Page 1

Berastagi 18-27 C

R. Prapat 25-340C

Parapat 17-27 0C

P. Siantar 18-280C

Sibolga 22-33 0C

0

Hujan guntur

Berawan

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Senin Medan 24-330C

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

SENIN, Pahing, 6 September 2010/27 Ramadhan 1431 H

No: 23262 Tahun Ke-64

Terbit 28 Halaman (A1-12, B1-8, C1-8)

Harga Eceran: Rp 2.500,-

Waspada/Surya Efendi

KUE DAN MANISAN LEBARAN DISERBU: Warga menyerbu aneka kue dan manisan di Pasar Petisah Medan, Minggu (5/9). Minggu terakhir bulan puasa, warga Medan dan luar Medan memenuhi pasar perbelanjaan modern maupun tradisional guna membeli kebutuhan lebaran.

20 Juta Orang Siap Mudik Pengungsi Sinabung Rentan Gangguan Jiwa DPD RI Turunkan Psikolog Dan Ahli Kesehatan Jiwa KABANJAHE (Waspada): Berada di tempat penampungan dan meninggalkan seluruh harta benda termasuk rumah, membuat para pengungsi Gunung Sinabung memiliki beban pikiran yang sangat berat. Para pengungsi selalu teringat dengan tempat tinggalnya dan merasa cemas setiap kali terjadi letusan gunung Sinabung. Akibatnya, mereka sangat rentan terhadap gangguan jiwa mulai dari gejala yang ringan hingga berat. Demikian dikatakan Team Leader Community Mental Health Nursing Fakultas Keperawatan Universitas Indonesia DR. Budi Anna Keliat, S.Kp, M.App, Sc kepada Waspada usai memberikan terapi mental kepada ratusan pengungsi gunung Sinabung yang ditampung di Jambur Tuahlopati, Kabanjahe, Minggu (5/9) sore. Anna dan sejumlah anggota timnya yang bergabung dalam Posko DPD RI Peduli ini, berupaya meminimalisir gejala gangguan jiwa yang dialami para pengungsi akibat rasa kecemasan dan kesedihan yang berlebihan pasca meletusnya gunung Sinabung.

Berdasarkan Riset Kesehatan Dasar 2007, lanjut Anna, dari 361.060 jiwa penduduk Kab. Karo tercatat sekitar 354 jiwa mengalami gangguan jiwa Lanjut ke hal A2 kol. 1

JAKARTA (Waspada): Sekitar 20 juta warga secara nasional siap mudik untuk merayakan Lebaran di kampung halaman masing-masing. Puncak arus mudik tersebut secara berangsur-angsur dimulai pada Minggu (5/9), dengan menggunakan bus angkutan umum, pesawat terbang, kapal laut, mobil pribadi dan banyak yang menggunakan sepedamotor. Dalam menyukseskan arus mudik tersebut, Ketua Umum Palang Merah Indo-

nesia (PMI) Jusuf Kalla melepas ambulans dan pos pertolongan pertama di Silang Monas Jakarta, Minggu (5/9) pagi. Secara simbolik upacara ini digelar untuk pelepasan 4 ambulans helikopter, 263 mobil ambulans dan 270 pos pertolongan pertama guna menjadi tim siaga lebaran 2010.

Waspada/David Swayana

RATUSAN pengungsi gunung Sinabung yang ditampung di Jambur Tuahlopati, Kabanjahe, menjalani terapi mental melalui program Penatalaksanaan Keluarga Harmonis yang diselenggarakan Posko DPD Peduli, Minggu (5/9).

Canda Pengungsi

Kajian Tafsir Al-Quran Oleh Dr H Achyar Zein, MA

AL-QUR’AN adalah kitab suci ajaib karena tidak ada satupun pernyataannya yang bertentangan dengan penemuan modern. Padahal masa yang dilalui al-Qur’an cukup panjang yaitu 1431 (seribu empat ratus tiga puluh satu) tahun. Meskipun masa yang sudah dilalui al-Qur’an cukup panjang namun pesan-pesannya tetap saja eksis.

HAMPIR seluruh pengungsi gunung Sinabung yang menghuni Jambur Tuahlopati, Kabanjahe memperlihatkan raut wajah tegang. Tatapan mata mereka begitu tajam setiap kali melihat kedatangan orang asing yang mengunjungi tempat pengungsian tersebut. Minggu (5/9) sore, Team Community Mental Health Nursing Fakultas Keperawatan Universitas Indonesia yang berada di bawah koordinasi Posko DPD Peduli menyambangi ratusan pengungsi tersebut. Tim yang dipimpin DR. Budi Anna Keliat, S.Kp, M.App, Sc itu menyapa setiap pengungsi, baik yang sedang duduk atau merebahkan diri di lantai. Meski bibir mereka tersenyum, namun kecemasan masih terpancar jelas di wajahnya. Sebagian lagi

Lanjut ke hal A2 kol. 6

Lanjut ke hal A2 kol. 6

Keajaiban al-Qur’an

: 12:25 : 18:32 : 04:53

Asar Isya Subuh

Hari Ini Presiden Tinjau Pengungsi Sinabung

Lanjut ke hal A2 kol. 2

Lanjut ke hal A2 kol. 3

Rasululllah SAW berkata: “Puasa yang kamu lakukan masih tergantung antara langit dan bumi sampai kamu membayar zakat fitrah.” (HR Abu Daud)

Waspada/Ismanto Ismail

Petugas Juru Periksa Reskrim Polsekta Medan Kota menginterogasi ketiga wanita diduga tersangka kasus copet terhadap WN Yaman di Ramadhan Fair, Minggu (5/9).

Tiga Wanita Pencopet WNA Di Ramadhan Fair Diringkus

Lanjut ke hal A2 kol. 3

Malaysia Harapkan Pertemuan Di Kinabalu Berikan Solusi MALAYSIA( Waspada): Pertemuan antara Indonesia dan Malaysia di Kinabalu pada 6 November 2010, diharapkan dapat memberikan solusi yang tepat dalam mengatasi permasalahan perbatasan kedua negara. Terutama setelah ketegangan yang terjadi akibat

Waspada/Hamdani

MEDAN (Waspada): Polsekta Medan Kota meringkus tiga wanita pencopet terhadap korbannya Warga Negara Yaman di Ramadhan Fair Jl. Masjid Raya, Sabtu (4/9) malam. Ketiga tersangka, JP, 32 dan A, 30, warga Jalan Dorowati Lorong Gereja Kampung Durian, Medan serta DA, 33,

: 15:31 : 19:38 : 05:03

Bandara Polonia, kawasan Jalan Djamin Ginting dan Jalan Sisingamangaraja Medan. Pantauan Waspada, warga masyarakat yang akan mudik terlihat berdesakan terutama untuk tujuan kota-kota terdekat seperti, Kisaran, Tanjungbalai, Tebingtinggi, Pematangsiantar menggunakan kereta api. Demikian pula yang menggunakan bus angkutan umum untuk tujuan kota-kota tersebut cukup ramai.

BERDOA BUAT SINABUNG: Ratusan umat Islam memanjatkan doa dan zikir bersama buat korban Sinabung di Masjid Agung Medan, Minggu (5/9). Diikuti dari berbagai daerah Kota Medan bertujuan meminta keselamatan dan perlindungan khususnya korban Sinabung.

MEDAN ( Waspada): Kepala Penerangan Kodam I Bukit Barisan Letkol CAJ Asren Nasution mengatakan, pihaknya siap untuk mengamankan seluruh proses kunjungan Presiden Susilo Bambang Yudhoyono guna meninjau pengungsi letusan Gunung Sinabung di Kab. Tanah Karo, Senin (6/9). “Kodam I Bukit Barisan siap mengamankan,” kata Asren Nasution berbuka puasa bersama Gubernur Sumatera Utara dengan pemimpin redaksi media massa di Medan, Minggu (5/9) malam. Bahkan, kata Asren, Pangdam I Bukit Barisan Mayjen TNI Leo Siegers memimpin langsung latihan persiapan penyambutan kedatangan Presiden Yudhoyono dan rombongan itu. Dengan pemantauan Pangdam I Bukit Barisan Mayjen TNI Leo Siegers, tim pengamanan sudah mensterilkan seluruh rute perjalanan Presiden Yudhoyono mulai dari kawasan Lanud Medan hingga lokasi pengungsian yang akan didatangi Presiden Yudhoyono. Pihaknya juga telah mengerahkan beberapa satuan tempur di jajaran

27 Ramadhan, untuk Medan dan sekitarnya

Zuhur Maghrib Imsak

Kegiatan tersebut merupakan partisipasi PMI kepada warga masyarakat muslim agar mereka dapat berlebaran dengan nyaman. Arus Mudik Di Medan Sementara itu, arus mudik dari Medan keluar kota menjelang H-5 Lebaran yang diperkirakan jatuh pada 10 September 2010, mulai berangsur padat, Minggu(5/9). Beberapa titik yang dijadikan arus mudik warga masyarakat ke luar kota yakni, Stasiun Besar Kereta Api Medan,

Presiden: Ekses Negatif Demokrasi Harus Dikoreksi CIKEAS, Bogor (Antara): Presiden Susilo Bambang Yudhoyono mengatakan ekses negatif sistem demokrasi yang berlangsung saat ini harus dikoreksi sehingga cita-cita reformasi dapat terjaga. Dalam sambutannya pada acara buka puasa bersama dengan pimpinan partai politik peserta deklarator SBY-Boediono di Puri Cikeas, Bogor,

Minggu (5/9) petang, Presiden mengatakan semua pihak harus bersama-sama memberikan koreksi bila ada yang menyimpang. “Banyak ekses dalam demokrasi yang kita jalankan, termasuk pemilu kepala daerah. Bila ada ekses jangan berdiam diri, mari kita lakukan perbaikan,” tegasnya. Lanjut ke hal A2 kol. 6

Waspada/Surya Efendi

GUBSU H Syamsul Arifin, SE memanjatkan doa ketika berziarah di makam mantan gubsu Alm HT Rizal Nurdin di kuburan Masjid Raya Al Mashun Medan, Minggu (5/9).

demonstrasi di depan Kedutaan Besar Malaysia di Jakarta beberapa waktu lalu. Menteri Luar Negeri Malaysia Anifah Aman mengatakan, pihaknya tidak merasa optimistis maupun pesimistis mengenai hasil pertemuan nanti. Namun, dia yakin kedua negara akan dapat bekerja sama untuk mengatasi masalah perbatasan laut. “Kita harus sadar sebagai negara bertetangga, hal seperti ini dapat terjadi lagi di masa yang akan datang. Ini karena perairan pesisir dan batas maritim kita sangat jauh dan luas. Karena itu, kemungkinan terjadi lagi bentrokan akan sangat besar,” ujarnya seperti dikutip dari laman berita Bernama,Minggu(5/9). Menurutnya, jika situasi serupa terjadi lagi di perairan kedua negara, maka yang terpenting adalah bagaimana kedua negara dapat mengendalikan situasi sehingga isu tidak terus berkembang dan membesar. Jika tidak, suasana akan semakin panas dan masalah akan semakin runcing.”Dan yang paling penting lagi, suasana harus dapat dikendalikan Lanjut ke hal A2 kol. 6

Dua TKI Dari Malaysia Meninggal Di RS Koja JAKARTA(Waspada): Tenaga Kerja Indonesia (TKI) yang dideportasi karena sakit dari Malaysia, meninggal dunia di RSUD Koja Jakarta Utara. Nyawa mereka terlambat diselamatkan karena selama di penjara Malaysia, keduanya tak mendapat pelayanan medis. Samsini, 48, asal Desa Malik Jaran Kecamatan Sakra Kabupaten Lombok Timur Nusa Tenggara Barat, dideportasi bersama 319 TKI lainnya dari Malaysia. Wanita 3 anak ini, tiba di Pelabuhan Tanjung Priok dengan kapal KM Bukit Raya, 26 Agustus 2010. Dalam keadaan kritis, dia langsung dibawa ke RSUD Koja. Menurut keterangan Lily Pujiati selaku Koordinator LSM Peduli Buruh Migran, Samsini bekerja selama 18 bulan di perkebunan lada putih Johor Malaysia. Ia ditangkap Lanjut ke hal A2 kol. 1

Lima Tahun Tragedi Mandala Di Polonia

erampang Seramp ang

Sumut Harapkan Kualanamu Tak Molor Lagi

- Jangan siap mudik saja, uncang juga harus siap - He...he...he...

MEDAN (Waspada): Tragedi hancurnya pesawat Mandala di ujung landasan pacu Bandara Polonia Medan, Sumatera Utara, Minggu (5/9) genap berusia lima tahun. Lanjut ke hal A2 kol. 3


Berastagi 18-270C

R. Prapat 25-340C

Parapat 17-270C

P. Siantar 18-280C

Sibolga 22-33 0C

Berawan

Hujan guntur

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Medan 24-330C

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

z Edisi Luar Kota SENIN, Pahing, 6 September 2010/27 Ramadhan 1431 H z No: 23262 Tahun Ke-64z

60 Hektare Pertanian Warga Ditutupi Debu Vulkanik

MEDAN (Antara): Diperkirakan sekitar 60 hektare dari 150 hektare luas lahan pertanian milik warga Desa Sukadebi, Kecamatan Naman Teran, Kabupaten Tanah Karo, Sumatera Utara ditutupi debu vulkanik cukup panas yang disemburkan Gunung Sinabung. Salah seorang warga Desa Sukadebi, Simson Sembiring ,40, ketika dihubungi Antara dari Medan, Minggu (5/9) pagi, mengatakan lahan pertanian penduduk yang ditutupi debu vulkanik itu, saat ini sedang ditanami sayur-sayuran berupa tomat,cabai, jeruk dan kopi. Simson Sembiring mengatakan tanaman kopi itu seluas 20 hektare, jeruk 20 hektare, tomat lima hektare dan cabai 10 hektare. Tanaman yang sudah lama dihinggapi debu vulkanik itu seluruhnya memutih sehingga belum bisa dilihat oleh warga, karena mereka masih trauma dan takut untuk pulang ke rumah, sehubungan akhir-akhir ini aktivitas Gunung Sinabung yang terus meletus dan mengeluarkan asap tebal yang bercampur dengan partikel belerang. Para petani warga Desa Sukadebi itu, saat ini masih memilih tempat yang aman dan tinggal di lokasi penampungan yang ada di Kabanjahe. “Warga Desa Sukadebi itu juga berkeinginan untuk pulang ke rumah mereka untuk melihat tanaman yang ditutupi debu vulkanik itu, tetapi mereka masih takut dan tak berani,” kata Sembiring. Selanjutnya ia menjelaskan, belum lama ini memang ada sebanyak 150 warga dari jumlah 300 kepala keluarga yang menghuni Desa Sukadebi itu pulang untuk membersihkan rumah mereka. Lanjut ke hal A2 kol 1

Terbit 28 Halaman (A1-12, B1-8, C1-C8) z zHarga Eceran: Rp 2.500,-

Doa Dan Zikir Untuk Korban Sinabung

PVMBG Agar Teliti Gunung Martimbang

Waspada/Hamdani

Ratusan umat Islam berdoa dan dzikir bersama untuk korban bencana alam meletusnya Gunung Sinabung, di Masjid Agung, Medan, Minggu (5/9). Doa dan dzikir warga Kota Medan itu untuk meminta keselamatan dan perlindungan kepada Allah SWT agar bangsa Indonesia, khususnya korban bencana letusan Gunung Sinabung, Kabupaten Karo.

TARUTUNG (Waspada): Mengantisipasi hal yang terburuk akibat letusan gunung berapi, anggota DPRD Taput Bangun Lumbantobing meminta Pemkab Tapanuli melalui instansi terkait berkoordinasi dengan Pusat Vulkanologi dan Mitigasi Bencana Geologi (PVMBG) meneliti Gunung Martimbang. “Penelitian terhadap Gunung Martimbang di Selatan Tarutung Ibukota Tapanuli Utara atau 4 kilometer itu, sangat perlu diteliti secepat mungkin, mengingat banyaknya sumber air panas dan air soda, yang ditenggarai merupakan rembesan dari gunung berapi aktif tersebut,” terang Tolkit panggilan akrab anggota DPRD Taput itu kepada Waspada, Jumat (3/9). Tolkit mencontohkan, Gunung Sinabung di Karo meletus, setelah tidak beraktivitas ratusan tahun. Pengalaman itu harus dijadikan acuan dalam mengantisipasi hal yang paling terburuk bila terjadi bencana geologi. “Bila dilakukan penelitian sedini mungkin terhadap gunung Martimbang, tentu dapat memperkecil terjadinya hal yang buruk. Juga mengingat besarnya intensitas gempa lokal yang terjadi 2009 dan 2010,” ungkap ketua DPC Partai Demokrasi Pembaharuan (PDP) itu. Gunung Martimbang, ujar Tolkit, memiliki ketinggian sekitar 800 meter di bawah permukaan laut. Ironisnya lagi, Tarutung yang berada di lembah atau dihapit oleh pegunungan, dialiri oleh dua sungai besar yang bermuara persis di bawah Gunung Martimbang. Sehingga dikhawatirkan, bila gunung itu meletus, muara kedua aliran sungai tersebut tersumbat total, dan Tarutung akan berubah menjadi danau. Lanjut ke hal A2 kol 4

PMI Siap Bantu 20 Juta Pemudik Garuda Kerahkan Dua ‘Sapu Jagat’

Sampaikan Uneg-uneg Ke Kantor Waspada:

JAKARTA (Waspada): Ketua Umum Palang Merah Indonesia (PMI) Jusuf Kalla melepas ambulans dan pos pertolongan pertama di Silang Monas Jakarta, Minggu (5/9) pagi. Secara simbolik upacara ini digelar untuk pelepasan 4 ambulans helikopter, 263 mobil ambulans dan 270 pos pertolongan pertama guna menjadi tim siaga lebaran 2010.

97.000 Guru Tidak Menerima Tunjangan

Ambulans ini menurut Kalla, semuanya dioperasikan dengan standar yang sangat baik. PMI diturunkan ke jalan, karena pada arus mudik lebaran setidaknya ada 20 juta orang yang berlalu-lalang di jalanan untuk mudik ke kampung atau desa. “Dengan 20 juta orang ini, bukan tidak mungkin ada kecelakaan meski kita tidak inginkan,” kata Kalla saat pelepasan di Monas. Lanjut ke hal A2 kol 1

KAJIAN TAFSIR AL-QURAN

MASJIDIL HARAM DIABADIKAN DARI JAM SAKSASA

Oleh Dr H Achyar Zein, MA

Keajaiban Al-Qur’an Al-Qur’an adalah kitab suci ajaib karena tidak ada satupun pernyataannya yang bertentangan dengan penemuan modern. Padahal masa yang dilalui al-Qur’an cukup panjang yaitu 1431 (seribu empat ratus tiga puluh satu) tahun. Meskipun masa yang sudah dilalui al-Qur’an cukup panjang namun pesan-pesannya tetap saja eksis. Jika al-Qur’an adalah kitab yang biasa-biasa saja maka sudah pasti terdapat sebagian dari pesan-pesannya yang kadaluarsa. Ajaibnya, setiap kali ayat-ayat al-Qur’an dibaca maka setiap itu pula muncul inspirasi baru. Inspirasi ini dapat memotivasi manusia untuk menguak misteri alam yang selama ini tak terpikirkan oleh manusia.

Lanjut ke hal A2 kol 2

Zuhur Magrib Imsak

MEDAN DAN SEKITARNYA : 12.25 Asar : 18.32 Isya : 04.53 Subuh

Presiden: Koreksi Ekses Negatif Demokrasi CIKEAS, Bogor (Antara): Presiden Susilo Bambang Yudhoyono mengatakan ekses negatif sistem demokrasi yang berlangsung saat ini harus dikoreksi sehingga cita-cita reformasi dapat terjaga. Dalam sambutannya pada acara buka puasa bersama dengan pimpinan partai po-

litik peserta deklarator SBYBoediono di Puri Cikeas, Bogor, Minggu (5/9)petang, Presiden mengatakan semua pihak harus bersama-sama memberikan koreksi bila ada yang menyimpang. “Banyak ekses dalam demokrasi yang kita jalankan, termasuk pemilu kepala dae-

rah. Bila ada ekses jangan berdiam diri, mari kita lakukan per-baikan,” tegasnya. Kepala Negara menjelaskan reformasi gelombang pertama yang bergulir sejak 1998 telah sama-sama dilalui. Si s t e m d e m o k ra s i t e l a h Lanjut ke hal A2 kol 6

M a s j i d i l H a ra m d i Makkah, yang dipenuhi ummat Muslim yang sedang melaksanakan shalat, Minggu (5/9), diabadikan dari Menara Jam Dinding Raksasa. Arab Saudi menyatakan jam dengan diameter 43 meter ini sebagai jam terbesar di dunia, yang berdiri di atas bangunan setinggi 400 meter, yang juga diklaim sebagai bangunan nomor dua paling tinggi di dunia. -- Reuters

LHOKSEUMAWE (Waspada): Puluhan guru dari tiga kabupaten/kota, yaitu Aceh Utara, Bireuen dan Kota Lhokseumawe, mendatangi kantor harian Waspada Lhokseumawe untuk melepaskan uneg-uneg, setelah tidak ada jalan ke luar yang dapat mereka lakukan. Para guru tersebut dipimpim Ketua Koalisi Barisan Guru Bersatu (Kobar GB) Aceh, Sayuti Aulia Yusuf. “Pagi tadi kami sudah berkumpul di suatu tempat, dan membahas segala masalah yang dihadapi guru di Aceh. Akhirnya kami memutuskan mendatangi Waspada untuk membeberkan masalah kami,” ucap

WASHINGTON (Waspada): Peringatan runtuhnya menara kembar Wolrd Trade Center (WTC) akibat serangan teroris di New York, AS, pada 11 September 2001, akan d i l a k s a n a k a n . Um a t m u s l i m A m e r i k a d i m i n t a meningkatkan penjagaan pada masjid-masjid mereka. Kekhawatiran umat muslim Amerika disebabkan banyaknya sentimen anti-Islam yang timbul akibat serangan tersebut. Diduga sentimen ini akan memuncak pada 11 September nanti.

ACEH TIMUR ( Waspada): Santri di Provinsi Aceh mengutuk dan mengecam keras rencana pembakaran kitab suci Al Quran oleh kelompok ‘Dove World Outreach Center’, di Amerika Serikat. “Rencana pembakaran Al Quran itu, menurut wacana untuk memperingati tragedi pemb o m a n Wo r l d Tr a d e Centre 11 September 2001. Jika rencana itu terjadi, maka kita selaku organisasi santri di Aceh, akan menggelar aksi,” ujar Sekretaris Umum Rabitah Santri Se Aceh (Rassa), Tgk. HM. Iqbal, B.Th, MA, kepada Waspada, Minggu (5/9) di Idi.

Lanjut ke hal A2 kol 4

Lanjut ke hal A2 kol 1

Rasululllah SAW berkata: “Puasa yang kamu lakukan masih tergantung antara langit dan bumi sampai kamu membayar zakat fitrah.” (HR Abu Daud) Serangan 11 September 2001 di WTC.

Muslim Amerika Waspada Sambut 11 September

Lanjut ke hal A2 kol 7

80 Persen Penghuni Rutan Tarutung Kasus Begu Ganjang TARUTUNG (Waspada): Umumnya penghuni Rutan Tarutung para tersangka kasus begu ganjang yang merupkan titipan Polres Tapanuli Utara dan Kejaksaan. “Kapasitas Rutan Tarutung sudah over kapasitas. Idealnya

Santri Aceh Kutuk Rencana Pembakaran Al Quran

: 15.31 : 19.40 : 05:03

Sayuti kepada Waspada , Minggu (5/10). Secara umum, Sayuti menyebutkan 97.000 guru pegawai negeri di Aceh belum dibayar uang Otonomi Khusus (Otsus) atau Migas sebesar Rp2,2 juta setahun per guru. Dia mendesak pemerintah dan Dinas Pengelolaan Kekayaan Aset Daerah (DP KAA) Aceh membayarnya sebelum meugang (hari potong menjelang lebaran) Idul Fitri. Selain belum dibayarnya uang kompetensi dari hasil migas itu, sejumlah guru di daerah juga menghadapi masalah lain yang beragam.

Antara

TKI MUDIK. Seorang Tenaga Kerja Indonesia (TKI) yang bekerja di Malaysia (tengah) menangis ketika disambut oleh keluarganya saat tiba di Bandara Internasional Adisutjipto, Yogyakarta, Minggu (5/9). Sejumlah Tenaga Kerja Indonesia (TKI) yang sudah mendapatkan libur mulai berdatangan ke tanah air untuk merayakan lebaran di kampung halaman bersama keluarganya.

Waspadai Hipnotis JAKARTA (Antara): Kepala Badan Reserse dan Kriminal Polri Komisaris Jenderal Ito Sumardi, mengimbau masyarakat yang mudik ke kampung halamannya untuk mewaspadai praktik kejahatan di kendaraan umum yang menggunakan modus hipnotis. “Ini imbauan saja karena banyak penjahat Lanjut ke hal A2 kol 2

Rutan Tarutung hanya menampung 82 orang, tetapi saat ini berpenghuni 181 orang. Paling banyak terkait kasus begu ganjang berjumlah 144 orang. Dengan terpaksa gudang-gudang dan ruang Serbaguna dijadikan kamar tanahan,” ujar Kepala Rutan Tarutung – Taput, Agus Rachmatamin, Bc.IP.SH, (Foto) Minggu (5/9) kepada Waspada. Agus menyebut, pihaknya tetap berupaya melakukan pembinaan kepada warga binaannya kendati dengan memakai fasilitas yang terbatas, seperti, lapangan dan ruangan serbaguna. Katanya, ruangan yang dijadikan sebagai kamar hanya untuk sementara saja. Kita tetap melakukan yang terbaik bagi napi maupun penghuni lainnya. Apalagi beberapa bulan lalu banyak terjadi kasus begu ganjang di Taput yang melibatkan warga pedesaan tersangkanya. Barangkali mereka Lanjut ke hal A2 kol 3

Serampang - Ingat jasa guru yooo .... - He.... he....he....


Berita Utama

A2 PMI Siap ....

Untuk itu Kalla mengucapkan terimakasih dan menanamkan rasa kebanggaan bagi petugas yang ada di lapangan. Karena di tengah masyarakat lain sedang berbahagia, petugas PMI harus ada di lapangan untuk melakukan misi-misi kemanusiaan. “Ini adalah tugas mulia dan penting, juga pengabdian yang penting. Jadi saya sampaikan terima kasih dan selamat bertugas,” kata Kalla. Dalam pelepasan tim siaga lebaran 2010 ini, menurut Ketua Bidang Kesehatan PMI Farid Husein, PMI menyediakan pertolongan pertama dengan jumlah armada yang disiapkan mencapai 263 mobil ambulan, 273 pos pertolongan pertama, 4 ambulans helikopter, 4461 relawan, 154 dokter, dan 256 perawat. “Ini kami lepas secara nasional,” ujar Farid. Dalam acara simbolik di Monas ini terlihat ada 4 ambulans, 42 ambulans darat, dan ada 80 relawan yang berasal dari DKI Jakarta.Selain melepas melalui upacara, Kalla juga melihat simulasi pertolongan pertama dan melakukan penempelan stiker t a n d a t i m s i a g a l e b a ra n disiapkan. Kerahkan Dua ‘Sapu Jagat’ Pada masa menjelang Lebaran 2010 ini, maskapai penerbangan mulai melakukan peningkatan kapasitas. Garuda Indonesia yang memaksimalkan kapasitasnya dengan menambah frekuensi dan pengalihan operasi pesawat. Juru bicara Garuda Pujobroto mengatakan, pihaknya akan mendatangkan dua unit pesawat jumbo, Boeing 747400 untuk mengangkut para penumpang.

Pesawat ini fungsinya menjadi pesawat sapu jagat yang akan menyapu setiap penumpang mulai awal pekan ini. “Karena besarnya pesawat, hanya bisa mengangkut pemudik di bandara tertentu saja yaitu Polonia (Medan) dan Juanda (Surabaya),” kata Pujobroto di Jakarta Minggu (5/9). Sebelumnya, Direktur Pengembangan dan Teknologi In f o r m a s i Ga r u d a , E l i s a Lumbantoruan mengatakan, dalam operasi Lebaran 2010 maskapai BUMNtersebut akan diperkuat dengan dua pesawat besar yaitu Boeing 747-400. Pesawat tersebut biasanya dioperasikan pada rute Jakarta-Jeddah, akan dioperasikan untuk rute Jakarta-Medan dan Jakarta-Surabaya. “Menjelang IdulFitri, penerbangan ke Jeddah biasanya berkurang, karenanya penerbangan ke Jeddah dikurangi,” kata Elisa. Pesawat Boeing 747-400 memiliki kapasitas cukup besar, bila dimaksimalkan bisa mengangkut 428 penumpang. Demi kenyamanan penumpang, jumlah kursi dimodifikasi menjadi kurang dari 400. Dengan kapasitas tersebut bisa memaksimalkan penumpang. Dua Boeing 747-400 tersebut dioperasikan untuk rute Jakarta-Medan dan Jakarta-Surabaya, karena dua kota tersebut merupakan kota tujuan penerbangan dengan permintaan yang paling besar. Dijelaskan, pada Lebaran kali ini Garuda menambah sebanyak 30 ribu kursi tambahan yaitu 23 ribu untuk Garuda dan 7.000 kursi akan dioperasikan oleh unit usaha garuda yaitu Citilink. (VIVAnews/kps)

60 Hektare ....

“Ratusan warga Desa Sukadebi itu dievakuasi petugas dengan menggunakan mobil milik Pemkab Tanah Karo untuk menjaga hal-hal yang tidak diingini terjadi terhadap petani tersebut,” kata Sembiring.

Santri Aceh ....

muslimin di seluruh dunia. “Apabila benar terjadi, maka akan memancing reaksi keras dari umat Islam di seluruh dunia dan menimbulkan ketegangan, bahkan konflik keras antar umat beragama,” imbuh Iqbal. Kare n a n y a , s a m b u n g Iqbal, rencana tersebut harus dicegah sejak dini. “Kita dari santri meminta agar umat Islam mendoakan agar rencana pembakaran Al Quran, tidak terjadi,” pintanya seraya mengatakan, doa umat Islam adalah upaya menyelamatkan Al Quran dari pelecehanpelecehan terhadap kesucian kalam Allah. Menurut Iqbal, pelecehan seperti rencana kali ini bukan hanya kali ini dilakukan, karenanya Rassa mengecam keras tindakan pembakaran tersebut. “Karena kita nilai sebagai bentuk perendahan martabat kaum muslim seluruh dunia,” tegas Iqbal. (cmad)

Namun, katanya, warga yang pulang ke rumah itu, terpaksa balik lagi ke tempat pengungsian menyusul terjadinya letusan Gunung Sinabung Jumat (3/9) sekitar pukul 04:50 WIB.

Kata Iqbal, pihaknya sebagai ikatan santri dan alumni dayah di Aceh, mengutuk rencana pembakaran Al-Quran. Pasalnya, selain Al Quran sebagai kitab suci umat Islam se dunia, setiap muslim berhak melindungi kitab sucinya dari pelecehan non Islam. Lebih lanjut alumni Pascasarjana University Of Lukcnow, India, itu menyebutkan, Rassa mengecam keras rencana pembakaran Al Quran yang dinilai sebagai tindakan keji, tidak beradab, dinilai sangat merendahkan kehormatan dan keagungan serta kesucian Al Quran. Menurut Iqbal, jika rencana kafir tersebut berhasil, maka hari itu dianggap tidak hanya merupakan penghinaan terhadap kesucian Al Quran, namun penghinaan terhadap Islam dan kaum

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport.

Waspadai ....

Jawaban Problem Catur: 1. KxK, bxK. 2. g4. Hitam menyerah karena 2. ...., hxg. 3. fxg, Rh6. 4. Rc2 seterusnya mengambil jalur a untuk menyantap c4. Jika 2. ......., f5. 3. exf5+, Rf6. 4. Re3. Hitam tidak dapat mempertahankan c4 atau laju g4.

Jawaban TTS: TTS Topik

Santapan Ramadhan

I Z A K S U H I T Q U N M I I N L G U A F K H A M R F A I A Q L I Y Y R N Y D A A H J T U J U H P A A K A L A J E

A T F I T R A S N A N N A R I A S E D E K A Y B A L Q A D R A H I A 'I S M A H H A A U Q A L A H S S U L U H R I B N N G K I N G

H I B A H

B U T A

Jawaban Sudoku:

6 9 7 4 1 8 5 3 2

1 2 3 5 9 6 4 7 8

4 5 8 3 7 2 6 9 1

7 4 2 8 3 5 9 1 6

5 3 9 7 6 1 8 2 4

8 6 1 9 2 4 7 5 3

3 8 6 2 5 7 1 4 9

2 7 4 1 8 9 3 6 5

9 1 5 6 4 3 2 8 7

memanfaatkan kesempatan pada saat penumpang sedang tidur lelap malam atau pagi,” katanya saat meninjau situasi di Stasiun Gambir, Jakarta, Minggu (5/9). Ito mengatakan Polri bekerja sama dengan PT Kereta Api Indonesia untuk melakukan pengamanan di jalur mudik maupun di rangkaian kereta. “Khususnya pencurian direlnya, cuma mungkin perlu diwaspadai ada hipnotis, jadi masing-masing penumpang diimbau agar betul-betul menjaga harta miliknya,” ujarnya. Ito menuturkan modus operandi kejahatan dengan hipnotis sangat mungkin terjadi saat arus mudik berlangsung.”Hipnotis sangat mungkin terjadi dan tiap tahun terjadi. Tapi saat ini belum ada

Keajaiban ....

Sebagai contoh, al-Qur’an selalu menghubungkan hujan dengan kesuburan tanamtanaman. Ketika dilakukan penelitian, ternyata hujan mengandung pupuk sehingga hasil tanaman yang disiraminya lebih baik dari yang disirami manusia. Pada saat manusia menduga bahwa bumi adalah datar akan tetapi al-Qur’an menyatakan sebaliknya bahwa bumi adalah bulat. Setelah dilakukan penelitian modern ternyata bumi memang bulat sesuai dengan pernyataan alQur’an. Masih banyak lagi contohcontoh lain yang dikemukakan oleh al-Qur’an yang terbukti kebenarannya oleh penelitian modern. Contoh-contoh dimaksud seperti hukum, sosial, ibadah, bisnis dan sebagainya.

WASPADA Senin 6 September 2010

Sinode Godang Amandemen HKBP Telan Biaya Rp7 M

Antara

AMBULANS UDARA. Ketua umum PMI Jusuf Kalla berada di ruang kemudi helikopter yang menjadi ambulans udara ketika berlangsungnya Apel Siaga Lebaran 2010 di Monas, Jakarta, Minggu (5/9). Pada mudik lebaran ini PMI menyiapkan empat unit ambulans udara untuk memberikan pertolongan pertama bila terjadi kecelakaan di jalan tol Jakarta-Merak, JakartaCikampek, Jakarta-Ciawai dan Jakarta-Clenyi.

TARUTUNG (Waspada): Sinode Godang Amandemen (SGA) HKBP (Huria Kristen Batak Protestan) yang berlangsung selama tiga hari (14 hingga 16 September) di Seminarium Sipoholon – Tapanuli Utara, menelan biaya Rp7 miliar. Untuk biaya penyelenggaraan Sinode Godang HKBP hanya Rp1,5 miliar yang sumber dananya dari berbagai partisipasi dan kontribusi dari resort – resort HKBP di Nusantara. Apalagi pelaksanaan Sinode Godang Amandemen HKBP baru kali ini diselenggarakan. Demikian disampaikan Ketua Umum Panitia SGA HKBP yang juga Sekjen HKBP Pdt Ramlan Hutahaean MTh didampingi Ka. Biro Personalia Pdt Donald Sipahutar STh (Sekretaris Umum Panitia SGA) HKBP 2010 kepada war-

Lima Lembaga Strategis Harus Berperan Atasi Isu Begu Ganjang TARUTUNG (Waspada): Isu begu ganjang beberapa tahun terakhir di Kab. Tapanuli Utara telah merusak tatanan kehidupan masyarakat juga merenggut nyawa beberapa warga yang dituduh sebagai pemilik begu ganjang. Merebaknya isu begu ganjang di Taput yang selama ini terkenal dengan daerah adat dan pusat penyebaran a j a ra n a g a m a K r i s t e n d i Indonesia, sangat memilukan. Sudah bergesernya nilainilai adat, agama, yang berakibat pada tatanan kehidupan yang harus saling bermusuhan satu sama yang lain. Sehingga sekelompok orang sengaja

80 Persen Penghuni .... melakukan perbuatan melawan hukum dengan main hakim sendiri itu secara beramai-ramai sehingga banyak yang dititipkan di Rutan Tarutung sebagai tersangkanya, ujar Agus. Sementara itu, Kapolres Taput AKBP I. Ketut Gede Wijatmika, SiK kepada wartawan mengakui, Kapoldasu sudah memberitahunya masalah begu ganjang di Kabupaten Taput. “Untuk mengantisipasinya, kita akan terus melakukan koordinasi dengan berbagai elemen masyarakat maupun kepada Pemkab Taput. Karena munculnya kasus begu ganjang di tengah masyarakat dengan main hakim sendiri, jelas sebagai perbuatan melawan hukum. Apalagi ada korban,” ujar Kapolres. (a13)

laporan, hanya pencurian biasa,” tuturnya. Ito mengungkapkan, Polri telah mendukung penuh pengamanan di sepanjang jalur mudik dengan mengerahkan anggotanya di daerahdaerah. “Kita sudah ada langkahlangkah yang dilakukan, semua kereta itu secara terbuka dikawal oleh anggota Polri khususnya Brimob (Brigade Mobil) untuk menjaga keamanan sepanjang rel kereta api maupun gerbong kereta dari segala kemungkinan termasuk kemungkinan sabotase,” paparnya menegaskan. Pada kesempatan itu, Ito melakukan peninjauan dengan didampingi oleh Direktur Utama PT KAI Ignatius Jonan dan Kepala Daerah Operasi (Kadaop) I Mulianta Sinilingga. Adapun dari segi hukum, sosial, ibadah dan bisnis dapat dikatakan bahwa keajaiban alQur’an kurang bergaung. Hal ini bukan karena tidak ada keajaiban pada bidang-bidang ini tetapi terlalu banyak campur tangan manusia di dalamnya. Keajaiban dalam bidang hukum dapat ditandai adanya jaminan kelanggengan hidup dan sifat hukumnya yang elastis. Akan tetapi ketika hukum al-Qur’an ini sampai ke tangan manusia maka kesan yang muncul adalah statis dan kekerasan. Demikin juga dalam hubungan sosial dimana alQur’an menyatakan bahwa perbedaan ras adalah media untuk saling mengenal. Ketika hal ini ditangani oleh manusia maka perbedaan ras selalu dijadikan alasan untuk saling

mempergunakan kesempatan itu untuk mencetuskan isu yang tidak lagi beradab di Bona Pasogit saat ini. Menurut Tolkit, itu terjadi disebabkan pesimisme dan kecemburuan sosial di kalangan masyarakat Bona Pasogit. Sehingga muncul pikiran dan pemikiran sekelompok orang untuk memperlakukan seseorang di luar norma agama, adat dan hukum serta menjadi modal memprovokasi kelompok agar bertindak anarkis bahkan pembunuhan. Peristiwa itu terjadi di Tapanuli Utara di Desa Sitanggor, Kec. Muara, Desa Partangga, Kec. Sipoholon, Siborongborong, Pangaribuan dan beberapa desa lainnya. Di Desa Sitanggor, misalnya, akibat isu Begu Ganjang terjadi pembunuhan, pembakaran mayat, perusakan rumah dan lainnya. Begitu juga di desa lainnya. Jelas telah melanggar norma-norma adat, budaya, agama dan hukum. Oleh sebab itu, kata Tolkit, ada lima lembaga strategis yang ambil peranan untuk menghilangkan isu begu ganjang di Taput. Kelima lembaga

antara lain, keagamaan, seperti gereja atau masjid. Gereja dan masjid harus bertindak lebih aktif memberikan siraman rohani dan pembinaan mental kepada warga. Sehingga masyarakat percaya, tidak ada kekuatan apapun di dunia ini selain dari Tuhan. Kemudian, lembaga pendidikan seperti sekolah. Lembaga pendidikan seperti sekolah yang dilayani oleh para guru sebaiknya mencerminkan prilaku siswa yang berakhlak . Guru sebagai pelayan formal di sekolah khusus kepada anak didik agar benar-benar hadir sebagai panggilan jiwa, bukan komersial. Organisasi Kepemudaan (OKP) dan Organisasi Kemasyarakatan (Ormas). Juga harus memberikan yang terbaik untuk memberikan sosialisasi kepada masyarakat khusus di desa agar tidak cepat terprovokasi issu miring yang berakibat fatal terhadap rusaknya tatanan soaial. Dengan penyebaran isu, seseorang telah memiliki begu ganjang yang seolah olah dapat membuat seseorang jatuh sakit dan bahkan meninggal dunia seketika.

Muslim Amerika ....

Kepala Badan Perencana Pembangunan Pemkab Taput Drs Parsaoran Hutagalung yang dikonfirmasi wartawan menyangkut imbauan anggota dewan itu, belum dapat berkomentar. “Saya masih rapat,” ujarnya. (a13)

inginkan, seperti membersihkan taman, memberi makan tuna wisma, dan memberikan mainan bagi anak yang sakit sebagai kampanye nasional promosi Islam pelayan kemanusiaan. “Kami dapat memperkirakan ada orang gila di luar sana yang akan melakukan aksi gila, tapi kami tidak ingin menciptakan histeria di antara umat muslim. Amerika, secara umum mendukung pluralisme, hanya saja terdapat banyak informasi salah beredar di luar sana yang menimbulkan kebingungan,” ujar salah satu anggota Dewan Organisasi Islam Michigan, Victor Begg. Sementara, Islamic Center di banyak kota di Amerika saat ini meningkatkan pengawasannya, dan menjaga hubungan dekat dengan para penegak hukum. “Kami meminta setiap orang tetap waspada dan melaporkan segala sesuatu yang dianggap mencurigakan,” ujar Ramzy Kilic, anggota Dewan Hubungan Islam Amerika yang bermarkas di Tampa, Florida. Peringatan 11 September selalu menjadi tantangan bagi umat muslim Amerika. Ditambah lagi teriakan oposisi menentang pembangunan mesjid di ground zero, semakin memperburuk citra Islam. (VIVAnews/AP)

membantai. Dalam bidang ibadah terasa sekali keajaiban alQur’an yang menerapkan rukun dan syarat yang sederhana. Akan tetapi, ketika persoalan ini ditangani oleh manusia maka yang muncul adalah rukun dan syarat yang ‘menjelimet’. Sebagai contoh, perintah tayammum dalam al-Qur’an hanya menyapu muka dan kedua tangan dan tidak menyebutkan sampai siku. Akan tetapi ketika sampai ke tangan manusia maka batas sapuan pada tangan disebutkan sampai siku. Adapun dalam bidang bisnis, al-Qur’an hanya mensyaratkan saling ridha (‘an taradhin). Ketika sampai ke tangan manusia maka muncul syarat lain yaitu adanya ijab kabul antara penjual dan

pembeli dalam satu majlis. Keajaiban al-Qur’an dalam beberapa bidang di atas adalah prinsip dasar yang dibangun oleh al-Qur’an yaitu untuk memudahkan manusia. Kemudahan ini tidak lain agar manusia dapat melakukan aktifitas secara bebas. Realitasnya, syarat yang dikemukakan oleh al-Qur’an sangat sesuai dengan kehidupan dunia modern. Hal ini menjadi bukti bahwa alQur’an adalah kitab suci ajaib yang kebenarannya dapat dirasakan oleh setiap generasi. Meskipun perbuatan manusia dapat menutup keajaiban al-Qur’an namun lambat laun keajaiban tersebut akan kembali bergaung. Karena, keputusan yang dibuat oleh manusia tidak mampu beradaptasi dengan perkembangan zaman.

Situasi diduga bertambah panas pada tanggal 11 September yang bertepatan Hari Raya Idul Fitri. Para ulama muslim Amerika khawatir peringatan itu disalahartikan sebagai peringatan serangan teroris. Dikabarkan akan ada demonstrasi di lokasi pembangunan masjid dekat ground zero. Demonstrasi ini akan menampilkan Geert Wilders, politisi Belanda pembenci Islam yang pernah heboh dengan film “Fitna”. Ditambah lagi pada tanggal itu, akan ada rencana hari pembakaran kitab suci AlQur’an oleh sebuah sekte Kritsten Dove World Outreach Center di Florida. Komunitas Islam meminta bantuan para pemimpin agama lain dan memberikan bantuan kepada lingkungannya untuk menunjukkan kesetiaan mereka kepada Amerika. Hal ini mereka lakukan untuk melindungi komunitas mereka dari hal-hal tidak di-

PVMBG Agar ....

tawan di Kantor Pusat HKBP, Jumat (4/9). Sekjen HKBP menerangkan, poin-poin yang akan dibahas dalam SGA sudah ada dan materinya berdasarkan usulan dari MPS-D (Majelis Pekerja Sinode – Distrik). Di antara item yang akan dibahas, kata Sekjen, perubahan sistim pemilihan Ephorus HKBP menjadi langsung yang hanya ada dua calon. Untuk dapat dicalonkan harus sudah pernah sebagai Praeses, Ketua Rapat Pendeta (KRP). Jenjang struktural di HKBP sudah pernah di dijabatnya. Barangkali usulan itu ada untuk memperketat calon pimpinan yang diajukan ke Sinode Agung HKBP. Jadi tidak semua Pendeta dapat dicalonkan,tegas Pdt Ramlan Hutahaean MTh. Sedangkan untuk periode, lanjut Sekjen, ada usulan agar 6 tahun, 5 tahun dan 4 tahun. Ini juga menjadi pembahasan terpenting disamping penyederhaaan peserta Sinode dan penguatan MPS agar lebih berfungsi dalam membantu pimpinan HKBP untuk pelayanan,ujarnya seraya menye-

but, peserta SGA HKBP 2010 di Seminarium Sipoholon akan di ikuti 1.300 orang dari 620 resort HKBP se-Dunia. PTUN Sekjen menginformasikan, PTUN (Pengadilan Tata Usaha Negara) telah memenangkan tuntutan HKBP untuk kebebasan beribadah dengan mendirikan rumah ibadah. Begitu juga putusan PTTUN (Pengadilan Tinggi Tata Usaha Negara) Jawa Barat yang mengabulkan tuntutan jemaat HKBP Pilladelpia dan HKBP Pangkalan Jati – Depok. Dalam putusan itu, mencabut pelarangan walikota mendirikan rumah Ibadah. Dengan begitu, sebut Pdt Ramlan Hutahaean MTh, segala argumen yang dibuat Pemda setempat tentang proses perizinan mendirikan rumah ibadah dicabut. Dari sudut putusan itu, mendirikan rumah Ibadah sudah dapat diteruskan. Sehingga putusan itu kita minta supaya diamankan Pemer intah sebagai perwujudan negara hukum, pinta Pdt Ramlan Hutahaean, MTh. (a13)

Selanjutnya, Lembaga Adat Dalihan Natolu (LADN) Taput. LADN selaku lembaga yang dibentuk pemerintah daerah harus bekerjasama untuk melaksanakan pertemuan dan diklat pembinaan moral, mental terhadap warga. Sehingga isu Begu Ganjang’ yang selama ini dicetuskan tidak lagi dipercaya. L e m b a g a Ke s e h a t a n . Peranan Lembaga kesehatan selaku pelayan kesehatan terhadap masyarakat di daerah sangat diperlukan. Sebab pelayan medis seperti dokter, bidan, perawat dan mantri kesehatan harus dapat menjawab isu Begu Ganjang. Artinya, seseorang jatuh sakit dan bahkan meninggal dunia medis, harus dapat memvonnis dan memberi jawaban kepada masyarakat karena mengidap sesuatu jenis penyakit, bukan karena akibat Begu Ganjang. Pemerintah, tambahnya, sebagai pelayan masyarakat harus lebih bijaksana membuat kebijakan untuk memutuskan yang terbaik di masyarakat, pungkasnya. (c12)

Sebagaimana Ketua Kobar-GB Aceh Utara, Yursal mengatakan sejumlah guru yang ada di Aceh Utara belum mendapatkan tunjangan non sertifikasi Rp250 ribu selama enam bulan. Juga belum dibayarnya rapel kenaikan tunjangan selama 15 bulan, terhitung Januari 2009-Maret 2010. Sementara permasalahan guru di Bireueun, 5.339 guru pegawai negeri tidak dibayar uang minum sejak Juli-Desember 2009, juga belum dibayarnya rapel kenaikan beras dari Januari 2009-Maret 2010, dan belum menerima pembayaran kenaikan gaji 5 sejak Januari-April. Sedangkan pegawai seluruh Indonesia semuanya sudah, kata Ketua Kobar-GB Bireueun, Drs M. Jafar. Sejumlah guru dari Kota Juang itu mengaku telah mendatangi DPR Bireueun sebanyak lima kali, juga menemui Bupati dan Sekda pada kesempatan lain, tetapi tak mendapatkan hasil apa-apa tentang masalah yang mereka hadapi.

97.000 Guru ....

Sementara Sekretaris Kobar-GB Lhokseumawe, Andika mengeluhkan soal pemotongan uang apresiasi rapel kenaikan gaji yang dilakukan secara beragam dari 5%-10%. Dengan ancaman, jika tidak bersedia, amprah kenaikan gaji tak diproses. Selain itu juga dilakukan pemotongan terhadap tunjangan beras 10%, jika tidak bersedia tunjangan itu terancam hangus. Dan uang pemotongan itu didalihkan sebagai uang ucapan terimakasih. Sedangkan uang non sertifikasi sudah dibayar, tetapi lagi-lagi ‘disunat’ Rp10 ribuRp15 ribu dengan alasan sebagai uang buka puasa bagi DPKAD. Selain permasalahan itu, Kobar-GB Aceh, Sayuti Aulia mengatakan, jika guru yang ada di bawah Dinas Pendidikan belum mendapat tunjangan non sertifikasi sebesar Rp250 ribu selama enam bulan, maka sejumlah guru di bawah Kementrian Agama, belum mendapat uang tunjangan itu selama 1,5 tahun. (b12/b03)

Presiden: Koreksi ....

kita buka ruang publik yang semakin luas,” paparnya. Dalam sambutannya, Presiden juga menilai perlunya Indonesia memiliki konsensus sebagai dasar kemajuan Indonesia seperti konsensus yang dimiliki oleh AS dan China. Membandingkan dengan konsensus Washington dan konsensus Beijing, Presiden mengatakan bisa jadi konsensus Jakarta bila bisa diwujudkan akan memiliki enam pilar. Pilar pertama adalah menjalankan demokrasi bersama penegakan hukum sekaligus menjaga stabilitas. Pilar kedua adalah peranan pemerintah dalam ekonomi dijalankan tapi nilai konstruktif dalam kaidah pasar agar kompetitif tidak boleh diabaikan. Pilar ketiga, menurut Presiden adalah meskipun ekonomi nasional sudah terintegrasi dengan ekonomi internasional namun bukan berarti multina-

sional corporation yang diutamakan namun juga memperhatikan usaha kecil dan menengah. “Elemen yang keempat, pertumbuhan penting namun harus diikuti pemerataan dan keadilan sosial sekaligus pemeliharan lingkungan yang baik,” katanya. Pilar kelima, yang penting juga diperhatikan menurut Presiden, mendorong pasar domestik. “Bila masyarakat kita semakin besar daya beli, maka pasar dalam negeri akan semakin kuat dan hidup,” katanya. Dan pilar yang keenam adalah pemerintahan presidential dengan sistem multi partai. “Bangsa ini bangsa kita sendiri, kita sah dan dibenarkan untuk memikirkan sistem nasional yang cocok untuk bangsa kita. Kita tidak harus ikut-ikutan ambil model negara mana pun yang belum tentu bila diterapkan di Indonesia membawa keberhasilan,” kata Presiden.

terbentuk namun bukan berarti tidak ada kekurangan. “Desentralisasi dalam praktiknya ada penyimpangan. Mari kita perbaiki. Jangan dibaca dengan pengembalian sistem otoritarian, karena demokrasi, ham dan desentralisasi adalah agenda reformasi kita, tapi bila ada masalah jangan kita diamkan,” tegasnya. Menurut Presiden, upayaupaya untuk menyusun sistem nasional dan konsensus bagi masa depan Indonesia bukanlah monopoli elit politik semata namun juga ruang diskusi dan wacana dari publik diakomodasi sehingga semua pihak ikut serta mewujudkan sistem nasional bagi Indonesia di masa yang akan datang. “Kita punya tanggung jawab. Saya senang bila parpol pikirkan itu semua. Kita semua sebagai pelaku, stake holder. Pemerintah, DPR, DPD tidak boleh monopoli apa pun . Mari


Berita Utama

A2 Malaysia Tangkap Lagi Lima Nelayan Langkat JAKARTA(Waspada):Sekjen Koalisi Rakyat untuk Keadilan Perikanan (KIARA) Riza Damanik mengatakan, Malaysia kembali menangkap lima nelayan tradisional Indonesia dan menahannya di Kantor Polisi Kampung Jawi, Malaysia. “Penangkapan dilakukan Jumat pada pukul 10 pagi. Sekarang mereka dititipkan di tahanan kantor Polisi Kampung Jawi Malaysia. Pihak keluarga telah mengkonfirmasi ini, dan juga jaringan kita serta para nelayan yang lolos dari aksi penangkapan itu,” katanya, Minggu (5/9). Riza Damanik mengatakan, kelima nelayan berasal dari Kelurahan Sei Bilah dan Kelurahan Sei Bilah Timur, Kecamatan Sei Lepan, Kabupaten Langkat, Sumatera Utara. Kelima nelayan itu, Naser, 34, Junaidi, 30, Iswadi, 32, Jolauni, 31, dan Ali Akbar, 22. Ia menyakini penangkapan kelima nelayan oleh pihak Malayasia dilakukan di perairan Indonesia. Ini sesuai pengaduan para nelayan yang lolos dari penangkapan aparat Malaysia tersebut. “Mereka meyakini masih di perairan Indonesia,” katanya. Sementara itu, Kedubes RI di Malaysia, menurut dia, se-

perti biasa, belum memberitahukan penangkapan tersebut terhadap pihak keluarga. “Saya berharap KBRI segera bertindak memberikan bantuan hukum. Saya tidak tahu, KBRI selalu terlambat, padahal seharusnya setiap penangkapan, maka otoritas Malaysia memberitahukan kepada KBRI segera,” katanya. Terkait dengan enam nelayan tradisional dari Sei Bilah, Langkat, Sumut yang sebelumnya ditangkap pada 9 Juli, kini telah mendapatkan kejelasan. Ia mengatakan keenam nelayan itu, yang sebelumnya berada ditahanan Balai Polis Kuah Lengkawi kini telah berada di Penjara Pokok Sena, Malaysia. Ia mengatakan, lima dari enam nelayan tersebut dipenjara hingga 29 Oktober 2010. Mereka adalah Ismail, 27, Amat, 24, Hamid, 50, Syahrial, 42, dan Mahmud, 42, akan ditahan hingga 29 Oktober 2010. Sementara Zulham,40, harus mendekam hingga 9 Desember 2010. “Mereka harus dipenjara karena minimnya bantuan hukum yang diberikan, padahal mereka meyakini masih menangkap ikan di perairan Indonesia. Dimana pemerintah saat dibutuhkan?,” katanya.

Pengungsi Sinabung ...

gunung Sinabung lewat program Penatalaksanaan Keluarga Harmonis. Posko DPD Peduli ini didirikan oleh para anggota DPD RI asal Sumut yakni H. Rahmat Shah, Rudolf Pardede, Prof. Darmayanti dan Parlindungan Purba, SH, MM dengan mendatangkan sejumlah Psikolog dan Ahli Kesehatan Jiwa. Selama beberapa hari terakhir, kata Parlindungan, pihaknya sudah melihat bahwa bantuan pangan dan obat-obatan sudah mencukupi. Karena itu, DPD RI berupaya memberi bantuan berbeda namun dirasakan manfaatnya oleh para pengungsi. “Atas dasar pertimbangan itu, DPD RI mendirikan Posko DPD Peduli yang memberi pelayanan rehabilitasi mental kepada para pengungsi. Pelayanan kesehatan jiwa ini sangat penting mengingat para pengungsi sangat rentan terhadap depresi akibat kecemasan dan kesedihan yang berlebihan,” demikian Parlindungan.(m26)

berat dan 17.439 jiwa mengalami gangguan jiwa ringan. Namun organisasi kesehatan dunia (WHO) mengingatkan bahwa bencana dapat menjadi pemicu menigkatnya kasus gangguan jiwa hingga dua kali lipat. Karenanya, Pemerintah Kabupaten Karo harus segera mengantisipasi agar kasus gangguan jiwa yang sudah ada tersebut tidak mengalami peningkatan pasca bencana meletusnya gunung Sinabung. “Pemerintah harus memberi perhatian serius terhadap masalah gangguan jiwa ini. Secara ekonomi, Pemkab Karo telah kehilangan Rp420 juta per bulan akibat kasus gangguan jiwa. Sebab, 354 penderita gangguan jiwa tersebut tidak lagi produktif,” ujarnya. Sementara itu, anggota DPD RI asal Sumut Parlindungan Purba, SH, MM mengatakan, pihaknya telah mendirikan Posko DPD Peduli guna melakukan rehabilitasi mental terhadap para pengungsi

Dua TKI ... karena tidak memiliki dokumen lengkap seperti paspor dan visa. Dan meringkuk di Rumah Tahanan (Rutan) Semenji Malaysia selama 2 bulan. “Dia (Samsini) sempat mendapat perawatan di RSUD selama 10 hari. Kondisinya kian menurun akibat penyakit kanker payudara stadium 4 yang dideritanya. Akhirnya ia meninggal pukul 16.41,” ucap Lily. Rencananya jenazah Samsini yang selama bekerja di Malaysia hanya digaji 10 ringgit atau

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. KxK, bxK. 2. g4. Hitam menyerah karena 2. ...., hxg. 3. fxg, Rh6. 4. Rc2 seterusnya mengambil jalur a untuk menyantap c4. Jika 2. ......., f5. 3. exf5+, Rf6. 4. Re3. Hitam tidak dapat mempertahankan c4 atau laju g4.

Jawaban TTS: TTS Topik

Santapan Ramadhan

I Z A K S U H I T Q U N M I I N L G U A K H A M R F F A I A Q L I Y Y R N Y D A A H J T U J U H P A A K A L A J E

A T F I T R A S N A N N A R I A S E D E K A Y B A L Q A D R A H I A 'I S M A H H A A U Q A L A H S S U L U H R I B N N G K I N G

H I B A H

B U T A

Jawaban Sudoku:

6 9 7 4 1 8 5 3 2

1 2 3 5 9 6 4 7 8

4 5 8 3 7 2 6 9 1

7 4 2 8 3 5 9 1 6

5 3 9 7 6 1 8 2 4

8 6 1 9 2 4 7 5 3

3 8 6 2 5 7 1 4 9

2 7 4 1 8 9 3 6 5

9 1 5 6 4 3 2 8 7

Rp 22.500 per hari ini, akan dikirim ke Lombok besok, Senin 6 September 2010 pukul 12.40 menggunakan pesawat Lion Air. “Berdasarkan keterangan teman-temannya di penjara, dokumen paspor dan visa Samsini ditahan oleh majikannya. Selama dipenjara ia tidak mendapat perhatian dari petugas penjara. Jangankan diberi obat, makan saja hanya satu kali dalam sehari,” jelas Lily. Biaya perawatan di rumah sakit, kata Lily, ditanggung oleh Departemen Kesehatan, sedangkan pemulangan jenazah ditanggung oleh Direktorat Bantuan Sosial Korban Tindak Kekerasan Pekerja Migran, Kementerian Sosial. Sebelumnya nasib serupa juga dialami Slamet, 48, warga Desa Klanting Kecamatan Sukodono Lumajang Jawa Timur. Slamet dideportasi bersama 311 TKI lainnya. Ia tiba di Pelabuhan Tanjung Priok dengan kapal KM Ciremai dalam kondisi kritis, 2 September lalu. Ia meninggal setelah mendapat perawatan selama 1 jam di RSUD Koja Jakarta Utara, karena mengidap penyakit dalam. Bapak 2 anak ini, ditangkap karena tidak memiliki dokumen. Jenazahnya telah dikirim ke kampung halamannya Sabtu 4 September 2010. (Vivanews)

Tiga Wanita ... warga Jalan Dorowati Lorong Gereja Kampung Durian, Medan serta DA, 33, warga Jalan Cemara Gang Pinus I Medan, diduga melakukan aksinya dengan menyilet tas sandang korbannya. Informasi di Polsekta Medan Kota menyatakan peristiwa itu terjadi, Sabtu malam sekira pukul 23:00, korban Dania, 15, bersama temannya Aisyah, 18, keduanya WN Yaman, berkunjung ke arena Ramadhan Fair. Di tengah ramainya pengunjung yang memadati Ramadhan Fair itu, korban didesak ketiga wanita tersebut dan salah seorangnya menyilet tas korban sehingga robek. Dari dalam tas itu tersangka mengambil HP dan uang Rp40 ribu. Korban Dania menyadari tas nya telah robek memeriksa isinya ternyata HP dan uangnya telah raib. Selanjutnya korban bersama temannya mengadu ke posko Ramadhan Fair atas peristiwa yang dialaminya. Petugas yang menerima pengaduan korban berikut ciriciri ketiga wanita yang dicurigai mencopet korban melakukan pencarian di sekitar lokasi kejadian. Akhirnya, ketiga tersangka wanita itu ditemui di Jl Sinabung dan petu-

Presiden: Ekses ...

Waspada/Surya Efendi

BUKA BERSAMA WARTAWAN: Gubsu H Syamsul Arifin, SE menyampaikan sambutan dihadapan Ketua PWI Sumut, para pemimpin redaksi dan wartawan dalam buka puasa bersama yang digelar Dinas Komunikasi dan Informasi Provsu di gedung Uniland Plaza Medan, Minggu (5/9). Hadir pada acara tersebut Kadis Kominfo Sumut Drs H Eddy Syofian yang juga Pj Walikota Tebingtinggi, Kapendam I/BB Al Ustadz Letkol CAJ DR H Asren Nasution, MA yang tampil menyampaikan tausyiah, Wakil PU/Wapemred Hr Waspada, H Teruna Jasa Said, Ketua PWI Sumut Drs M Sjahrir, Ketua Serikat Penerbit Suratkabar (SPS) Sumut H M Zaki Abdullah, Ketua Dewan Kehormatan Daerah (DKD) PWI Sumut H A Muchyan AA, Ketua Ikatan Jurnalis Televisi Indonesia (IJTI) Sumut, Edi Irawan.

