanla Langkat segera membangun pabrik es batangan yang berfungsi untuk bahan pengawet hasil tangkapan nelayan.“Kemarinadabangunan pabrik es batangan di daerah Tanjungpura, namun sampai sekarang tak berfungsi,” jelasnya.(c01)

H. Amri Tambunan Resmikan Masjid Jami’ Agung Lubukpakam LUBUKPAKAM (Waspada): Bupati Deliserdang Drs. H. Amri Tambunan, Sabtu (5/4) meresmikan bangunan baru Masjid Jami’ Agung Lubukpakam yang tergolong megah dan dibangun lewat pola kebersamaan. Pembangunan masjid ini akan dijadikan iconnya Kab. Deliserdang sejalan dengan visi misi pembangunannya mewujudkan Deliserdang yang maju bersamamasyarakatyangreligius, sejahtera dan bersatu dalam kebhinnekaan. Bupati Deliserdang Drs H. Amri Tambunan didampingi Ketua TP PKK Hj. Anita Amri Tambunan, Dandim 0204/DS Letkol Arh Saeful Mukti Ginanjar, KajariLubukpakamKhairilAswan Harahap, SH, MHum, Asisten I H. Syafrullah, S.Sos, MAP unsur Muspida, para Camat dan tokoh agama, menyampaikan haru dan bangga melihat kebersamaan umat muslim di daerah ini yang diharapkan menjadi andalan untuk menapak majunya pembangun Deliserdang ke depan. Menurut Bupati, kehadirannya meresmikan Masjid Jami’

Agung ini memiliki arti tersendiri baginya dan keluarga, karena ini merupakan kunjungan kerja terakhirnyasebagai Bupati yang menjabat dua periode, dan berakhir 7 April 2014. Bupati yakin dengan rasa kebersamaan yang kokoh selama ini, masyarakat Deliserdang ke depanakanlebiheksismelangkah dan mengukir sejarah karena sudah berada pada posisi yang tepat, bahkan tidak akan ketinggalan di tengah lajunya kemajuan zaman. Dikatakan Bupati, kekuatan kebersamaan seperti ini harus terus dipertahankan bahkan ditingkatkan sebab sangat dibutuhkan dalam menyahuti tuntutankebutuhanmasyarakatyang kian berkembang. “Sebagai umat yang dimanjakanAllahSWTdalamkehidupan, kita dibekali ilmu pengetahuan dan kemampuan yang hampir tidak terbatas. Namun tujuan kita sesungguhnya tidak hanya sampai di situ, Allah telah mengingatkan kita akan menuju akhirat, karenanya mari kita tingkatkan keimanan dan ketaqwaan lewat

pengamalan ajaran agama termasuk dengan memakmurkan masjid ini,” harap Bupati. Sementara Kajari Lubukpakam Khairil Azwan Harahap, SH, M.Hum selaku ketua panitia pembangunan Masjid Jami’ Agung Lubukpakam, menjelaskan awalnya masjid itu dibangun pada 1968 di atas tanah seluas 3.200 M2, luas bangunan 1.121 M2 dengan daya tampung jamaah 1.500 orang. Kemudian dibangun kembali pada November 2012 yang pada peletakan batu pertamanya dilakukan Kajati Sumut saat itu, Dr. H. Noor Rochmad, SH, MH. Khairil Aswan yang didampingi Ketua BKM Afwan Helmi, MA dalam kesempatan juga tak lupa menyampaikan terimakasih kepada Pemkab Deliserdang di bawah kepemimpinan Bupati Deliserdang Drs. H. Amri Tambunan, yang banyak memberi perhatian bagi kelanjutan pembangunan masjid ini sehingga dapat terbangun dengan megah, dengan harapan dapat dipergunakanuntukkepentingankemaslahatanumatdalammenjalankan

perintah agama. Demikian juga kepada seluruh masyarakat yang telah berinfaq dengan menyisihkan sebagian rezekinya, hingga masjid yang memang didambakan ini bisa cepat selesai. Peresmian Masjid Jami’ Agung Lubukpakam yang megah ini ditandai dengan penandatanganan prasasti oleh Bupati Drs. H. Amri Tambunan sekaligus peninjauan dan sholat Zuhur berjamaah, serta penyerahan bingkisan kepada bilal masjid kota Lubukpakam sekitarnya. (crul/a06)

Waspada / Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu ditepungtawari sejumlah alim ulama dan pemuka masyarakat di Masjid As-Syuhada Stabat.

Ngogesa Sitepu Bersilaturrahim Dengan Ratusan Jamaah Umroh STABAT (Waspada): Keluarga BesarH.NgogesaSitepumenjalin temu silaturrahim bersama 200an jamaah umroh d ikediaman pribadinya di Desa Sei Limbat Kec. Selesai, Minggu (6/4). Silaturrahim diisi doa syukur atas terpilihnya kembali H. Ngogesa Sitepu,SHsebagaiBupatiLangkat periode 2014-2019. Jamaah yang hadir merupa-

kan jamaah yang diberangkatkan ke tanah suci Makkah Al Mukarramahuntukmenunaikanibadah umroh yang secara pribadi dibiayai H. Ngogesa Sitepu sejak 1999 hingga akhir Maret 2014. “Semoga pertemuan ini menambah rasa persaudaraan kita semua,” begitu kata H. Ngogesa didampingi istrinya Hj. Nuraida dan putri sulungnya Delia Pratiwi Br Sitepu, serta kedua putranya

RizkyYolanda Sitepu danWendy Isman Sitepu. Ngogesajugamenyampai-kan terima kasih atas dukungan dan doa dari para jamaah dan masyarakatLangkatumumnya,sehingga terpilih kembali sebagai Bupati Langkatpriodekedua. Sebelumnya Drs H. Legimun mewakili jamaah menyampaikanterimakasihserta tausyiah disampaikan Al Ustadz H. Rahul Irfan Yusuf.

Sehari sebelumnya, seribuan jamaah pengajian Al Hidayah se Kab. Langkat menggelar dzikir akbar sebagai wujud syukur atas terpilihnya kembali H. Ngogesa yang berpasangan dengan H. SulistiantosebagaiBupatidanWakil BupatiLangkatperiode2014-2019, diMasjidAs-SyuhadaStabat.Acara diisi dengan tausyiah Ustadz Syahrinal Lubis serta penyerahan balai dan tepung tawar.(a01)

Tabrak Lari, Satu Tewas P. BRANDAN (Waspada): Santi Maya Sari, 18, warga Gg Umar Kel. Pelawi Selatan Kec. Babalan tewas ditabrak bus angkutan kota mini jurusan Brandan - T. Pura, di Jalinsum km 75-76 Desa Securai Selatan, Kec. Babalan. Korban yang mengendarai sepedamotor Honda Supra Fit, ditabrak dari belakang dan tewas dalam perjalanan menuju rumah sakit. Menurut keterangan di TKP, pagi itu salah satu bus angkutan kota mini BK 1833 LR dari arah Pangkalanbrandan melaju kencang menuju Kota Tanjungpura. Bus tiba-tiba menghantam sepedamotor dikemudikan korban dari belakang. Akibatnya, korban terpental ke aspal. Setelah kejadian sopir bus langsung kabur dengan menurunkan penumpangnya. Warga berusaha mengejar pelaku tabrak lari dan sebagian lagi mengevakuasi korban ke rumahsakit. Namun usaha pengejarantakmembawahasil.Wargahanyamenemukanbusditinggal pelaku tak jauh dari TKP, tepatnya di Dusun Alurrejo, Desa Securai Selatan. Warga pun melaporkan temuan itu ke polisi. Sementara karena kondisinya, korban kemudian dievakuasi ke RS di Medan, namun meninggal dunia dalam perjalanan. Kaposlantas Pangkalanbrandan, Aiptu RismanTambunan ketika dikonfirmasi melalui handphone, Minggu (6/4). membenarkan korban meninggal dunia saat menuju rumah sakit di Medan. “Bus mini yang dikemudikan pelaku sudah diamankan,” terangnya.(c01)

KNIA Siap Songsong MEA 2015

Waspada/Khairul K Siregar

BUPATI Deliserdang Drs. H. Amri Tambunan didampingi Dandim 0204 DS Letkol Arh Saepul Mukti Ginanjar, Kajari Lubukpakam Khairil Aswan Harahap, SH, M.Hum, Asisten I H. Syafrullah, S.Sos, MAP menandatangani batu prasasti peresmian Masjid Jami’ Agung Lubukpakam.

Pemko Binjai Tetap Bersinergi Dengan Pesantren BINJAI (Waspada):Wali Kota Binjai HM Idaham, SH, M.Si mengemukkan, sektor pendidikan sangat penting ditingkatkan. Pemerintah Kota Binjai memprioritaskan sektor pendidikan termasuk pesantren. Hal itu dikemukakan HM Idaham, SH, MSi, Sabtu (5/4) malamdalamsilaturahmiPemko dengan Masyarakat Peduli Santri (MPS) di Pesantren An-Nursali, Jalan Kol.Yos Sudarso, Kelurahan Cengkeh Turi, Kec. Binjai Utara. Pemko Binjai menyatakan terimakasih kepada Dr. Suheldi sebagai Ketua Yayasan Ralas AnandayangmengelolaPesantren An-Nursali dengan santri dari yatimpiatudanorangtakmampu. “Banyakorangsuksesatauberha-

sil tidak peduli terhadap yatim piatu. Dr. Suheli sebagai warga BinjaiyangsuksesdiJakartasangat berbedadansangatpedulidengan yatimpiatudanmasyarakatmiskin, pekerjaan yang mulia ini akan diberikan Allah SWT nikmat dan rezeki yang berlimbah,” ujarnya. Idaham menegaskan Pemko Binjai tetap bersinergi dengan pondok-pondok pesantren, sebab pesantren akan mampu melahirkan generasi beriman, bertaqwa dan bermoral. Ketua Masyarakat peduli Santri (MPS) H. Wahyudi, SH menjelaskan, bagaimana awal berdirinya pesantren An-Nursali yang dipelopori Dr. H. Suheldi. Konsep dasar pendidikan di Pesantren An-Nursali diprioritaskan

kepadaanakyatimpiatudananak tidak mampu. Selama mengikuti pendidikan di pesantren tidak dikutip bayaran. Pesantren yang sudah berjalan tiga tahun, kini memasuki tahap pelepasan kelas 3tingkatTsanawiyah.“Bagaimana kelanjutan pendidikan ke tingkat lebihtinggi,halitulahsangatdiperlukan kepedulian masyarakat terhadapparasantri,”ujarWahyudi. KetuaYayasan Ralas Ananda yang mengelola Pesantren AnNursali, Dr. H. Suheldi menyatakan, pesantren yang berdiri 2010 kini mempunyai 72 siswa.Tahun ajaran baru nanti sudah banyak mendaftar, sehingga dilakukan seleksi. Yang paling diutamakan adalahanakyatimpiatudanorang tak mampu. (a04)

Waspada/Riswan Rika

WALI KOTA Binjai HM Idaham dan Ketua Yayasan Dr H. Suheldi serta Ketua MPS H.Wahyudi bersama santri Pesantren An-Nursali.

MEDAN (Waspada): General Manager PT Angkasapura II Kualanamu International Airport (KNIA) HT Said Ridwan ST, MM, menyatakan pihaknya siap menyongsong Masyarakat Ekonomi ASEAN 2015. “Lima elemen penting inti MEA 2015 adalah barang, jasa, investasi, modal dan pekerja terampil,” ujar GM KNIA HT Said Ridwan saat memberikan paparan dalam acara ‘Dialog Publik Kesiapan KNIA menyongsong MEA 2015 di Ballromm Arya Duta Hotel, kemarin. Said menyatakan bahwa transportasi udara dan logistik memiliki peran penting, untuk itu pihaknya telah mengambil langkah-langkah kesiapan KNIA dalam menyongsong MEA 2015. Pihaknya juga, kata Said, telah menyiapkan infrastruktur pendukung terminal kargo, yakni perkantoran dan pergudangan kargo lini 2. “Ini akan dimanfaatkan oleh freight forwarding, express curier dan dijadikan sebagai logistik park,” sebut Said yang pada kesempatan itu juga menyampaikan konsep aerocity dan aerotropolis serta peran stakeholder dan pemerintah, baik pusat maupun daerah. Fokus Sementara Ketua DPP Asosiasi Forwader Logistik Indonesia (ALFI) Yuki kepada Waspada di sela-sela acara mengaku bangga melihat kondisi KNIA. “Meski harus kita akui masih perlu pembenahan di beberapa sisi, namun secara menyeluruh saat perdana turun di bandara Kualanamu, saya sebagai bangsa Indonesia amat bangga,” ujarnya. Soal dialog publik yang dihadiriWagub T. Erry Nuradi, sejumlah asosiasi pengusaha, AP I, Custom Imigration Quarantene, dan pakar akademisi Sumut terkait hukum perdagangan,Yuki juga menyatakan salut dengan paparan GM PT AP II Kualanamu. “Saya harap beliau bisa fokus dengan yang disampaikannya, amat bagus,” ujarnya sembari berjanji jika anggota asosiasinya ada yang nakal tolong disampaikan,(m16)

Waspada/Ibnu Kasir

KETUA Forum Anak Bangsa Kab. Langkat, Delia Pratiwi br Sitepu, SH menyerahkan bingkisan kepada seluruh peserta kegiatan Porseni-RA se Kab. Langkat di alun-alun Tengku Amir Hamzah Stabat.

Langkat Menuju Generasi Beriman Dan Prestasi STABAT (Waspada): Pelaksanaan Pekan Olah Raga dan Seni Raudhatul Athfal (Porseni-RA) bertujuan untuk membangkitkan kreativitas dan kemampuan anak usia dini, sehingga daerah ini akan memiliki generasi beriman, berakhlak mulia serta memiliki ilmu dan prestasi yang baik. Kita semua berharap munculnya bibit bibit berbakat yang kelak mengharumkan nama daerah, kata Sekda H. Indra Salahuddin ketika membacakanpidatotertulisBupatiLangkatdalam acarapembukaanPorseni-RAdialun-alunTengku Amir Hamzah di Stabat, kemarin. SebelumnyaDeliaPratiwiSitepu,selakuKetua Forum Anak Bangsa Kab. Langkat mengemukakan, anak-anak usia dini ibarat selembar kertasputih.“Kitasebagaiorangtuawajibmemberi

pendidikan yang terbaik untuk mereka. Peran orangtua yang sangat dominan untuk mendidik anak sejak usia dini agar mereka tumbuh dan berkembang menjadi anak yang berbudi pekerti luhur dan berakhlak mulia,” kata Delia, yang merupakan putri sulung dari H. Ngogesa Sitepu. Ketua Ikatan Guru Raudhatul Athfal (IGRA) Kab.Langkat,Fatimahmenjelaskan,tujuankegiatan ini untuk melatih kemandirian, kejujuran dan sportifitas anak sebelum mereka memasuki pendidikan Sekolah Dasar. Peserta terdiri 1.962 dari 18 PC-IGRA se Kab. Langkat yang mengikuti berbagai perlombaan di antaranya lomba pidato, mewarnai, tahfiz, mars RA, gerak jalan, senam anak sholeh, menari sertalombagerakansholatsubuhberjamaah.(a01)

Taman Siswa T. Tinggi Kasus Oknum Polres Binjai Merasa Dibohongi Ditindaklanjuti Polres Langkat TEBINGTINGGI (Waspada): Perguruan Taman Siswa kota Tebingtinggi di Jalan Deblot Sundoro, Kel. Deblot Sundoro, Kec. Padang Hilir, merasa dibohongi. Pasalnya, pengelola pendidikan anak usia dini (Paud) ‘S’ selama tiga tahun menggunakan aset dan administrasi perguruan itu, tanpa berkontribusi terhadap sekolah, meskiPaud‘S’mendapatbantuanpuluhanjutarupiahdaripemerintah. Dari sejumlah berkas yang diperoleh, Paud ‘S’ berdasarkan akte pendirian dari notaris Denilah Shofa Nasution, SH, M.Kn No.57 tanggal 27 April 2011, merupakan lembaga yang tak punya hubungan organisatoris dengan Perguruan Taman Siswa. Namun bertahuntahun menggunakan aset Perguruan Taman Siswa dan memakai kop surat‘Wanita Taman Siswa’ dalam kegiatan administrasi dengan pihak luar. Dari penelusuran di Dinas Pendidikan kota Tebingtinggi, sejak 2010-2013 Paud ‘S’ telah menerima sejumlah bantuan APBN, APBD provinsi dan APBD kotaTebingtinggi. Dana yang diterima mencapai Rp60 juta lebih. Belum diketahui bagaimana pengelolaan dana bantuan dari pemerintah itu. Sedangkan jumlah anak yang diayomi di Paud ‘S’ dikabarkan tahun 2013/2014 hanya enam anak.(a09)

STABAT (Waspada): Polres Langkat terus menindaklanjuti laporan warga Jalan Hang Tuah Stabat yang dianiaya dan diperkosa oknum Polresta Binjai 17 Maret silam di dalam mobil di sekitaran Kota Stabat dan di salahsatu tempat di kawasan Diski. Kapolres Langkat melalui Kasat Reskrim AKP RosyidHartantomengatakan,pelakubelumdapat ditahan karena belum cukup bukti. “Kita telah dua kali memanggil saksi dari rekan tersangka namun tidak hadir. Dalam waktu dekat akan dilakukan panggilan paksa jika tidak mau hadir juga,” tegas Rosyid, Jumat (4/4). Kasat Reskrim menambahkan, berdasarkan informasi dia terima, pelaku bukan akan dimutasi ke markas kepolisian di Nias karena kasus tersebut, namun sebelumnya sudah berulangkali terlibat

masalah lain. Dalam pemerkosaan dan penganiayaan yang dilakukan Brigadir MTS kepada SA, 19, warga Jalan Hang Tuah dimaksud, diperoleh informasi dari sejumlah tetangga korban, keduanya sudah lama menjalin hubungan asmara namun karena sesuatu hal yang belum diketahui hubungan mereka kandas awal Maret. Kemudian, 17 Maret silam, korban yang mengaku hendak ke rumah kakaknya di Kel. Perdamaian Kec. Stabat sebagaimana laporannya di Mapolres Langkat, dihadang pelaku yang mengendarai mobil ToyotaVios. Korban dipaksa masuk ke mobil kemudian diperkosa dan dianiaya hingga luka memar, setelah itu dibawa ke salahsatu tempat di sekitaran Diski. Korban baru dapat lari setelah pelaku tertidur pulas. (a03)

Sumatera Utara

C2 WASPADA Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Opini, Artikel & Agama: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: H.Akmal AZ Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkili Harahap. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Efendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: Zultamser. Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); ; T. Junaidi (Hiburan); Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi), Hang Tuah Jasa Said (Potret). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkili Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Efendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Efendi, Hamdani, Rizky Rayanda. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra, Agustian Akhmad. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Munawardi Ismail, (Koordinator Liputan) Muhammad Zairin, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanaiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar. Singkil: Tarmizi Ripan, Mansurdin.

Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.  Perwakilan dan Biro Banda Aceh: Jalan Ratu Syaiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.  Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.  Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412.

KISARAN (Waspada): Polisi nyaris ditikam saat akan mengamankan seorang perampok. Karena melawan petugas dan mencoba melarikan diri, tersangka dilumpuhkan dengan tembakan. Informasi dihimpun Waspada, Minggu (6/4), tersangka DD, 22, warga Jalan Kartini, ditahan karena terlibat perampokan sepedamotor di Jalinsum, tepatnya di depan Hotel Nusa Indah, Kisaran, dua bulan lalu, dan akhirnya ditangkap, Sabtu (5/4) pukul 00:00. “Karena melawan dan nyaris menikam petugas dengan senjata tajam, dan berusaha kabur, demi keamanan terpaksa kami lumpuhkan dengan menembaknya dua kali di bagian kaki, kiri dan kanan,” jelas Kasat

Reskrim Polres Asahan AKP Hendra Eko Triyulianto, melalui Kanit Resum Ipda Rianto, saat berbincang dengan Waspada. Rianto juga menjelaskan, sebelumnya diamankan salah seorang rekannya AB, warga yang sama, dan selanjutnya mengarah ke DD.Tersangka juga sempat kabur ke luar kota menghabiskan uang hasil kriminal dengan berfoya-foya. “Saat melakukan tindakan kejahatan, mereka ada berenam. Dan sekarang kita masih memburu empat orang lagi.

Kasus ini masih dalam tahapan pengembangan,” jelas Rianto. Rianto juga menjelaskan, selain perampokan sepedamotor, tersangka juga terindikasi terlibat tujuh tindakan kriminal lainnya, di antaranya penjambretan. “Kita masih melakukan pengembangan, sehingga semua tersangka dapat diringkus,” jelas Rianto. Rianto juga mengimbau kepada masyarakat untuk selalu waspada, dan diharapkan jangan mengendarai sepedamotor di tempat sunyi larut malam. “Masyarakat harus selalu hatihati dan waspada, karena tindak kejahatan bukan karena niat, karena ada kesempatan,” jelas Rianto. (a15)

PPS Dan Sekdes Bagan Bilah Delapan Bulan Tidak Terima Honor RANTAUPRAPAT (Waspada): Diduga ada permainan oknum Ketua PPS dan Sekretariat PPK, Panitia Pemungutan Suara (PPS) dan Sekretariat Desa Bagan Bilah, Kec. Panai Tengah, Kab. Labuhanbatuselamadelapanbulan tidak menerima honor alias gaji. Suwandi anggota PPS dan Parti Ariani Sekretariat PPS Desa Bagan Bilah kepada wartawan, Kamis (3/4) mengatakan, mereka sudah delapan bulan tidak menerima honor alias gaji sebagai anggotaPPSdanSekretariatPPSDesa Bagan Bilah Kecamatan Panai Tengah.“Sejak April 2013 dilanjutkan tahapan Pileg, kami baru 2 kali menerima honor yakni bulan AprildanbulanSeptember,selanjutnya belum pernah,” jelasnya. “KetuaPPSDesaBaganBilah, Anwar Rambem selaku perwakilan yang mengambil uang honor ke Sekretariat PPK (Panitia Pemilihan Kecamatan), selalu beralasan honor tersebut belum diterima,” ujarnya. Sambil menunggu, akhirnya PPS dan Sekretariat menanyakan hal itu kepada Sekretariat PPK Kecamatan, dan oleh PPK Kecamatan diakui bahwa honor mereka telah dibayarkan setiap bulannya kepada Anwar selaku Ketua PPS Desa Bagan Bilah. Anwarpuntakbisamengelak, dia mengakui kepada rekanrekannya bahwa dana itu dia pakai. “Setelah kami tanya, dia mengaku kalau uang itu dia pakai

dan berjanji akan membayar. Namun, sampai sekarang beliau tidak kunjung hadir,” jelas Pariati. Namun dibalik itu, mereka heran kenapa honor mereka bisa dibayarkan oleh Sekretariat PPK Kecamatan, padahal itu jelas ada pertanggungjawabannya, “Herankamipak,kamitakpernah menandatangani honor kok tiap bulan bisa dibayar,” tegas mereka. Tidak hanya masalah gaji dan biaya sekretariat, untuk biaya Bimtek (Bimbingan Teknis) mereka harus mengeluarkan biaya sendiri, sebab Ketua PPS Anwar Rambe sudah jarang kelihatan, “Padahal banyak KPPS masih yang belum mengerti pelaksanaan Pileg, mulai dari pemungutansuarahinggapenghitungannya di desa kami ini. SedangkanwaktuPilegsudahdekat, jadi sudah dua kali kami mengadakan Bimtek terhadap KPPS dengan biaya sendiri,” katanya. Mereka berharap agar persoalan PPS di Desa Bagan Bilah segera diselesaikan pihak Kecamatan PPK dan Sekretariat Kec. Panai Tengah, jika ingin Pileg Tahun 2014 di desa Bagan Bilah berjalan sesuai yang diinginkan. Sekretariat PPK Kec. Panai Tengah melalui Bendahara Ida mengaku,honoranggotaPPSdan SekretariatDesaBaganBilahtelah dibayarkan melalui Ketua PPS Desa Bagan Bilah, Anwar Rambe. Namun, mereka baru tahu kalau honoritutidakdibayarkansetelah

anggota PPS dan Sekretariat datang menanyakan persoalan honor yang belum mereka terima ke kantor Sekretariat PPK Kec. Panai Tengah. “Ya sudah dibayar itu melalui Ketua PPS desa Bagan Bilah. Kita puntahusetelahanggotaPPSdan Sekretariat melapor bahwa dana itu belum dikasih kepada mereka. Sekarang sudah kita suruh langsung mereka mengambilnya,” jelas Ketua Dahcyar PPK Kec. Panai Tengah. Tokoh Masyarakat Desa Bagan, Bilah Burhan, kepada wartawan mengatakan, beliau berharap pihak aparat hukum seperti Kepolisian dan Kejaksaan Negeri Rantauprapat mengaudit dana PPK di Kec. Panai Tengah. Sebab tidak terlepas hampir di seluruh PPS desa Bagan Bilah terjadi seperti ini. “Kalau di tingkat penyelengara seperti ini, bagaimana Pemilu mau Jurdil. Harus diaudit itu, jelas ada permainan antara Ketua dan Sekretariat. Artinyakan laporan mereka fiktif, ini uang negara kalau tidak terlaksana Pemilu di sini, kami rugi,” ujarnya. Sekretaris KPU Labuhanbatu Gargaran Siregar, Kamis (3/4), mengatakan, honor anggota PPK dan PPS setiap bulannya telah mereka transfer melalui rekening masing-masing sekretariat kecamatan di Kab. Labuhanbatu. “Masalah honor tidak pernah ada hambatan,” katanya. (c07)

TANJUNGBALAI (Waspada): Enam orang Bunda Pendidik Anak Usia Dini (PAUD) dan pengurus kecamatan Himpunan PAUD Indonesia se Kota Tanjungbalai, dikukuhkan di pendopo rumah dinas kepala daerah Rabu (2/4). Mereka dikukuhkanlangsungolehBunda PAUD Kota Tanjungbalai, Dra. Hj. Armaini Jannah, merujuk pada SK Wali Kota Tanjungbalai Nomor 900/425/IV/2014. Bunda PAUD yang dikukuhkan itu, untuk Kec. Datukbandar Nazla, Kec. Datukbandar Timur JulianiSukiman,Kec.Tanjungbalai Selatan Nurmalini, Kec. Tanjungbalai Utara Cut Azizah, Kec. Seitualang Raso Apri Meliani

Nasution, dan Kec. Teluknibung Warda Ningsih. Untuk Ketua dan Sekretaris Himpunan Pendidik Anak Usia Dini Indonesia Kec. Datukbandar MariatidanNurlainiSamosir,Kec. Datukbandar Timur Nurhayati Simangunsong dan Nunung Puwanti,Kec.TanjungbalaiSelatan Asmariani dan Henni Simangunsong, Kec. Tanjungbalai Utara Siti Aisyah dan Mayasari, Kec. Seitualang Raso Nurhayati Panjaitan dan Agustina, serta Kec. TeluknibungEviNadlidanSarifah Khairani. Dalam sambutannya, Wali Kota Tanjungbalai Thamrin Munthe mengingatkan, Bunda PAUD di tingkat kota hingga

kecamatan, wajib terlibat dan memberikan kontribusi membinasertamengembangkan lembaga PAUD di wilayahnya. “Sedikitnya 70 persen kejiwaan anakdipengaruhiolehlingkungan, maka sejak belia, anak-anak harus diajarkan berprilaku baik dan santun,” pesan Thamrin. Disebutkan alumni IAIN Sumut itu, membimbing anak merupakan tanggungjawab bersama, sebab sejak dini kita harus memberikan terbaik bagi mereka.“Palingpentingituadalah memberikan pemahaman ilmu agama, sosial, budaya sehingga anak-anak kita menjadi generasi yang berkarakter,” ujar Thamrin Munthe. (a14)

Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Plt Sekdakab Kukuhkan FMM Gen Emas En Pabolo RANTAUPRAPAT (Waspada): Plt. Sekdakab Labuhanbatu mengukuhkan Forum Masyarakat Madani (FMM) Gen Emas En Pabolo Kab. Labuhanbatu yang diketuai oleh Sabaruddin Marpaung, Kamis (3/4) di Hotel Permata Land Jalan AchmadYani, Rantauprapat. Selain Sabaruddin Marpaung, para Pengurus Forum Masyarakat Madani yang turut dikukuhkan, terdiri dari Wakil Ketua I Tatang Hidayat,Wakil Ketua II Rol Bariah,Wakil Ketua III Mariani danWakil Ketua IV Pdt. MA Siagian. Sedangkan posisi Sekretaris diduduki oleh Joko Gunawan, Wakil Sekretaris I Masri Halim, Sekretaris II Aswin Syahputra dan Lutfiani Siambatan duduk sebagai Bendahara. Plt. Sekdakab Labuhanbatu H Ali Usman Harahap, SH dalam pidato pelantikannya mengatakan, Pemkab Labuhanbatu sangat bergembira dan menyambut baik atas terbentuknya Forum Masyarakat Madani ini. Ternyata, masih ada orang atau masyarakat yang mau bergerak membantu pemerintah dalam bidang kesehatan dan dapat memberikan kontribusi yang positif. Sabarauddin Marpaung dalam sambutannya mengharapkan, agar pemerintah dan stakeholder dapat mensupport kegiatan yang akan dilaksanakan FMM di Kab. Labuhanbatu. (c07/a18)

Waspada/Budi Surya Hasibuan

PLT Sekdakab Labuhanbatu H. Ali Usman Harahap, SH diabadikan bersama pengurus FMM Labuhanbatu.

Senin 7 April 2014

Perampok Ditembak

Enam Bunda PAUD Di T. Balai Dikukuhkan

Hubungi kami


Waspada/Rahmad F Siregar

BUNDA PAUD Kota Tanjungbalai, Dra. Hj.Armaini Jannah, mengukuhkan enam orang Bunda PAUD dan pengurus kecamatan Himpunan PAUD Indonesia se Kota Tanjungbalai di pendopo rumah dinas kepala daerah, Rabu (2/4).

Aksi Spekulan Lambungkan Harga Tanah LIMAPULUH(Waspada): Pembangunan pelabuhan di kawasan Desa Gambus Laut, Kec. Limapuluh, Kab. Batubara yang terintegrasi dengan program MP3EI Sei Mangke, membuat makelar dan spekulan tanahtelahmelambungkanharga tanah di sekitar Desa Gambus Laut, Perupuk, dan Kuala Indah. Direktur Eksekutif Batubara Hijau Muhammad A Sahuri kepada Waspada, Kamis (3/4) mengungkapkan, kondisi garis pantai Batubara khususnya di Desa Kuala Indah, Gambus Laut dan Perupuk menurut peta kehutanan ada yang berstatus kawasan hutan lindung dan ada juga Hutan Produksi Terbatas (HPT). Dengan rencana pembangunan pelabuhan yang akan menggunakan lahan pesisir pantai ini, hampirseluruhgarispantaisudah

dimiliki perorangan. Tidak saja lahan darat maupun mangrove, bahkan laut pun sudah ada yang memilikinya dengan ganti rugi terhadap penduduk. Penjual belian lahan dan laut ini juga dikuatkan dengan surat dari pejabat berwenang. “Kami melihat ada upaya untuk mengaburkan status lahan dipesisir pantai, mangrove dan laut itu dari kawasan hutan yang merupakan milik negara menjadi milik perorangan. Sehingga, saat nanti terjadinya pembebasan lahan, spekulan akan meraup untung, maka terjadilah situasi negara beli tanah negara,” kata Sahuri. Lebih lanjut dikatakannya, Departemen Kehutanan perlu melihat masalah ini menurut peraturan danperundang-undangan.PelindojugasebagaiBUMN

perlu mencermati masalah ini sehingga dana pemerintah tidak dimanfaatkan pihak-pihak yang ingin memperkaya diri dengan cara tidak sah. Sahurimemintasemuapihak mempelajari kembali legalitas pengalihan hak atas lahan yang diperjual belikan itu. “ Apakah bisa laut dan hutan diperjual belikan, bagaimana legalitasnya,” kata Sahuri. Sebelumnya Camat Limapuluh Drs Darmansyah menjawab Waspada mengatakan, selama ia menjabat tidak pernah mengeluarkan atau menerbitkan surat tanah untuk kawasan tersebut. Ia juga mengakui kalau saat ini harga lahan disana sudah melambung. Tanah seluas satu rante atau 400m bujur sangkar bisamencapaiRp60sampaiRp80 juta. (c05)


KASAT Reskrim Polres Aashan AKP Hendra Eko Triyulianto, bersama Kanit Resum Ipda Rianto memeriksa keadaan DD yang dilumpuhkan dengan timah panas di dua betis kakinya, dan menjalani perawatan di RSUD Kisaran.

Kampanye Terakhir Golkar Tanjungbalai:

Di Era Orde Baru Rakyat Senang TANJUNGBALAI (Waspada) : Kampanye Partai Golkar di Lapangan Sepakbola Kapias Pulau Buaya, Kec. Teluknibung, Kota Tanjungbalai berlangsung meriah dihadiri ribuan simpatisan dan kader, Sabtu (5/4). Pada kampanye hari terakhir itu, partai berlambang pohon beringin menghadirkan juru kampanye nasional, Mahadi Sinambela dan Ahmad Doli Kurnia Tanjung. Sementara dari Provinsi Sumatera Utara, Romay Noor dan dari DPD Golkar Tanjungbalai Rolel Harahap. Mahadi Sinambela dalam orasi politiknya mengangkat isu zaman orde baru yang dipimpin Partai Golkar rakyat sangat senang. Sebab harga kebutuhan pokok terjangkau karena Indonesia waktu itu swasembada pangan. “Saat ini harga terus melambung tinggi, Indonesiaharusimporberas,daging,cabai,bahkan garam. Ini sangat memprihatinkan. Untuk itu, mari bersama-sama memenangkan Partai Golkar agar rakyat hidup senang, sejahtera, dan gembira,” kata Mahadi.

Mahadi mengungkapkan, visi Partai Golkar sangat jelas yakni membangun Indonesia menuju kesejahteraan rakyatnya. Saat ini ungkapnya, para kader Golkar memiliki sumber daya manusia yang mumpuni serta peduli dengan rakyatnya. “Di Orde Baru, stabilitas politik terjamin, pertumbuhan ekonomi terus meningkat, serta pemerataan pembangunan,” ujar Mahadi. Sementara, Ketua DPD Partai Golkar Tanjungbalai Rolel Harahap mengajak seluruh rakyat Indonesia memilih Partai Golkar. Agar kelanjutan pembangunan khususnya di Tanjungbalai terus berjalan dan semakin ditingkatkan. Sedangkan Romay Noor yakin bahwa 2014 merupakan tahun kemenangan Golkar. Menurutnya, hal itu dibuktikan dengan semakin solidnya seluruh kader maupun simpatisan. “Mari rapatkan barisan, kemenangan sudah di depan mata,” kata Romay Noor. Kampanye kali itu menghadirkan artis Dedi KDI yang diundang langsung dari Jakarta. (a32)

Kapoldasu Komitmen Berantas Judi Dan Narkoba SEIRAMPAH (Waspada): Sejak dari awal menjabat, Kapolda Sumut telah berkomitmen memberantas penyakit masyarakat (Pekat) khususnya Narkoba dan Judi. “Saya tidak akan pernah menjalin berhubungan atau kerja sama dengan jaringan narkoba dan judi. Begitu juga himbauan saya kepada para Kapolres, dalam prinsip saya hidup sekali maka buatlah berarti.” Demikian dikatakan Kapoldasu Irjen. Pol. Drs. SyarifGunawandidampingiDirIntelPoldasuKombes Pol. Aris Cahyo Sutikno dan Karorena Poldasu, Kombes Pol. Kasmudi pada Kunker) ke Markas Polres Serdang Bedagai (sergai), Kamis (3/4). Kedatangan Kapoldasu beserta rombongan disambut Kapolres Sergai, AKBP B Anies Purnawan,Waka Polres, Kompol Drs. Soepriatmono, para Kabag, Kasat, Kapolsek, Perwira dan Bintara di jajaran Polres Sergai serta pengurus Bhayangkari Cabang Sergai. Syarif Gunawan juga mengatakan, dirinya tidak akan mengintervensi para penyidik dan para Kapolres dalam penanganan setiap kasus.

Namun, jika melanggar tugas, konsekuensinya akan berhadapan dengan hukum itu sendiri. Kepada personil Kepolisian, Kapoldasu mengingatkanjanganadalagipolisiyangmelanggar peraturan dan ketentuan sebagai anggota Polri. Terlebih sampai terjebak di dalam lingkaran narkoba dan perjudian serta penyakit masyarakat lainnya yang semua itu akan berakhir dalam jeruji Lapas dan akan memperburuk citra Kepolisian. Terkait Pileg 9 April, Kapoldasu dengan tegas menyatakan polisi harus netral, tidak memihak. “Jangan ada personil polisi yang bermain-main dengan caleg atau parpol meskipun saudara atau keluarga sendiri,” tegasnya. Sebelumnya Kapolres Sergai, AKBP B Anies Purnawan melaporkan, untuk pengamanan Pileg 2014,9April,PolresSergaimenyiagakan350personil, 61 personil BKO dari Polda, 28 personil cadangan, duapletonTNIdariKodim0204DS,serta2.388orang Pam Swakars. Dan selama tahapan Pileg, pihaknya tetap melakukan pengamanan dan pengawasan termasuk pengamanan kantor KPUD Sergai, serta pengamanan pelaksanaan kampanye. (c03)

Pemko T. Balai Fokus Pembinaan SDM TANJUNGBALAI (Waspada): Pemerintah Kota Tanjungbalai akan memprioritaskan pembinaan sumber daya manusia (SDM) yang mampu bersaing di era globalisasi ini. “Minimnya sumber daya alam sebagai penunjang pendapatan asli daerah harus diimbangi dengan program yang bermuara kepada peningkatan SDM,” ujarWali Kota Tanjungbalai Dr. H. Thamrin Munthe (foto), Rabu (2/4). Dikatakan Thamrin, Instruksi Menteri Aparatur Negara (Menpan) RI, Kabupaten/Kota yang minim sumber daya alam harus bisa mengoptimalkan program perencanaan peningkatanSDM,yangtujuannyakepentinganindividu, organisasidankepentingannasional.Perencanaan

itu, menurut Thamrin, harus berhubungan dengan kebutuhan Pemkohariinidanpadamasaakan datang, serta diselaraskan dengan Visi-Misi Pemda. “Salah satu misi Pemko, mewujudkanTanjungbalai sebagai kota berpendidikan, perdagangan dengan masyarakat yang sejahtera,” tukas Thamrin. Bidang pendidikan, menurut Thamrin, harus diawali dengan menanamkan pendidikan karakteristik kepada anak sejak usia dini, sehingga akan muncul generasi yang berkarakter, dan mengerti apa yang dibuat hari ini maupun akan datang. Untukperdagangan,dikatakan, Pemko juga telah membina masyarakat,khususnyapelakuusahakecilmenengah, serta pedagang keliling. (a14)

Ali Ahmad, Warga Miskin Yang Luput Dari Perhatian Pemerintah TGTIRAM (Waspada): Ali Ahmad, 85 seorang duda yang tidak mempunyai pekerjaan tetap, penduduk Gang Popat, Desa Bogak, Kec Tanjungtiram, Kab. Batubara luput dari perhatian pemerintah. ‘’Jangankan mendapatkan bantuan raskin, maupun program kesehatan dan bentuk sosial lainnya. KTP saja tidak punya karena tidak ada membantu untuk mengurus, ‘’tukasnya, didampingi Polmas Irwansyah kepada Waspada, di Tanjungtiram, Kamis (3/4). Sejak istrinya meninggal dunia delapan tahun lalu, kehidupannya tidak menentu terkadang tidur di gudang maupun di rumah ibadah sambil mengharapkan belas kasihan orang untuk membantu makan. Sedangkan mengharapkan sanak keluarga tidak memungkinkan karena mereka umumnya hidup pas-pasan bekerja sebagai nelayan dan ibu rumah tangga. Sejak KTP sebagai identitas dirinya hilang, sampai sekarang tidak pernah diurus karena tidak tahu. Dan kemungkinan karena tidak memiliki KTP tersebut dia tidak terdata di desa sehingga tidak tersentuh program Pemerintah. ‘’Apakah itu bisa di dapat secara gratis karena untuk membayar uang tak ada. Apa yang bisa saya berikan untuk makan saja mengharapkan belas kasihan orang,’’katanya. Belum lagi bila dirinya jatuh sakit susah untuk berobat, sehingga perlu perhatian pemerintah untuk mencari solusi hal itu agar dirinya dapat

hidup layak sebagaimana warga lainnya. ‘’Jangan karena ketidaktahuan, dirinya terus dibodoh-bodohi.Disinilahperansebagaiaparatur Pemerintah apakah desa maupun kecamatan sebagai pelayan dan pengayom masyarakat membantuAli,‘’ujarIrwansyah.AliAhmadmudah untuk ditemui karena sering mangkal di kedai kopi dekat Pos Polisi Tanjungtiram. (a13)

Waspada/Iwan Has

ALI Ahmad 85 seorang duda warga Tanjungtiram, Kab Batubara yang luput dari perhatian pemerintah didampingi petugas Polmas.