20 Juta Orang ... Juga untuk tujuan Riau, Palembang, Jambi dan lainnya. Sedangkan, armada angkutan umum kendaraan bermotor tidak ada masalah dalam mengangkut para penumpang yang akan mudik. Demikian pula di Bandara Polonia, ribuan penumpang berjejal di ruang tunggu domestic.Mereka berangkat tujuan Jakarta dan kota –kota lainnya di Pulau Jawa. Sedangkan situasi keamanan terlihat kondusif. Aparat keamanan dari kepolisian berjaga-jaga di setiap persimpangan jalan untuk mengatur arus lalu lintas. Sumber di Dinas Perhubungan Kota Medan yang ditemui mengatakan, arus mudik ke luar kota belum sepenuhnya karena pada H-5 menjelang Lebaran ini belum libur dan beberapa hari ke depan masih merupakan hari kerja hingga Kamis (9/9). Tetapi, arus mudik pada H5 ini berjalan secara berangsur, dan puncaknya diperkirakan terjadi pada Rabu (8/9) atau kamis (9/9). Bahkan, untuk tujuan kota-kota di kawasan Sumatera Utara kemungkinan tidak terlalu padat karena banyak pemudik menggunakan sepedamotor. Partisipasi Sedangkan, acara yang digelar PMI di Silang Monas merupakan partisipasi terhadap warga masyarakat khususnya kaum muslim agar mereka dapat berlebaran dengan nyaman. Ambulans ini, menurut Kal-

Hari Ini Presiden ... Kodam I Bukit Barisan untuk mengamankan kedatangan Presiden Yudhoyono dan rombongan tersebut. “Jadi secara umum, pengamanan di daerah sudah siap. Langsung dipantau Pangdam I Bukit Barisan Mayjen TNI Leo Siegers,” katanya. Asren menjelaskan, Presiden Yudhoyono dan rombongan akan tiba di Lanud Medan

Lima Tahun ... Peristiwa kelabu yang merenggut tiga putra terbaik Sumut bersama seratusan penumpang lainnya itu setiap tahun diperingati oleh keluarga korban dan kerabat dekat dengan cara ziarah dan sedekah kepada anak yatim. Sama seperti hari Minggu itu, Gubernur Sumut H Syamsul Arifin didampingi Pj Walikota Tebing Tinggi yang juga Kepala Dinas Kominfo Sumut, Eddy Syofian, Kepala Penerangan Daerah Militer Kodam I Bukit Barisan Letkol CAJ Asren Nasution dan lainnya melakukan ziarah ke pusara almarhum Gubsu HT Rizal Nurdin, di Kompleks Makam Kesultanan Deli di Masjid Raya Al Mashun Medan. HT Rizal Nurdin adalah salah seorang dari seratusan korban pesawat Mandala. Di dalam pesawat yang naas lima tahun lalu itu, juga terdapat almarhum mantan Gubsu Raja Inal Siregar dan Ketua Pengurus Wilayah Al gas melakukan penggeledahan tas mereka. Ternyata tidak ditemukan barang bukti milik korban, sebab ketiga tersangka diduga terlebih dahulu membuangnya ke bawah mobil yang sedang parkir dekat mereka berdiri. Saat petugas memeriksa kolong mobil tersebut ditemukan dua unit HP dan tissue berisi silet. Selanjutnya ketiga tersangka dipertemukan dengan korban dan diperlihatkan HP yang ditemukan. Ternyata salah satu HP tersebut milik korban sedangkan satu HP lagi milik Selamat Harahap, 43, pegawai BUMN warga Jl. Teratai Medan, yang juga sebelumnya telah melaporkan kecopetan sehingga kehilangan hand phonenya di Ramadhan Fair. Dalam pemeriksaan ketiga tersangka membantah tuduhan telah melakukan copet terhadap korban. Menurut tersangka barang bukti itu tidak ditemukan di tangan mereka. Kapolsekta Medan Kota AKP Amri Z SH saat dikonfirmasi mengatakan, ketiga wanita itu yang diduga sebagai tersangka copet masih dalam pemeriksaan. “Kalau ketiganya tidak mengaku itu hak mereka. Kita punya saksi korban dan saksi lainnya bahkan barang bukti,” tutur Amri. (m31/m39)

la, semuanya dioperasikan dengan standar yang sangat baik. PMI diturunkan ke jalan, karena pada arus mudik lebaran setidaknya ada 20 juta orang yang berlalu-lalang di jalanan untuk mudik ke kampung atau desa. “Dengan 20 juta orang ini, bukan tidak mungkin ada kecelakaan meski kita tidak inginkan,” kata Kalla saat pelepasan di Monas tersebut. Untuk itu Kalla mengucapkan terimakasih dan menanamkan rasa kebanggaan bagi petugas yang ada di lapangan. Karena di tengah masyarakat lain sedang berbahagia, petugas PMI harus ada di lapangan untuk melakukan misi-misi kemanusiaan. “Ini adalah tugas mulia dan penting, juga pengabdian yang penting. Jadi saya sampaikan terima kasih dan selamat bertugas,” kata Kalla. Dalam pelepasan tim siaga lebaran 2010 ini, menurut Ketua Bidang Kesehatan PMI Farid Husein, PMI menyediakan pertolongan pertama dengan jumlah armada yang disiapkan mencapai 263 mobil ambulans, 273 pos pertolongan pertama, 4 ambulans helikopter, 4461 relawan, 154 dokter dan 256 perawat. “Ini kami lepas secara nasional,” ujar Farid. Pada acara simbolik di Monas itu terlihat ada 4 ambulans, 42 ambulans darat, dan ada 80 relawan dari DKI Jakarta. Selain melepas melalui upacara, Kalla juga melihat simulasi pertolongan pertama dan melakukan penempelan stiker tanda tim

siaga lebaran disiapkan. Garuda Kerahkan Dua “Sapu Jagat” Sementara itu, maskapai penerbangan mulai melakukan peningkatan kapasitas. Seperti Garuda Indonesia. Maskapai itu memaksimalkan kapasitasnya dengan menambah frekuensi dan pengalihan operasi pesawat. Juru bicara Garuda Pujobroto mengatakan, pihaknya akan mendatangkan dua unit pesawat jumbo, Boeing 747-400 untuk mengangkut para penumpang. Pesawat ini fungsinya menjadi pesawat sapu jagat yang akan menyapu setiap penumpang mulai awal pekan ini. “Karena besarnya pesawat, hanya bisa mengangkut pemudik di bandara tertentu saja yaitu Polonia (Medan) dan Juanda (Surabaya),” kata Pujobroto di Jakarta Minggu (5/9). Sebelumnya, Direktur Pengembangan dan Teknologi Informasi Garuda, Elisa Lumbantoruan mengatakan, dalam operasi Lebaran 2010 maskapai BUMNtersebut akan diperkuat dengan dua pesawat besar yaitu Boeing 747-400. Pesawat yang biasanya dioperasikan pada rute Jakarta-Jeddah, akan dioperasikan untuk rute Jakarta-Medan dan Jakarta-Surabaya. “Menjelang IdulFitri, penerbangan ke Jeddah biasanya berkurang, karenanya penerbangan ke Jeddah dikurangi,” kata Elisa. Pesawat Boeing 747-400 memiliki kapasitas cukup besar, bila dimaksimalkan bisa mengangkut 428 penumpang. (m32/m06/kps/Vivanews)

Senin (6/9) pagi dan akan mendapatkan pemaparan dari Pangdam I Bukit Barisan Mayjen TNI Leo Siegers tentang langkahlangkah yang telah dilakukan untuk membantu Pemprov Sumut dalam menangani pengungsi di Tanah Karo. Setelah itu, pemaparan akan dilanjutkan oleh Gubernur Sumut, Syamsul Arifin mengenai kebijakan dan penanganan yang dilakukan di Tanah Karo. “Setelah pemaparan itu, Pre-

siden Yudhoyono dan rombongan langsung menuju Tanah Karo,” kataya. Dalam kunjungan tersebut, Presiden Yudhoyono dan Ibu AniYudhoyono akan didampingi sejumlah menteri dalam kabinet Indonesia Bersatu (KIB) II. Namun Kapendam I Bukit Barisan Letkol CAJ Asren Nasution belum mengetahui menterimenteri yang akan mendampingi Presiden Yudhoyono tersebut. (m19)

Washliyah Sumut yang juga anggota DPD-RI asal Sumut, H Abdul Halim Harahap. “Hari ini, lima tahun lalu, masyarakat Sumut berduka karena kehilangan tiga putra terbaiknya dalam kecelakaan pesawat Mandala Airlines di ujung landasan pacu Polonia Medan. Makanya, di hari bersejarah ini berziarah ke makam mantan pemimpin saya, sekaligus ke makam Sultan Deli,” ujar Syamsul. Menurut mantan Bupati Langkat dua periode itu, dirinya dan seluruh masyarakat Sumut yang hidup saat ini, tak boleh melupakan jasa ketiga pemimpin ini dalam memajukan dan mensejahterakan perekonomian di daerahnya. “Dua di antara mereka adalah pemimpin di bidang pemerintahan dan seorang lagi pemimpin spritual. Jadi, di hari baik di bulan Ramadhan ini saya sebagai seorang pemimpin di masa kini berdoa kepada Allah untuk meminta pengampunan atas kesalahan dan kealpaan ketiga pemimpin masa sebelumnya semasa hidupnya,” jelas Syamsul. Terkait dengan percepatan Bandara Kualanamu, Syamsul berharap komitmen yang diberikan pemerintah terakhir kalinya agar tidak molor lagi. “Sudah ditegaskan pemerintah bahwa

Bandara Kualanamu akan operasional 2012. Kita harapkan segera terwujud dan pembangunannya tak molor lagi,” ungkap Syamsul. Di kesempatan itu, Eddy Syofian menambahkan, selain berziarah, sore harinya Gubsu bersama keluarga alarhum HT Rizal Nurdin melakukan zikir dan wirid yasin bersama anak yatim di Gubernuran Medan yang diteruskan dengan berbuka puasa bersama. Dijelaskan Eddy, acara seperti hari ini setiap tahun terus digelar Gubsu dan keluarga al-marhum HT Rizal Nurdin. Setidaknya gugurnyatigaputraterbaikSumut itu, akan dijadikan momentum untuk percepatan pembangunan Bandara Kualanamu. “Peristiwa kelabu lima tahun itu kini sudah jadi momentum percepatan Bandara Kualanamu. Sebab, saat almarhum HT Rizal Nurdin dikebumikan, Presiden Susilo Bambang Yudhoyono bersama Menteri Perhubungan kala itu Hatta Rajasa sudah memberikan janji untuk mewujudkan pembangunan Bandara Kualanamu. Kini telah lima tahun berlalu dan esok (hari ini) Presiden datang ke Sumut. Kita harapkan, momentum ini bisa kembali mempercepat pembangungan pada 2012,” beber Eddy. (m19)

Kepala Negara menjelaskan reformasi gelombang pertama yang bergulir sejak 1998 telah sama-sama dilalui. Sistem demokrasi telah terbentuk namun bukan berarti tidak ada kekurangan. “Desentralisasi dalam praktiknya ada penyimpangan . Mari kita perbaiki. Jangan dibaca dengan pengembalian sistem otoritarian, karena demokrasi, ham dan desentralisasi adalah agenda reformasi kita, tapi bila ada masalah jangan kita diamkan,” tegasnya. Menurut Presiden, upayaupaya untuk menyusun sistem nasional dan konsensus bagi masa depan Indonesia bukanlah monopoli elit politik semata namun juga ruang diskusi dan wacana dari publik diakomodasi

Malaysia Harapkan ... sehingga tidak ada pihak luar dengan agenda tersembunyi yang akan memanfaatkan situasi,” tambahnya lagi. Anifah yang selama ini berhubungan terus dengan Menlu Indonesia Marty Nalategawa terkait isu yang berkembang, mengatakan bahwa dia percaya demonstrasi yang terjadi tidaklah mewakili semua rakyat Indonesia. Hasil pertemuan nanti menurutnya akan menjadi suatu hal yang ditunggu-tunggu ma-

Canda Pengungsi ... bertanya-tanya, bantuan apa gerangan yang bakal diberikan kepada mereka lagi. Secara perlahan, DR. Budi Anna Keliat, S.Kp, M.App, Sc mulai menjadi pusat perhatian para pengungsi. Kemudian, dia memimbing para pengungsi agar selalu mengingat-ingat kejadian indah yang pernah dialami para pengungsi selama hidupnya. “Coba pejamkan mata. Bayangkan gunung Sinabung itu adalah gunung yang indah dan terhampar sawah yang subur tempat kita bercocok tanam. Lupakan semua kejadian-kejadian yang membuat kita sedih,” ucap Anna di hadapan ratusan pengungsi. Pada sesi berikutnya, Anna meminta lima pasangan pengungsi untuk berdiri di depan. Setelah itu, Anna meminta masingmasing pasangan pengungsi tersebut memuji pasangannya. Spontan susana yang semula kaku, berganti dengan penuh

WASPADA Senin 6 September, 2010 sehingga semua pihak ikut serta mewujudkan sistem nasional bagi Indonesia di masa yang akan datang. “Kita punya tanggung jawab. Saya senang bila parpol pikirkan itu semua. Kita semua sebagai pelaku, stake holder. Pemerintah, DPR, DPD tidak boleh monopoli apa pun . Mari kita buka ruang publik yang semakin luas,” paparnya. Dalam bagian lain, Presiden menilai perlunya Indonesia memiliki konsensus sebagai dasar kemajuan Indonesia seperti konsensus yang dimiliki oleh Amerika Serikat dan China. Membandingkan dengan konsensus Washington dan konsensus Beijing, Presiden mengatakan bisa jadi konsensus Jakarta bila bisa diwujudkan akan memiliki enam pilar. Pilar pertama adalah mensyarakat kedua negara. “Saya kira ini adalah pertemuan yang penting, terutama setelah di Indonesia terdapat demonstrasi selama beberapa hari di depan kedutaan besar kami. Jadi, hasil pertemuan ini akan sangat ditunggu oleh masyarakat Malaysia dan Indonesia,” ujarnya. Anifah mengatakan, pertemuan itu akan mendiskusikan kerjasama penggunaan teknologi modern dan perlunya kantor pusat memiliki alat yang dapat melacak kapal yang kedapatan melintasi perbatasan maritim. (Vivanews)

jalankan demokrasi bersama penegakan hukum sekaligus menjaga stabilitas. Pilar kedua adalah peranan pemerintah dalam ekonomi dijalankan tapi nilai konstruktif dalam kaidah pasar agar kompetitif tidak boleh diabaikan. Pilar ketiga, menurut Presiden adalah meskipun ekonomi nasional sudah terintegrasi dengan ekonomi internasional namun bukan berarti multinasional corporation yang diutamakan namun juga memperhatikan usaha kecil dan menengah. “Elemen yang keempat, pertumbuhan penting namun harus diikuti pemerataan dan keadilan sosial sekaligus pemeliharan lingkungan yang baik,” katanya. Pilar kelima, yang penting juga diperhatikan menurut Presiden, mendorong pasar domestik. “Bila masyarakat kita semakin besar daya beli, maka pasar dalam negeri akan semakin kuat dan hidup,” katanya. Dan pilar yang keenam adalah pemerintahan presidential dengan sistem multi partai. “Bangsa ini bangsa kita sendiri, kita sah dan dibenarkan untuk memikirkan sistem nasional yang cocok untuk bangsa kita. Kita tidak harus ikut-ikutan ambil model negara mana pun yang belum tentu bila diterapkan di Indonesia membawa keberhasilan,” kata Presiden.

kekeluargaan. Untuk sementara, tidak terlihat lagi ketegangan diraut wajah para pengungsi. Doswadi, 76, salah seorang pengungsi yang mengikuti simulasi tersebut tidak bisa menahan gelak tawanya. Pria yang sudah lanjut usia itu diminta untuk membisikkan sesuatu bernada pujian ke telinga istrinya yang berusia 74 tahun. “Apakah selama ini bapak pernah memuji istri?” tanya Anna. “Saya sering memuji dia, tapi dia jadi marah. Baru kali ini dia tertawa,” ujar Doswadi yang disambut gelak tawa ratusan pengungsi, petugas keamanan dan relawan lainnya. Usai melaksanakan simulasi tersebut, Anna mengatakan, kegiatan itu merupakan bagian dari rehabilitasi mental yang telah disusun dalam program Penataan Keluarga Harmonis untuk para pengungsi gunung Sinabung. Dari beberapa kali simulasi, terungkap adanya hubungan keluarga yang kurang harmonis

di antara pengungsi sehingga dapat memicu terjadinya depresi lebih berat ketika terjadi bencana. “Bayangkan saja, ada di antara para pengungsi yang telah berkeluarga tersebut mengaku hanya berbicara selama 5 menit dalam satu hari dengan pasangannya. Setelah itu, mereka lebih banyak bertengkar,” ujar Anna. Saat situasi seperti ini, tentunya menjalin komunikasi yang baik dalam suatu keluarga harmonis dapat membantu mengurangi risiko depresi yang dialami para pengungsi. “Jika depresi itu berlarut-larut, tidak tertutup kemungkinan akan menjadi gangguan jiwa berat,” tambahnya. Sementara itu, Jimi, 40, pengungsi lain yang mengikuti simulasi tersebut juga mengutarakan kegembiraannya. “Sudah lama saya tidak memuji istri. Tapi, ketika saya diminta memuji istri dan istri memuji saya, ada kegembiraan yang saya rasakan,” ujarnya. (m26)

Keajaiban al-Qur’an ... Jika al-Qur’an adalah kitab yang biasa-biasa saja maka sudah pasti terdapat sebagian dari pesan-pesannya yang kadaluarsa. Ajaibnya, setiap kali ayat-ayat al-Qur’an dibaca maka setiap itu pula muncul inspirasi baru. Inspirasi ini dapat memotivasi manusia untuk menguak misteri alam yang selama ini tak terpikirkan oleh manusia. Sebagai contoh, al-Qur’an selalu menghubungkan hujan dengan kesuburan tanamtanaman. Ketika dilakukan penelitian, ternyata hujan mengandung pupuk sehingga hasil tanaman yang disiraminya lebih baik dari yang disirami manusia. Pada saat manusia menduga bahwa bumi adalah datar akan tetapi al-Qur’an menyatakan sebaliknya bahwa bumi adalah bulat. Setelah dilakukan penelitian modern ternyata bumi memang bulat sesuai dengan pernyataan alQur’an. Masih banyak lagi contoh-contoh lain yang dikemukakan oleh al-Qur’an yang terbukti kebenarannya oleh penelitian modern. Contohcontoh dimaksud seperti hukum, sosial, ibadah, bisnis dan sebagainya. Adapun dari segi hukum, sosial, ibadah dan bisnis dapat dikatakan bahwa keajaiban al-Qur’an kurang bergaung. Hal ini bukan karena tidak ada keajaiban pada bidang-bidang ini tetapi terlalu banyak campur tangan manusia di dalamnya. Keajaiban dalam bidang hukum dapat ditandai adanya jaminan kelanggengan hidup dan sifat hukumnya yang elastis. Akan tetapi ketika hukum al-Qur’an ini sampai ke tangan manusia maka kesan yang muncul adalah statis dan

kekerasan. Demikin juga dalam hubungan sosial dimana al-Qur’an menyatakan bahwa perbedaan ras adalah media untuk saling mengenal. Ketika hal ini ditangani oleh manusia maka perbedaan ras selalu dijadikan alasan untuk saling membantai. Dalam bidang ibadah terasa sekali keajaiban al-Qur’an yang menerapkan rukun dan syarat yang sederhana. Akan tetapi, ketika persoalan ini ditangani oleh manusia maka yang muncul adalah rukun dan syarat yang ‘menjelimet’. Sebagai contoh, perintah tayammum dalam al-Qur’an hanya menyapu muka dan kedua tangan dan tidak menyebutkan sampai siku. Akan tetapi ketika sampai ke tangan manusia maka batas sapuan pada tangan disebutkan sampai siku. Adapun dalam bidang bisnis, al-Qur’an hanya mensyaratkan saling ridha (‘an taradhin). Ketika sampai ke tangan manusia maka muncul syarat lain yaitu adanya ijab kabul antara penjual dan pembeli dalam satu majlis. Keajaiban al-Qur’an dalam beberapa bidang di atas adalah prinsip dasar yang dibangun oleh al-Qur’an yaitu untuk memudahkan manusia. Kemudahan ini tidak lain agar manusia dapat melakukan aktifitas secara bebas. Realitasnya, syarat yang dikemukakan oleh al-Qur’an sangat sesuai dengan kehidupan dunia modern. Hal ini menjadi bukti bahwa al-Qur’an adalah kitab suci ajaib yang kebenarannya dapat dirasakan oleh setiap generasi. Meskipun perbuatan manusia dapat menutup keajaiban al-Qur’an namun lambat laun keajaiban tersebut akan kembali bergaung. Karena, keputusan yang dibuat oleh manusia tidak mampu beradaptasi dengan perkembangan zaman.


Medan Metropolitan

WASPADA Senin 6 September 2010

A3

Pemko Segera Bersihkan Kolong Fly Over MEDAN (Waspada): Seusai Lebaran Idul Fitri, Walikota Medan Rahudman Harahap akan membongkar Pedagang Kaki Lima (PKL) yang berada di kolong Fly Over Pulo Brayan. Pihaknya kini tinggal menunggu surat dari Menteri Pekerjaan Umum (PU) yang memerintahkan dirinya melarang masyarakat berjualan di bawah jembatan layang tersebut. “Orang ribut soal pedagang di bawah Fly Over. Habis lebaran kita akan bongkar semua pedagang yang berjualan di bawah Fly Over setelah surat dari Menteri PU turun mengatakan dilarang berjualan di bawah Fly Over, karena kalau terbakar akan merusak jalan itu,” kata Rahudman kepada wartawan di Rumah Dinas Walikota Medan, Minggu (5/9). Menurut Rahudman, dalam

surat Menteri PU yang akan turun nantinya berisikanWalikota Medan harus menertibkan pedagang yang berada di bawah jalur Fly Over. “Kalau sudah turun surat itu, berarti sudah jelas aturannya tidak boleh berjualan di bawah Fly Over. Jadi, tidak ada alasan bagi siapa pun untuk bertahan berjualan di tempat tersebut,” katanya. Begitu pun, katanya, Pemko akan mencari solusi bagaimana

Siswa SMATinggalkan Rumah MEDAN (Waspada) : Syaiful Bachri, pelajar kelas III SMA Tiga Binanga Tanah Karo, sudah hampir dua minggu meninggalkan rumah dan tidak diketahui keberadaannya. Tentu saja hal ini menyebabkan orang tuanya panik dan berharap agar Syaiful (foto) segera kembali ke kampung halamannya di Desa Simolak, Kec. Tiga Binanga. “Pihak keluarga berharap bagi siapa saja yang melihat anak remaja ini agar menyarankannya pulang, karena orang tuanya sangat kuatir akan keberadaan Syaiful,” tutur Abdurrahman Perangin-angin, mewakili pihak keluarga, yang datang ke redaksi Waspada, Jumat (3/9). Menurutnya, Syaiful adalah siswa yang pemberani dan salah seorang pemain sepak bola di sekolahnya. Kepergiannya sungguh membuat orang tuanya bingung, sehingga sangat berharap kepada siapa saja yang melihatnya untuk menyampaikan keberadaannya. “Kami berharap siapa saja yang melihat Sayaiful supaya memberitahukan kepada kami ke Jalan Ibrahim Umar No 34 Medan, telepon 061-4569138. Bagi yang bisa membantu akan kami berikan hadiah sepantasnya,” kata Abdurrahman sembari menyebutkan orang tua Syaiful bernamaYoung Ahmad dan Norma di Desa Simolak, Tanah Karo. (m36)

PSMTI Bagi Sembako Kepada 200 KK Duafa MEDAN (Waspada): Dalam rangka membantu kaum duafa menjelang lebaran, Paguyuban Sosial Marga Tionghoa Indonesia (PSMTI) Kecamatan Medan Petisah, membagikan paket bahan pokok kepada 200 KK warga Kelurahan Sei Putih Timur II, Sabtu (4/9). Hadir dalam kegiatan sosial tersebut anggota DPRD Medan Hasyim SE, Ketua PSMTI Medan Petisah Amir Sujono, Bendahara Lie Lie, Sekretaris A Liong, Penasehat Halim Tjandra serta para pengurus dan donatur. Pembagian bahan pokok kepada 200 KK warga Sei Putih Timur II dan sekitarnya berlangsung di Jalan Sewindu pukul 16.00 hingga selesai. Sebagian besar warga yang menerima santunan merupakan kaum duafa, janda dan lainnya yang berhak menerima bantuan. Sebagian besar penerima mengatakan bersyukur diadakannya sumbangan tersebut karena kondisi ekonomi saat ini sangat sulit setelah berusaha mencukupi kebutuhan pendidikan. Menurut Amir Sujono, kegiatan amal tersebut merupakan tahun kedua yang dilakukan PSMTI Kecamatan Medan Petisah, untuk membantu masyarakat sekitar menghadapi lebaran dengan peningkatan sekitar 50 kk dibanding tahun lalu yang hanya 150 orang penerima. Peningkatan tersebut merupakan kebijakan para pengurus PSMTI Medan Petisah, setelah melihat kondisi ekonomi masyarakat saat ini sangat sulit dibanding tahun lalu. Sementara itu para donatur juga banyak yang mendukung peningkatan kegiatan sosial tersebut. (m40)

Pascasarjana UMA Santuni 50 Anak Yatim MEDAN (Waspada): Keluarga Besar Pascasarjana Universitas Medan Area (KB - PPs UMA) melaksanakan kegiatan berbuka puasa bersama sekaligus sekaligus memberikan santunan kepada 50 anak yatim dari kawasan Padang Bulan Medan, di kampus UMA, Jalan Sei Serayu Medan, Selasa (31/8). Acara buka puasa bersama tersebut menghadirkan Ustaz H Muhammad Nuh dan turut dihadiri Koordinator Kopertis Wilayah I Sumut - NAD, Prof. Zainuddin, Direktur PPs UMA, Drs. Heri Kusmanto, MA, para wakil direktur, ketua Prodi, para dosen dan mahasiswa MAP UMA di antaranya Doni M Dahlan, M Nedy Afriadi dan Sarjuli serta pegawai di lingkungan PPs UMA. Ustaz Muhammad Nuh dalam tausiahnya mengajak umat Islam untuk selalu bermunazat kepada Allah SWT pada 10 hari terakhir di bulan puasa Ramadan. “Mari kita bermunazat dan berdoa pada 10 hari - hari terakhir Ramadan ini untuk diri sendiri, keluarga dan masyarakat,” ucapnya. Dalam syariat puasa, kata M Nuh, umat Islam diajarkan untuk hidup teratur karena puasa merupakan proses melatih diri sendiri untuk selalu mentaati aturan yang diperintah Allah SWT. Sebab itu perintah puasa ditujukan hanya kepada orang-orang beriman. Bahkan puasa sudah ada sejak umat-umat terdahulu namun puasa dalam ajaran agama Islam merupakan penyempurna puasa dari umat-umat terdahulu. Direktur PPs UMA, Drs. Heri Kusmanto didampingi Wakil Direktur I dan II, Ir Erwin Pane dan Drs Usman Tarigan, MS menyatakan, buka puasa bersama sekaligus penyantunan anak yatim yang dilakukan Keluarga Besar PPs UMA merupakan wujud silaturahim dalam membangun ukhuwah Islamiah. “Kegiatan buka puasa bersama dan santunan yang kami lakukan sudah menjadi agenda rutin setiap tahun. Bahkan untuk pemberian santunan tidak hanya saat bulan puasa Ramadan tapi juga pada bulan lainnya,” ujar Heri Kusmanto seraya menyampaikan UMA juga telah melakukan kepedulian terhadap para pengungsi akibat meletusnya Gunung Sinabung di Tanah Karo. (m41)

Waspada/Ist

SERAHKAN: Koordinator Kopertis Wilayah I Sumut - NAD, Prof. Zainuddin didampingi Direktur PPs UMA, Drs. Heri Kusmanto, MA menyerahkan santunan secara simbolis kepada sejumlah anak yatim pada kegiatan buka puasa bersama, di PPs UMA Jalan Sei Serayu Medan, Selasa (31/8).

supaya pedagang di sana masih bisa mencari nafkah dengan baik dan Fly Over tidak terganggu. “Kita akan cari solusinya bagi pedagang agar tetap bisa berjualan tanpa menggangu ketertiban. Jadi, harus ada solusi, dan bukan membabi buta. Tapi yang pasti jangan sampai pedagang melanggar peraturan yang telah ditetapkan pemerintah,” ucapnya. Menurut Rahudman, Fly Over di Kota Medan bukan

menjadi tempat berjualan, melainkan dijadikan sebagai taman kota agar kelihatan indah. “Kolong Fly Over itu harus ditata untuk dijadikan sebagai taman, dan bukan sebagai lokasi berjualan,” paparnya. Di tempat yang sama, Rahudman juga mengatakan, selain fokus untuk menertibkan PKL di bawah Fly Over, pihaknya juga akan menepati janjinya dengan membuka sejumlah Puskesmas selama 24 jam. “Ha-

bis Lebaran ini kita akan launching sejumlah Puskesmas di pusat kota untuk buka selama 24 jam. Mereka akan melayani masyarakat Medan untuk mendapatkan perobatan,” tukasnya. Sebelumnya, pada waktu Rahudman menjadi Penjabat Walikota Medan juga telah berjanji akan menertibkan PKL yang berada di bawah Fly Over. Namun, sampai saat ini belum berjalandenganalasanbelumada penampungan mereka. (h10)

Indikasi Uang Palsu Tak Ditemukan BI Apresiasi Prestasi Unit Syariah Bank Sumut MEDAN (Waspada): Pemimpin Bank Indonesia(BI) Medan DR Gatot Sugiono S memberikan apresiasi tinggi dan sangat menghargai prestasi kinerja Bank Sumut khususnya unit usaha syariah. “Kami (pihak BI – red) menilai kinerja unit syariah Bank Sumut bagus. Direksi kami lihat cukup komit dan berupaya optimal mengelolanya sehingga wajar kinerjanya baik. Kami sangat menghargai prestasi ini,” ujarnya kepada wartawan usai berbuka puasa bersama Badan Musyawarah Perbankan Daerah (BMPD) Sumut, Jumat (3/9). Pada acara berbuka puasa bersama di Lantai 9 Gedung Pusat PT Bank Sumut di Jalan Imam Bonjol Medan, dihadiri para pimpinan bank di Sumut termasuk Direktur Utama (Dirut) Bank Sumut, H Gus Irawan Pasaribu, Direktur Umum, H M Yahya serta Direktur Pemasaran dan Syariah PT Bank Sumut H Zeinilhar, diisi dengan shalat Maghrib, shalat Isya, shalat Tarawih dan shalat Witir berjamaah. Sedangkan tausyiah oleh Al Ustadz Latief Khan. Gatot mengemukakan, usaha syariah merupakan salah satu opsi dalam bisnis perbankan, apalagi di Indonesia yang penduduknya mayoritas umat Islam. “Dengan perkembangan sistem perbankan syariah ini sangat bagus untuk mendukung pertumbuhan ekonomi nasional, apalagi sistem syariah

ini sangat fair dibanding sistem suku bunga. Sebab dalam sistem syariah kalau ada untung akan ada sharing bagi bank, namun kalau enggak ya tidak,” ujarnya. Karena itu, lanjutnya, pola syariah perlu terus disosialisasikan. “Bank Sumut unit syariah saya harap terus meningkatkan pelayanan dan lakukan terus komunikasi produktif kepada masyarakat,” ujarnya seraya optimis perkembangan unit syariah Bank Sumut akan terus maju sebagaimana kemajuan kinerja Bank Sumut secara umum. “Selanjutnya pihak-pihak yang berkepentingan seperti Masyarakat Ekonomi Syariah, alim ulama, Majelis Ulama Indonesia (MUI) perlu terus melakukan sosialisasi demi kemajuan usaha syariah di Indonesia khususnya di Sumut,” tuturnya. Dikemukakan, BI sebagai bank sentral terus mengupayakan pengembangan ekonomi syariah melalui pendidikan, penyuluhan dan strategi pembinaan untuk unit-unit yang sudah menggunakan pola syariah seperti BMT yang merupakan bagian penting agar sistem syariah semakin memasyarakat. Pada kesempatan ini, Gatot juga menjelaskan beberapa komitmen aktual pihak BI di Sumut antara lain melakukan koordinasi dan konsolidasi dengan berbagai pihak kompeten dalam upaya peningkatan sis-

tem keamanan perbankan termasuk upaya pendeteksian peredaran uang palsu. Khusus tentang uang palsu, Gatot menegaskan sejauh ini tidak ada indikasi ditemukannya di Sumut. Dirut Bank Sumut H Gus Irawan Pasaribu juga menyampaikan terima kasih atas komitmen pihak BI yang sangat membantu bagi berkembangnya sistem syariah. “Secara nasional share sistem syariah pada perbankan sekitar 3% sementara di Bank Sumut sudah di atas 5%. Hal ini tak lepas dari bantuan BI,” ujarnya seraya mengemukakan pihaknya komit untuk terus meningkatkan kinerja dan prestasi unit syariah Bank Sumut. Sementara itu pada acara berbuka puasa bersama ini Gus Irawan menyampaikan terima kasih atas dipercayakannya Bank Sumut selaku tuan rumah. Dia berharap acara yang bertema “Ramadhan Bulan Penuh Berkah Tingkatkan Amal Ibadah dan Ukhuwah” ini dapat lebih meningkatkan kerjasama antar perbankan dalam aktivitas sehari-hari. Gatot Sugiono yang juga Ketua BMPD Sumut ini juga menjelaskan berbagai aktivitas sosial dan kemasyarakatan telah dilakukan oleh organisasi BMPD Sumut antara lain juga telah menyalurkan bantuan bagi korban musibah Gunung Sinabung di Kabupaten Karo.(m19)

Charity for Sinabung Sukses Galang Dana MEDAN (Waspada): Dalam rangka membantu korban Gunung Sinabung, Yayasan Gedung Wanita Karo menggelar event ‘Charity for Sinabung’ dengan tema ‘Malam Seni Peduli Gunung Sinabung’ di Gelanggang Mahasiswa Universitas Sumatera Utara, Sabtu (4/9). Acara ini turut menampilkan berbagai kesenian tradisional, tarian-tarian, serta berbagi alat musik tradisional daerah tanah Karo, seperti Keteng-keteng, Indung Gendang, Mangkok, Serunai serta Gong yang disuguhkan Sanggar Seni Sirulo asuhan Juara Ginting dan Sanggar Elsada. Dikawal para tokoh-tokoh seni daerah tersebut, Yayasan GWK pun mengundang simpati publik melalui pagelaran seni tersebut. Perwakilan GWK, Rimienda Ginting mengaku,

puas dapat memberikan sumbangsih bagi para saudaranya di Tanah Karo. “Kami yakin pada tujuan utama kegiatan ini, menggalang dana bantuan bagi saudara kita yang dirundung musibah pasca meletusnya deleng (gunungred) Sinabung,” jelas Rimienda. Selain itu, acara ini juga menghadirkan artis top Tanah Karo, seperti Asmahera beru Sinulingga, penyanyi legendaris Tanah Karo, Bahagia Surbakti, Anta Prima Ginting, Luther Tarigan dan Bungaria beru Sembiring. Tidak ketinggalan aksi dari Melita beru Sembiring dan Mery beru Tarigan diiringi aransemen musik kenamaan Fakta Ginting. “Marilah kita sama-sama peduli pada apa yang dirasakan oleh para pengungsi Gunung Sinabung. Mereka bukanlah

orang miskin, namun karena bencana alam yang menimpa mereka, kita harus mengulurkan tangan untuk membantu mereka,” ujar Rimienda menambahkan turut digelar lelang lagu yang hasilnya total diberikan kepada para pengungsi. Di sela-sela kegiatan, terlihat aksi solidaritas dari audiens yang hadir untuk memberikan sumbangsihnya dalam bentuk uang di keranjang yang telah dipersiapkan panitia. Di antara para donatur adalah Redaktur Waspada Online, Sastroy Bangun, mewakili media tersebut. “Sebagai pemuda kelahiran Tanah karo, saya merasa tergugah dengan insiden ini. Kalau bukan kita (pemuda Karo-red) yang menolong saudara kita yang berada di kamp pengungsian, siapa lagi?!” ujar pria yang akrab disapa Roy ini. (m33)

Waspada/Abdullah Dadeh

Keluarga TKI dari berbagai daerah memadati Bandara Polonia Medan, seperti suasana dipintu keluar terminal luar negeri, Minggu.

Bandara Polonia Dan KA Dipadati Pemudik MEDAN (Waspada) : Bandara Polonia Medan dan stasiun besar Kereta Api Medan dari pagi hingga sore dipadati arus mudik Lebaran ke beberapa jurusan, Minggu (5/9), namun suasana belum begitu meningkat. Sementara di Bandara Polonia Medan, arus mudik bergerak dari Jakata, Bandung dan Surabaya bahkan dari Pekanbaru tujuan Medan. Rata-rata pesawat jenis Airbus A-320, ER-900 dan Boeing 737-400 terisi seat. Misalnya Air Asia QZ-7920 dari Bandung membawa 135 penumpang QZ-7610, membawa 142 penumpang, Lion Air JT380 dan JT-394 dari Jakarta membawa 206 dan 211 penumpang. Sementara Batavia Air Y6591 membawa 143 penumpang dan Air Asia QZ7492 dari Jakarta membawa 177 penumpang. Data penumpang sehari sebelumnya, arus datang dari berbagai kota besar tujuan Medan

juga meningkat. Di terminal internasional, para TKI yang balik ke kampung juga mulai meningkat. Pada umumnya para TKI datang dari Kuala Lumpur dan Penang untuk cuti lebaran selama dua minggu.”Kami akan balik lagi semingu setelah lebaran,” ujar Dilla, TKI asal Aceh Singkil, setelah melapor kedatangannya di Posko Posdal TKI. Selain itu di Bandara Polonia dibuka Posko Kesehatan 24 jam H-7 dan H+7 lebaran, kata dr Hj. Heriati, koordinator Posko Kesehatan Lebaran, menghadapi berbagai kemungkinan di bandara. Arus KA Di stasiun besar KA, arus penumpang mulai bergerak naik ke segala jurusan. Seperti kereta api penumpang Sri Bilah dari stasiun besar Medan berangkat pukul 08:07 tujuan Rantau Prapat mengangkut lebih kurang 90 persen dari

kapasitas 1.164 tempat duduk baik bisnis, eksekutif maupun ekonomi. Petugas Posko stasiun besar KA Divre I Sumut/Aceh Syamsuddin,ketikadikonfirmasimembenarkan arus penumpang sudah mulai bergeraknaik ke segala jurusan, namun belum begitu meningkat.“Peningkatan arus biasanya dua hari menjelang lebaran baik tujuan Rantau Prapat, Tanjung Balai, Kisaran dan Medan tujuan P. Siantar,” ujarnya. Begitu juga pengiriman barang seperti kendaraan roda dua juga meningkat ke segala jurusan sejak seminggu lalu. Rata-rata 20 hingga 25 kendaraan roda dua dikirim setiap hari. Minggu KA Medan berakhir mengirim kendaraan, setelah itu akan digunakan untuk angkutan penumpang, kata Ferianta Ginting, petugas KA Medan. (m32)

Pelindo I Bantu Korban Sinabung MEDAN (Waspada): Menajemen PT Pelabuhan Indonesia (Pelindo) I merupakan BUMN yang mengelola pelabuhan umum di Aceh, Sumut, Riau dan Kepulauan Riau, melakukan aksi peduli bencana gunung Sinabung dengan memberikan bantuan Rp121.175.000. Tim Peduli Sinabung Pelindo I, sebelumnya dilepas dari kantor pusat Jalan Krakatau Ujung, Sabtu (4/9) pagi. Selanjutnya rombongan yang mewakili manejemen dan pengurus pusat Serikat Pekerja Pelindo I, dibawah pimpinan Direktur Utama Harry Sutanto dan Direktur Operasi dan Teknik Iman S bersama dua truk yang

mengangkut bahan bantuan langsung ke Kabanjahe. Bantuan Pelindo I ini diserahkan ke Posko Bencana Gunung Sinabung di Kantor Bupati Tanah Karo. Penyerahan dilakukan secara simbolis oleh Direktur Utama Pelindo I Harry Sutanto kepada Bupati Tanah Karo DD Sinulingga. Harry Sutanto mengatakan, pihak Pelindo turut merasakan apa yang dialami masyarakat Tanah Karo akibat meletusnya Gunung Sinabung, semoga bantuan ini dapat meringankan beban dan dan dapat bermanfaat. Dijelaskannya, bantuan itu diberikan dalam bentuk bahan makanan siap saji, makanan

Waspada/Ist

Direktur Utama Pelindo I Harry Sutanto (kiri) ketika menyerahkan bantuan yang diterima Bupati Tanah Karo DD Sinulingga di posko Pemda Tanah Karo di Kabanjahe, Sabtu (4/ 9), disaksikan Direktur Teknik Iman AS, ketua tim Peduli Sinabung Pelindo I Bistori Pandiam, Sekretaris Parsulian MT Manurung dan Bendahara Ramli Simanjuntak.

bayi, susu, makanan ringan, ikan asin, popok bayi, pembalut wanita dan selimut dengan nilai Rp211.175.000. Mengapa jenis ini yang diserahkan, menurut Dirut, karena ini merupakan hasil koordinasi dengan Posko Bantuan Pemkab Karo kepada tim Peduli Pelindo I yang melakukan survey beberapa hari lalu. Bantuan ini, jelas Harry Sutanto, diperoleh dari manajemen Pelindo I dari program CSR dan sumbangan sukarela dari pegawai Pelindo I yang tergabung dalam Serikat Pekerja Pelabuhan Indonesia I. “Pelindo I berkomitmen untuk maju bersama dalam meraih prestasi. Atas keberhasilan ini Pelindo I tidak pernah melupakan lingkungannya. Oleh karena itu hari ini, kami membuktikan kembali kepedulian itu dalam meringankan penderitaan orang lain, melalui aksi peduli Sinabung. Aksi serupa juga pernah dilakukan yang diberikan kepada korban gempa Padang, Jambi dan longsor di Mandailing Natal, bayi kembar empat yang lahir di RSU Dr Pirngadi Medan dan lainnya,” sebut Harry. Sementara Humas Pelindo I M Taufik Fadillah menjelaskan, jumlah bantuan CSR Pelindo I yang telah diserahkan kepada masyarakat selama tahun 2009 Rp1.053.391.160. Sedangkan realisasi bantuan CSR selama tahun 2010 Rp623.238.000 ditambah Rp100 juta untuk bantuan peduli bencana Gunung Sinabung. (m35)


Medan Metropolitan A4 Tuna Netra Diperjuangkan Dapat Bantuan APBD MEDAN (Waspada): Jelang berakhirnya bulan suci Ramadhan, Wakil Ketua DPRD Kota Medan Ikrimah Hamidy berbuka puasa dan membagikan bingkisan kepada Persatuan Tuna Netra Indonesia (PERTUNI) cabang Kota Medan. Pertemuan ini sebagai bagian untuk menjalin silaturahim dan menyerap aspirasi para tuna netra yang akan diperjuangkan agar dapat bantuan dari APBD Kota Medan menyusul belum berpihaknya Pemko

terhadap nasib mereka. Hal itu disampaikan Ikrimah Hamidy, kemarin, di Sekretariat PERTUNI Medan Jalan Sampul. Acara tersebut dimulai dengan pembacaan ayat suci Al Quran dengan huruf

Sarjana Nasution Bantu Kaum Duafa MEDAN (Waspada): Dalam rangka bulan suci Ramadhan, Ikatan Persaudaraan Sarjana Nasution (IPSN) mengadakan bakti sosial berbagi kasih dengan masyarakat anak yatim piatu, fakir miskin dan kaum duafa dengan memberikan sumbangan paket sembako lebih kurang untuk 300 orang . “Acara penyerahan paket sembako kepada masyarakat kurang mampu di kawasan Bandar Selamat berlangsung di Masjid Al Ijtimaiyah Bandar Selamat, “ kata Wakil Ketua IPSN Efdi Boy Nasution, SH, Sabtu (4/9). Kata Efdi Boy, kegiatan ini rangkaian bakti sosial menyakapi momen Ramadhan berbagi kasih dengan mereka yang kurang beruntung. Paket sembako tersebut berisi kebutuhan harian yang dapat digunakan para warga “Sembako berisi beras, gula, minyak goreng, dan mie instan berasal dari sumbangan para anggota IPSN, “ katanya. Didampingi Sekretaris Umum IPSN Dr Syahfrizal Nasution, kata Efdi Boy, kegiatan ini terus menerus dilakukan guna meringankan sedikit beban kaum miskin dan tidak mampu. Lebih jauh, tambah Syahfrizal, hadir dalam penyerahan sembako itu, Ketua Umum IPSN Prof Yusuf Nasution, SpPD, para pengurus teras Prof Dr Habibah Hanum Nasution, SpPD, Drs Hasby Nasution, Hj.Tapiani Nasution dan Dewan Penasehat Batara Nasution, Bsc. Salah satu warga yang menerima paket sembako tersebut, mengucapkan banyak terima kasih kepada IPSN yang telah berbagi kebahagiaan dengan warga Bandar Selamat. Ditambahkan, Efdi Boy, IPSN juga tengah mengagendakan acara Halal Bi Halal sesama anggota IPSN. (h05)

IPK Santuni 1.000 Anak Yatim MEDAN (Waspada): Dewan Pimpinan Pusat Ikatan Pemuda Karya (DPP IPK) Indonesia yang dipimpin Ketua Umum Budi Panggabean menyantuni sekitar 1.000 anak yatim piatu dan kaum duafa dari panti asuhan se Kota Medan. Selain menyantuni anak yatim piatu dan kaum duafa berupa paket berisi syrup, kain sarung, makan dan uang yang diserahkan salah seorang Ketua DPP IPK Frees didampingi Sekretaris H Arfan Maksum Nasution, Ketua IPK Sumut Nelson Diapari Simanjuntak SH dan Ketua IPK Medan Basirun, Keluarga Besar IPK juga memberikan talih kasih kepada pasukan melati (penyapu jalan). Pemberian santunan dilaksanakan bersamaan acara berbuka puasa bersama di rumah pendiri IPK mendiang Olo Panggabean Jl. Sekip/Waru Medan, kemarin, yang dihadiri Muspida plus, Wakil Ketua KNPI Sumut Jhoni Koto, para pengurus IPK diantaranya Hara Ito Panggabean, Ir Moko Panggabean dan ratusan anggota dan kader IPK. Gubsu H Syamsul Arifin SE dalam sambutannya yang dibacakan Kabid Pembinaan Politik Dalam Negeri dan LSM Ahmad Firdaus Hutasuhut SH MSI mengatakan, selain berbuka puasa bersama, pertemuan ini dapat lebih mempererat hubungan silaturahmi diantara kita, sesuai tema acara “Memelihara Silaturahmi, Kebersamaan, Dan Kepedulian Sosial Antar Sesama”. Ketua DPD IPK Sumut Nelson Diapari Simanjuntak menyatakan, kegiatan ini merupakan upaya membina tali silaturahmi sesama pengurus, anggota dan kader IPK. “Mudah-mudahan niat baik yang dilaksanakan ini dapat meningkatkan tali silaturahmi diantara kita,” ujarnya sambil mengajak seluruh anggota dan kader IPK untuk menghormati saudaranya yang menjalani ibadah puasa. Sementara Sekretaris DPP IPK H Arfan Maksum Nasution dalam sambutannya mengucapkan terima kasih kepada semua pihak terutama pengurus IPK Sumut dan unsur panitia yang telah bekerja sehingga acara terlaksana. Sedangkan Al Ustadz Syariffudin Pasaribu dalam tausiyahnya menuturkan, Ramadhan merupakan bulan penuh rahmat dan pengampunan. Oleh karenanya dalam bulan Ramadhan ini kita tingkatkan amal ibadah agar menjadi umat yang bertaqwa. (m31)

braile oleh Nurman Ritonga. Ikrimah yang ketika itu hadir sekaligus mengisi ceramah menjelang berbuka puasa menyebutkan, Allah SWT pernah menegur Rasulullah SAW di dalam surat ‘Abasa, di mana Rasulullah pernah lebih mengutamakan dakwah kepada kalangan penguasa qurais dibanding dengan kalangan rendahan, padahal pada waktu itu ada seorang tuna netra tua bernama Abdullah bin Ummu Maktum, sangat ingin masuk Islam. “Kisah ini harus menjadi cermin bagi kita agar tidak pilih kasih kepada siapa pun, apalagi jika hanya didasarkan kepada aspek fisik semata. Malah sebaliknya, kita yang diberi nikmat tubuh yang normal harus lebih perhatian kepada kalangan lain yang diberi keterbatasan,” ujarnya. Sementara itu, Ketua PER-

TUNI Kota Medan Mardizhon Tanjung menyampaikan sejumlah persoalan yang dialami para tuna netra. Selama ini mereka kurang mendapat perhatian yang baik. Hal ini terbukti dengan minimnya bantuan bagi pengembangan organisasi ini dalam kurun waktu 5 tahun terakhir dari APBD Kota Medan serta fasilitas bagi tunanetra yang minim di berbagai gedung dan perkantoran. Namun, sebutnya semua itu tidak menyurutkan semangat juang warga PERTUNI. Malah sebaliknya menjadi sebuah tantangan dalam mengukir sukses. Diakuinya, kondisi kurang secara fisik, tapi hati dan kemauan kerja kuat bagaikan karang. “Kami tidak ingin anak kami putus sekolah dan terlantar, maka kami mohon agar kerjasama

dari semua pihak dapat dilakukan, khususnya di bulan Ramadhan ini, sehingga tidak ada lagi pihak-pihak yang berupaya menzhalimi anggota PERTUNI di lapangan hanya karena kami tuna netra, “ katanya. Pada kesempatan ini, hadir sejumlah Ketua Pos Keadilan Peduli Ummat (PKPU) Sumut Lukmanul Hakim, Kepala Dinas Pendidikan Kota Medan Hasan Basr, Kepala Dinas Perindustrian dan Perdagangan Kota Medan T Basyrul Kamali. Dalam kesempatan ini, Lukmanul Hakim menyampaikan sejumlah program PKPU, baik di pusat maupun di daerah yang telah dilakukan. Bahkan belum lama ini, PKPU telah menyalurkan bantuan bagi masyarakat korban letusan Gunung Sinabung. (h05)

Unpri Bekali Lulusan Empat Kecerdasan MEDAN (Waspada): Lulusan Universitas Prima Indonesia (Unpri) diyakini akan mampu menghadapi kehidupan pengalaman di dunia kerja dan masyarakat sebagai sarjana yang siap merancang dan meniti karir. Hal tersebut disampaikan Rektor Unpri, Prof. dr. Djakobus Tarigan, AAI, DAAK, ketika mewisuda 216 orang lulusan perguruan tinggi tersebut yang dilaksanakan di Hotel Danau Toba Internasional Medan, Sabtu (4/9). Lulusan Unpri yang diwisuda merupakan sarjana dari Strata-1 (S-1) dan Program D-3 di antaranya dari Fakultas Keperawatan dan Kebidanan (FKK), Fakultas Kesehatan Masyarakat (FKM), Fakultas Ekonomi dan Fakultas Ilmu Komputer. Hadir pada upacara wisuda itu Koordinator wilayah 1 NADSumut, Prof. Dr. Zainuddin, MPd, Ketua Yayasan Perguruan Tinggi Prima Indonesia, dr. I Nyoman Ehrich Lister, M.Kes, AIFM, Ketua BPH Yayasan, Tommy Leonard, SH, Wakil Rektor I, Prof. Dr. drg. Monang

Panjaitan, MS, Ketua Medical Education Unit (MEU), Dr. dr. Umar Zein, para wakil rektor, dekan, dosen di lingkungan Unpri serta undangan lainnya. Prof. Djakobus mengatakan, lulusan Unpri mampu menghadapi persaingan di dunia kerja dan menjalani kehidupan bermasyarakat karena telah dibekali pengetahuan dan keterampilan serta bekal hidup memadai yaitu dengan empat kecerdasan. “Dengan andalan empat kecerdasan yakni kecerdasan intelektual, spiritual, sosial dan emosional, kami yakin lulusan kami dapat mengintegrasikan diri dengan lingkungan,” ucapnya. Rektor juga berpesan agar para lulusan dapat memanfaatkan dan menciptakan kesempatan serta mampu berkompetisi secara sehat dan sportif. Pada kesempatan itu rektor mengingatkan tanda orang berilmu adalah dapat memberi manfaat di tengah masyarakat. “Meskipun telah lulus, teruslah memperkaya diri dengan berbagai ilmu pengetahuan. Sebab, hanya orang-orang

yang berilmu tinggilah yang akan sukses di tengah-tengah masyarakat,” pungkasnya. Sementara itu Koordinator Kopertis wilayah 1 NAD-Sumut, Prof. Dr. Zainuddin, MPd mengungkapkan seseorang akan sukses di masyarakat bila mampu melaksanakan empat hal penting, yakni mau belajar secara terus-menerus, gigih meraih cita-cita, disiplin, serta memiliki sikap pendekatan pribadi yang baik, sopan santun sehingga tercipta saling menghargai dan menghormati. Kopertis menilai Unpri telah mengalami perkembangan dan kemajuan yang cukup pesat serta berhasil dalam manajemen kualifikasi dosen yang berdampak positif pada kualitas mahasiswa dan alumninya. Bahkan dia menilai Ketua Yayasan Perguruan Tinggi Prima Indonesia dr I Nyoman Ehrich Lister kreatif dalam membangun dan mengembangkan Unpri. Itu dapat dilihat dari Unpri tercatat sebagai perguruan tinggi swasta yang memiliki banyak guru besar. (m41)

Waspada/Ismanto Ismail

BKKBN Peringati Nuzul Quran MEDAN (Waspada): Badan Kependudukan dan Keluarga Berencana Nasional (BKKBN) Sumut mengadakan kegiatan Nuzul Quran sekaligus berbuka puasa bersama anak yatim dan kaum duafa di halaman Masjid As-Sakinah komplek perkantoran BKKBN Jalan Krakatau Ujung, Medan, Rabu (1/9). Kegiatan yang diawali dengan pembacaan Al-Quran oleh qori Drs Arfan ini dihadiri Kepala BKKBN Sumut H Indra Wirdhana SH. MM, Sekretaris Drs Jumali, Kepala Bidang (Kabid) IKAP Drs Datang Sembiring MPHR, Kabid Supervisi dan sejumlah Kepala Seksi dan staf BKKBN Sumut. Ketua BKM Masjid As-Sakinah MYudi SE mengatakan, kegiatan Nuzul Quran dan berbuka puasa bersama dengan orang-orang tak mampu di sekitar lingkungan kantor BKKBN Sumut ini setiap tahun dilaksanakan. Hal ini dalam rangka meningkatkan hubungan Ukhuwah Islamiyah. “Apalagi di bulan suci ini hubungan silaturahmi harus dijaga dengan baik, sehingga amalan kita di bulan yang baik ini tidak sia-sia,” ujar M Yudi yang juga menjabat Kasubbag TU di BKKBN Sumut. Pada kesempatan itu BKKBN Sumut juga memberikan bantuan kepada fakir miskin di sekitar kantor, diantaranya 17 anak sekolah Al-Ihsan yang tidak mampu, 10 anak yatim dan 6 lansia (lanjut usia). Selain itu BKKBN juga memberikan bingkisan kepada imam masjid, muazin, bilal yang selama bulan suci Ramadhan ini mengisi kegiatan di Masjid As-Sakinah. Penyerahan bantuan dan bingkisan ini dilakukan oleh Kepala BKKBN Sumut Indra Wirdhana didampingi para kepala bidang. Sementara Al-Ustadz Mujiadi M Nur dalam tausyiah siraman rohaninya mengupas tentang penekanan kepada kaum muslim agar lebih mensyukuri nikmat yang diberikan Allaw SWT. Sebelumnya Kepala BKKBN Sumut mengatakan, kegiatan ini lebih ditujukan agar terjalin silaturahmi antar sesama pegawai di lingkungan kerja BKKBN. Sebab tanpa hubungan silaturahmi itu semua pekerjaan dan program-program tidak akan selesai dengan baik. “Kalau tali silaturahmi baik, persatuan dan kesatuan di instansi BKKBN Sumut akan semakin kokoh,” tuturnya. (m29)

Waspada/Ist

Wakil Ketua MUI Pu-sat, Prof. Din Syamsuddin saat menyampaikan tausiyahnya dalam peringatan Nuzul Quran di IAIN SU, Kamis (2/9) malam yang turut dihadiri Gubsu, H. Syamsul Arifin, SE dan Rektor IAIN, Prof. Nur Ahmad Fadil Lubis, MA, Ketua MUI Sumut, Prof. Dr. H Abdullah Syah dan lainnya.

IAIN SU Peringati Nuzul Quran

Indonesia Masih Tuna Aksara Moral MEDAN (Waspada): Wakil Ketua Umum Majelis Ulama Indonesia (MUI) Pusat, Prof. H Din Syamsuddin mengungkapkan, sampai saat ini Indonesia masih tuna aksara moral, sehingga negara ini mengalami kemajuan yang lamban. “Tuna aksara moral ini bahkan lebih berbahaya dari tuna aksara huruf arab maupun huruf latin sekalipun,” kata Din Syamsuddin dalam tausiyah peringatan Nuzul Quran Keluarga Besar Institut Agama Islam Negeri (IAIN) Sumatera Utara di Masjid Ulul Albab, Kampus I Jalan Sutomo Medan, Kamis (2/9) malam. Prof. Din Syamsyuddin menjelaskan, kalau tuna aksara Al-Quran dan buta huruf latin mudah untuk dientaskan sampai ke titik terendah, mengingat saat ini begitu banyak metode pengajarannya. Namun untuk buta aksara moral ini, sangat berat dan berbahaya karena tanpa disadari telah melanda kaum terdidik yang justru telah menguasai aksara Arab dan latin tersebut. Tapi tidak mampu membaca dan menterjemahkan huruf-huruf moral dalam kehidupan sehari-hari. Hal inilah yang terjewantah

dalam prilaku korupsi, makelar kasus, makelar pajak, tanah dan lain sebagainya. “Buta aksara moral inilah yang masih menghinggapi anak bangsa ini sehingga kita semakin terpuruk dan tidak dihargai lagi di dunia internasional,” ungkap Guru Besar Universitas Islam Negeri Jakarta ini. Selain buta aksara moral, lanjutnya, umat Islam saat ini mengalami kesenjangan antara pesan-pesan Al-Quran dengan kenyataan umat. Kenyataan hari ini telah terjadi kesenjangan besar antara idealisasi Islam dengan realisasi Islam di seluruh dunia. Padahal sesunggunya Islam secara normatif merupakan agama yang sangat mendukung kemajuan peradaban. Menurut Din, dengan semangat Nuzul Quran tahun ini, umat Islam di Indonesia harus berhasil menangkap dan merealisasikan ajaran yang sangat mendukung kemajuan, kasih sayang, perdamaian, penggalian ilmu pengetahuan dan kemajuan peradaban dunia tersebut. “Umat Islam harus berhasil menangkap semangat yang disampaikan Al-Quran untuk diterapkan dalam kehidupan nyata demi mencapai

kemajuan dan kesejahteraan hakiki,” ucapnya. Disampaikan Ketua PP Muhammadiyah ini, untuk merealisasikan langkah tersebut peran dariIAINSUsebagaisebagaipusat keunggulan akademik sangat dibutuhkan. “Bersama ormas Islam dan komponen umat lainnya, kekuatan intelektual itu harus menjalin kerjasama dengan pemerintah serta segenap masyarakat untuk merentas kesenjangan serta mengatasi setiap persoalan crusial yang masih dihadapi umat,” kata Din. Peringatan Nuzul Quran tersebut dihadiri Gubernur Sumatera Utara, H. Syamsul Arifin, SE, Rektor IAIN SU, Prof. H Nur Ahmad Fadhil Lubis, MA, para pembantu rektor, Ketua MUI Sumut, Prof. Dr. H Abdullah Syah, KH Zulfikar Hajar, Lc, tokoh agama, ulama dan undangan lainnya. Gubernur Sumatera Utara, H. Syamsul Arifin, SE dalam sambutannya mengingatkan perlunya Sumut memiliki satu pusat kajian Islam terpadu, sehingga persoalan keumatan bisa dicarikan jalan keluarnya secara terpadu, sistematis dan terukur demi pencerahan umat Islam menjadi lebih baik. (m41)

F.SPTI-K.SPSI Imbau Kenaikan Tarif Sesuai Ketentuan

Waspada/Sugiarto

Yayasan Perguruan Tinggi Prima Indonesia dr I Nyoman Ehrich Lister (empat kanan) bersama Koordinator Kopertis wilayah 1 NAD-Sumut, Prof. Dr. Zainuddin, MPd foto bersama usai menyerahkan penghargaan kepada beberapa wisudawan terbaik.

Pelayanan Kesehatan Untuk Pengungsi Sinabung

Mewakili Ketua Umum DPP IPK Frees didampingi Ketua DPD IPK Sumut Nelson Diapari Simanjuntak, Hara Ito Panggabean dan Basirun memberikan santunan kepada anak yatim dan kaum duafa serta penyapu jalan.

WASPADA Senin 6 September 2010

MEDAN (Waspada): Sesama anak bangsa harusnyalah saling bahu-membahu dalam kebaikan. Seharusnya pula, yang diberikan kepada msyarakat adalah sesuatu yang terbaik. Dengan itu, akan terasa manfaatnya. Hal itu disampaikan dr Robert Valentino Tarigan, Pimpinan BT/BS BIMA Indonesia yang berpusat di Jalan Bantam No 6 A Medan kepada wartawan di tengah-tengah pengungsi korban letusan Gunung Sinabung, kemarin, terkait pelayanan kesehatan untuk pengungsi tersebut yang diadakan Robert Valentino Tarigan bersama Ir. Saymarantha S.L. Rajabana Purba dimulai Senin (30/8), di Jambur Taras Berastagi dan Gedung KWK (Kursus Wanita Kristen GBPK) Jalan Udara No 49 Berastagi. Tim dokter yang melaksanakan pelayanan tersebut, yakni

dr Polo Tarigan, dr Franks Wijaya, dr Imee S Surbakti, dr Widya MS Gultom, dr Elda B Bangun. Para dokter dibantu apoteker Idris Tarigan dan Hisar Sinaga. “Pelayanan kesehatan sampai 3 September 2010. Tapi jika memang diperlukan, mungkin akan diperpanjang,” ujar Valentino. Dalam satu hari sedikitnya 700-an orang pengungsi mendapat pengobatan massal tersebut. “Kami mengucapkan terimakasih yang sebesar-besarnya kepada tim dokter, khususnya dr Robert Valentino yang telah bersusah payah sehingga acara ini dapat terselenggara dengan baik,” kata S Surbakti, salah seorang pengungsi. Menyahuti hal itu, Koordinator Dokter Franks, SKed menyatakan, pihaknya akan selalu siap untuk kegiatan serupa. “Kami para dokter, jika dibutuhkan merasa senang

sekali dapat dilibatkan melakukan pengobatan kepada masyarakat,” katanya. Sementara itu, Murni, salah seorang masyarakat yang juga ikut berobat mengungkapkan rasa syukurnya atas prakarsaValentino, juga tim dokter. Mengapa tidak, para pengungsi yang tidur, makan dan buang air tak seperti biasa berkemungkinan besar akan terkenan gangguan kesehatan. Dengan pelayanan kesehatan ini masyarakat pengungsi dapat terbantu. Menyahuti hal itu,Valentino mengatakan, memang seharusnya sesama anak bangsa saling bahu-membahu dalam kebaikan. “Gerakan-gerakan amal seperti ini harus terus-menerus ditumbuhkembangkan guna membangkitkan nilai-nilai soilidaritas masyarakat. Yang kaya mengasihi yang miskin dan yang miskin menghargai yang kaya,” ujarnya. (m08)

Waspada/ist

dr Robert Valentino Tarigan SPd (no 3 dari kanan berdiri) sedang berbicang-bincang sembari mengamati kerja tim dokter di Gedung KWK Berastagi.