Sumatera Utara

WASPADA Senin 7 April 2014


Banyak Warga Tak Tahu Cara Pemungutan Suara SIMALUNGUN (Waspada): Meskipun pelaksanaan Pemilu Legislatif sudah di ambang pintu, namun kalangan pengurus partai politik (Parpol) dan Caleg (Calon Legislatif) di Kab. Simalungun, khawatir pelaksanaan Pemilu Legislatif 9 April tidak berjalan sesuai diharapkan, akibat lemahnya sosialisasi pelaksanaan pemilu. Masih banyak warga memiliki hak pilih belum mengetahui tata cara pemungutan suara pemilu. “Jangankan masyarakat awam, unsur PPK (Panitia PemilihanKecamatan)danPPS(Panitia Pemungutan Suara) masih bertanya tentang tata cara pemu-

ngutan suara,” tegas Edy Sumanto, Wakil Ketua DPD PAN Simalungun, Jumat (4/4). Dikatakan, sosialisasi dilakukan KPU Kab. Simalungun masih

sangat lemah. Hal ini dibuktikan dengan banyak masyarakat yang belum mengetahui tata cara pemungutan suara di TPS. Padahal, kata dia, pelaksanaan pesta demokrasi yang digelar sekali dalam lima tahun itu sudah tinggal hitungan hari. “Sewaktu saya turun ke beberapa desa, masih banyak warga yang bingung, bahkan ada unsur PPK dan PPS yang notabenenya sebagai penyelenggara pemilu di kecamatan juga masih bertanya, apakah sistem pemungutan suara dilakukan dengan cara mencontreng atau menco-

blos. Kertas suara ada gambar atau tidak. Inikan aneh, panitia saja belum begitu memahami, apalagi masyarakat awam,” ujar Edy dengan nada pesimis. Menurutnya, lembaga paling bertanggungjawab dalam sosialisasi tentang pelaksanaan dan tata cara pemilu adalah pihak Komisi Pemilihan Umum (KPU) Kab. Simalungun. “Tidak ada alasan lain, KPU yang paling bertanggungjawab mensosialisasikannya,” tandas Edy. Memang, lanjutnya, pihak KPU ada melakukan sosialisasi

melaluipemasanganspandukdan selebaran tentang pelaksanaan pemilu.Namunsosialisasidengan bentuk spanduk dan selebaran kurangefektif,karenatidaksemua orang yang rajin membaca spanduk atau selebaran. “Seharusnya, sosialisasiyangefektifdanhasilnya bisa maksimal dengan cara simulasi langsung bersama kelompok masyarakat,” kata Edy. Sementara, komisioner KPU Simalungun membidangi Divisi Humas, Adelbert Damanik, saat dihubungiSabtu(5/4),tidakmenjawab SMS yang dikirim. (a29)

Pemilih Khusus Di P.Sidimpuan Tak Dapat Undangan Memilih P. SIDIMPUAN (Waspada): Berdasarkan Peraturan Komisi Pemilihan Umum (PKPU) No.26 Tahun 2013, pemilih yang terdaftar dalam DPT dan DPK diberikan formulir model C6 atau undangan memilih, namun di P.Sidimpuan hanya yang terdaftar di DPT mendapat undangan memilih, sedangkan pemilih khusus tidak diberikan. Informasi diperoleh Waspada, Minggu (6/4) di P.Sidimpuan,

surat pemberitahuan tentang waktudantempatmemilihdiTPS berbentuk formulir C6 sebagai bagian dari logistik Pemilu Legislatif2014telahdidistribusikan KPU pada 3 April 2014 ke setiap kecamatan di Kota P.Sidimpuan. Jumlahnya sesuai dengan jumlah Daftar Pemilih Tetap (DPT) 141.797 lembar. FormulirC6yangdidistribusikan untuk Kec.P.SidimpuanUtara terdiri dari 158 TPS sebanyak

APK Masih Marak Di P.Sidimpuan P. SIDIMPUAN (Waspada): Hari pertama minggu tenang, Alat Peraga Kampanye (APK) partai politik peserta Pemilu dan caleg dariberbagaitingkatan,termasukcalonDPD,masihbanyakditemukan di berbagai ruas jalan di Kota P.Sidimpuan. Bahkan, terkesan tidak ada pembersihan dari penyelengara Pemilu. Pantauan Waspada, Minggu (6/4), spanduk dan baliho yang seharusnya ditertibkan penyelenggara Pemilu sejak pukul 00:00 usai pelaksanaan kampanye terakhir 5 April 2014 tersebut, ternyata tidak ditertibkan karena hingga pukul 15:00 , bendera, baliho dan spanduk berbagai ukuran termasuk milik calon DPD RI masih banyak ditemukan. Seperti di sepanjang Jalan Mandailing, Kec. P.SidimpuanTenggara yang terhubung ke Jalan Imam Bonjol sampai ke Jalan SM Raja, Kec.P.Sidimpuan Selatan hingga ke wilayah Kec. Batunadua, bendera partai politik, serta baliho dan spanduk caleg DPRD Kota P.Sidimpuan, DPRD Provinsi Sumatera Utara dan DPRRI masih banyak ditemukan. Hal serupa juga ditemukan di Jalan Kenanga, Jalan Tapian Nauli, Jalan Imam Bonjol, Jalan Merdeka , Jalan St. Soripada Mulia, Jalan St.Muhammad Arif dan sejumlah ruas jalan lainnya, termasuk di Pusat Kota P.Sidimpuan APK dari sejumlah partai politik peserta Pemilu Legislatif 2014 masih berkibar dengan bebas. ParlagutanHarahap,DivisiPenindakandanHukumPanwasluKota P.Sidimpuan ketika dikonfirmasi Waspada mengatakan, pembersihan terhadapAPKtersebutmerupakantanggungjawabbersamapenyelenggara pemilu dengan Pemerintah Kota P.Sidimpuan. (cml)

22.497 lembar, Kec. P.Sidimpuan Selatan terdiri dari 155 TPS sebanyak 45.714 lembar, Kec.P.SidimpuanTenggara terdiri dari 77TPS sebanyak 22.497 lembar, Kec. P.SidimpuanBatunaduterdiri dari 66TPS dapat jatah 13.977 lembar, Kec.P.Sidimpuan Hutaimbaru terdiridari49TPSsebanyak11.503 danKec.P.SidimpuanAngkolaJulu terdiri dari 19 TPS sebanyak 5.793 lembar formulir C6. Surat pemberitahuan tentang waktu dan tempat memilih di TPS atau yang lazim disebut undangan memilih kemudian didistribusikan Pantia Pemilihan Kecamatan (PPK) ke Panitia Pemungutan Suara (PPS) dan diteruskan ke KPPS (Kelompok PanitiaPemungutanSuara)untuk

disampaikan ke masing-masing pemilih yang terdaftar di DPT. Namun, 4.442 pemilih yang terdaftar pada Daftar Pemilih Khusus (DPK) tidak diberikan dengan alasan logistik yang disiapkan sesuai julah DPT. Padahal menurut Peraturan KPU No.5Tahun 2014 sebagai perubahan dari Peraturan KPU No.26 Tahun 2013 dalam Pasal 15 ditegaskan,pemilihyangterdaftar di DPT, DPTb dan DPK diberikan formulir C6. Divisi Logistik dan Keuangan KPU Kota P.Sidimpuan HR.Ranto Siregar,S.Ag, M.Si kepada Waspada sebelumnya mengatakan jelang hari ‘H’ 9 April 214, selain formulir C6, logistik pemilu yang sudahdidistribusikan adalahDPT

Logistik Pemilu Didistribusikan SIBUHUAN (Waspada): Logistik pemilihan umum (Pemilu) legislatif2014mulaididistribusikan KomisiPemilihanUmumDaerah (KPUD) di berbagai kabupaten/ kota di Sumut, termasuk KPUD Kab. Padanglawas (Palas), KPUD Padanglawas Utara (Paluta) dan KPUD Kab. Mandailing Natal. ‘’Sudah mulai didistribusi ke seluruhTempatPemungutanSuara di12kecamatanse-Kab.Padanglawas,’’ujarDivisiLogistikKPUDPalas, Rahmat Efendi Siregar SS kepada wartawan, Minggu (6/4). Pendistribusian logistik langsung ke PPS ini berlangsung dua

hari, untuk tahap pertama logistik didistribusi ke enam kecamatan yang jarak tempuhnya lebih jauh, yakni Kec. Sosa, Kec. Batang Lubu Sutam, Kec. Hutaraja Tinggi, Kec. Barumun Tengah, Kec. Sihapas Barumun, dan Kec. Huristak Di Paluta Sedangkan di Padanglawas Utara (Paluta), pendistribusian logistik dan perlengkapan Pemilu 2014 akan dimulai serentak, Jumat (4/4). Pendistribusian logistikpemiluinijugamelibatkan PPK, PPS dan KPPS yang diawasi langsungPanwasmasing-masing di kecamatan.

Tenunan Ulos Laris Manis Di Pav. Samosir PRSU SAMOSIR (Waspada): Selama berlangsungnya even Pekan Raya Sumatera Utara (PRSU) di Jalan Jenderal Gatot Subroto, Tapian Daya, Medan, pengunjung dikabarkan meningkat dua kali lipat dibandingkan tahun sebelumnya. ‘’Lihat saja, hampir sepuluh buku tamu terisi penuh selain ada juga tamu yang tidak menandatangani buku tamu,’’ ujar Kabag Perekonomian Viktor Sitinjak, SE kepada Waspada, Minggu (6/ 4). Di paviliun ini, tenunan ulos laris manis. Ditambahkannya, Pemkab Samosir pada Even PRSU menampilkan berbagai karya seni ukiran, pakaian tenunan ulos, bahan pertanian seperti kentang, bawang merah, brosur tentang Kehutanan Samosir dan lainnya. Namun, kata dia, dari semua yang dipamerkan di Pavilun Pemkab Samosir, pengunjung lebih banyak tertarik dan membeli bahan/ pakaian tenunan ulos binaan Dinas Koperindag Samosir, sehingga stok yang tersedia disebutkan hampir habis, kemudian disusul produk pertanian. Kegiatan pameran di PRSU melibatkan beberapa satuan kerja di lingkungan Pemkab Samosir di antaranya Dinas Pertanian, Koperindag, Kehutanan, Ketahanan Pangan dan lainnya. (c11)

G-Resources Martabe Gold Mine Gelar Operasi Katarak Gratis KABANJAHE (Waspada): Hasil pemeriksaan mata dan skrining di beberapa posko pengungsian didapatkan 121 jiwa pengungsi Sinabung terkena katarak. G-Resources Martabe Gold Mine bekerjasama dengan Kodam I/BB akan selenggarakan operasi katarak gratis, 8-10 Juni di RSU TNI Putri Hijau Medan bagi pengungsi Sinabung dan 1.500 pasien katarak lainnya. Pemeriksaanmatadanskriningkatarakgratisbagi15ribupengungsi sinabung di 32 titik dilaksanakan 5-6 April, lebih 30 relawan, termasuk dokter mata dan perawat mahir dikerahkan untuk kegiatan ini, ungkap manajer senior komunikasih korporat G-Resources Tambang Emas Martabe Katerina Siburian kepada Waspada, Sabtu (5/4). Empattitikposkodijadikantempatpemeriksaanmatadanskrining yakni posko Masjid Agung, Zentrum GBKP, gedung serbaguna KNPI, dan Paroki Gereja Katolik Kabanjahe bekerjasama dengan A New Vision dan Kodam I/BB gelar bakti sosial pemeriksaan mata dan operasi katarak mendapatkan 121 jiwa pengungsi Sinabung terkena katarak dan harus di operasi. Ditambahkan Donna Hattu didampingi Ratna Novianti, Natalia Cristian, Novi Ristyanti tim komunikasi panitia penyelenggaraan operasikatarakgratis,rangkaiankegiatanbaktisosialiniakanditeruskan hingga menjangkau masyarakat luas. Dan pekan informasi katarak dan skrining dilaksanakan di enam lokasi,Gambir,Pahae,Tuka,BatangToru,MuaraBatangtorudanSipirok mulai April hingga Mei 2014. ‘’Jumlah dana digelontorkan dalam bakti sosial ini senilai Rp1,2 miliar,’’ papar Katerina Siburian. (c10)

dan buku panduan KPPS.”DPT merupakan panduan bagi KPPS untuk menyampaikan formulir C6 kepada pemilih,” katanya. Pemilih yang terdaftar di DPK, katanya tidak diberikan undangan memilih karena formulir C6 yang diterima KPU P.SidimpuandariKPUPusathanyauntuk pemilih terdaftar di DPT.“Jumlah Formulir C6 yang diterima KPU P.Sidimpuan seimbang dengan jumlah surat suara yang ditetapkanberdasarkanDPT,’’kataRanto Siregar. Ketika ditanya tentang kekurangan 494 lembar surat suarauntukcalonDPDdanDPRD Kota P.Sidimpuan, Ranto Siregar menjelaskan sudah cukup, termasuk kebutuhan logistik lainnya. (cml)


KPUD Palas disaksikan unsur Muspida Palas melakukan pemusnahan surat suara rusak, Minggu (6/4).

Komisioner KPUD Paluta Divisi Logistik Masnilam Hasibuan SE mengatakan, pendistribusian ini dijadwalkan mulai Jumat (4/4) sampai Selasa (8/4) yang diawali dari kecamatan hingga mencapai ke seluruh TPS yang ada di desa. Dijelaskannya, jenis logistik yang akan didistribusikan antara lain berupa surat suara sesuai DPT yang terdaftar ditambah 2 persen, kotak suara sebanyak 4 buah per TPS, tinta 2 botol per TPS, paku 4 buah per TPS serta pulpen 2 kotak per TPS. Di Madina Di Mandailing Natal, malah sejak Kamis (3/4), KPUD Madina sudah mulai mendistribusikan logistik sebagai keperluan pemilihan umum (Pemilu) legislatif. “Pengiriman perdana logistik sudah dimulai kemarin. Pendistribusian berbagai alat keperluan pemilu mulai dari kotak suara, kertassuaradankeperluanlainnya dilakukan dengan memakai armada truk,” ucap Budy Ardiansyah sebagai Divisi Logistik KPU Madina, Jumat (4/4). Menurutnya, pada pengiriman perdana itu dialokasikan untuk daerah pemilihan (dapil) terjauhyakniDapilMadinaIIIdan Dapil Madina IV (daerah pantai barat) agar logistik tersebut cepat sampai di kecamatan maupun desa di sana. (a33/a35/a28)

Bupati Tobasa Doakan Pelajar Hadapi UN BALIGE (Waspada): Bupati Toba Samosir (Tobasa) Pandapotan Kasmin Simanjuntak memberangkatkan para pelajar seKab.Tobasa untuk menghadapi Ujian Nasional (UN) dengan menggelar acara doa bersama di halaman SMPN Satu Atap Pangururan Kec.Borbor, barubaru ini. Pemberangkatan para pelajar SD, SLTP dan SMU/SMK seKab.Tobasayangdipusatkanpada sekolah daerah terpencil, diawali dengan melakukan acara kebaktian dipimpin Pendeta Jimmy Pandingan. STh yang dihadiri Kadis Pendidikan Lalo Simanjuntak, anggota DPRD Tobasa Gumontang Pasaribu, anggota DPRD Sumut Biller Pasaribu,

para kepala sekolah, guru dan orangtua murid. “UN salahsatu indikator penentuan kelulusan para pelajar dalamprosespendidikan.Setelah melalui tahapan ini, maka ditentukan jenjang pendidikan yang akan diikuti selanjutnya untuk mencapai masa depan yang lebih baik sebagai generasi penerus bangsa, untuk itu perlu lebih bersungguh-sungguh dalam mengikuti proses belajar mengajar untukmemperolehhasilUNyang memuaskan,” kata BupatiTobasa dalam sambutannya di hadapan ribuan pelajar. Para pelajar juga diminta, untuk memanfaatkan seluruh kesempatan yang ada untuk mengulangi dan memperdalam

mata pelajaran yang sudah didapatkan di sekolah kata Bupati, dukungan dan peranan orangtua juga sangat berpengaruh pada prosesbelajaranakdidik,sehingga dihimbauparaorangtuaagarmemberi waktu dan kesempatan yang lebih luas bagi anak didik dalam berkonsentrasi belajar dan mempersiapkan diri menghadapi UN. Selanjutnya Bupati Tobasa Pandapotan Kasmin Simanjuntak didampingi Ketua TP PKK Ny. Netty Pandapotan br Pardosi dan Kadis Pendidikan Lalo H Simanjuntak, memberikan “Boras Sipir Ni Tondi” (ritual adat Batak memberi restu/doa) dan menyerahkan secara simbolis peralatan sekolah berupa alat tulis bagi para pelajar.(a22)

Waspada/Sukri Falah Harahap

KAPOLRES Tapsel, AKBP Abdul Rizal A Engahu, menerima penjelasan dari Divisi Logistik, Syawaluddin Lubis, dan Sekretaris KPU, Yunus Daulay, tentang kesiapan logistik Pemilu di gudang KPU Tapsel.