MEDAN (Waspada): Menjelang H-5 lebaran, Federasi Serikat Pekerja Transportasi Indonesia – Konfederasi Serikat Pekerja Seluruh Indonesia (F.SPTI-K.SPSI) Sumut mengimbau kepada seluruh pengusaha dan pekerja transportasi untuk tetap menaikkan tarif sesuai dengan ketentuan. Mereka berjanji akan turut mengawasi soal tarif angkutan sampai selesai arus balik lebaran. “Dan apabila kita ketahui ada angkutan yang menaikkan tarif diluar ketentuan maka kita akan merekomendasikan kepada Dinas Perhubungan (Dishub) Sumut untuk memberikan sanksi sesuai aturan,” kata Ketua FSPTI-KSPSI Sumut, Rizaldi Mavi, didampingi Sekretaris, Hendra Mika Siahaan, Wakil Ketua, Rismansyah Siregar, Surya Kalfin, OK Azhari, Asmoko Edi kepada Waspada di kantor mereka, Jalan Denai

Medan, Minggu (5/9). Rizaldi mengakui memahami jika pengusaha dan pekerja transportasi baik darat, udara dan laut, berusaha memanfaatkan membludaknya penumpang pada masa arus mudik dan balik lebaran ini dengan menaikkan tarif. Namun biar bagaimanapun, kenaikan tarif tersebut tetap harus sesuai dengan ketetapan pemerintah. “Kita tetap harus bertanggungjawab menciptakan suasana kondusif kepada masyarakat yang memanfaatkan jasa angkutan untuk mudik lebaran,” katanya. Dia juga mengimbau anggota FSPTI-KSPSI Sumut untuk tidak bekerjasama dengan calo. Meminta Dishub untuk serius memantau praktek percaloan tiket. Sehingga masyarakat dapat pelayanan maksimal selama lebaran.

Sementara Hendra Mika menambahkan, agar Kadishub Sumut dapat memaksimalkan seluruh angkutan lebaran, untuk dapat mengakomodir seluruh masyarakat. Khususnya untuk angkutan kereta api antar kota. “Sebaiknya dapat memaksimalkan seluruh gerbong yang ada. Karena kereta api ini efektif untuk meminimalisir kemacatan lalulintas,” jelasnya. Dia juga berharap seluruh program Dishub di bidang angkutan darat, laut dan udara agar dapat segera terealisasi. Mengingat kebutuhan masyarakat yang sudah demikian mendesak untuk jasa angkutan. Dia juga menegaskan FSPTIKSPSI Sumut supaya berperan aktif dalam kelancaran arus mudik dan arus balik lebaran. “Kita akan berperan aktif dalam pengamanan dan kelancaran lalu lintas selama masa mudik dan balik lebaran,” katanya.(h11)

PT Madina Agrolestari Bodohi Masyarakat Desa Sikapas MEDAN (Waspada): Perusahaan pemegang izin lokasi di sekitar Desa Sikapas, Kecamatan Muara, Batang Gadis Madina, PT. Madina Agrolestari dinilai telah membodohi masyarakat desa tersebut, sebab tidak mau memberikan lahan plasma dengan luas yang sesuai dengan peraturan. Dalam hal ini, Bupati Madina diminta untuk meninjau ulang izin lokasi yang telah diberikan kepada perusahaan yang bergerak dibidang pertanian itu. “Sudahlah luas lahan yang dijanjikan tidak sesuai Peraturan Menteri Pertanian (Permentan), parahnya lagi, sampai sekarang lahan itupun itu belum terealisasi kepada masyarakat,” kata Penasihat Lembaga Swadaya Masyarakat Cakra, Nekson Tanjung kepada Waspada di Medan, Sabtu (4/9). Tanjung menjelaskan, sebenarnya menurut Peraturan Menteri Pertanian No.26/Permentan/OT.140/2/2007 tentang pedoman perizinan usaha perkebunan, PT Madina Agrolestari seharusnya memberikan kebun plasma kepada masyarakat dengan luas lahan minimal 20 persen dari total luas lahan izin lokasi.

Sehingga, kata Tanjung, seharusnya perusahaan itu memberikan sekitar 1300 Ha lahan kepada masyarakat. Karena sesuai izin lokasi No.525.25/ 427/K/2007 yang dikeluarkan bupati Madina tanggal 27 Juni 2007 lalu, luas areal PT. Madina Agrolestari adalah sekitar 6500 Ha. Namun ternyata dalam nota kesepahaman antara PT. Madina Agrolestari dengan KUD Air Manis, disebutkan masyarakat hanya akan diberikan lahan plasma seluas 572 Ha. Padahal jika merujuk kepada Permentan, perusahaan seharusnya memberikan sekitar 1300 Ha kebun plasma kepada masyarakat Desa Sikapas. “Dapat dilihat jelas PT. Madina Agrolestari jelas-jelas telah melanggar Permentan No.26/Permentan/OT.140/2/ 2007 tentang pedoman perizinan usaha perkebunan, dan semangat peningkatan taraf hidup masyarakat dalam sektor perkebunan sesuai dengan Permentan No.33/Permentan/ OT.40/7/2006 tentang pengembangan perkebunan melalui program revitalisasi perkebunan,” jelasnya.

Nekson menegaskan, jika PT. Madina Agrolestari tidak sanggup merealisasikan pembangunan kebun plasma untuk warga Desa Sikapas sesuai dengan aturan Permentan, maka sebaiknya perusahaan itu angkat kaki dari Madina. Karena banyak investor yang bersedia bekerjasama dengan KUD Air Manis dengan persentase yang lebih menguntungkan bagi warga Desa Sikapas. Dia juga mengingatkan agar jangan sampai ada oknum yang mencoba membela PT Madina Agrolestari karena permasalahan ini menyangkut nasib warga Desa Sikapas. Dan kepada DPRD Madina selaku lembaga aspirasi rakyat harusnya lebih aspiratif dan jangan memperumit permasalahan yang ada. “Diharapkan kepada siapapun yang merasa ikut membela PT. Madina Agrolestari supaya segera sadar diri karena ini adalah kehancuran warga Desa Sikapas. “Bupati Madina meninjau kembali izin lokasi yang diberikan kepada perusahaan itu karena sebenarnya izin lokasi itu sudah berakhir pada 27 Juni 2010,” katanya.(h11)


Medan Metropolitan

WASPADA Senin 6 September 2010

BNI Syariah Bagikan Sembako Di Masjid Jamik MEDAN (Waspada): Untuk mewujudkan kedekatan Bank BNI Syariah dengan seluruh lapisan masyarakat, khususnya kepada kaum dhuafa, BNI Syariah Medan membagikan sembako kepada kaum dhuafa di Masjid Jamik Jl. Taruma Simpang Kejaksaan Medan Petisah, Jumat (3/9). Penyerahan paket Ramadhan berbagi bersama BNI Syariah Medan langsung diserahkan Pimpinan BNI Syariah Darmayanti Daud didampingi Manager Operasional M Muttaqin dan Pimpinan KCPS SM Raja Medan Zul Irfan. Menurut Darmayanti Daud kepada wartawan, kegiatan ini dilakukan serentak di seluruh Indonesia pada hari yang sama dalam rangka kemeriahan Bulan Ramadhan sekaligus menyambut Hari Raya Idul FItri 1431 H, untuk dapat berbagai bersama kaum dhuafa membantu agar dapat merayakan hari kemenangan ini. “Hal ini untuk mewujudkan kedekatan Bank BNI Syariah dengan seluruh lapisan masyarakat dan untuk menunjukan kepedulian kepada kaum dhuafa, sesuai dengan Tagline-nya ‘Semakin Dekat Di Hati” maka dilaksanakan kegiatan yang bersifat massal dan berbentuk Charity yang juga dilaksanakan di seluruh Cabang Bank BNI Syariah seluruh Indonesia,” katanya. Adapun paket sembako yang diberikan sebanyak 200 paket dengan bekerjasama pihak Badan Kenaziran Masjid Jamik, sebagai pembagi kupon yang dapat ditukar menjadi paket sembako berisikan gula pasir, minyak goreng, tepung, mentega, susu, sirup dan biskuit. Lebih lanjut dikatakan Darmayanti, kegiatan ini dilaksanakan berkesinambungan karena pada Sabtu (4/9), juga berbuka puasa bersama anak yatim dan abang becak yang ada di Kota Binjai, karena BNI Syariah juga mempunyai cabang pembantu yang merupakan daerah kerjanya di Kota Rambutan itu. (m38)

Yasora Salurkan Sembako

Waspada/Sugiarto

Dua angkutan umum berhenti dan menaikkan penumpang di rambu larangan berhenti di Jalan Brigjen Katamso Medan, Minggu (6/9). Pelanggaran rambu-rambu lalu lintas oleh pengemudi angkutan umum ini sering terjadi di Kota Medan.

Izin Hotel Delta Harus Ditinjau Ulang Tak Layak Ruko Jadi Hotel Bintang 4

Waspada/Ist

Pimpinan BNI Syariah Darmayanti Daud menyerahkan paket sembako sebagai wujud kedekatan BNI Syariah Medan kepada kepada masyarakat di sekitar Masjid Jamik, Jumat (3/9).

Persit I/BB Serahkan Bantuan Pengungsi Sinabung MEDAN (Waspada): Ketua Persit Kartika Candra Kirana (KCK) PD I/ Bukit Barisan Ny. Yuni Leo Siegers bersama rombongan menyerahkan langsung bantuan kemanusiaan kepada para pengungsi letusan Gunung Sinabung di Kabupaten Karo, Rabu (1/9). “Bantuan itu berupa mi instan 90 kotak, tikar 90 buah, pembalut 200 buah, obat tetes mata 90 kotak, susu OHT 400 kotak, masker 10 kotak, biskuit 20 kotak, sarung 450 buah, mi cangkir 110 buah, beras 7 karung, roti 35 kotak,” kata Kapendam I/BB Letkol CAJ. Asren Nasution, kemarin. Menurut Asren, bantuan diberikan langsung di Jambur Tuah Lopati Kecamatan Kabanjahe dengan pengungsi 1543 jiwa, Jambur Teras Berastagi di Kecamatan Berastagi dengan jumlah pengungsi 2.357 jiwa, dan Jambur Desa Tongkah Kecamatan Dolat Rakyat dengan pengungsi 258 jiwa. Hal serupa juga dilakukan Kodam l/BB yang penyerahannya diwakili oleh anggota Kodim 0205/TK di beberapa tempat pengungsian, yaitu di Jambur Lige Jalan Jamin Ginting, Kabanjahe. (cmai)

MEDAN (Waspada): Komisi C DPRD Medan meminta Dinas Kebudayaan dan Pariwisata (Disbudpar) meninjau kembali izin hotel dan tempat hiburan Delta. Diduga telah terjadi manipulasi dalam pengoperasian unit usaha tersebut. Kemarin, Komisi C bertemu dengan aparat Disbudpar Medan di gedung dewan. Meski topik utama pertemuan membahas tentang Laporan Pertanggungjawaban (LPj) penggunaan anggaran tahun 2009, namun dibahas juga tentang operasional hotel dan tempat hiburan Delta. Komisi C menilai masalah ini juga penting. Rapat hari itu dipimpin Ketua Komisi C Aripay Tambunan. Dia hanya ditemani dua anggota komisi dari 11 orang jumlah personel Komisi C, yakni Herry Zulkarnain dan A-Hie. Sedangkan dari Disbudpar hadir Kadis Rismaria Hutabarat dan tiga orang staf Arjuna Sembiring, Riswan dan Aldi. Komisi C mempertanyakan status tempat hiburan Delta yang terletak di Jalan Ir. H. Juanda karena pada bulan Ramadhan, mereka tetap beroperasi. Padahal sesuai dengan aturan, seluruh tempat hiburan tutup. Belakangan diperoleh informasi kalau izin Delta adalah hotel. Dengan begitu hiburan yang ada di sana boleh beroperasi karena merupakan fasilitas hotel.

Informasi ini, menurut Ketua Komisi C Aripay Tambunan, perlu dikonfirmasikan ke Disbudpar sebagai pemberi izin. Karena dari kasat mata, yang terlihat lebih menonjol di Delta adalah tempat hiburannya (karaoke) dibandingkan hotelnya. ‘’Kalau hanya fasilitas, harusnya yang lebih menonjol itu hotelnya,’’ ujarnya. Keterangan mengejutkan akhirnya diperoleh dari Kadisbudpar Rismaria Hutabarat. Katanya, izin Delta adalah hotel berbintang empat. Maka sesuai aturan, mereka diperbolehkan mengoperasikan tempat hiburannya, karena merupakan fasilitas hotel. Mendengar pernyataan ini, muncul berbagai pertanyaan dari Komisi C. Herry Zulkarnain, langsung mempertanyakan kriteria hotel bintang empat. Menurutnya sangat tidak layak Delta berpredikat bintang empat. ‘’Tempatnya saja di ruko. Saya ragu kalau fasilitas yang dimilikinya benar-benar bintang empat,’’ kata Herry. Menjawab ini, Rismaria Hutabarat mengatakan penetapan

bintang bukan wewenang mereka. Disbudpar hanya bertugas memberikan izin. Status hotel ditentukan oleh Persatuan Hotel dan Restoran Indonesia (PHRI) Sumut. ‘’Merekalah yang berhak memberikan status bintang pada hotel,’’ kata Rismaria. Dalam hubungan dengan PHRI ini, Komisi C juga minta Disbudpar harusnya tidak menerima begitu saja rekomendari yang dikeluarkan PHRI. Karena bila timbul masalah, yang dipersalahkan adalah Disbudpar.Tapi, Rismaria Hutabarat, menjawab kalau mereka sudah pernah meminta agar PHRI melibatkan mereka dalam memberikan status bintang kepada hotel. Sarat permainan Dari pertemuan antara Komisi C dengan Disbudpar, terungkap kesan pemberian izin operasional Hotel Delta, sarat dengan permainan. Malah untuk anggota Komisi C Herry Zulkarnain, kasus ini menjadi aneh. Karena ada pengusaha yang memaksakan bintang hotelnya naik. Umumnya yang terjadi, pengusaha menyebutkan hotel mereka bintang dua tapi fasilitas bintang empat. ‘’Ini terbalik. Kan aneh,’’ katanya. Sementara itu, staf Disbudpar Riswan mengatakan, Delta mengantongi dua izin. Hotel dan tempat hiburan. Itulah yang kemudian pada beberapa waktu lalu terlihat fasilitas hiburan

di Delta telah beroperasi, tapi hotelnya belum. Melihat banyaknya persoalan tidak wajar yang dilihat Komisi C, akhirnya pertemuan itu menyepakati Disbudpar untuk meninjau ulang izin Hotel Delda. Termasuk keberadaannya yang hanya di sebuah bangunan berbentuk ruko. Menurut Aripay Tambunan, Disbudpar tidak bisa lepas tangan dengan hanya menyebut sebagai pemberi izin semata. Sebagai pemerintah, harusnya Disbudpar mempertimbangkan tentang persaingan usaha sejenis. Kata Tambunan, tidak adil kalau izin hotel bintang empat bisa diberikan dengan kepada usaha yang hanya bertempat di ruko. Sementara, untuk yang lain harus mengeluarkan investasi yang sangat besar.‘’Katakanlah Hotel Garuda Plaza. Statusnya hanya bintang tiga. Tapi coba lihat investasinya dibanding Delta yang bintang empat,’’ kata Tambunan. Ditambahkan Aripay Tambunan, harusnya Disbudpar, tidak menerima saja permintaan pengusaha tanpa pertimbangan. Bisa saja itu akal-akalan pengusaha. Seperti yang terjadi sekarang. Saat bulan Ramadhan, mereka bilang fasilitas hotel. Di luar itu mereka mengaku izin tempat hiburan. ‘’Tidak boleh begitu,’’ katanya. (m17)

Cabut Izin Diskotek Etrance Waspada/Ist

SERAHKAN: Ketua Persit Kartika Candra Kirana (KCK) PD l/ Bukit Barisan Ny. Yuni Leo Siegers kepada salah seorang pengungsi.

PP Sumut Bantu Pengungsi Sinabung MEDAN (Waspada): Sebagai rasa kemanusiaan terhadap sesama manusia atas terjadinya letusan Gunung Sinabung, Majelis Pimpinan Wilayah Pemuda Pancasila (MPW PP) Sumut memberikan bantuan kepada masyarakat yang mengungsi, Rabu (1/9). MPW PP Sumut diwakili Sekertaris Koti PP Sumut, Ibnu Abas beserta rombongan mengunjungi para pengungsi di Jambur Taras Berastagi. MPW PP Sumut memberikan bantuan kepada para pengungsi 500 kg beras, 50 baju kaos, mi instan 50 dus dan air mineral. Ibnu Abas mewakili Ketua MPW PP Sumut Anuar Shah mengatakan, pihaknya turut prihatin atas musibah dialami masyarakat Karo, khususnya warga yang bermukim di kaki Gunung Sinabung yang kini mengungsi. “Bantuan ini merupakan bentuk kepedulian PP,” kata dia. Setelah memberikan bantuan, rombongan menuju Jambur Lige, Kabanjahe. Di situ MPW PP Sumut juga PP Kabupaten Karo memberikan bantuan kepada warga berupa 12 karung beras, 61 kotak air mineral dan telur 4 papan. (m11)

Waspada/Ist

MPW PP Sumut memberikan bantua kepada korban meletusnya Gunung Sinabung, di Jambur Taras, Berastagi, Rabu (1/9).

A5

MEDAN (Waspada): Diduga menampilkan penarik seksi dan beroperasi saat bulan Ramadhan, Dinas Kebudayaan dan Parawisata (Disbudpar) Sumut didesak mencabut izin operasional Diskotek Etrance di Jalan Raden Saleh Medan. Desakan itu datang sejumlah elemen pemuda antara dari Wakil ketua DPD Ikatan Pemuda Karya (IPK) Andhy P Nainggolan. Katanya, kegiatan di tempat hiburan malam itu, selain melanggar norma agama dengan menampilkan sajian penari seksi berpakaian sangat minim, juga berlangsung hingga dini hari. “Kita telah lakukan investigasi dan diskotek itu ternyata

buka hingga dini hari, dan ironisnya lagi, menampilkan penari erotis,” seru Andhy kepada wartawan, Minggu (5/9). Padahal berdasarkan surat edara Gubernur Sumatara Utara Syamsul Arifin menyatakan bahwa selama bulan suci Ramadhan, semua tempat atau lokasi hiburan malam seperti, karaoke, pub, diskotik dan bar atau sejenisnya di Sumatera Utara harus dihentikan atau ditutup. Gubsu juga menegaskan apabila kedapatan melanggar, pihak kepolisian akan langsung mencabut ijin operasionalnya. Di mana ketentuan tersebut harus dipatuhi oleh semua pihak tanpa terkecuali. “Terhadap surat edaran itu,

sudah disalurkan ke seluruh bupati/walikota di Sumut untuk menutup tempat-tempat hiburan malam selama bulan suci berlangsung. Terhadap pelanggaran atas ketentuan tersebut, diminta aparat kepolisian untuk mencabut izinnya,” terangnya. Terkait operasional tempat hiburan malam yang ada di hotel-hotel berbintang, seperti JW Marriott Medan, Grand Aston dan hotel lainnya, Gubsu juga menegaskan peraturan itu juga harus diberlakukan. Hal senada juga dikemukakan Wakil Ketua DPW GP Ansor Sumut Sutrisno. Menurutnya, kalau memang hal itu terjadi, maka pemerintah khusunya

Dinas Prawisata harus segera mencabut izin tempat hiburan malam yang melanggar kaidah agama. Karena hal itu berekses pada rusaknya moral dan budaya bangsa. Diaman Indonesia dikenal dengan budaya ketimurannya yang cukup kental. Dan kalau ini dibiarkan dikhawatirkan akan merusak moral para pemuda masa depan bangsa. Sementara pengurus HMI Sumut Zainal Arifin mengingatkan, kalau pemerintah dalam hal ini dinas parawisata terkesan terkesan tutup mata dengan persoalan moral bangsa, maka kedepannya, pihaknya akan melakukan gerakan turun ke jalan guna mempercepat proses pencabutan izin tersebut. (h05)

IJTI Beri Pelatihan Dasar Jurnalistik Televisi Kepada Mahasiswa MEDAN (Waspada): Desentralisasi penyiaran yang merupakan konsekuensi dari pemberlakuan Undang-undang penyiaran No. 24/1997 dan diubah dengan UU No.32/2002 secara tidak langsung membuka peluang sekaligus tantangan bagi para profesional di bidang broadcasting (penyiaran) di daerah. “Akan banyak tumbuh lembaga-lembaga penyiaran lokal yang diharapkan diisi para profesional daerah nantinya,” ujar Eddy Iriawan, Ketua Pengda Ikatan Jurnalis Indonesia (IJTI) Sumatera Utara saat membuka Pelatihan Dasar Jurnalistik Televisi bagi mahasiswa di Aula Dinas Kominfo Provinsi Sumatera Utara Sabtu pekan lalu. Di hadapan sekitar 40 peserta pelatihan, Eddy menjelaskan, secara teknis sedikit ada perbedaan antara jurnalistik siaran (broadcasting journalism) dengan jurnalistik cetak

(printed journalis). Karenanya kemampuan secara teknis jurnalistik penyiaran sangat dituntut sejak dini dikuasai para mahasiswa. Apalagi kini ada trend kecenderungan mahasiswa yang ingin terjun di bidang jurnalistik cukup besar saat ini. Sebagai wadah para jurnalistik televisi, IJTI Sumut menurut Eddy mempunyai tanggung jawab moral untuk membagi pengalaman dan kemampuan jurnalistik televisi para anggotanya kepada para mahasiswa. “Mengapa kita harus merekrut tenaga jurnalis tv dari luar daerah kalau kemampuan para mahasiswa jebolan kampus di Sumut mampu menjalankannya,” tegas Eddy lagi. Namun untuk mencapai kemampuan profesional tersebut, mahasiswa tidak bisa hanya mengandalkan keinginan besar tanpa dibekali kemampuan teknis dan etika yang

betul. Melalui pelatihan dasar inilah diharapkan para mahasiswa bisa menyaring seluruh model pelatihan yang disiapkan IJTI untuk bekal terjun di dunia nyata jurnalistik nantinya. Dalam pelatihan dasar satu hari penuh ini, sedikitnya 40 peserta yang terdiri dari para mahasiswa Universitas Negeri Medan (Unimed) dan Universitas Sumatera Utara (USU). Selain kalangan mahasiswa, pelatihan ini juga diikuti para awak penerbitan pers kampus seperti Suara USU. Beberpa pemberi materi di antaranya Pudji Santo (Metro TV). Pudji Santoso lebih menyoroti perkembangan jurnalistik televisi di Indonesia yang terbilang relatif baru dibanding jurnalistik cetak. Sementara Agus Supratman (Trans TV) dan Cuk Arbianto (SCTV) menyuguhkan materi teknik pengambilan gambar. Sementara Yu-

dhistira (SCTV ) dan Ahmad Zulfikar Sagala (MNC Grup) memberikan pencerahan bagaimana menulis berita televisi. Para mahasiswa yang mengikuti pelatihan dasar ini mengaku mendapat banyak pengalaman berharga untuk nantinya bisa terjun di dunia jurnalistik televisi. Namun para peserta berharap, IJTI Sumut bisa menambah modul pelatihan dengan memberikan kesempatan para peserta terjun ke lapangan langsung meliput sebuah peristiwa. Menyikapi permintaan ini, IJTI Sumut memastikan akan melanjutkan pelatihan dasar ini dengan pelatihan lanjutan.“Kita sedang mempersiapkan modul permanen pelatihan jurnalistik dari mulai dasar, lanjutan hingga mahir,” jelas Ahmad Zulfikar Sagala, Ketua Bidang Diktlat IJTI Sumut menutup sesi tanya jawab dalam pelatihan ini. (m08)

MEDAN (Waspada) : Yayasan Sosial Angsapura (Yasora) menyalurkan bantuan sembako kepada ratusan warga di sekitar sekretariat Yasora Jl. logam Medan. Bantuan ini merupakan agenda rutin telah dilakukan Yasora sejak tahun 1991 dan hampir 20 tahun,” sebut Ketua Umum Yasora Hakim Tanjung didampingi Sekum Eddy Iskandar, Ketua Bidang Sosial Pendi dan KTU Hasan Basri di sela-sela penyerahan bantuan, Rabu (1/9). Kata dia, Yasora sebagai lembaga sosial berupaya sebaik mungkin membantu masyarakat membutuhkan, kali ini pihaknya menyalurkan bantuan kepada 250 kepala keluarga di sekitar sekretariat Yasora. Bantuan yang disalurkan antara lain beras 10 kg, mie instan 1 kotak dan gula 20 kg. Selain kepada warga kurang mampu, pada saat yang sama juga diserahkan bantuan beasiswa kepada 9 anak yatim piatu. Bantuan sembako juga disalurkan kepada pengurus masjid dan 113 orang pegawaiYasora,secara simbolis diserahkan langsung Ketua UmumYasora Hakim Tanjung. Beberapa warga menyatakan sangat terbantu dengan sumbangan dari Yasora. Mereka berharap agar kegiatan ini terus berlanjut setiap tahunnya. Selain itu kegiatan yang sama juga dilaksanakan Yasora yakni menyalurkan santunan hari raya kepada 9 panti asuhan disekitar kota Medan. Bantuan berupa 60 kg beras, 50 kg kacang hijau dan gula pasir 50 kg. Bantuan ini diantar langsung kepada panti asuhan AlJamiyatul Washliyah, AlWashliyah Gedung Johor, AlWashliyah KL.Yos Sudarso, Darul Aitam Aceh Sepakat, Mamiyai Al Ittihadiyah, Muhammadyah Putera, Muhammadyah Putri, Zending Islam Indonesia dan Pembangunan Didikan Islam. Bersamaan dengan perayaan ritual sembahyang di pekuburan Sibiru-biru, Yasora juga memberikan batuan kepada masyarakat di sekitar perkuburan tersebut. Bantuan diberikan kepada 265 kepala keluarga, berupa 10 kg beras, 1 kotak mie instan dan 2 kg gula. (m32/rel)

PKB Pakpakbharat Santuni Anak Yatim Dan Jompo MEDAN (Waspada): Anggota dewan dari Partai Kebangkitan Bangsa (PKB) Pakpakbharat, Juanda Banurea bersama Ketua DPW PKB Sumut, Drs. Ance Silian memberikan santunan kepada anakanak yatim dan para jompo, di Pakpakbharat, kemarin. Kegiatani ini merupakan bagian dari kepedulian anggota DPRD Pakpakbharat dari PKB, sehingga apa yang dirasakan oleh masyarakat dapat dirasakan juga. Kendatipun, anggota dewan, Juanda Banurea merupakan non muslim, tetapi rasa kemanusiaan tetap berjalan di bulan suci ramadhan. “Ini selalu dilakukan di dalam menyambut bulan suci ramadhan dan tahun baru. Mudah-mudahan kerukunan di tengah-tengah masyarakat secara umum Sumut dan terkhusus Pakpakbharat tetap terjalindenganbaik,”ujarJuandaBanurea,kepadawartawandiMedan. Dia berharap, kerukunan umat beragama harus tetap menjadi prioritasdalamberbangsadanbernegara.Sebab,diaselalumemandang semua masyarakat di Pakpakbharat adalah saudara. Tidak ada perbedaan di antara satu dengan lainnya. Banurea mengharapkan, kepada kawan-kawan yang ada belum dapat berbagi rasa, itu tidak ada unsur kesengajaan, tetapi disebabkan keterbatasan yang ada. Sementara,KetuaPKBSumut,AnceSilianmengimbaujugakepada masyarakat agar kerukunan selalu tetap di jaga. “Berbagi rasa dan rejeki kepada masyarakat merupakan sebuah kemuliaan. Mudahmudahan apa yang diberikan mendapat ganjaran yang setimpal dari tuhan. Inilah bukti dari kepedulian kita terhadap anak-anak negeri ini,” ujar Ance. Menurut Ance Silian, agar kader-kader di daerah tersebut kiranya selalu dijaga dan dibina dengan baik, sehingga terjalin silaturahmi yang baik. Selain itu, menurut Ance, Banurea juga sudah mengunjungi masyarakat korban gunung merapi Sinabung serta memberikan bantuan ala kadarnya kepada masyarakat setempat di pengungsian. Sedangkan DPW PKB Sumut juga sekaligus melakukan safari ramadhan ke daerah tersebut serta mengelilingi daerah Dairi, Pakpakbharat dan Karo. “Mudah-mudahan apa yang dilakukan ini setidaknya bermaanfaat bagi semua masyarakat yang ada,” ujar Ance Silian. (m41)

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight

Pukul

Tiba Dari

Flight

Pukul

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-146 11 Jakarta GA-041 12 Jakarta GA-043

06.25 09.05 10.55 12.25 13.45 15.45 17.10 18.10 19.10 14.45 09.45 15.15

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Jakarta Jakarta

GA-180 GA-182 GA-184 GA-186 GA-148 GA-188 GA-190 GA-192 GA-196 GA-147 GA-040 GA-042

06.10 08.00 09:30 10.50 11.50 12.50 14.10 16.15 19.35 18.10 09.15 17.30

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6. Penang 7 Surabaya 8 Bandung 9 Jakarta 10 Jakarta 11 Jakarta 12 Phuket (3,5,7)

08.50 09.40 18.00 20.10 10..05 18.25 08.40 08.40 12.20 13.30 18.40 17.45

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Surabaya Bandung Jakarta Jakarta Jakarta Phuket (3,5,7)

AK-936 QZ-8055 AK-456 AK-938 QZ-8073 QZ -5836 QZ .7610 QZ- 7486 QZ-7496 QZ-7502 QZ-7504 FD-3990

08.25 11.55 17.40 19.40 09.33 18:00 08.25 0815 19.15 13.05 15.40 17.15

RI-088

15.45

AK- 937 QZ- 8054 AK- 457 AK-939 QZ-8072 AK 5837 QX- 7611 QZ -7487 QZ-7497 QZ-7503 QZ-7505 FD-3991

MANDALA AIRLINES 1 Padang RI 089

17.20

Padang

LION AIR 1 Jakarta JT- 381 2 Jakarta JT- 397 3 Jakarta JT- 301 4 Jakarta JT- 395 5 Jakarta JT- 303 6 Jakarta JT- 399 7 Jakarta JT- 383 8 Jakarta JT- 385 9 Jakarta JT- 387 10 Jakarta JT- 305 11 Jakarta JT-309 12 Batam/S.baya JT-972 13 Banda Aceh JT-396 14 Penang JT-1280 15 Penang JT-1282 16 Penang JT-1286 17 Sibolga 1,3,5,7 JT-1254 18 Meulaboh 2,4,,6,7 JT-1252 19 L.Seumawe 2,4,5,7 JT -1250 20 Gunung Sitoli JT-1260 21 Gunung Sitoli JT-972

06.30 09.00 10.00 11.00 12.00 13.45 15.35 17.05 18.35 21.15 22.25 12.55 19.35 07.10 09.50 15.30 13.50 11.28 08.50 12.35 12. 55

MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.25

Kuala Lumpur MH-860 Kuala Lumpur MH-864

08.25 14.45

SILK AIR 1 Singapura 2 Singapura

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Batam/S.baya Banda Aceh Penang Penang Penang Sibolga 1,3,5,7 Meulaboh 2,4,6,7 L.Seumawe 2,4,6,7 Gunung Sitoli Gunung Sitoli

JT-380 08.20 JT-398 09.20 JT-394 10.20 JT-302 11.20 JT-398 10.45 JT-382 13.05 JT-384 14.55 JT-396 16.25 JT-306 19.35 JT-386 21.35 JT-308 23.20 JT-971 12.20 JT-397 08.20 JT-1281 09.20 JT-1283 12.05 JT-1287 17.56 JT-1256 15.40 JT-12.53 13.25 JT-1251 10.55 JT-1261 08.15 JT-973 14.40

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

08.30 20.45

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

07.50 20.00

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Batam

7P-592 7P-598 7P-594 7P-596 7P-568

10.10 12.50 15.50 19.10 13.00

Jakarta Jakarta Jakarta Jakarta Batam

7P-591 7P-597 7P-593 7P-595 7P-567

09.35 12.15 15.15 18.25 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-017 SJ-035 SJ-041 SJ-010 SJ-102 SJ-021

10.20 15.30 19.10 15.05 15.20 11.30 07.20 16.00

Jakarta Jakarta Jakarta Jakarta Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-014 SJ-034 SJ-140 SJ-140 SJ-103 SJ-020

11.50 18.35 20.15 14.30 15.25 14.20 09.35 14.45


A6

Semarak Ramadhan Ustadz H. Azhari Akmal Tarigan

Idiom-idiom Kepedulian Yang Terlupakan TELAH menjadi rahasia umum bahwa di zaman kemerdekaan banyak juga anak negeri ini yang berkhianat. Kooperatif terhadap para penjajah agar memperoleh fasilitas dan kesenangan, meskipun berkhianat kepada bangsa yang mengalami penderitaan dalam perjuangan. Akan tetapi para pejuang yang konsisten selalu mendengar suara hatinya untuk tidak saja mencari kesenangan dan fasilitas dirinya dan tidak peduli pada nasib anak negeri yang hampir makan tanah. Keadaan yang kurang lebih sama kita alami juga saat sekarang ini; adanya anak negeri yang karena ingin mendapatkan kesenangan atau fasilitas dari pihak asing lalu menerapkan kebijakan atau menerapkan sistem ekonomi atau sosial atau apapun namanya yang hanya berpihak pada segelintir orang, dan tak perduli pada nasib rakyat yang hari demi hari kian melarat dan menyedihkan. Para pejuang negeri ini telah menggadaikan harta, tenaga, dan bahkan jiwa mereka karena kepedulian mereka terhadap sebuah bangsa yang bernama Indonesia, dan sebagai konsekwensi dari malakah (karakter) bangsa itu maka saat inipun kita butuhkan pra pemimpin dan tokoh yang memiliki kepedulian ; mereka mau berjuang karena peduli, mau capek karena peduli, kurang tidur karena peduli, dan bahkan rela lapar karena peduli. Karakter peduli yang dimiliki anak negeri gayung bersambut dengan idiom-idiom kepedulian yang diajarkan oleh Islam, agama yang dianut oleh mayoritas anak negeri. Namun karena brondong matrealisme dan pragmatisme yang membrondong anak-anak negeri ini, akhirnya idiom-idiom kepedulian itu sering terlupakan dan bahkan terabaikan hingga karakter kepedulian kita menjadi mati rasa. Puasa Ramadhan meminta kita untuk menghidupkan kembali kesadaran kepedulian itu. Hari-hari berlalu (al-ayyam) selama Ramadhan meminta kita untuk menginternalisasi idiom-idiom kepedulian yang diajarkan agama ini yang sungguh mengesankan” “Kalau shalat yang kita kerjakan dimulai dari takbir, mengkonstrasikan diri untuk menyembah dan mengagungkan Allah, maka shalat diakhiri dengan salam dengan menoleh ke kanan dan ke kiri sebagai simbol kepedulian pada lingkungan dan kondisi yang ada di sekitar. Kalau di dalam tahiyyat seorang yang shalat mengucapkan shalawat dan salam pada Rasul maka sejajar dengan itu ia diminta untuk mengucapkan salam kepada manusia lain. Jika seseorang mendapat rezeki dari Tuhannya maka pada saat yang sama dia diminta untuk menyadari bahwa pada hartanya ada hak fakir miskin. Begitu pentingny kepedulian itu hingga seorang yang membagi bukaannya kepada orang lain akan memperoleh pahala sebagaimana pahala orang yang menerimanya tanpa mengurangi pahala yang menerima. (Al-Hadis). Karekter hakiki dari seorang muslim dalam kaitannya dengan kepemilikan apapun, adalah kesadarannya bahwa dia bukan pemilik hakiki dari apa yang ada padanya. Pemilik hakiki adalah Allah, dia hanya media yang memiliki hak distributif, sebagai pembagi. Dilihat secara demikian maka puasa Ramadhan merupakan saat “opname”’ rawat nginap bagi kepedulian kita yang sudah mati rasa. Melalui Ramadhan Allah memberitahu bahwa kita tidak boleh besenang-senang di atas penderitaan orang lain. “Terkutuklah para pemimpin yang menjual rakyat untuk popularitas dan keuntungan pribadinya” (Al-Hadis). Puasa Ramadhan seakan meminta kita untuk me.ngakhiri cara hidup boros ditengah rakyat yang kekurangan. Bahkan adalah suatu kezaliman bila kita masih tega makan enak sementara tetangga kita dalam kondisi lapar. Dengan begitu maka kita akan dapat mengembalikan karakter kita sesungguhnya, masyarakat Indonesia sebagai masyarakat peduli”. Wallahu a’lamu bi al-shawab

Zakat Dan Tangung Jawab Individu Dan Sosial ZAKAT merupakan salah satu rukun Islam yang menjadi kewajiban bagi setiap muslim melaksanakannya sesuai dengan ketentuan syari’at. Seperti juga ibadah Islam lainnya, zakat memiliki peran dan fungsi ganda, di antara individu dan masyarakat. Sebagai tanggung jawab individu, zakat memiliki beberapa peran, yaitu: a. Sebagai bentuk perwujudan keimanan seorang muslim yang diaplikasikan dengan pelaksanaan ajaran agama yang dalam hal ini zakat. Sesuai dengan hadits tentang kewajiban zakat, dengan berzakat seseorang telah membuktikan diri sebagai mukmin (orang beriman) sekaligus Muslim (orang yang Islam). Dengan dua gelar ini seseorang memiliki hak mencapai kebahagiaan dunia dan akhirat. b. Sebagai sarana pembersihan diri bagi yang mengeluarkan zakat, sebagaimana firman Allah SWT yang artinya: “Ambillah (zakat) dari harta mereka (orang kaya) sebagai zakat dan pembersih jiwa mereka” (Q.S. at-Taubah: 103). Dalam kesehariannya manusia tidak bisa melepaskan diri dari noda dan dosa sekecil apapun. Imam Ghazali mengibaratkan hati laksana cermin yang jernih, setiap kali melakukan dosa cermin itu ternoda, semakin banyak dosa semakin hitamlah kaca tersebut, dan akhirnya gelap dan hitam. Di sinilah peran zakat untuk membersihkan cermin sehingga jernih kembali dan pada saat ini mampu menangkap cahaya nur Ilahi kembali. c. Sebagai media mendekatkan diri kepada Allah. Sebagai Yang Suci, Allah hanya bisa didekati mereka yang suci. Ketika kesucian menjadi ciri orang berpuasa maka ketika itu ia memiliki kesempatan mendekatkan diri kepada Allah, sebagai salah satu keinginan ideal setiap umat Islam. Sedangkan sebagai tanggung jawab sosial, zakat berperan sebagai upaya pemberian pembelaan (advokasi) terhadap kaum lemah (fakir miskin). Pembelaan dilakukan, karena merupakan suatu kewajiban (dignity) bukan hanya sekedar belas kasihan (charity). Dalam kaitan ini Allah menetapkan delapan kriteria yang berhak menerima zahat, dua yang pertama ialah faqir dan miskin. Adanya kaya miskin adalah menjadi realitas hidup yang selalu hadir dalam kehidupan manusia. Islam dengan sistem ajarannya yang lengkap tidak membiarkannya tetap eksis, di sinilah zakat berperan. Zakat diharapkan akan mampu menguranginya, jika belum terhapuskan akan dilanjutkan dengan pemberian infaq dan shadaqah. Agar peran ini dapat berjalan maksimal dibutuhkan kesadaran penuh umat Islam tentang pelaksanaan zakat, tidak hanya kewajiban melainkan tanggungjawab dan kebutuhan, yaitu kebutuhan untuk mewujudkan harmoni sosial yang adalah kebutuhan manusia. Berkaitan dengan harmoni sosial itu secara langsung atau tidak peran negara atau penguasa sangat dibutuhkan. Negara berhak memberikan sedikit tekanan agar masyarakat mau membayar zakatnya, sesuai dengan teks ayat yang menggunakan kata “khuz” yang berarti ambil. Posisi Nabi sebagai pemimpin agama dan negara (risalah dan khilafah) ketika diperintahakan mengambil berarti dengan menggunakan dua kekuatan tersebut.

Orang Khusnul Khotimah Miliki Dead Instink Kuat MEDAN (Waspada): Ustadz H Azhari Akmal Tarigan, mengatakan orang-orang yang khusnul khotimah memiliki kepekaan (kejelian) dalam dead instink (firasat) yaitu tentang firasat kematian. Tarigan menyampaikan kulibas (kuliah lima belas menit) Ramadhan 1431H, dengan tema “bebas dari dosa sosial” usai buka puasa bersama keluarga besar Dinas Bina Marga Sumut di Mushalla Baitussalam Jalan Sakti Lubis Medan, Sabtu 4/9) malam. Hadir Kadis Bina Marga Provsu H.Marapinta Harahap, Sekretaris H.Johan Samose Harahap, Ketua PHBI M.Riduan, S.Sos,MAP, M. Haldun, bendaharawan M.Yunus Hanis Siregar, H. Amir Effendi Hasibuan, H.Ulam Raya Hutagalung, Kepala UPRPJJ Medan H. Tobrani, M.Husni, Iswahyudi, serta staf,

pegawai dan ibu-ibu Dharma Wanita jajaran Dinas Bina Marga Provsu. Kata Tarigan, selain itu orang-orang yang khusnul khotimah, jika meninggal dunia tidak meninggalkan utang piutang (memberi wasiat kepada keluarga sebelum meninggal dunia). Seperti Nabi Muhammad SAW walau dalam keadaan sakit pun tetap berpesan kepada keluarga, istri maupun para sahabat. Tapi Nabi hanya sering sakit pada kepalanya dan badannya panas. Sedangkan obatnya tidak harus pergi ke dokter seperti saat sekarang ini. Hanya dengan

Mukimin Buka Puasa Bersama Anak Yatim Dan Fuqoro MEDAN (Waspada): Mukimin Polonia Hotel Medan menyelenggarakan acara berbuka puasa bersama 450 anak yatim dari berbagai kawasan kota Medan dan kaum fakir miskin (fuqoro wal masakin), Jumat (3/9). Ketua F.PPP DPR RI Drs H Hasrul Azwar, MM, menyebutkan, tahun ini dana yang terkumpul dari para donatur yang merupakan kalangan mukimin Polonia Hotel ini berjumlah Rp 135 juta. Dengan jumlah itu, maka sanak yatim yang diundang akan memperoleh santunan sekitar Rp 300.000 setiap orang. Tidak disebutkan nama-nama donatur penyantun anak yatim tersebut, sebab katanya, kegiatan dan sumbangan ini dilakukan berdasarkan keikhlasan semata. “Yang jelas nama-nama dan amal mereka tentu sudah dicatat oleh Allah SWT,” ujar Hasrul. Kegiatan ini sudah dilakukan sejak delapan tahun yang lalu, untuk berbagi rasa dan suka para mukimin dengan para anak yatim dan fakir miskin. Para mukimin yang bernasib lebih mujur menyisihkan sebagian rezekinya dan dikumpulkan bagi kepentingan menyantuni anak yatim ini. Selain Drs H Hasrul Azwar MM dan HY Sir, tampak hadir antara lainWakilWalikota Medan Drs H Dzulmi Eldin, MM, Bupati Serdang Bedagai Ir HT Erry Nuradi, Rektor Unimed Prof Dr Syawal Gultom, MPd bersama PR II Unimed Drs Chairul Azmi, MPd. Kakan Kementerian Agama Medan H Abdul Rahim M.Hum menutup acara dengan doa.(rel/m10)

kompres sudah bisa sembuh. Kemudian isyarat lainnya kondisi yang kuat. Masih kata Tarigan, dosa pribadi hanya bisa ditutupi dengan kesolehan pribadi, antara lain dengan shalat tahajjud, bersedekah, menyantuni anak yatim, fakir miskin, kaum duafa. Sedangkan untuk menghapus dosa sosial, kita harus mencari orang-orang yang pernah kita sakiti hatinya dengan memohon maaaf (hablum minannas). Seperti pesan Nabi Muhammad SAW, berbunyi : ikuti perbuatan burukmu dengan perbuatan yang baik. Santuni anak yatim, fakir miskin maka itulah amalan yang paling hebat, ini tidak bisa dilakukan oleh Malaikat kecuali manusia. “Jadi apa yang telah dilakukan Dinas Bina Marga Provsu pada setiap hari Jumat malam bulan Ramadhan dengan menyantuni anak yatim, dan fakir miskin dengan memberi makan merupakan amal yang yang luar biasa dan akan mendapat ganjaran pahala berllipat ganda dari Allah SWT di yaumil mahsar. Apa yang diperbuat Dinas Marga Provsu pasti

diganti Allah,” kata Tarigan yang juga kolumnis rubrik Mimbar Jumat di Harian Waspada. Kemudian Nabi Muhammad menganjurkan, agar pergauliah manusia dengan cara yang baik. Saling bertegur sapa, berilah senyum kepada sesama manusia. Karena kita sebagai manusia derajatnya sama di mata Allah yaitu berasal dari setetes air mani, maka kita tidak boleh sombong, lagak, lantam, arogan, sok yang satu saat akan dipanggil Allah SWT dan kembali juga ke tanah. Anjuran lainnya adalah jangan meninggalkan utang piutang karena akan dibawa ke akhirat. Dan meninggalkan keluarga, anak-anak, cucu dalam keadaan utuh. Marikitabersihkandosasosial dan dosa pribadi kita agar memperoleh kedamaian dan ketenangan apbila kita telah sampai di yaumil mahsar nantinya. Ketua PHBI Kantor Dinas Marga Provsu M.Riduan, S.Sos, MAP menambahkan, usai buka puasa dilanjutkan dengan shalat maghrib, Isya berjamaah dan tarawih, dengan imam H.Azhari Akmal Tarigan dan bilal Heriadi Kudadiri,ST.(m25)

Waspada/ME Ginting

Para karyawan Astra Group membagi-bagikan bingkisan Ta’jil kepada para pengendara kendaraan yang berbuka puasa di jalan.

Astra Group Bagi Ribuan Paket Ta’jil MEDAN (Waspada): Astra Group Medan mengadakan kegiatan bagi-bagi ribuan paket Ta’jil kepada pengendara kendaraan roda dua dan empat yang berbuka puasa di jalan. Kegiatan diadakan di dua titik yakni di Jalan Gatot Subroto depan kantor Astra Rent a Car (Trac) dan depan kantor United Tractors Jalan Sisingamangaraja Medan, Jumat (3/9), dilanjutkan buka puasa bersama sesama karyawan. Ketua Panitia Teuku Edi Syahputra yang juga Head Regional Office Sumatra Astra World didampingi Head of Administration Dwi Martono M dan Branch Manager Toyota AUTO 2000 Medan Amplas T Martogi S mengatakan, kegiatan tersebut sebagai bentuk kecil perwujudan misi perusahaan yaitu “menjadi milik yang bermanfaat bagi bangsa dan negara” bahwa semangat berbagi dan ingin menjadi salah satu aktifitas perusahaan-perusahaan yang tergabung dalam Astra Group. “Artinya kita ingin berbagi dengan masyarakat yang berbuka puasa di jalan karena tidak semua sempat buka puasa bersama keluarga di rumahnya. Kegiatan seperti ini baru tahun ini dilakukan. Kalau tahun-tahun sebelumnya kita berbagi dengan anak-anak panti asuhan dan lainnya,” kata Edi Syahputra.(h10)

STAL Pomdam I/BB Santuni Anak Yatim MEDAN (Waspada): STAL (Instalisasi Tuna Tertib Militer (STAL) Pomdam I/BB menyantuni anak yatim dari pondok pesantren Al-Wasliyah Kampung Lalang Sunggal, sekaligus buka puasa bersama dan peresmian pemakaian tempat wudhuk dan tempat shalat di Masjid At-Taubah yang baru selesai dikerjakan, berlangsung di lokasi TARA Masmil (Kemasyarakatan Militer) Jalan Binjai Medan, Sabtu (4/9). Kepala Instalisasi Tuna Tertib Militer (KA STAL) Pomdam I/BB Kapten CPM Muhammad Basuki selaku ketua panitia dan penggagas kegiatan, mengatakan acara ini semata-mata lebih terfokus sebagai ajang silaturrahmi sesama jajaran Pomdam I/BB khususnya serta anak yatim dan para pesantren (warga binaan TNI) yang sedang menjalani proses hukum di TARA Masmil Medan. M. Basuki mengucapkan terimakasih kepada semua pihak yang telah memberikan bantuan moril maupun material karena Masjid At-Taubah dapat dipergunakan sebagai tempat ibadah maupun kegiatan lainnya terutama pembinaan rohani bagi tahanan sementara (TARA). Ustadz Drs.Sabam Sabaruddin Situmorang,S.Ag dalam tausyiahnya dengan tema “detik-detik jelang akhir Ramadhan”, mengatakan, awal Ramadhan suasana Masjid penuh dengan jamaah namun pada Ramadhan mendekati

akhir jamaah banyak yang sibuk. Berakhirnya Ramadhan nanti menangislah yang dilangit dan dibumi karena Ramadhan berkesan mengkaji makna apa sebenarnya dibalik Ramadhan yang penuh berkah dan ampunan tersebut. Dengan Iqra’ (membaca) mengejar ilmu Ramadhan telah melatih kita, bukan kita yang melatih Ramadhan. Apa action yang telah kita perbuat dibulan Ramadhan, jika kita memakai Iqra’ maka akan kita perolah nikmat. Maka jika kita sudah mengetahui tauhidnya dalam menanggapi masalah apapun tidak akan stres, karena mental kita sudah ditempa lewat berpuasa dibulan Ramadhan, ujar

Konsultasi Zakat Diasuh Oleh:

Ustadz H. Muhammad Nuh (Dewan Syari’ah LAZ Peduli Ummat Waspada)

Zakat Dan Pajak Tanya: Assalamu’alaikum Wr.Wb. Ustadz, saya mau bertanya: Kita ada usaha yang sudah berjalan bertahun-tahun. Persoalannya, selama ini kita terkena dua beban : bayar zakat dan bayar pajak. Apa boleh kita bayar pajak saja yang juga diniatkan bayar zakat? Terima kasih. (Taufik) Jawab : Wa’alaikumussalam Wr.Wb. Pak Taufik yang berbahagia, kita bersyukur kepada Allah SWT.bahwa pak Taufik sukses berusaha. Semoga Allah SWT.melimpahkan keberkahanNya kepada Bapak sekeluarga dan kita semua. Amin. Terkait dengan Zakat dan pajak, memang ada persamaan dan ada juga perbedaannya. Persamaan antara Zakat dan Pajak : 1. Unsur paksaan dan kewajiban yang merupakan cara untuk menghasilkan pajak, juga terdapat dalam zakat. 2. Orang yang menunaikan zakat dan pajak, sama-sama tidak boleh mendapatkan imbalan tertentu. 3. Pajak di zaman modern mempunyai tujuan kemasyarakatan, ekonomi dan politik, maka zakatpun memiliki tujuan yang lebih luas. Adapun perbedaan antara zakat dan pajak cukup mendasar, di antaranya: 1. Hakikat dan tujuannya, zakat adalah bagian dari ibadah kepada Allah SWT.sedangkan pajak hanya kewajiban warga kepada Negara. 2. Batas minimal, dalam zakat ada nishab yang sudah ditentukan oleh Rasulullah Saw.dan tidak ada yang berwenang untuk mengubahnya, sedangkan dalam pajak penetapan dan perubahan ketentuan dan kadarnya sangat tergantung pada kebijakan penguasa. 3. Zakat bersifat terus menerus, dengan keterlibatan pemerintah ataupun tidak, sementara pajak sangat tergantung pada kekuatan pemerintah dalam penerapannya. 4. Zakat hanya diperuntukkan bagi delapan kelompok mustahiq sebagaimana disebutkan di surah At-Taubah/9:60, pajak digunakan untuk membiayai pengeluaran umum Negara sebagaimana ditetapkan oleh penguasa. 5. Zakat merupakan bukti keimanan dan keislaman seseorang yang mempunyai pengaruh duniawi dan ukhrawi, pajak hanya sebagai bukti warga yang baik dan tidak punya pengaruh ke akhirat. Jadi, sebagai Muslim yang baik kita berkewajiban menunaikan zakat, dan sebagai wargaa Negara yang baik kita juga harus membayar pajak. Peraturan dan perundangundangan kita menyebutkan bahwa zakat dapat mengurangi pendapatan kena pajak. Kini sedang berlangsung pembahasan di DPR RI untuk merevisi Undang-undang No.38 tahun 1999 tentang Pengelolaan Zakat. Harapan kita ke depan agar zakat dapat mengurangi pajak sehingga bagi kita kaum Muslimin tidak terkena kewajiban ganda seperti sekarang.Wallahu a’lam. LAYANAN JEMPUT ZAKAT (Khusus Kodya Medan): 08126375062 Pembayaran ZIS via Bank Zakat Infak/Sedekah BMI 211.00044.15 BMI 211.00002.15 BSM 006.002240.7 BSM 006.000832.1 BNI Syariah 0092687629 BNI 005.7504808 BCA 022.1750828 Bank Sumut 100.02.04.034144.5 Bank Mandiri 106.000220380.3

MTS Muallimin Univa Salurkan Zakat Fitrah Kepada Mustahiq MEDAN (Waspada): Selama ini proses pembelajaran disekolah lebih diorientasikan pada teori bukan pada aplikasi dan aktualisasi, terutama yang berkaitan dengan bidang fikih yang membahas tentang zakat fitrah. Banyak murid telah menyerap ilmu yang telah ditransfer gurunya, bahkan banyak para murid memiliki nilai Rapot tinggi, namun sudahkah mereka bisa mempraktikkan dalam kehidupan sosial. Untuk itulah MTS Muallimin Univa melaksanakan Program penyerahan zakat fitrah 1431 H/2010 M. Kepala Madrasah Tsanawiyah Muallimin Universitas Al Washliyah (Univa) Medan Drs. Sutrisno, SH mengatakan , pada acara penyerahan zakat fitrah di ruang Madrasah MTS Muallimin UNIVA, Sabtu ( 28/8) lalu. Selain itu, dengan dilaksanakannya penyerahan aakat fitrah kepada Mustahiq secara langsung, para murid dapat mempraktikkannya dan tidak hanya diingat dalam hafalan semata”. Penyerahan zakat fitrah dilakukan secara simbolis kepada perwakilan Mustahiq (wali murid yang kurang mampu ) oleh Kepala MTS Muallimin Univa Drs. Sutrisno, SH dan ketua pelaksana penyaluran zakat fitrah 1431H/2010 M ustadz Drs Abdul Aziz, disaksikan perwakilan dari Biro Rektor Univa Agusman Damanik dan guru MTS Muallimin ustadz Drs H. M. Idris Yusuf,BA dan Muhayyan, S.Hi, S.Pdi. Zakat fitrah yang terkumpul berasal dari para wali Murid yang mampu sebanyak 566,6 Kg Beras untuk disalurkan kepada 40 orang Mustahiq. Penyaluran zakat fitrah MTS Muallimin Univa tahun 1431 H/2010 M selain berdasarkan Mazhab Syafii juga telah mendapat persetujuan Kantor DepartemenAgama Kecamatan Medan Amplas. (m25)

WASPADA Senin 6 September 2010

Situmorang. Renungkanlah dirimu kepada sang Khaliq, kita harus sabar dan ikhlas dalam menjalankan perintah Allah, karena balasannya adalah Syurga. Kalau kita mampu berpuasa 30 hari, kenapa kita tidak lakukan puasa sunnat Senin-Kamis. Maka sebagai umat Islam yang beriman kita harus konsisten dan komitmen, begitu juga jadi prajurit TNI harus siap segalanya dalam menghadapi tantangan walau bagaimanapun beratnya pasti ada hikmah dibalik itu. Jadilah prajurit yang tangguh,” ujar Situmorang. Sodaqoh kepada anak yatim memiliki makna yang luar biasa yaitu dapat menutupi aib kita,

Waspada/H.Suyono

Ka STAL (Kepala Instalisasi Tuna Tertib Militer) Pomdam I/ BB Kapten CPM Muhammad Basuki memberikan bingkisan kepada sejumlah anak yatim pondok pesantren Al-Wasliyah Kampung Lalang Sunggal, pada acara silaturrahmi buka puasa di lokasi TARA Masmil Jalan Binjai Medan, Sabtu (4/9).

dijauhkan dari bala dan malapetaka. Maka para santri di TARA Masmil kiranya dapat merenungkan diri, jangan kita merasa ego, karena jabatan dan pangkat merupakan amanah dari Allah yang harus diaktualisasikan dengan benar di tengah masyarakat. Apalagi pangkat atau jabatan terakhir bagi manusia dimata Allah adalah almarhum. Karena satu saat semua kita akan merasakannya, namun kapan dan dimana Allah yang Maha mengetahui. Kasi Rustahmil Pomdam I/ BB Mayor CPM (K) Herlina Harahap,SH mewakili Dan Pomdam I/BB Kol.CPM Sudirman yang berhalangan hadir, mengatakan pembinaan rohani bagi para tahanan di TARA (tahanan sementara) Masmil secara rutin dilakukan, dan ini program rutin. Tapi kali ini bertepatan dengan bulan Ramadhan, maka sekaligus kita jadikan ajang silaturrahmi dan pemberian bingkisan kepada anak yatim. Kata Herlina, mereka (para Pesantren (tahanan) bukan penjahat, tapi mereka kurang disiplin dalam menjalankan tugas sehingga melanggar peraturan yang telah ditetapkan di Militer. Maka merekapun harus mendapat pembinaan guna memperbaiki diri. Turut hadir Kapten CHK Sri Amansyah,SH mewakili Ka Masmil Medan Mayor CHK Ahmad Jumali yang berhalangan hadir. Acara diakhiri buka puasa, shalat maghrib berjamaah dan makan bersama.(m25)

Keterangan: Rubrik ini terbit setiap hari selama Bulan Ramadhan yang dikelola oleh LAZ Peduli Ummat Waspada. Bagi Anda yang ingin konsultasi zakat melalui rubrik ini dapat dikirim ke alamat kami: Jl. Brigjend Katamso No. 1 Medan 20151 (Gedung Harian Waspada) Telp/fax. (061) 4511936 / 08126526295 atau e-mail: muhammadnuh66@gmail.com

Rubrik Tanya Jawab MUI Medan Oleh: Drs. Kiai Muhyiddin Masykur (Sekretaris Komisi Fatwa MUI Kota Medan)

Tanya: Ada seorang Mubaligh mengatakan: Allah tidak menerima amal kecuali amal itu ikhlas, mencari ridho Allah. Apakah orang yang membaca surah Yasin atau bersedekah dengan niat supaya dimurahkan rezekinya dan dihindarkan dari musibah itu bisa dikatakan ikhlas, bagaimana sebenarnya esensi atau hakikat ikhlas itu? Jawab: Tujuan hidup manusia adalah untuk beribadah kepada Allah swt sesuai dengan firmannya : “Dan aku tidak jadikan jin dan manusia melainkan supaya beribadah kepada-Ku.” (QS. Adz-dzariah:56). Sedangkan syarat diterimanya amal ibadah adalah ikhlas yaitu: ibadah itu dilaksanakan atas dasar ikhlas mencari ridho Allah sebagaimana dinyatakan dalam hadits Nabi saw: “Allah tidak menerima amal ibadah melainkan yang dilakukan atas dasar ikhlas karena Allah dan untuk memperoleh ridhonya.” (HR. Abu Daud dan Nasa’i) Ikhlas dikalangan Ulama’ Sufi memiliki beberapa startifikasi atau tingkatan. Tingkatan terrendah adalah melakukan ibadah dengan harapan Allah swt akan memudahkan urusan duniawinya sebagai balasannya, seperti membaca Al-Qur’an surah Waqi’ah agar diberi kelancaran rezeki. Tingkatan menengah yaitu beribadah supaya memperoleh pahala atau surga dan terhindar dari dosa atau neraka. Tingkatan tertinggi bagi ikhlas adalah beribadah tanpa mengharap imbalan apapun, semata-mata menjalankan perintah untuk bertaqarub kepada Allah. Seakan-akan orang yang mencapai derajat ikhlas yang tertinggi ini berkata, “aku makhluk dan hamba yang sudah semestinya mengabdi kepada Allah swt, masalah ganjaran itu bukan urusan ku. Kewajiban ku adalah menjalankan perintahnya.” (Kifayah Al-Atqiyah:32) Dalam kitab I’anatut-Tholibin I/129 juga dijelaskan: “tingkatan ikhlas itu ada tiga, 1) tingkatan tertinggi ( ulya’) yaitu beramal ibadah hanya karena Allah semata, untuk mengikuti perintahnya dan melaksanakan hak kehambaannya. 2) tingkatan menengah (wustha) yaitu beramal ibadah utuk mendapatkan pahala di akhirat. 3) tingkatan terendah (dunya) yaitu beramal ibadah untuk mendapatkan kemuliaan di dunia dan keselamatan dari musibah. Selebihnya itu di namakan riya’ walaupun berbeda-beda caranya. Ikhlas itu bagian dari keharusan dalam beragama dan kesempurnaan iman, ia adalah rohnya amal dan beramal tanpa ikhlas bagaikan jasad tanpa nyawa, bagaikan pohon yang tidak berbuah dan awan yang tidak menghasilkan hujan. Kebalikan ikhlas adalah riya’ yakni beribadah bukan karena Allah swt tetapi untuk memamerkan ibadahnya dihadapan manusia supaya dipuji dengan maksud-maksud tertentu. Riya’ itu juga dinamakan syirik kecil karena dosanya lebih kecil daripada syirik dalam pengertian menyekutukan Allah. Jadi sebenarnya tidak ada larangan menggunakan bacaan Al-Qur’an, zikir-zikir, do’a-do’a atau bersedekah untuk kepentingan dunia serta hajat-hajat yang baik sesudah niat ikhlas karena Allah, dan ini termasuk cara-cara bertawassul dengan amal-amal sholeh dan membaca Al-Qur’an dan hal ini hukumnya boleh, bahkan lebih cepat diterimanya, dan tidk ada perselisihan antar ulama’.(Madza fi sya’ban:112) Dengan memperhatikan beberapa penjelasan di atas dapat di jelaskan bahwa beramal dengan harapan Allah akan melapangkan rezeki dan dijauhkan dari musibah itu termasuk ikhlas yang tingkatannya rendah.