Polres Tapsel Kerahkan 800-an Personil Amankan Pemilu P.SIDIMPUAN (Waspada): Polres Tapanuli Selatan mengerahkan 800-an personil untuk mengamankan pemungutan dan perhitungan suara Pemilu Legislatif 2014 di tiga kabupaten wilayah hukumnya, Kab. Tapsel, Padanglawas Utara, dan Padanglawas. “Untuk pengamanan Pileg, kita kerahkan 800an personil. Termasuk personil BKO dari Polda Sumut dan Detasemen C Brimobdasu,” kata Kapolres Tapsel, AKBP Abdul Rizal A. Engahu SIK.MSi, saat meninjau kesiapan logistik Pemilu di KPU Tapsel, Kamis (3/4). Tinjauan ke gudang KPU Tapsel di Komplek Pendidikan Abdi Negara, Kel. Sadabuan, Kota Padangsidimpuan, didampingi Kabag Ops, Kompol M Simanjuntak, Kabag Sumda, Kompol TB Pane, Kasat Lantas, AKP Abdi Abdullah SH, dan Kasat Intelkam, AKP R Sihotang. Kepada wartawan, Kapolres Tapsel menjelaskan, personil yang ditugaskan untuk mengamankanTempat Pemungutan Suara (TPS) dua orang. Jumlah TPS yang diamankan kedua personil tersebut bervariasi, bisa 1 sampai 10 TPS. “Untuk pengamanan TPS, kita gunakan format Badai Sistem. Setiap personil punya seorang patner, dan mereka bisa ditugaskan untuk mengamankan 1 sampai 10 TPS. Jumlah TPS yang diamankan tergantung situasi dan medannya,” kata Kapolres Tapsel. Pantauan Waspada, Kapolres Tapsel dan rombongan disambut Sekretaris KPU, Drs.Yunus Daulay, dan Divisi Logistik, Syawaluddin Lubis, S.Sos. Kepada AKBP Abdul Rizal, mereka mela-

porkan bahwa pendistribusian logistik dilakukan Sabtu (5/4) pagi. “Terjadi kelebihan dan kekurangan kertas suara, namun Jumat (4/4) sudah teratasi. Kertas suara yang lebih adalah untuk DPR RI 2.303 lembar dan DPD 2.696. Kertas suara yang kurang adalah DPRD Kabupaten 126, dan DPRD Provinsi 32 lembar,” ujar Syawal. Berdasarkan rapat koordinasi di KPU Prov. Sumut, katanya, sudah ada perintah kalau surat suara DPR dan DPD yang lebih itu didistribusikan ke KPU Padangsidimpuan. Pasalnya, KPU Kota tersebut kekurangan kertas surat suara DPR dan DPD. Sementara kekurangan kertas suara DPRD Provinsi dan DPRD Kabupaten, sudah dikirim KPU Sumut. Lebih lanjut Syawal menambahkan, jumlah Daftar PemilihTetap (DPT) diTapsel 199.796 orang. Untuk kertas surat suara, saat ini telah disiapkan sesuai DPT dan ditambah surat suara cadangan 2 persen atau 3.996 lembar. Untuk Rumah Tahanan (Rutan) Cabang Sipirok yang jumlah DPT-nya 23 orang, tidak ada TPS khusus. Para tahanan akan menggunakan hak suara di TPS yang berjarak sekira 50 meter dari Rutan. Teknis pelaksanaannya sedang dikoordinasikan dengan Polres Tapsel. Sekretaris KPU Tapsel, Drs. Yunus Daulay, mengatakan, PPK sudah diperintahkan untuk mendahulukan pendistribusian logistik Pemilu ke daerah pelosok atau terpencil. Seperti desadesa di Kec. Aek Bilah, Saipar Dolok Hole, Sipirok, dan Angkola Sangkunur. (a27)

Wartawan Madina Unjukrasa PANYABUNGAN (Waspada): Wartawan di Madina tergabung dalam PWI, KWRI, IJTI, dan ForumJurnalistikMadinamengadakanaksiunjukrasa ke Kantor DPRD Madina, dan rumah dinas Kalapas Kelas II B Sipaga-paga, Kamis (3/4). Unjukrasa puluhan wartawan dilakukan sebagai bentuk aksi dukungan moral atas tindak kekerasan pemukulan dialami wartawan Harian Andalas di Madina, Jefri Barata Lubis, baru-baru ini. Dalam aksi di Kantor DPRD Madina diterima Ketua DPRD Madina, As Imran Khaitamy dan anggota Iskandar Hasibuan, dan Parlaungan Nasution, kalangan jurnalis meminta supaya pimpinanDPRDmaupunKetuaBKDmemproses PAW anggota DPRD Madina dari Partai Hanura, Ir.AM, dan juga mencabut hak-hak yang bersangkutan di DPRD karena kini sedang menjalani hukuman pidana. Usai aksi di Kantor DPRD Madina, aksi wartawan yang konvoi menggunakan sepedamotor menuju rumah dinas Kalapas, dan langsung disambutKalapasKlsIIBSipaga-paga,ArifRahman. Kepada Kalapas, wartawan Madina meminta supaya jangan ada perlakukan khusus bagi narapidana yang banyak uangnya. Karena informasi berkembang, napi bernama AM bebas menggunakan telepon seluler di dalam penjara.

UsaiaksidirumahdinasKalapas,10perwakilan wartawan melakukan audiensi langsung dengan Kapolres Madina, AKBP.Mardiaz, K.D,S.Ik,M.Hum, yang mengatakankomitmennya untuk mengungkap para pelaku pemukulan wartawan yang kini sudah empat orang dijadikan tersangka berikut barang bukti dua unit mobil. Wartawan Harian Andalas di Madina, Jefri Barata Lubis dipukuli sejumlah orang tidak di kenal di depan LP.Siapa-paga. Para pelaku datang menggunakan dua unit mobil L.300 yang di balut stiker Partai Hanura yang kini sudah diamankan pihak Polres Madina. Pemukulandidugadilatariakibatpemberitaan terhadapsalahsatuketuapartaidiMadina.Namun, hingga berita ini dikirimkan, belum diketahui siapa dalang intelektual pemukulan meskipun sudah empat orang dijadikan tersangka oleh Polres Madina. Para pelaku yang sudah ditahan yakni, I, GMN, AS, dan R. Tersangka dikenakan pasal 170 KUHP subs psl 351 KUHP tentang penganiayaan secara bersama-sama. Para tersangka ketika di wawancarai wartawan di Polres mengaku tidak kenal dan tidak punya masalah dengan wartawan Andalas, Jefri Barata Lubis. Mereka mengaku memukul Jefri Barata Lubis karena dorongan hati nurani saja. (c14)

IRT Dihipnotis, Rp8,6 Juta Raib KABANJAHE (Waspada): Seorang ibu rumah tangga (IRT), Satna Tantry br Sinuraya warga Merek, Kec. Merek, Kab. Karo mengaku sebagai korban hipnotis di Pusat Pasar Kabanjahe, Kamis (3/4) sekitar pukul 14:00. Akibat kejadian itu, korban mengaku kehilangan satu dompet berisi Rp8,6 juta beserta surat penting lainnya. Hal ini disampaikan Satna Tantry br Sinuraya didampingi kuasa hukumnya, Faudu Halawa kepada wartawan di Mapolres Karo JalanVeteran Kabanjahe, usai melaporkan kejadian yang dialaminya kepada petugas Polres Tanah Karo untuk pengusutan lebih lanjut. Kata Satna, kejadian yang dialaminya ini berlangsung ketika sedang asyik memilih pakaian loak di Pusat Pasar Kabanjahe, persis di sekitar kios darurat Jalan Abdul Kadir Kabanjahe. Dia didekati seorang wanita setengah baya yang kemudian menyapanya dan berbincang.

Setelah wanita tersebut pergi, korban tersadar kalau dia telah dihipnotis wanita yang ada di sampingnya, karena tas yang dibawa telah terbuka dan dompet di dalamnya berisi uang tunai Rp8,6 juta telah hilang. Korban tidak menyangka ibu berperawakan biasa yang berpura-pura ikut memilih pakaian seraya mengapit korban telah menghipnotisnya. Kejadian tersebut baru dia sadari setelah wanita yang diduga menghipnotisnya sudah menghilang. Kejadian tersebut kemudian disampaikan kepada kuasa hukumnya melalui telepon untuk mendampinginya melaporkan kejadian tersebut ke Mapolres Tanah Karo. Satna mengaku kehilangan satu dompet berisi uang tunai Rp8,6 juta beserta KTP, buku tabungan bankdanCUSondangNauliKabanjahe,kartuasuransi Prudentialdansuratlainnya.Korbanberharappihak polisi dapat meringkus pelakunya demi rasa aman dan nyaman warga Kab. Karo. (c09)

Kebut-kebutan Resahkan Warga

Korban Gagalkan Pencurian Ranmor

PEMATANGSIANTAR (Waspada): Aksi kebut-kebutan dengan menggunakan sepedamotor dilakukan kalangan remaja di Kota Pematangsiantar, dalam satu minggu ini terlihat semakin meresahkan warga. Seperti yang terlihat, Kamis (3/4), sepuluh sepedamotor yang dipakai siswa berseragam baju putih dan celana pendek biru itu, masing-masing dengan berboncengan, kejar-kejaran di antara padatnya lalulintas, seperti bus angkutan umum yang ada di Jalan Kartini di Pematangsiantar. Beberapa pelajar putri yang nyaris ditabrak para gerombolan sepedamotor siswa SMP itu, ketika mereka akan menyeberang dari depan sekolahnya di perguruan Taman Siswa, terlihat menjeritjerit ketakutan. Sementara pemuda ingusan yang menjadi penyebab kejadian itu bukan menjadi ketakutan, sebaliknya mereka terlihat semakin‘garang’ menggas suara sepedamotornya sehingga terdengar bising dan ingar-bingar. Banyak warga menyayangkan terjadinya aksi kebut-kebutan yang kerap dilakukan remaja di jalan-jalan padat di kota itu. Apalagi di lokasi tersebut pada siang hari khususnya saat jam keluar sekolah tidak pernah terlihat ada petugas. (crap)

SIDIKALANG (Waspada): Erwin Angkat, penduduk jalan Tembakau No.13, Sidikalang, Dairi, korban pencurian satu unit kendaraan bermotor (ranmor) jenis sepedamotor Honda Scopy No.Pol BB 5050 YF, berhasil merebut sepedamotornya dari tangan tersangka berinisial KS, 23, warga dusun Batangari desa Sipalipali Kec. Pegagan Hilir, Jumat (4/4) sekira 23.30. Kasubbag Humas Polres AKP Lamhot Limbong menjelaskan hal tersebut kepada wartawan, Sabtu(5/4)menambahkan,korbanbarusajapulang dan memasukkan sepedamotornya ke rumah. Namun pintu depan masih terbuka, sedangkan kunci sepedamotornya masih lengket di kereta.Tersangka,KS dan temannya AP warga desa Tigalingga Kec. Tigalingga (masih huron), melintas dari jalan tersebut dan melihat pintu rumah terbuka dan mencuri sepedamotor tersebut.

Waspada/Jimmi Sitinjak

BUPATI Tobasa memberikan beras Sipir Ni Tondi (ritual adat Batak memberikan restu/doa) kepada para pelajar dalam menghadapi UN di SMPN Pangururan Kec.Borbor.

Saatkejadian,korbandenganposisidibelakang rumah mendengar suara mesin sepedamotornya hidup, langsung bergegas ke depan. Dilihat sepeda motornya sudah dilarikan orang, Erwin bersama temannya, Saut Sianturi yang sedang nonton TV diberitahukan, sehingga keduanya mengejar pelaku dengan sepedamotor lain. Dikatakan, antara tersangka dengan korban, sempat kejar-kejar keliling kota. Persis di depan kantor bupati, korban berhasil menempel sepedamotoryangdikemudikantersangkadengan kecepatan tinggi. Tersangka yang sudah hilang kendali,jatuhdansepedamotornyadirebutkembali dan menghubungi polisi. Menurut Limbong, KS mengalami luka akibat terjatuhkeaspal,sedangkantemannya,APberhasil melarikan diri dan kini masih buron.Tersangka KS sudah diamankan untuk proses hukum selanjutnya. (a20)

C4 1 CM


Rp. 22.000

2 CM

BURSA AUTOMOTIVE Informasi Pembaca

Bursa Automotive AC BR CL ND DB

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

I N FO DAI H AT SU Pick Up DP 10 Jtan, Xenia Dp 20 Jtan, Terios DP 30 Jtan, Luxio, GM Minibus, Sirion, Proses Mudah, Cepat dan Paling Murah. INFO ADWIN 0 8 2 1 6 1 1 6 9 7 2 1 HONDA CITY V-TEC Th 05. Manual, Wrn Silver Metalik, Mobil Istimewa, Ex Wanita, BK 100 V, 1 Tangan dr baru, Rp. 110Jt. Jl. Sm Raja No. 200. 0812 6038 5555 / 7851402 T OYOTA INNOVA V Bensin Th’08 Manual. Wrn Abu - Abu Metalik, Pakai Tv, a/n Pribadi, Cantik Sekali, Rp. 165Jt. Di Depan Sekolah Eria No. 200. 0853 6231 2323 / 7851402

DI J U AL 1 unit Mobil TOYOTA INNOVA Tahun 2012. Warna Grey, Kondisi Sangat Terawat, Mobil Jarang Di Pakai. Hub (0821 6078 4666) ( 061 6998 4000)

Rp. 33.000

3 CM

Rp. 44.000

T OYOTA HARDTOP Solar Th’84. Wrn Biru Putih, BK 2 Angka, Mobil Cantik, Rp. 123Jt. Jl. Sm Raja No. 200. 0815 3373 3688 / 7851402 J U A L M U R A H / C E PA T TOYOTA AVANZA G VVTi 2010. Silver, Original, Lengkap, Tinggal pakai, H. 128Jt Nego. Hub 0813 6106 7593

DEALER TOYOTA BARU READY STOCK All Type TOYOTA, Bunga Ringan Dan Cicilan Murah, 1 s/d 6 Tahun, Cash/ Kredit. Hub Annuar Damanik 0 8 2 3 7 0 8 8 0 8 1 5 JUAL CEPAT TANPA PERANTARA 1. L .300 Minibus Starwagon Thn 1999. W. Putih, Baru Cat, Surat Hidup, Muka, Ban Baru, Nego. 45 Juta. dan Dijual 2. Sebidang Tanah Kebon Lama (Gas - Gas). Luasnya +/- 2 Ha Tanah Landai, Ada Bekas Kolam. Lewat Perkebunan Rispa Desa Pasanggrahan Pargarutan Jalan +/- 400 M Belum Diaspal. Hub H. ZUL Harahap 0852 7087 6024

Ingin Promosikan Produk Anda


WASPADA Media yang Tepat untuk Iklan Anda

4 CM

Rp. 55.000

6 CM

Rp. 121.000



T ELAH T ERCECER AKTA GANTI RUGI TANAH CAMAT Percut Sei Tuan No. 72/3/1984 Persil No. 59 Desa Sambirejo Kab. Deli Serdang. A/N. ALI FIKRI. BA



Dengan Harga 1.550 USD 3 KALI MIQAT




BUTUH DANA BU T U H DAN A 1 Hari Clear, Khusus Surat Tanah, Tanpa Izin Usaha/ Syarat Gampang. Hub 0 8 1 2 6 0 7 8 7 2 3 0


(FLIGHT GARUDA INDONESIA) - (MES -JED-MES) Direct Flight (Tgl. 1 Mei ‘14 - 20 Juni ‘14)

T ERCECER 2 BPKB BK 6318 DP DAN BPKB BK 6590 AQ. An. Ismet Harahap. Alamat Jl. Anggaran 3 / 14 Kompleks Dispenda Patumbak. Tercecer Tgl 10-8-2013 di sekitar Komplek

Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan Dibuka sampai malam Jam 21.30 WIB


TOUR PERJALANAN : All in + Jabal Magnit, Pemerasan Susu Unta, Musium Ka’bah, Hudaibiyah, Dll

HAJI PLUS 10.000 USD Daftarkan segera diri Anda, untuk apa menunggu lama, kami menyediakan Haji Plus d e n g a n K u o t a Te r b a t a s De nga n Fa silit a s: H ot e l Gra nd Z a m za m (H ot e l N o. 1 di Sa udi Ara bia ) Dan Travel Yang Berpengalaman


PT. AL’MUCHTAR TOUR & TRAVEL Jl. Sisingamangaraja No. 180 Medan Te lp: (0 6 1 ) 7 8 7 1 8 6 0 H P: 0 8 1 2 6 0 7 4 0 6 9 7 (SH ELLY )


DIBUTUHKAN SEGERA PU STAK A WAN Syarat: 1. Pria/Wanita (usia max 28 th) 2. Pendidikan S1 (Perpustakaan) IPK > 3.00 3. Mampu mengoperasikan komputer (Microsoft Office & Internet) 4. Mampu berbahasa Inggris

S E C U R I T Y /S AT PA M Syarat: 1. Laki-laki (usia max 30 th) 2. Tinggi minimal 162 cm 3. Pendidikan SLTA sederajat 4. Menyertakan SKKB (SK Kelakuan Baik) 5. Pengalaman 1 tahun LAMARAN & CV DIKIRIM KE: STIK “PEMBANGUNAN” MEDAN Jl. SM RAJA no.84 Medan (depan Ramayana Teladan)





DIGITAL Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)


6 CM x 1,5 kolom Rp. 165.000


STUK. BK 9108 BH. No uji : MDN 5028 A. A/N : Rusli. Alamat : Jl. G. Subroto KM 9 No. 572 medan. Merek : Mitsubishi

Surat Perjanjian Dan Penyerahan Tanah Diatas Materai Tertanggal 17 Feb 1990. A/N. Bismar Rambe yang terletak di Jalan Saudara Gg. Baru Kel. SUdirejo I Kec. M. Kota. Tercecer sekitar Jl. Saudara Sampai Sp. Limun

8 CM Rp. 137.500

Senin, 7 April 2014

DI CARI ACCOU N T I N G Untuk perkebunan Kelapa Sawit yang bisa buat Neraca dan Laba rugi, Yang sudah berpengalaman untuk ditempatkan di Banda Aceh, Lamaran diantar ke Jalan Kenanga Raya No. 66. Telepon 061- 8220082



I nfo Pe m e sa na n I k la n H ub. PI N BB 2 6 2 4 7 F5 E H P. 0 8 7 7 1 7 8 4 4 0 3 5 - 0 8 1 1 6 0 4 6 9 0

Ucapan Terima Kasih




HP : 0 8 1 3 7 5 8 3 1 0 4 6 Atas Pembayaran Manfaat Klaim Penyakit Kritis serta Pembebasan Premi Sampai usia 65 tahun dengan Service yang Sangat Cepat dan memuaskan




Dari :

Ra m a Cha ndra

H P. 0812.6495.8456, 0813.6137.2321 0852.0648.6301, 0823 6252 6008 TELP. 061- 4576116 FAX 061-4512319

AL FAATIH TOUR & TRAVEL Umroh & Haji Services Website : Email : Facebook : alfaatihtourtravel

HP. 081362106106, 085277251151, 081264853281 H A R G A PA K E T V. I . P ( B ) J lh. H a ri :

Harga / USD

9 hari 14 hari 12 hari + Dubai 14 hari + Turki 14 hari + Aqsa


Pa k e t :

Madinah – Makkah Madinah – Makkah Madinah – Makkah – Dubai Madinah – Makkah – Turki – Dubai Madinah – Makkah – Aqsa

Te r se dia : T ik e t Dom e st ik & I nt e r na siona l H ot e l Vouc he r, T r a ve l Doc um e nt Jalan Denai No. 168, Medan - Sumatera Utara Telp./Fax. 061-7331115 Tersedia Harga Paket Umroh Dengan Harga Terjangkau Bisa Cicil





(Untuk Ambeien)

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna K H U SU S WAN I T A: K H U SU S PRI A: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DI J AM I N 100% K ON SU LT ASI U M U M : H AN YA T EM PAT - Buka aura K AM I K LI N I K - Cari jodoh M AK EROT - Pelaris - Mencari orang hilang J L. LAK SAN A N O. 6 2 A M ASU K DARI J L. AM ALI U N Y U K I SI M PAN G RAYA M EDAN (PRAK T EK T ETAP) H P: 0 8 1 2 4 0 3 8 3 3 3 - w w w.t e ra pia lat vit a lm a ke rot .c om

Wasiri berani menjamin kesembuhan tuntas ambeien/wasir anda. Sangat berkhasiat dan cepat menghilangkan ambeien. Wasir yang menonjol maupun yang tumbuh di dalam. Redakan rasa sakit, perih dan menghentikan pendarahan waktu buang air besar, mencegah infeksi dan panas dalam serta melancarkan buang air besar. Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7364920 - 7323590

Akibat Stroke Sugianto Tidak Bisa Berjalan


LOWONGAN KERJA Kami “ CV.KHARISMA NUSANTARA” (Masih membutuhkan segera untuk menjadi pegawai di bidang)

“KESENIAN AKROBATIK KELILING NUSANTARA” A. 4 orang Wanita untuk membagi bagikan Snack kepada para Undangan B. 2 Orang Pria / Wanita untuk MC (berpengalaman) C. 4 Orang Wanita untuk menghias Dekorasi Peralatan dan membantu untuk mengantar Undangan D. 4 Orang Wanita untuk membantu anggota pertunjukan

Syarat - Syarat : 1. Usia 18 s/d 30 tahun (penampilan menarik) 2. Tidak keberatan sering keluar kota 3. Tidak dalam sedang kuliah 4. 3 Bulan sekali cuti 5. Gaji bulanan dijamin memuaskan Yang berminat hubungi langsung dengan Ibu Selpiana No HP 0812 6248 7751 0812 5287 0121 Telp. Kantor 061 - 8474523 - 8476924. Iklan ini berlaku 1 Minggu sejak penerbitan




PAWANG PEMILU RI 2014 Mau Jadi Anggota DPRD, DPRK, DPR RI, Partai Menang Pemilu. Silahkan Hub 0813 9799 2417, 0852 9753 2928

Menerima Pemasangan dan Service CCTV. Hub 0 8 1 3 6 1 1 5 4 1 0 7 , 0877 6891 8282

BURSA DIBUTUHKAN PUSTAKAWAN Syarat : - Wanita dan berpenampilan menarik - Lulusan S1 Ilmu Perpustakaan - Bersedia mengikuti Shift Kerja (2 Shift) - Memiliki komitmen untuk memajukan dunia pendidikan - Lebih diutamakan bagi Fresh Graduate Dengan melengkapi : - Surat Lamaran - Daftar Riwayat Hidup - Fotocopy KTP -Pasfoto warna terbaru 3x4 cm = 2 lembar - Ijazah terakhir (Legalisir) - Surat Keterangan Berbadan Sehat Lamaran diantar langsung ke : ST M I K Pot e nsi U t a m a J l. K .L. Yos Suda rso N o. 3 A T a njung M ulia M e da n Pa da ba gia n : Cust om e r Se rvic e Lamaran diantar paling lambat Tanggal : 26 April 2014 Pada 26 April 2014 Pada hari dan jam kerja



KOMPUTER PROGRAM K OM PU T ER : ARSESOFT . COM Tersedia Software : - Professional Accounting System (PAS) - Aplikasi Handphone dan Elektronik - Aplikasi GL Professional - Aplikasi Pegadaian dan Kas Cocok untuk Perusahaan Dagang & Jasa. Gratis Download, Gratis Pakai* Syarat dan ketentuan berlaku.