Luar Negeri

WASPADA Senin 6 September 2010

A7

Ledakan Kuat Di Baghdad, 8 Tewas

Seorang Tewas, Tiga Cedera Dalam Serangan Udara Israel

BAGHDAD, Irak (Antara News): Satu ledakan kuat menghantam kompleks kementerian pertahanan yang tiga pekan lalu menjadi lokasi serangan bom bunuh diri yang menewaskan belasan calon tentara, kata koresponden AFP. Data awal kementerian dalam negeri menyebutkan paling tidak delapan tewas dan tiga lainnya cedera akibat ledakan yang terjadi sekitar pukul 10:50 waktu setmepat (14:50 WIB) dekat distrik-distrik Bab al Muatham ibukota Iran itu. Ledakan kuat itu terjadi dekat markas besar Komando Militer Rusafa di Baghdad timur, menimbulkan asap mengepul di udara. Ledakan itu diawali dengan ledakan-ledakan yang lebih kecil hampir serentak di ibu kota itu. Markas besar militer itu digunakan sebagai pusat pengrekrutan tentara pada 17 Agustus ketika seorang pembom bunuh diri meledakkan bom yang dibawanya, menewaskan 59 orang. Ledakan Minggu (5/9) itu adalah terbesar melanda Baghdad sejak pusat pengrekrutan tentara itu diserang dan terjadi empat hari setelah pasukan AS secara resmi mengubah perang mereka di Irak dan misi tempur menjadi operasi-operasi “memberikan nasehat dan membantu.” Wakil Presiden AS Joe Biden meluncurkan misi baru ketika mengunjungi Baghdad pekan lalu, membuka satu tahap baru dalam penggelaran tujuh tahun pasukan yang telah menewaskn 4.400 tentara AS itu. Dia dalam satu pidato, Rabu mengatakan aksi kekerasan di Irak kini berada pada tingkat paling rendah sejak perang itu, tetapi statistik resmi pada hari yang sama menyatakan 426 orang tewas dalam aksi kekerasan bulan lalu, yang menegaskan kemampunan pihak gerilyawan untuk membunuh.

GAZA CITY,Wilayah Palestina (Antara/AFP): Pesawat-pesawat tempur Israel melancarkan tiga serangan terhadap Jalur Gaza selatan, menewaskan seorang, melukai tiga lainnya dan beberapa hilang, menurut sumber medis dan keamanan Palestina. Dua serangan ditargetkan pada terowongan penyelundupan di perbatasan dengan Mesir di Rafah Sabtu (4/9), melukai dua orang. Salah satu dari terowongan-terowongan itu roboh, menewaskan seorang pria.Orang lainnya masih hilang dan orang ketiga menderita cedera serius, menurut saksi mata. Serangan lain ditargetkan pada satu bekas pangkalan yang digunakan oleh sayap bersenjata gerakan Hamas, yang menguasai kontrol Jalur Gaza pada 2007. Seorang juru bicara militer Israel membenarkan tiga serangan tersebut, dan mengatakan bahwa salah satunya ditujukan pada “penggalian terowongan ke arah wilayah Israel” untuk serangan-serangan lintas perbatasan. Serangan-serangan udara itu terjadi setelah penembakan sebuah roket dari Gaza ke Israel oleh para gerilyawan Palestina pada Sabtu, yang tidak menyebabkan jatuhnya korban atau kerusakan, menurut pihak militer negara Yahudi itu. Insiden itu menyusul pertemuan Kamis diWashington antara Presiden Palestina Mahmoud Abbas dan PM Israel Benjamin Netanyahu, untuk meluncurkan kembali perundingan perdamaian langsung setelah 20 bulan terhenti. Hamas Kamis mengancam akan melakukan serangan-serangan ke Israel setelah melancarkan dua serangan terhadap para pemukim Israel di wilayah Tepi Barat yang diduduki oleh negaraYahudi itu, yang menewaskan empat orang dan melemparkan selubung atas peluncuran kembali perundingan tersebut.

NATO Laporkan Tentara AS Tewas Di Afghanistan KABUL,Afghanistan(Antara/AFP):SebuahbomrakitanalaTaliban meledak menewaskan seorang tentara Amerika Serikat di pusat pemberontakan Afghanistan selatan, kata NATO Minggu (5/9). Serangan itu terjadi pada Jumat, menurut pernyataan yang dikeluarkan oleh Pasukan Bantuan Keamanan Internasional (ISAF) NATO. ISAF membenarkan, secara terpisah, bahwa tentara yang tewas adalah prajurit Amerika. Kematian prajurit itu menjadikan 496 jumlah tentara asing yang tewas dalam perang Afghanistan sejauh tahun ini, menurut perhitungan AFP berdasarkan data laman icasualties. org. Jumlah tentara asing yang tewas pada 2009 mencapai 521. Perang yang kini mendekati akhir tahun kesembilan itu, didukung oleh tentara internasional yang hampir mendekati kekuatan penuh 150.000 orang, yang berasal dari AS dan NATO.

BUS TERKUBUR LONGSOR DI GUATEMALA, 18 TEWAS

Reuters

Masyarakat berkumpul di sekitar sebuah bus yang terkubur akibat longsor di jalanraya antar negara Amerika, 80 km di luar kota Tecpan, ibukota Guatemala, Sabtu (4/9). Sekurangkurangnya 18 orang tewas Sabtu, termasuk selusin penumpang bus yang terkubur dalam longsor, yang disebabkan hujan lebat yang melanda negara Amerika Tengah itu dan selatan Mexico.

AS Pertahankan Ribuan Pasukan Di Irak WASHINGTON (Antara News/AFP): Amerika Serikat mungkim mempertahankan ribuan tentara di Irak setelah tahun 2011 untuk mengatasi ketegangan sektarian dan membantu meningkatkan kemampuan militer Baghdad, kata para ahli dan mantan perwira. Para pejabat AS secara pribadi mengaku bahwa kehadiran militer AS di Irak hampir pasti akan diperpanjang, kendatipun satu perjanjian keamanan menetapkansemuapasukanASakan dipulangkan akhir tahun 2011. Militer AS masih diperlukan tidak hanya untuk tugas teknis guna mempertahankan keberadaan angkatan bersenjata Irak, tetapi juga melindugi rakyat Irak yang khawatir akan terjadi kembali pertumpahan darah sektarian dan etnik, kata para pengamat. Militer Baghdad tetap mengandalkanpadadukunganlogistik AS, udara, peralatan dan keahlian, sementara dari sebagian besar politisi ingin pasukan AS dipertahankan sebagai pasukan

Reuters

Apolinar Sanchez menggendong putrinya, kembar siam Maria (kiri) dan Elsa Guadalupe, ketika mereka menghadiri pesta perayaan ulangtahun pertama si kembar itu di satu desa pekerja di Santa Catarina, di pinggiran Monterrrey, Sabtu (4/9). Kembar putri itu, 1, yang bergabung pada sistem pencernaan, hati dan pinggul, akan menjalani operasi pemisahan dalam waktu satu bulan, demikian menurut media lokal. Ayah mereka mengatakan ada kemungkinan bahwa salah seorang dari kembar itu akan menemui ajalnya sebagai dalam operasi tersebut.

India Ujicoba Rudal Jelajah Supersonik BHUBANESWAR, India (Antara News/AFP): India Minggu (5/9) berhasil melakukan ujicoba rudal jelajah supersonik darat ke darat versi BrahMos yang dikembangkannya bersama dengan Rusia, kata para pejabat. Rudal itu ditembakkan dari sebuah peluncur bergerak 200 km timur laut Bhubaneswar, ibu kota negara bagian Orissa, India Timur. Ujicoba rudal versi BrahMos darat ke darat itu berhasil dan mencapai semua tujuan misi itu, kata diektur Lapangan Ujicoba Terpadu di Chandipur, S.P Dash kepada AFP. Ujicoba terakhir dilakukan 21 Maret, BrahMos memiliki jangkauan tembak 290km dan dapat membawa 300 kilogram hulu ledak konvensional. Rudal itu mengambil nama Sungai Brahmaputra India dan Sungai Moskow Rusia.(*)

Serangan Pesawat Mata-mata AS Tewaskan Delapan Gerilyawan MIRANSHAH, Pakistan (Antara/AFP): Serangan pesawat mata-mata Amerika menewaskan delapan gerilyawan di daerah suku di bagian baratlaut Pakistan, dekat perbatasan Afghanistan. Serangan itu ditargetkan terhadap sebuah kompleks gerilya-wan didesaDattaKheldidistrikWaziristanUtara,pusatterkenalbagigerilyawan Taliban dan Al Qaida, menurut beberapa pejabat Pakistan. “Sebuah pesawat mata-mata AS telah menembakkan rudal di sebuah rumah yang digunakan oleh gerilyawan sebagai kompleks. Delapan gerilyawan tewas dalam serangan itu dan 12 yang lain terluka,” kata seorang perwira keamanan di Peshawar kepada AFP melalui telefon Sabtu (4/9). Dua pejabat intelijen di Miranshah, kota penting diWaziristan Utara, juga memastikan serangan itu dan korbannya. Salah seorang dari mereka mengatakan bahwa sebuah truk pick up dua kabin juga hancur akibat rudal yang ditembakkan dari sebuah pesawat pengintai itu. “Lima gerilyawan setempat dan tiga asing tewas dan 12 yang lain luka-luka,” tambah pejabat intelijen se-tempat itu. Para pejabat Pakistan menganggap gerilyawan Arab dan Asia Tengah sebagai gerilyawan asing. Datta Khel, sekitar 30 Km di barat Miranshah, telah sering menjadi sasaran serangan pesawat mata-mata, termasuk serangan Jumat malam yang menewaskan empat gerilyawan asing ketika serangan itu menghantam sebuah mobil, ujar beberapa pejabat keamanan. Serangan sebelumnya Jumat menewaskan enam gerilyawan ketika serangan itu menghantam sebuah kompleks di pinggiran kota Miranshah. Empat gerilyawan dilaporkan tewas dalam serangan lainnya di Waziristan Utara pada 28 Agustus, setelah serangan pada 24 Agustus yang menewaskan 12 orang. Daerah itu juga dikenal sebagai benteng pertahanan jaringan Haqqani terkait Al Qaida, yang telah melakukan serangan terhadap pasukan AS dan NATO yang berperang di Afghanistan. Pasukan AS telah melakukan perang mata-mata terhadap para komandan Taliban dan al Qaida di daerah suku di bagian baratlaut Pakistan itu, tempat gerilyawan membuat tempat perlindungan di gunung di luar pengawasan langsung pemerintah.

pemeliharaan perdamaian. “Kebutuhan yang lebih mendesak adalah mengajarkan mereka bagaimana menggunakan senjata dan memberikan jaminan keamanan bagi kelompok-kelompok masyarakat bahwa mereka tidak akan dieksploitir oleh perseteruan internal di masa lalu,” kata Stephen Riddle dari Dewan Hubungan Luar Negeri. Memberikan bantuan teknik sementara memainkan peran perdamaian yang terbatas akan memerlukan satu jumlah pasukan yang relatif sederhana, barangkali sekitar tiga brigade atau sekitar 10.000 tentara, kata beberapa mantan perwira militer. Kepala staf angkatan darat Irak Jendral Babaker Zebari

mengemukakan kepada AFP bulan lalu bahwa pasukan negaranya akan memerlukan dukungan AS untuk beberapa tahun kedepan, sementara para pengamat di Washington memperkirakan sekitar separuh dari pasukan yang ada sekarang dipertahankan setelah tahun 2011. Para pemimpin Irak mungkin meminta puluh ribu tentara AS untuk tetap berada di negara itu selama satu periode,” kata Richard Haas, seorang diplomat penting dalam pemerintah presiden George.W Bush. AS akan membantu sejumlah persenjataan, helikopter jet tempur untuk mempertahankan negara. Irak sesungguhnya tidak memiliki angkatan udara , angkatan laut untuk menjaga pelabuhan-pelabuhan memperoleh laporan intelijen yang dikumpulkan dari pesawat-pesawat yang tidak berawak. Jika hubungan antara kelompok Sunni dan Syiah dan

Kurdi terancam tidak bisa dikendalikan, atau jika sumber penting minyak dan prasrana lainnya berada dalam ancaman dari dalam atau luar Irak, Baghdad dapat meminta bantuan pasukan AS, katanya. Selain pada tentara bersenjata, para pejabat AS sedang berencana akan mengerahkan ribuan kontraktor swasta untuk memikul tugas keamanan yang sebelumnya ditangani pasukan. Hampir 50.000 tentara AS kini masih berada di Irak dengan peran “memberikan nasehat dan membantu “ setelah Presiden Barack Obama, Selasa mengumumkan secara resmi berakhirnya misi tempur AS. Setiap perundingan masa depan tentang kehadiran asukan AS harus menunggu terbentuk pemerintah baru di di Irak, di mana para politisi gagal mencapai kesepakatan bagi berbagi kekuasaan sejak pemilu parlemen Maret lalu.

Gempa Bumi 7,1 SR Di Selandia Baru Rekahkan Tanah 3,5 M CHRISTCHURCH, Selandia Baru (AP): Gempa bumi kuat yang merubuhkan gedung-gedung, meretakkan jalan-jalan dan merusak jaringan rel kereta api di sekitar Christchurch, Selandia Baru, juga menimbulkan rekahan tanah (celah) baru selebar 3,5 meter di permukaan tanah, demikian menurut seorang geologis Minggu (5/9). Gempa dengan kekuatan 7,1 skala richter yang menghancurkan sejumlah bangunan, merusak jalan-jalan dan lintasan rel kereta api di satu kota Selandia Baru juga menyebabkan celah selebar 3,5 meter, kata para pejabat. Sedikitnya 500 gedung, termasuk 90 properti di kota Christchurc hancur akibat gempa yang melanda negara itu pukul 4:35 dinihari Sabtu dekat kota South Island yang berpenduduk 400.000. Namun sebagian besar lain hanya mengalami kerusakan kecil. Aliran listrik terputus ke wilayah itu, jalan-jalan tertutup

reruntuhan bangunan dan saluran gas serta air terganggu, kata Walikota Christchurch Bob Parker sambil mengingatkan, gempa susulan yang masih terjadi kemungkinan akan menyebabkan gedung-gedung yang rusak akan semakin parah. Gurubesar Geologi Universitas Canterbury Mark Quigley mengatakan,“apa yang kami lihat sepertinya terjadi celah baru yang mengoyak tanah dan mendorong permukaan tanah naik sekitar 3 meter. Gempa itu disebabkan tubrukan antara piringan tektonik Australia dan Pasifik yang masih terus terjadi,” katanya. “Satu sisi bumi menurun sampai 3,5 meter dan di bagian lain naik,” kata Quigley kepada National Radio. “Rekahan panjang di permukaan bumi menyebabkan terbelahnya rumah-rumah dan jalan-jalan. Kami melihat sendiri dua rumah yang benar-benar terbelah dua akibat gempa itu,” katanya.

Roger Bates, yang peternakannya berada di Darfield dekat dengan pusat gempa, mengatakan timbulnya celah baru telah merampas sebagian tanahnya. “Saya kehilangan 2 meter tanah perbatasan,” tambahnya. PM: Ajaib, tak ada korban PM John Key, yang terbang ke Christchurch untuk melakukan peninjauan kerusakan yang ditimbulkan gempa tersebut, mengatakan ‘memang benarbenar suatu keajaiban’ bahwa tidak ada korban tewas dalam gempa sekeras itu. Menteri Pertahanan Sipil John Carter mengatakan ‘banyak kerusakan atas infrastruktur penting ... air, sistem air limbah.” Para pakar mengatakan kecilnya jumlah korban cedera menunjukkan negeri itu memiliki aturan pembangunan. “Selandia Baru memiliki undang-undang pembangunan yang amat baik... yang artinya gedung-gedung kuat, dibanding dengan bangunan di Haiti,” yang

mengalami kerusakan luas akibat gempa bumi berkekuatan 7,0 skala Richter tahun ini, kata pakar bumi profesor Martha Savage. Survei Geologi Amerika Serikat (USGS), gempa berkekuatan 7,4 pada Skala Richter telah mengguncang Selanda Baru, hanya 7 km di tenggara Christchurch, pada tengah malam waktu setempat, kata Survei Geologi Amerika Serikat (USGS), Jumat. Tidak ada peringatan tsunami segera. USGS sebelumnya menyatakan gempa itu berkekuatan 7,3 SR. Pusat gempa ada di kedalaman 66Km dan gempa itu melanda pada pukul 16:35 GMT (23:25WIB). Christchurch, di pantai timur South Island, adalah kota terbesar kedua Selandia Baru dengan penduduk sekitar 342.000 orang.(m18/ m07)

Topan Tunda Pelatihan AL AS Dan Korsel SEOUL,KoreaSelatan(Antara/AFP):MiliterKoreaSelatanMinggu (5/9) mengkonfirmasikan pelatihan angkatan laut gabungan dengan AmerikaSerikatyangbertujuanuntukmenunjukkankekuatanmiliternya ditunda karena topan mendekati wilayah negara itu. Pelatihan lima hari, yang menurut rencana diselenggarakan 5-9 September itu belum ditetapkan tanggal baru, kata seorang jurubicara Gabungan Kepala Staf kepada AFP. “Tidak akan ada kegiatan pelatihan hari ini karena topan Malou semakin dekat ke wilayah itu, dan akan segera mengumumkan tanggal dimulai pelatihan itu,” katanya. Pelatihan militer terbaru itu adalah bagian dari pelatihan militer yang diselenggarakan sendiri atau bersama dengan AS — sebagai satu unjuk kekuatan terhadap Korut setelah negara itu menuduh Pyongyang mentorpedo kapal perang Cheonan Maret lalu yang menewaskan 46 awaknya. Seoul dan Washington, yang mengutip hasil penyelidikan multinasional, menuduh Pyongyang mentorpedo kapal perang Cheonan Maret lalu dan menewaskan 46 pelautnya.Negara komunis itu membantah keras tuduhan itu dan mengancam akan melakukan tindakan balasan terhadap pelatihan militer dekat perbatasan laut antara Korea, menyebut itu adalah satu awal bagi invasi. Pelatihan angkatan laut mendatang di lepas pantai barat Laut Kuning itu menurut rencana akan melibatkan dua kapal perusak berpeluru kendali, sebuah kapal pengintai laut, sebuah kapal selam dan pesawat-pesawat pengintai P-3C Orion dari militer AS. Korsel akan mengerahkan empat kapal perusak, paling tidak satu pergat, pesawat-pesawat p-3C dan sebuah kapal selam, kata Gabungan Kepala Staf Seoul, Jumat dan menambahkan 1.700 personil militer dari kedua negara akan ikut serta. BadancuacaKorselmengatakanTopanMalou,yangsedangbergerak ke arah utara dari pulau Okinawa Jepang, diperkirakan akan melanda semenanjung Korea sekitar Selasa malam, memperingatkan bahwa akan terjadi angin kencang dan gelombang tinggi di laut itu.

Pangkalan Militer Rusia Diserang, 5 Orang Tewas MAKHACKALA, Rusia (Antara/Itar-Tass-OANA): Serangan pelaku bom bunuhdiri di kamp brigade mekanis infantri di kota Buinaksk, wilayah Kaukasus Utara, Rusia, Dagestan, menewaskan lima tentara dan 26 lainnya cedera, kata Kementerian Situasi Darurat dan Pertahanan Sipil wilayah Dagestan (EMERCOM) kepada Itar-Tass. Insiden itu terjadi pada sekitar pukul 01:00 waktu setempat Sabtu (4/9), ketika pelaku pengeboman mengendarai sebuah mobil kecil Lada dengan bahan peledak di dalamnya. Dia masuk melalui pintu gerbang kamp lapangan itu. Dari 26 petugas yang cedera, 22 di antaranya kondisinya cukup berat saat peristiwa itu dilaporkan. Tiga petugas lainnya dalam keadaan sangat gawat dan dua lainnya lagi kondisinya berat, kata juru bicara EMERCOM. Sekitar 10 tentara menderita luka ringan dan bantuan medis diberikan kepada mereka di tempat kejadian. Bagi korban cedera berat, sebagian besar dari mereka telah dibawa ke rumah sakit militer Buinaksk, namun beberapa di antara mereka mendapatkan perawatan di sebuah rumah sakit kota. Fasilitas militer yang ditargetkan oleh kalangan teroris Ahad pagi, berlokasi di luar kota Buinaksk dekat desa Khalimbek-aul.

Singa Laut Aniaya Anak Laki-laki Di KB Australia SYDNEY, Australia (AP): Seorang anak laki-laki berusia 11 tahun Sabtu (4/9) menjalani pemulihan setelah seekor singa laut menganiayanya di satu acara pertunjukan di akuarium populer Kebun Binatang Sydney. Penganiayaan itu disaksikan para pengunjung lainnya dengan rasa cemas. Anak laki-laki itu, yang disebut ibu tiringan sebagai Jack Lister, telah diajak oleh penjaga kebun binatang untuk menemui singa laut betina berusia 8 tahun pada acara pertunjukan singa laut Jumat. Setelah memberi makan binatang itu, Jack keliru mengikuti binatang tersebut yang keluar dari pentas, dengan menakut-nakuti singa laut itu, kata para petugas kebun binatang. Singa laut itu menggigit anak laki-laki tersebut yang mengakibatkan terjadi beberapa cedera di perutnya. Jack menjalani operasi perut Jumat malam dan berada dalam kondisi stabil di sebuah rumah sakit. Ibu tiri Jack, Dalitta Wright, mengatakan kepada The Daily Telegraph, suratkabar Sydney, dalam satu cerita yang disiarkan Sabtu bahwa serangan itu demikian cepat dan tiba-tiba.(m07)

Kapal Irlandia Bergabung Dengan Armada Kebebasan Gaza Kedua LONDON, Inggeris (Antara/ IRNA-OANA): Pertemuan terbuka diadakan di Cork, Irlandia Selatan sebagai bagian dari upaya pengumpulan dana nasional untuk mengirim satu kapal Irlandia buat Flotila Kebebasan Kedua ke Jalur Gaza bulan depan. Kapal Irlandia buat Kampanye Gaza secara resmi diluncurkan di Dublin, Senin lalu, oleh organisasi setempat Friends of Palestinedanberafiliasibagiupaya baru guna menerobos blokade tiga tahun Israel atas Jalur Gaza. “Meskipun ada propaganda Israel, Jalur Gaza tetap berada di bawah pengepungan dan krisis kemanusiaan sama buruknya dengan sebelumnya. Daerah pantai kecil itu, yang jadi tempat tinggal bagi 1,5 juta orang Palestina, secara efektif jadi kamp

penjara terbuka yang dikuasai oleh Israel,” kata para pendukung kapal itu Sabtu (4/9). Sebanyak 50 pegiat Irlandia diperkirakan akan bergabung di dalam armada kapal bantuan kedua setelah yang pertama secarabrutaldiserangolehper-sonil pasukan komando Israel yang memakai topeng di perairan internasional pada akhir Mei, ketika sembilan relawan dibantai. “Penting bahwa kita memperlihatkan solidaritas kita buat rakyat di sana. Tak cukup cuma peduli. Kita harus bertindak,” kata Fintan Lane dari Free Gaza Movement, yang melakukan perjalanan di kapal Rachael Corrie, yang berbendera Irlandia, dalam flotila pertama yang dirampas oleh Israel. Pemimpin Ireland-Palestine Solidarity Campaign (IPSC)

Freda Hughes menyambut baik gagasan baru tersebut. Ia mengatakan penting bagi rakyat Irlandia untuk selalu ingat kebrutalan keji Israel dalam blokade yang berlangsung atas Jalur Gaza, yang telah membinasakan rakyat di sana. “Keikutsertaan kami memperlihatkan tanda penting dalam kegiatan kami guna mengakhiri rezim Apartheid Israel, yang menolak hak nasional, politik, sipil, dan kemanusiaan rakyat Palestina,” kata Hughes. Pertemuan pengumpulan dana itu diselenggarakan di seluruh Irlandia guna menandai peluncuran Kapal Irlandia ke Jalur Gaza, untuk mendukung flotila kedua, yang diperkirakan berjumlah 15 kapal dari Inggris, Amerika Serikat, Kanada dan benua Eropa.

Reuters

Para petugas kepolisian Thailand melakukan penelitian di lokasi ledakan bom sepedamotor di luar satu rumah sakit di provinsi Pattani, selatan Thailand, Minggu (5/9). Militan Muslim diduga bertanggungjawab atas serangan tersebut yang mencederai tiga warga desa, kata polisi.


Nusantara

A8

WASPADA Senin 6 September 2010

PBNU: SBY Harus Tegas Hadapi Malaysia JAKARTA ( Waspada): Ketua Umum Pengurus Besar Nahdlatul Ulama (PBNU) KH Said Aqil Siradj meminta Presiden Susilo BambangYudhoyono (SBY) mendesak Malaysia meminta maaf kepada Indonesia atas pelecehan terhadap kedaulatan bangsa, dengan melakukan pelanggaran perbatasan dan penangkapan kepada tiga petugas DKP (Departemen Kelautan dan Perikanan) itu. Karena itu, SBY sebagai kepala negara harus tegas dan berani menghadapi Malaysia. Yang diinginkan PBNU dalam masalah ini, kata dia, agar SBY bersikap tegas dan berani kepada Malyasia, karena kita di pihak yang benar. “SBY harus menyatakan bahwa kamu (Malaysia) terbukti salah, dan untuk itu harus meminta maaf kepada rakyat Indonesia,” tandas KH Said Aqil Siradj pada wartawan, saat berbuka puasa bersama para ulama, duta besar negara sahabat dan pengurus PBNU di Gedung PBNU Jl. Kramat Raya Jakarta, Sabtu (4/9).

Idul Fitri Bersamaan Tentang kemungkinan perbedaan Hari Raya Idul Fitri 1431 H, PBNU yakin tidak akan terjadi perbedaan. “Jika puasanya 30 hari, berarti Idul Fitri 10 September 2010. Tapi kalaupun terjadi perbedaan, maka perbedaan itu hal biasa. Karena masing-masing berdasar pada kriteria yang dianut,”kata dia. Bagi NU, penentuan awal bulan itu harus didahului dengan ru’yatul hilal bil fi’li, yaitu melihat bulan dengan mata telanjang di berbagai titik yang telah ditetapkan PBNU dan Departemen Agama. “Bahwa pengertian ru’yatul hilal bukan berarti hilal ada atau tidak ada, melainkan hilal itu terlihat atau tidak. Dan perbedaan sering terjadi antarnegara-negara di Timur Tengah, yang jaraknya berdekatan. misalnya antara Yaman dengan Mesir, Saudi Arabia dengan Yordan dan lain-lain. Jadi, perbedaan itu biasa saja, tidak usah dibesarbesarkan,” tutur Said Aqil.(aya)

JK Beri Penghormatan Terakhir Ke Zuraida Anwar

Antara

KUE LEBARAN: Warga berburu kue kering di salah satu toko kue di pasar Jatinegara, Jakarta, Minggu (5/9). Menurut pedagang, permintaan kue kering untuk memenuhi kebutuhan lebaran tahun ini meningkat sebesar 20% - 30% dibanding tahun lalu dengan kisaran harga Rp 75 ribu sampai 100 ribu per kg.

Razia Main Pukul, Mapolsek Dibakar

JAKARTA (Antara): Wakil Presiden RI periode 2004-2009, Muhammad Jusuf Kalla, memberikan penghormatan terakhirnya bagi almarhumah Hj. Siti Zuraida Rosihan Anwar, Minggu (5/9), di rumah duka yang juga kediaman tokoh pers H. Rosihan Anwar. Selain Jusuf Kalla, yang datang bersama istrinya, Mufidah Jusuf Kalla, tampak Gubernur DKI Jakarta Fauzi Bowo, hadir memberikan rasa simpatinya. Beberapa pejabat dan orang ternama, seperti Miranda Goeltom dan Dewi Motik Pramono juga nampak di rumah duka Jalan Surabaya No. 13, Menteng, Jakarta Pusat. Karangan bunga yang datang diantaranya dari Direktur Lembaga Penyiaran Publik (LPP) RRI, Parni Hadi, dan pengusaha Aburizal Bakrie.

Istri tokoh pers tiga zaman, Rosihan Anawar, meninggal setelah sempat dirawat di Rumah Sakit Metropolitan Medical Center (MMC), Kuningan, Jakarta, karena terjatuh setelah menunaikan ibadah shalat di pagi hari. Almarhumah yang masih terhitung kerabat Pahlawan Nasional M. Husni Thamrin meninggalkan seorang suami dan tiga orang anak. “Ibu beberapa tahun ini memang sering sakit-sakitan dan bolak-balik ke rumah sakit, hingga tadi sehabis shalat ibu terjatuh,” kata Andi, seorang kerabatnya. Almarhum Zuraida dimakamkan di Tempat Pemakaman Umum (TPU) Karet selepas shalat Ashar, dan diberangkatkan dari rumah duka yang juga kediaman keluarga H. Rosihan Anwar di Jalan Surabaya 13, Menteng, Jakarta Pusat.

23 Warga Ditangkap MUSI RAWAS (Antara): 23 Warga Rawas Ulu, Kabupaten Musi Rawas, Sumatera Selatan ditahan polisi, terkait pembakaran markas kepolisian sektor Rawas Ulu Sabtu (4/9). “Ada 23 orang yang ditahan untuk dimintai keterangan kasus pembakaran Mapolsek Rawas Ulu, sedangkan warga yang terluka tembak ada satu orang dan sudah diobati,” kata Kapolda Sumatera Selatan Irjen Pol. Hasyim Irianto, usai menghadiri pelantikan bupati/wakil bupati Musi Rawas terpilih 2010-2015, Ridwan Mukti dan Hendra Gunawan, Minggu (5/9). Peristiwa itu, kata Kapolda,

berawal dari razia kendaraan digelar petugas, dimana ada warga terjaring karena tidak memiliki surat-menyurat kelengkapan berkendara. Namun warga tersebut terjatuh dari kendaraannya akibat dipukul petugas Bripda Zailani. Dia kemudian melapor kepada keluarganya di Desa Lesung Batu dan mendatangi Polsek Rawas Ulu. Aksi pemukulan ini berhasil didamaikan Kapolsek Iptu Telaumbanua, antara kedua pihak yang bertikai. Namun saat perdamaian di atas segel dibuat, datang ratusan massa melakukan perusakan dan pembakaran kantor polsek. Akibat pembakaran ini satu mobil patroli, dua sepeda motor barang-bukti kejahatan dan ba-

ngunan Polsek hangus terbakar yang nilainya masih dalam pendataan petugas, sedangkan tahanan dan senjata dapat diselamatkan. Untuk itu dia mengharapkan kalangan masyarakat daerah itu bersama-sama menahan diri. Bagi petugas yang bersalah akan ditindak tegas, begitu juga kepada masyarakat yang terbukti bersalah melakukan pembakaran kantor polisi berikut peralatannya. Sementara, Kapolres Musi Rawas AKBP Imam Syahcroni mengatakan, saat ini Polsek Rawas Ulu yang berada di Jalan Lintas Sumatera menempati Pos PAM Lebaran di Simpang Nibung dekat perbatasan dengan Provinsi Jambi.

Waspada/Ist

LIRA bersama sejumlah ormas dan tokoh mendeklarasikan Posko Bela Negara Barisan Pengawal Merah Putih di Jakarta, Sabtu (4/9).

Perempuan LIRA Pantau Pemimpin Daerah JAKARTA (Waspada): Para pemimpin di daerah jangan merasa kinerjanya tidak diawasi karena jauh dari pantauan pusat. “Mereka harus tetap menjalankan aturan sesuai undangundang, bukan menyelewengkan kewenangan dengan alasan kepentingan rakyat,” tegas Ketua Umum Perempuan Lumbung Informasi Rakyat (LIRA), Hj Siti Mariani saat deklarasi Posko Bela Negara Barisan Pengawal Merah Putih di Jakarta, Sabtu (4/9). Posko Bela Negara terdiri dari sejumlah ormas dan sejumlah tokoh diantaranya mantan gubernur DKI Jakarta, Sutiyoso dan Lembaga Perempuan LIRA. Perempuan LIRA, kata dia, sangat berkepentingan mengawal bangsa, baik kepentingan di daerah maupun di pusat. Namun yang lebih penting, perlu mengawal atau ikut mengawasi jalannya pemerintahan di daerah.

Siti, yang lahir di Tanjungbalai, merasa berkepentingan membantu melalui Lembaga Perempuan LIRA. “Secara pri-badi saya juga memantau kinerja pemimpinnya. Jika sesuai aturan kita harus dukung, tetapi jika keluar dari aturan, Perempuan LIRA yang akan dibentuk Sumut akan membawa persoalannya ke pusat,” tandasnya. Menurut Siti, masalah dihadapi masyarakat sehari-hari umumnya pendidikan, kesehatan dan kesetaraan gender. Karena itu, Perempuan LIRA akan merampungkan kepengurusannya sampai kabupaten/kota. Dengan begitu, dapat membantu bukan saja untuk kaum perempuan, tetapi untuk kepentingan secara menyeluruh. Aktivitas Perempuan LIRA menurut Presiden LIRA, Yusuf Rizal, untuk mendorong program pembangunan abad milenium. “Ada delapan sasaran antara lain, kesetaraan gender,

kemiskinan, persoalan anak, pendidikan lingkungan, pembangunan berkelanjutan. Jadi nantinya Perempuan LIRA sebagai ujung tombak dan mendukung LIRA, terutama mengungkap korupsi di daerah.” Perempuan LIRA juga ikut dalam Barisan Pengawal Merah Putih, sehingga keberadaannya masuk juga dalam posko bela negara. “Ibu Siti juga ikut membaca deklarasi bersama Pak Sutiyoso, mantan gubernur DKI Jakarta,” kata Yusuf Rizal. Dalam kesempatan itu, Sutiyoso meminta pemerintah segera “mendandani” semua angkatan, baik laut, udara dan darat. “Kita tidak mau dilecehkan. Sudah saatnya kita bergandengan tangan, karena apa yang dilakukan Malaysia sudah mencapai batas kesabaran kita sebagai anak bangsa. Bahkan untuk bercerai dengan Malaysia pun kita sudah siap,” katanya.(j07)

Kondisi di lapangan sudah kondusif dan personil yang dikirimkan dari Polres Musi Rawas sebanyak 1 SSK (satuan setingkat kompi) sudah diku-

rangi dan masih ada beberapa regu saja yang bertugas mengamankan lokasi kejadian dan mencegah aksi susulan.

KPA Sulsel Pecahkan Rekor Sahur Terbanyak MAKASSAR (Antara): Komunitas Pecinta Alam (KPA) Sulawesi Selatan, Minggu (5/9) dinihari memecahkan rekor makan sahur dengan peserta terbanyak yakni mencapai 6.876 orang. Ketua panitia penyelenggara, Elizabeth Lembang, di Makassar mengatakan, jumlah peserta melebihi jumlah yang telah ditargetkan sebelumnya, yakni 6.500 orang. Total jumlah peserta yang ikut dalam kegiatan ini dihitung dari jumlah kupon makan telah yang diberikan oleh panitia kepada peserta. Dalam kegiatan tersebut, terlihat barisan peserta yang duduk memenuhi jalan Pantai Losari sepanjang 500 meter. Kegiatan dilakukan untuk memecahkan rekor Museum Rekor Indonesia (MURI) yang pernah dibuat di Jakarta, dimana dalam kegiatan tersebut jumlah peserta sahur sebanyak 6.135 orang. Menurutnya, kegiatan makan sahur terbanyak yang pernah dilakukan di Jakarta dilaksanakan di dua tempat berbeda. “Berbeda halnya dengan di Makassar, dimana pelaksanaannya dilakukan di satu tempat, yakni di sepanjang jalan Pantai Losari Makassar,” imbuhnya. Meskipun tidak dihadiri oleh perwakilan dari MURI, namun hasil kegiatan ini akan diserahkan kepada MURI sebagai bentuk pengakuan telah memecahkan rekor yang pernah diciptakan sebelumnya di Jakarta. “Hasil dari kegiatan ini, termasuk data-data, tanda tangan peserta dan dokumentasinya akan langsung kami serahkan kepada pihak MURI, agar sertifikat pemecahan rekor ini bisa diterima.” Dia menambahkan, tujuan awal dari pelaksanaan kegiatan ini untuk menyatukan seluruh golongan di Kota Makassar, baik agama, suku dan ras. Kegiatan ini turut melibatkan 500 KPA di Makassar, juga beberapa daerah lain, seperti Kabupaten Maros, Pangkep, Barru, Enrekang, Tanatoraja, Gowa, Takalar dan Sinjai. Acara turut dimeriahkan sejumlah komunitas masyarakat di Makassar, seperti komunitas vespa, motor antik sepeda ontel, dan sebagainya.

Diduga Meninggal, Mantan Bupati Gianyar Sadarkan Diri GIANYAR (Antara): Mantan Bupati Gianyar, Anak Agung Gede Agung, sadarkan diri setelah sampai di Rumah Sakit Umum Daerah (RSUD) Sanjiwani, Gianyar, Bali. “Kejaiban terjadi. Tibatiba bapak dinyatakan bisa bicara, padahal sebelumnya informasi kami terima bapak telah meninggal, “ kata Dewa Nyoman Agung, Sekretaris Puri Gianyar, Bali, Minggu (5/9) Menurut dia, Anak Agung telah terseret arus mulai pukul 09:00 Wita hingga pukul 02:00. “Kalau tidak keajaiban, mana mungkin bapak hidup?, katanya. Dia mengatakan, mantan bupati itu ditemukan oleh I Wayan Mustika terdampar di Pantai Selukat, Desa Keramas, Kecamatan Blahbatuh Gianyar. “Bapak kala itu sudah dinyatakan meninggal, namun ketika diperiksa di RSUD Sanjiwan, tiba-tiba bapak sadar serta bisa bicara,” jelasnya. A.A Gede Agung Bharata, 61, dan istrinya Nanik Wirna, 58, diinformasikan ditemukan telah meninggal dunia pada Minggu sekitar pukul 02:00. “Sebelumnya kami mendapatkan informasi mantan bupati itu sudah menjadi mayat, namun ternyata sadarkan diri,” jelas Kapolsek Kota Gianyar, AKP I Gede Putu Astawa. Tubuh istri mantan Bupati Gianyar, Nanik Wirna, ditemukan lebih awal di Pantai Lebih, Gianyar. Setelah itu sang suami ditemukan di pantai Selukat, Desa Masceti, Blahbatuh, Gianyar, Bali. Hubungan Masyarakat RSUD Sanjiwani Kabupaten Gianyar, I Gudi Yudiarta, mengatakan saat ini jazad Nanik dit di ruang mayat RSUD Sanjiwani. “Sang istri sudah pasti dinyatakan meninggal karena tenggelam. Adapun sang suami setelah dicek kondisinya, ternyata masih hidup. Kami dengar juga begitu, ada informasi mantan bupati sudah meninggal, “ jelasnya. Anak Agung Gede Baratha dan istrinya hilang karena terseret arus di muara (loloan) Pantai Sedayu, Klungkung perbatasan Kabupaten Klungkung dengan Gianyar, Minggu pukul 10:00. Keduanya saat itu sedang berjalan-jalan bersama seorang sopir dan pembantu, mantan bupati dan istri turun di Pantai Sedayu, kemudian berjalan ke Pantai Lebih, Gianyar. Celakanya saat mereka menyeberang di muara pantai Sedayu justru terseret arus air.

Antara

ISTRI ROSIHAN ANWAR. Sejumlah kerabat melayat jenazah Siti Zuraida, istri wartawan senior Rosihan Anwar di rumah duka Jalan Surabaya 13, Jakarta, Minggu (5/9). Siti Zuraida meninggal pada usia 87 tahun sekitar pukul 08.30 WIB setelah lama menderita sakit . Laporan ke: 31

DOMPET PEDULI UMMAT WASPADA Setiap sedeqah yang kita salurkan di jalan Allah akan menjadikan pelindung kita dari api neraka. Salurkan Zakat, Infaq dan Shadaqah Anda ke lembaga yang Amanah, Profesional & Transparan Transfer via bank, AC. Peduli Ummat Waspada

Zakat BMI 211.00002.15 BSM 006.0022407 BCA 022.1750828 BNI Syariah 0092687629 Bank Mandiri 106.0002203803

Infak/Sedekah BMI 211.00044.15 BSM 006.0008321 BNI 005.7504808 Bank Sumut 100.02.04.034144.5

ZIS terpublikasi 1 Januari 2010 s/d laporan 30

Rp 525.705.067

ZIS

ZIS

1889. Hamba Allah - Medan Rp 10.000.000 1890. Hj. Suhana - Transfer Bank Mandiri Rp 4.000.000 1891. Hamba Allah - Medan Rp 6.000.000 1892. dr. Elmeida Effendi, Sp.KJ-Medan Rp 3.000.000 1893. dr. H. Chairul Mursin, Sp.An - Medan Rp 3.000.000 1894. Yusri Natar Nasution - Kanwil Direktorat Pajak Sumut I Rp 2.000.000 1895. Prof. Dr. Hafas Hanafiah, Sp.B, Sp.OT(K) - Medan Rp 2.000.000 1896. Ir. H. FauziYusuf - PTPNV Pekan Baru Rp 1.500.000 1897. Prof. H. Mohammad Syukur, MS - Medan Rp 1.500.000 1898. Hj. Nurlian, SH - Medan Rp 1.500.000 1899. dr. Tengku Sofia Hanum - Transfer Bank Mandiri Rp 1.200.000 1900. Kartika - Setor BSM Rp 1.000.000 1901. Sabaruddin Lubis - Medan Rp 1.000.000 1902. Ir. H. Razali Ishak, MBA - Medan Rp 1.000.000 1903. Ir. H. Erwin Nasution - PTPN I NAD Rp 1.000.000 1904. Hamba Allah - Medan Rp 1.000.000 1905. Pinbuk ATM Bank Mandiri Rp 800.000 1906. PT. Murni Glory Indonusa-Medan Rp 750.000 1907. Dr. H. Rosihan Arbi - Medan Rp 500.000 1908. Hamba Allah - Setor BSM Rp 500.000 1909. Prof. Dr. Haidar Puta Daulay/IAINSU - Pbk BMI Rp 400.000 1910. Adi Chandra Chaniago-Setor BSM Rp 300.000

1911. Fauziah - Kanwil Direktorat Pajak Sumut I Rp 200.000 1912. Hamba Allah - Waspada Medan Rp 200.000 1913. Hamba Allah - PT.PP. London Sumatera Medan Rp 200.000 1914. Arief Feryanto, Felida Hafas & Fiona Calista - Singapore Rp 200.000 1915. Prof. Dr. Amiur Nuriddin, MA/IAINSU - Pbk BMI Rp 200.000 1916. Wendra Pratama - Kanwil Direktorat Pajak Sumut I Rp 178.000 1917. Kel. Prof. Dr. Hafas Hanafiah, Sp.B, Sp.OT(K) - Medan Rp 160.000 1918. Ir. H. Alfian Danial - Medan Rp 150.000 1919. Sigit - Medan Rp 125.000 1920. NN - ATM BNI Rp 100.000 1921. NN - Pbk BNI Rp 50.000 1922. Drs. Rahmat Nauli, M.Si/Unimed-Pbk BNI Rp 50.000 1923. Dona Irfan - Kanwil Direktorat Pajak Sumut I Rp 47.000 1924. Khairina Masitha - Kanwil Direktorat Pajak Sumut I Rp 40.000 1925. Dra. Martina Restuati, M.Si/Unimed - Pbk BNI Rp 40.000 1926. Dr. Hj. Siti Zubaidah, M.Ag/IAINSU- Pbk BMI Rp 25.000 1927. Dr. H. Fachruddin, MA/IAINSU-Pbk BMI Rp 20.000 1928. Mhd. Aswin - Pbk BMI Rp 20.000 1929. Hamba Allah - Setor BMI Rp 20.000 1930. Hamba Allah - Setor Bank Muamalat Rp 10.000 1931. Dra. Nurmalis, M.Si/Unimed-Pbk BNI Rp 10.000

Rp 43.950.000

Jumlah laporan ke: 31

Rp 45.995.000

Penerimaan dan Pemanfaatan Dana

Penerimaan

Pemanfaatan

Periode Mei 2000 s.d Desember 2008 Periode 1 Januari s.d Desember 2009

4.909.978.548 4.198.629.299 711.349.249 1.696.397.466 1.233.343.200 463.054.266

Total

6.606.376.014

5.431.972.499

Saldo

1.174.403.515

Konsultasi Zakat Bersama Ustadz M. Nuh Abdul Muis SMS: 08126526295 e-mail: peduliummat@waspada.co.id Hubungi Kami: Lembaga Amil Zakat Provinsi Sumatera Utara Peduli Ummat Waspada Jl. Brigjen Katamso No. 1 Medan telp. 061-4511936 - 4150858 (evi) Fax. 061-4511936 E-mail: peduliummat@waspada.co.id Khusus Kodya Medan, ZIS diatas Rp 500.000,- kami siap menjemput (4511936 - 08126375062)


Sport

WASPADA Senin 6 September 2010

A9

Jenny Berbulan-bulan Layani Rooney

Reuters

POLANDIA-UKRAINA: Bek Polandia Rafal Murawski (kiri) bertarung seru dengan penyerang Ukraina Andriy Shevchenko (kanan) dalam duel eksibisi di Slaski Stadium, Ludz, Sabtu (Minggu WIB). Ukraina menahan imbang 1-1 tuan rumah Polandia pada laga ujicoba antar tuan rumah bersama Euro 2012 tersebut.

LONDON (Waspada):Wayne Roone kembali menjadi buah bibir. Namun perbincangan seputar striker Manchester United itu bukan karena kegemilangannya di lapangan, melainkan soal kehidupan pribadinya. Pasalnya, seorang pelacur berumur 21 tahun Jenny Thompson mengaku selama berbulanbulan melayani nafsu Rooney. Padahal saat itu istrinya Coolen Mary tengah hamil anak pertamanya, Kai. “Wayne meminta saya melayaninya dan membayar saya. Dia seperti tidak peduli sedang mengkhianati Coolen,” ungkap Jenny, seperti dikutip News of the World, Minggu (5/9). Jenny mengaku dibayar 1.200 pounds untuk sekali kencan. Dia pun mengaku pernah diminta Rooney agar datang bersama temannya untuk melakukan threesome. “Wayne selalu menikmati pertemuan kami. Saya kira dia merasa tidak tersentuh dan tindakan-

nya tidak bisa dilihat orang lain,” papar Jenny. “Sebagai seorang wanita, saya tidak menyukainya jika itu terjadi pada saya, terutama ketika saya hamil,” katanya menambahkan. Hanya saja permasalahan ini tampaknya tidak terlalu merisaukan Federasi Sepakbola Inggris. Terbukti FA belum mengeluarkan keputusan apa pun menyikapi kasus dimaksud, padahal Rooney sedang dalam kamp The Three Lions untuk melakoni laga kualifikasi Euro 2012. Dalalm situsnya FA malah mengkonfirmasi, Rooney tetap akan berlaga membela Inggris untuk menghadapi Swiss di di Basel besok malam, setelah tampil gemilang saat menggilas Bulgaria 4-0 di Wembley, Jumat kemarin. (h01/okz/now) Wayne Rooney dituding mengkhianati istrinya Coolen Mary ketika tengah hamil.

Reuters

Capello Buka Ceki LONDON (Waspada): Pelatih Inggris Fabio Capello buka ceki mengenai alasannya mengubah peran Wayne Rooney saat Inggris membantai Bulgaria 4-0 pada laga perdana babak kualifikasi Euro 2012. “Saya memberikan peran berbeda kepada Rooney. Dia melakukannya dengan sangat baik,” beber Capello, Minggu (5/9). Penyerang Manchester United yang mengalami penurunan performa saat Piala Dunia 2010 itu, ternyata mampu memperlihatkan ketajamannya lagi berkat peran barunya. Rooney mengkreasi seluruh gol Three Lions. “Saya berbicara dengannya sebelum pertandingan dimulai,” jelas Capello. “Dia harus berada di depan dua gelandang tengah dan dari posisi itu dia maju dan bebas untuk mengatur segala sesuatunya. Rooney benar-benar menunjukkan kapasitasnya dengan baik,” puji pelatih asal Italia tersebut. Capello juga memuji performa winger Arsenal Theo Walcott, yang juga melengkapi

proses permainan sempurna yang ditunjukkan Rooney sepanjang pertandingan di Wembley, London, Jumat kemarin. Karenanya kapten Steven Gerrard berharap, Inggris mampu menjaga konsistensi saat menghadapi Swiss pada laga kedua Grup G, Selasa (7/9) malam GMT. Gerrard pun tak ingin Inggris senasib dengan Spanyol, yang dipermalukan Swiss 0-1 pada laga perdana Piala Dunia 2010. “Laga internasional jauh dari rumah selalu menyulitkan. Swiss sudah menunjukkan di Piala Dunia betapa bagusnya mereka saat mengalahkan Spanyol,” kenang Gerrard. “Jadi kami harus bermain dengan level yang sama (saat melawan Bulgaria) jika menginginkan hasil itu,” tambah kapten Liverpool itu dalam Goal. Tapi Inggris harus kehila-

ngan bek sentral Michael Dawson yang mengalami cedera lutut saat menggebuk Bulgaria. “Kami prihatin, dia akan mendapat hasil pemindaian dalam beberapa hari ke depan. Kami berharap tidak terlalu buruk,” jelas Gerrard. Dawson sendiri divonis harus beristirahat selama delapan pekan, setelah terpaksa ditarik keluar pada babak kedua di Wembley. Capello kemudian menggantikan Dawson dengan bek andalan Bolton Wanderers Gary Cahill, yang juga tampil gemilang sebagai benteng di depan kiper Joe Hart. Tottenham Hotspur mengklaim, Dawson cedera engkel kaki kiri hingga harus mengubur impiannya untuk tampil pada partai perdana babak penyisihan Liga Champions melawan Werder Bremen dan FC Twente. Spurs yang mengalami krisis di lini belakang dengan belum pulihnya kapten Ledley King, kini hanya berharap kepada bek William Gallas dan Sebastien Bassong untuk menjadi pengawal di area sentral pertahanan Lilywthites. (h01/bb/gsm/ap)

Saran Malouda PARIS (Waspada): Untuk mengatasi keterpurukan Prancis yang baru dipermalukan Belarusia 0-1 pada laga kualifikasi Euro 2012, Jumat kemarin, Florent Malouda (foto) pun memberi saran. Inti sarannya, Les Bleus mesti menanamkan rasa ‘benci kekalahan’ supaya terlecut untuk segera bangkit hingga akhirnya meraih hasil memuaskan. “Ada penurunan performa dan kami menemukan hal itu bukan saja pada pertandingan kemarin (melawan Belarusia). Kami butuh (rasa) benci kalah,” saran Malouda dalam TheWorld Game, Minggu (5/9). “Kami akan kembali lagi selangkah demi selangkah,” tambah gelandang subur Chelsea tersebut. Rentetan hasil buruk tim Ayam Jantan dimulai sejak kua-

lifikasi Piala Dunia 2010. Meski akhirnya lolos, Prancis tersingkir dari babak penyisihan grup dengan posisi juru kunci dan tanpa satu pun kemenangan. Kegagalan itu dibumbui dengan konflik internal yang akhirnya berujung pemogokan pemain. Semua rangkaian insiden itu membuat Les Bleus akhirnya terpuruk di peringkat 21 dunia. “Tidak mudah untuk pulih dan menemukan karakter kembali. Kekecewaan wajar, tapi harus ada perasaan ingin berubah. Semua kekalahan ini harus berhenti,” harap Malouda. Menjamu Belarusia, bencama Les Blues berlanjut akibat gol tunggal Sergei Kislyak menit 86. “Kami tidak bisa mengatakan kekalahan itu sebuah malapetaka. Kami harus melihat lebih dekat apa yang terjadi,” dalih

Problem Catur Putih melangkah, bisakah dia menang?

Jawaban di halaman A2.

Waspada/Austin Antariksa

Alejandro Tobar (dua kiri) tengah menanti kepastian pengurus dan manajemen PSMS Medan. Reuters

Pelatih Inggris Fabio Capello (kanan) mengungkapkan alasannya mengubah peran Wayne Rooney.

Fans Bosnia Keroyok Wakil Ketua Federasi LUKSEMBURG (Waspada): Deputi Federasi Sepakbola Bosnia Bogdan Ceko dikeroyok pendukung tim nasionalnya sendiri di Luksemburg. “Mereka bertanya apakah saya ketua Federasi. Saya bilang tidak,” ucap Ceko seperti dikutip dari The World Game, Minggu (5/9). Namun Ceko tetap diserang di depan halaman hotel tempat tim Bosnia menginap pasca melawan tuan rumah Luksemburg pada laga kualifikasi Eruo 2012, Jumat kemarin. “Mereka tanya lagi apakah saya wakilnya. Kemudian empat atau lima orang menghampiri dan mulai memukuli saya,” beber Ceko, yang dirawat di rumah sakit dengan cedera kepala. Belum ada tersangka dalam peristiwa ini, tapi media setempat melaporkan bahwa mereka adalah pendukung Bosnia yang tidak puas dengan aktivitas Federasi Sepakbola Bosnia. (okz)

Saadane Mundur AP

pelatih Laurent Blanc. “Memang kami tidak mengawalinya dengan baik. Kami tidak bisa memanfaatkan sejumlah peluang. Saat anda tidak bisa memenangkan laga, harusnya anda memastikan tidak akan menderita kekalahan,” katanya lagi. Blanc sempat membela diri karena pasukannya belum komplit, terlebih striker andalannya Karim Benzema masih dibekap cedera. (h01/vvn/goal/afp)

ALJIR (Antara/Reuters): Pelatih Aljazair Rabah Saadane (foto) mundur setelah timnya hanya bermain imbang 1-1 melawan Tanzania dalam duel kualifikasi Piala Afrika, Jumat kemarin. “Keputusannya untuk mundur telah disetujui oleh AP Presiden Federasi Sepakbola Aljazair (AFF) Mohamed Raouraoua,” kata Federasi Sepakbola Aljazair dalam situsnya yang dikutip Minggu (5/9). Saadane sebetulnya telah diperpanjang kontraknya dua tahun, Juli lalu, meskipun Aljazair kembali dari Piala Dunia 2010 di Afrika Selatan tanpa sebuah kemenanganpun. Pelatih berusia 64 tahun itu telah mengantar Aljazair menuju putaran final Piala Dunia yang pertama selama 24 tahun dan membawa timnya maju ke semifinal Piala Afrika tahun ini.

Nasib Tobar Di Ujung Tanduk MEDAN (Waspada): Wacana dibidiknya mantan pemain PSMS, Gustavo Chena, akan beralamat buruk buat legiun asing yang tengah menjalani seleksi di kubu Ayam Kinantan, Alejandro Tobar. Bila Chena jadi datang, otomatis posisi gelandang asal Chile itu terancam batal direkrut. Seperti diketahui posisi kedua pemain itu sama-sama playmaker. Belum ada kepastian mengenai hal itu, namun memang angin lebih kencang berhembus ke arah pencoretan. Ini tak lain karena kondisi fisik Tobar kerap dipermasalahkan. Selain itu,Tobar dicap lamban oleh tim pelatih dan enggan beradu fisik dengan lawan. Padahal performanya tidak bisa dikatakan buruk. Umpan-umpan yang kerap memanjakan striker pada beberapa laga ujicoba menjadi bukti Tobar belum habis. Saat melibas Medan Selection dalam laga ujicoba di Stadion Teladan Medan, Sabtu (4/9), tercatat beberapa kali, duet calon striker asing PSMS Amos Marah dan Roberto Acosta mendapatkan umpan-umpan matang yang selayaknya berbuah gol. “Tobar sebenarnya bagus, tapi saya yakin Chena akan lebih mobil di lapangan. Kita tunggu keputusan pelatih seperti apa,” ujar Sekretaris PSMS, Idris SE, Minggu (5/9). Sementara itu, Asisten Pelatih PSMS Suyono mengatakan keputusan akan nasib Tobar masih menunggu Pelatih Zulkarnain Pasaribu. Namun sinyal-sinyal pencoretan lebih kuat karena

PSMS Bidik Chena Asalkan harganya cocok,” MEDAN (Waspada): PSMS pungkas Sekretaris Umum Medan masih berupaya menPSMS, Idris SE, Minggu (5/9). dapatkan pemain asing berProses perekrutan pemain kualitas. Bukan hanya tengah yang pernah merumput di menyeleksi trio egiun asing Persija Jakarta, Persebaya SuraAlejandro Tobar (Chile), baya dan Deltras Sidoarjo ini Amos Marah (Liberia) dan memang berbeda dari legiun Roberto Acosta (Paraguay), asing lainnya. Jika biasanya satu nama lain tengah dibidik pemain asing terlebih dulu untuk memperkuat skuad menjalani proses seleksi yang Ayam Kinantan pada Divisi nantinya berujung ke negosiasi Utama Liga Indonesia 2010/ harga, Chena tak demikian. Hal 2011. itu dikarena kualitas pemain Nama tersebut tak lain berusia 28 tahun itu yang meadalah mantan pemain PSMS, nurut Idris tak perlu diragukan Gustavo Chena (foto). Gelanlagi. dang asal Argentina itu tengah Waspada/Austin Antariksa “Untuk Chena tidak perlu dalam proses negosiasi dengan PSMS. Pada partai puncak Liga Indoseleksi lagi. Kita langsung nego harga saja karena nesia tiga tahun silam, Chena turut andil mememang tidak ragu untuk kualitasnya,” tambah ngantarkan PSMS yang akhirnya merebut gelar pria berdarah Aceh itu. runner-up. Namun PSMS tidak sendirian memburu “Saat ini, kita ingin membawa Chena kembali Chena karena dikabarkan PSIS Semarang ingin ke Medan. Sementara kita lagi nego harga dan memperpanjang kontraknya. Sebelumnya, sepertinya seratus persen pemain yang berChena bergabung di paruh kedua kompetisi sangkutan mau main lagi di sini (PSMS-red). Divisi Utama lalu. (m33)

TTS SANTAPAN RAMADHAN Mendatar 2. Wajib dibayar sebelum shalat idulfitri. Puasa sebulan belum terangkat ke langit kecuali membayarnya sebelum shalat idulfitri. 6. Bebas dari neraka adalah (Pilih/ tulis tanpa spasi: Itqun Minan nar, Izatun alnafsi atau Atqin Minan nar). Menurut hadis, ada 60.000 orang setiap malam bebas dari neraka pada akhir Ramadhan. 8. Derma. Zakat fitrah yang dibayar setelah shalat idulfitri dianggap sebagai ______ biasa. 10. Minuman keras. 11. Surat ke-97 Al Quran tentang lailatul qadar. 13. Rasional; Menurut akal. 14. Tanpa berbuat kesalahan; Bebas dosa. 16. Ucapannya La haula wala quwwata illa billahil ‘aliyil-azim, artinya: tiada daya upaya dan kekuatan melainkan Allah Yang Maha Tinggi dan Maha Agung. 19. Tulis dalam bilangan, jumlah orang beriman yang akan masuk surga tanpa dihisab menurut HR Bukhari-Muslim. 21. Salah satu dari lima binatang berbahaya yang boleh dibunuh walau menggunakan ihram di tanah suci.

pelatih mengeluhkan performa Tobar yang kurang agresif di lapangan. “Masih menunggu bang Zul (Zulkarnain Pasaribu-red). Tim pelatih cenderung mencoretnya karena khawatir tidak akan sanggup menjalani satu musim kompetisi. Memang kita akui umpan-umpannya masih jempolan, tapi fisikNasib Tobar Di Ujung Tanduknya kurang memadai. Untuk popularitas memang masih ada, tapi Tobar yang sekarang tidak sama dengan lima tahun lalu,” pungkas Suyono. Kendati begitu, PSMS harus siap tidak mendapatkan apa-apa. Pasalnya belum tentu Chena menyepakati tawaran harga dari manajemen. Jika ini terjadi dan Tobar dicoret, bisabisa PSMS tak akan punya playmaker, posisi yang selama ini sangat dibutuhkan. Secara terpisah, Eddy Syahputra, pimpinan sekaligus pemilik Ligina Sportindo, agen yang membawahi Tobar meminta pengurus maupun manajemen Ayam Kinantan bersikap tegas dan segera memberi keputusan. “Untuk skill permainan, Tobar cukup berkualitas. Hanya saja, fisiknya memang saat ini belum prima. Maklum, karena hampir setahun terakhir dia tidak bermain akibat ada kesibukan dengan urusan rumah tangganya di Chile. Tapi kami yakin fisiknya sudah bisa kembali seperti semula dalam sebulan ke depan,” ujar Eddy saat dihubungi Waspada, Minggu (5/9). (m33/yuslan)

Menurun 1. Bacaannya Astaghfirullah hal ‘adzim, menjadi obat segala dosa. 2. Yang Memiliki Dua Cahaya (Pilih/ tulis tanpa spasi: Zu Syaukah, Zun Nurain atau Zun Nurdin), gelar untuk Usman bin Affan ra. 3. Masalah yang diperselisihkan antara lain mengenai mazhab, ijtihad dan masalah-masalah lain. 4. Deretan nama-nama mereka yang terpercaya meriwayatkan hadis; Sandaran untuk suatu keshahihan hadis. 5. Pemberian sebagai rasa kasih kepada siapa yang disukai. 7. Istri Nabi Muhammad SAW yang paling cerdas dan tajam ingatannya. 9. Pimpinan Ashabul-fil, laskar gajah. 12. Balasan hukuman sepadan dengan kejahatan yang diperbuat, misalnya bunuh dibalas dengan bunuh, kecuali pihak dirugikan memaafkan atau minta ganti rugi. 15. Menjelang kiamat, semua negeri akan diinjaknya, kecuali Makkah dan Madinah. 17. Tersendiri. Awal dan akhir Islam sama, kata hadis. 18. Tunanetra (bisa masuk surga jika bersabar selama hidupnya, kata hadis). 20. Haji (Inggris)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan hari ini: sangat mudah (*), bisa diselesaikan dalam waktu tak sampai empat menit. Jawabannya lihat di halaman A2 kolom 1.