PENGOBATAN ALTERNATIF TERAPI URAT -Stroke -Asam Usat -Asam lambung Ringan/ Kronis (Sakit Maag) -Rematik -Keseleo -Urat kejepit -Ginjal

-Lumpuh -Migran -Sakit Gigi -Darah Tinggi -Gula -Usus Turun - Kejantanan Pria

Alamat Jalan Jahe 8 No. 37 Perumnas Simalingkar (Medan). HP 0813 7535 3566 (Bpk. Handi)




Senin 7 April 2014

Wali Nanggroe Harus Satukan Lagi Masyarakat Aceh IDI (Waspada): Menjelang pemilu 2014, perpecahan eks kombatan Gerakan Aceh Merdeka kian nyata di Aceh. Partai Aceh (PA) dan Partai Nasional Aceh (PNA) yang sama-sama dimotori eks kombatan GAM, berseteru. Mereka terlibat perang orasi di panggung kampanye. Bahkan, di beberapa daerah, kedua kubu

kerap bentrok fisik hanya garagara beda pandangan politik. “Ini harus segera dicarikan solusi. Bukan hanya PA dan PNA saja. Seluruh masyarakat Aceh, baik yang ada di Aceh maupun di seluruh dunia, harus disatukan kembali.Jikatidak,Acehakanhancur,”tegasmantanWakilPanglima Operasi GAM, Ridwan Abu Bakar (foto), dalam wawancara khusus dengan Waspada di Idi, AcehTimur,Minggu(6/4)malam. Sesepuh mantan GAM yang

Suami Tangkap Istri Lagi ‘Naik Bulan’ Dengan Pria Lain LANGSA(Waspada):Karimuddin,21,wargaSungaiPauhPusaka, Kecamatan Langsa Barat menangkap basah istrinya,Ys, 20, sedang ‘naik bulan’ dengan pria lain di dalam kamarnya, Sabtu (5/4) sekira pukul 04:00. Selanjutnya, Karimuddin bersama warga setempat menggelandang istrinya dan pasangan selingkuh ke markas Syariat Islam Kota Langsa. “Persoalan istri saya, sepenuhnya saya serahkan kepada WH untuk diselesaikan secara hukum,” kata Karimuddin yang profesinya sebagai tukang becak di hadapan petugas WH. Kadis Syariat Islam Kota Langsa Ibrahim Latif yang dihubungi wartawan, Sabtu (5/4) mengatakan, pria dan wanita pelaku zina itu telah diamankan sementara di kantor Dinas Syariat Islam. Dari hasil pemeriksaan, mereka telah melakukan perbuatan zina, melakukan hubungan suami sebanyak tiga kali dalam waktu yang berbeda. Ibrahim Latif yang didampingi Danton WH Tgk Irmansyah menambahkan, mereka kita amankan sebelum kita proses lebih lanjut. Kita akan memanggil keluarga kedua belah pihak dan perangkat gampong. Kita usahakan mereka akan kita proses sesuai acara jinayah. (m43)

Kecelakaan Di Gandapura, Wanita Muda Tewas BIREUEN (Waspada) : Mobil kijang Innova BK 1186 QB dikemudikan Sarman mengalami kecelakaan menabrak ruko di tikungan Cot Puuk, Kecamatan Gandapura, Bireuen, Sabtu (5/4) . Akibatkecelakaanitu,seorangsaleswanitamudabernamaJuliani, 29, warga Medan tewas setelah berada di Puskesmas Gandapura, sementara Sarman, sopir Innova selamat hanya mengalami luka ringan. Kasat Lantas Polres Bireuen AKP Thomas Nurwanto melalui Kanit Laka Aiptu Zulkarnaen yang turun ke lokasi mengatakan, kecelakaan yang menimpa mobil Innova diduga akibat kecepatan tinggi tidak mampu mengendalikan mobilnya di tikungan Cot Puuk, kebetulan cuaca hujan gerimis dan kondisi jalan licin. Mobil sempat terguling beberapa kali kemudian menabrak ruko mengakibatkan Juliani tewas dan kondisi mobil Innova yang ditumpangi rusak berat sudah ditarik dengan Derek, diamankan di Mapolres Bireuen. Jenazah korban Juliani yang meninggal dalam kecelakaan itu sudah diantarkan kepada keluarganya di Medan. (b12)

akrab disapa NekTu ini berharap, Wali Nanggroe, Malik Mahmud Al-Haytar,bersama-samadengan ulama selaku Tuha Peut dalam lembaga Wali Naggroe, dengan segala kewenangannya, segera bermusyawarah serta memben-

tuk tim khusus sebelum semuanya terlambat. “Kalau sudah terjadi konflik horizontal yang parah, tidak ada artinya lagi kita tawarkansolusi.BangsaAcehakan terperangkap dalam perang saudaradanakhirnyaakanhabissendiri karena saling membunuh sesama saudara,” papar Nek Tu. Anggota DPR Aceh ini juga mengingatkan,WaliNaggroeyang sudah diangkat selayaknya Raja oleh rakyat, bukanlah wali naggroe GAM atau wali nanggroe Partai Aceh.Wali naggroe adalah wali seluruh masyarakat Aceh. Itusebabnya,WaliNanggroeharus jadi sosok pemersatu. “Eks GAM, baik yang di dalam maupun luar negeri, pecah karenafaktorinternal.Antaralain, pecah karena tak setuju MoU Helsinki dan pecah saat mengusung Zaini-Muzakir sebagai

Gubernur dan Wakil Gubernur Aceh. Kalau ada usaha sungguhsungguh menyatukan mereka kembali, pasti bisa. Sebab, orangorang ini semuanya anak-anak Alm Tgk Hasan Tiro,” imbuhnya. Nek Tu juga menyebut, Aceh kini sudah berada dalam genggaman orang Aceh sendiri. Kepala daerah, mulai dari tingkat provinsi hingga kabupaten kota diisi mantan kombatan GAM. Begitu juga di parlemen. Sehingga, tidak ada alasan Aceh tidak maju. “Yang terpenting, jalankan amanah rakyat sesuai wasiat Tgk Hasan Di Tiro; Buet beutupat, bek sompuncadanbekmufakatngon aneuk miet bak peukara-peukara penteng. (Laksanakan tugas dengan niat lurus, jujur dan jangan bermufakat dengan anak kecil dalam perkara-perkara penting),” pungkas Nektu.(b19)

Aceh Belum Ada Perubahan BANDA ACEH (Waspada) : Mantan Tokoh Gerakan Aceh Merdeka (GAM) Husaini Hasan menegaskan, hingga saat ini Aceh belum ada perubahan signifikan baikdarisisipembangunanmaupun ekonomi. Bahkan Aceh setelahdamaiyangsemestinyasemakin maju justru makin merosot. Husaini Hasan menyatakan perlu adanya satu perubahan untuk memimpin Aceh.‘’Sekarang ini Aceh seperti tidak tentu arah dantujuannya.Padahalanggaran Aceh besar, tapi kemiskinan di sana sini, itu karena Aceh dipimpinolehpremanpolitikdanmafia ekonomi,‘’ kata Husaini Hasan di Aceh Besar, Minggu (6/4). Husainimenilaisituasipolitik Aceh saat ini morat-marit, demokrasi tidak berjalan pada relnya,penembakan,intimidasi,dan kekerasan lainnya dipicu oleh ketamakan politikus ingin menguasai Aceh dengan segala cara. “Kalauiniterusdibiarkanmau dibawa ke mana Aceh, yang ada hanyakehancuran,rakyatsengsara. Apakah rakyat mau dikorbankan lagiuntukkepentinganpenguasa,‘’ ujar mantan petinggi GAM ini. Karenanya dia sangat mengharapkan, Aceh bisa dipimpin

oleh figur yang mengerti akan rakyatnya, tidak ada kemiskinan, perekonomian yang maju serta bisa hidup dalam kondisi yang kondusif. Menanggapi pernyataan Husaini Hasan, Humas Pempov Aceh Murthalamuddin menegaskan bahwa jika beliau berpendapat seperti itu, silahkan saja dan itu merupakan hak beliau. Namun Murthalamuddin mengatakan, saat ini yang dibu-

tuhkan rakyat Aceh adalah perdamaianyangsudahlamadiidamidamkan. Rakyat Aceh hanya butuh kedamaian, bukan pertentangan dan kekisruhan. Menurutnya, Aceh saat ini membutuhkan orang-orang yang berfikir positif, bukan ingin mencari-cari permusuhan. “Orangorang berfikir positif yang mau membangun Aceh yang dibutuhkan saat ini,” kata Murthalamuddin. (b09/b01)

Kesadaran Terhadap Penghijauan Tinggi BANDA ACEH (Waspada): PlhWalikota Banda Aceh Illiza Sa’aduddin Djamal mengatakan, kesadaran warga Kota Banda Aceh akan pentingnya keberadaan pohon semakin tinggi. Demikian ungkap Illiza, saat menanam pohon bersama Dirjen Bina Pengelolaan DAS Perhutanan Sosial Kementerian Kehutanan Indonesia Hilman Nugroho di Taman Wisata, Ulee Lheue, Banda Aceh, Sabtu (5/4). Kata dia, saat ini kesadaran warga kota akan pentingnya penghijauan semakin tinggi. Hal ini, kata Illiza, dapat dilihat dari semakin banyaknya keterlibatan warga kota, baik secara pribadi menanam pohon di rumah maupun secara kelompok seperti kelompok tani. Dia berharap kesadaran warga kota semakin meningkat sehingga setiap lahan kosong milik warga akan menjadi hutan bagi mereka sehingga kota yang hijau seperti yang diidam-idamkan akan segera terwujud. (b02)

Waspada/Muhammad Riza

JET BUS Pusaka, yang terbalik di jalan lintas Banda Aceh- Medan, tepatnya di litel S, Desa Simpang Beutong, Kecamatan Muara Tiga, Pidie. Sabtu (5/4)

Bus Pusaka Terbalik, 30 Penumpang Selamat SIGLI (Waspada): Jet bus Pusaka, nomor polisi BL 7383 PB. Sabtu (5/4) sekira pukul 22:11 terbalik hingga masuk parit, di kawasan leter S, kilometer 85, Desa Simpang Beutong, Kecamatan Muara Tiga, Pidie. 30 Penumpang termasuk tujuh anakanak selamat. “Korban jiwa nihil, namun kondisi penumpang luka lecet dan ada beberapa orang yang patah tulang,” tutur Kapolres Pidie AKBP Sunaryadi Tempat Kejadian Perkara (TKP). Sunarya mengungkapkan, bus terbaru itu sedang dalam perjalanan dari Banda Aceh menuju Kota Medan, Sumatara Utara. Setiba di TKP, bus

tersebut tergelincir pada jalan menurun disertai belokan, dan bus itupun sempat berhenti persis pada birem jalan, lalu terbalik. “Penyebab sementara kecelakaan tunggal ini diduga ban sebelah kanan gundul, ditambah jalan licin sehingga pas tikungan tajam menurun selip, lalu terbalik,” ujar AKBP Sunarya. Dalam peristiwa itu M Saleh, 50, sopir bus tersebutmenderitalukalecetdanterkilir.Sedangkan 30 penumpang korban bus naas itu dirawat tercecer. 14 Penumpang dirawat di RSU Tgk Chik Ditiro Sigli, dan 16 lainnya dirawat di Puskesmas Padang Tiji. (b10)

Bangun Kembali Jembatan Hanyut MEUREUDU (Waspada) :Warga Desa Blang Awe, Kecamatan Meureudu dan warga Desa Seunong, Kecamatan Meurah Dua, Pidie Jaya berharap Pemkab setempat segera membangun kembali jembatan menghubungkan kedua kecamatan tersebut, yang hanyut dihantam banjir bandang lima tahun lalu. Jembatan di atas Sungai Meureudu berjarak sekira2kilometerarahselatanjalanlintasSumatera (Jalinsum) Banda Aceh-Medan, berfungsi menghubungkan warga Blang Awe-Seunong dan ke lahan perkebunan rakyat di daerah itu. Pantauan Waspada, Minggu (6/4), kondisi jembatan gantung diperkirakan panjang 70 meter dan lebar 180 cm itu, kini tinggal kenangan karena tanpa bekasnya lagi kecuali hanya fondasi terjungkal,sementarakerangka,lantaidankabelpenyang-

ga utama tanpa bekasnya lagi. Sulaiman dan Jamal, dua warga yang tinggal dan menetap dekat jembatan itu mengatakan, banjir besar tahun 2009 bukan hanya merusak jembatan gantung, juga menghanyutkan puluhan rumah warga di Desa Dayah Usen, Mancang dan Pante Beureune. Kata dia, akibat hanyutnya jembatan tersebut, membuat warga terpaksa berenang untuk menuju ke seberang sungai. Untuk pengangkutan, sejumlah pemilik lahan terpaksa menggunakan pundak dan menyeberangi sungai dengan resiko tinggi. Camat Meureudu Jauhar dan Camat Meurah Dua Mahdi mengatakan, pembangunan kembali jembatantersebutsudahsangatmendesak.Namun, kedua camat tersebut belum mengetahui apakah Pemkabtelahmenganggarkandanatahunini.(b09)

Waspada/Rusli Ismail

JEMBATAN gantung di Kabupaten Pidie Jaya dibiarkan rusak parah, di antaranya hanyut dibawa banjir bandang hingga kini belum dibangun yang baru. Seperti dalam foto Jembatan Gantung Lampoh Lada, Meureudu, yang ambruk

Warga Miskin Bangun Rumah Korban Kebakaran MADAT (Waspada): Warga Desa Pantee Bayam, Kec. Madat, Aceh Timur, yang rata-rata masih hidup di bawah garis kemiskinan, membangunsaturumahkonstruksikayuuntukkorban kebakaran di desa itu, secara swadaya. “RumahinimilikMuhadir,30.Rumahlamanya, juga terbuat dari kayu, terbakar Minggu siang, 30 Maret 2014. Semuanya ludes.Yang tersisa cuma baju di badan, karena saat kejadian dia dan keluargasedangkerjadisawah,”kataKeuchikatauKepala Desa Pante Bayam, M Piah, Minggu (6/4). Keuchikmerincikan,semuawargaDesaPante Bayam ikut menyumbang, membangun rumah baru untuk keluarga duafa itu. Bentuknya ma-

cam-macam. Ada yang kasih uang, baju bekas dan ada juga yang kasih beras. Sementara bantuan masa panik dari pemerintah, hingga kemarin siang belum sampai ke lokasi. KetuaYayasan Bedah Rumah Al-Iklhas Madat, SulaimanHamzahmenambahkan,pembangunan rumah tersebut terealisasi berkat bantuan dan kerjasama yang baik antara aparat desa dengan seluruh lapisan masyarakat Pantee Bayam dan Komite Peralihan Aceh (KPA) Madat. SementaraKhatijah,27,istriMahadir,mengaku senang sekaligus terharu karena banyak pihak, terutamawargaDesaPanteBayam,bahumembahu membangunrumahbaruuntukkeluarganya.(b19)


KHATIJAH dan dua anaknya (tengah) diabadikan bersama pengurus Yayasan Bedah Rumah Al-Ikhlas Madat dan pengurus KPA Madat, di depan rumah barunya, di Desa Pantee Bayam, Madat, Minggu (6/4)

Aceh C6 4,8 Juta Penduduk Tetap Dapat Layanan Kesehatan Gratis BANDA ACEH (Waspada): Walaupun kartu Jaminan Kesehatan Rakyat Aceh (JKRA) dan Jaminan Kesehatan Nasional (JKN) belum selesai dicetak, namun 4,8 juta jiwa penduduk Aceh tetap mendapat pelayanan kesehatan gratis dengan prima.

Demikian penegasan Kadis Kesehatan Aceh Taqwallah pada penyerahan secara simbolis kartu JKRA dan JKN oleh Gubernur Aceh Zaini Abdullah kepada perwakilan masyarakat Aceh, Jumat (4/4) di Meuligo Gubernur, Banda Aceh. “Walaupunkartubelumselesaidicetaksemua,pendudukAceh tetap mendapat pelayanan ketika sakit,” katanya.

Antisipasi Kenaikan, PiJay Percepat Salurkan Raskin

Program ini, jelas Taqwallah, telah dilaksanakan sejak 1 Januari 2014 lalu, dan dikelola oleh Badan Penyelenggara Jaminan Sosial (BPJS) Kesehatan. “Untuk tahun 2014 Pemprov Aceh menyediakan anggaran lebihdariRp400miliar.Sedangkan untuk tahun 2015 diperkirakan membutuhkan biaya lebih dari Rp560 miliar,” katanya. Taqwallah juga merincikan, dari total 4,8 juta jiwa penduduk Aceh; 2,1 juta penduduk miskin dijamin pemerintah pusat, 446

ribu Pegawai Negeri Sipil, 77 ribu jiwa dijamin oleh pemberi kerja/ perusahaan. “Dan sisanya 2 juta jiwa lebih dijamin oleh Pemprov Aceh, dengan premi Rp19.225 per jiwa per bulan,” imbuhnya. Bagi penduduk Aceh yang belum menerima kartu, jelasTaqwallah, tidak perlu resah karena dengan Kartu Askes, Kartu Jamkesmas, KTP/KK Aceh atau surat keteranganyangsahlainnyatetap dapat memperoleh pelayanan kesehatan secara gratis.