1 9 2 3 4 1 9 8 4 3 7 8

7 5 8 3 8 6 8 7 9 3 2 5 1 4 6 1 9 4 2 6 4 3

5 8

2 7 1 4 6 8 4 3 3 6 8 5


Sport

A10

WASPADA Senin 6 September 2010

Tango Tiru El Matador AP

BUENOS AIRES (Waspada): Gelandang bertahan Inter Milan dan Argentina Esteban Cambiasso (foto), yakin gaya main Spanyol bisa menjadi panutan bagi setiap pesepakbola dunia. Karenanya Tango, menurut Cambiasso, perlu meniru gaya El Matador. “Anda tidak boleh mati sebelum mencoba bermain seperti apa yang dilakukan Spanyol,” pesan Cambiasso kepada La Nacion, yang dikutip Minggu (5/9). Komentar itu dilancarkan Cambiasso jelang laga ujicoba bergengsi Argentina kontra jawara Piala Dunia 2010 dan Piala Eropa 2008 itu di Buenos Aires,

Selasa (7/9) waktu Amerika. “Saya rasa Spanyol dan Barcelona adalah dua tim yang punya fans netral dan akan selalu setia membayar hanya untuk menyaksikan mereka bermain,” puji Cambiasso, yang kembali dipanggil membela Tango pasca lengsernya Diego Maradona. “Setiap pemain menikmati dan berusaha menerapkan cara mereka bermain. Dalam hal gaya dan ide, Barcelona adalah klub beruntung dari banyak klub lain di dunia,” ujarnya lagi. “Gagasan pelatih kami, Sergio Batista, mengadopsi mentalitas yang sama. Kami ingin bermain dengan mengua-sai bola seperti yang mereka lakukan dan tetap mendominasi sepanjang pertandingan. “Kami harus coba menjadi seperti mereka, karena kami cukup mempunyai bakat untuk melakukannya,” katanya menambahkan. Pola menyerang Namun untuk duel tersebut,

pelatih Sergio Batista belum menentukan siapa yang akan mendampingi Lionel Messi di lini depan Albiceleste. Padahal menurut kantor berita Telam, Batista sudah menetapkan pemain intinya dengan memakai pola menyerang 1-4-3-3. Posisi kiper akan tetap diisi Sergio Romero yang juga tampil di Piala Dunia 2010. Di lini belakang, Javier Zanetti akan kembali diturunkan bersama Martin Demichelis, Gabriel Milito dan Gabriel Heinze. Sedangkan di lini tengah, Batista akan menempatkan trio Javier Mascherano, Ever Banega dan Cambiasso, alternatifnya adalah Angel Di Maria. Di garis serang baru Lionel Messi yang dipastikan akan dipasang. Posisi penyerang tengah kemungkinan diisi Gonzalo Higuain, satu tempat lagi akan diperebutkan Carlos Tevez dan Andres D’Alessandro. Eksibisi melawan Matador

menjadi ujian bagi Batista untuk membuktikan kepantasannya menggantikan Maradona. Sedangkan Spanyol terus ‘menggila’ dengan membantai Liechtenstein 4-0 pada laga tandang kualifikasi Euro 2012, Jumat kemarin. “Mendapat kesempatan bermain di El Munomental (lawan Argentina) sangat saya harapkan. Seluruh rekan saya di tim juga tak sabar melakoni duel tersebut,” jelas gelandang Cesc Fabregas. Namun kapten Arsenal itu sadar, La Furia Roja bisa saja menelan kekalahan. “Kami semua tahu bila suatu hari nanti akan ada tim yang mengalahkan kami,” papar Febregas dalam AS. “Tapi yang terpenting, kami harus tetap tampil kompetitif sepanjang waktu. Jika nanti pada akhirnya kami harus kalah, maka kami akan jatuh tanpa harus kehilangan martabat,” katanya lagi. (h01/okz/goal/as)

Top Skor Spanyol 44 Gol: Raul Gonzalez David Villa 29 Gol: Fernando Hierro 27 Gol: Fernando Morientes 26 Gol: Emilio Butragueno Fernando Torres

Fernando Torres (belakang) tetap bangga kendati rekor golnya masih jauh di bawah tandemnya David Villa (depan). -AP-

Torres Bangga, Villa Optimis MADRID (Waspada): Striker Spanyol Fernando Torres tetap bangga dengan koleksi 26 golnya untuk tim nasional, apalagi itu sudah menyamai rekor gol legenda Real Madrid Emiliano Butragueno. “Sangat menyenangkan bisa menyamai rekor 26 gol milik Butragueno. Kini saya ingin terus menambah perbendaharaan gol untuk menyamai rekor 44 gol milik Villa dan Raul,” tekad Torres dalam AS, Minggu (5/9). Torres menggenapi torehan 26 golnya saat menyumbang

dua gol dalam kemenangan 40 El Matador atas Liechstenstein pada laga pembuka kualifikasi Euro 2012, Jumat kemarin. Bomber andalan Liverpool itu berarti menyamai torehan Butragueno yang membela La Furia Roja pada era 1984-1992. “Merupakan suatu kebanggaan tersendiri bagi saya bisa mencetak gol sebanyak ini dan bermain di tim ini,” tegas Torres. Tapi torehan golnya masih jauh di bawah tandemnya David Villa, yang kini hanya membutuhkan satu gol untuk melewati

rekor Raul Gonzales sebagai pencetak gol tersubur Spanyol dengan 44 gol. Villa sendiri optimis bisa melampaui rekor Raul, setelah dia mencetak gol ketika La Furia Roja membungkam Liechtenstein. Hanya saja dia masih menyesali kegagalan mencetak banyak gol di Tallinn. “Sangat menyedihkan karena saya memiliki peluang mencetak gol di menit-menit akhir laga, tapi bola masih melenceng,” sesal Villa. “Tapi saya tak terlalu buru-

buru dan yang terpenting tim melakukannya dengan baik, kami mendapat hasil maksimal di sini. Saya harap bisa terus membela timnas untuk jangka waktu lama,” tambah mantan maskotValencia, yang kini memperkuat Barcelona tersebut. Villa pun serius menatap lawatan El Matador ke Buenos Aires. “Jika terus bermain, maka saya akan terus mencetak gol. Meski hanya laga persahabatan, kami harus menang lawan Argentina,” tekad Villa. (h01/as/rtr)

Reuters

Fisik para pemain Brazil digenjot dalam sesi latihan di kamp Joan Gamper, dekat Barcelona, Spanyol, Sabtu (Minggu WIB).

Duet Perdana Robinho-Pato BARCELONA (Waspada): Pelatih Brazil Mano Menezes menduetkan duo penyerang AC Milan Robinho dan Alexandre Pato buat kali pertama dalam sesi latihan di Barcelona, Sabtu (Minggu WIB). Menezes yang sudah memanggil 21 pemain, menurut Globoesporte, Minggu (5/9), membagi pasukannya dalam dua tim, utama dan cadangan untuk kemudian saling bertanding. Tim Utama diisi oleh Diego Alves, Daniel Alves, David Luiz, Thiago Silva, Andre Santos, Lucas, Hernanes, Ramires, Carlos Eduardo, Pato dan Robinho. Sedangkan tim cadangan diramaikan Gabriel, Rafael, Alex, Henrique, Douglas Costa, Fernandinho, Philippe Coutinho, Sandro, Hulk dan Andre. Ini kali pertama Robinho bertandem dengan Pato. Robinho sendiri baru gabung dari Manchester City ke Milan, klub yang sudah tiga tahun dibela Pato. Duel berakhir dengan skor imbang 2-2. Dua gol tim utama diborong Carlos Eduardo, sedangkan tim cadangan membalasnya melalui Douglas Costa dan Philippe Coutinho. Menezes yang hanya mem-

bawa pemain berbasis di Eropa dijadwalkan akan menggenapkan pemainnya menjadi 22. Untuk itu Federasi Sepakbola Brazil (CBF) telah memanggil bek Barcelona Adriano Correa

untuk menggantikan bek Real Madrid Marcelo yang menderita gastroenteritis. Latihan tim Samba di kamp Joan Gamper yang dimulai Jumat lalu, diagendakan berakhir

Selasa (7/9). Selecao tidak akan memainkan laga persahabatan, tapi berlatih tanding melawan Barcelona B pada hari penutupan sesi latihan. (h01/vvn/goal)


Sport

WASPADA Senin 6 September 2010

A11

Dua Jelita Unjuk Kekuatan NEW YORK, AS (Waspada): Dua petenis cantik, Maria Sharapova (foto) dan Caroline Wozniacki, akhirnya bertemu di babak keempat turnamen AS Terbuka di Flushing Meadows menyusul kemenangan mereka pada Minggu (5/9).

AP

Djokovic Atasi Cuaca Panas NEW YORK, AS (Waspada): Unggulan ketiga Novak Djokovic (foto) masih menjadi salah satu favorit di turnamen AS Terbuka 2010 setelah melangkahkan kakinya ke putaran keempat dengan mengalahkan James Blake, Minggu (5/9). Tampil di Arthur Ashe Stadium, Djokovic yang biasa dijuluki The Serbian Sensation menundukkan Blake yang juga favorit tuan rumah dengan tiga set 6-1, 7-6, 6-3. Selain Blake, Djokovic juga mampu mengatasi cuaca panas yang terik. “Jika bermain dengan angin yang kuat, mental Anda harus sangat kuat untuk menemukan cara bermain yang baik. Ter-

utama jika pemain di seberang net Anda begitu agresif, mengambil semuanya di awal-awal dan memainkan game yang berisiko,” ujar Djokovic. Di babak 16 Besar, Djokovic akan bertemu petenis AS lainnya, yaitu unggulan ke-19 Mardy Fish. Sebelumnya, Fish menundukkan petenis Prancis Arnaud Clement 4-6, 6-3, 6-4, 1-6, 6-3. Unggulan kedua dan juara bertahan, Roger Federer, terus membuka peluangnya memburu mahkota grand slam ke17. Petenis peringkat dua dunia ini berhasil memastikan diri ke putaran empat usai menaklukkan petenis Prancis Paul-

Henri Mathieu 6-4, 6-3, 6-3. Pada putaran keempat nanti, FedEx akan menghadapi Jurgen Melzer. Unggulan ke-13 asal Austria ini lolos dengan menundukkan Juan Carlos Ferrero (Spanyol) 7-5, 6-3, 61. Di laga lain, petenis Swedia Robin Soderling juga berhasil melenggang usai mengandaskan petenis Belanda Thiemo de Bakker 6-2, 6-3, 6-3. Petenis muda Jepang, Kei Nishikori, kali ini bernasib sial karena harus mengundurkan diri saat tertinggal dari Albert Montanes (Spanyol) 6-2, 2-1. Pelengkapbabak16Besarlainnyaadalah duo Prancis, Gael Monfils dan Richard Gasquet. (m33/ap)

Petenis Denmark Caroline Woz n i a c k i m a j u s e t e l a h menyingkirkan petenis Taiwan Chan Jung-yan 6-1 6-0. Wozniacki, tahun lalu lolos ke final, merupakan unggulan pertama dan baru kehilangan tiga game dalam tiga laga. Ini merupakan prestasi terbaik di AS Terbuka sejak Chris Evert kehilangan dua game dalam tiga pertandingan lawa pada 1976. Selain Wozniacki, petenis Rusia Maria Sharapova yang tengah berusaha mengembalikan reputasinya juga lolos ke babak keempat lewat kemenangan mutlak atas petenis muda AS Betarice Capra. Melawan Capra yang semula diharapkan tampil mengejutkan layaknya Melina Oudin tahun lalu, tampak tidak berdaya dan kalah kelas dari Sharapova yang sempat mencicipi aroma ratu tenis dunia. Tanpa kesulitan, Masha menang telak 6-0, 6-0. Menanggapi lawan berikutnya adalah unggulan pertama, Sharapova memujiWozniacki sebagai pemain lengkap dan terbaik saat ini. “Ia mampu berlari sepanjang hari dan mengembalikan bola kita. Ia juga mampu mengubah irama permainan de-

AP

ngan baik dan merepotkan lawannya. Karena itulah, ia kini berada di puncak,” kata Sharapova yang pernah mengalahkan Wozniacki dua kali pada 2008. Petenis Rusia lain, Maria Kirilenko, harus terhenti lajunya akibat tak kuasa meladeni kompatriotnya, Svetlana Kuznetsova.

Kovalainen Semangat Hadapi Monza

Reuters

Rudy Fernandez memastikan kemenangan Spanyol atas Yunani dan bersiap-siap meladeni tantangan Serbia dalam perempatfinal Kejuaraan Dunia Bola Basket 2010.

Spanyol Tantang Serbia Di 8 Besar ISTANBUL (Waspada): Tim nasional bola basket Spanyol menembus babak 16 Besar Kejuaraan Dunia Bola Basket 2010 usai mengalahkan Yunani 80-72 di Sinan Erdem Dome, Istanbul, Minggu (5/9). Spanyol memimpin jalannya pertandingan hingga akhir babak pertama dengan keunggulan 37-31. Namun,Yunani bangkit di set ketiga dan hanya kalah satu poin 52-51 di akhir set ketiga. Pertandingan di kuarter terakhir semakin menarik. Spanyol

berhasil melakukan delapan dari 18 percobaan lemparan tiga angka dan menekan hingga 133 untuk memimpin jauh. Yunani sempat mendekati perolehan poin menjadi 72-68, tapi Ricky Rubio kembali menjauhkan Spanyol dengan dua kali lemparan three point. Spanyol akhirnya melangkah ke perempatfinal setelah menang 80-72. Rudy Fernandez yang bermain di NBA bersama Portland Trailblazers mencetak 14 poin untuk Spanyol, sedangkan duo

Yunani Dimitrios Dimantidis dan Nikolaos Zisis sama-sama mengoleksi 16 poin. Di babak perempatfinal, lawan Spanyol adalah Serbia yang menang tipis 73-72 atas Kroasia. Aleksander Rasic menjadi pahlawan kemenangan Serbia saat mencetak lima poin di 21 detik akhir pertandingan. “Pertandingan sangat, sangat tangguh malam ini. Sangat diperlukan bermain 40 menit untuk mengalahkan tim bagus seperti Krosia,” ujar pelatih Serbia Dusan Ivkovic. (m33/rtr)

Fernando Alonso (kiri) dan Felipe Massa wajib hadir dalam sidan WMSC.

AP

Alonso-Massa Harus Hadiri Sidang MARANELLO, Italia (Waspada): Duo pembalap Ferrari, Fernando Alonso dan Felipe Massa, telah dipanggil oleh FIA untuk menghadiri persidangan disipliner World Motor Sport Council (WMSC). Seperti diberitakan Daily AS, Minggu (5/9), Alonso dan Massa diharuskan hadir dalam persidangan yang dihelat di Paris pada 8 September mendatang

ataupun melalui video link. Tim Kuda Jingkrak itu harus menjalani persidangan atas tindakan team order yang dilakukannya di GP Jerman silam. Tindakan ini melanggar aturan FIA yang dianggap telah memanipulasi hasil balapan. Banyak pihak yang berharap WMSC bisa memberikan sangsi yang tegas untuk tim berbasis di Maranello itu. Namun,

Alonso mencoba menghadapinya dengan santai. “Tidak, saya rasa tidak demikian. Kami santai,” ujarnya. Selain dua pembalapnya, Ketua Tim Stefano Domenicalli dan tim manajer Massimo Rivola juga dijadwalkan akan hadir. Untuk hasil keputusan sidang akan dipublikasikan sesegera mungkin. (m33/auto)

nyol) 6-0, 6-1. Jika menang, Kuznetsova bakal menghadapi pemenang duel antara Wozniacki dan Sharapova di perempatfinal. Kejutan besar tetap mewarnai putaran ketiga tunggal putri. Kali ini, korbannya adalah unggulan keempat asal Serbia, Jelena Jankovic, yang diharuskan ang-

kat koper lebih cepat lantaran dibekap petenis non unggulan Estonia, Kaia Kanepi, 6-2, 7-6. Turut membukukan kemenangan adalah Vera Zvonareva (Rusia), Yanina Wickmayer (Belgia) dan Andrea Petkovic (Jerman). (m33/ap)

Mobil Jenson Button yang ditabrak Sebastian Vettel pada GP Belgia lalu. -AP-

HINGHAM, AS (Waspada): Heikki Kovalainen (foto) tak sabar melanjutkan seri F1 di Monza, Italia, pekan depan. Bagi pembalap Lotus Racing, Monza adalah sirkuit yang memiliki keistimewaan tersendiri. Pembalap Finlandia berusia 28 tahun memang hanya finish di posisi 16 pada GP Belgia pekan lalu. Kendati begitu, hasil tersebut tak menyurutkan semangat Kovalainen menyambut GP Italia, 12 September mendatang. “Setelah seri di Spa, saya dalam kondisi baik, secara fisik maupun mental,” aku Kovalainen sebagaimana dikutip GPUpdate, Minggu (5/9). “Monza merupakan salah satu atraksi terbesar sepanjang musim, akan sangat menyenangkan kembali ke Italia. Ini adalah sirkuit yang sangat berbeda serta memiliki atmosfer hebat,” cetusnya. “Tentu saja, Ferrari akan mendapat dukungan dari sebagian besar penonton. Tapi, begitu pula dengan semua fans yang mencintai olahraga F1,” tutur pembalap yang melakukan debutnya di ajang F1 pada GP Australia 2007. “Saya rasa ini akan menjadi akhir pekan yang menyenangkan. Bagi pembalap seperti kami, Monza adalah trek berkarakter cepat. Selain itu, dengan konfigurasi downforce yang rendah, balapan akan sangat menarik,” imbuh mantan driver McLaren itu “Ini juga akan menjadi suguhan menyenangkan bagi fans. Semua pembalap dipaksa menggeber kecepatan. Alhasil, trek akan menjadi pemandangan menakjubkan,” pungkas Kovalainen. (m33/kez)

Jawara AS 2004 itu membukukan kemenangan ke-100 di ajang grand slam usai melibas Kirilenko 6-3, 6-4. Di babak berikutnya, Kuznetsova akan menantang wakil Slovakia Dominika Cibulkova yang sukses mengkandaskan Lourdes Dominguez Lino (Spa-

AP

Amarah Button Belum Reda WOKING, Inggris (Waspada): Pembalap McLaren, Jenson Button, masih belum bisa meredakan amarah terhadap Sebastian Vettel setelah pembalap Red Bull itu membuatnya tersingkir di GP Belgia pekan lalu. Button terpaksa gagal finish di Sirkuit SpaFrancorchampis saat cukup aman berada di posisi kedua, setelah Vettel lepas kendali dan mencoba menyalip pembalap Inggris itu. Insiden itu akhirnya terjadi setelah sebelumnya Vettel berulang kali terlihat terlalu bernafsu mendahului Button. Tabrakan itu membuat

Button tertinggal 35 poin dari rekan setimnya, Lewis Hamilton, yang kokoh di puncak klasemen dengan 182 poin. Button sendiri mengaku belum bisa memahami cara berpikir Vettel. “Pandangan saya masih belum berubah. Tadinya saya cukup bingung dengan apa yang dilakukan Sebastian. Kini, saya masih merasa apa yang dilakukannya benar-benar tidak perlu,” tegas Button. “Dia tidak perlu menyalip di situ dan saya sendiri tak berusaha menutupnya, jadi harusnya mobilnya tak perlu sefrontal

itu saat menabrak saya,” lanjut Button geram. “Yang paling menjengkelkan adalah saya kehilangan poin yang sangat besar. Saya tahu masih ada 150 poin lagi untuk di-rebut, tetapi itu tak terlalu membantu karena sekarang saya tertinggal 35 poin dari Lewis,” terang sang juara bertahan. “Semuanya masih mungkin, tetapi untuk saat ini Anda harus bisa mengambil poin sebanyak mungkin dan insiden di Spa itu benar-benar tidak perlu,” ketus Button lagi. (m33/auto)


Sport

A12

WASPADA

Senin 6 September 2010

Pedrosa Panaskan Persaingan MISANO, Italia (Waspada): Dani Pedrosa (foto) membukukan prestasi terbaiknya dalam ajang MotoGP ketika mendominasi Sirkuit Misano, Italia, Minggu (5/9), sekaligus mengatasi Jorge Lorenzo.

Reuters

Rossi Pasang Jam Di Helm MISANO, Italia (Waspada): Meski sudah mengoleksi enam gelar juara dunia MotoGP dan gelar di kelas lainnya, Valentino Rossi (foto) ternyata masih tidak tepat waktu saat menjalani balapan. Hal itu berusaha diatasinya lewat helm baru. Ada yang berbeda dari Valentino Rossi saat menjalani seri lomba MotoGP San Marino, Minggu (5/9). Pasalnya, Rossi menggunakan helm baru bergambarkan jam besar di atas helmnya. Ketika didesak wartawan untuk menyebutkan arti dari helm anyarnya tersebut, The Doctor mengaku jam besar yang ada di atas helmnya bertujuan untuk mengingatkannya dengan waktu kualifikasi atau saat balapan. “Helm ini adalah lelucon mengenai penempatan wak tu saya. Kami harus mena-

ruh jam besar di atasnya dengan helm berbeda menunjukkan waktu yang tepat di setiap sesi balapan jadi saya bisa datang tempat waktu,” ujar Rossi seperti dikutip Autosport. Rossi sendiri berhasil memperbaiki performa pada MotoGP San Marino ketika mengakhiri lomba di urutan ketiga. Ini tak lain karena kondisi pundaknya sudah membaik dari sebelumnya. “Saya merasa lebih baik dengan kaki saya, tapi trek ini sangat menuntut pundak saya. Saya mengalami sakit dan kehilangan 0,1 detik setiap mengerem. Beruntung sakit ini tidak semakin buruk saat balapan tadi,” pungkas Rossi yang tertinggal dari Dani Pedrosa (Repsol Honda) dan rekan setimnya di FIAT Yamaha, Jorge Lorenzo. (m33/auto)

AP

San Marino Makan Korban MISANO, Italia (Waspada): Kabar buruk datang dari MotoGP San Marino, Minggu (5/9), setelah pembalap Jepang Shoya Tomizawa (foto) meninggal dunia akibat mengalami kecelakaan di balapan Moto2 atau kelas 250 cc di Sirkuit Misano. Pembalap berusia 19 tahun ini meninggal setelah mengalami cedera parah setelah terjatuh dalam balapan yang akhirnya dimenangkan Toni Elias itu. Seperti dilansir Autosport, Tomizawa mengalami luka parah setelah disambar Alex de Angelis dan Scott Redding yang memacu motor dengan kencang. Usai kecelakaan itu, Tomizawa langsung dibawa ke rumah sakit terdekat. Sayang, Tomizawa gagal tertolong dan menghembuskan nafas terakhir pukul 14.20 waktu setempat. Tomizawa merupakan salah satu sensasi di balapan Moto2 musim ini, namun dedikasinya pada dunia balap

harus dibayar dengan nyawa. (m33/auto)

AP

.

Rider Repsol Honda asal Spanyol dan pemegang pole position itu menyelesaikan lomba dengan catatan waktu 44 menit 22,059 detik, setelah mendominasi 28 putaran. Hasil ini melengkapi akhir pekan gemilang bagi Pedrosa, yang juga mencatat waktu tercepat free practice serta merebut kualifikasi sehari sebelumnya. Lorenzo, pemimpin kejuaraan dunia, harus rela finish kedua setelah terpaut 1,9 detik di belakang Pedrosa disusul juara dunia dan pemenang tahun lalu Valentino Rossi yang tertinggal 3,2 detik. Teammate Pedrosa, Andrez Dovizioso, menyelesaikan balapan di urutan keempat atau tepat di depan andalan Ducati Marlboro, Casey Stoner. Gelar juara di MotoGP San Marino ini merupakan kemenangan back to back pertama bagi Pedrosa, setelah menjuarai MotoGP Indianapolis di AS pekan lalu. Dengan sukses tersebut, Pedrosa menuai kemenangan

keempat musim ini yang juga torehan terbaiknya di kelas premier sekaligus membuka peluang bersaing dengan Lorenzo dalam perebutan gelar. Sementara Rossi harus melewati Stoner dan berta-

han dari kejaran Dovizioso untuk merebut podium ketiga agar menjaga ambisinya bertatap muka dengan para pendukungnya di Misano yang hanya berjarak 12 km dari kediamannya di Urbino.

Hasil MotoGP San Marino Dani Pedrosa Jorge Lorenzo Valentino Rossi Andrea Dovizioso Casey Stoner Ben Spies Colin Edwards Alvaro Bautista Hector Barbera Marco Melandri Aleix Espargaro Hiroshi Aoyama Randy de Puniet Marco Simoncelli

(Spanyol/Repsol Honda) (Spanyol/Fiat Yamaha) (Italia/Fiat Yamaha) (Italia/Repsol Honda) (Australia/Ducati Marlboro) (AS/Yamaha Tech3) (AS/Yamaha Tech3) (Spanyol/ Rizla Suzuki) (Spanyol/Aspar Ducati) (Italia/Honda Gresini) (Spanyol/Pramac Ducati) (Jepang/Interwetten Honda) (Prancis/LCR Honda) (Italia/Honda Gresini)

44:22.059 44:23.959 44:25.242 44:28.513 44:40.538 44:50.444 44:56.993 45:00.216 45:03.002 45:04.436 45:07.965 45:08.453 45:12.054 45:45.202

Selepas GP San Marino, Pedrosa berhasil memperkecil selisih angka di klasemen kejuaraan dunia dengan

total nilai 208, terpaut 63 poin dari Lorenzo dengan balapan menyisakan enam seri lagi. (h09/ap/mgp)


Sumatera Utara

WASPADA Senin 6 September 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:27 12:40 12:28 12:35 12:34 12:31 12:27 12:23 12:30 12:29

‘Ashar 15:35 15:46 15:36 15:41 15:41 15:42 15:37 15:33 15:39 15:37

Magrib 18:33 18:47 18:34 18:42 18:41 18:36 18:33 18:29 18:36 18:36

‘Isya

Imsak

Shubuh Syuruq

Kota

19:42 19:56 19:43 19:51 19:50 19:44 19:42 19:38 19:45 19:45

04:53 05:05 04:54 05:00 05:00 04:59 04:54 04:50 04:57 04:56

05:03 05:15 05:04 05:10 05:10 05:09 05:04 05:00 05:07 05:06

L.Seumawe 12:33 L. Pakam 12:26 Sei Rampah12:25 Meulaboh 12:37 P.Sidimpuan12:24 P. Siantar 12:25 Balige 12:25 R. Prapat 12:22 Sabang 12:40 Pandan 12:26

06:18 06:31 06:19 06:25 06:25 06:24 06:19 06:15 06:22 06:21

Zhuhur ‘Ashar 15:39 15:35 15:34 15:45 15:36 15:35 15:35 15:33 15:45 15:37

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:40 18:32 18:31 18:43 18:29 18:31 18:31 18:27 18:47 18:31

19:49 19:41 19:40 19:52 19:38 19:40 19:39 19:36 19:57 19:40

04:58 04:53 04:52 05:03 04:52 04:52 04:53 04:50 05:05 04:54

05:08 05:03 05:02 05:13 05:02 05:02 05:03 05:00 05:15 05:04

Sibolga 12:26 Sidikalang 12:28 Sigli 12:38 Singkil 12:30 Stabat 12:27 Takengon 12:34 T.Balai 12:22 Tapaktuan 12:33 Tarutung 12:26 T.Tinggi 12:25

06:24 06:18 06:17 06:28 06:17 06:17 06:18 06:14 06:30 06:19

Zhuhur ‘Ashar 15:37 15:37 15:44 15:41 15:36 15:41 15:32 15:42 15:36 15:34

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:31 18:33 18:45 18:36 18:33 18:41 18:28 18:39 18:31 18:31

19:40 19:42 19:54 19:44 19:42 19:50 19:37 19:47 19:40 19:40

04:54 04:55 05:03 04:58 04:54 05:00 04:50 05:00 04:53 04:52

05:04 05:05 05:13 05:08 05:04 05:10 05:00 05:10 05:03 05:02

Panyabungan 12:23 Teluk Dalam12:30 Salak 12:28 Limapuluh 12:24 Parapat 12:26 GunungTua 12:23 Sibuhuan 12:23 Lhoksukon 12:32 D.Sanggul 12:26 Kotapinang 12:21 AekKanopan 12:23

06:19 06:20 06:28 06:23 06:19 06:25 06:14 06:25 06:18 06:17

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur ‘Ashar 15:35 15:42 15:38 15:33 15:35 15:34 15:34 15:39 15:37 15:32 15:33

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:28 18:34 18:34 18:30 18:31 18:28 18:27 18:39 18:32 18:26 18:28

19:36 19:43 19:42 19:38 19:40 19:36 19:36 19:48 19:40 19:35 19:37

04:52 04:59 04:55 04:51 04:53 04:51 04:51 04:58 04:54 04:49 04:50

05:02 05:09 05:05 05:01 05:03 05:01 05:01 05:08 05:04 04:59 05:00

06:16 06:23 06:20 06:16 06:18 06:16 06:16 06:23 06:19 06:14 06:15

Secara Garis Besar, Jalinsum Langkat Aman Dilalui

Kapolsek Kuala Dimutasi Ke Humbahas

STABAT (Waspada): Pemudik yang melintas di Jalinsum Kab. Langkat tidak perlu khawatir dengan kondisi ruas jalan di sana, sebab Jalinsum Langkat bebas dari jalan yang berlubang maupun kupak-kapik. Pantauan Waspada Minggu (5/9), Jalinsum di Kec. Stabat, Hinai, Tanjungpura hingga ruas jalan di Kec. Gebang dapat dilalui dengan kecepatan tinggi jika menggunakan mobil maupun motor. Namun beberapa ruas jalan yang bergelombang di Kec. Gebang perlu diwaspadai pengguna kendaraan bermotor untuk menghindari kecelakaan lalulintas. Selain itu di Jalinsum Kec. Stabat, pengguna kendaraan harus hati-hati melintas di kawasan Sei Dendang tepatnya di sekitar Kantor PAN Langkat jika melaju dari arah Medan menuju Aceh, sebab terdapat beberapa titik tumpukan material bangunan yang terlalu ke badan jalan. Akibatnya ruas jalan semakin sempit. Kondisi itu telah terlihat dalam dua pekan terakhir. Belum ada tindakan petugas berwenang maupun dari pemilik material yang menyadari kondisi itu akan berbahaya untuk pengguna jalan. Informasi yang diperoleh dari Jajaran Kepolisian Resor Langkat, pada tahun 2008 tercatat 138 kasus kecelakaan lalulintas dan 71 kasus di tahun 2009. Meskipun jumlahnya menurun belum termasuk kasus Laka tahun 2010, berdasarkan catatan Waspada kecelakaan lalulintas tergolong tinggi di Jalinsum Hinai. Karena itu khusus bagi pemudik harus meningkatkan kehati-hatian melintas di Jalinsum tersebut. Salah satu faktor kasus Lakalantas sering terjadi di Hinai karena ruas jalan yang sempit. Terlepas dari itu, situasi di Terminal Bus Antar Provinsi Pasar X Tanjungberingin Hinai masih terlihat sama seperti hari-hari sebelumnya. Belum terlihat lonjakan penumpang pada H-5 lebaran. Salah seorang petugas di sana memprediksi arus mudik akan meningkat pada H-3 lebaran. (a38)

STABAT(Waspada):Kapolsek Kuala Resor Langkat AKP Pawang Ternalem Sembiring dimutasi ke Polres Humbahas sebagai Kasat Lantas. Penggantinya AKP RA. Turnip dari Penyidik Propam Poldasu. Serah terima jabatan berlangsungdiMapolresLangkat, Sabtu (4/9). Kapolres mengucapkan terima kasih kepada pejabat lama atas dedikasi dan pengabdiannya dalam melaksanakan tugas. Sementara untuk pejabat baru diharapkanmampumeneruskan kebijakan-kebijakan yang telah terjalin bersama masyarakat dan mampu meningkatkan situasi kamtibmas yang kondusif di wilayah tugas. (a38)

Pengendara Supra X Tewas , Sepeda Motor Terlempar 100 Meter TELUKMENGKUDU (Waspada): Pengendara Sepeda motor Honda Jenis Supra X nomor polisi BK 2924 AR, Rafles Tito Sagala,25, warga Jalan Sukaria nomor 58 Kelurahan Sidorejo, Kec.Medan Tembung tewas di tempat kejadian perkara (TKP) sementara sepeda motornya terbang sejauh 100 meter, Sabtu (4/9) sekira pukul 15:30 di Jalinsum KM 49-50 di depan Masjid Al Islah, Dusun Bhakti, Desa Sei Buluh, Kec.Teluk Mengkudu, Kab.Serdang Bedagai. Rahmat Nasution,52, warga di sana mengatakan, saat itu dirinya berada di sekitar masjid yang berjarak sekitar 25 meter dan sebelum peristiwa itu terlihat sepeda motor melaju dengan kecepatan tinggi dari arah Tebingtinggi menuju Medan kemudian yang dari arah berlawanan sepertinya berselisihan dengan becak bermotor jenis barang yang membawa kayu, lalu oleng dan korban terjatuh sedangkan sepeda motor meluncur sejauh 100 meter, terangnya kepada Waspada. “ Spontan saya dan warga sekitar mendatangi korban yang ternyata telah meninggal dengan luka dibahagian kepala yang cukup serius, sedangkan sepeda motor berhenti tepat di depan sebuah doorsmeer,”tambah Rahmat. Adi, 21, pekerja doorsmeer kepada Waspada mengaku sangat terkejut karena dari arah Tebingtinggi ada satu unit sepeda motor meluncur kencang dan berhenti setelah menubruk dinding jembatan tepat berada di depan kami bekerja, setelah kami lihat ternyata pengemudinya telah tewas sejauh sekitar 100 meter. Satlantas Polres Sergai yang turun keelokasi kejadian langsung mengevakuasi korban ke RSU Sultan Sulaiman Sergai di Desa Firdaus berikut sepeda motor diamankan di Mapolantas.(ces)

Kader PDI-P Buka Bersama Puluhan Anak Yatim LUBUKPAKAM (Waspada): Sasaran strategis PDI-P tidak hanya menyejahterakan kader dan simpatisan partai, tetapi juga memiliki sasaran strategis untuk meningkatkan kesejahteraan rakyat. Kebesaran suatu partai dapat dirasakan oleh masyarakat, sehingga masyarakat dapat merasakan arti kehadiran suatu partai politik dalam memberikan nuansa untuk meningkatkan perekonomian masyarakat, terkait dalam memperjuangkan aspirasi masyarakat itu sendiri. Demikian Ketua DPC PDI-P Deliserdang, Apoan Simanungkalit pada acara buka puasa bersama puluhan anak yatim dan pengurus PAC dari 22 kecamatan dan kader, Jumat (2/9) sore di Kantor Sekretariat DPC Jalan Tirta Deli Lubuk Pakam. Simanungkalit juga menyampaikan program kerja ke depan tidak hanya berdasarkan retorika yang berkembang dalam masyarakat, tetapi harus dirancang berdasarkan data yang valid. Kegiatan tali asih ini juga berkaitan dengan konsolidasi partai yang dipimpin pengurus DPP, Ir Hasto Kristianto, MM selaku Sekretaris didampingi Mahendra, pengurus DPD Sumut Zakaria Bangun, SH.MM dan Ahyar Nasution dan Syahrul Efendi Siregar berlangsung dialogis dengan banyaknya kader yang menyampaikan situasi dan kondisi yang harus dibenahi di wilayah Deliserdang. Buka puasa bersama yang juga dihadiri pengurus Baitul Mulimin Sumut, KH Anwar Nur Siregar dan H Zainal Arifin tampak hikmad yang dirangkai dengan pemberian santunan kepada 40 orang anak yatim yang tersebar di Deliserdang. (a06)

HMI, PMII, IMM Dan HIMMAH Gelar Kegiatan Hikmah Ramadhan PERCUT SEI TUAN (Waspada): Empat organisasi mahasiswa Islam yang terdiri dari Badan koordinasi Himpunan Mahasiswa Islam (Badko HMI) Sumut, Pengurus Koordinator Cabang Pergerakan Mahasiswa Islam Indonesia (PKC PMII) Sumut, Dewan Pimpinan Daerah Ikatan Mahasiswa Muhammadiyah (DPD IMM) Sumut dan Pengurus Wilayah Himpunan Mahasiwa Al-Washliyah (HIMMAH) Sumut, dengan kepanitiaan bersama, melakukan kegiatan “Malam Hikmah Ramadhan”. Kegiatan berupa buka puasa bersama masyarakat Perumnas Mandala dan santunan untuk duafa dan anak yatim tersebut digelar hari Senin (6/9) di Masjid Raya Al-Muhajirin Perumnas Mandala. Gubernur Sumatera Utara, H Syamsul Arifin, SE dan Kapolda Sumut, Irjenpol Oegroseno, SH sudah mengkonfirmasi akan menghadiri acara tersebut. Kegitan “malam hikmah Ramadhan” ini bertujuan untuk konsolidasi organisasi mahasiswa Islam, meningkatkan ukhuwah islamiyah dan mengasah kepekaan sosial terhadap semama. Ini juga merupakan implementasi salah satu tridharma perguruan tinggi, yakni pengabdian mahasiswa kepada masyarakat, ujar A. Jabidi Ritonga, ketua panitia. Syamsir Pohan, Ketua Umum Badko HMI Sumut menambahkan, kegiatan “hikmah malam Ramadhan” ini merupakan momen langka. Kegiatan dan kepanitiaan bersama empat organsisasi mahasiswa Islam - dengan latar belakang berbeda ini - tentu patut mendapat apresiasi dari seluruh kelompok masyarakat di Sumut. Bersamaan kegiatan itu, nantinya kami akan menggalang dana untuk membantu meringankan korban letusan Gunung Sinabung, ujar Alimnur Nasution, Ketua Umum PW HIMMAH Sumut. Dengan ini, kami mengundang mahasiswa Islam dan ormas-ormas Islam untuk dapat menghadiri buka puasa bersama dan santunan duafa. Acara diadakan Senin (6/9) pukul 17:00 hingga 19:30, tambah Alimnur. (m43)

Waspada/Sapriadi

BAHU JALAN TINGGI: Bahu jalan Jalinsum Medan-Rantauprapat, tepatnya di sekitar wilayah Bunut, Kisaran, terlalu tinggi sehingga bisa menyebabkan kendaraan tergelincir dan memicu laka lantas, mengingat arus mudik sudah mulai memadati wilayah itu, sehingga diharapakan perhatiaan instansi sekitar untuk memperbaikinya. Foto direkam, Minggu (5/9).

Antisipasi Kemacetan, Alat Berat Disiagakan Di Aek Latong MEDAN (Waspada): Bupati Tapanuli Selatan (Tapsel) H Syahrul M Pasaribu menyatakan sudah menyiagakan satuan kerja perangkat daerah (SKPD) yang berkompeten khususnya pihak Pekerjaan Umum Daerah (PUD) setempat untuk stand by. Pihaknya juga menyiagakan alat berat demi menjaga kelancaran arus lalulintas khususnya di kawasan rawat macet dan rawan longsor seperti di kawasan sekitar Aek Latong. Hal itu disampaikan Syahrul kepada wartawan di Kantor Gubsu, Sabtu (4/9). Bahkan pihak Pemkab, lanjutnya, telah berkoordinasi dengan Kepala Dinas PU Bina Marga Provinsi Sumut, H Marapinta Harahap

yang juga telah mengkoordinasikannya pula kepada Balai Besar Jalan dan Jembatan Sumut untuk menyiagakan alat-alat berat khususnya di kawasan sekitar Aek Latong. Tentang kesiapan Kabupaten Tapsel menerima para pemudik termasuk posisi wilayahnya sebagai perlintasan pemudik ke arah Mandailing Natal dan lintas barat Pulau Sumatera secara umum bupati mengemukakan Insya Allah berbagai persiapan telah dilakukan bersama Muspida dengan leading sector pihak Polres setempat yang juga sudah menggelar Posko Ketupat Lebaran. “Bupati Tapsel siap mem-back up,” ujarnya seraya menilai positip telah digelarnya Apel Siaga Ketupat Lebaran di kabupaten tersebut. Sembari mengharapkan agar masyarakat merayakan Lebaran dengan penuh khusyuk dalam suasana religius bupati menjelaskan, pihaknya

telah memerintahkan Dinas Kesehatan agar seluruh Puskesmas tetap buka selama Lebaran untuk memberikan pelayanan yang baik kepada masyarakat yang membutuhkannya. Aktualisasikan MHB Pada kesempatan itu Syahrul meminta para pemudik Lebaran dari parserahan (perantauan – red) yang saat ini mulai berangsung-angsur datang dalam jumlah besar ke kampung halamannya masingmasing di kabupaten tersebut hendaklah kembali mengaktualisasikan semangat marsipature hutana be (MHB) atau peduli untuk membangun kampung halaman. “Saat ini arus pemudik yang tiba di Tapsel sudah semakin besar dan diperkirakan puncaknya pada pekan-pekan ini.Wajar jika potensi pemudik ke Tapsel sangat besar, karena putra-putri asal Tapsel yang berada di

parserahan dari dulu dikenal cukup besar, yang sebagian besar di antaranya merupakan tokoh-tokoh berpengaruh berskala nasional,” ujarnya. Syahrul yang datang ke Medan untuk beberapa acara di antaranya menghadiri buka puasa bersama dan pembukaan Rapimwil Partai Persatuan Pembangunan (PPP) Sumut mengakui, semangat MHB yang dipopulerkan H Raja Inal Siregar saat menjabat Gubsu beberapa tahun lalu akan terus relevan untuk diaktualisasikan sebagai stimulan pembangunan daerah atas partispasi perantau. “Masa-masa mudik Lebaran ini merupakan momentum strategis bagi para perantau yang pulang kampung untuk mengaktualisasikan semangat MHB itu apalagi kondisi Tapsel masih cukup besar mengharapkan peranserta para perantau termasuk para tokoh asal Tapsel di Jakarta ikut berjuang agar

infrastruktur Tapsel dapat dibenahi lebih signifikan atas bantuan pemerintah pusat dan potensi para perantau dioptimalkan,” ujarnya. Melalui peran serta semua pihak, termasuk peranserta para perantau asal Tapsel yang cukup potensi di berbagai wilayah di nusantara khususnya di Jakarta maka pembangunan Tapsel akan lebih maju sehingga segala potensi sumberdaya manusia (SDM) dan sumberdaya alam (SDA) Tapsel dapat dikonsolidasikan untuk membangun Tapsel. “Hal ini sangat strategis sehingga diharapkan Tapsel sebagai kabupaten induk benarbenar menjadi leading sector bagi empat kawasan pemekarannya yang kini juga sudah relatif maju yaitu Kabupaten Mandailing Natal, Padanglawas, Padanglawas Utara dan Kota Padangsidimpuan,” tuturnya. (m19)

Ketua Hanura T. Tinggi

Muswil Partai Hanura Sumut Secara De Facto Sah TEBINGTINGGI (Waspada): MusyawarahWilayah Partai Hati Nurani Rakyat (Hanura) Sumut yang berlangsung 27-28 Agustus di Hotel Polonia, Medan , secara de facto sah. Karena, seluruh proses administrasi kegiatan Muswil telah terlaksana dengan benar. Bahkan, hingga penetapan aklamasi Latifah Hanum sebagai Ketua oleh mayoritas peserta Muswil. Hal itu disampaikan Ketua DPC Partai Hanura Kota Tebingtinggi Drs Muhammad Ardi, Minggu (5/9), sehubungan dengan adanya penolakan dari sekelompok aktifis partai yang mengklaim Muswil Partai bentukan Jend TNI (Purn) Wiranto itu, ditunda untuk jangka waktu tak terbatas. Tiga calon ketua

diprediksi maju dalam Muswil itu, yakni Zulkifli Siregar (Anggota DPRD Sumut), Fauzi Rangkuti dan Latifah Hanum. Dikatakan, kronologis Muswil Partai Hanura awalnya berjalan baik. Pimpinan sidang Nurdin Tampubolon dan jajaran DPP bersama peserta Muswil awalnya membahas, Tatib Muswil. Namun pada salah satu poin terjadi perdebatan sengit, yakni poin calon Ketua tidak pernah mendapat surat peringatan partai. Perdebatan sengit itu, kata Ardi, tak terselesaikan pimpinan sidang hingga ditunda untuk buka puasa dan Maghrib. Pada sesi berikutnya, entah bagaimana Unsur Ketua DPP Partai Hanura Nurdin Tampubolon, mengumumkan Muswil

yang sedang berlangsung itu ditunda untuk waktu yang tak terbatas. Alasannya, penundaan itu merupakan hasil konsultasi dengan DPP Partai Hanura, setelah memperhatikan adanya potensi konflik. Tanpa peduli protes peserta, Nurdin Tampubolon mengetuk palu dan bersama unsur pimpinan sidang lainnya meninggalkan begitu saja arena Muswil. Sepeninggal pimpinan sidang, arena Muswil dalam keadaan vacuum. Namun, sebagian besar peserta daerah masih berada di tempat. Dalam kondisi itu, tiga pimpinan daerah dari Medan , Tebingtinggi dan Samosir, mengambil alih persidangan dan mengumpulkan peserta. Persidangan

dipimpin tiga Ketua DPC itu berlanjut dihadiri 19 dari 34 cabang yang ada serta organisasi sayap. Sidang itu, kemudian memutuskan memilih secara aklamasi Latifah Hanum sebagai Ketua DPW Partai Hanura Sumut. “Terakhir dari 19 peserta cabang dan Orsap, 16 peserta menanda tangani berita acara. Jadi hasil pemilihan memenuhi quorum,” kata Ardi dikediamannya. Selain itu, usai Muswil, Ardi bersama pimpinan sidang berangkat ke Jakarta bertemu unsur pimpinan DPP mempertanyakan, kebijakan Nurdin Tampubolon menunda acara Muswil. Nyatanya, dari pertemuan dengan sejumlah unsur DPP, yakni Bambang W Suharto

(Dewan Pensehat), Hj Sri Chandrawaty (pendiri/Ketua) serta Sekjen DPP, tidak ada kebijakan penundaan Muswil itu diberitahukan kepada mereka. “Saya perkirakan, kebijakan Nurdin Tampubolon, karena ada kepentingan kelompok,” tegas Ardi. Bahkan, Ardi juga menyesalkan sikap emosional ditunjukkan salah satu unsur Ketua DPP Partai Hanura Chairuddin Ismail yang marah dan melecehkan dengan menunjuknunjuk muka Ardi, tak senang acara Muswil masih berlangsung. Diakui, saat ini pihaknya tengah berusaha mendapatkan SK kepengurusan dari DPP Partai Hanura dari hasil Muswil itu.(a08)

Pemkab Sergai Peringati Peristiwa Jatuhnya Mandala Airlines M E D A N ( Wa s p a d a ) : Mengenang lima tahun tragedi jatuhnya pesawat Mandala Airlines di Medan pada 5 September 2005 lalu yang merenggut ratusan jiwa para penumpang termasuk tiga putra terbaik bangsa Indonesia, jajaran Pemerintah Kabupaten Serdang Bedagai, Minggu pagi (5/9) melakukan ziarah ke makam Alm. HT Rizal Nurdin di pemakaman kompleks Masjid Raya Al-Mashun Jalan Mahkamah Medan. Hadir di sana Bupati Sergai HT Erry Nuradi, Sekdakab Drs H Haris Fadillah, MSi, para pimpinan Satuan Kerja Perangkat Daerah (SKPD) Pemkab Sergai, para Asisten, Staf Ahli Bupati dan Al Ustadz Drs H Amhar Nasution MA. Ziarah yang didahului dengan pembacaan ayat suci Al Quran, pembacaan tahtim dan tahlil serta doa yang dipimpin Al Ustadz Drs H Amhar Nasution MM dan diakhiri dengan

penaburan bunga oleh seluruh peziarah ke pusara Alm. HT Rizal Nurdin mantan Gubsu dan Pangdam I/BB itu. Sekdakab Sergai Drs H Haris Fadillah, MSi mewakili jajaran Pemkab Sergai dalam kesempatan itu mengatakan, ziarah setiap tahunnya yang dilakukan oleh Pemkab Sergai ke makam Almarhum sejak lima tahun lalu, selain mendoakan arwah Almarhum agar dapat diterima di sisi Allah SWT sekaligus mengenang jasa-jasa Almarhum, karena semasa Almarhum Mayjend TNI HT Rizal Nurdin memimpin Provinsi Sumatera Utara termasuk menjadi Kasdam dan Pangdam I/BB banyak hal positif yang dapat ditauladani. Bupati Sergai HT Erry Nuradi atas nama keluarga Almarhum H.T. Rizal Nurdin bin HT Nurdin dalam kesempatan itu mengucapkan terima kasih kepada seluruh keluarga besar Pemkab Sergai yang setiap tahunnya berinisiatif melakukan

ziarah ke makam Almarhum. Di tengah-tengah cuaca mendung kemudian cerah pada Minggu pagi itu, HT Erry Nuradi yang juga adik kandung dari Almarhum menuturkan, kebersamaan dan kekompakan yang dilakukan jajaran Pemkab Sergai tidak hanya dalam melaksanakan tugas tetapi juga dalam mengenang jasa-jasa para pemimpin merupakan suatu kebanggaan dan diharapkan dapat terus dilanjutkan. Seraya menguraikan sekilas sejarah perjalanan hidup Almarhum HT Rizal Nurdin, Bupati Sergai HT Erry Nuradi juga berharap kepada peziarah untuk dapat mendoakan arwah dua putra terbaik bangsa Indonesia lainnya yakni Alm. H Raja Inal Siregar dan Alm. H Abdul Halim Harahap serta arwah seratusan korban yang pada lima tahun lalu sama-sama tertimpa musibah jatuhnya pesawat Mandala Airlines di kawasan Padang Bulan Medan. (a07)

Waspada/Andi Nasution

ZIARAH MAKAM: Mengenang lima tahun tragedi jatuhnya pesawat Mandala Airlines di Medan, Bupati Sergai HT Erry Nuradi dan keluarga besar jajaran Pemkab Sergai melakukan ziarah dan tabur bunga di makam Alm HT Rizal Nurdin mantan Gubsu di pemakaman kompleks Mesjid Raya Al-Mashun Jln. Mahkamah Medan, Minggu pagi (5/9).

Jelang Lebaran, TAC Pertamina Santuni Anak Yatim Piatu P.BRANDAN (Waspada): TAC Pertamina Salamander Energy ( North Sumatera) Ltd dan EP Field Pangkalan Susu, Pertamina Area PB RU-II , Pertamina Gas dan RS Pertamina PB, di guesthouse P.Brandan, Kamis (2/9)berbukapuasabersamadan santuni anak yatim dan yatim piatu Panti Asuhan DarulYatama Babalan. SupandrimewakiliPimpinan Operation memberikan secara simbolis paket bantuan berupa satu dus mi instan dan satu kotak syrup pada 150 anak yatim piatu di lingkungan area. Kegiatan ini mendapat responpositifdariaparaturpemerintahan beberapa kecamatan seTeluk Aru. Dihadiri Camat Babalan, Sei.Lepan, Brandan Barat, Gebang dan para Lurah /Kades pada empat kecamatan dan tokoh agama, tokoh pemuda Edi Pringadi. TausiyahsertashalatMaghrib berjamaah diimami oleh Ustadz Drs Mujio Arianto. (c02)

Satu Rumah Dan Lods Terbakar Di P. Susu P. SUSU (Waspada): Satu rumah dan puluhan lods lapak pedagangpasartradisionalPekan Rabu di Dusun Melati, Desa Payatampak,Kec.Pangkalansusu terbakar, Sabtu (4/9) petang. Api juga membakar satu unit mobil pick up BK 3194 BT berisikan sekitar 0,5 ton tandan buah segar kelapa sawit milik, Ramadhani, 25, yang kebetulan sedang parkirdihalamanrumahnyayang terbakar. Kebakaran yang terjadi petangitumembuatwargadisekitar tempat kejadian panik. Sejumlah personil aparat kepolisian Polsek Pangkalansusu turun berupaya menenangkan warga sekaligus menjaga keamanan. Pertamina EP Field Pangkalansusu yang berjarak hanya beberapa kilometer dari lokasi kejadian begitu menerima informasi tentang peristiwa ini segera mengerahkan dua unit mobil pemadam kebaran. Kerugian akibat peristiwa ini diperkirakan mencapat puluhan juta rupiah.(a02)

PT Florindo Makmur Bagikan 694 Paket Lebaran Ke Warga SEIRAMPAH (Waspada): Perusahaan pengolahan tepung tapioka PT Florindo Makmur yang berlokasi di Dusun V Desa Pergulaan Kec. Sei Rampah membagikan 694 paket lebaran kepada Warga Desa Pergulaan danDesaSimpangEmpat,Minggu (5/9). Humasy PT Florindo Makmur Mariyatno mengatakan, pembagian 694 paket lebaran merupakan bentuk kepedulian perusahaan kepada masyarakat sekitar pabrik khususnya warga Desa Pergulaan 364 paket dan Desa Simpang Empat 330 paket, dalam menghadapi lebaran yang merupakan kali kedua sejak beroperasinya pabrik kami yang merupakan kegiatan rutin setiap tahunnya, terangnya kepada Waspada di sela-sela pembagian paket itu. Kepala Desa Simpang Empat Lesmana Surya mengucapkan terima kasih kepada manajemen PT Florindo Makmur atas kepeduliannya khususnya kepada Warga Desa Simpang Empat dan 330 paket akan dibagikan kepada Warga Dusun I Sinayan, Dusun X Simpang Empat dan Dusun XII Belidaan, ungkapnya. (ces)


B2

Sumatera Utara

Hadapi Lebaran, Polres Asahan Turunkan 20 Sniper

Banyak Pasangan Calon Bupati Labusel Tidak Kampanye

KISARAN (Waspada): Mengantisipasi tindak kejahatan menjelang dan saat lebaran, Polres Asahan menurunkan 20 penembak jitu yang bersiaga pada 20 lokasi yang dianggap rawan di wilayah Kisaran, Asahan. “Mereka disiagakan untuk antisipasi tadanya tindakan kejahatan, seperti perampokan, curat dan curas, sehingga pelaksanaan lebaran tahun ini dapat berjalan dengan aman dan tertib,” ungkap Kapolres Asahan, AKBP J Didiek Dwi Priantono, melalui Kasat Samapta AKP Charles Napitupulu, ditemui Waspada, saat melakukan patroli rutin, Sabtu (4/9). Oleh sebab itu, lanjut Napitupulu, diturunkan penembak dengan dilengkapi senjata api laras panjang dan ditemani oleh rekan polisi lainnya , yang ditempatkan sarana umum, seperti terminal, stasiun, tempat umum dan di tempat lainnya yang dianggap rawan tindakan kejahatan. (csap)

Bank Mandiri Rantauprapat Buka Bersama Anak Yatim RANTAUPRAPAT (Waspada): Pimpinan cabang Bank Mandiri Rantauprapat A Yani, Kab. Labuhanbatu, Sabtu (4/9), menggelar acara berbuka puasa bersama dan memberikan santunan kepada 40 anak yatim dari Panti Asuhan Putri Siti Khadijah, Rantauprapat. Acara berbuka puasa bersama dan pemberian santunan kepada anak yatim itu, juga dihadiri pimpinan cabang Bank Mandiri Martinus Lubis Rantauprapat, pimpinan cabang Bank Mandiri Aekkanopan dan pimpinan cabang Bank Mandiri Kotapinang, beserta istri. Pimpinan Cabang Bank Mandiri Rantauprapat AYani, Sus Irwanto mengatakan, kegiatan ini dimaksudkan sebagai implementasi dari Program Bina Lingkungan, yang dilaksanakan Bank Mandiri secara nasional. Kegiatan ini selain dihadiri empat pimpinan cabang Bank Mandiri di tiga kabupaten ini, juga dihadiri sejumlah karyawan Bank Mandiri di daerah ini. Selain acara berbuka puasa bersama dan pemberian santunan kepada anak yatim, kegiatan ini juga diselingi dengan mendengarkan tausyiah agama, disampaikan Al Ustadz Drs H Makmur TB Siregar, serta melaksanakan shalat maghrib berjamaah. (c07)

Safari Ramadhan Di Bilahhilir NEGERI LAMA (Waspada): Pemkab Labuhanbatu, tahun anggaran2011mendatang,berencanaakanmembantupembangunan pagar Masjid Besar Negerilama, Kec. Bilahhilir. Biaya untuk pembangunan pagar masjid itu, sudah direncanakan dalam APBD (Anggaran Pendapatan dan Belanja Daerah) tahun 2011 mendatang. Pernyataan ini, disampaikan Ketua DPRD Labuhanbatu, Hj Ellya Rosa Siregar, dalam sambutannya selaku Ketua Tim Safari Ramadhan 1431 H, Jumat (3/9). Menurut Ellya Rosa Siregar, yang juga putri Bilah asal “kota gamak” Negerilama itu, rencana pembangunan pagar Masjid Besar Negerilama itu sudah dibahas dan dibicarakan di tingkat panitia anggaran. (a07)

Anggota DPRD Batubara Kecewa KTP 3 Bulan Tak Siap T.TIRAM (Waspada): Sakroni warga Desa Bagandalam Tanjungtiram anggota DPRD Batubara kecewa dengan pelayanan pendistribusian KTP kepada masyarakat, seperti dialaminya sendiri sudah 3 bulan mengurus KTP tidak kunjung selesai. “Begitulah keadaannya, saya sendiri saja menunggu sudah 3 bulan tidak juga siap, apalagi kalau masyarakat lain. Entah apa penyebabnya, seharusnya pihak Dinas Capil Batubara bersama kecamatan/desa mencari solusi terbaik,” sebut Sakroni, Minggu (5/9). Menurut Sakroni atas penjelasan Sekcam Nasir berbagai alasan penyebab penyaluran KTP ‘macet’, akibat gangguan on-line, blanko KTP tidak ada, KTP menumpuk belum di teken Capil. Kalau alasan blanko KTP tidak ada kurang tepat karena sudah dianggarkan dana untuk itu. Dia menilai masalah KTP di Batubara memang sudah keterlaluan seperti penyakit ‘kronis’ mengundang keributan, harga mahal melebihi Perda, pelayanan lambat terkesan pelayanan kepada masyarakat ‘main-main’. (a30)

Mahasiswi STMIK Parbina Puri Tewas Digilas Truk PEMATANGSIANTAR (Waspada): Seorang mahasiswi STMIK Parbina Puri Pematangsiantar, korban Dewi Sartika Simanjuntak, 25,karyawatiAsliMotorYamaha komplekMegaLand Pematangsiantar, tewas mengenaskan sesudah digilas truk colt diesel merek PJ BK 9151 LT di Jalinsum Pematangsiantar-Medan, Km 6,5, Kelurahan Nagapitu, Kecamatan Siantar Martoba, Pematangsiantar, Minggu (5/9) siang. Korban yang sempat terkapar di jalan raya dalam keadaan tidak bernyawa, dievakuasi personil Sat Lantas Polresta Pematangsiantar yang datang ke TKP sesudah menerima laporan, ke kamar jenazah RSUD Dr. Djasamen Saragih untuk divisum. Keterangan dihimpun menyebutkan korban yang merupakan warga Bandar Pasir Mandoge, Kabupaten Asahan dan kos di Pematangsiantar itu sedang mengendarai sepeda motor Yamaha Mio BK 6196 TX dari arah Pematangsiantar menuju arah ke Medan saat kecelakaan terjadi. Saat di TKP, tiba tiba sepeda motor korban disambar mobil truk Colt Diesel dari belakang yang dikemudikan seorang pria turunan TionghoaJan,56,warga komplek pabrikmie SiantarEstate, Kecamatan Siantar, Kabupaten Simalungun dari arah samping. Akibatnya, sepeda motor menjadi kehilangan kendali dan akhirnya terjatuh bersama korban. Korban terjatuh persis di bawah ban belakang mobil truk hingga badannya tergilas ban belakang truk dan tewas seketika akibat dadanya remuk tergilas ban. Kapolresta Pematangsiantar saat dikonfirmasi melalui Kasubbag Humas Iptu Altur Pasaribu dan Kasat Lantas AKP Hendri Situmorang, SS menyebutkan kecelakaan lalu lintas itu masih dalam penyelidikan dan Jan diduga melakukan tindak pidana menghilangkan jiwa orang lain akibat kelalaiannya dan melanggar Pasal 359 KUH Pidana.(a14)

Lantai Dua Pasar Suprapto Mirip Kandang Hewan TANJUNGBALAI (Waspada): Lantai dua Pasar Suprapto di Jalan Suprapto, Kota Tanjungbalai, lebih tepat disebut sebagai kandang hewan, pasalnya kios-kios yang ditinggal pemiliknya, kini beralih fungsi menjadi tempat buang hajat. Pantauan Waspada di lantai dua Pasar Suprato Tanjungbalai menyatakan, lebih dari sepuluh unit kios yang seharusnya menjadi tempat berdagang pakaian berubah menjadi tempat buang air besar dan kecil. Hal ini terlihat banyaknya bekas air seni yang menggenangi lantai kios tersebut, ditambah lagi kotoran manusia berserakan dimana-mana, sehingga menimbulkan aroma tidak sedap, Minggu (5/9). “Kios-kios ini lebih layak disebut sebagai kandang hewan, karena hanya hewan yang buang air di sembarang tempat,” ucap seorang pedagang di lantai dua Pasar Suprapto, T Boru Sinambela, 45, kepada Waspada. Lebih ironisnya lagi, kata boru Sinambela, selain dijadikan toilet, banyak pasangan anak muda berbuat mesum disana, dan tak jarang mengambil meja pedagang untuk dijadikan tempat tidur. “Menjelang sore hari, banyak pasangan muda-mudi di lantai dua pasari ini, dan kemungkinan merekalah yang selalu membawa mejaku ke belakang sana,” ujar Boru Sinambela. Menurut pedagang lainnya, S Boru Siagian, 42, mengatakan, seharusnya, pedagang pakaian hanya dibenarkan menggelar dagangannya di lantai II, namun sebagian memilih di lantai I. Dan, akibatnya, sekitar 100 kios tersedia di lantai II, hanya tinggal 17 kios yang dihuni pedagang pakaian lainnya, sehingga kios-kios tersebut dijadikan tempat yang tidak semestinya oleh orang yang tidak bertanggungjawab. (crs)

WASPADA Senin 6 September 2010

Waspada/Sapriadi

SIAGA: Seorang personil Polres Asahan membawa senjata api saat melakukan pengamanan menjelang lebaran di Jalan Imam Bonjol, Kisaran. Terlihat juga Kasat Samapta yang sedang memantau perkembangan pengamanan di Kisaran, Asahan. Foto direkam, Sabtu (4/9).

Lanjutan Pembangunan RSU T. Balai Diragukan TANJUNGBALAI (Waspada): Lanjutan pembangunan Rumah Sakit Umum Kota Tanjungbalai di Jalan Kartini, Kel. Sijambi, Kec. Datukbandar, diragukan tepat waktu. Kendati tahun anggaran 2010 hanya tersisa tiga bulan lagi, namun belum ada tanda-tanda lanjutan pembangunan RSU dimulai, padahal alokasi dana yang dianggarkan pada APBD 2010 sekitar Rp 6 miliar. “Hari ini sudah September, berarti tidak sampai 3 bulan lagi masa tahun anggaran 2010, sedangkan lanjutan pembangunan RSU belum juga dimulai, ada apa ini,” tukas Sekretaris Fraksi PDI Perjuangan DPRD KotaTanjungbalai, Hakim Tjoa Kian Lie, kepada Waspada, Minggu (5/9).

Menurut Hakim, mengingat RSU sangat penting untuk melayani kesehatan masyarakat, seharus Pemko lebih memprioritaskan pembangunannya, sehingga dapat dimanfaatkan semaksimal mungkin. Hakim menegaskan, apabila lanjutan pembangunan RSU tidak rampung tepat waktu, berarti Pemko gagal meningkatkan pelayanan kesehatan bagi masyarakat. “DinasPekerjaanUmumyang harus bertanggung jawab jika pembangunan RSU tak tepat waktu,apalagikinitidakadaistilah pekerjaanmenjadiluncuranpada Tahun Anggaran selanjutnya,” tegas Hakim. Begitupun, Hakim tidak mampu menutupi kekhawatirannya. “Melihat kondisi di lapangan, kita sangat khawatir pekerjaan itu tidak tepat waktu, dan bila ini terjadi, yang rugi Pemerintah dan masyarakat,” ketus Hakim. Sementara, pihak terkait di

Dinas Pekerjaan Umum mengungkapkan, lanjutan pembangunan RSU Tanjungbalai dikerjakan PT P dan perusahaan tersebut juga sudah menandatangani dokumen proyek yang salah satu intinya menyatakan kesiapanmelaksanakanpekerjaan itu sesuai waktu yang ditentukan. “Memang ketentuannya jika dikerjakan tidak tepat waktu, perusahaan bersangkutan bakal dikenakan denda,” katanya. Pantauan Waspada selama sepekan, belum ada kegiatan apapun, kecuali material bangunan yang ditumpukkan begitu saja di sekitar lokasi pembangunan RSU Tanjungbalai. Diduga, tumpukan material dimanfaatkan untuk mengelabui Walikota, Sekda dan Dinas PengelolaKeuanganAsetDaerah, untuk mencairkan sebagian dana anggaran pembangunan RSU Tanjungbalai. (a37)

Kejaksaan Didesak Usut Anggaran Perjalanan Dinas DPRD T. Balai TANJUNGBALAI (Waspada): Kejaksaan didesak mengusut dana anggaran perjalanan dinas pimpinan dan anggota DPRD Kota Tanjungbalai TA 2010 senilai Rp2.292.200.000. “Dana sebesar itu tidak realistis atau diluar kewajaran dan kesannya terlalu dibengkakkan, jadi kami minta Kejaksaan mengusut aliran dana itu demi kepentingan masyarakat Tanjungbalai,” kata aktifis LSM Kota Tanjungbalai, AH Sibarani, kepada Waspada, Minggu (5/9). Selain perjalanan dinas, Sibarani juga menyampaikan desakannya kepada Kejaksaan untuk menelusuri anggaran pendidikan pimpinan dan anggota DPRD pada tahun anggaran sama senilai Rp416 juta. “Kita bukan menuduh, namun alangkah baiknya jika aparat hukum menelusuri penggunaan dana itu, apakah nilainya sudah sesuai dan apa benar dana sebesar itu digunakan serta bagaimana pula manfaatnya, khususnya bagi rakyat Tanjungbalai, sebab ang-

gota dewan itu kan wakilnya rakyat,” ketus Sibarani. Sumber Waspada di Tanjungbalai, kegiatan pendidikan Ketua DPRD sebanyak 6 kali setahun, wakil ketua masingmasing 5 kali dan anggota DPRD sebanyak 4 kali. Sementara, kunjungan kerja Ketua DPRD ke Jakarta, 5 kali selama setahun, wakil ketua dan anggota 3 kali, ditambah lagi dengan 2 kali kunjungan ketua dan wakil ketua ke wilayah tengah, sedangkan anggota cuma sekali. Untuk kunjungan kerja ke Medan, ketua dan wakil ketua 6 hari x 12 bulan, sedangkan anggota 4 hari x 12 bulan. Jadi, kunjungan kerja dan pendidikan pimpinan serta anggota DPRD Kota Tanjungbalai selama setahun mencapai Rp2.753. 200.000. Dari jumlah keseluruhan dana kunjungan kerja, menurut sumber, baru dipertanggungjawabkan ke bagian keuangan hanya Rp1,46 miliar, sedangkan dana pendidikan baru Rp 225 juta. Sebelumnya, sejumlah ele-

men masyarakat mengecam dana anggaran untuk kunjungan kerja pimpinan dan anggota DPRD Kota Tanjungbalai ke luar daerah selama 2010, mencapai Rp 2.292.200.000, atau lebih besar daripada periode lalu. Menurut Pejabat Pelaksana Teknis Kegiatan yang juga Kabag Perencanaan dan Perundangundangan Sekretariat DPRD, Ramadhan Syahdan, anggaran kunjungan kerja pimpinan dan anggota DPRD itu, masih terlalu kecil dibanding daerah lain di Indonesia. Malah katanya, anggaran senilai Rp2,2 miliar itu, sudah dikurangi dan lebih kecil daripada tahun-tahun sebelumnya. “Dibandingkan daerah lain, anggaran kita masih kecil. Untuk meningkatkan kinerja DPRD, kalau bisa malah anggarannya ditambah,” kata Ramadhan sambil menambahkan, dana kunjungan kerja DPRD yang ditanggung APBD hanya 3 kali dalam setahun. (a37)

Cetiya Dhammacakka Kisaran Salurkan Paket 50 Paket Lebaran KISARAN (Waspada): Majelis Agama Budha Therevada Indonesai (Magabudhi) PC Asahan , Cetiya Dhammacakka, salurkan sedikitnya 50 paket lebaran kepada warga prasejahtera yang ditinggal di sekitar majelis, Minggu (5/9). “Bantuan diberi sebagai tali kasih kepada sesama umat beragama, yang saling tolong menolong, sehingga dengan bantuan yang kami berikan ini, diharapkan dapat membantu atau meringankan beban umat islam yang tergolong prasejahtera saat menghadapi Hari Raya Idul Fitri yang tinggal hitungan hari,” ungkapWakil ketua Cetiya Dhammacakka, Joseph Randy kepada Waspada. Kegiatan ini, kata Joshep, merupakan program tahunan yang sudah terjadwal, paket yang kami berikan terdiri dari sembako, sajadah, dan kain sarung. “Besar harapan bantuan yang kami berikan dapat membantu masyarakat, dan dapat digunakan dengan sebaik mungkin,” ungkap Joshep. Senada dengan Lurah Kisaran Kota, kecamatan Kisaran Barat, Taufan Irianto, sangat mendukung kegiatan ini, karena kegiatan merupakan gambaran kerukunan beragama, dan kepedulian dengan sesama.

KOTAPINANG (Waspada): Banyak pasangan calon Bupati Labuhanbatu Selatan tidak melaksanakankampanyeterbuka,dari9pasangancalon Bupati/Wakil Bupati Labusel, sejak dimulainya masa kampanye terbuka sudah berlangsung tiga hari mulai, Jumat (3/9) hanya satu pasangan calonbupati/wakilyangmelaksanakankampanye terbuka yakni pasangan nomor urut satu H. Zulkarnain Hasibuan/Fadly Tanjung. Ketua Panwaslu Kab. Labusel H Syahruddin Lubis bersama anggota Panwaslu Ridwan Hasibuan mengatakan kepada Waspada, Sabtu (4/9) di kantor Panwaslu Jl. Pancasila Kotapinang. Menurut Panwaslu Labusel banyaknya pasangan calon bupati/wakil tidak melaksanakan kampanye terbuka lantaran bertepatan dengan bulanpuasa,sehinggadiprediksimasapendukung calon itu sedikit yang hadir. Namun menurut Panwaslu, pasca lebaran nanti diprediksi akan banyak yang melaksanakan kampanye terbuka, ucapnya. Menurut Syahruddin, jadwal kampanye Pemilukada Labusel tahun 2010 sebanyak 14 hari, dilaksanakan setiap kecamatan yang ada. Masa kampanye dimulai 3 September 2010 berakhir 23 September 2010, namun sejak tanggal 7 hingga 14 September 2010 jadwal kampanye ditiadakan karena bertepatan suasana hari Raya Idul Fitri. Sederhana Kendati dalam suasana bulan Ramadhan, namun kampanye pasangan calon Bupati/Wakil Bupati Labuhanbatu Selatan (Labusel) dari pasangan No 1 H. Zulkarnaen Hasibuan, SE alias H Kaneng dan Ahmad FadlyTanjung, SAg , berlangsung sederhana di tanah lapang Desa Sidodadi, Kec. Kampung Rakyat, Jumat (3/9) dihadiri lebih kurang 2000-an massa pendukung/simpatisan. Ketua Juru kampanye (Jurkam) H Makmur Ismail Harahap dalam pidato kampanye mengatakan, pasangan calon Bupati Labusel No 1 merupakan pasangan yang tidak diragukan lagi karena pasangan ini sudah cukup piawi dalam

pemerintahan, sebab latar belakang pengalaman H Zulkarnanen Hasibuan alias H Kaneng meniti karir di pemerintahan sudah cukup lama, beliau sejak masa bujangan sudah mengabdi sebagai PNS di Pemkab Labuhanbatu dan terakhir ini H Kaneng menjabat sebagai asisten III di Pemkab Labusel. Dengan demikian jika H Kaneng bersama pasangannyaUstadzAhmadFadlyTanjungterpilih nanti pada Pemilukada Labusel 27 September 2010 maka H Kaneng dan Ustadz Fadly diyakini mampu meletakkan pondasi pemerintahan di Labusel, sebab jika salah dalam meletakkan kerangkapondasimakasalahpulanantiseterusnya. Untuk itu kata Makmur Ismail, nanti dalam Pemilukada kita jangan salah pilih. Kalau sempat kita salah memilih figur yang belum berpengalaman di pemerintahan maka 5 tahun ke depan kerangka pondasi akan salah seterusnya. Paling tidak kalau kita pilih figur yang belum berpengalaman di pemerintahan, setidaknya figur itu pasti harus belajar lagi dalam implementasi tugas Pemerintahan, padahal masa jabatan hanya 5 tahun. Makmur melanjutkan, pasangan wakil bupati Ustadz FadlyTanjung, SAg, dikenal sebagai tokoh agamadantokohmuda sudahcukuplamadikenal ditengah masyarakat Labusel terutama dalam majelis-majelis ta’lim. Kedua sosok ini H Kaneng dan Fadly Tanjung merupakan putra daerah asli dari Labuhanbatu Selatan. Ustadz Fadly Tanjung dalam kampanyenya berjanji kalau dipercaya oleh rakyat, dia tidak mengenal korupsi. Menurut Fadly, kepentingan masyarakat wajib didahulukan terutama urusan KTP dan kartu keluarga akan digratiskan. Ketua DPC PDI-P Labusel H Zainal Harahap mengatakan, DPC PDI-P Labusel tidak ada menjual sampan partai kepada calon bupati/ wakil bupati, tetapi Partai PDI-P mengusung kadernya mencalonkan pasangan H Zulkarnaen alias H Kaneng bersama Ustadz Fadly Tanjung, merupakan kader terbaik. (c05)

Danpos Polisi Kampung Masjid Dituding Lepaskan Tersangka Judi RANTAUPRAPAT (Waspada): Aiptu AF Harahap, Komandan Pos polisi (Dan pos Polisi) Kel. Kampung Masjid, Kec. Kualuh Hilir, Kab. Labuhanbatu Utara dituding melepaskan tersangka pemain judi ‘song’dengan menerima uang Rp5 juta dari tangan para tersangka. Informasi yang dihimpun Waspada, peristiwa pada kasus judi kartu joker yang dipakai bermain songituterbongkarketikaparatersangkamengaku mendapat beban berbeda ketika harus memberikan uang untuk menyogok oknum Danpos dimaksud. Awalnya, para tersangka T Hidayat, Heri, A.Hamit, Sahyuti, Siin dan Buyung Alim ketika sedangbermainkartusongdigerebekolehDanpos polisi Kampung Masjid, Jumat (3/8) di Dusun Pulau, Kel. Kampung Masjid. Para tersangka berhasil kabur dan beberapa buah sepeda motor tinggal di TKP dan diamankan oleh Danpos. Anehnya, barang bukti sepeda motor milik para tersangka bukannya diboyong ke pos polisi, tetapi dibawa ke rumah seorang penduduk bernama Agus Masek. Beberapa hari kemudian, muncul seorang yang mengaku perwakilan dari para tersangka bernama Tengku Agus yang memohon agar kasus judi itu tidak lagi dilanjutkan dan sepeda motor mereka dilepaskan. Menurut sumber yang layak dipercaya diantaranya UJ, GN dan AP, warga Kel. Kampung Masjid, diduga kedatangan Tengku Agus menghadapDanposternyatajugasekaligusmemberikan uang Rp 5 juta sebagai uang pelicin untuk Danpos. “Danpos menerima uang itu pak, karena beberapa orang tersangka termasuk Tengku agus juga mengaku kepada kami bahwa ia telah menyerahkan uang itu kepada Danpos,” ucap mereka.

Danpos Polisi Kampung Mesjid Aiptu AF harahap ketika dikonfirmasi, Minggu (5/9) melalui selular membenarkan, dirinya ada melakukan penangkapan kepada para tersangka judi namun tersangka melarikan diri dan berhasil mengamankan barang bukti beberapa unit sepeda motor milik tersangka. Namun, Danpos membantah dirinya ada menerima uang Rp 2 juta yang diberikan para tersangka melaluiTengku Agus penduduk Dusun Pasar Bilah, Kel. Kampung Masjid. “Tidak benar itu, saya tidak ada menerima uang dari Tengku Agus, sepeda motor saya lepaskan karena ada permintaan dari warga yang katanya digunakan penjaga masjid untuk beraktifitas,” ucap Danpos. Kapolsek Kualuh Hilir AKP Harahap kepada wartawan ketika dikomfirmasi menyatakan akan segera melakukan penyidikan untuk memperoleh bukti yang lebih akurat. Ia juga berjanji akan segera mengambil tindakan tegas kepada Danpos jika terbukti bersalah. “Kalau memang terbukti saya akan copot jabatannya sebagai Danpos, biarpun sama-sama kamibermargaHarahapbiarsajakalaumerugikan dan melanggar aturan lebih bagus ditindak saja” ucap Kapolsek. Sementara Kapolres L.Batu AKBP Robert Kenedy melalui Pabung Kasat Intelkam AKP Mijerketikaditemuidiruangkerjanyamenyatakan akan segera menyelidiki kebenaran kasus itu. Sebagai langkah awal, di depan wartawan, Kasat Intelkam langsung menghubungi Danpos Polisi Kampung Masjid melalui selular. Kepada Kasat,Danposmengakuiperbuatannyaitu,namun katanya uang yang diterimanya bukanlah Rp 5 juta, melainkan hanya Rp 1,5 juta. (a27)

Akibat Air Limbah Mengalir Ke Parit, Warga Ajukan Protes Ke Suzuya RANTAUPRAPAT (Waspada): Akibat air limbah (kotoran manusia) yang berasal dari septictank Suzuya Plaza Hotel mengalir ke parit di lingkungan sekitar, beberapa warga mengajukan protes ke pihak manajemen. Pasalnya parit mengeluarkan bau tak sedap hingga mengganggu aktivitas warga. Tidak hanya warga sekitar yang terganggu, bau itu juga mengganggu pedagang nasi yang berjualan di sekitar lokasi hingga menyebabkan pelanggan tidak bersedia singgah ke warung sekitar. Seperti diungkapakan Mul Mujiono, salah seorang pedagang nasi yang berjualan di halaman sebuah ruko di samping Suzuya menyebutkan, awalnya saat dirinya hendak membuka warungnya bau tak sedap keluar dari parit yang berada di pinggir jalan kemudian Mul terus mencari sebab musabab keluarnya bau tersebut hingga menemukan bau itu terjadi akibat adanya air yang meluber dari septictank Suzuya. “Waktu mau saya buka warung bau tak sedap keluar dari parit, terus saya lihat pegawai Suzuya memeriksa lubang kontrol septictank, saya minta aja sama mereka agar segera membereskan hal itu,” ucapnya. Protes itu juga dilayangkan warga lainya yang disampaikan kepada manajemen Suzuya, Akibat itu Mul Mujiono akhirnya menunda membuka warungnya karena takut pelanggannya tidak akan

mau singgah ke warung karena bau tak sedap itu. Karena adanya protes warga pihak Suzuya langsung menurunkan mobil pembersih dari Dinas Kebersihan Pemkab Labuhanbatu untuk melakukan pembersihan dengan menyemprotkan air dan penyedotan di dalam parit. Humas Suzuya Dewi ketika dikonfirmasi wartawan terkait hal itu, membantah kalau yang menyebabkan bau tak sedap itu adalah kotoran manusia yang sengaja dialirkan dari septictank melalui parit. Dia menyebutkan bau itu diakibatkan karena beberapa waktu lalu Suzuya melakukan penyedotan septicktank dan air dari pembersih sedotan itu yang mengalir ke parit hingga menyebabkan bau. “Kemarin kita melakukan penyedotan, karena ada penyumbatan disaluran pembuangan yang diakibatkan oleh para pengunjung membuang pembalut wanita dan lain-lain ke dalam toilet, dan mungkin air sedotan itu yang masuk ke parit, kalau bau itu kita akan bereskan karena kita tidak mau dong masyarakat terganggu,” tukasnya. Dewi merinci ada empat septicktank yang dioperasikan Suzuya hingga saat ini, dan jika septicktank itu pernah akan dibersihkan dan sisa kotoran akan dibuang ke lokasi tanah yang dimiliki Suzuya.(c01)

Anggaran Sekretariat Daerah Batubara 2007/2008 Perlu Diaudit Waspada/Sapriadi

BERI BANTUAN: Wakil ketua Cetiya Dhammacakka, Joseph Randy, didamping Lurah Kisaran Kota, Taufan Iriadi memberikan paket lebaran kepada warga yang tergolong prasejahtera, serta wartawan Waspada, Bustami CP yang ikut memberi bantuan berupa uang, dan terlihat warga yang menerima bantuan itu tersenyum melukiskan kebahagiaan. Foto direkam, Minggu (5/9) “Bantuan yang diebrikan ini jangan dilihat dari isinya, namun keihklasan dan kepedulian Cetiya Dhammacakka kepada kita semua, dan berharap tali asih ini bisa bermanfaat bagi masyarakat,” ungkap Taufan. Dalam kesempatan itu

terlihat juga Koresponden Waspada, Bustami CP memberikan bantuan berupa uang kepada warga yang tergolong prasejahtera, dengan tujuan agar warga tersebut dapat menikmati lebaran seperti warga lainnya. (csap)

LIMAPULUH(Waspada): Segala pembangunan di Batubara mulai nampak mengeliat terutama sarana infrastruktur jalan darat dan jembatan lintas pantai pada kabupaten yang memilikki tujuh wilayah kecamatan itu. ‘’Pembenahanterhadapsaranadanprasarana infrastruktur ini tak terlepas perhatian OK Arya Zulkarnain, SH. MM sebagai Bupati Batubara definitif untuk membangun memulaikan programnya tahun 2009. Setelah sebelumnya kabupaten pemekaran dari Asahan ini dipimpin Pj Bupati tak ada kesan yang ditinggalkan, kecuali temuan proyek bermasalah di lapangan termasuk pembangun pasar,’ ‘ tukas sejumlah masyarakat di Batubara kepada Waspada, Sabtu (4/9) seraya menyebutkan, pengunaan dana APBD dan hibah tahun 2007/2008 patut ditelusuri karena ada kesan

tidak jelas digunakan. Munculnya temuan proyek bermasalah berimbas ke arah aliran dana hibah selama dua tahun berturut-turut diterima Batubara sebesar Rp 25 miliar dikelola semasa Pj Bupati tidak jelas dan menurut kabar dananya sudah ludes digunakan salah satu sasarannya untuk sewa perkantoran dan ATK diperlukan sehingga menjadi ajang tertentu untuk mendapatkan bagian. ‘’Apa ini tidak menyimpang. Tahunya kita dana hibah dari Pemprovsu dan kabupaten induk itu salah satu sasarannya untuk membangun perkantoran pemerintah yang disering dengan APBD. Anehnya sarana perkantoran yang ada saat ini dibangun setelah terpilihnya OK Arya sebagai bupati yakni dalam tahun 2009 dan bukan semasa Pj,’ ‘ujar Emi dan Adek.(a11)


Sumatera Utara

WASPADA Senin 6 September 2010

C3

15 Kandidat Balon KDH ‘Lirik’ PDIP Tapteng, 4 Balon Lirik Golkar Waspada/Zulfan Nasution

SERAHKAN: Pimpinan Cabang Bank Mandiri Sibolga Danang Indrawanto saat menyerahkan santunan kepada anak yatim piatu di panti asuhan Darur rahmah Sibolga Sabtu (4/9).

Bank Mandiri Sibolga Buka Puasa Dan Santuni Anak Yatim SIBOLGA (Waspada): Bank Mandiri cabang Sibolga mengadakan program Mandiri Peduli dengan berbuka puasa dan menyantuni anak yatim di Panti Asuhan Darur Rahmah Sibolga, Sabtu (4/9). Acara dipimpin Pimpinan Cabang Bank Mandiri Sibolga Danang Indrawanto yang juga dihadiri para petinggi Bank Mandiri cabang Sibolga seperti Tim Leader SBDC Rohadi Hariyuwanto. Pimpinan cabang Bank Mandiri Sibolga Danang Indrawanto dalam sambutannya mengatakan, program berbuka puasa bersama dan penyantunan anak yatim ini dinamakan dengan program Mandiri peduli dan program ini dilaksanakan setiap tahunnya. Sebelum dilaksanakan pemnyantunan di pamnti asuhan Darur Rahmah ini, Bank Mandiri cabang Sibolga sudah melaksanakan program yang sama yakni penyantunan kepada anak yatim yang dilaksanakan dikantor cabang Bank Mandiri Sibolga. Menurut Danan, bantuan ini diserahkan kepada 30 orang anak yatim piatu dibawah asuhan Panti Asuhan Darur Rahmah yang diberikan dalam bentuk bantuan uang tunai Rp150 ribu per anak, dan bingkisan masing-masing anak senilai Rp 100 ribu. Sumber dana sanunan ini berasal dari dana CSR Bank Mandiri kantor pusat dan acara seperti ini dilaksanakan hampir serentak diseluruh Bank Mandiri diseluruh wilayah Indonesia. (a18)

Muslimat NU Sumut Bantu Pengungsi Gunung Sinabung KABANJAHE (Waspada): PimpinanWilayah Muslimat Nahdlatul Ulama Sumut menyerahkan bantuan secara langsung kepada para pengungsi Gunung Sinabung di tiga Posko pengungsian, berupa beras, gula, susu siap saji, ikan kaleng dan sejumlah jenis kebutuhan lainya, Kamis (2/9). Ketua I PW Muslimat NU Sumut Murniati Br Ketaren memimpin langsung penyerahan bantuan didampingi Bendahara HJ Retni Kamaluddin Lubis, Dra Hj Khairani Lubis, Muallimah Nurhalimah Lubis dan sejumlah pengurus lainnya. Pengurus PW Muslimat NU Sumut mengunjungi Posko Pengungsian di Desa Tanjung Pulo, Kec. Tiga Nderket dimana pengugsi berasal dari pasar Tiga Nderket dan Desa Tanjung Morawa yang berkisar 250 pengungsi sebagian besar anak-anak. Pengurus PW Muslimat NU Sumut juga mengunjungi posko pengungsian di Desa Siabang-abang, Kec. Kuta Buluh. Di lokasi ini tidak berbeda jauh dari posko lainnya, kebanyakan pengungsi anak-anak kemungkinan besar para orang tua mereka pergi ke ladang untuk mengurusi tanaman mereka. Demikian juga di Desa Tanjung Blang, Kec. Payung di desa ini suasana pengungsi lebih ramai. Ketua I PW Muslimat NU Sumut, Murniati br Ketaren menyebutkan rasa prihatin membuat pengurus PW Muslimat NU Sumut berbagi rasa dan suka dengan memberikan bantuan. ‘’Sesama satu bangsa wajib saling bantu, sebab sesama anak bangsa tetap satu dimanapun berada. Apalagi saudara kita petani yang berada di lereng Gunung Sinabung terpaksa mengungsi karena Gunungnya saat ini memuntahkan lahar yang membahayakan. PW NU Sumut berharap kepada pengungsi yang beragama Islam untuk tetap menjalankan ibadah puasa, sebab puasa itu wajib kepada semua Muslim yang masih mampu dan sehat,’’ katanya. (rel/m43)

PANDAN, Tapteng (Waspada): Tim penjaringan bakal calon (balon) Bupati danWakil Bupati Tapanuli Tengah periode 2011– 2016 DPC PDI Perjuangan, Sabtu (4/9) kemarin, secara resmi menutup pengambilan formulir pendaftaran melalui partai itu. Ketua tim penjaringan balon Bupati/Wakil Bupati DPC PDI Perjuangan Tapteng, Patricius M Rajagukguk mengatakan, sejak pengumumuman sekaligus pengambilan formulir pendaftaran dibuka dari tanggal 26 Agustus 2010 hingga penutupan, 4 September 2010, sebanyak 15 balon yang sudah mengambil formulir pendaftaran ke tim penjaringan DPC PDIP Tapteng. Ke-15 balon itu di antaranya kandidat kuat Dina Riama br Samosir, MA Effendy Pohan, Albiner Sitompul, Raja Bonaran Situmeang, Pulung Hutabarat, Dimpu Lumbantobing, Imal Raya Harahap, Syukran J Tanjung, Purnas Sarumpaet, Edison Simbolon, Satria J Sinambela,

Marbidu Marbun, Supriadi Syahkubat, Darwin Panjaitan dan Awaluddin Rao. “Kita berharap semua kandidat balon Bupati/Wakil Bupati yang telah mengambil formulir di DPC PDI Perjuangan benar-benar serius melalui pengembalian formulir (mendaftar) pada saat pembukaan pendaftaran pada tanggal 6 – 23 September 2010 ini,” kata Patricius yang juga Wakil Ketua Bidang Pemenangan Pemilu ini didampingi Sekretaris tim penjaringan Lumbanraja Nahampun, Ketua tim verifikasi Herbert Hutabarat dan Wakadip Humas JhnnySindo usai rapat penutupan pengambilan formulir pendaftaran balon di Sekretariat DPC PDI Perjuangan di Jalan Padangsidimpuan Km8, Kel. Sibuluan I, Kec. Pandan, Tapteng, Sabtu (4/9) kemarin. Hadir pada saat rapat itu seluruh fungsionaris DPC PDIP Tapteng di antaranya Ketua DPC PDIP Tapteng Jamarlin Purba, Wakil Ketua Bidang Idelogi dan Kaderisasi Syarifuddin

Simatupang,Wakil Ketua Bidang Pemberdayaan Perempuan Merry Br Tampubolon, Wakil Ketua Bidang Organisasi dan Kader Patarsono Tinambunan, Wakil Ketua Bidang Pembangunan Daerah dan pemerintah Jhon Piter Pasaribu,Wakil Ketua bidang buruh Tani dan Nelayan Syahbullah Silitonga, Wakil Sekretaris Bidang Internal Inventaris dan kekayaan partai Rumodang Br Situmeang,Wakil Sekretaris bidang Ekternal August Hutagalung. Menurut Ketua tim penjaringan DPC PDI Perjuangan Tapteng, dengan banyaknya calon yang mengambil formulir pendaftaran ke PDI Perjuangan adalah bukti atau indikator bahwa PDI Perjuangan masih diperhitungkan dalam percaturan politik khususnya di Kabupaten Tapteng. Sementara itu, Ketua DPC PDIP Tapteng Jamarlin Purba berharap kepada para kandidat balon yang sudah mengambil formulir pendaftaran di DPC PDIP Tapteng bekerja mulai

sekarang ke tengah – tengah masyarakat minimal memperkenalkan diri atau mempublikasikan program-programnya agar masyarakat dapat mengetahuinya. Sudah 4 Balon Lirik P. Golkar Sementara itu, sejak Partai Golkar membuka jadwal pengambilan formulir dari tanggal 3 – 17 September 2010, sudah ada 3 kandidat calon hingga Sabtu (4/9) kemarin yang datang mengambil formulir pendaftaran ke partai itu di antaranya Syukran Tanjung, Hikmal Batubara dan Dina Riama Br Samosir dan Edison Simbolon. Ketua Tim penjaringan Puspa Aladin Sibuea melalui Humas Makmur Pakpahan berharap para putra-putri terbaik Tapteng dapat segera mungkin mengambil formulir di tim penjaringan balon Bupati/Wakil Bupati di DPD Partai Golkar sebelum jadwal pembukaan pendaftaran pada tanggal 18 – 21 September 2010 ini. (a18)

18 Ribu Pengungsi Di 11 Posko Kekurangan Selimut MEDAN (Waspada): Pengurus Mamre resort GBKP Helvetia, Medan,Sabtu(4/9)mengunjungi para pengungsi akibat letusan Gunung Sinabung, Kab Karo. Sekitar 18 ribu jiwa pengungsi yang tersebar di 11 posko kekurangan selimut. Tempat penampungan pengungsiyangdidatangiMamre GBKP Helvetia, Pt Antoni Ginting, Pt Terkelin Tarigan, ST, Winner Clinton Bangun, dan Koordinator, Hasry Ginting Suka adalah lokasi Posko Induk GBKP Jalan Kiras Bangun/ Jalan Tiga Nderket,KotaKabanjahe.Sebagai bentuk kepedulian, mereka menyerahkan bantuan beras. Di lokasi penampungan Posko Induk dihuni sekitar lebih kurang900jiwapengungsiberasal dari berbagai desa di sekitar Gunung Sinabung. Pt Antoni Ginting usai menyerahkan bantuan mengatakan,parapengungsiyang berada di lokasi penampungan inidiharapkanbersabardanselalu tabah dalam menghadapi segala cobaan. “Kita harus tetap sabar dalam menghadapi tantangan ini.Para pengungsi juga menjaga kesehatan, sehingga tidak sakit, “ katanya didampingi Terkelin Tarigan dan Hasry Ginting Suka. Bantuan ini, tambah Hasry

Ginting Suka, merupakan wujud kepedulian yang dilakukan Mamre GBKP Helvetia untuk masyarakatKabupatenKaroyang mengungsi pasca meletusnya Gunung Sinabung. Kata mereka, bantuan yang sedikit ini diharapkan mampu meringankan penderitaan pengungsi. “Apa yang dialami pengungsi akibat meletusnya Gunung Sinabung, adalah penderitaankitajuga.Sama-samamerasakannya. Kita berharap dalam waktu dekat ini mereka bisa kembali ke desanya, “ timpal Winner Clinton Bangun Koorrdinator Posko Induk GBKP, Pdt Agustinus Purba usai menerima bantuan itu mengatakan, semua bantuan yang diterima para dermawan dan perusahaan yang peduli langsung disalurkan ke sejumlah posko pengungsian yang tersebar di Tanah Karo. Seperti, Posko di Desa Siabangabang,Poskodi DesaKuta Buluh, Posko di Desa Bintang Meriah, Posko di Desa Perbesi, PoskodiDesaTigaBinanga,Posko di Singgamanik, Posko Mulia Rakyat, Posko di Jln Katepul, Pokso kantor Depag, Posko Sentrum GBKP, dan Posko Simpang Singa. DidampingiPdtPandiaselaku

ketua klasis GBKP Kaban JaheT.Panah dan Dk. Drs Menno Depari, Purba mengatakan, bentuk bantuan yang diterima dari berbagai pihak berupa beras mie instan, aqua, susu, dan obatobatan.”Yang kurang saat ini selimut mengingat malam hari di T.Karo ini sangat dingin, “ katanya. Sementara itu data yang diperoleh dari Posko Induk GBKP Jalan Kiras Bangun, jumlah pengungsi tercatat sebanyak 18.000 jiwa yang ditampung di 11poskopenampunganyangtersebar di Tanah Karo. “Pengungsi yang berada di 11 posko dari semua etnis dan semua agama, kami tidak ada membeda-bedakansatuadengan yang lain karena kami di sini senasib dan sependeritaan, bagi umat Islam yang berpuasa juga kitalayanisecarabaik,hinggasaur dan berbuka puasa mereka tidak terganggu, “ tegas Depari. Dk Drs Menno Depari mengatakan,hinggasaatinimasih sangatmengarapkanbantuandari para dermawan, mengingat

belum adanya keterangan resmi dari pihak terkait sampai kapan situasiinidinyatakan aman.”Kami sangat butuh sekecil apapun bantaun dari para dermawan, bantuan selimut sangat diharapkan, “ tegasnya. Lebih jauh, kata dia, pantia PoskoIndukmasihmelarangpara pengungsi kembali ke desa mereka masing-masing karena situasi juga belum aman.”Seperti hari ini (Sabtu-red) gunung itu meletus lagi, “ tegasnya. Sebelumnya, Gunung Sinabung meletus Minggu (29/9) sekira pukul 00:08 dan mengeluarkan asap tebal, percikan api, debu vulkanik, serta partikel belerang yang cukup panas. Gunung Sinabung memiliki ketinggian 2.640 meter di atas permukaan laut. Koordinat puncakGunungSinabungadalah 3 derajat 10 menit LU, 98 derajat 23 menit BT. Gunung Sinabung menunjukkan aktivitasnya dengan mengeluarkan asap hitam pada hari Sabtu (28/08) pagi, setelah terlelap 400 tahun. (h05)

Waspada/Edoard Sinaga

SANTUNAN: Area Manager Bank Mandiri Pematangsiantar Atmo Prawiro Y Hutauruk menyerahkan bingkisan dan santunan kepada 80 anak yatim saat berbuka puasa bersama di kantor Bank Mandiri Pematangsiantar, Sabtu (4/9) sore.

Bank Mandiri Beri Bingkisan, Santunan Dan Buka Puasa Bersama Anak Yatim P.SIANTAR(Waspada):Setiapindividupastimempunyaikeinginan mendapatkan suatu penghidupan yang lebih baik dan tidak terkecuali anak-anak yatim. “Sudah menjadi kewajiban kita bersama melindungi, memperhatikan dan memberikan kehidupan yang layak kepada mereka. Kami yakin, masa depan bangsa ini nantinya berada di tangan generasi muda seperti mereka,” sebut Area Manager Bank Mandiri Kota Pematangsiantar Atmo Prawiro Y Hutauruk saat penyerahan bingkisan, santunan dan buka puasa bersama dengan anak yatim di kantor Bank Mandiri itu, Sabtu (4/9) sore. Hadir saat itu Ustadz Azrul Azwan Sirait, sebanyak 80 anak yatim beserta para pendamping/pengasuh mereka, jajaran pegawai Bank Mandiri Area Pematangsiantar dan lainnya. Menurut Hutauruk, Bank Mandiri selalu berupaya mendekatkan diri dengan seluruh lapisan masyarakat di wilayah Pematangsiantar dan Simalungun serta salah satunya melalui penyerahan santunan dan bingkisan sekaligus buka puasa bersama. Menjawab pertanyaan, Hutauruk menyebutkan bingkisan dan santunan yang diberikan kepada 80 anak yatim di Pematangsiantar, 50 anak yatim di Rantauprapat dan 20 anak yatim di Sibolga. (a14)

KPUD Tetapkan 10 Calon Bupati Karo BERASTAGI (Waspada): KPUD Kab. Karo menetapkan nomor urut 10 pasangan calon Bupati Karo – Wakil Bupati Karo yang akan bertarung pada Pemilukada 27 Oktober mendatang di Hotel Green Garden Berastagi, Jumat (3/9). Penetapan nomor urut calon kepala daerah itu, setelah dilakukan pencabutan nomor urut oleh ke sepuluh pasangan calon. Hasil pencabutan nomor urut 10 pasangan calon bupati dan wakil bupati Karo2010-2015,nomorurut1: pasanganSitiAminah–SalmonSumihar Sagala (jalur Parpol), nomor 2 pasangan Riemenda Ginting-Aksi Bangun (jalur parpol), nomor 3: pasangan Sumbul Sembiring-Paham Ginting (jalur parpol), nomor urut 4: pasangan Roberto Sinuhaji– Firman Amin Kaban (jalur perseorangan), nomor urut 5: pasangan Abed Nego Sembiring–Sanusi Surbakti (jalur perseorangan). Nomor urut 6: pasangan Nabari Ginting–Paulus Sitepu (jalur parpol), nomor urut 7: pasangan Petrus Sitepu–Kornalius Tarigan (jalur perseorangan), nomor urut 8: pasangan HM. Ramli Purba– Roni Barus (jalur parpol), nomor urut 9: pasangan Kena Ukur Surbakti-TerkelinBrahmana(jalurparpol)dannomorurut10:pasangan Andy Natanael Manik–Fakhry Samadin Tarigan. Kesepuluh pasangan calon Bupati Karo/Wakil Bupati Karo akan bertarungmerebutkursiyangakanditinggalkanDaulatDanielSinulingga yang akan berakhir, 27 Desember mendatang. (c06)


Sumatera Utara

B4

Desakan Terus Mengalir Agar Pemilukada Ulang Madina Digelar Waspada/ist

SANTUNAN: Dirut PT Mega Hotel, Kasim Wijaya, disaksikan Wakil Walikota, H Maragunung Harahap, menyerahkan santunan kepada anak yatim dan kaum duafa yang bermukim di sekitar bangunan milik perusahaan perhotelan, Kamis (2/ 9).

Mega Hotel Sidimpuan Santuni Anak Yatim Dan Kaum Duafa P.SIDIMPUAN (Waspada): PT Mega Hotel yang beralamat di jalan Imam Bonjol, Kelurahan Aek Tampang, Kecamatan Padangsidimpuan Selatan, Kota Padangsidimpuan, menyantuni anak yatim dan kaum dhuafa Lingkungan I dan IX, Kamis (2/9). Kegiatan ini merupakan pertama kalinya digelar PT Mega Hotel dibawah pimpinan Kasim Wijaya. Wakil Walikota, H Maragunung Harahap, dan Ketua MUI Padangsidimpuan Selatan, H Hasan Ashari Lubis, dan para tokoh masyarakat setempat, turut menghadiri acara tersebut. “Menyantuni anak anak yatim dan kaum duafa sekaligus menyerahkan bingkisan lebaran kepada tokoh masyarakat ini, merupakan yang pertama kalinya kita gelar dan akan berkelanjutan setiap tahunnya,” kata ketua panitia, Zulkifli Lubis alias Utom. H Hasan Azhari Lubis dalam tausiyahnya mengatakan, menyantuni anak yatim dan orang tidak mampu adalah amalan yang sangat mulia dan merupakan tanggungjawab kita bersama. Wakil Walikota, H Maragunung Harahap, menyampaikan terimakasih atas kepedulian pihak manajemen PT Mega Hotel. Karena telah peduli kepada kaum duafa dan anak yatim piatu, apalagi dalam kondisi menyambut lebaran seperti sekarang ini. Dirut PT Mega Hotel, Kasim Wijaya, menyebut santunan yang diberikan itu sebagai bentuk kepedulian perusahaannya kepada masyarakat sekitar dan sekaligus untuk bersilaturahmi. (crm)

Warga Mondan Dan Pancinaran Butuh Jembatan Penyeberangan PANYABUNGAN ( Waspada ) : Masyarakat Desa Mondan dan Pancinaran, Kecamatan Hutabargot, Kabupaten Mandailing Natal, membutuhkan sarana transportasi jembatan penyeberangan menuju kawasan Desa Rumbio Kecamatan Panyabungan Utara, untuk memudahkan pemasaran hasil pertanian dan perkebunan-nya. Jembatan penyeberangan berguna untuk peningkatan perekonomian masyarakat, sebab hingga saat ini,warga kedua desa masih menggunakan angkutan pedati dan perahu gantung ( getek) untuk mengangkut hasilnya. “Kami masih menggunakan pedati untuk membawa hasil alam jika melintasi Sungai Batanggadis,sebab pakai perahu gantung ( getek ) tidak mungkin, karena tonasenya sangat terbatas,” kata beberapa warga kepada Waspada, Minggu ( 5/9). Menurut warga, perahu gantung atau getek yang ada hanya digunakan untuk penyeberangan warga menuju wilayah Mondan dan Pancinaran serta menuju puluhan desa lainnya yang berada diseberang Batanggadis. Rajamin Johar Nasution, salah seorang warga mengatakan, selain dua desa yang berada di seberang Batanggadis itu,warga DesaRumbiojugamemilikibanyaklahanpersawahandanperkebunan di seberang sungai,sehingga saling bersinggungan dengan kebutuhan jembatan itu. Johar bersama warga lainnya sangat mengharapkan perhatian pemerintah daerah untuk membangun jembatan penyeberangan tersebut. (a24)

Dua Dari Tiga Jabatan Strategis Di Bagian Humas Setdakab Taput Lowong TARUTUNG (Waspada): Dua dari tiga jabatan strategis di bagian Humas dan Keprotokolan Setdakab Taput hingga saat ini masih lowong. Kedua jabatan dimaksud yakni Kasubbag Dokumentasi dan Kasubbag Pers. Informasi yang diperoleh Waspada, kekosongan kedua jabatan itu sudah berlangsung lama. Jabatan Kasubbag Dokumentasi selama 6 bulan, jabatan Kasubbag Pers selama 2 bulan. Kedua jabatan itu sangat startegis, sebab tugas pelayananya sangat dibutuhkan oleh masyarakat di Taput. Pengisian jabatan itu sudah sangat mendesak, jika tidak ada Humas dan Informasi itu akan vakum, tanada Ketua LSM TOPANRI Harapan S, kepada Waspada di Tarutung baru-baru ini. Sekdakab Taput Drs. Sanggam Hutagalung MM, menjawab Waspada (3/9) atas kekosongan kedua jabatan Kasubbag itu tidak banyak berkomentar.“Sesegera mungkin akan diisi,” jawab Sanggam

PANYABUNGAN (Waspada): Berbagai pihak seperti pengurus partai politik, LSM ,Ormas serta pribadi terus mendesak pihak Pemkab,DPRDdanKPUDKabupatenMandailingNatalagarsecepatnya melaksanakan Pemilukada ulang sesuai dengan keputusan Mahkamah Kontitusi (MK) terus mengalir. SetelahsebelumnyaPKS,PKB danPPPMadinamendesakPemkab Madina melalui pandangan akhir fraksi di DPRD Madina, kini desakan datang langsung dari calon wakil bupati Madina pasangan No 6 Drs Dahlan Hasan Nasution. Kepada wartawan di Panyabungan Sabtu ( 4/9) malam, Dahlan Hasan mengatakan, pemerintah diharapkan sesegera mungkin melaksanakan Pemilukada Ulang di Madina, jangan di tunggu-tunggu lagi tahun 2011. “Kepada Bapak-bapak yang duduk di DPRD Madina agar menguatkan hal ini kepada Pemkab. Saya sebagai perwakilan sebagian masyarakat Madina menyerukan halinikepadaDPRD,Pemkabdan KPUD”, katanya. Menurutnya,dalam Kepmen

PT PLN (Persero) Ranting Gunung Tua Santuni Anak Yatim GUNUNGTUA (Waspada) : PT PLN (Persero) Ranting Gunungtua mengadakan buka puasa bersama masyarakat Gunung Tua julu sekaligus menyantuni anak yatim di kantor PLN Ranting Gunungtua, Jalan Raya Gunungtua-RantauPrapat,DesaGunungtua Baru, Kecamatan Padang Bolak, Kabupaten Padanglawas Utara, Sabtu (4/8) malam. Manajer PT PLN (Persero) Ranting Gunungtua, Sainan kepadaWaspada,disela-selaacara mengatakan, kegiatan dilaksanakan sebagai wujud membangun kesadaran dan kebersamaan antar sesama, serta untuk menjalin silaturahmi antara pegawai dengan masyarakat yang diharapkan bisa membawa manfaat dalam mengisi kesucian bulan Ramadhan ini. “Kegiatan ini selain sebagai wujud membangun kesadaran dan kebersamaan antara sesama. juga sasarannya agar pegawai PLN persero ranting Gunungtua dapatmeningkatkanibadahpada bulan suci ini,” sebutnya. Disinggung kesiapan dan kondisi PLN ranting Gunungtua dalammenghadapiharirayayang sudahdekat,Sainanmenuturkan, Insya Allah PT Persero ranting Gunungtua akan berupaya semaksimal mungking untuk tidak ada pemadaman dalam menghadapi hari raya idul fitri yang sudah dekat ini,ungkapnya. Al Ustadz Makmur Harahap yang hadir sebagai penceramah mengulasmaknadanhakikatdari puasa yakni, Puasa yang sebenarnya adalah, tidak hanya menjaga dari makan minum serta bersetubuh, tapi panca inderanya juga berpuasa, kata Al Ustadz Makmur Harahap. (csp)

PT ANJ Agri Gelar Safari Ramadhan Dan Khitanan Massal ANGKOLA SELATAN,Tapsel (Waspada): PT Austindo Nusantara Jaya (ANJ) Agri yang bergerak di bidang perkebunan kelapa sawit, sejak Kamis-Minggu (25/9) menggelar safari Ramadhan dan khitanan massal di sekitar wilayah Hak Guna Usahanya (HGU) di Kecamatan Angkola Selatan, Kab. Tapanuli Selatan. Selain itu PT ANJ Agri juga menggelar berbagai kegiatan sosial lainnya yang tidak saja bagi anak-anakkaryawanperusahaan, tapi juga dengan warga sekitar perusahaan. Seperti pemberian bingkisan kepada warga sekitar. Menurut External Relation Manager PT. ANJ Agri,Tri Hidayat, didampingi External Relation, M Romy Tarigan, kegiatan sosial keagamaan ini merupakan program berkelanjutan perusahaan yang dulu dikenal dengan PT OPM. Kegiatan ini juga bagian dari program bina lingkungan (CSR). Camat Kecamatan Angkola Selatan, Hamdy S Pulungan, mengapresiasi kegiatan sosial berupakhitananmassaldansafari ramadhan dilakukan pihak PT ANJ Agri ini. “Mewakili masyarakat Kecamatan Angkola Selatan, saya ucapkan terimakasih atas kepedulian PT ANJ Agri. Karena telah membuktikan bahwa perusahaan perkebunan ini tidak hanya memikirkanaspekbisnis,tapijuga peduli terhadap masyarakat sekitar,” ungkapnya.

Waspada/Sukri Falah Harahap

KHITANAN MASSAL: External Relation Manager PT ANJ Agri, Tri Hidayat dan Camat Angkola Selatan, Hamdy S Pulungan, diabadikan bersama peserta khitanan massal di Dusun Binasari. Anggota DPRD Tapsel asal daerah pemilihan Angkola Selatan, Haris Yani Tambunan, juga mengapresiasi PT ANJ Agri. Diharapnya program sosial ini jangan hanya pada bulan Ramadhan. Lebih seringlah memperhatikan kondisi sosial warga sekitar perusahaan dengan meningkatkan program CSR. Sedangkan ketua panitia pelaksana kegiatan sekaligus External Relation PT ANJ Agri, M Romy Tarigan, menjelaskan rangkaian kegiatan sosial itu degelar sejak Kamis (2/9), berupa khitanan massal diikuti 28 orang anak karyawan dan anak warga Dusun Binasari di komplek PT

ANJ Agri Siais. Pada Jumat (3/9) kegiatan safari Ramadhan dan khitanan massal di Dusun Binasari. Kegiatan itu dihadiri anggota DPRD Tapsel, Haris Yani Tambunan, Camat Angkola Selatan, Hamdy S Pulungan, Kapolpos Siais Iptu HP Harahap, para Estate Manager Kebun Siais, Ir Jerileva Purba, Ir Sarman Manik, Ir Suhaimi, serta sejumlah staf. Sabtu (4/9) safari Ramadhan di Dusun Janji Matogu, dan ditutup pada Minggu (5/9) dengan kegiatan safari Ramadhan serta buka puasa bersama karyawan di komplekPTANJAgriSiaissertapenyerahanbingkisanlebaran. (a20)

No 57 Tahun 2004, pasal 8 dijelaskan, apabila Pemerintah Kabupaten tidak mampu menyediakan dana untuk Pilkada atau Pemilukada maka Pemerintah Provinsi dapat menyiapkannya. “Jadi saya mewakili masyarakat Madina menyampaikan kepada pihak yang berkompeten agar sesegera mungkin melaksanakan pemilukada ulang, apalagi mungkin kekuarangan dana Pemilukada ulang ini tidak begitu banyak karena masih ada sisa dari Pemilukada yang lalu,” ungkapnya. Kemudian lanjut Dahlan, dalam Kepmen yang sama pasal 30 ayat 1, 2 dan 3 dijelaskan, dana Pilkada atau Pilkada ulang dapat dipakai dari dana tidak terduga dari APBD berjalan. Apabila belumdapatdianggarkandidalam APBD agar di upayakan penggunaannya mendahului pengesahan. Jadi sebenarnya kalau Pemkab Madina dan pihak yang berkompeten lainnya ada keinginan melaksanakan Pilkada ulang di tahun 2010 bisa dilaksanakanya.” ujarnya. Sebelumnya,pengurusPartai Keadilan Sejahtera melalui ketuanya H Martua, Lc, MA, mengatakan Pemkab Madina melalui KPUD di harapkan melaksanakan Pemilukada ulang Madina di tahun 2010. “Sekarang anggota DPRD dari PKS termasuk saya dan kawan-kawan dari partai pendukung yaitu PPP dan PKB terus melakukan lobi di DPRD agar pelaksanaanya di tahun 2010 ini. Kita dari Komisi I telah berangkat ke Jakarta melobi untuk segera percepatan Pemilukada ulang ini,” ucapnya. Kepada pendukung dan simpatisanHidayat-Dahlandiha-

rapkanagartetapsoliddanjangan terpengaruh isu-isu yang menyesatkan. Sebab belakangan ini sengaja dimunculkan isu-isu yang memecah belah persatuan dan memudarkan semangat pendukung Hidayat-Dahlan. Mulai dari isu yang mengatakan Hidayat-Dahlan didiskualifikasi sampai kepada Hidayat-Dahlan ditangkap. “Kita sudah dapat kepastian dari pusat,pasangancalonbupatiyang 7 tetap ikut dalam Pemilukada ulang dan bagi yang mengundurkan diri akan didenda Rp2 miiar,” jelas Martua. Kata dia ,pelaksanaan PemilukadaMandailingNataldiharapkan tetap tahun 2010 dan tidak menunggu sampai tahun 2011. Pemkab Madina dharapkan agar segera mengupayakan pengalokasian dana di tahun 2010 dan kepadaKPUDMadinadiharapkan agar menetapkan jadwal Pilkada Ulang Madina. Hal yang sama juga dikatakan Ja’far Suheri dari Partai Kebangkitan Bangsa yang mendesak Pemkab Madina agar melaksanakan Pemilukada ini di tahun 2010 dan tidak menunggu anggaran di 2011. Begitu juga KPUD Madina di harapkan agar segera mnetapkan jadwal Pemilukada Ulang Madina ini. Masaah ini sebenarnya terkait dengan kemauan Pemkab dan pihakpihak yang berkompoten di dalamnya. Ja’far mengungkapkan , berlarut-larutnya pelaksanaan Pemilukada Madina di khawatirkan akan menimbulkan kerawanan sosialdankonflikditengah-tengah masyarakat. Selain itu, semangat kerja para SKPD dan semua perangkatnyakitaperhatikanjauh

menurun dari hari-hari biasanya karena ketidak pastian pemilukada ini. Artinya kalau dibiarkan berlama-lama efek negatifnya lebih banyak ketimbang positifnya. “Masyarakat Madina saat ini menunggu kepastian jadwal Pilkada ulang Madina. Pemkab Madina kita harapkan mengupayakan Pemilukada Madina tahun 2010 ini. Terkait dengan pendanaan, inikan Pemkab bisa saja mengambil kebijakan atau minta bantuan kepada Provsu atau ke pusat, yang jelas pelaksanaanyajangandibiarkanberlarutlarut”, sebutnya. Kemudian kata Ja’far, elit-elit politik Madina diharapkan agar menahan dari komentar-komentar yang membingungkan masyarakat. “Mari kita berikan pendewasaan berpolitik kepada mayarakat. Keputusan MK sudah final untuk Pemilukada Madina, tidak bisa di tawar-tawar lagi “, tambahnya. Halyangsamajugadikatakan Ketua Majelis Adat Mandailing Sumatera Utara (MAMSU) Muhammad Sukhairy Lubis, S. Fil. Menurut Sukhairy, tidak alasanpemerintahuntukmenundanunda pelaksanaan Pemilkuda ulang Madina. “Anggota DPRD Madina diharapkan agar segera mendesak Pemkab Madina melaksanakan Pemilukada Ulang ini , begitu juga KPUD agar segera menetapkan jadwalnya. Jangan biarkan rakyat Madina terlalu lama menunggu, saya khawatir kalau ini dilama-lamakan akan menimbulkan hal-hal negatif di tengah-tengah masyarakat”, harapnya ketika dihubungi melalui telepon selularnya.(a24)

WASPADA Senin 6 September 2010

Pimpinan Dewan Nilai Gozali Pulungan Pantas Jadi Sekda PANYABUNGAN (Waspada): Drs Gozali Pulungan, SH.MM yang menjabat pelaksana tugas Sekda Kabupaten Mandailing Natal sekarang ini dinilai pantas menjadi pejabat sekda defenitif, karena telah memenuhi beberapa kriteria yang dianggap penting dan perlu. Itu dijelaskan salah satu pimpinan DPRD Madina, Fahrizal Ependi, SH kepada wartawan, Minggu (5/9) di Panyabungan, dalam menyikapi beredarnya rumor Gozali Pulungan tidak pantas jadi sekda karena dianggap kaku dan alasan lainnya yang terkesan tendensius pribadi. Dijelaskan Rizal politisi dari Partai Hanura itu, Gozali Pulungan di nilai kooperatif dan profesional dalam menjalankan tugastugas kedinasan. Itu bisa dilihat saat ia menjadi pimpinan koordinator eksekutif dalam pembahasan RAPBD dan tugas dinas lainnya. Begitu juga dengan tugas beratnya sebagai ketua panitia pemekaran pantai barat, bisa diselesaikannya dengan tahapan dan mekanisme yang diatur dan dituntut dalam undang-undang. Sehingga penggunaan anggaran dalam pemekaran tersalurkan pada tempatnya. Dari segi karir dan kepangkatan, Gozali Pulungan lebih layak. Karena sejak berdirinya Kabupaten Mandailing Natal, ia sudah menempati beberapa jabatan strategis mulai dari Kepala Inspektorat, Bawasda, Bappeda, Kehutanan, dan Asisten I Administrasi membidangi keuangan. Gozali Pulungan menjadi Sekda merupakan tuntutan situasi dan sejalan dengan apa yang diajukan Bupati Madina, H Amru Daulay, SH. (csh)

Dinkes Paluta Hunjuk Tim Antisipasi KLB Selama Hari Raya GUNUNGTUA (Waspada) : Dinas Kesehatan Kabupaten Padang Lawas Utara menghunjuk tim antisipasi kejadian luar biasa (KLB) selama Hari Raya Idul Fitri 1431 H, guna untuk mencegah penyakit menular seperti diare dan keracunan makanan. Tim antisipasi KLB yang dibentuk bertujuan mencegah dan menanggulangi potensi penyakit menular pada saat peringatan hari besar keagamaan seperti Hari Raya Idul Fitri. “Kecenderungan surveilans penyakit sering terjadi kejadian luar biasa khususnya diare dan keracunan makanan” ujar Mara Bintang Harahap, Kepala Dinas Kabupaten Padanglawas Utara, melalui Kabid P2P Dinkes Paluta, Dr.Irwan kepada Waspada, Minggu (5/9) di Gunungtua. Dijelaskan, upaya pencegahan KLB dan pemberantasan penyakit menular pada saat Hari Raya, maka perlu dihunjuk Tim Antisipasi Kejadian Luar Biasa. Tim ini akan berposko pada seluruh Puskesmas yang ada di sepanjang Jalan Lintas Sumatera. Karena itu, kata Mara Bintang melalui dr Irwan, kepada masyarakat supaya mendatangi posko-posko itu jika mulai mengalami gejala penyakit. Anggota tim antara lain, dr Irwan, Ester Siregar, Jupriadi Hiburan, Ganti Paruntungan Pulungan, SKM, Rodikson Simanullang, Amd.(csp)


Sumatera Utara

WASPADA Senin 6 September 2010

DPRD Setujui P-APBD Simalungun 2010 Rp 107 M Lebih PD Agromadear Diusulkan Pailit SIMALUNGUN (Waspada): DPRD Simalungun melalui rapat paripurna dewan yang digelar, Kamis (2/9), akhirnya menyetujui Rancangan Perubahan Anggaran Pendapatan dan Belanja Daerah (RP-APBD) Kab. Simalungun Tahun Anggaran (TA) 2010 untuk ditetapkan menjadi Perda. Rapat paripurna dewan dipimpin Ketua Dewan Binton Tindaon didampingi Wakil Ketua Julius Silalahi dan Burhanuddin Sinaga, hanya diikuti 30 orang dari 45 orang anggota dewan daerah itu. Sidang paripurna dengan agenda penyampaian pendapat akhir fraksi atas RP-APBD Simalungun 2010 dihadiri Bupati Simalungun di-

wakili Sekretaris Daerah, Mahrum Sipayung dan para pimpinan SKPD. Dalam rapat paripurna itu, seluruh fraksi di DPRD Simalungun pada pendapat akhir fraksinya menyatakan dapat menerima dan menyetujui ancangan peraturan daerah PAPBD TA 2010. Sedangkan jumlah APBD tahun anggaran 2010 semula sebesar Rp 925,1 miliar lebih, kemudian di PAPBD 2010 bertambah sekitar Rp 107,7 miliar sehingga menjadi Rp 1,032 triliun lebih atau bertambah sekitar 11,65 persen. PD Agromadear Diusulkan Pailit Sebelum menyampaikan pendapat akhirnya, fraksi-fraksi

DPRD Simalungun melalui juru bicara masing-masing fraksi menyampaikan saran dan kritikan tajam kepada pihak eksekutif. Selain menyoroti tentang kinerja eksekutif yang belum maksimal, kalangan anggota dewan juga menyoroti tentang keberadaan PD Agromadear. Dikatakan, keberadaan PD (Perusahaan Daerah) Agromadear yang notabene milik Pemkab Simalungun hingga saat ini tidak mampu berkembang dan tidak memberikan kontribusi PAD kepada Pemkab Simalungun. “ PD Agromadear yang telah beroperasi lebih kurang enam tahun sampai saat ini belum ada memberikan kontribusi PAD kepada Pemkab Simalu-

ngun. Sementara anggaran yang diperuntukkan untuk perusahaan tersebut telah mengalami defisit,” tegas Hj Herlina Gusti yang bertindak sebagai juru bicara Fraksi Golkar Nusantara pada rapat paripurna dewan. Bahkan Gusti menyebutkan, lemahnya keberadaan PD Agromadear dipicu perpecahan antara Dirut (Direktur Utama) dengan jajaran direksi yang tidak sejalan untuk menjalankan operasional perusahaan milik daerah itu. Justru itu, Fraksi Golkar Nusantara mengusulkan, jika memang tidak mampu berkembang sebaiknya PD Agromadear dipailitkan saja, katanya. (a15)

Bupati Sergai Sampaikan Nota Jawaban SEIRAMPAH ( Waspada): Bupati Serdang Bedagai H T Erry Nuradi menyampaikan nota jawaban atas pemandangan umum fraksi-fraksi DPRD Sergai atas nota pengantar Bupati tentang Perubahan Anggaran Pendapatan Belanja Daerah (PAPBD) 2010, Jumat (3/9) di gedung dewan di Desa Firdaus Kec.Sei Rampah. Paripurna yang dipimpin Wakil Ketua DPRD Sergai M Y Basrun didampingi Ketua DPRD H Azmi Y Sitorus, Wakil Ketua Drs Sayutinur, Drs Abdul Rahim dan 33 anggota DPRD dihadiri Sekdakab Sergai Drs H Haris Fadillah, Kasdim 02/04 PT Deli Serdang, mewakili Kapolres Sergai dan Pengadilan Negeri Tebing Tinggi, para SKPD dan Camat se Sergai. Bupati Sergai H T Erry Nuradi dalam nota jawabannya atas pemandangan fraksi-fraksi

di antaranya mengatakan, menyangkut pengutipan retribusi hasil bumi yang dilaksanakan di setiap pos telah diupayakan sesuai potensi yang ada dengan tetap menggunakan kuitansi (karcis) dan saat ini telah mencapai 58 persen, paparnya. “Mengenai pajak restoran dan rumah makan dalam PAPBD terjadi penambahan target yang ditetapkan sebesar Rp74.400.000 sehingga menjadi Rp350.000.000, sedangkan untukpajak reklame dapat kami jelaskan penerimaan pajak ini sangat bergantung dari banyaknya papan reklame oleh wajib pajak berkenaan dan juga terjadi penambahan target yang ditetapkan Rp50.000.000 sehingga target menjadi Rp650.000.000”, papar Erry Nuradi. Selanjutnya tambah Bupati, beberapa potensi sektor pajak dan retribusi daerah yang erat

kaitannya dengan sektor pariwisata, kami terus berupaya agar pengelolaan potensi sektor ini dapat dikelola secara tertib, efektif dan trasnparan. “Sedangkan penerimaan dari pegelolaan kekayaan daerah diproyeksikan bersumber dari deviden PT Bank Sumut dan pengelolaan kawasan wisata Pantai Cermin, sedangkan BUMD yang lama (PT Sergai Global Mandiri) sudah tidak beroperasi lagi dan laporan telah diaudit terlampir dalam penyampaian APBD tahun lalu, terkait BUMD yang baru belum beroperasi karena masih menunggu beberapa persyaratan,” jelas Erry Nuradi. Kemudian imbuh Bupati, Pemda selalu melakukan upaya semaksimal mingkin dalam peningkatan PAD di Kab.Sergai, berbagai upaya telah dilakukan di antaranya melalui sosialisasi

melalui SKPD terkaityang membidangi setiap jenis pajak (retribusi), kepada para wajib pajak terkait kawajiban membayar pajak dan bagi yang tidak memenuhi kewajibannya tellah dilaksanakan penanganan lebih lanjut dengan melibatkan instansi terkait sesuai peraturan perundangan, tambah Erry Nuradi. “Namun kami menyadari bahwa tuntutan peningkatan PAD di Kab.Sergai menjadi sorotan utama, sehingga ke depan kami akan berupaya untuk lebih memaksimalkan PAD dalam memberikan kontribusi pada penerimaan daerah pada keseluruhan”, imbuh Bupati. Paripurna akan dilanjutkan, Senin (6/9) dengan agenda tanggapan akhir gabungan komisi-komisi di DPRD Sergai. (ces/a07)

Polres Simalungun Kerahkan 350 Personil Amankan Lebaran P. SIANTAR ( Waspada): Selain meningkatkan mobilitas manusia secara besar-besaran menjelang Idul Fitri, acap ditandai dengan meningkatnya kuantitas dan kualitas tindak pidana khususnya kejahatan konvensional yang meresahkan masyarakat. “Hal itu itu tentunya tidak dapat dibiarkan dan sebagai penanggungjawab keamanan dalam negeri, Polri dituntut untuk mampu mengungkapkan kasus-kasus itu dan diharapkan tidak terulang lagi,” tegas Kapolri Jenderal Pol Bambang Hendarso Danuri dalam amanat tertulisnya yang dibacakan Kapol-

res Simalungun AKBP Drs Marzuki selaku Irup dan dibantu Dan Up Iptu Jony Andreas dalam gelar apel Operasi Ketupat Toba 2010 di Aspol Simalungun, Jalan Sangnawaluh, Kamis (2/9). Berkaitan dengan Operasi Ketupat 2009, lanjut Kapolri, tercatat jumlah kecelakaan lalu lintas turun 35,53 persen, korban tewas turun 35,71 persen korban luka berat turun 32,89 persen dan pelanggaran lalu lintas turun 70,81 persen. Khusus untuk daerah hukum Polres Simalungun, menurut Kapolres didampingi Pahumas Kompol Ramli Sirait

dan Kasat Lantas AKP Baginda Sitohang, pihaknya lebih menitikberatkan pengamanan pariwisata terutama menuju kawasan kota turis Parapat. Kapolres menyebutkan, pelaksanaan Operasi Ketupat Toba 2010 melibatkan 350 personil terdiri dari seluruh unsur kepolisian, instansi terkait seperti Denpom I/1, Brimob, Dishub, TNI-AD terdiri Kodim 0207/Simalungun dan Batalyon 122/TS, Mitra Kamtibmas serta sarana pendukung terdiri unit sepeda motor dan mobil termasuk kenderaan alat berat, Pos Pam Keliling dan lainnya.