Sementara Gubernur Zaini Abdullah mengatakan, selain untuk meningkatkan kualitas kesehatanmasyarakat,kehadiran JKRA dan JKN juga bertujuan meningkatkankesejahteraanrakyat dan mengurangi angka kemiskinan. Dengan adanya fasilitas ini, gubernur berharap, masyarakat Aceh bisa lebih fokus menjalankan aktivitas sehari-hari tanpa perlu memikirkan biaya pengobatan mana kala mengalami gangguan kesehatan. (b06)

LANGSA (Waspada): Pergaulan muda-mudi sekarang ini sangat memprihatikan. Mereka bergaul sudah lewat batas. Di jalanan, di atas sepedamotor mereka bermesraan, berpelukan, berciuman di depan umum. Demikian disampaikan Kadis Syariat Islam Kota Langsa Ibrahim Latif dalam safari khutbahnya di Masjid Jamik Sirajul Huda, Alue Dua Langsa Baro, Jumat (4/4). Dikatakannya, para orang tua jangan membiarkan anak perempuannya bergaul bebas dengan anak laki-laki, apalagi dibawa malam Minggu dan pulang sampai larut malam. Kalau pulang sudah larut malam. “Konon lagi sudah tengah malam di tempat yang gelap lagi pasti terjadi khalwat atau mesum, bahkan lebih dari itu terjadi. Makaberhati-hatilah,kitaselakuorangtuahendakdapatmenjaganya dan memberikan yang terbaik kepada anak. Bukan sebaliknya, membiarkan mereka melakukan pergaulan bebas,” katanya. DikatakanIbrahim,dirinyapernahmenangkappasanganmudamudi sedang pacaran di jalan Lingkar PTP. Ketika ditangkap, mereka sedang bermesraan. (m43)

Anggota Babinsa Terima Kendaraan BIREUEN (Waspada): Sebanyak 63 unit kendaraan roda dua jenis sepedamotor Yamaha Vixxon dari Mabes TNI Angkatan Darat diserahkan secara simbolis Dandim 0111/Bireuen, Letkol KAV Asep Solihin, Kamis (3/4), kepada para Babinsa yang bertugas di Koramil dan Posramil di bawah jajarannya untuk keperluan operasional dalam menjalankan tugasnya. Dalam kesempatan tersebut, yang ikut disaksikan Kasdim Mayor KAV Minarso dan sejumlah perwira, Dandim 0111/Bireuen, Letkol KAV Asep Solihin menegaskan, kendaraan roda dua yang diberikan untuk operasional dalam mendukung pekerjaan anggota Babinsa, hendaknya digunakan sebagaimana mestinya. Dengan diberikan kendaraan roda dua tersebut, sambung Dandim, juga semakin mudah memperoleh informasi dan mengetahui hal-hal yang terjadi di wilayah tugasnya Babinda. (cb02)

Orang Aceh Jangan Terbuai Sejarah LHOKSEUMAWE(Waspada):Dalammenumbuhkankesadaran sebagai mahkluk yang senantiasa berupaya merajut keharmonisan, tentuselainpetunjukagama,manusiamestilahbelajardarisejarahnya. Sejarah bisa dijadikan landasan berpijak untuk melangkah lebih jauh. Yang tidak diharapkan kita terbuai dengan sejarah. Sejarah tidak kenal kadaluarsa, kecuali jika sejarah dimanipulasi sedemikian rupa untuk kepentingan-kepentingan tertentu, kata Kamaruddin Hasan, Ketua Development for Research and Empowerment (DeRE-Indonesia) di Lhokseumawe, Rabu (2/4). Katanya, sejarah ibarat cermin dan kita manusia harus belajar untuk memahami latar belakang permasalahan guna melangkah ke masa depan. Sejarah itu sangat mustahak, tanpa suatu perspektif yangdiperolehdarikejadian-kejadianmasalalu,bagaimanakitadapat menghadapi masalah-masalah hari ini ataupun hari esok. (b14)

Kapus Diminta Tingkatkan Disiplin PNS IDI (Waspada): Kepala Puskesmas (Kapus) di jajaran Dinas Kesehatan Aceh Timur untuk dapat meningkatkan kedisiplinan para pegawainya dan juga memantau kinerja para Bidan Desa (Bides) yang ditempatkan di wilayah kabupaten ini. “Disiplin sangat penting ditegakkan terutama disiplin jam kerja bagi para PNS maupun tenaga kontrak yang bertugas di masingmasing puskesmas di Aceh Timur,” ungkap Amir Syarifuddin SKM, Sekretaris Dinas Kesehatan Aceh Timur, Selasa (2/4), di ruang kerjanya. Menurutnya, dari hasil pantauan yang dilakukan pihaknya dapat disimpulkan, kedisiplinan para pegawai di tingkat puskesmas belum maksimal sebagaimana diharapkan. (cri)

Takengen – Blangkejeren Putus Total Akibat Longsor BANDA ACEH (Waspada): Hubungan-darat antaraTakengen, AehTengah-Blangkejeren, Gayo lues putus total menjelang Jumat tengah malam (4/4)hinggaSabtu(5/4)petang.SeorangcalonDPD RIasalAcehAdnanNSterpaksabermalamditengah hutan belantara karena terkurung longsor. Adnan menyebutkan, kondisi perbukitan sangat mengerikan, selain jurang menganga, jalan sangat licin dan berlubang. Banyak kenderaan roda dua dan empat terjebak. Marhaban, salah seorang warga dari Kutacane-Takengenyangmerasajagonyamainlumpur pada jalur ini sempat terperosok dan sepeda motornyatenggelamseparuh,sepatunyahilangditelan lumpur Gunung Tembolon. Longsoran terparah di kawasan Gunung tembolo, Gayo Lues dan antara Isaq-Pegasing. Adnan NS waktu itu dalam perjalanan pulang Kotacane, Blangkejeren,Takengen dan Redelong. Calon DPD RI ini terjebak di beberapa tempat. Waktu pergi dan pulang, Tapi kemarin malam terpa-rahlongsornya.Disanamemanglagimusim

TAPAKTUAN(Waspada):BupatiAcehSelatan T Sama Indra meminta Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi, Azwar Abubakar memprioritaskan sisa honorer kategori-II (K2) yang belum lulus seleksi, menjadi pertimbangan dalam seleksi mendatang. “Sisa honorer K2 yang belum lulus dalam seleksi kemarin berjumlah seribu orang lebih, hendaknya menjadi prioritas dan pertimbangan dalam seleksi berikutnya,” kata bupati dalam pertemuan silaturahmi dengan MenPAN RB Azwar Abubakar, di gedung pertemuan Rumoh Agam, Tapaktuan, Jumat pekan lalu. Sedangkan honorer K2 yang dinyatakan lulus sebanyak 492 orang dari jumlah honorer K2 seluruhnya sebanyak 1.700 orang lebih. “Jadi sisanya ini yang kami minta pertimbangan Pak Menteri,”

peng-hujan. Akibat longsor, badan jalan banyak menjelma menjadi bukit yang di atasnya ikut terbawa pepohonanyangmasihberdiritegak.Sebagianlagibadan jalan berubah menjadi selokan.Banyak alat berat nyaris tertimbun total, krn jalan di kawasan ini memangsedangdilakukanperluasandenganpemotongan tebing yang terjal. Ketua Dewan Kehormatan Daerah(DKD) PWI Aceh ini lolos Sabtu dinihari berkat bantuan masyarakat setempat.Dia terpaksa mundur ke belakang belasankilometer,setelahbadanjalanyangtertimpa pepohonandiBurLintangdisingkirkandankembali ke Isaq kemudian memutar via Jagong Jeget ke Atu Lintang terus Pegasing dan Takengen. Saya yakin masih banyak kendaraan terkurung di sana, karena maju terhadang longsor berbukit dan mundur pun terhadang bukit yang baru jatuh.Mudah-mudahantakadayangadakenderaan yang tertimbun. Saya sangat khawatir ada mobil yang membawa keluarga dan bayi di depan kami, waktu itu mereka masih terjebak”, ujarnya. (b02)

sebut Sama Indra dalam sambutannya. Kondisiini,menurutdia,sangatpentingmengingat selain mereka telah lama masa honornya, jumlahPNSdidaerahnyajugamasihkurang,hanya sebanyak 6.682 orang dan 50 persen di antaranya merupakan tenaga guru dan selebihnya aparatur struktural, penyuluh dan paramedis. Jika jumlah PNS ini telah memadai, akan dapat memberi pelayanan prima kepada masyarakat. Menteri Azwar Abubakar menyatakan tidak tertutup kemungkinan membuka peluang bagi honorer yang belum lulus dan masalahnya tergantung anggaran dan kebutuhan daerah. “Sepanjang anggarannya tersedia dan tenaganya memang dibutuhkan daerah, tak ada masalah dan kita oke-oke aja,” tutur Azwar. (b30)

Kantor Keuchik Butuh Mobiler

Jalan Berlubang Siap Makan Korban

Kadis SI: Pergaulan Mudamudi Memprihatikan

Senin 7 April 2014

Prioritaskan Sisa Honorer K2 Gagal Seleksi

MEUREUDU (Waspada) : Untuk mengantisipasi kenaikan hargaberasyangmelonjakharganyadipasar,PemerintahKabupaten (Pemkab) Pidie Jaya bersama Bulog Sub Devisi Regional IV Sigli yang membawahi Kabupaten Pidie dan Pidie Jaya mempercepat penyaluran beras miskin (Raskin) untuk 12.561 Rumah Tangga Sasaran (RTS) di delapan kecamatan se-Pidie Jaya. Kabag Kesejahteraan Sosial (Kessos) Setdakab Pidie Jaya Sulaiman, Jumat (4/4) mengatakan, percepatan pendistribusian jatah raskin yang mulai tahun ini diberikan secara gratis sudah tuntas didistribusikan kepada yang berhak menerima untuk delapan kecamatan di Pidie Paya. “Kita lakukan sekaligus mempercepat pendistribusian beras raskin gratis, guna mengantisipasi melonjaknya harga beras di pasar. Langkah itu dipandang sangat efektif ketimbang melakukan operasi pasar (OP) beras yang hanya bisa bertahan sesaat, usai OP harga beras kembali naik,” sebut Sulaiman. Untuk mengimbangi kenaikan itu, Pemkab bersama Bulog memberikan sebuah solusi dengan mempercepat pembagian beras miskin gratis langsung kepada masyarakat di desa-desa. (b09)

BLANGKEJEREN (Waspada) : Seiring maraknya pembangunan jalan oleh pemerintah kabupaten dan provinsi hingga ke pelosok Gayo Lues, ternyata masih banyak jalan di pusat kota terabaikan, sepertihalnyajalanmenujuKampungBadak yangsaatinikondisinya cukup membahayakan pengguna jalan. Amatan wartawan, posisi lubang terletak di bagian tengah badan jalan berdiameter lebih 60 cm persegi, dengan kedalaman satu meter setengah ke dalam.Yang diperkirakan, akibat box curvet dibawahbadanjalanambruk.Tentusaja,pengendaraketikamelintas jalan tersebut harus mengurangi kecepatan guna menghindari lubang yang cukup membahayakan itu. Saat ini, warga memberi tanda dengan meletakkan gelondongan kayu di dekat lubang tersebut guna menghindari pengguna jalan nyungsep ke dalam lubang. Amin, 52, warga yang melintas mengatakan, kondisi lubang ini telah lama dan sudah berbulan-bulan tanpa ada perbaikan dari pihak terkait. Dikatakan, selain lubang tersebut, masih banyak lagi lubang kecil di beberapa titik arah menuju kampung Badak, tepatnya setelah jembatan menuju kampung Badak, yang kondisinya sangat mengganggu pengguna jalan, hal ini diduga akibat truk penambang pasir yang beroperasi di areal penambangan umum tersebut dengan melebihi tonase sehingga badan jalan jadi kupak-kapik dan bergelombang. (cjs)


Waspada/Abdul Mukthi Hasan

SITUASI di Komplek PPI Peudada, Bireuen, Minggu (6/4)

Nelayan Sulit Peroleh Solar Subsidi BIREUEN(Waspada):Sejumlah nelayan di Pangkalan Pendaratan Ikan (PPI) Kecamatan Peudada Bireuen, mengeluh, sejak beberapa pekan ini mereka sulit memperoleh solar bersubsidi di pasaran sehingga mereka terpaksa membeli yang non-subsidi denganhargayanglebihtinggiuntuk bisa menjalankan aktivitasnya. Panglima Laot Lhok Kuala Peudada, Abdurrahman Haji dan sejumlah nelayan kepada wartawan, Minggu (6/4), membenarkan selama ini nelayan di PPI PPI Peudada sulit memperoleh BBM jenis solar sehingga harus membeli solar non subsidi yang dijual agen di komplek PPI tersebut dengan harga Rp6.500 per liter. “Agen tersebut terpaksa menjual harga begitu karena dia membelinya di SPBU dengan harga standar,” katanya. Menurutnya, di PPI Peudada tersebut sekarang ini ada sekitar

100 unit boat, dan 42 kapal penangkap ikan jenis 20 GT dan 30 GT. “Untuk boat kecil atau boat becak sekali pergi melaut membutuhkan solar minimal 35 liter, sedangkan boat ukuran membutuhkan solar sampai 500 liter,” paparnya. Panglima Laot mengatakan, untuk mengatasi hal tersebut dia mengharapkan pemerintah atau pihakterkaitsudahsaatnyamembangun SPBU mini di kompleks PPI Peudada tersebut. Iqbal, seorang tokoh pemuda Peudada, mengatakan, areal di PPI Peudada yang begitu luas dan banyakboatyangmangkalbelum adaSPBUminiyangmenyediakan solar subsidi sehingga nelayan kesulitan memperoleh langsung BBM jenis solar subsidi yang harganya miring dari harga standar di SPBU. Menurut Iqbal, nelayan di PPI Peudada membutuhkan es

batangan sekitar 1.000 batang yang harganya Rp25 ribu per batang. “Untuk memenuhi kebutuhan es, Pemkab Bireuen juga sudah saatnya membangun pabrik es dengan kapasitas produksi es lebih banyak,” harapnya. Sejumlah nelayan di PPI Peudada mengharapkan kepada pihak terkait untuk memperdalam mulut kuala supaya aktivitas para nelayan menjadi lancar dengan mudahnya keluar masuk boatdan kapalpenangkapanikan ke tempat tersebut. KadisKelautandanPerikanan BireuenJafarmengatakan,dirinya ikutprihatindengankeluhannelayan di PPI Peudada tersebut, namun di Bireuen telah dibangun SPDN di kawasan Minapolitan di Kuala Jangka, kendalanya saat ini, belum ada alokasi BBM dari Pertamina. “Kebutuhan BBM solar mencapai 50 ton,” jelasnya. (cb02)

UIN Ar-Raniry Gunakan Sistem Akademik Online BANDA ACEH (Waspada): Untuk meningkatkan pelayanan publik di kampus UIN Ar-Raniry Banda Aceh, seluruh civitas akademika akan dilatih sistem akademik secara online, sistem ini sudah siap dibangun. DemikiandisampaikanKetua TimCyberNazaruddinMusausai melakukan rapat koordinasi untukmembahasrencanapelatihan sistem akademik online bagi dosen, karyawan dan mahasiswa di ruang sidang Biro Rektor UIN Ar-Raniry, kemarin. “Rapatinidilaksanakanuntuk mempresentasikan hasil pembuatan cyber kampus kepada parapimpinanbaikditingkatbiro

maupun tingkat fakultas guna untuk membahas mekanisme pelatihanyangakandilaksanakan nanti,” kata Nazar. Menurut dia, pelatihan akan direncanakan pada pertengahan April. Pelatihan ini sangat penting menyangkut jalan atau tidaknya sistem akademik online nanti sangat tergantung pada keaktifan dosen, pihak akademik dalam menggunakannya. “Dengan berlakunya sistem ini tentunya akan sangat membantu dan memudahkan proses belajar mengajar, karena semua prosesakademikdalamdilakukan secara online,” ujarnya. Hal yang dapat mempermu-

dah dalam pelayanan di antaranya pada pengajuan Kartu rencana Studi (KRS), pengisian nilai Kartu Hasil Studi (KHS), bimbingan skripsi dan data mahasiswa, dosen, prodi atau jurusan dapat diakses dengan cepat. Rektor UIN Ar-Raniry Farid Wajdi Ibrahim menekankan pengembangan sistem informasi berbasis IT harus dijadikan program prioritas UIN Ar-Raniry. Menurut dia, pimpinan UIN Ar-Raniry akan memfasilitasi setiapkebutuhanyangdiperlukan untuk mempercepat terlaksananya sistem online di Kampus Darussalam ini. (b04)

Upaya Wujudkan Gagasan Tgk Chik Dipaloh PENDUDUK Desa Paloh Dayah, Muara Satu, Lhokseumawe berupaya mengembalikan keberadaan desa tersebut sebagaimana awal mulanya, yakni sebagai tempat pengajian pada waktu dulu. Ada sebuah dayah atau pesantren tradisional di wilayah desa itu pada zaman dahulu yang dipimpin oleh Tgk Chik Di Paloh. “Kami mulai membangun dan menghidupkan kembali bekas dayah Tgk Chik Dipaloh dengan mendirikan masjid dan tempat pengajian,” kata pimpinan Balai Pengajian Darussalam, Tgk Nazar Sabi, Minggu (6/4). Satu jadwal pengajian diisi langsung oleh guru-gurunya dari para cendikiawan muslim atau ulama dari wilayah Lhokseumawe dan Aceh Utara. Katanya, anakanak sampai orang tua renta diwajibkan untuk mengikuti pengajian, sebab menuntut

ilmu itu memang diwajibkan kepada setiap orang mukmin laki-laki dan perempuan tanpa ada batas umur. Masjid Assaadah Teungku Chik Dipaloh sudah tegak berdiri sekitar dua tahun lalu dan mengadakan pengajian rutin untuk umum dengan mengundang alim ulama dari beberapa tempat. “Pengajian berlangsung siang dan malam di kompleks masjid dengan balai-balai pengajian tempat belajar,” jelas Tgk Nazar. Langkah ini merupakan salah satu usaha dari penduduk untuk menguatkan Islam sekaligus mendirikan kembali dayah Tgk Chik. Pengajian yang telah lama berlangsung dilakukan setiap Jumat dua kali bagi lelaki, yakni malam Rabu dan malam Minggu. Sementara untuk perempuan, dilaksanakan tiga hari dalam sepekan, yakni pada Selasa, Jumat, dan Senin.