“Pos Pengamanan sebanyak tujuh unit yang berada di kawasan Kerasaan, Bangun, Dolok Merangir, Simpang Kawat, Seribu Dolok dan satu unit khusus Pos lelah yang dilengkapi dengan massage ringan, minuman, makanan ringan secara gratis,” imbuh Kapolres. Mengenai kawasan rawan kecelakaan, sebut Kapolres, di antaranya lintasan jalan Pematangsiantar-Dolok Panribuan, Dolok Merangir-Medan dan lainnya. “Kawasan longsor turut mendapat perhatian seperti kawasan Sibaganding,” katanya. (a14)

Mantan Petinju Tewas Dibunuh P. SIANTAR ( Waspada): Seorang mantan petinju, Lelong Simanjuntak, 45, wiraswasta, warga Huta Pardomuan Nauli, Nagori Buntuturunan, Kecamatan Hatonduhan, Kabupaten Simalungun diduga tewas dibunuh seorang pemuda sekampungnya. Keterangan dihimpun dan informasi di Polres Simalungun, Jumat(3/9)menyebutkankorban diduga dibunuh JS, 21, petani, warga sama dengan korban di Huta Parbeokan, Nagori Buntuturunan, Kecamatan Hatonduhan pada Kamis (2/9) pukul 17:00. Pembunuhan itu terjadi hanya gara-gara mobil Daihatsu TaftGTBK1765XWdikemudikan korban bersenggolan dengan mobil Daihatsu Taft Badak bermuatan buah kelapa sawit yang dikemudikan abang kandung JS. Saat itu, JS dan abangnya hendak mengantar buah kelapa sawit dari Pardomuan Nauli ke

Buntuturunan dan berpapasan dengan mobil korban yang datang dari arah berlawanan. Kedua mobil diduga terlalu dekat hingga terjadi senggolan. Mobil dikemudikan abang JS tetap melaju dan tidak mempedulikan senggolan itu, sedang korban malah berbalik arah dan mengejar mobil itu hingga akhirnya berhasil disusul. Ketika kedua mobil sudah berhenti, korban segera turun dari mobilnyadanlangsungmarah-amarah. Abang korban yang merasa takut terhadap korban langsung turun dari mobil dan kabur. Sedang JS yang tidak sempat pergi menjadi sasaran kemarahan korban. Sambil-marah-marah, korban menampar JS dan tangannya menarik krah baju JS. JS saat itu tidak tinggal diam dan tangannya segera meraih sebilah parang yang tergeletak di samping tempat duduk pengemudi dan menghunjamkannya berkali-kali ke perut korban.

Akibat tikaman itu, korban melepaskankrahbajuJSdanberusaha menghindar dan hendak lari menggunakan mobilnya. Namun, luka berat dan darah yangmengucurdariperutkorban membuat korban lemas dan terjatuh di dekat pintu mobilnya. Kesempatan itu digunakan JS menikami leher, kepala dan tangan korban hingga akhirnya korban tewas di tempat kejadian. Ayah JS yang kebetulan melintas dari tempat kejadian akhirnya membawa JS beserta barang bukti sebilah parang ke Polsek Tanah Jawa dan melaporkan kejadian itu. Pihak Polsek Tanah Jawa selanjutnya mendatangi tempat kejadian dan melakukan penyelidikan serta membawa jenazah korban ke RSUD Dr. Djasamen Saragih, Kota Pematangsiantar guna keperluan visum. Kapolres Simalungun AKBP Drs. Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas

Saat Sidang, Hakim Usir Pengacara TEBINGTINGGI (Waspada) Sidang perdata kasus sengketa tanah jalan di Desa Sampang Buah, Kec. Sipis-pis, Kab. Sergai yang digelar di Pengadilan Negeri (PN) Tebingtinggi Deli berlangsung singkat. Pasalnya, majelis hakim mengusir pengacara pengugat dengan alasan tidak menghormati persidangan. Penasehat hukum dan ketiga saksi tergugat yang diajukan pada saat itu langsung meninggalkan persidangan. Sidang yang berlangsung, Kamis (2/9) itu mengajukan 3 orang saksi dari tergugat yakni Rodon Sinaga warga Desa Huta Tausang, Kec. Sipis-pis, Kab. Sergai, Arifin Sinaga, Sahadin Saragih keduanya warga Desa Sampang Buah, Kec. Sipis-pis Sergai. Kehadirannya terkait sengketa jalan melalui lahan Barisman Saragih (tergugat) dan ke 12 temannya dengan pihak pengugat Lasem Damanik warga

Desa Masango, Kec. Sipis-pis, Kab. Sergai. Saat persidangan berlangsung, penasihat hukum tergugat, Khoirul Hustaman Hasibuan, SH mengatakan bahwa pertanyaan majelis hakim kepada saksi-saksi tergugat yang dihadirkan keluar dari pokok perkara yang menjadi masalah sengketa jalan. “Hakim mengatakan yang paling berkompeten di ruang sidang adalah Hakim. “Saya langsung interupsi, karena saya sebagai penasehat hukum tergugat, maka saya berhak memperjuangkan hakhakdarikliensayadipersidangan,’’ papar Khoirul Hustaman usai persidangan. Saat dikonfirmasi wartawan, Majelis Hakim Novarina Manurung, SH mengatakan, penasehat hukum tergugat tidak menghormati jalannya persidangan dengan baik. “Kami mempunyai hak meng ‘kat’ jalannya sidang,” ucapnya. Sidang diberhentikan

denganmengeluarkanpenasehat hukum tergugat dan saksisaksinya. Menurut informasi yang diperoleh, kasusnya perdata berawal saat Lasem Damanik (penggugat) membeli lahan perkebunansawitseluas4hektare di Desa Sampang Buah. Diakui adanya jalan seluas 2 meter menuju ladang dari tergugat. Karena merasa mempunyai jalan penggugat merasa rugi atas hasil kebunnya yang tidak bisa keluar menuju pasar lintas. Makanya tidak diberi jalan oleh tergugat dengan alasan tanah miliknya. Sudah ada upaya damai yang ditawarkan oleh pihak tergugat dengan pengantian kerugian namun pihak Lasem Damanik tidak mau menerimanya dengan alasan, tanah selebar 2 meter adalah miliknya dan langsung membuat laporan ke pengadilan. (a09)

Iptu Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK di Mapolres, Jumat (3/9) menyebutkan JS diduga melakukantindakpidanadengan sengajamenghilangkanjiwaorang laindanmelanggarPasal338KUH Pidana. JS sudah ditetapkan sebagai tersangka dan ditahan sesudah diproses. (a14)

B5

Manajemen Theme Park Berbagi Kasih Dengan Seratusan Anak Yatim PANTAICERMIN (Waspada): Manajemen objek wisata Pantai Cermin Theme Park dan Resort Hotel setiap tahunnya mengadakan acara berbagi kasih dengan seratusan anak yatim dan piatu dari warga sekitar Kec.Pantai Cermin dengan menggelar buka puasa bersama dan pemberian bantuan perlengkapan alat tulis. Hal itu disampaikan oleh Asst. Director of Marketing & Communication T.Feria Aznita

didampingi Marketing Manager Desi Muharani ketika dihubungi Waspada, Jumat (3/9) di Desa Pantai Cermin Kec. Pantai Cermin Kab.Serdang Bedagai. “Acara diawali dengan pembacaan ayat suci Al Quran kemudian siraman rohani oleh Ustadz Bahiruddin , kemudian berbuka puasa para undangan dan anak-anak yatim shalat berjamaah serta makan malam bersama,” jelas Feria. Acara ini imbuh Feria meru-

pakan kegiatan rutin yang dilaksanakan setiap tahunnya yang pada tahun ini diadakan pada Kamis (20/8) sebagai wujud kepedulian terhadap masyarakat setempat dan sekaligus untuk mempererat hubungan silaturahmiantarsesamaumatmuslim. “ Selain itu, menjelang libur lebaran tahun ini, Pantai Cermin Theme Park telah mempersiapkan berbagai macam kegiatan dan hiburan untuk para pengunjung diantarnya kegiatan,

bazaar, band performance, magic show, karaoke, fun games dan parade badut dan acara puncak kegiatan tersebut mulai 10 – 19 September 2010. mendatang,” tambah Feria. Acara yang dihadiri tokoh masyarakat Pantai Cermin dan seluruh manajemen diakhiri dengan pemberian bantuan kepada seluruh anak yatim yang hadir berupa perlengkapan alat tulis yang diserahkan oleh para Manajemen Theme Park. (ces)


B6 Polres Tapteng Gelar Pasukan Operasi Ketupat SIBOLGA (Waspada) : 300 Personil Polres Tapteng melakukan gelar Pasukan Operasi Ketupat yang dipimpin Kapolres Tapteng AKBP Dicky Patrianegara di lapangan bola Pandan, Kamis (2/ 9) sekaligus penyerahan kendaraan bermotor dinas di beberapa instansi. Kasatlantas AKP Dahlan Anzib menjelaskan, mulai Jumat (3/9) dilakukan operasi ketupat dan berakhir +7 lebaran dengan 2 pos pam yakni di Desa Bonandolok dan Simpang Kalangan. Dijelaskan Dahlan, lokasi pos pam di Bonandolok bekerjasama dengan Dinas Bina Marga Sumut guna mengantisipasi bencana longsor dan sudah disediakan alat-alat berat dan sinsaw bila terjadi bencana segera dapat diantisipasi memperlancar arus lalulintas bagi para pemudik. Sementara pos pam 2 di Simpang Kalangan, menurut Kasatlantas, mengantisipasi laka lantas dan mematuhi ramburambu lalulintas termasuk daerah tersebut merupakan lokasi pariwisata agar jangan macet. (a34)

XL Bantu Korban Sinabung MEDAN (Waspada): PT XL Axiata Tbk turut prihatin atas terjadinya bencana letusan Gunung Sinabung, Kabupaten Karo. Sebagai bentuk kepedulian melalui program CSR (Corporate Social responsibility), XL membantu masyarakat dengan memberikan obat-obatan, selimut, air mineral, mi instan, perlengkapan bayi, susu bayi, dispenser, sarung, masker, gula, dan menyediakan TUG (telefon umum gratis). Vice President (VP) West Regional Agus Simorangkir mengatakan, bantuan diberikan XL sebagai salah satu bentuk kepedulian XL sesama dan ikut merasakannya dan program CSR XL. Selain memberikan bahan logistik, XL juga mendirikan posko bantuan. Ada juga disediakan untuk sarana telekomunikasi TUG (telepon umum gratis) untuk memberikan informasi terakhir kepada saudara kerabat yang ada di luar daerah. “Ada 42 BTS XL (2G/3G) melayani 200 ribu pelanggan di Kabupaten Karo. Sejak terjadinya letusan hingga saat ini jaringan XL tetap aman dan dapat melayani pelanggan dengan normal. Tidak ada lonjakan trafik yang cukup berarti. XL juga melewatkan jaringan fiber optic melalui Tanah Karo, sehingga kehandalan jaringan diharapkan dapat membantu komunikasi masyarakat,” terangnya. Selain itu, Manager Management Service West Area Firman AJ menyebutkan, bantuan dari XL akan terus didistribusikan ke posko-posko pengungsi di Kabupaten Karo dan sekitarnya. Tim dari XL terus bergerak secara bergiliran ke lokasi pengungsi. Beberapa bahan logistik lagi akan disalurkan terus guna memenuhi kebutuhan dari korban.(m09)

PB Al Washliyah Kunjungi Pengungsi Sinabung KABANJAHE (Waspada): Pengurus Besar (PB) Al Washliyah yang dipimpin Ketua Umum, Prof. Dr. H. Muslim Nasution, MA mengunjungi sejumlah lokasi pengungsian korban letusan Gunung Sinabung di Kabupaten Karo, diantaranya Jambur Lige Kabanjahe, Kamis (2/9). Kedatangan Ketua Umum PB AlWashliyah didampingi Sekjend, Drs. Haris Sambas, Ketua Umum PP Ikatan Pelajar Al Washliyah Wizdan Lubis, Ketua Umum PW Al Washliyah Sumut Drs. H. Nizar Syarif, Rektor Universitas Al Washliyah Prof. Dr. H. Syahrin Harahap, Rektor Universitas Muslim Nusantara Al Washliyah, Prof. Hj. Sri Sulistyawati, M.Si dan ketua Umum Pemuda Al Washliyah Medan, Tuah Aman, S.Ag SH. PB Al Washliyah menyerahkan bantuannya yang terdiri dari aneka sandang dan pangan yang diterima dan akan disalurkan oleh Ketua Umum PD Al Washliyah Kabupaten Karo. Selain mengunjungi lokasi penampungan, Muslim beserta rombongan juga menyempatkan diri mengunjungi Masjid Al Jihad desa Tiga Serangkai kecamatan Simpang Empat kabupaten Karo, salah satu desa yang saat ini kosong karena warganya ikut dievakuasi. Kepada wartawan, Muslim Nasution mengatakan, dalam waktu dekat pihaknya akan menyediakan penceramah untuk memberikan pencerahan rohani bagi pengungsi. PB Al Washliyah juga akan mengirimkan sukarelawan pendamping pengungsi, khususnya yang beragama Islam. (c06)

Rekaman Peristiwa PT Medan Bebaskan Terdakwa Penyerobotan Lahan Di Muara Upu Tapsel P.SIDIMPUAN (Waspada): Pengadilan Tinggi (PT) Medan membatalkan putusan Pengadilan Negeri Padangsidimpuan terkait vonis satu tahun enam bulan penjara terhadap dua terdakwa kasus penyerobotan lahan di Desa Muara Upu, Kec. Muara Batang Toru, Kab. Tapanuli Selatan, Bahari Efendi Pasaribu dan Adzan Mulia Pasaribu. Dalam amar putusan No 581/Pid/2010/PT-Mdn, mejelis hakim PT Medan telah membatalkan putusan PN P. Sidimpuan tertanggal 25 Juni 2010 Nomor 230/Pid.B/2010/ PN.Psp. Bahkan majelis hakim memerintahkan kedua terdakwa untuk segera dibebaskan dari tahanan negera. Kemudian menyatakan dakwaan JPU tidak dapat diterima karena bertentangan dengan peraturan MA No 1 tahun 1956 Pasal 1.

Demikian disampaikan kuasa hukum kedua terdakwa, Marwan Rangkuti SH, di kantor Pengacara Marwan Rangkuti dan Rekan, Jalan Perintis Kemerdekaan, Kelurahan Padangmatinggi, Kota Padangsidimpuan, Sabtu (4/9). Adapun mejelis hakim PT Medan yang menyidangkan perkara banding atas Putusan PN Padangsidimpuan, diketuai Husni Rizal, SH, bersama hakim anggota, H Sudrajat Dimiyanti, SH.MH, dan Elang Prakoso Wibowo SH. “Alhamdulillah, banding kami ke PT Medan atas putusan PN Padangsidimpuan No 230/ Pid/2010 telah dikabulkan. Kedua klient saya juga sudah dikeluarkan dari rumah tahanan negara alias bebas dari tuntutan h u k u m ,” s e b u t M a r w a n Rangkuti. Dijelasannya, apa yang telah

diperiksa dan juga dijadikan dasar hukum sebagai pertimbangan bagi majelis hakim PT Medan dalam memutus perkara, sudah merupakan pertimbangan hukum yang sangat tepat dan benar. “Putusan atas pembatalan putusan PN Padangsidimpuan ini sudah tepat dan benar. Keputusan ini sekaligus membuktikan bahwa putusan pengadilan tingkat pertama itu ngawur,” ucap Marwan yang juga Ketua Bidang Pembelaan Provesi Advokat DPC Peradi Padangsidimpuan. Secara terpisah, Arman Pasaribu mewakili pihak keluarga Bahari Efendi Pasaribu dan Adzan Mulia Pasaribu, bersyukur dan berterimakasih atas putusan PT Medan. “Putusan ini membuktikan jika keadilan masih ada di negeri ini dan memang berpihak kepada

yang benar,” katanya. Ditambahkan, setelah adanya putusan PT Medan dan memiliki kekuatan hukum tetap, pihaknya berencana melakukan tuntutan pidana maupun perdata terhadap oknum Jaksa Penuntut Umu (JPU) dari Kejari Padangsidimpuan yang berinisial GP. ”Tuntutan JPU itu sudah merugikan kami secara jasmani dan rohani. Atas dasar itu kami akan balik menuntut baik secara perdata maupun pidana,” tegasnya. Untuk diketahui, majelis hakim PN Padangsidimpuan pada 25 Juni 2010 lalu telah memutuskan hukuman 1 tahun enam bulan penjara kepada Bahari dan Adzan Pasaribu atas perkara penyerobotan lahan milik Koperasi Makaty Karya di Desa Muara Upu. (a20)

Hidayat: Jadikan Ramadhan Benteng Menahan Diri PANYABUNGAN (Waspada): Pasangan calon bupati/ wakil bupati Madina periode 2010-2015, HM Hidayat Batubara, SE – Drs Dahlan Hasan Nasution mengadakan acara buka puasa bersama dengan lebih kurang 200 orang masyarakat di Kecamatan Bukit Malintang, Kabupaten Mandailing Natal baru-baru ini. Acara yang dipusatkan di Pasar Baru Malintang itu merupakan bahagian rangkaian dari Ifhtor Jama’i (buka puasa bersama) yang dilaksanakan DPD II Partai Keadilan Sejahtera (PKS) Kabupaten Madina dalam mengisi agenda rutin tahunan partai berbasis Islam itu. Tujuannya untuk menjalin dan mempererat tali silaturrahmi/rahim dengan semua masyarakat dari semua elemen. Dayat Batubara dalam kata sambutannya berharap dengan moment buka puasa bersama di bulan suci Ramadhan mampu meningkatkan ke imanan dan ketakwaan. Dan masyarakatpun bisa lebih mengenali diri masing-masing untuk menuju peroses menciptakan keselarasan dan rasa persaudaraan yang tinggi terhadap sesama manusia. “ Hanya dengan cara itu kita bisa memimpin diri supaya terhindar dari perbuatan-perbuatan yang merugikan moral dan dilarang keras oleh agama. Jika itu bisa terlaksana, hidup kita akan terpimpin dengan baik dan berjati diri, serta memberikan kesabara dan ketabahan

dalam menghadapi masalah hidup manusia, kita harus ingat, Tuhan senantiasa mencoba umatnya untuk kebaikan “ ucap Dayat. Katanya, ia menerapkan prinsip itu dalam diri dan kehidupannya. Sehingga, ketika mengalami masalah, ia tetap tenang dan membuang jauh ras kecewa dan putus asa. Karena ia yakin, apa yang datang dan pergi dalam kehidupan manusia adalah hal mutlak kehendak NYA, dan terbaik bagi manusia. Ia juga berpesan kepada kepada masyarakat pendukung maupun simpatisan pasangan Hidayat-Dahlan di Pemilukada putaran pertama (I), supaya menjadikan bulan Ramadhan sebagai benteng untuk menahan diri dari serangan lawanlawan politik yang dapat memicu keributan. Sebaliknya menjadikan momen untuk menggalang kekuatan lebih dahsyat untuk memenangkan suara dan pilihan hati nurani rakyat di

pilkada pemungutan suara ulang tahap kedua dengan satu tekad dari rakyat untuk kemakmuran rakyat. Ayahanda Hidayat, H Maslin Batubara pada kesempatan itu juga mengucapkan rasa bangga dan terima kasihnya kepada segenap masyarakat Madina yang telah memberikan kepercayaan sehingga di pemilukada putaran pertama anaknya menang, meskipun akhirnya kemenangan itu tertunda. Namun ia hakkul yakin suara rakyat untuk penegemban amanah rakyat nantinya akan jauh lebih besar. Ketua DPD PKS Madina, H Martua Nasution, LC.MA mengimbau kader PKS dan simpatisan supaya terus meningkatkan ukuwah islamiyah di bulan Ramadhan. Karena di bulan suci itu, segala perjuangan manusia untuk kebaikan akan

sangat istimewa di mata Tuhan. Dengan demikian, perjuangan PKS dan pendukung lainnya dalam mengemban amanah rakyat akan mendapatkan ridho, untuk mengantarkan Dayat-Dahlan menjadi Bupati /Wakil Bupati Madina mendatang. Karena sudah tegas di putusan MK, kontestan pemilihan bupati dan wakil bupati tetap di ikuti 7 pasangan calon. “ Karena itu masyarakat jangan khawatir dan teruslah berjuang,” jelas H Martua. Hadir dalam acara itu para pengurus teras DPD PKS Madina, antara lain, H Riadiy Husnan LC, kemudian tokoh masyarakat, tokoh adat, alim ulam dan sebagainya. Usai buka puasa bersama, pasangan Hidayat-Dahlan menyempatkan diri temu ramah dengan warga, kemudian memberikan tali asih. (csh)

Budi Agung R.Prapat Santuni Anak Yatim Dan Jompo RANTAUPRAPAT (Waspada): Para pengurus Yayasan Badan Sosial Budi Agung Rantauprapat menyantuni anak yatim dari 3 panti asuhan dan panti jompo, Jumat (3/9). Hadir di sana Ketua yayasan DR HC Sujian/Acan didampingi Wakil Ketua Jony/Acai, Wakil Sekretaris Rasyidin Siregar dan salah seorang anggota Jaya Kumaren. Mereka pertama sekali mengunjungi Panti Asuhan Siti Khadijah. Selanjutnya dikunjungi dan diberikan bantuan ke Panti Werda Harapan, Jalan Dewi Sartika, Panti Asuhan Putra Muhammadiyah, Jalan Padang Matinggi dan Panti Asuhan Putra Al-Arif, Jalan Padang Matinggi. Menurut Acan, semua yang diperolehnya terdapat milik orang lain walau itu terbilang sebahagiannya. (a27)

WASPADA Senin 6 September 2010

PT PHG Bantu 5.030 Duafa Dan Anak Yatim Di Palas SIBUHUAN (Waspada): PT PHG memberikan bantuan untuk 5.030 orang duafa dan anak yatim yang berada di sekitar lingkungan perusahaan yang tergabung dengan PT Permata Hijau Group di wilayah Kabupaten Padanglawas. Demikian keterangan Manajer Umum Kantor Direksi PT PHG Asep Tatang dan Sofyan Manan Nasution didampingi KDP David Siburian, GM Kebun dan manajer kebun serta pabrik perusahaan Group PT PHG yang beroperasi di Padanglawas, Jumat (3/9). Kegiatan pemberian bantuan sosial yang dilakukan itu merupakan program rutin yang dilakukan setiap tahun di bulan Ramadhan menjelang Lebaran. Sebelumnya juga perusahaan itu memberikan bantuan ke sejumlah masjid untuk mendukung kegiatan tadarusan sepanjang bulan Ramadan. Juga melakukan operasi pasar murah minyak goreng di Hutaraja Tinggi, Sosa dan Lubuk Barumun sebanyak 7.000 liter dengan harga jauh lebih murah dari harga pasar. (a32)

HIPMI Labuhanbatu Santuni Anak Yatim Piatu RANTAUPRAPAT( Waspada): Badan Pengurus Cabang Himpunan pengusaha muda indonesia ( BPC HIPMI ) Labuhanbatu memberikan santunan tali asih kepada 50 anak yatim, dalam rangakaian acara buka bersama pengurus Himpunan pengusaha Muda Indonesia Labuhanbatu ( HIPMI ) Rabu (1/9) di kantor HIPMI Jalan SM Raja Ujung Bandar Rantau Prapat. Acara ini digelar oleh pengurus HIPMI berdasarkan rasa solidaritas agar lebih mempererat hubungan silaturahmi antar sesama pengurus, kata Ketua BPC HIPMI Labuhanbatu H Idlinsah Harahap. Wakil Bupati Labuhanbatu Suhari Pane, SIP mengatakan, keberhasilan seseorang tidak ada ukurannya dengan seorang pegawai negri sipil ( PNS ), kunci keberhasilan adalah niat seseorang melakukan yang ingin berhasil harus dibaringi dengan semangat yang tinggi serta kemauan yang keras. (c01)

Ketua DPRD Bagi Bingkisan Kepada Jamaah Tarawih RANTAUPRAPAT(Waspada): Ketua DPRD Labuhanbatu Hj Ellya Rossa Siregar menyelenggarakan shalat Tarawih bersama di rumah dinas Ketua DPRD Labuhanbatu di Jalan Jenderal Sudirman Rantauprapat. Setelah mendekati datangnya Idul Fitri Hj.Ellya Rossa Siregar Rabu (1/9) malam memberikan bingkisan berbentuk parsel kepada seluruh jamaah yang hadir beserta dua botol sirup per orangnya, sementara Freddy Simangunsong selaku suami memberikan bunga api kepada seluruh jamaah anak-anak. Hj.Ellya Rossa Siregar ketika dikonfirmasi Waspada Rabu (1/9) malam di rumah nya mengatakan “saya menyelenggarakan shalat Tarawih berjamaah ini dengan tujuan agar masyarakat labuhanbatu khususnya Kelurahan Padang matinggi dapat menjadi lebih dekat lagi kepada saya, karena saya menyadari karena merekalah saya bisa menjadi Ketua DPRD seperti sekarang ini,”katanya. (c01)

HIPIMI Binjai Santuni Yatim Piatu BINJAI (Waspada) : Himpunan Persaudaraan India Muslim Indonesia (HIPIMI) Kota Binjai berbuka puasa bersama dengan anak yatim piatu, Kamis (2/9) di kediaman Alex Murad di Jalan Sudirman Binjai. Menurut pengurus HIPIMI Alex Murad didampingi Abd.Wahab dan M Nasir, berbuka puasa bersama 60 anak yatim piatu dari Al Wasliyah dan warga Gang Matseh memberikan kebersamaan dalam menjalani ibadah Ramadhan. Hal ini, menurut Alex, sesuai petunjuk Dewan Pembina HIPIMI Syamsul Arifin yang juga Gubernur Sumatera Utara. Berbuka puasa bersama, shalat Maghrib berjamaah, pengurus HIPIMI Binjai menyerahkan santunan kepada yatim piatu. Hal ini agar anak-anak yatim piatu bisa menunaikan hari kemenangan dengan sukacita. Alex menyebutkan,HIPIMI Kota Binjai sejak pengurusnya dilantik Dewan Pembina Syamsul Arifin sudah berjalan satu tahun dan mendatang HIPIMI mulai melahirkan program untuk anggota dengan mendirikan koperasi dan aktivitas sosial kemasyarakatan. (a03)


WASPADA Senin 6 September 2010

Bupati Sergai Sampaikan Terimakasih Kepada PDI Perjuangan SEI RAMPAH(Waspada): Bupati Serdang Bedagai HT Erry Nuradi menyampiakan ucapan terimakasih kepada Partai Demokrasi Indonesia Perjuangan (PDI P) Serdang Bedagai, DPD PDI P Sumut dan DPP PDI P atas dukungan partai ini dalam menghantarkan dirinya bersama H Soekirman menjadi pemenang pemilukada 12 Mei 2010 dan sudah dilantik Gubsu menjadi Bupati-Wakil Bupati Sergai 2010-2015 tanggal 9 Agustus 2010. Pernyataan disampaikannya di hadapan sekira 800-an warga PDIPdanBamusiSergaisaatberbukapuasabersamayangdilaksanakan di halaman kantor DPC PDI P Sergai, Jumat (27/8) Dia berharap, dukungan PDI P tidak hanya pada pilkada yang telah selesai , tetapi juga dalam kepemimpinannya di tanah Bertuah Negeri Beradat untuk lima tahun kedepan. Acara berbuka puasa itu dirangkai dengan penyerahan dokumen pilkada Sergai 2010 yang diserahkan ketua DPC PDI P Sergai Khairy A Zulmy kepada Bupati Sergai Selain itu , Khairy A Zulmy juga menyampaikan bingkisan paket lebaran kepada 20 orang sesepuh PDI P Sergai. Turut hadir , Sekdakab Serdang Bedagai Drs H Haris Fadillah, MSi, seluruh pengurus DPC PDI P dan Bamusi Sergai , Fraksi PDI P dan sejumlah tokoh masyarakat dan tokoh agama. (a07)

Polresta Binjai Ringkus Dua Pria Pemilik Shabu BINJAI (Waspada) : Sat Narkoba Polres Binjai, Rabu (1/9)meringkus dua pria pemilik satu paket shabu, AS alias Mat, 29, warga Jalan Serayu, Dusun V, Kec. Sunggal, Deliserdang, dan ZF alias Dodo, 40, warga Jalan KaryaWisata, Medan Johor. Kedua tersangka diringkus di Jalan baru Binjai, persisnya di kafe N di Kecamatan Binjai Utara. “Guna pengusutan selanjutnya kedua tersangka bersama barang bukti diamankan di rumah tahanan Sat Narkoba Polres Binjai,” kata Kapolres Binjai AKBP Dra Rina Sari Ginting melalui Kasat Narkoba AKP Achiruddin, kemarin. Keterangan diperoleh, ketika Sat Narkoba Polres Binjai, melakukan patroli ke kawasan Binjai Utara usai menerima informasi kalau pengunjung kafe N ada memiliki Narkotika jenis shabu. Informasi tersebut langsung ditindaklanjuti dengan petugas meluncur ke lokasi. Begitu melihat kedua pria berada di dalam kafe sesuai dengan ciri-ciri seperti yang diinformasikan langsung diringkus. Ketika diperiksa saku celana AS alias Mat ditemukan satu paket shabu. (a04)

Polres Binjai Gelar Pasukan Operasi Ketupat Toba 2010 BINJAI (Waspada) : Polres Binjai melaksanakan operasi khusus kepolisian dengan sandi Operasi Ketupat Toba 2010. Pelaksanaan gelar operasi tersebut ditandai dengan gelar pasukan. Bertindak selaku Irup Kapolres Binjai AKBP Rina Sari Ginting dan komandan upacara Kaur Bin Ops Sat Sabhara Iptu Zakaria di lapangan bola kaki Mapolres Binjai, Kamis (2/9). Kapolres Binjai AKBP Rina Sari Ginting sempat melakukan pemeriksan barisan pasukan dan menyematkan pita tanda operasi kepada perwakilan petugas Polres Binjai, POM dan LLAJ. Kapolri Jenderal Polisi Drs H Bambang Hendarso Danuri dalam amanat tertulisnya yang dibacakan Kapolres Binjai mengatakan, menjelang dan menyambut Idul Fitri kegiatan dan aktivitas masyarakat akan meningkat cukup tinggi, yang ditandai dengan ramainya pengunjung di pusat- pusat perbelanjaan, meningkatnya arus transportasi yang digunakan masyarakat baik arus mudik maupun arus balik, situasi ini harus kita antisifasi dengan sebaik-baiknya.(a04)

Gelapkan Sepeda Motor Cicilan Dihukum 7 Bulan Penjara PANYABUNGAN(Waspada): Akibat menggelapkan sepeda motor cicilan, Duma Sari Batubara warga Kayu Jati Panyabungan, divonis Majelis Hakim Pengadilan Panyabungan 7 bulan penjara, Kamis (2/9). Sebelumnya, Jaksa Penuntut Umum (JPU) M. Iqbal, SH menuntut setahun penjara.Terpidana sesuai tuntutan FIF Cabang Padangsidimpuan Pos Panyabungan, menggelapkan sepeda motor Honda Supra X 125 tahun 2008. Kepala Cabang FIF Padangsidimpuan melalui Kepala Pos FIF PanyabunganMuhammadIrfanSiregarusaipersidanganmengatakan, sebelumnya kita tidak ingin memperkarakan, namun terpidana tetap tidak mau diajak koordinasi Seharusnya, kalau memang dia sudah memberikan kepada orang lain menyambung cicilan sepeda motor tersebut, selaku pemilik pertama wajib melaporkan ke perusahaan dengan jelas, sehingga tanggungjawabnya terhadap sepeda motor itu selesai. (csh)

Sumatera Utara Oknum Kabid Kabid Dinas PU Palas Jadi Tersangka SIBUHUAN ( Waspada): Oknum Kepala Bidang Cipta Karya dan Bina Marga Dinas Pekerjaan Umum dan Pertambangan Energi Mineral Kabupaten Padanglawas, AHN jadi tersangka dan masuk bui atas dugaan korupsi dana pemeliharaan proyek Tahun Anggaran (TA) 2009. Kepala Cabang Kejaksaan negeri Padangsidimpuan di Sibuhuan, Kipli Ramadan, SH kepada Waspada, Kamis (2/9), setelah memintai keterangan sejumlah saksi terkait kasus pemeliharaan fiktif pada proyek rehabilitasi daerah irigasi Aek Ukka, Desa PP Makmur TA 2009, sumber dana stimulus fiskal APBN sebesar 49.515.000 dengan jumlah pagu proyek sebesar Rp.990.300.000. Hal itu menindaklanjuti surat perintah penyidikan no PRINT. 02/N.2.20.9/Fd.1/08/2010 tanggal 3 Agustus dan surat perintah penahanan no.. PRINT.02/N.2.

20.9/Fd.1/08/2010 tanggal 2 September 2010. Dikatakan, berdasarkan keterangan sejumlah saksi, dan juga hasil pemeriksaan terhadap tersangka oknum Kabid Bina Marga dan Cipta Karya yang juga mantan pimpro di Dinas PU Padanglawas, AHN diduga kuat menyalahgunakan wewenang yang dapat berakibat timbulnya kerugian keuangan negara, yang melanggar pasal 2 ayat (1), pasal 3, pasal 8 dan pasal 9 Undangundang no 20 tahun 2001. Kasus pemeliharaan fiktif pada proyek rehabilitasi daerah irigasi Aek Ukka Desa PP Makmur TA 2009 yang melibatkan mantan pimpro Dinas PU Palas itu, Dengan tim penyidik yang dipimpin langsungKacabjariSibuhuan,Kipli Ramadan,SHdanClaraH.Siregar, SH. Penahanan yang dilakukan untuk memudahkan pemeriksaan lanjutan dalam perkara duga-

Pustu Dan Poskesdes Di Sidimpuan Diduga Tidak Bersertifikat P.SIDIMPUAN (Waspada): DPRD Kota Padangsidimpuan, melalui Fraksi Partai Demokrat (FPD) menyoroti legalitas pendirian sejumlah Puskesmas Pembantu (Pustu) dan Pos Kesehatan Desa (Poskesdes) di wilayah kota itu. Menurut data dan informasi langsung yang diperoleh DPRD di lapangan, banyak Pustu dan Poskesdes yang tidak memiliki sertifikataliaspendiriannyamasih di tanah warga dan suatu saat bisa digugat. “DPRD sudah merekomendasikan kepada Walikota, Zulkarnaen Nasution, agar mempertanggungjawabkannya. Anggaranuntuksertifikasikepemilikan ratusan juta, namun faktanya banyakPustudanPoskesdesyang tidak punya sertifikat,” kata Ketua FPD, Khoiruddin Nasution, Rabu (1/9). Menurut FPD, Dinkes telah besikap asal caplok atas lahan milik warga utuk pembangunan

Pustu dan Poskedes. Karena banyakwargayangmengakubelum menghibahkan tanahnya, namun telah dibangun Pustu dan Poskedes. FPD sangat menyangkan sikap Kadis Kesehatan Pemko Padangsidmpuan yang hingga saat ini belum memberi jawaban atasrekomendasiDPRDtersebut. Kemudianpenggunaananggaran pembebasan lahan dan sertifikasi hingga kini juga belum dipertanggungjawabkan. P Harahap, 39, warga pemilik lahan di Desa Pudun dan di atasnya dibangun Pustu mengaku hingga kini keluarganya belum memberikan izin atas pendirian Pustu itu. Kadiskes Kota Padangsidimpuan, Doria Hafni Lubis, beberapa waktu lalu kepada DPRD mengaku tidak mengetahui hal itu. Saat itu dia berjanji kepada DPRD akan memeriksa ulang, namun hingga kini belum ada jawabanyangditerimadewan.(crm)

Fraksi Partai Demokrat Apresiasi Kepemimpinan Amru Daulay PANYABUNGAN (Waspada): Atas usaha pembangunan yang telah dilaksanakan secara bersungguh-sungguh dan terlepas dari segala kelemahan yang ada, sebagai bangsa yang beradab , kami dari Fraksi Partai Demokrat DPRD Madina mengucapkan terima kasih kepada H Amru Daulay , SH , untuk segala yang beliau berikan dalam pengabdiannya sebagai Bupati Madina masa bhakti 2005-2010. Hal itu disampaikan Ketua Fraksi Partai Demokrat Madina

Ir Ali Mutiara Rangkuti didampingi Drs Irwan Nasution dan Rahmad Rizki kepada Waspada, Minggu (5/9),terkait akan berakhirnya masa jabatan Amru Daulay sebagai Bupati Madina pada 12 September 2010 mendatang ini. Menurutnya,suka atau tidak suka,kita harus akui di bawah kepemimpinan H Amru H Daulay, SH sebagai bupati, Kabupaten Mandailing Natal telah mengalamikemajuanyangcukup signifikan. (a24)

an korupsi terkait kasus pemeliharaan fiktif pada proyek rehabilitasi daerah irigasi Aek Ukka desa PP Makmur TA 2009 sebesar Rp.49.515.000 dengan jumlah pagu proyek sebesar Rp.990. 300.000 sumber dana stimulus fiskal APBN 2009. Kepala Dinas Pekerjaan Umum dan Pertambangan Energi Mineral Kabupaten Padanglawas, Ir Choirul Windu Harahap, ketika coba dihubungi terkait penahanan oknum Kabid itu tidak berhasil dihubungi. Menurut salah seorang pegawai mengatakan bahwa Kadis PU Palas sedang tugas luar, ia juga merasa terkejut atas penahanan rekannya, hanya karena masalah pemeliharaan proyek TA 2009. (a32)

B7

PT ISM Dan Karyawan Buka Puasa Bersama Muspika TANJUNGMORAWA (Waspada): PT. Indofood Sukses Makmur (ISM) Tbk Noodle Division Cabang Medan serta karyawan berbuka puasa bersama dengan Muspika Tanjungmorawa, tokoh masyarakat, MUI, dan memberikan santunan kepada puluhan anak yatim, di halaman perusahaan tersebut, Selasa (31/8). Camat Tanjungmorawa Hasbi mengatakan, pemerintah memberikan penghargaan yang setinggi-tingginya kepada PT ISM Tbk Noodle Division Cabang Medan, walaupun saat ini perekonomian nasional sedang prihatin dan berdampak terhadap dunia usaha yang kian melemah, namun masih mampu menyelanggarakan kegiatan

berbuka puasa bersama serta memberikan santunan kepada anak yatim. Kepala Cabang PT. ISM Tbk Noodle Division Cabang Medan Mochtar Sukardi menyebutkan, walau perusahaan saat ini secara umum mengalami krisis namun kegiatan berbuka puasa bersama serta memberikan santunan kepada anak yatim di lingkungan perusahaan tetap dilaksanakan setiap tahun, dan merupakan agenda tetap. Mochtar menyampaikan terima kasih kepada warga masyarakat yang telah membantu kelancaran aktivitas perusahaan dan pemberian penghargaan masyarakat terhadap perusahaan sebagai perusahaan yang peduli pendidikan.

Kegiatan kemudian dilanjutkan dengan siraman rohani oleh Ustadz Imam Musa Nazibullah dan dilakukan berbuka puasa bersama, kemudian shalat maghrib berjamaah. Setelah makan malam dilanjutkan pemberian bingkisan dan santunan terhadap anak yatim yang diserahkan secara simbolis oleh Komandan Koramil 16/ TM Kapten Kav. Rianto didampingi Kepala Cabang PT. ISM Tbk Noodle Division Cabang Medan Mochtar Sukardi, tokoh pemuda dan MUI Deliserdang. Turut hadir antara lain, Kapolsek Tanjungmorawa, Sekretaris PWI Perwakilan Deliderdang Rinto Sustono, Kepala Desa Tanjung Morawa B H Fauzy, Ketua MUI dan Kepala KUA H Aminullah. (csn)


Aceh C1 Gubernur Buka Peluang Pengrusakan Hutan KEL

WASPADA Senin 6 September 2010

Waspada/Khairul Boangmanalu

SANTUNI DHUAFA: Ketua Dewan Pimpinan Cabang (DPC) Ikatan Wanita Pengusaha Indonesia (Iwapi) Subulussalam, Hj. Mariani Harahap sedang menyerahkan santunan kepada sejumlah dhuafa, Jumat (3/9) di rumah pribadinya di Subulussalam.

DPC Iwapi Subulussalam Santuni Kaum Duafa SUBULUSSALAM (Waspada): Ketua Dewan Pimpinan Cabang (DPC) Ikatan Wanita Pengusaha Indonesia (Iwapi) Subulussalam, Hj. Mariani Harahap menyantuni ratusan kaum duafa se-Kota Subulussalam. Pemberian bingkisan seperti sirup, gula dan uang ini merupakan rangkaian buka puasa bersama pada hari yang sama, kemarin, di rumah Hj. Mariani Harahap di Subulussalam, selaku istri Wakil Walikota Subulussalam, H. Affan Alfian Bintang. Selain para duafa, ikut buka puasa bersama dilanjutkan shalat maghrib berjamaah, segenap Pengurus Parpol Hanura se-Kota Subulussalam dan ratusan undangan. Menurut Hj. Mariani Harahap, motivasi pemberian santunan didasari kepada pesan agama, betapa pentingnya sikap kepedulian orang-orang yang memiliki harta untuk membantu sesama, terutama kepada kaum yang lemah karena harta yang dimiliki adalah titipan Allah SWT dan sifatnya tidak kekal.

Karenanya Hj. Mariani yang juga anggota DPRK Subulussalam ini minta para duafa selalu bersabar dan berdoa agar pemberian yang alakadarnya itu diberkahi Allah SWT. Dalam kesempatan ituWakilWalikota H. Affan Alfian Bintang juga menyerahkan bingkisan dan uang saku kepada sejumlah pengurus masjid. Sejumlah sumber kepada Waspada menye-butkan, kegiatan sosial yang dilakukan Affan Alfian Bintang bersama keluarga sudah rutin dilaksanakan, bahkan sebelum menjadi Wakil Walikota, terutama kepada para anak yatim, duafa, jompo maupun masyarakat lain yang dinilai membutuhkan bantuan. “Kalau kedermawananWakilWalikota dan keluarga memang sudah cukup diketahui masyarakat,” katanya. Mereka pun berharap, kepedulian dan kedermawanan Affan selaku WakilWalikota dan Hj. Mariani Harahap selaku anggota DPRK sekaligus pengusaha sukses tidak akan pernah surut.(b33)

BPKEL Ultimatum 16 Perusahaan Perkebunan ACEH TIMUR (Waspada): Setelah Polres Aceh Tamiang, menetapkan Direktur PT RML berinisial K sebagai tersangka dalam kasus pembukaan kebun dalam hutan lindung, Badan Pengelola Kawasan Ekosistem Leuser (BPKEL) Wilayah Aceh, mengultimatum 16 perusahaan perkebunan lain. “Ke-16 perusahaan perkebunan, baik yang dikelola secara terorganisir, maupun milik perseorangan, telah kita ingatkan dan kita ultimatum melalui suart resmi yang kita layangkan,” ujar Staf Konservasi Badan Pengelola Kawasan Ekosistem Leuser (BPKEL) Wilayah Aceh, Rudi Putra, kepada Waspada, Rabu (1/9). Rudi mengatakan, keberadaan BPKEL di Aceh adalah sebagai badan otonom yang dibentuk oleh Pemerintah Aceh berdasarkan Pergub Nomor 52 Tahun 2006, dimana tugasnya antara lain adalah menyelematkan hutan Aceh, khususnya hutan lindung dan hutan yang di dalam Kawasan Ekosistem Leuser (KEL). Menurut Rudi, melihat kondisi hutan di

Aceh Tamiang, membuat pihaknya sangat prihatin. Selain kerusakan hutan sudah digaris memprihatinkan, merambahnya perkebunan sawit dan lainnya juga membuat KEL disana semakin menyempit, bahkan Kabupaten AcehTamiang, adalah peringkat pertama kerusakan hutan. Oleh karenanya, lanjut Rudi Putra, pihaknya perlu menyelamatkan hutan lindung dan KEL di Aceh Tamiang dengan mengeluarkan surat peringatakan pada, Kamis, 26 Agustus 2010 kepada 16 pelaku, baik itu perusahaan maupun prerseorang. “Kita melayangkan surat itu karena berdasarkan hasil survey, bahwa keberadaan kebun-kebun itu dalam kawasan hutan lindung dan masuk dalam KEL,” ujarnya. Rudi Putra menambahkan, pemilik perkebunan yang diingatkan itu adalah karena dianggap illegal, sebab keberadaannya di dalam hutan lindung dan hutan produksi dalam Kawasan Ekosistem Leuser (KEL) Kabupaten Aceh Tamiang. (cmad)

“Terutama rekomendasi Irwandi terhadap pemberian ijin Hutan Tanaman Industri (HTI) seluas 31.472 hektar kepada PT Rencong Pulp And Paper di 3 Kabupaten di Aceh yakni di Aceh Tamiang, Aceh Timur dan Aceh Utara, bertolak belakang terhadap penyelamatan Hutan Aceh dan Moratorium Logging (jeda tebang),” ungkap Direktur Eksekutif LembAHtari, Sayed Zainal, M, SH kepada Waspada, Sabtu (4/9). Menurut Sayed, Gubernur dinilai banyak kalangan gagal mengelola hutan Aceh, bukan memperbaiki malah menghan-

curkan. Kebijakan Irwandi mengundang reaksi keras LSM lokal yang konsen terhadap penyelamatan lingkungan. Sayed Zainal, lebih lanjut menyatakan bentuk rekomendasi yang diberikan Irwandi, merupakan babak baru pengrusakan hutan KEL di Aceh. Sebab, Irwandi sudah mengangkangi apa yang dia terbitkan yaitu moratorium logging. Sayed menerangkan, pasca perjanjian damai antara Gerakan Aceh Merdeka (GAM) dengan Pemerintah RI 15 Agustus 2005, Irwandi menerbitkan 3 rekomendasi kepada 3 kabupaten untuk pengelolaan KEL Aceh, dijadikan Hutan Tanaman Industri (HTI). Sayed memaparkan; Rekomendasi dari Abdul Latif (Bupati Aceh Tamiang) No: 522/23697 tahun 2009, Rekomendasi dari Bupati Aceh Timur No: 522/21/ 10776 tahun 2009 dan Rekomendasi Bupati Aceh Utara No: 522/11098 tahun 2008 tanggal 18 November dan Kadishutbun Aceh tertanggal 07 Juni 2010 No: 522.64/3.777-IV, telah melanggar Peraturan Perundangundangan. “Saya pikir, tiga rekomendasi yang diberikan Irwandi kepada tiga kabupaten itu penuh muatan politis. Betapa tidak, moratorium logging dibuat, lalu dilanggar dengan cara memberikan rekomendasi, permainan

ACEH TIMUR (Waspada): Kompor minyak jenis Hock meledak ketika sedang memanaskan air di Desa Gampong Jalan, Kecamatan Idi Rayeuk, Kabupaten Aceh Timur, Sabtu (4/8) sekira pukul 21:30. Akibatnya, ruang dapur rumah jadi arang. Kebakaran terjadi sesaat setelah jamaah shalat tarawih pulang dari masjid dan meunasah. Rumah berkonstruksi kayu milik Tabrani, 45 ruang dapurnya hangus dilalap si jago merah. Bahkan seluruh bagian rumah

nyaris dilahap, tetapi api berhasil dipadamkan setelah warga sekitar membantu menyiram. Kejadian yang sempat mengejutkan warga berawal ketika isteri Tabrani sedang memasak air di dapur. Tiba-tiba kompor minyak yang biasa dipakai memanaskan air meledak. Api yang mulai membesar langsung menyambar dinding di mana di lantai juga terdapat puluhan botol kaca berisi minyak tanah. Istri Tabrani ketakutan lari ke ruang depan memba-

KUALASIMPANG (Waspada): Lembaga Advokasi Hutan Lestari (LembAHtari) menilai Gubernur Pemerintah Aceh, Drh Irwandi Yusuf plin plan dalam menjalankan kebijakan. Hal itu terlihat dari berbagai rekomendasi yang diberikan Irwandi yang diduga tidak mengacu kepada landasan hukum serta aturan yang telah digariskan, sehingga membuka peluang dalam pengerusakan hutan Kawasan Ekosistem Leuser ( KEL).

apalagi ini?,” kata Sayed. Ironisnya, sambung Sayed, Irwandi juga mengeluarkan pencadangan izin areal HTI yang diterbitkan No: 522.51/ BP2T/4729/2010 tanggal 07 Juni 2010, kepada PT Rencong Pulp And Paper Industry (RPAPI) pembangkangan dan pengangkangan Undang-Undang Tata Ruang Nasional tahun No: 26/2007, PP No: 26/2008 mengenai tata ruang nasional termasuk Undang-Undang Nomor 11/2006 Tentang Pemerintahan Aceh. Sayed mencontohkan pasal 150 ayat 1 s/d 4 UUPA, Pemerintah Aceh ditugaskan untuk melakukan pengelolaan KEL secara pengamanan, pelestarian dan pemulihan fungsi KEL secara lestari. Sedangkan ayat 2 mengatakan dilarang mengeluarkan ijin dalam KEL. Hasil monitoring LembAHtari, kenyataan di lapangan ternyata wilayah yang direkomendasi Irwandi—Wilayah Gunung Sangkapane—rata-rata 1.000 meter di atas permukaan laut, sementara kemiringannya (slove) di atas 30 derjat dengan curah hujan cukup tinggi bersebelahan langsung dengan hutan lindung dan bukan kawasan hutan kritis, walau pun eks Hak Penguasaan Hutan (HPH) PT KwalaLangsadanPTTjiptaRimba Djaja berakhir 20 Mei 2000. Di sisi lain, imbuhnya lagi,

Kompor Meledak, Rumah Terbakar ngunkan suaminya. Sementara api terus membesar hingga menyambar atap rumah dari daun rumbiya. Tabrani berteriak minta tolong. Tak lama kemudian, dua unit pemadam kebakaran dari UPTD Idi tiba di lokasi, sehingga api dapat dipadamkan. “Kita sudah menerima laporan kebakaran itu. Bahkan, polisi juga dikerahkan ke lokasi tadi malam,” ujar Kapolres Aceh Timur AKBP Ridwan Usman, melaluiKapolsekIdiRayeukAKPNurdin Z, Minggu (5/9) di Idi.(cmad)

Pemerintah Aceh telah mencadangkan konsep Aceh Hijau, bahkan ada program bantuan Bank Dunia melalui United Nation Development Programme (UNDP), Program Pengurangan Resiko Bencana Berbasis Komunitas (PRBBK). “Kok malah Irwandi mencadangkan 31.472 hektar untuk HTI, sementara Bank Dunia melalui UNDP sibuk melakukan program pengurangan resiko bencana berbasis komunitas. Irwandi malah sebaliknya; membuat program penghancuran KEL Aceh, ada apa ini?” ujar Sayed. Sayed menyatakan, pihaknya sangat kuatir, apabila terjadi banjir tahunan atau sepuluh tahunan dengan durasi dan curah hujan diatas 150 mm/de-

tik di hulu Kabupaten Aceh Tamiang, Aceh Timur dan Gayo Lues seperti Desember 2006, dipastikan wilayah Aceh Tamiang akan tenggelam diterjang air bah, bahkan akan lebih besar lagi akibat Ijin HTI diberikan Irwandi. “Saya mengajak masyarakat, lembaga, lembaga donor dan anggota dewan perwakilan rakyat daerah hingga ke pusat, menolak setiap kebijakan yang tidak berpihak dan berkelanjutan demi kepentingan sesaat. Kami juga memberikan apresiasi kepada Bupati Bener Meriah yang dengan tegas menolak pemberian rekomendasi izin PT Rencong Pulp And Paper Industry di wilayah mereka,” imbau Direktur Eksekutif LembAHtari itu.(b24)

Pengusaha Wajib Bayar THR KUALASIMPANG (Waspada): Dewan PimpinanWilayah Serikat Pekerja Aceh ( DPW-SPA) Kabupaten Aceh Tamiang mengingatkan pengusaha di Kabupaten Aceh Tamiang khususnya dan Aceh pada umumnya untuk membayar Tunjangan Hari Raya ( THR) bagi pekerja atau karyawan/tinya. “THR salah satu hak normative karyawan yang wajib dipenuhi pengusaha atau perusahaan dan harus telah dibayar paling lambat H-7, atau seminggu sebelum lebaran,” kata Ketua Umum DPWSPA Kabupaten Aceh Tamiang, Abdul Halim, SE didampingi Wakil Ketua, Zakaria dan Sekum, Rusdi, Rabu (1/9). Menurut Halim, dasar hukum pemberian THR merujuk kepada Peraturan Menteri Tenaga Kerja ( Permennaker) No.14/01/Men/ 1994. Karyawan yang berhak mendapat THR adalah yang telah bekerja selama 3 bulan ke atas dengan persentase tertentu. Bagi karyawan yang telah bekerja di atas 1 tahun berhak mendapat THR satu bulan gaji penuh dan bagi karyawan yang baru bekerja di bawah setahun,THR diberikan secara proporsional yaitu masa kerja dibagi 12 dikalikan 1 bulan gaji/upah. Ketua DPW –SPA Kab. Aceh Tamiang, Abdul Halim mengungkapkan, perusahaan /pengusaha yang belum membayar THR berdasarkan pengalaman tahun sebelumnya antara lain pekerja took, pekerja sector bangunan ( pekerja bangunan), pengusaha perkebunan yang tidak jelas status izinnya, padahal jika dilihat masa kerja mereka pada umumnya di atas setahun, tetapi THR yang mereka dapatkan hanya berupa uang daging dan uang sirup. Karena itu, DPW-SPA mengharapkan pihak atau pemilik usaha dagang tahun ini jangan ada lagi perlakuan yang sangat merugikan bagi karyawan/pekerja. “Bayarlah THR karyawan/pekerja sesuai peraturan, sangat wajar membayar hak mereka untuk setahun sekali satu bulan gaji,” tegas Abdul Halim.(b24)

Kasus Pemalsuan Data, Mahasiswa Kecam Panitia NAGAN RAYA (Waspada): Pemkab Nagan Raya mengalokasi dana untuk beasiswa tahun 2010 dari APBK bagi mahasiswa berprestasi, yang sedang menempuh study di Perguruan Tinggi Negeri (PTN) mau pun Swasta (PTS), baik di Nagan Raya maupun provinsi serta luar negeri, dengan anggaran Rp1,15 miliar. Berdasarkan informasi, persyaratan untuk mengurus beasiswa harus memiliki IP tertinggi. Tapi tim Advokasi Ikatan Pelajar Mahasiswa Nagan Raya, Barona kepada Waspada, menyebut persyaratan itu sangat memberatkan mahasiswa yang tidak berprestasi. Maka, ini mendorong beberapa mahasiswa nekat memanipulasi berkas agar bisa mendapat bantuan beasiswa. Yang kami sayangkan, katanya, kenapa masalah ini sampai kepada pihak berwajib, padahal semua berkas masih tahap permohonan dan masih bisa diverifikasi tentang kelayakan di terima atau tidaknya.(mji)

Masyarakat Minta Copot Kades Imsakiyah Ramadhan Senin, 6 September 2010 27 Ramadhan 1431 H 28 Ramadhan 1431 H

Berbuka Imsak

18:45 05:05

Jadwal untuk kota-kota lainnya: Calang (-1 menit), Jantho (-2 menit), Singkil, Meulaboh (-3 menit), Meureudu, Sukamakmue, Sinabang (-4 menit), Bireuen (-5 menit), Sp 3 Redelong, Takengon, Blangpidie (-6 menit), Lhokseumawe, Tapaktuan (-7 menit) Lhoksukun, Blang Keujeuren (-8 menit), Idi, Kutacane, Singkil (-10 menit), Langsa, Kualasimpang, Subulussalam (-11 menit). Sumber: Badan Hisab dan Rukyat Provinsi Aceh

GAMBA TANYO > Neu poto keujadian meunarek ngon kamera HP 3,2 mega piksel, kirem ngon MMS keu 08192110147. Na imbalan pulsa 20 ribee keu poto nyang di peuteubit.

JALAN MACAT PARAH

Jalan Pajak Ikan Samakurok Panton Labu, Aceh Utara, macat parah akibat disesaki pengguna jalan pada siang dan sore hari setiap bulan Ramadhan. Diharapkan pemerintah menjadikan jalan tersebut dua jalur, agar kemacatan bias berkurang. Foto diabadikan Kamis (2/9). Pengirim Aiyub, Tanjong Madat, 0852600238xx

Waspada/Muhammad Rapyan

LUBANG: 5 Anggota DPRK Simeulue, Ketua Komisi B, Ir. Mawardi Nasra, MM, Ketua Komisi D, M. Andi, Ketua Balegda, Rasmanudin H. Rahamin, SE, Asnawi dan Rahmad, paling kanan staf Sekwan Simeulue, Osisi Sarumaha, SE melihat taburan lubang ruas jalan dari dan ke SinabangLuan Balu persisnya antara desa Amaiteng —Linggi.