“Jadwal-jadwal ini akan kami perbanyak sehingga setiap malam ada pengajian. Selain pengajian umum tersebut, di Paloh Dayah ada tujuh balai pengajian lain yang dikhususkan bagi pendidikan anak-anak dan remaja. “Anak-anak dan remaja harus dibiasakan dengan kitab Arab-Jawi, sebagai-mana kemampuan orang-orang Aceh dalam membaca aksara ini pada tempo dulu,” kata Nazar. Dayah Tgk Chik Dipaloh sedang melakukan pembenahan di berbagai bidang, baik pola pendidikan yang harus disesuaikan dengan keadaan zaman, maupun penambahan fasilitas yang masih terlalu kurang. “Namun segalanya berlangsung lebih cepat dan lebih baik dari perkiraan,” ungkap Thayeb Loh Angen, salah seorang tokoh dan pengusul pendirian Dayah Tgk Chik Dipaloh ini. Arafat Nur

PEUREULAK (Waspada): Para keuchik di Kabupaten Aceh Timur hingga saat ini masih melayani administrasi bagi warganya dirumah. Hal tersebut karena gampong yang sudah memilikikantorkeuchik,tetapitidakdilengkapidengan mobilernya. Sebagaimanadiketahui,pembangunankantor keuchikolehpemerintahdaerahsudahdigalakkan sejakbeberapatahunlalu.Namun,hinggakinimasih banyak kantor keuchik di wilayah Kabupaten Aceh Timur yang belum difungsikan secara maksimal dengan dalih klasik yakni tidak memiliki mobiler sebagaialatkerja,bahkanterkesanbangunankantor keuchik yang telah dibangun itu sia-sia saja. “Bahkan untuk membuat surat bagi kepentingan warga terpaksa kami harus pergi ke tempat

rental komputer, kondisi seperti ini jelas tidak efektif dalammemberikanpelayanankepadamasyarakat,” ungkap Jamaluddin Sekretaris Gampong Pasir Putih, Kecamatan Ranto Peureulak, Aceh Timur, Minggu (6/4). Diakuinya,gampongPasirPutihsudahmemiliki bangunan kantor keuchik, tetapi tidak bisa dimanfaatkan dengan efektif karena tidak tersedianya peralatan kerja. “Ironisnya lagi hingga 2014 ini mobiler yang ada hanya mesin ketik yang sudah usang dan tidak dapat digunakan lagi,” papartnya. Menurutnya, seiring perkembangan zaman sudah selayaknya setiap kantor keuchik minimal memiliki satu unit komputer sehingga bisa mengakomodir surat-menyurat bagi keperluan masyarakat. (cri)

Universitas Al-muslim Buka Prodi PAUD LHOKSEUMAWE(Waspada):Duniapendidikan di Universitas Al-Muslem Kabupaten Bireuen terasa semakin berkembang pesat, Kamis (3/ 4) seiring mulai dibukanya Program Studi (Prodi ) Pendidikan Anak Usia Dini (PAUD) untuk tahun akademik 2014/2015. Selainitu,padaawalMei2014mendatang,Universitas Al-Muslim akan mengharumkan nama besar Indonesia dengan menampilkan sejumlah tarian traditionalbernuansaIslamiyangberasaldariempat daerah di Negara Korea. Antara lain tarian traditional Aceh, Sumatera, Sulawesi dan kalimantan. Hal itu diungkapkan Rektor Uniuversitas AlMuslim Amiruddin Idris di Kampus B Universitas Al-muslim di Jalan Merdeka Kec. Banda Sakti,

Kota Lhokseumawe. “Prodi PAUD akan berada di bawah Fakultas Keguruan dan Ilmu Pendidikan (FKIP). Berarti untuk FKIP sudah ada sembilan Prodi,” ujarnya. Amiruddin mengatakan, pendidikan usia dini, baik TK ataupun PAUD di Aceh khususnya Kabupaten Bireuen, Kota Lhokseumawe, Kabupaten Aceh Utara dan kota lainnya mulai semakin berkembang pesat. Namun sayangnya, jumlah guru dengan pendidikan khusus tentang anak usia dini masih minim bagai api jauh dari panggang. Padahal usia dini merupakan peluang emas bagi anak-anak untuk bisa belajar lebih pintar agar mampu menjadi calon pemimpin bangsa di masa mendatang. (b16)

Pemilik Lahan Diminta Bersihkan Hutan Kecil BANDA ACEH (Waspada) : Masyarakat Gampong (Desa) Lamlagang, Kecamatan Banda Raya, Kota Banda Aceh diresahkan dengan keberadaan hutan kecil yang semakin bersemak tumbuh di areal lahan kosong hingga menutupi bagian badan Jalan Seulanga yang tidak kunjung dibersihkan pemiliknya. “Meski tidak seluruh dan semua badan jalan di desa itu yang disalup semak belukar atau hutan kecil, namun, ditemukan banyak lahan kosong yang telah ditumbuhi hutan kecil kurang mendapat perhatian dan tidak dibersihkan pemilikinya,”

ungkap Ridwan, warga setempat, Kamis (3/4). Di areal hutan kecil pinggir jalan utama di desa tersebut sangat rawan terjadi bahaya karena terhalang pandangan terhadap pengendara kendaraan menyusul sebagian badan jalan disalup semak hutan kecil yang menjalar dari lahan kosong penduduk dan telah ditumbuhi hutan itu. Kepala Desa Lamlagang Mustari AWahab mengaku banyak lahan kosong di wilayahnya yang telah ditumbuhi hutan kecil. Dan pemilik lahan itu kebanyakan berdomisili di desa dan daerah lain sehingga sangat sulit untuk dihubungi. (b09)

80 Persen Padi Gagal Panen BIREUEN (Waspada): Akibat datangnya kemarau mendadak pascapara petani menanam padinya di sawah beberapa bulan lalu, 80 persen sawah milik petani di beberapa kecamatan di Bireuen dikabarkan gagal panen, hanya 20 persen saja yang dapat diperoleh hasilnya. Sehingga para petani di kabupaten tersebut mengalami kerugian yang lumayan. Informasi yang diperoleh, sejumlah petani dari sejumlah kecamatan di Bireuen, sedang memanen padinya yang ditanam beberapa bulan lalu. Namun, mereka gagal memanen padinya hingga 80 persen akibat setelah ditanam beberapa waktu lalu, langsung dilanda kekeringan sehingga hanya 20 persen padi mereka yang bisa di penen,

sedangkan 80 persen dikabarkan gagal total, karena padinya poso atau telah mati, setelah ditanam atau menjelang berbuah batang padi mereka langsung kering, setelah ditanam. Informasi lainnya, sawah yang gagal dipanen hingga mencapai 80 persen itu, antara lain, sawah di Kecamatan Gandapura, Makmur, Kutablang, Peudada dan kecamatan lainnya. Keujruen Blang (pengurus air sawah) Gandapura, M Thahir Idris mengungkapkan, padi yang ditanam di sawah di wilayah Kecamatan Gandapura dan Makmur hanya 20 persen yang bisa dipanen dari luas areal sawah yang ditanam padi, sedangkan80persengagal,karenakawasantersebut pasca ditanam padi dilanda kemarau. (cb02)

USAID Prioritas Latih 8 SMP MANGGENG RAYA (Waspada) : Sebanyak 8SekolahMenengahPertama(SMP)danMadrasah Tsanawiyah (MTs) masing-masing 7 SMP dan 1 MTs di Kabupaten Aceh Barat Daya memulai tahap pelatihan Pembelajaran Konstektual dan Manajemen Berbasis Sekolah. Acara yang dimulai Kamis (3/4) dan direncanakan hingga 5 April 2014 mendatang digelar di kompleks Sekolah Terpadu Abdya Padang Meurante Kecamatan Susoh. Kegiatan itu merupakan bagian dari komitmen USAID (United States Agency for International Development) Prioritas (Prioritizing Reform, Innovation, and Opportunities for Reaching Indonesia’s Teacher, Administrators and Students) bersama dengan Pemkab Abdya dalam meningkatkanmutupendidikanhingga2017nanti. Kadis Pendidikan Abdya Yusnaidi mengharapkan pelatihan ini dapat merubah cara berfikir guru terutama dalam melaksanakan proses bela-

jar mengajar. “Saya mengharapkan pelatihan ini dapat merubah cara berfikir guru terutama dalam melaksanakan proses belajar mengajar yang dilaksanakan dalam kelas berlangsung efektif dan menyenangkansehinggadapatmenghasilkansiswa yang lebih baik,” harapnya. Kegiatan pelatihan yang difasilitasi USAID Prioritas tersebut dilakukan secara bergelombang (pergrup). Setiap sekolah mengirimkan 15 guru dari 5 mata pelajaran (mapel) yaitu Bahasa Indonesia, Bahasa Inggris, Matematika, IPS dan IPA. Secara bergantian, guru-guru mapel tersebut mendapatkan materi pembelajaran konstektual selama 3 hari termasuk praktik langsung yang dilakukan di sekolahnya selama satu hari. Koordinator USAID Prioritas Provinsi Aceh, Ridwan Ibrahim berharap kegiatan pelatihan itu bisa mendongkrak mutu dan kualitas pendidikan di Abdya. (cza)


WASPADA Senin 7 April 2014


Masa Tenang, Alat Peraga Masih Berserakan LANGSA (Waspada) : Memasuki masa tenang menjelang Pemilu 2014 yang tinggal beberapa hari lagi, sejumlah bendera partai politik dan alat peraga kampanye seperti baliho, spanduk dan stiker calon legislatif masih berserakan di sejumlah ruas jalan di Kota Langsa. Seharusnya, memasuki masa tenang sudah bersih dari alat peraga kampanye. Pantauanwartawan,Minggu (6/4) di lapangan seperti di Jln. Lilawangsa, Jln.Panglima Polem,

Jln.A Yani, Jln.Iskandar Sani, Jln.TM.Zein, Jln.Peurumnas, Jln Sudirman, dan di beberapa gam-

pong yakni Gampong Sidorejo, Sidodadi, Pondok Keumuning Kecamatan Langsa Lama dan sejumlah ruas jalan lainnya serta beberapagamponglainnya,masih banyak terpasang bendera partai politik dan alat peraga kampanye caleg. Komisioner Panwaslu Kota LangsaWahyu menjelaskan, hasil rapat antara Panwaslu, Komisi

Independen Pemilihan (KIP), Satpol PP denganWakilWalikota LangsaMarzukiHamid,beberapa hari lalu, untuk pembersihan alat peraga kampanye partai politik khusus Minggu (6/4), diberi kesempatankepadapenguruspartai politik maupun caleg untuk membersihkannya sendiri. Namun,padahariberikutnyajikamasihadaalatperagakampanyemaka akan ditertibkan oleh Satpol PP. Sementara bagi posko pemenang pemilu partai politik yang berjarak lebih kurang 200 m dari TempatPemungutanSuara(TPS)

agar ditutup supaya tidak kelihatan, dan yang diperbolehkan di poskohanyabalihopenguruspartai politik dan bendera partai. Selain itu, Panwas juga telah merekomendasikankeKIPuntuk pembersihan alat peraga kampanye memasuki masa tenang selama tiga hari. KIP juga telah menyurati pengurus partai politik agar membersihkan alat peraga kampanye serta secara tulisan maupun lisan Panwas telah menyampaikan kepada pengurus partai politik peserta pemilu. (cms)

Syariat Islam Pondasi Pembangunan Aceh

Waspada/M Syafrizal

MEMASUKI masa tenang menjelang Pemilu Legislatif, sejumlah baliho caleg masih terpasang di sejumlah jalan di Kota Langsa, Minggu (6/4)

LHOKNIBONG (Waspada): Anggota Komisi C DPRA, Ridwan Abu Bakar , menyatakan, Syariat Islam merupakan pondasi program pembangunan Aceh di segala bidang, termasuk di bidang politik. “Karena itu Syariat Islam harus terus dimantapkan di Aceh, termasuk lewat edukasi intensif di pondok pesantren atau dayahdayah,” kata kata politisi Partai Aceh (PA) ini saat menghadiri acara Maulid, di Yayasan Pesantren Nurussa’dah, Desa Paya Demam Sa, Aceh Timur baru-baru ini. Mantan kombatan GAM senior yang akrab disapa Nek Tu ini menambahkan, ulama -ulama kharismatik di Aceh, diharapkan juga ikut memantau dan mendampingi kinerja perangkat adat dan pemerintahan di Aceh, termasuk kinerjaWali Naggroe, supaya Aceh ke depan semakin maju dan islami. Selain Nektu, acara maulid di Yayasan Nurussa’dah, Desa Paya Demam Sa, juga dihadiri anggota DPRA dari PPP, H Murhaban Makam, dan caleg DPRK dari PA Marzuki Ajad atau Panglima Misee.(b19)

Empat Warga Diamankan Terkait Kampanye

Kampanye Hari Terakhir Di Aceh Besar Aman KOTA JANTHO (Waspada): Situasi keamanan di Kabupaten Aceh pada hari terakhir kampanye terbuka partai politik peserta Pemilu 2014 di sejumlah lokasi di daerah itu berlangsung aman. Semua partai yang menggelar orasi politiknya, mampu meredam emosional massa pendukung sehingga tidak sampai menimbulkan kekacauan dan keributan antara pendukung satu partai dengan pendukung partai lain. Kapolres Aceh Besar AKBP Djadjuli menyatakan, personel kepolisian dibantu prajurit TNI melakukan pengamanan secara ekstra di beberapa lokasi yang dianggap rawan terjadi tindak kekerasan, termasuk di lokasi kampanye terbuka.“Alhamdulillah, situasinya aman dan terkendali. Kita berharap semuanya berjalan lancar sesuai jadwal,” ujar, Sabtu (5/4). Dikatakan, meski selama berlangsungnya kampanye terbuka di wilayah hukum Polres Aceh Besar kondisi keamanan relatif aman, namun pihak kepolisian dibantu prajurit TNI tetap bekerja ekstra melakukan pengamanan sehingga pada hari pemilihan berlangsung, masyarakat bisa datang ke Tempat Pemungutan Suara (TPS) untuk menyalurkan aspirasinya. (b05)

Polda Aceh Dibantu TNI Amankan Pemilu BIREUEN (Waspada): Kapolda Aceh Irjen Pol Husein Hamidi mengatakan, dalam rangka pengamanan Pemilu Legislatif (Pileg) tahun 2014, selain dibantu pasukan dari Mabes Polri, Polda Aceh juga dibantu anggota TNI dari Kodam Iskandar Muda (IM). Hal ini sebagaimana disampaikan Kapolda Aceh di Mapolres Bireuen, Sabtu (5/4). Dia menjelaskan, jumlah personel polisi yang terlibat dalam pengamanan pemilu ini lebih dari 9.000 orang, termasuk polisi polres se-Aceh, dan ditambah anggota Brimpob, serta TNI yang kini sudah disiagakan di setiap Kodim. Karenanya, dalam pengamanan pemilu nanti polisi akan bersinergi dengan TNI sehingga masyarakat akan merasa aman hingga pada saat memberikan suara di Tempat Pemungutan Suara (TPS). Dalam rangka menjaga keamanan menjelang pemilu, Kapolda Aceh juga menginstruksikan untuk terus dilakukan razia dan patroli. “Kita telah melaksanakan pengamanan sejak tahapan pemilu pertama dilaksanakan sekarang yang merupakan hari terakhir kampanye,” paparnya. (b17)

LHOKSEUMAWE ( Waspada):Sebanyakempattersangka diamankanpihakkepolisianmenjelang kampanye Partai Nasional Aceh (PNA). Terduga pelaku itu dinilai mengacaukan jalan kampanye partai tersebut di lapangan eks Cunda Plaza, Lhokseumawe, Jumat (4/4) sore. Kapolres Lhokseumawe AKBP Joko Surachmnato mengatakan, kejadian pertama terjadi di seputaran Jembatan Sawang Kupula, Cunda pada pagi hari. Informasi diterima, tiga orang diduga dari simpatisan salah satu partai lokal merusak alat peragakampanyemilikpartaiyang didukungnya. Halitubelumbisadikaitannya dengan kegiatan kampanye PNA yang akan digelar di lapangan eks CundaPlaza,Lhokseumawe,sore itu. Partai yang menjadi korban itumenuduhPNAsebagaipelakunya,namunsetelahdilakukanpenyisiran ke tempat kejadian perkara(TKP),pelakunyaadalahorang partaiitusendiri,bukanorangPNA. Begitu juga, tindakan ini sem-

pat disaksikan aparat keamanan yang bertugas di sana, serta masyarakat setempat. Namun, Joko Surachmanto baru bisa memastikan hal itu setelah melakukan penyelidikan lebih lanjut. Sementara tiga terduga pelaku ini telah diamankan ke Mapolres. KetikadiwawancaradiMapolres, mereka membantah. Menurutnya, saat itu sedang memfoto alat peraga partai mereka yang dirusak, untuk dilaporkan ke Panwaslu, dan mereka bukan pelaku perusakan. Mereka itu, A, 29, K, 27, dan M, 29, ketiganya adalah warga Kecamatan Muara Dua, Lhokseumawe. Kejadian kedua, kata Kapolres, pada sore hari, sesuai informasi didapatkan, ketika massa PNA dari arah timur (Lhoksukon) tiba di Kandang, kemudian mobil pick-up mereka diketapel dan dilempar batu. Sehinga kaca depan mobil itu bolong ukurang sekitar 7x60 cm. Setelah itu, massa PNA ini mengamankan satu orang bernama M yang diduga sebagai pelaku.

M diduga sebagai pelaku juga membantah kejadian ini. Menurutnya,ketikaitumelihatkeramaian di lokasi kejadian, kemudian dia menghampirinya. “Pas saya lihat ada keramaian, saya mendekat, tapi malah saya yang dituduh pelakunya,” tutur M. Namun menurut temannya, M alias B yang warga Kecamatan Muara Dua itu diketahui ada sedikit keterbelakangan mental. Semuapernyataandiadiutarakan agar tidak dikutip. Kejadianketiga, tambah Joko Surachmanto, saat mobil Partai Aceh berlalu beriringan,namunsalahsatumobil menggunakan lampu rotator dan serine. Pertama pihak Densus telah mengingatkan agar tidakdibunyikanmengingatsituasi lalu lintas sedang ramai saat kampanye PNA. Tapi hal itu tidak diindahkan, maka kali kedua saat di Hagu BaratLautbertemulagidenganDensus setelah adu mulut dan lampu itu dicabut. Kemudian mobil itu diamankan pihak kepolisian ke Mapolres. (cmk)

Tiba (light, asal, waktu)

Berangkat (light, tujuan, waktu)

Garuda Indonesia GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45


FY 3400 Penang*


Lion Air JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air SJ 010 Jakarta/Medan

Air Asia QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

KIP Aceh Timur Distribusikan Logistik IDI (Waspada): Komisi Independen Pemilihan (KIP) Aceh Timur mulai mendistribusikan logistik Pemilihan Legislatif (Pileg) 2014, Sabtu (5/4). Empat kecamatan menjadi prioritas pengiriman lebih awal. Keempat titik tersebut yakni Simpang Jernih, Serbajadi—Lokop, Peunarun dan Blang Seunong, Kecamatan Pante Bidari. Dua dari empat kecamatan harus dibawa melintasi kabupaten tetangga dengan jarak mencapai 200 kilometer dari pusat Pemkab Aceh. Diperkirakan, logistik yang dibawa menggunakan truk itu akan tiba setelah 12 jam perjalanan darat ke titik kecamatan yakni Simpang Jernih melintasi wilayah Kota Langsa dan AcehTamiang, sementaraBlangSeunongharusditempuhmelalui Langkahan, Aceh Utara. Sejumlah Tempat Pemungutan Suara (TPS) di beberapa desa di Kecamatan Simpang Jernih harusditempuhmenggunakanjalursungai,karena sampan (getek) satu-satunya sarana transportasi di pedalaman Aceh Timur sehingga KIP setempat lebih awal mendistribusikan seluruh logislatik

pemilu ke daerah-daerah terpencil. Distribusi logistik pemilu di Aceh Timur diiringi pengawalan ketat dari pihak kepolisian. Di kantor KIP Aceh Timur yang berada di Jalinsum Banda Aceh - Medan persisnya di Desa Alue Nibong, Kecamatan Peureulak juga terlihat pasukan khusus dari Gegana dan personel Brimob. Personel kepolisian bersenjata lengkap ikut mengiringi pendistribusian logistik dari kantor KIP Aceh Timur menuju titik-titik pemungutan suara. Distribusi pihak KIP hingga ke PPK di kecamatan, selanjutnya PPK akan mendistribusikan ke PPS di desa-desa. “Mulai hari ini kita distribusikan logistik pemilu. Hari ini prioritaskan ke titik-titik terpencil,” ujar Sekretaris KIP Aceh Timur, Saiful. Kapolres Aceh Timur AKBP Muhajir dalam kesempatan yang sama juga mengatakan, seiring dengan distribusi logistik pemilu 2014, pihaknya juga mengirimkan pengawalan sesuai kebutuhan, bahkan untuk titik-titik rawan pihaknya akan memonitor dari luar oleh tim khusus yang dikirim secara silih berganti hingga hari H, 9 April nanti. (b24)

Logistik Pemilu Di Bireuen Didistribusikan BIREUEN (Waspada): Komisi Independen Pemilihan (KIP)/KPU Kabupaten Bireuen mulai mendistribusikan logistik Pemilu. Pengangkutan kebutuhan pemungutan suara ini akan dikawal ketat aparat kepolisian. KomisionerKIPBireuen,AgusniIsmail,Minggu (6/4)mengatakan,logistikuntukkebutuhanpemilu diTempat Pemungutan Suara (TPS) sudah dimasukkan ke dalam kotak suara untuk didistribusikan hinggakedesa-desa.“Semuakebutuhansudahcukup

dan sudah siap didistribusikan,” jelas Agusni. Agusni menegaskan, perlengkapan pemungutan suara itu paling sudah sampai di TPS pada 8 Aprilmalamsehinggapadaharipemungutansuara, yakni 9 April pagi semua kebutuhan itu sudah tersedia. Kendati demikian, Agusni juga menginginkan kepada semua pihak, termasuk para wartawan agar turut berpartisipasi guna kelancaran pelaksanaan pemilu. (b17)

KIP Langsa: Gunakan Hak Pilih LANGSA (Waspada) : Menjelang Pemilu 2014, Komisi Independen Pemilihan (KIP) Langsa mengajak masyarakat untuk menggunakan hak pilihnya pada 9 April nanti, dengan cara turun ke gampong-gampong dalam wilayah setempat. Ketua KIP Langsa Agusni AH, Minggu (6/ 4) mengatakan, pihak KIP sejak Jumat (4/4) hingga Senin (7/4) telah menurunkan petugasnya ke seluruhgampongdilimakecamatanuntukmengajak masyarakat agar berpartisipasi memberikan hak suaranya.

Dijelaskan, tim yang difasilitasi dengan mobil dan pengeras suara itu bertugas untuk mengingatkan atau mengajak masyarakat agar tidak lupa menggunakanhakpilihnyakeTempatPemungutan Suara (TPS) yang disediakan, pada Pemilu Rabu (9/4) mendatang. Selain itu juga, petugas membagi-bagikan stiker imbauan dan ajakan serta contoh surat suara pemilu caleg kepada masyarakat. Ini dilakuan menurutdalamupayauntukmeningkatkanpartisipasi masyarakat pada pemilu tahun 2014 ini. (cms)

Muspika Dan Linmas Langsa Gelar Doa LANGSA (Waspada) : Ratusan personel linmas petugas pengamananTempat Pemungutan Suara (TPS) bersama Muspika Kecamatan Langsa Kota menggelar doa bersama di aula pertemuan kantor setempat, Sabtu (5/4). Saat berlangsungnya pembacaan doa dipimpin tokoh muda Langsa Kota Fauzan, para muspika, Kapolsek Langsa Kota AKP Armen Siregar, Danramil Kapten Herman, Camat Langsa Kota Muhammad Jamil Gade serta ratusan personel linmas terlihat khusyuk berdoa memohon

kepadaAllahSWTagarPemilulegislatifberlangsung lancar, aman dan damai di Langsa Kota. Dalam arahannya Kapolsek Langsa Kota AKP Armen Siregar mengharapkan kepada personel linmas untuk profesional dalam menjalankan tugas dan fungsinya selaku garda terdepan dalam pengamanandilokasiTPS.“Sayamengingatkankepada saudara, tugas ini adalah merupakan tugas mulia dan marilah kita laksanakan secara profesional demi terwujud serta suksesnya pemilu legislatif di Kota Langsa yang kita cintai ini,” ujarnya. (cms)

Wagub Aceh Hadiri Reuni Akbar SMPN 1 Idi

Pedalaman Aceh Utara Rawan Pemilu LHOKSEUMAWE (Waspada): Kapolres Lhokseumawe AKBP JokoSurachmantomenyebutkan,beberapakecamatanpedalaman di Aceh Utara (wilayah hukum Polres Lhokseumawe) sebagai titik rawan Pemilu 9 April. Sebab itu, pengamanan khusus untuk daerah itu akan dilakukan. Ketika disinggung titik rawan pemilu pada hari pemungutan suara, Kapolres Lhokseumawe menyebutkan beberapa titik rawan, khusus di Kabupaten Aceh Utara. “Iya, ada beberapa titik rawan memang, seperti di Kecamatan Samudera, Sawang, Kuta Makmur, Nisam Antara, Dewantara, Geureudong Pase,” tutur Joko di Mapolres, Jumat (4/4). Semua titik rawan yang petakan ini menjadi perhatian khusus. “Ini memang menjadi atensi kita untuk melakukan pendekatanpendekatan, kita lakukan patroli juga, supaya tidak terjadi halhal yang tidak kita inginkan. Pada prinsipnya, jangan sampai terjadi benturan,” paparnya. (cmk)

Waspada/M Ishak

PROSES distribusi logistik Pemilu 2014 dari kantor KIP Aceh Timur, Sabtu (5/4) diprioritaskan ke daerah terpencil seperti Kecamatan Simpang Jernih, Peunarun dan Serbajadi (Lokop)

Waspada/Mustafa Kamal

POLISI menunjukkan kaca depan mobil milik simpatisan PNA yang diketapel di seputaran Kandang, Lhokseumawe, Jumat (4/4)

Mereka Harus Selamatkan Seni Budaya Aceh BANYAK sekali pameo endatu yang masih membekas dalam ingatan orang Aceh, semuanya berpesan untuk menjaga warisan budaya turun temurun. Di antaranya, “Adat bak poe teumeureuhom, hukom bak Syah Kuala, qanun bak Putroe Phang, reusam bak Laksama.” Itu adalah hadih maja Aceh yang sangat terkenal, yang bermakna tentang peletakan hukum, penyelesaian segala macam persoalan dan wewenang sang ahli. Jadi intinya adalah serahkan masing-masing masalah kepada orang atau lembaga yang berwenang atau berkompeten. “Bubei dua jab, seumeureukap dua muka. Keunoe toe keudeh rab, man dua pat meuteumee laba.” (Ini berkenaan dengan orang yang licik dan pandai dalam mengolah untuk mencapai keuntungan ganda). “Buya krueng teudongdong, buya tamong ka meuraseuki” (Ini adalah sindiran kepada anak negeri yang tidak mengerti apa-apa sehingga bangsa luar bisa meraup keuntungan di negerinya sendiri tanpa bisa berbuat apa-apa).

Bila para wakil rakyat terpilih ingin membangun negeri ini, maka jangan ragu untuk memperjuangkan segala kebutuhan yang mendukung upaya melestarikan seni budaya Aceh. Karena selama seni budaya masih dipertahankan, maka manfaat dan hikmahnya akan terus mengalir sepanjang masa untuk anak cucu. Rektor Universitas AlMuslim Kabupaten Bireuen Amiruddin Idris (foto) mengatakan dirinya sudah melihat langsung apa hikmah dan manfaat mempertahankan seni budaya tradisional. Amiruddin menjelaskan pada zaman modern

sekarang, tidak ada hasil ilmu tehnologi yang bisa dipamerkan orang Aceh untuk menarik mata dunia, seperti kemampuan hebat yang ditunjukkan Jepang, Amerika Serikat, Rusia dan lainnya. Akan tetapi, kampus AlMuslim melalui Sanggar Mirah Delima justru bisa berkibar ke seluruh penjuru dunia hanya dengan cara melestarikan seni budaya Aceh. Dia sendiri mengaku tidak pernah menduga kalau masyarakat belahan dunia lain sangat mencintai segala bentuk seni budaya seperti yang ada di Aceh. Kini Korea dan Jepang telah melakukan kerjasama dengan Universitas Al-Muslim dalam dunia pendidikan. “Mereka kerap mengundang kami hanya untuk menampilkan berbagai tarian adat Aceh. Bahkan, sampai sekarang mereka masih melakukan kajian dan penelitian terhadap budaya Aceh,” tuturnya. Amiruddin juga meminta orang yang terpilih dalam Pemilu legislatif 2014 jangan pernah melupakan harunya kisah pengorbanan Sultan Iskandar Muda masa silam dalam mempertahankan budaya Aceh. Zainuddin Abdullah

IDI (Waspada): Guna meningkatkan mutu pendidikanAcehyanglebihterjamindimasadatang, Pemprov Aceh baru-baru ini telah mengirimkan 200 tenaga pendidikan di berbagai tingkatan untuk magangkenegerijiranMalaysia.Sementaradibidang kesehatan,20dokterspesialisjantungjugatelahdikirim untuk memantapkan ilmunya ke India. Demikian disampaikanWakil Gubernur Aceh Muzakir Manaf ketika menghadiri Reuni Akbar Alumni SMPN 1 Idi di Komplek SMPN 1 Idi, Kabupaten Aceh Timur, Minggu (6/4).

Menurutnya,tujuandititipnya200tenagapendidikan dan 20 tenaga medis ke Malaysia dan India guna meningkatkan sumber daya manusia dalam mewujudkan kesejahteraan masyarakat Aceh di bidang pendidikan dan kesehatan. Harapandiakedepanmutupendidikankhususnya di SMPN 1 Idi lebih ditingkatkan lagi, apalagi pembangunan yang dipacu di SMPN 1 Idi sudah sangat memadai menjadi motivasi baru dalam merajut kemajuan pendidikan Aceh di masa akan datang. (b24)

Selesaikan Perseteruan Politik Aceh LHOKSEUMAWE (Waspada): Menyelesaikan masalah perseteruan politik di Aceh tidak cukup hanya dengan retorika kampanye“siap kalah dan siapmenang”.Tidakpuladenganstrategimenambah pasukankeamananagarPemilutetapberjalanlancar. “Persoalan ini perlu langkah radikal, terutama dari aktor politik yang kini berkonflik untuk merumuskan kesadaran untuk berdamai, atau atau paling tidak memilih sikap pasif dalam merespon kekerasan,” ungkapTeuku Kemal Fasya, pengamat politik dan Antropolog Aceh, Minggu (6/4).

Katanya,sangatperluvisicerdasuntukmembumikan nilai-nilai demokrasi, sejarah, dan kearifan lokal Aceh, sebagai nilai yang padu dalam menghentikan transisi konflik menuju keharmonisan perdamaian yang berkelanjutan. Tugas beratnya, lanjut dia, mewujudkan kata damai dan demokrasi itu dengan sederhana. Mulai dari elite turun ke akar rumpun. Mulai dari gubuk di sawah hingga ke meunasah. Mulai dari masyarakatpegunungansampaikemasyarakatperkotaan dan pesisir. (b14)

1.412 Satlinmas Siap Sukseskan Pileg di Banda Aceh BANDA ACEH (Waspada): Sebanyak 1.412 anggota Linmas yang direkrut dari pemudapemuda Gampong di Banda Aceh siap mengamankanPemilulegislatif(Pileg)2014diKotaBanda Aceh. Kesiapaniniditandaisaat1.412anggotaLinmas ini mengikuti apel siaga yang dipimpinWalikota BandaAcehHjIllizaSa’aduddinDjamaldihalaman Balaikota, Banda Aceh, Sabtu (5/4). Pada kesempatan itu, Illiza mengatakan, Pemerintah Kota Banda Aceh melalui aApel Siaga Satlinmas memberi amanah dan tugas yang

sangat mulia kepada anggota Satlimas mewakili 90 gampong untuk mensukseskan Pemilihan Umum Legislatif Tahun 2014 agar berlangsung aman, lancar dan tertib. “Tentunyabanyakpihakyangberharapkepada Satlinmas bersama aparat penegak hukum untuk menjaga ketentraman masyarakat dari seluruh rangkaian pemilu untuk melindungi masyarakat sertamenjaminhakasasimanusiadalammenyampaikan pendapat sehingga perlu peran satlinmas untuk ditempatkan di Ring 1 di setiap TPS,” ujar Illiza. (b02)

Laporan Khusus


WASPADA Senin 7 April 2014



WAKIL Gubernur Sumatera Utara Ir. HT Erry Nuradi, MSi dan pimpinan YP Pangeran Antasari Deliserdang foto bersama dokterdokter kecil.

KETUA YP Pangeran Antasari Dr. Tommy Leonard, SH, MKn dan Kepala SMK dan SMA Sulaiman, SPdI menunjukkan hasil kerajinan tangan para siswa SMK YP Pangeran Antasari beserta piagam penghargaan Juara I Business Plan Competition tingkat Regional Sumatera dengan karya ‘Sapu Lidi Multi Fungsi’.

Wagubsu Kunjungi Yayasan Pendidikan Pangeran Antasari

Sekolah Anak Berprestasi YAYASAN Pendidikan (YP) Pangeran Antasari yang mengasuh 1.200 anak didik mulai dari Taman Kanak-kanak, Sekolah Dasar, Sekolah Menengah Pertama, Sekolah Menengah Atas, dan Sekolah Menengah Kejuruan telah mampu menorehkan berbagai prestasi anak didiknya baik di tingkat kecamatan, tingkat provinsi, bahkan tingkat nasional. Yayasan Pendidikan Pangeran Antasari yang berada di Desa Helvetia, Kecamatan Labuhandeli, Kabupaten Deliserdang ini telah menorehkan sejumlah prestasi pada perlombaan dokter kecil nasional dan Business Plan Competition se-Sumut, serta prestasi individu para siswa lainnya. Bahkan, YP Pangeran Antasari saat ini merupakan salah satu lembaga pendidikan berprestasi di Sumatera Utara. Atas berbagai prestasi yang diperoleh siswasiswi YP Pangeran Antasari ini, mendorong Wakil Gubernur Sumatera Utara (Wagubsu) Ir. HT Erry Nuradi, MSi berkunjung

ke sekolah yang terletak di Desa Helvetia, Kecamatan Labuhandeli, Kabupaten Deliserdang, Kamis (3/4). Kehadiran Wakil Gubernur Sumatera Utara HT Erry Nuradi tersebut atas kekagumannya atas berbagaiprestasiyangtelahdiraih para siswa dengan melakukan ‘Kunjungan Prestasi Sekolah’ di Sumut, salah satunya adalah Yayasan Pendidikan Pangeran Antasari. Wagubsu disambut langsung KetuaYayasanPendidikanPangeran Antasari Dr.Tommy Leonard, SH, MKn, Ketua Pembina YP Pangeran Antasari Heriyanti, SH, MKn, Kepala SMA/SMK YP Pa-

ngeran Antasari Sulaiman, SPdI, Kepala SD dan SMP Drs. Armansyah, MPd, Ketua BMKSS Sumut Drs Suparno MPd, Camat Labuhandeli H Gongma Sehat Harahap, S.Sos, MAP, para guru, dan disambut antusias para siswa Tim Dokter Kecil YP Pangeran Antasari. HT Erry Nuradi sangat mengapresiasi atas prestasi siswa SMKYP Pangeran Antasari yang telah memproduksi ‘Sapu Lidi Multi Fungsi’ karya siswi Rafika Syuri Marpaung danViddyna Sri Utami.‘’Kedepan SMKYP Pangeran Antasari dapat menghasilkan produk lain yang bermanfaat dan terjangkau oleh masyarakat luas,’’ katanya. Mantan Bupati Serdang Bedagai ini juga memberi ucapan selamat kepada Rizky Anandaputra, dokter kecil SDYP Pangeran Antasari yang mampu mengharumkan nama Sumut dalam bidang pendidikan nasional, dengan berbagai prestasinya baik dalam Dokter Kecil maupun melalui karya puisinya.

Petinggi Pemprovsu ini menegaskan, berbagai raihan prestasi YP Pangeran Antasari sebagai hasil kerja keras warga YP Pangeran Antasari Deliserdang. Erry berharap kepada para siswaYP Pangeran Antasari untuk terus meraih prestasi dan menjunjung tinggi budi pekerti. Ia menguraikan hakikat pendidikan adalah daya upaya untuk memajukan budi pekerti atau karakter, pikiran dan jasmani anak didik. Dia juga berpesan agar generasi penerus bangsa tidak menggunakan narkoba, jangan terlambat sekolah, disiplin dan terus berkarya. ‘’Budayakan sifat jujur, disiplin, ikhlas dan mulailah dari diri sendiri,’’ harapnya. Pada kesempatan itu, Ketua YP Pangeran Antasari Dr.Tommy Leonard, SH, MKn menyampaikan dukungan pihaknya terhadap pengembangan fasilitas dan pendidikan di YP Pangeran Antasariyangmerupakansekolah sang juara baik di tingkat Sumut maupun nasional.

Atas prestasi yang diraih para siswa tersebut,Tommy bertekad untuk mengembangkan karyakarya yang dihasilkan para siswa dan melanjutkan produk-produk kerajinan lainnya. “Kita sangat mendukung untuk terus dikembangkan, sehingga SMK kita ini bisa menjadi icon kewirausahaan di Sumatera Utara,” ujarnya. Bahkan, Tommy segera membuka Sekolah Tinggi Ilmu Ekonomi (STIE) Akuntansi dan Bisnis Intenasional (STIE A&BI) sebagai pengembangan pendidikan di kawasan Labuhandeli sekitarnya yang memiliki potensi besar dalam peningkatan kualitas sumber daya manusia. Sementara itu, Kepala SMA/ SMKYP Pangeran Antasari Sulaiman, SPdI atas nama yayasan dan guru-guru dan para siswa menyampaikan terima kasih atas kunjungan Wagubsu tersebut, semoga kunjungan tersebut memberikan motivasi kepada para siswa, guru-guru untuk terus meningkatkan prestasi dan terus berkarya.

Sulaiman menyebut,YP Pangeran Antasari merupakan satu dari enam sekolah berprestasi di Sumut. YP Pangeran Antasari yang berdiri tahun 1986 ini telah memiliki prestasi tidak diragukan lagi, baik di tingkat SD, SMP, SMA, maupun SMK. Beberapa prestasi yang telah diraih para siswa YP Pangeran Antasari di antaranya juara pertama Business Plan Competition se-Sumutpada2013dengankarya ‘Sapu Lidi Multi Fungsi’, dan mewakili Sumatera Utara di tingkat nasional. “Kemudian dokter-dokter kecil kita juga telah banyak memperoleh berbagai kejuraan, tidak hanya di tingkat kecamatan, tingkat kabupaten. Dokter Kecil YP Pangeran Antasari terpilih sebagaijuarapertama,danmasuk dalam nominasi nasional. BersamaYayasan, kami bertekad untuk terus mengembangkan berbagai bakat, karya dan prestasi para siswa,” ujarnya.


KETUA Pembina YP Pangeran Antasari Heriyanti, SH, MKn didampingi KetuaYayasan Dr.Tommy Leonard,SH,MKn menyambut kehadiran Wagubsu Ir. HT Erry Nuradi, MSi di sekolah tersebut.

* Sugiarto


WAGUBSU Ir. HT Erry Nuradi, MSi menerima plakat dari Ketua Pembina Yayasan Pendidikan Pangeran Antasari Heryanti, SH, MKn.



WAGUBSU Ir. HT Erry Nuradi, MSi melihat karya siswa Sapu Lidi Multi Fungsi yang menjadi juara Business Plan Competition tingkat regional Sumatera dan mewakili Sumut di ajang tingkat nasional.

WAGUBSU Ir. HT Erry Nuradi, MSi bersama pimpinan Yayasan Pendidikan Pangeran Antasari menyaksikan presentasi dokter kecil.


WAGUBSU Ir. HT Erry Nuradi, MSi foto bersama Ketua YP Pangeran Antasari Dr Tommy Leonard SH MKn (kiri) dan Ketua Pembina YP Pangeran Antasari Heriyanti SH MKn.

Waspada/Sugiarto Waspada/Sugiarto


WAGUBSU Ir. HT Erry Nuradi, MSi foto bersama pimpinan Yayasan Pendidikan Pangeran Antasari beserta jajaran dewan guru.

WAGUBSU Ir. HT Erry Nuradi, MSi foto bersama siswa Pramuka Yayasan Pendidikan Pangeran Antasari beserta dewan guru.



WAGUBSU Ir. HT Erry Nuradi, MSi foto bersama pimpinan Yayasan Pendidikan Pangeran Antasari dan jajaran dewan guru, beserta para murid Taman Kanak-kanak.

WAGUBSU Ir. HT Erry Nuradi, MSi foto bersama pimpinan Yayasan Pendidikan Pangeran Antasari dan jajaran dewan guru, beserta para murid Sekolah Dasar.

SISWA Dokter Kecil Rizki Anandaputra membacakan puisi di hadapan Wagubsu Ir HT Erry Nuradi MSi.


WAGUBSU Ir. HT Erry Nuradi, MSi foto bersama pimpinan Yayasan Pendidikan Pangeran Antasari dan sebagian siswa SMA dan SMK.

Waspada, senin 7 april 2014  
Read more
Read more
Similar to
Popular now
Just for you