DPRK Minta Jalan Sinabang Luan Balu Diperbaiki SIMEULUE (Waspada): Lima anggota DPRK Simeulue, Ir. Mawardi Nasra, MM, M.Andi, Asnawi. Rasmanudin H. Rahamin, SE dan Rahmad minta pemerintah/eksekutif selaku pengambil dan pelaksana kebijakan segera memperbaiki ruas jalan dari dan ke Sinabang— Luan Balu yang kondisinya kini rusak berat. Harapan untuk perbaikan jalan itu dimaksud para legislatorif Simeulue ini mereka tujukan kepada pemerintah Provinsi Aceh baik itu kepada pihak Dinas Bina Marga—PU juga kepada DPRA. Karena jalur jalan dimaksud adalah jalur jalan provinsi. M. Andi yang turun melakukan Pansus bersama 4 rekannya yang lain, kemarin, kepada Waspada mengharapkan Pemerintah Provinsi Aceh yang menjadi penanggungjawab anggaran proyek jalan lingkar di Simeulue, khususnya dari dan ke Sinabang—Luan Balu, kiranya penanggungjawab proyek melakukan pengawasan. Soalnya, kata M. Andi, cepat rusaknya aspal jalan di Simeulue karena pelaksanaannya terkesan asal-asalan, sehingga umurnya singkat. Seperti halnya yang paling palang parah ruas jalan dari dan ke Sinabang— Luan Balu, di sekitar desa Amaiteng ke Desa Linggi. Kemudian jalan Lintas dari dan ke Sinabang—Luan Balu,

di sekitar jalan batas desa Ujung Tinggi dan Air Pinang. Ironinya, lagi sambung Rasmanuddin H. Rahamin, SE. Jalan antara Ujung Tinggi dan Air Pinang belum lama selesai dikerjakan kontraktor. Bahkan anehnya, sambungan jalan ini di sekitar Titi Olor masih dalam tahap pengerjaan. “Kok yang ini sudah rusak, ya,” sebut politisi PKS itu. Di pihak lain Asnawi, anggota DPRK Simeulue dari Partai Bulan Bintang menekankan kembali ke depan kiranya pemerintah provinsi yang mengelola anggaran jalan provinsi di Simeulue untuk melakukan pengawasan secara benar sehingga pembangunan sarana umum efektif. Tidak seperti pembangunan jalan yang sudah-sudah. Di pihak lain Ir. Mawardi Nasra, MM yang juga ikut Pansus selain meminta pihak DPRA dan Dinas Bina Marga—PU Provinsi Aceh bertanggungjawab terhadap cepat rusaknya aspal jalan dari dan ke Sinabang Luan Balu, dia juga menyoroti Bupati Simeulue yang terus membiarkan truk-truk tronton melebihi tonase dan seyogianya tidak boleh lewat di jalan raya, lalu lalang saban hari mengangkut material. Mestinya dengan kelas jalan begini, truk-truk besar sepuluh dan dua belas ban tidak boleh lewat di jalan kita yang kondisi aspalnya seperti kulit bawang ini. “Kalau ini pemerintah Si-

meulue tidak tegas kepada para kontraktor, maka proses pembangunan jalan lingkar Simeulue tidak akan selesaiselesai.” Sementara Sekretaris Komisi C DPRK Simeulue, Rahmad yang menjadi Ketua Pansus Jalan dari dan Ke Sinabang Luan Balu ini menyatakan sangat sependapat dengan harapan itu. Dia menambahkan, karena melihat paranya kondisi beberapa titik lintasan dari dan ke Luan Balu, khususnya di antara Desa Amaiteng dan Linggi dan Ujung Tinggi dan Air Pinang, kiranya Dinas PU Simeulue berkoordinasi dengan Dinas PU Aceh untuk penanggulangan. Jika memang belum ada dana yang memadai untuk pengaspalan, setidaknya meminta pengertian kepada pelaksana proyek atau para pengusaha yang telah merusak lintasan itu melalui penggunaan alatalat berat yang seharusnya tidak pantas melintas di situ tapi mereka paksakan. Untuk melakukan penambalan. Menurutnya, perlu segera perbaikan mengingat menjelang lebaran dan sesudah lebaran ruas jalan penghubung antara kawasanTimur dan Barat Pulau Simeulue banyak dilintasi masyarakat, sehingga dengan tidak banyaknya lubang-lubang, diharap tingkat kecelakaan pengguna jasa jalan dapat terkurangi. (cmr)

NAGAN RAYA (Waspada): Masyarakat Kila minta Pemkab Nagan Raya mencopot Kades dari jabatannya, karena banyak kasus berlapis seperti rumah bantuan, penggelapan dana dan lain sebagainya. Kades diduga mencuri kabel jembatan titi Krung Kila yang panjangnya 30 meter di Kec. Seunagan Timur yang masih diproses di Polsek. Masyarakat Kila, Usman, mohon kebijakan yang merakyat kepada oknun- oknum pemerintah Gampong. Permasalahan – permasalahan di antara lain penyelewengan Dana Gapoktan tahun 2008, pembiayaan upah masyarakat dalam pembersihan lahan baru yang terlibat beberapa orang, pencurian jembatan Ayun, penjualan hand-tracktor bantuan 2003 dan penyelewengan dana mesjid Kila. “Kami atas nama masyarakat gampong Kila minta Kades dicopot karena banyak merugikan masyarakat. Maka dengan adanya kasus-kasus seperti ini kami seluruh masyarakat gampong sudah bersepakat untuk mencopot kades Hasbi Budi dari jabatanya sebagai kades Gampong Kila. Kami juga melaporkan hal ini kepada Camat Seunagan Timur, untuk menggantikan Kades,’’ kata Usman. Sementara Camat Seunagan Timur M. Nasir yang dikonfirmasi, Kamis (2/9), membenarkan adanya laporan masyarakat, tapi itu diduga disebabkan adanya oknum-oknum yang tidak senang dengan Kades.(mji)

PMI Nagan Buka Posko Siaga Lebaran MEULABOH (Waspada): Palang Merah Indonesia Kabupaten Nagan Raya, membuka Posko Siaga Lebaran yang diperuntukkan bagi pengguna jalan yang melintasi Jalan Nasional Meulaboh Tapaktuan, di Kawasan Suak Puntong. Kepala Markas PMI Nagan Raya, Teuku Ardiansyah Minggu (5/9) menyebut keberadaan posko di jalur mudik lebaran itu diharap dapat membantu pengguna jalan untuk beristirahat. PMI kata Ardiansyah juga menyediakan tempat rehat sejenak di kantor PMI di kawasan Beutong, “bila jalur mudiknya lewat takengon beutong nagan silakan istirahat di Markas PMI,” kata Ardiansyah. PMI melengkapi posko Suak Puntong dengan menyediakan tenaga perawat dan ambulance jalan nasonal kawasan suak puntong. “Kami menyarankan agar supir untuk beristirahat sejenak, tidak musti di posko dimana saja dan kemudian melanjutkan perjalanan, banyak kasus lakalantas karena supir mengantuk dan kelelahan,” ungkap Ardiansyah (b32)

Polisi Sita 4 Sak Shabu LHOKSUKON, Aceh Utara (Waspada): Tim anti narkoba Polres Aceh Utara kembali berhasil menangkap tiga bandar narkotika jenis Shabu-shabu (SS) di Desa Matang Panyang, Kec Baktiya Barat, Aceh Utara, Jumat (3/9) sekira pukul 23:00 Wib. Bersama tersangka, polisi menyita 4 sak SS senilai Rp20 juta. Kapolres Aceh Utara AKBP Drs Herman Sikumbang melalui Kasat Reskrim AKP Erlin Tangjaya kepada Waspada, Minggu (5/ 9) menjelaskan, ketiga tersangka masing-masing Sbn bin Hsn, 28, Zks bin Myn, 28, keduanya asal Desa Samlako, Kec. Baktiya Barat—Sampoiniet dan Ags bin Abd, 25, asal Tanjong Cuengai, Kec. Tanah Jambo Aye, Aceh Utara.(cmus)


Aceh

C2

WASPADA Senin 6 September 2010

120 Napi Dapat Remisi Idul Fitri

Berduaan Di Reservoir, Warga Tangkap Sepasang Kekasih LHOKSEUMAWE (Waspada): Fakhrudini, Ketua Pemuda Gampong Pusong Lama yang juga salah seorang anggota Polisi Wilayatul Hisbah Kota Lhokseumawe, mengatakan, Jumat (3/9) pukul 01.00 dini hari, para warga Gampong Pusong Lama berhasil menangkap sepasang kekasih, yang sedang berduaan di tanggul reservoir. Gerak-gerik dua insana berlainan jenis itu telah diintai warga dari pukul 09:00 hingga pukul 01:00. “Karena mencurigakan dan dikhawatirkan akan terjadi hal yang tidak diinginkan, maka warga berupaya untuk menangkap. Pada malam itu, ke duanya digiring ke kantor geusyik. Setelah satu satu jam di sana, ke dua insan yang dimabuk cinta itu, dikirimkan ke Kantor Satpol-PP danWH Lhokseumawe, untuk diproses sesuai hukum berlaku,” kata Fakhrudini, kemarin. Ke dua insan berlainan jenis itu yakni Razali, 33, warga Tanah Luas, dan Trisna, 42, warga Lhoksukon. Hingga berita ini diturunkan, kedua kekasih itu sedang diinterogasi petugas WH. Fakhrudini kepada masyarakat mengimbau agar tidak berpergian ke reservoir di atas pukul 21:00, karena jika tidak diindahkan, maka warga terpaksa melakukan tindakan yang kurang menyenangkan. Menurut dia, kejadian ini telah terjadi beberapa kali di reservoir, ada yang diselesaikan di kantor geusyik dan ada yang dikirim ke kantor WH. (cmun)

Pramuka Aceh Utara Raih 4 Juara MTQ

KOTA LHOKSEUMAWE (Waspada): Edi Teguh Widodo, Kepala Lapas Kelas IIA Lhokseumawe, Kamis (2/9) di ruang kerjanya mengatakan, jumlah napi yang mendapat remisi idul fitri 1431 H mencapai 120 orang, satu orang bebas, setelah mendapat remisi 1 bulan. Napi yang bebas pada hari raya Idul Fitri atas nama Hamdani bin Basyah,50,diaditahankarenakasuspenganiayaan,karenaitudiatersangkut pasal 351. Yang bersangkutan berasal dari Gampong menasah Dayah, Kecamatan Muara Satu, Pemerintah Kota Lhok-seumawe. Hamdani mendapatkan jatah hukuman kurungan selama 1,6 tahun. Harusnya, dia dibebaskan pada 2 Oktober nanti, namun karena mendapat remisi satu bulan, dia dibebaskan pada hari raya Idul Fitri. “Hamdani sudah pasti bebas pada hari raya ini. Remisi ini khsus diberikan kepada mereka yang beragama Islam, selain itu tidak,” kata Edi Teguh Widodo. Disebutkan, jumlah tanahan dan Napi di Lapas Kelas IIA Lhokseumawe hingga saat ini mencapai 308 orang, 20 orang diantaranya perempuan. Namun, klondisi Lapas sekarang ini dinilai terlalu sempit dan sudah over kapasitas. Pada hari raya Idul Fitri, pihak Lapas juga memberikan kebebabasan kepada pihak keluarga tahanan untuk berkunjung ke Lapas tersebut, mulai hari meugang hingga hari raya ke dua. Para pengunjung diingatkan untuk tidak membawa senjata tajam, senjata api, narkoba serta barang-barang terlarang lainnya.(cmun)

Waspada/Muhammad Riza

LHOKSUKON, Aceh Utara (Waspada): Kwartir cabang Pramuka Aceh Utara, meraih empat kategori juara dalam lomba Musabaqah Tilawatil Quran (MTQ) Tunas Ramadhan ke X, yang digelar di Takengon, 28 Agustus -1 September 2010. Prestasi itu masing-masing dipersembahkan oleh Zulfa Maulida, meraih juara satu ketegori MTQ putri tingkat penegak. Lalu, juara satu putra diraih Naliman dan juara tiga untuk kategori khatil quran tingkat penggalang yang dipersembahkan Muhammad Salim. Terakhir, juara harapan satu untuk kategori musabaqah fahmil quran beregu putri. “Kita mengutus 24 peserta dalam even tahunan itu. Secaraumum,penampilantimAcehUtarasangatbaik.Tahun lalu, kita hanya mampu memperoleh tiga juara, ini sudah ada peningkatan,” kata Ketua Kwarcab Pramuka Aceh Utara, Ismed Nur AJ Hasan, kepada Waspada, Kamis (2/9). Ismed menambahkan, sejauh ini pihaknya cukup puas dan bangga dengan prestasi yang diraih dalam MTQ yang turut diikuti utusan dari provinsi Sumatera itu. “Meski demikian, ke depan kita tetap akan terus membenahi seluruh kinerja tim supaya bisa mengukir prestasi yang lebih baik lagi,”tandasnya. (cmus)

Dua Warga Aceh Utara Meninggal Lakalantas BIREUEN (Waspada): Dua warga Aceh Utara, Hamzah ,21, asal Desa Blang Naleung Mameh dan Marzuki, 40, penduduk Desa Keude Mane Kecamatan Muara Batu meninggal dunia akibat kecelakaan lalulintas (lakalantas) abu (1/9) malam di lintasan Medan-Banda Aceh tepatnya di Simpang Pulo Awe Kec. Kutablang, Bireuen. Marzuki mengederai becak motor melaju dari arah Banda Aceh, dan Hamzah mengenderaiYamahaV-ixion BL 6819 NB datang dari arah yang berlawanan dengan berboncengan dengan Andrian,21, juga penduduk desa yang sama. “Saat itu Hamzah berusaha mendahului mini bus, namun sampai di TKP bertabrakan dengan becak yang dikenderai Marzuki sehingga Hamzah meninggal di tempat kejadian dan Marzuki meninggal di rumah sakit, sedangkan Andria mengalami luka serius,” jelas Kapolres Bireuen AKBP H Raden Dadik Junaedi SH melalui Kasatlantas, AKP Suhardiman didampingi Kanit Laka, Aiptu Mahdi Ahmad, Kamis (2/9). Sekaitan dengan hal tersebut, Suhardiman mengatakan, jajaranya telah berupaya maksimal untuk mengurangi jumlah kecelakaan lalu lintas dengan melakukan sosialisasi ketertiban berlalu lintas di seluruh wilayah Bireuen serta meningkatkan patroli. Sementara itu, bersama Kabag Ops, Kompol Yoga Prasetyo, SIK, Kasat Lantas AKP Suhardiman mengatakan, untuk pengamanan lalulintas arus mudik dan arus balik Idul Fitri ini Polres Bireuen telah menyiapkan dua pos, yakni di Batee Iliek Kecamatan Samalanga dan di Keude Kutablang Kec. Kutablang. Operasi Ketupat tahun ini, sebut Yoga Prasetyo, akan mulai dilaksanakan pada 3 September hingga 18 September 2010 seraya menjelaskan untuk persiapan operasi dimaksud jajarannya melakukan gelar pasukan di Mapolres setempat Kamis (2/9) petang. (cb03)

Bupati Buka Puasa Bersama Abang Becak

SEULAWAH: Penebangan kayu dan pembakaran hutan lindung di kawasan gunung Seulawah makin meningkat, foto direkam belum lama ini.

Tiga Rumah Musnah Terbakar SYAMTALIRA ARON, Aceh Utara (Waspada): Tiga rumah milik ibu dan dua anaknya yang dibangun berdekatan di perbatasan Desa Keutapang, Kec. Syamtalira Aron dan Desa Aceh Utara, Sabtu (4/9) sekira pukul 11:30 Wib, ludes terbakar. Tidak ada korban jiwa, namun kerugian ditaksir mencapai ratusan juta rupiah. Sementara penyebab kebakaran masih dalam proses penyelidikan pihak berwajib. Dugaan sementara, api berasal dari hubungan pendek arus listrik. Ketiga rumah tersebut masing-masing, milik seorang janda, Fatimah Mahmud, 60, dan milik anaknya Hanafiah, 35 serta Muhammad Jafar Usman, 46. Jenis ketiga rumah ini bervariasi, satu unit rumah permanen, satu semi permanen dan satu lagi berkontruksi kayu. Informasi dihimpun Waspada, tak ada saksi yang tahu pasti darimana sumber api berasal. Para korban dan warga baru menyadari kebakaran itu, saat api sudah membumbung tinggi dan sudah menguasai hampir seluruh kontruksi bangunan. Api menjalar sangat cepat, sehingga sebagian besar harta benda tidak sempat diselamatkan. “Saat kejadian, saya sedang mencuci pakaian di kamar mandi. Tiba – tiba terdengar teriakan kebakaran dari anakanak yang kebetulan sedang bermain di halaman rumah. Saya kaget dan langsung berlari keluar,”kata M Jafar, salah seorangkorban,kepadaWaspada,kemarin. Jafar menambahkan, karena galau dan kebingungan, ia tidak sempat menyelamatkan harta bendanya. “Baru sesaat keluar, saya baru teringat si bungsu

masih tidur dalam ayunan, dalam rumah. Saya pun bergegas masuk lagi untuk menyelamatkan dia. Ketika itu saya juga sempat mengambil beberapa ijazah anakanak. Sedangkan harta lain, semuanya musnah,”katanya. Di tempat sama, Fatimah, ibu M Jafar, mengatakan, api pertama terlihat dari ruang depan rumahnya. Dalam sekejap api langsung menjalar hingga menghanguskan ketiga rumah. “Saat kejadian, saya sedang berada di luar,” kata Fatimah dengan nada sedih. Pantauan Waspada, tiga unit mobil pemadam kebakaran, masing – masing satu unit dari Pemkot Lhokseumawe dan dua unit dari Pemkab Aceh Utara, baru tiba di lokasi setelah api menghanguskan ketiga rumah tersebut. Meski agak

terlambat, petugas tetap memadamkan seluruh titik api supaya tidak terus menjalar ke rumah warga lainnya. Kapolres Aceh Utara AKBP Drs Herman Sikumbang, melalui Kapolsek Syamtalira Aron, Iptu Yusuf Hariadi, membenarkan adanya musibah kebakaran itu. “ Kasus ini masih kita selediki. Dugaan sementara, kebakaran terjadi karena konslet listrik,”kata Kapolsek, singkat. Sementara Pjs Kepala Desa Keutapang, Zainal Abidin, meminta pemerintah secepat mungkin menyalurkan bantuan masa panik, termasuk tenda untuk membangun hunian darurat. Pasalnya, keluarga korban kebakaran tersebut enggan menumpang di rumah warga lain dan bersikukuh tetap tinggal di lokasi bekas kebakaran.(cmus)

Waspada/Musyawir

PUING: Sejumlah warga memperhatikan puing sisa bangunan rumah yang terbakar di kawasan perbatasan Desa Keutapang Kec. Syamtalira Aron dan Desa Pusong Kec Samudera, Aceh Utara, Sabtu (4/9) siang.

Harapkan Tunjangan Guru Dibayar Sebelum Idul Fitri Rapel 5 Persen Dipertanyakan

BIREUEN (Waspada): Bupati Bireuen Nurdin Abdul Rahman mengadakan buka puasa bersama di meuligoe, setempat, Kamis (2/9) yang dirangkai dengan pemberian bantuan kepada masing-masing organisasi para abang beca sebesar Rp 3 juta. Kabag Humas Setdakab Bireuen, M Zubair, dalam keterangannya kepada Waspada di ruang kerajanya, Kamis (2/8) mengatakan, acara ini merupakan bentuk kepedulain kepada para abang beca yang ada di Bireuen itu. Menurut Zubair, para abang beca yang buka puasa bersama itu adalah mereka tergabung adalam organisasi, Pertisa, Gajah Puteh, dan Persatuan Becak Penumpang Kota Juang (PBPKJ). “Bupati berharap bantuan itu jangan dinilai dari jumlahnya, tetapi itu hanyalah sebagai kepedulian pemerintahuntukpemberdayaanorganisasibecak,meskipun kondisi keuangan daerah dalam serba kekurangan,” katanya. Sehari sebelumnya, Front Mahasiswa Pemuda Aceh Jeumpa atau Jeumpa Mirah Bireuen, juga menggelar buka puasa bersama di satu warkop kawasan Geulanggang Tuengoh, Kota Juang, kabupaten setempat, Rabu (1/9). Acara buka bareng ini, turut dihadiri sejumlah tokoh muda Bireuen, sekaligus untuk membahas mengenai tantangan dan peluang menuju Bireuen yang gemilang, dalam acara diskusi sebelum buka puasa. (amh)

BIREUEN (Waspada): Ketua Koalisi Barisan Guru Bersatu (Kobar-GB) Bireuen, M Jafar, mengharapkan kepada pemerintah setempat untuk membayar atau melunasi tunjangan guru sebelum memasuki Idul Fitri ”Sampai sekarang banyak tunjangan atau hak guru di Bireuen belum dibayar oleh Pemkab Bireuen karena berbagai sebab, maka para guru mengharapkan beberapa jenis hak mereka segera dibayar sebelum lebaran,” tegasnya. Menurut M Jafar, pihaknya bersama sejumlah pengurus Kobar-GB serta sejumlah guru dua hari lalu sudah menyampaikan persoalan itu kepada Sekdakab Bireuen menyampaikan masalah tersebut dua hari lalu, dan sebelumnya juga telah menjumpai anggaota DPRa, bahkan Bupati Bireuen. Dikatakan M Jafar, dalam pertemuan dengan Sekdakab Bireuen saat itua, Sekdakab berjanji akan mengusahakan uang minum tahun 2009 dan tunjangan fungsional serta sertifikasi dalam waktu dekat, begitu juga tunjangan sertifikasi dan fungsional akan diusahakananya. ”Uang

minum tahun 2009 sampai sekarang belum ada, besarnya Rp5.000/orang/hari untuk enam bulan yaitu Juli sampai Desembe 2009 totalnya Rp3,6 miliar,” sebutnya. Sedangkan tunjangan fungsional lanjutnya, adalah Rp250.000/guru ditambah uang sertifikasi satu kali gaji pokok untuk enam bulan dari Januari sampai Juni 2010 juga diusahakan. ”Semua kita maklum menjelang lebaran, banyak kebutuhan pengeluaran yang harus ditanggulangi setiap orang. Guru mengharapkan dibayar sebelum hari meugang,” kata M Jafar. A Sementara itu, Sekdakab Bireuen, Ir Nasrullah Muhammad yang ditanya wartawan terpisah kemarin membenarkan, Kobar GB telah menjumpai dirinya dan menyampaikan beberapa masalah tunjangan yang belum diterima mereka akan diusahakan dalam waktu dekat. ”Uang minum, tunjangan fungsional dan sertifikasi akan diusahakan. Sementara beberapa tunjangan lainnya sekarang ini sedang dibahas bersama,” jawabnya yang ditanya Waspada saat itu. Sementara itu, sejumlah PNS dan juga

guru di Bireuen mempertanyakan tunjangan kenaikan gaji sebesar 5 persen Januari sampai April 2010 belum dibayar sampai sekarang, padahal sudah dialokasikan dalam DAU. ”Kabupaten lain telah lama disalurkan sedangkan Bireuen kabarnya saja belum jelas-jelas,” kata seorang seorang ibu guru. Sekdakab Bireuen, Ir Nasrullah Muhammad, M.Si yang ditanya hal itu kemarin mengatakan, Pemkab Bireuen menerima surat tentang kenaikan tunjangan 5 persen pada bulan April, sementara APBK sudah dibahas satu bulan sebelumnya, sehingga belum dialokasikan waktu itu. Pembayaran akhirnya mengalami kendala karena anggaran terbatas. ”Yang belum dibayar adalah untuk Januari sampai April, sedangkan Mei sampai sekarang sudah diinkludkan dalam gaji setiap bulan,” katanya, seraya menambahkan, hak pegawai tetap diupayakan sebagaimana mestinya dan sekarang sedang dibahas lagi dengan legislatif tentang kewajiban yang belum dibayar. (amh)

48 Sekolah Terima Piala Dan Sertifikat Penghargaan Ketibaan (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 398 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *

FireFly

Keberangkatan (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta

16:30

11:15 JT 397 Medan/Jakarta 16:00 JT 307 Jakarta 19:50 JT 399 Medan/Jakarta

07:20 11:55 16:35

12:50 SJ011 Medan/Jakarta

13:20

12:20 AK 306 Kuala Lumpur *

FY 3401 Penang 13:50 FY 3400 Penang * Setiap Senin, Rabu, Jumat dan Sabtu.

12:45 14:20

ACEH UTARA (Waspada): Syahbuddin Usman, Sekretaris Daerah Kabupaten Aceh Utara, didampingi Drs. M. Jamil, M.Kes, Kepala Dinas Pendidikan, Pemuda dan Olah Raga, Kamis (2/9) pagi di halaman Kantor Bupati Aceh Utara, usai peringatan Hardikda ke-51 menyerahkan 48 piala dan penghargaan kepada 48 sekolah. Sekolahh penerima piala dan penghargaan itu mulai dari tingkat Taman Kanak-kanak hingga Sekolah Menengah Atas (SMA). Selain itu, piagama penghargaan juga diberikan kepada para guru berprestasi, kepala UPTD terbaik dan pengawas terbaik. Dominan penghargaan ini didapatkan oleh sekolahsekolah di daerah pedalaman, seperti

Cot Girek, Langkahan, Seunuddon dan lainnya. Kata M. Jamil, sesuai hasil seleksi dari World Bank, Aceh Utara terpilih sebagai pelaksanana pendidikan terbaik se-Indonesia.. Karena itu, belum lamanya ini, pihaknya telah mengirimkan 8.000-an tenaga guru PNS dan non PNS untuk mengikuti seminar dan pelatihan sebagai langkah untuk meningkatkan mutu Sumber Daya Manusia (SDM) yang handal di bidangnya masing-masing. Selain itu, pihak dinas juga telah melakukan kegiatan kualifikasi guru DII dan DIII menjadi S1. Kegiatan ini kerjasama dengan Unsyah dan Al-Muslim. “Ini merupakan kegitan untuk meningkatkan mutu pendidikan di Aceh Utara. Kami

yakin ini akan berjalan efektif dan lancer,” kata Sekdakab diamini M. Jamil. M.Kes. Pada kesempatan itu, M. Jamil juga menjelaskan, jumlah sekolah di Aceh Utara mencapai 705 sekolah, dari jumlah tersebut, sebanyak 25 persen, bangunan sekolahnya telah rusak. Pada tahun anggaran 2004-2005, sebelum dirinya menjadi Kadisdikjar, terdapat 52 unit proyek perbaikan sekolah, namun hingga kini belum rampung dikerjakan kontraktor. Pihaknya mengaku tidak tahu apa penyebabnya hingga ditelantarkan. “Insya Allah, kebutuhan untuk perbaikan 52 unit sekolah itu kita ajukan dalam APBK 2011, senilai Rp2,2 miliar. Ke 52 unit sekolah itu yakni dari SD hingga SMA,” kata M. Jamil. M.Kes. (cmun)

Ratusan Hektar Tanah BPKS Belum Miliki Sertifikat SABANG (Waspada): Hingga saat ini ratusan hektar tanah milik Negara yang sudah dibebaskan oleh Badan Pengusahaan Kawasan Pelabuhan Bebas Sabang (BPKS) sejak 2005 lalu, belum juga memiliki sertifikat Menurut sumber di kantor Badan Pertanahan Negara (BPN) Kota Sabang, hingga saat ini BPKS baru memiliki 20 persil tanah yang sudah di sertifikasi seluas 12,5 hektar dari 420 hektar tanah yang sudah di bebaskan seluruhnya. Gubernur Aceh, selaku Ketua Dewan Kawasan Sabang pada saat acara pelantikan Kepala BPKS yang baru Ruslan A Gani tanggal 21 Juli 2010 lalu, pernah mengingatkan, program sertifikasi tanah yang telah di bebaskan oleh BPKS sejak tahun 2005 sebagai asset Negara harus segera di laksanakan. Kepala BPKS Ruslan A Gani di celah-celah buka puasa bersama Selasa (31/8) di gedung BPKS menyebutkan, hingga saat ini pihaknya masih dalam proses ferifikasi asset-aset BPKS termasuk ratusan hektar tanah yang saat ini sudah dibebaskan dari tangan masyarakat dan terkait verifikasi tanah tersebut ia mengaku akan melakukan kerjasama dengan pihak BPN. “Kita akan melaksanakan program sertifikasi tersebut dalam tahun ini, dan saat ini kita sudah melakukan pendataan kembali dan kita juga akan mengajak pihak BPN untuk melaksanakan program sertifikasi tanah tersebut,” tegas Ruslan. Ia mengatakan selain program pendataan kembali aset negara yang saat ini sudah dikelola oleh BPKS pihaknya juga sedang melaksanakan beberapa program penting lanya yang harus di selesaikan dalam tahun 2010 ini termasuk masalah pembebasan lahan untuk pembangunan jalan, pembenahan struktur karyawan BPKS dan beberapa program lainnya. “Memang kita sedang melakukanya sedikit demi sedikit, maklum saya masih seumur jagung di BPKS dan tanpa dukungan semua pihak program yang akan saya jalankan nantinya juga tidak akan berarti apa-apa,” tambahnya. (b29)

Pengguna Wesel Pos Instan Meningkat KOTA LHOKSEUMAW (Waspada): Khairil Anwar, Kepala Pos dan Giro Lhokseumawe, Kamis (2/9) siang di ruang kerjanya mengatakan, selama Ramadhan, pengguna jasa wesel pos instan meningkat 300 persen, dengan jumlah transaksi per hari mencapai Rp10 miliar. Transaksi pengiriman dengan menggunakan jasa wesel pos instan meningkat tajam pada bulan ramadhan dan menjelang hari raya Idul Fitri. Pada hari-hari biasanya, jumlah pengirim mencapai 200an lembar, namun pada bulan ramadhan mencapai 600-an hingga seribuan lembar wesel pos instan. Kemudahan yang ditawarkan wesel pos instan, pengiriman uang akan sampai ke alamat yang dituju dalam hitungan detik, selain itu, pengirim dan penerima uang tidak harus antri di loket, tidak harus buka buku tabungan, dan pengirim dan penerima cukup menyerahkan selembar foto kopi kartu tanda penduduk (KTP) kepada petugas. “Sebagai tanda, kepada pengirim kita memberikan PIN. Kode PIN ini akan diperlihatkan kepada petugas pos saat penerima mengambil uang kiriman tersebut,” terang Khairil Anwar. Wesel pos instan sudah mulai aktif di masyarakat sejak tiga tahun lalu. Tingginya minat masyarakat mengirimkan uang lewat jasa wesel pos instan, sebagai tanda rasa percaya masyarakat Indonesia khususnya Aceh mulai meningkat kepada PT. Pos dan Giro. Kepercayaan ini bukan hanya dalam bentuk wesel, tapi juga dalam bentuk jasa kurir lainnya. PT. Pos dan Giro telah mulai hadir lebih dari 100 tahun lalu di Indonesia. Menjawab Waspada, Khairil mengatakan, selain wesel pos instan Indonesia, Pos dan Giro juga membuka Wesel Union (SU) untuk luar negeri. Rata-rata kiriman uang yang diterima PT. Pos berasal dari negara Malaysia, Prancis, Kanada, Swiss, Swedia, Jepang, Meksiko dan beberapa negara lainnya. Jumlah pengguna WU setiap hari mencapai 300-an lembar. “PenggunaWU juga dapat mengirimkan uangnya dalam hitungan detik. Sementara pengiriman dengan model lainnya selain pos, membutuhkan waktu paling cepat satu hari, belum antri berjamjam. Inilah kemudahan-kemudahan yang ditawarkan oleh PT. Pos dan Giro Indonesia,” katanya. (cmun)

Stok Beras Pidie Mencukupi SIGLI (Waspada): Badan Usaha Logistik (Bulog) Devisi Regional Sigli, telah menyiapkan 7.000 ton beras untuk memenuhi kebutuhan masyarakat Kabupaten Pidie dan Pidie Jaya selama bulan puasa dan lebaran Idul Fitri. “Kita puya stok beras sebanyak 7.000 ton. Jumlah ini sudah sangat mencukupi selama bulan puasa dan sampai akhir lebaran Idul Fitri. Artinya, Kabupaten Pidie dan Pidie Jaya stok berasnya aman” kata Kepala Bulog, Divisi Regional, Kota Sigli H.Saifullah, kepada Waspada, Jumat (3/9). Saiful, mengungkapkan dengan jumlah 7.000 ton stok beras yang dimiliki Kabupaten Pidie, Bulog Sigli dapat membantu memasok beras untuk Kabupaten Aceh Tengah sebanyak 1.500 ton dan untuk Aceh Barat 1.000 ton. Bantuan tersebut diberikan dalam upaya mengantisipasi menipisnya stok beras di dua daerah itu. “ Jadi kalau Pidie dan Pidie Jaya soal beras tidak ada persoalan, karena kita mempunyai stok yang mencukupi dan malah kita bisa bantu daerah lain di Aceh” papar Saiful, seraya menambahkan bahwa dalam upaya mengatisipasi kekurangan beras, Bulog Sigli jauh-jauh hari telah melakukan penampungan pasokan gabah dari petani lokal, sehingga stok beras di gudang Bulog di Meureudu dan Tijue, Sigli dapat dipastikan mencukupi. Selain itu, Bulog Sigli juga telah menyimpan beras untuk mengantisipasi bila sewaktu-waktu daerah tersebut terjadi bencana alam, seperti banjir, gempa atau tanah longsor yang acap kali terjadi di Aceh. Saiful, menyebutkan beras yang tersimpan di gudang Bulog Sigli tidak dijual di pasaran, melainkan beras-beras tersebut disalurkan khusus bagi masyarakat miskin di Kabupaten Pidie dan Pidie Jaya. “ Beras –beras yang tersimpan dalam gudang Bulag Sigli, ini kita salurkan bagi masyarakat miskin di Kabupaten Pidie yang berjumlah 56.953 RTS dan Pidie Jaya kita salurkan 19.694 RTS. Jadi tidak perlu khawatir tentang stok beras kita mencukupi” tandas H. Saifullah. Pantauan Waspada, di Pasar Kota Sigli,menjelang lebaran yang tinggal tujuh hari lagi terhitung sejak Jumat (3/9) harga beras masih normal dan tidak menunjukkan kenaikan maupun sebaliknya. ”Harga beras stabil, seperti beras yang bermutu bagus semacam beras Kemala masih ukuran 15 Kg masih dengan harga Rp 95 ribu” kata Usman salah seorang pedagang. Seraya berujar, stok beras jelang lebaran di Kota Sigli tidak mengalami masalah ditingkjat pedagang, dia memperkirakan usai lebaran harga beras akan kembali anjlok. (b20)


Aceh

WASPADA Senin 6 September 2010

C3 Anggota Dewan Dilarang Minta Dan Terima Proyek

‘Mustahil Islam Maju Jika Umat Tidak Bersatu’ ACEH TIMUR (Waspada): Agama Islam butuh kekompakan, karena dengan persatuan dan kesatuan musuh segan untuk menghancurkan Islam. Bahkan, mustahil Islam akan maju jika umat tidak bersatu melawan kebathilan dan kemungkaran. Demikian dikatakan Tgk. M. Yunus BTM, dalam ceramah Safari Ramadhan 1431 Hijriyah di Masjid Al Kubra Julok, Selasa (31/8) malam. Tgk. Yunus mengatakan, tata cara beragama Islam sangat mudah, apalagi umat mengetahui konsep sebagaimana dicontohkan Rasulullah SAW pada zamannya. Di hadapan unsur Muspida plus dan ratusan jamaah Tgk. M. Yunus mengatakan, Islam adalah agama yang penuh keberkahan dan kerahmatan.“Melihat sepintas dari maknanya, Islam berasal dari kalimat salama artinya selamat. Jadi siapa pun yang beragama Islam dengan mamatuhi segala aturan di dalamnya, maka akan selamat,” sebutnya. Dalam ramadhan ini, lebih lanjut sebut Tgk. Yunus, segala sesuatu kebaikan dalam bentuk ibadah yang dikerjakan umat dengan hati ikhlas, maka Allah akan membalasnya berlipat ganda. “Berbuat baik kepada sesama, niscaya Allah akan membalasnya,” katanya. Safari Ramadhan 1431 Hijriyah kali ini ikut dihadiri Bupati Aceh Timur, Muslim Hasballah, Ketua DPRK Aceh Timur, Tgk. Alauddin, Kapolres Aceh Timur, AKBP Drs Ridwan Usman dan Kajari Idi, serta sejumlah kepala dinas dan badan dalam lingkungan Pemkab Aceh Timur.(cmad)

Debu Penuhi Rumah Warga, Dewan Kecam PT JAM BLANGPIDIE (Waspada): Puluhan warga yang berdomisili di sepanjang jalan nasional kawasan Desa Padang Baru dan Desa Pulau Kayu Kecamatan Susoh Kabupaten Aceh Barat Daya (Abdya) mengeluh, setiap hari menghirup udara kotor bersumber dari jalan nasional di depan rumah mereka. Sementara Dewan Abdya mengecam keras sikap diamnya PT JAM yang acuh tak acuh dengan keluhan warga, Selasa (31/8) Pantauan di lokasi, kepulan debu tebal yang beterbangan tersebut diakibatkan oleh puluhan truk besar yang mengangkut batu gajah untuk pembangunan pelabuhan dari PT Juya Aceh Mining (PT JAM) di Pulau Kayu Susoh. Warga yang ditemui di lokasi mengeluhkan sikap semena-mena pihak PT JAM yang terkesan membiarkan debu beterbangan tanpa adanya penyiraman. Ny Intan, 52, warga Desa Padang Baru Susoh mengatakan akibat dari kepulan debu tebal setiap harinya, rumahnya dan juga rumah warga lainnya jadi super kotor.“Selain itu, akibat menghirupudarakotorbegini,anaksayayangkeduaharusdirawat di rumah sakit karena gangguan pernafasan,” ujarnya. Dilain pihak, Wakil Ketua DPRK Abdya yang dihubungi terpisah mengatakan sebaiknya PT JAM menghargai sikap diamnya warga yang tidak melakukan protes dengan berunjukrasa. “Tolong hargai kesabaran warga,” ujarnya. “Menjelang lebaran ini kita minta perusahaan bias menyiram jalan sampai bersih dari tanah yang menempel di jalan aspal, sebelum warga memprotes dengan cara-cara yang tidak benar,” kata Elizar Lizam.(sdp)

Pedagang Jam Diserbu Pembeli PANTONLABU, Aceh Utara (Waspada): Memasuki H-10 Idul Fitri 1431 Hijriyah, pedagang jam di Pantonlabu, Ibukota KecamatanTanah Jambo Aye, Aceh Utara, diserbu pembeli. Omzet mareka rata-rata naik hingga dua kali lipat dari hari biasa. “Hari biasa, omzet kami rata-rata hanya Rp1,5 juta. Kini mencapai Rp3 juta - Rp4 juta per hari. Jenis jam yang terjual bervariasi. Mulai dari merek murah hingga jam mewah. Namun yang paling banyak laku, jam anak-anak,” kata Muslim, 30, pedagang jam di Jalan Tgk Chiek Di Tiro, Pantonlabu, Senin (30/8). Muslim merinci, selain jam tangan untuk segala usia, tokonya juga menjual jam dinding dengan harga bervariasi dan relatif cukup terjangkau. “Jam tangan paling murah, kami jual Rp10 ribu per unit dan termahal— yang masih ada stok— berkisar antara Rp800.000-Rp900.000 per unit. Sedangkan untuk jam dinding paling murah Rp22.000 per unit dan termahal Rp700.000.”(cmus)

Waspada/Iskandar

Wakil Gubernur Aceh Muhammad Nazar meninjau Pasar Murah yang digelar di depan Mesjid Raya Banda Aceh, selama tiga hari, sejak Rabu (1/9) sampai Jumat. Pasar murah tersebut digelar Badan Usaha Milik Negara (BUMN) bekerjasama dengan forum peduli Aceh bertujuan meringankan beban warga yang hendak menyambut Hari Raya Idul Fitri.

Polisi Gagalkan Rencana Perampokan Seorang Ditangkap, 1 Senpi Disita BANDA ACEH (Waspada): Aparat kepolisian Polsek Baiturrahman, dibantu Polresta Banda Aceh, Sabtu (4/9) malam sekira pukul 20.30 Wib, menggagalkan rencana perampokan yang dilakukan komplotan bersenjata pistol. Komplotan bersenjata pistol itu merencanakan beraksi Sabtu tengah malam dengan sasaran SPBU, toko grosir dan rumah warga di Gampong Beuradeun, Kecamatan Lhoknga, Aceh Besar. Namun, niat komplotan yang juga berencana akan melakukan perampokan di Kota

Banda Aceh itu keburu tercium polisi yang langsung bertindak menangkap salah satu anggota komplotan tersebut berinisial Ca, 23, asal Nagan Raya yang sehari-hari berprofesi sebagai buruh bangunan. Satu tersangka lain, Muh, 23, asal Jambo Ayee, Aceh Utara berhasil meloloskan diri saat dilakukan penggerebekan terhadap sebuah ruko yang sedang dibangun di Jl. Sulaiman, Daud, Gampong Peuniti, Kota Banda Aceh. Dari tangan Ca, polisi mengamankan satu pucuk pistol merk Taurus, enam butir peluru dan tiga buah handphone. “Rencana perampokan sudah mereka susun sejak seminggu yang lalu ,dan akan dilaksanakan malam ini (Sabtu malamred). Tetapi karena cepat tercium oleh anggota, rencana itu

gagal,” kata Kapolresta Banda Aceh Kombes Pol Drs Armensyah Thay saat ditemui Waspada di Mapolsek Baiturrahman, Sabtu malam. “Selain di Lhoknga, mereka juga merencanakan akan melakukan aksi yang sama di Kota Banda Aceh,” tambah Kapolresta. Disebutkan, rencana perampokan berawal dari laporan masyarakat kepada aparat kepolisian, yang melihat ada pemuda yang membawa senjata pistol sedang berada di sebuah ruko yang sedang dibangun di Gampong Peuniti, tak jauh dari Meuligo (Pendapa) Gubernur Aceh. Mendapat laporan tersebut, aparat kepolisian dari Polsek Baiturrahman yang dipimpin Kapolsek Iptu Abdul Muthalib dengan dibantu personil Polres-

Atasi Beralih Fungsi, Bireuen Cetak 200 Ha Sawah Baru BIREUEN (Waspada): Untuk mengatasi banyaknya sawah yang telah beralih fungsi dan juga untuk mewujud mendukung ketahanan pangan nasional serta meningkatkan produksi padi, Dinas Pertanian, Peternakan, Perkebunan dan Kehutanan (Distannakbunhuta) Bireuen mencetak 200 hektar sawah baru bersumber dari dana APBN 2010 di sejumlah kecamatan wilayah kabupaten itu. Kadistannakbunhut Ir H Azmi Abdullah didampinggi Kabid Pengembangan Lahan, Muktar dan Kasie Perluasan Areal, Ir Haryati serta Ketua kelompok tani, Azhari saat meninjau lokasi cetak 23 hektar sawah baru di Desa Lheu Barat, Kecamatan Jeunieb, Senin (30/8) mengatakan, sebagian besar sawah cetak baru itu sebagian di antaranya sudah langsung ditanami padi oleh kelompok tani penerima mamfaat. “Pelaksanaan cetak sawah baru baik di Desa Lheu Barat dan sejumlah lokasi lainnya di Bireuen di mulai Juli 2010 lalu. Bahkan sebagian lahan sudah siap, seperti di Lheu Barat ini, langsung ditanami padi, seperi ini,” kata Kadis sambil menunjukkan ke arah sawah yang baru dicetak baru. (amh)

4000 Ton Jatah Beras Bulog Masih Di DKI ACEH UTARA (Waspada): Iskandar Saman, Kepala Bulog Sub Divre Lhokseumawe, Selasa (31/8) di ruang kerjanya mengatakan, stock beras mulai menipis. Jumlah beras yang masih tersimpan di gudang lebih kurang 1.200 ton. Sementara jatah beras 4000 ton masih di DKI. Begitu pun masyarakat diminta tidak khawatir. “Setelah kita salurkan kepada masyarakat dalam dua hari ini, beras tersisa di gudang sekitar 700-an ton. Masyarakat kita minta tenang, tidak perlu khawatir, karena setelah lebaran nanti, semuanya akan normal kembali,” terang Iskandar Saman didampingi Armia, Sekretaris. Harusnya, jatah beras 4000 ton tersebut telah harus diterima Bulog Sub Divre Lhokseumawe pada bulan ramadhan ini. Namun atas berbagai pertimbangan, pengiriman beras ke Aceh ditunda hingga selesai lebaran. “Pertama di bulan ramadhan, pertimbangannya, bongkar muat akan kesulitan tenaga kerja di Aceh. Kemudian tidak mungkin kapal bersandar terlalu lama di pelabuhan, ke tiga, biasanya satu kapal jumlah muatan beras 7000-10.000 ton, sementara jatah kita cuma 4000 ton. Atas dasar inilah, pengiriman sementara waktu diundurkan hingga setelah idul fitri,” terang Iskandar. (cmun)

Sambut Lebaran, Baperoh Santuni 60 Yatim LANGSA(Waspada) : Dalam rangka menyambut lebaran Idul Fitri 1431 Hijriyah yang tinggal dua pekan lagi, Badan Pembinaan Kerohanian (Baperoh) PT. Kantor Pos Cabang Langsa, Minggu (29/8), melakukan kegiatan amal berupa menyantuni 60 anak-anak yatim yang ada di Kota Langsa. Selain menyantuni puluhan anak-anak yatim, kegiatan yang dipusatkan di kantor Pos setempat tersebut juga diselingi dengan ceramah agama yang disampaikan oleh ustadz Nur Sanjaya dan silaturahmi antara pegawai kantor Pos Langsa bersama keluarga dan masyarakat setempat. Ketua Baperoh PT. Pos Langsa, Sukma. MT disela-sela kegiatan mengatakan, bahwa kegiatan tersebut merupakan agenda rutin tahunan yang dilakukan oleh pihaknya. Hal itu bertujuan untuk membantu meringankan beban yang dialami oleh para yatim saat menjelang lebaran.(ts)

Waspada/Iskandar

Kapolresta Banda Aceh Kombes Pol Drs Armensyah Thay memperlihatkan pistol merk Taurus yang disita dari tangan Ca, 23, anggota perampokan yang hendak melakukan aksinya di kawasan Lhoknga, Aceh Besar, Sabtu (4/9) malam.

ta Banda Aceh langung bergerak ke lokasi yang disebutkan. “Saat digerebek, Ca berada di dalam ruko yang sedang dibangun itu sedang tidur-tiduran. Dari tersangka aparat menyita satu pucuk senjata api jenis pistol merk Taurus beserta enam butir munisi. Sedangkan temannya berinisial Muh berhasil lolos,” u n g k a p Ko m b e s Po l Dr s Armensyah Thay. Dari tersangka yang ditangkap ini juga diperoleh keterangan bahwa mereka juga merencanakan akan melakukan perampokan terhadap sebuah SPBU di kawasan Lhoknga serta sebuah toko grosir dan rumah warga dengan menggunakan senjata tersebut,” sebutnya. Kapolresta mengatakan, senjata pistol yang disita anak buahnya dari tangan tersangka adalah senjata organik standar Polri. Sedangkan siapa pemilik senjata tersebut, kini sedang dalam penyelidikan. Pihak kepolisian kini sedang melakukan pencaharian terhadap Aan, anggota KPA Meulaboh, Aceh Barat yang kini berdomisili di Kota Banda Aceh. Aan disebut-sebut oleh Ca sebagai pemilik senjata yang disita aparat kepolisian itu. “Benar atau tidak pengakuan Ca itu, masih kita dalami,” sambungnya. Sementara itu, Ca yangditemui di Mapolsek Baiturrahman Sabtu tengah malam mengaku, senjata pistol tersebut diperolehnya dari Muh, yang sekarang sedang diburu polisi. Muh sendiri memperoleh senjata tersebut dari Aan. “Senjata itu sebenarnya senjata masa konflik dulu dan baru dipercayakan oleh Muh kepada saya sekitar dua minggu yang lalu. Kami merencanakan akan melakukan perampokan di daerah Lhoknga. Target kami pertama adalah toko grosir di kawasan Keudee Bieng,” sebut Ca. (b09)

Belanja Obralan Hingga Galeri PUASA Ramadhan 1428 H sudah memasuki hari ke sepuluh terakhir, kebiasaan jalanjalan sore hal yang menarik dan unik dilakukan masyarakat di Provinsi Aceh, seperti di Kota Banda Aceh, Kota Sigli (Pidie) dan Kota Meureudu (Pidie Jaya). Apalagi dimanfaatkan untuk berbelanja panganan berbuka dan bershoping ria di pusatpusat perdagangan. Lebaran memang tinggal menghitung hari. Sehubungan itu kota-kota atau pasar tradisional di Kota Banda Aceh, Aceh Besar, Pidie dan Pidie Jaya mulai ramai dijarah penduduk pinggiran kota bahkan desadesa pedalaman. Kebiasaan tahunan ini merupakan tradisi usang yang sudah mentradisi. Kaum ibu, bapak, remaja putra/ putri, anak-anak tumpah di pusat-pusat perbelanjaan mencari bekal sandang dan pangan lebaran. Kita merasa senang karena melihat kota-kota di Provinsi Aceh terutama Kota Banda Aceh yang dulu porak-poranda dihantam tsunami dan nyaris mati dari kegiatan pasar, kini

cukup bergairah. Labi-labi (angkot) dari dan ke semua jurusan, sepanjang pagi, siang, hingga sore bahkan malam aktivitasnya semakin meningkat. Begitu juga abang becak dan sopir taksi. Para pelaku pasar yang didominasi kaum ibu serta remaja putra/putri, memberi warna bagi nafas kehidupan Kota Banda Aceh dan kota-kota lainnya di Aceh. Pertokoan, super market dan lokasi “lapak” pedagang obralan menjadi sasaran “perburuan”konsumen semusim itu. Sementara pedagang terlihat saling intip mengubah taktik untuk menjaring pembeli. Triktrik dagang itu dimulai dari yang konvensional hingga modern. Dari permainan harga hingga kualitas barang. Dari pengadaan barang hingga interior dan eksterior toko. Di Pasar Aceh, pasar tertua di Banda Aceh, beragam pakaian anak-anak, remaja, dewasa dan orangtua terpajang luas. Bagi peminat yang ingin belanja tak perlu khawatir akan kehabisan barang. Tidak hanya pedagang pakaian. Tapi peci sebagai peleng-

kap pakaian shalat tarawih dan lebaran Idul Fitri juga menjadi pilihan kaum muslim, harganya pun terjangkau Rp30.000 sampai Rp50.000 meski ada juga yang di atas itu karena kualitas bagus. Sehingga pedagang peci yang menawarkan berbagai model dan motif juga ikut kecipratan rezeki. Barang-barang dagangan (pakaian) ditawarkan dengan harga bervariasi mulai Rp30.000 hingga Rp200.000 per potong celana dan baju. “Itu harga bukanya, masih bisa ditawar kok,” kata pria setengah baya berambut lusuh ini kepada Waspada, Rabu (1/9). Berbeda lagi di Shoping Centre, Pante Pirak, misalnya. Market berornamen Spayol dan paling beken karena digandrungikaulamuda.Inimenawarkan produk pakaian bermerek. Di sini, di swalayan milik putra Aceh (Kabupaten Pidie) ini, harganya pakai bandrol. Harga pas dan tak bisa ditawartawar. “Kualitas juga dijamin, pokoknya nggak kecewalah, “kata seorang pramuniaga di situ. Pante Pirak atau yang lebih

dikenal orang dengan sebutan PP,berada di posisi strategis bersebelahan dengan kantor KONI Aceh dan jembatan Pante Pirak. Dulu Pante Pirak yang luluhlantak dihantam musibah gempa dan tsunami sempat terhenti total operasionalnya selama tahunan. Namun untuk sekarang ini sudah difungsikan kembali menyusul dibangunnya kembali gedung megah itu. Meski demikian pengusaha beken ini telah juga membuka beberapa cabang usaha yang sama di berbagai sudut Kota Banda Aceh seperti Neusu, Ulee Kareng dan tempat lainnya. Memang, hari-hari terakhir di penghujung Ramadhan, suasana sore hingga malam di Banda Aceh dan kota-kota kecil lainnya di Aceh bertambah semakin semarak.Yang membedakan tak lagi kedengaran berisik musik dari tempat-tempat hiburan – atau noraknya wanita salon dan penjaja seks. “Kalaupun ada, mereka lebih santun dan tak berani vulgar,” kata seorang security salah satu hotel berbintang. H. Rusli Ismail

MEUREUDU (Waspada): Berdasarkan Peraturan Pemerintah No.25 Tahun 2004 tentang tata tertib DPRD, anggota dewan dilarang meminta ataupun menerima sesuatu dalam bentuk apapun, termasuk proyek pembangunan. ”Jika benar anggota DPRD (di Aceh DPRK atau DPRA-red) meminta atau mendapat proyek, itu suatu pelanggaran dan tidak ada landasannya,“ ungkap sejumlah pimpinan Asosiasi kontraktor kepada Waspada, Selasa (31/8). Ungkapan itu disampaikan sejumlah pimpinan Asosiasi dan Perusahaan Kontraktor di Kabupaten Pidie Jaya dan Pidie, sehubungan maraknya anggota dewan (DPRK) setempat masih dan sangat merambisi untuk memperoleh jatah proyek dari sejumlah dinas dan badan. Akibat ambisi anggota dewan yang ingin mendapatkan jatah proyek sehingga membuat sejumlah pemilik perusahaan kontraktor terancam gigit jari pada tahun 2010 ini, karena tak kebagian pekerjaan (proyek). Pasalnya, hampir sebagian besar jatah proyek itu akan jatuh ke tangan atau milik kolega anggota dewan, kata seorang pimpinan perusahaan yang enggan disebutkan identitasnya. Sementara anggota Dewan Perwakilan Rakyat Kabupaten (DPRK)PidieJaya,HasanBasri,STyangsengajamenghubungiWaspada melalui ponsel, Selasa (31/8) mengharapkan, panitia tender proyek di Pidie Jaya komit terhadap ketentuan dan aturan yang ada. Menurut politisi Partai Amanat Nasional (PAN) itu, hal yang paling penting harus dilakukan pihak panitia tender proyek adalah harus bekerja secara proporsional. “Jangan semua proyek di Pidie Jaya jatuh dan dimenangkan pesanan pendopo dan kolega pejabat,“ tegasnya. Anggota dewan Pidie Jaya yang dikenal vokal itu menegaskan, pada dasarnya semua asosiasi dan perusahaan berhak men-dapatkan pekerjaan (proyek-red) sesuai dengan peraturan peme-rintah. Sebelumnya, Wakil ketua DPRK Pidie Jaya, Ir. H. Sulaiman Ary terkait isu jatah proyek dari sejumlah dinas kepada beberapa anggota dewan menyebutkan, apabila terbukti ada anggota DPRK menerima proyek, perbuatannya dapat dikatagorikan sebagai tindakan korupsi. “Hal ini juga sudah diatur secara tegas di dalam Keppres No.80 Tahun 2003,“ tambah Sulaiman Ary. Sebab itu, menurut Sulaiman Ary, tidak masuk akal beberapa anggota DPRK Pidie Jaya mendapat jatah proyek pembangunan tahun 2010 di sejumlah dinas terkait. Lagi pula bila hal itu terjadi, berarti proses pelelangan proyek disinyalir direkayasa oknum terkait. (b21)

Dandim 0103: Aceh Utara Dan Lhokseumawe Kondusif LHOKSEUMAWE (Waspada): Menjelang hari Raya Idul Fitri, situasi dan kondisi keamanan di wilayah Kabupaten Aceh Utara dan Kota Lhokseumawe dinyatakan masih dalam keadaan aman dan kondusif dari pengaruh eskalasi kekerasan dan kriminal. Hal itu diungkapkan Dandim 0103, Letkol Wakhyono setelah melakukan kunjungan ke berbagai daerah pelosok desa baik Kabupaten Aceh Utara maupun Kota Lhokseumawe, Rabu (1/9). Dandim menegaskan, saat ini kondisi keamanan wilayah kerjanya mencakup Lhokseumawe dan Aceh Utara sudah aman. Hanya tinggal semua pihak untuk bisa bergandeng tangan meningkatkan perekonomin yang berujung kesejahteraan pada masyarakat. Putra asli Pekalongan itu juga menjelaskan menjelaskan, selama satu pekan lebih mulai bertugas di Kodim 0103, dia terus melakukan silaturrahmi dengan pihak Muspida Aceh Utara dan Lhokseumawe, tokoh ulama dan juga tokoh masyarakat. Jadi, sambung Dandim, dipastikan upaya silaturrahmi ini akan terus dilakukan hingga sampai ke seluruh lapisan masyarakat selama dia bertugas di Lhokseumawe dan Aceh Utara. Menurut Dandim menyangkut situasi keamanan di wilayah Kodim, sudah sangat kondusif, meskipun ada beberapa aksi kriminal, namun itu semua hanya latar berlakang ekonomi saja tanpa ada unsur kepentingan lainya. Pada kesempatan ini Dandim juga meminta pada semua elemen masyarakat khususnya di Aceh Utara dan Lhokseumawe agar jangan terlalu terlena dengan terus melihat ke belakang, terutama masalah dendam dan kebencian antara satu elemen masyarakat dengan lainnya. Tapi sudah saatnya untuk melihat kedepan, guna mensejahterakan serta menciptakan rasa aman dan kenyamanan pada semua lapisan masyarakat di bawah “payung” NKRI yang sudah menjadi harga mati.(b15)

Pemko Langsa Diminta Berantas Pengemis LANGSA (Waspada): Keberadaan pengemis liar di Kota Langsa semakin hari kian marak, terutama di setiap sudut Kota dan tempattempat keramaian. Padahal Walikota Langsa telah mengeluarkan Peraturan Daerah (Qanun) tentang larangan mengemis, namun tak mampu membendung aktifitas para pengemis yang terus meningkat. Karena itu, Pemko diminta memberantas pengemis liar dengan memberi tindakan tegas sesuai aturan yang telah ditetapkan. Direktur LBH Bening Sukri Asma, Selasa (31/8), mengatakan aktivitas mengemis merupakan penyakit masyarakat yang sudah ada sejak jaman dulu. Penyakit mengemis ini akan hilang bila ada keseriusan dari semua pihak untuk memberantasnya. “Mengemis adalah perbuatan yang tidak baik dan harus segera kita berantas. Kita tidak boleh membiarkan aktifitas itu terus subur di Kota Langsa,” kata Sukri. Karena itu Sukri Asma meminta Pemko Langsa untuk menindak tegas para pengemis yang masih bergentayangan di wilayah hukum Pemko Langsa. Apalagi, Walikota Langsa Zulkifli Zainon telah mengeluarkan Qanun menyangkut larangan untuk mengemis. “Payung hukum sudah ada untuk bertindak, jadi sekarang dibutuhkan action dan keseriusan dari para pejabat terkait di Pemko Langsa.” Menurut Sukri, selama ini maraknya pengemis jalanan yang terus bergentayangan lebih disebabkan oleh rendahnya kinerja aparatur Pemko Langsa. Para pejabat terkait di Kota Langsa tidak menunjukkan kinerja yang baik, bahkan produktifitas kerja hampir setiap SKPD terlihat memprihatinkan. Sehingga, berbagai peraturan daerah dan kebijakan Pemko Langsa seperti pemberantasan pengemis, tidak pernah tuntas dilaksanakan, demikian Sukri Asma. Sementara itu berdasarkan pantauan, disetiap sudut Kota Langsa terutama di Stasiun Pengisian Bahan Bakar Umum (SPBU) dan tempat-tempat keramaian, para pengemis mulai dari orang tuahinggaanak-anakterliahatmangkaldenganamansambilmemintaminta. Tak jarang, aktivitas para pengemis ini telah mem-buat warga Langsa menjadi resah. Karena, satu sisi bila ketahuan memberikan uang kepada pengemis di jalan, akan diganjar dengan hukuman denda jutaan rupiah sesuai dengan Qanun yang telah ditetapkan.(ts)

KNPI- KONIRY Aceh Besar Gelar Itikaf KOTA JANTHO (Waspada): Memasuki fase terakhir bulan suci Ramadhan 1431 H, Dewan Pengurus Daerah Komite Nasional Pemuda Indonesia (DPD KNPI) Kabupaten Aceh Besar bekerjasama dengan Korps Alumni IAIN Ar Raniry (KONIRY) Komisariat Daerah Aceh Besar menggelar kegiatan iktikaf. Kegiatan yang dipusatkan di Masjid Bustanul Jannah Ajun, Kecamatan Peukan Bada berlangsung sejak Senin (30/8) malam sampai 30 Ramadhan mendatang. Kegiatan yang dimulai setelah shalat taraweh hingga menjelang makan sahur diisi dengan kajian-kajian ke-islaman, Tadarrus, Qiyamullaili dan silaturrahmi. Kegiatan ini melibatkan Badan Kemakmuran Masjid (BKM) Bustanul Jannah Ajun, IKADI Aceh Besar dan Bank Indonesia Banda Aceh. Ketua panitia pelaksana DR Jasafat, MA dalam siaran pers turut ditandatangani H. KhalidWardana, S.Ag yangWaspada terima Senin malam, mengharapkan masyarakat di wilayah itu ikut berpartisipasi pada kegiatan tersebut dan memanfaatkan momentum akhir ramadhan untuk lebih mendekatkan diri kepada Allah SWT. “Kegiatan ini terbuka untuk umum. Jadi boleh diikuti siapa saja,” sebut DR Jasafat, MA. Di samping menggelar iktikaf, sebutnya lagi, panitia juga telah mengadakan serangkaian kegiatan lainnya yang dikemas dalam paket Gema Ramadhan KNPI-Koniry, di antaranya Safari Ramadhan ke-60 Masjid/Meunasah di wilayah pedalaman Aceh Besar seperti Leupung, Glee Jai, Glee Yeung, Biluy, Piyeung, Cot Keu-eung, Bung Cala, Simpang Tiga, Luthu dan Indrapuri.(b09)


Opini

C4

WASPADA Senin 6 September 2010

Sumatera Islamic Center Oleh Jhon Tafbu Ritonga Apakah Sumatera Islamic Center (SIC) rencana atau khayal besar? Bukan khayal, tapi mimpi yang dapat dirumuskan menjadi rencana dan program

S TAJUK RENCANA

Tradisi Mudik & Parsel

S

udah menjadi kegiatan rutin setiap kali menjelang tibanya Hari Raya Idul Fitri masyarakat berbondong-bondong melakukan perjalanan jauh atau pulang ke kampung halamannya, disebut juga mudik atau kembali ke ‘’udik’’ (dusun) yang fenomena itu sudah mentradisi dan membudaya, tidak mungkin dihalangi karena cukup banyak manfaatnya. Sehingga menjadi kewajiban pemerintah untuk memfasilitasi jalannya mudik secara massal —lewat darat, laut dan udara— agar masyarakat selamat ketempat tujuannya tanpa halangan berarti di jalan. Selain mudik, tradisi di kalangan masyarakat perkotaan adalah mengirim parsel lebaran. Parsel ini macam-macam isi dan tujuannya, dari yang seharga ratusan ribu berisi makanan dan minuman dan masuk kategori biasa, sampai jutaan rupiah berisi barang-barang berharga, bahkan puluhan juta rupiah hingga ratusan juta rupiah. Dan yang terakhir ini masuk kategori gratifikasi. Tentu saja, pemberian parsel model ini patut diantisipasi dan diawasi oleh KPK sehingga salah seorang pimpinan KPK Haryono Umar tegas mengatakan pengiriman parsel kepada pejabat dilarang. Tapi, lain KPK, lain pula perinsipnya Gubernur Jawa Tengah Bibit Waluyo . Ia mempersilakan pejabat di lingkungan pemerintah provinsinya untuk menerima bingkisan lebaran. Bahkan, dirinya tidak akan menolak dan tetap menerima jika ada yang akan memberi bingkisan lebaran. “Kalau diberi, ya diterima. Tidak perlu munafik,” tegas Bibit kemarin sembari meminta seluruh pihak tetap berpikir positif, bahwa pemberian bingkisan Lebaran ini merupakan bagian dari silaturahmi yang dilaksanakan setahun sekali sehingga ia kurang sepakat jika pemberian bingkisan lebaran kepada para pejabat ini berkaitan dengan Intisari sesuatu untuk kepentingan tertentu. Masih berlawanan dengan KPK Bibit Tradisi mudik menje- malah mengizinkan pejabat atau pegawai negeri sipil di lingkungan pemerintah prolang lebaran positif untuk untuk mudik dengan menggunasilaturahmi,bukan hura- vinsinya kan kendaraan dinas karena tidak akan ada hura. Awasi gratifikasi! yang berkurang dari kendaraan dinas yang digunakan untuk mudik. Namun kendaraan dinas yang digunakan harus tetap dirawat penggunaannya. Di mata KPK kendaraan dinas untuk urusan atau operasional pekerjaan karena menggunakan fasilitas negara yang dibeli dari uang rakyat. Mudik dan parsel, dua hal yang marak menjelang Idul Fitri 1431 H —Insya Allah jatuh pada hari Jumat (10/9) mendatang sesuai dengan hisab (perhitungan) Muhammadiyah dan Nahdlatul Ulama—, menurut hemat kita sulit dicegah. Jadi, meskipun akan ada dampak nengatifnya tapi tidak mungkin dapat dilarang sehingga yang diperlukan adalah pengaturan dan pengawasannya. Yang namanya mudik bagi umat Islam dalam menyambut Hari Raya Idul Fitri sudah menjadi bagian dari budaya sebagian masyarakat yang tinggal di kota-kota besar, atau merantau ke luar daerah. Biasanya, mereka yang sudah sukses di kota akan pulang untuk melihat dan mengunjungi sanak keluarganya di kampung. Tujuannya bersilaturahmi dan itu positif. Apalagi kalau mereka membawa modal untuk dibangun di kampung halamannya sehingga perekonomian di kampung itu bertambah maju. Yang sekadar menjalankan silaturahmi pun kita nilai positif, asalkan jangan sampai dipaksakan, misalnya sampai harus berutang ke kiri dan kanan hanya untuk pamer di kampungnya, capek-capek kerja 11 bulan dihamburkan saat mudik. Yang kita sebut terakhir jelas negatif! Oleh karena itu, tradisi mudik dapat disebut positif karena hubungan sosial masyarakat kembali terbina secara langsung bermakna menyambung tali kasih sayang sehingga tradisi mudik harus dipelihara karena tujuannya positif. Islam mengajarkan umatnya membina hablum minannas (hubungan dengan manusia) dan habklum-minallah (hubungan dengan Allah SWT). Dalam mudik kedua hal itu terlihat jelas. Berkumpul bersama dengan keluarga besar di kampung, menggemakan takbir bersama-sama, merayakan lebaran dan berbondong-bondong shalat Idul Fitri di lapangan terbuka membangun syiar Islam sembari saling bermaafmaafan. Sungguh kuat gaung religiusnya. Tak dapat diwakili dengan silaturahmi lewat telefon. Jadi, mesksipun pemerintah merasa kelabakan untuk memfasilitasi banyaknya warga yang mudik setiap tahunnya, jangan sampai menghambat, apalagi melarang, sebaliknya pemerintah punya kepedulian membantu masyarakat yang pulang kampung menjelang lebaran agar tidak terjadi hambatan maupun kecelakaan di jalan raya, laut, maupun udara. Bagi aparat keamanan, khususnya polisi, maraknya tradisi mudik memang merepotkan, seperti mengatur arus lalulintas di jalan raya yang pasti macet, menjaga keselamatan penumpang kendaraan dari hal-hal yang tak diingini di perjalanan, menjaga perumahan yang ditinggal warga pulang kampung. Apalagi belakangan ini marak perampokan, aksi hipnotis, pembiusan dll. Suasana mudik saat ini merupakan saat-saat rawan terjadi kejahatan.+

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN  Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817.  Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385  Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109  Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan hitam-putih Rp. 33.000,Halaman depan berwarna Rp. 90.000,Ukuran kolom: 40,5 mm E-mail Iklan: iklan@waspadamedan.com

trategi Pengembangan Islamic Center Melalui Pembangunan Ekonomi Umat. Demikian topik yang ditugaskan oleh panitia (PPKM) kepada saya. Dalam term of referencediarahkansupayapembahasanfokus pada empat substansi. Konsep dan strategi pengembanganperekonomianumatIslam Kota Medan; Strategi membangun jaringan perekonomian umat Islam Kota Medan; Peluang dan aspek pengembangan ekonomi dalam konsep pengelolaan dan pengembanganIslamicCenter;Islamiccenter, perbankan dan bisnis syariah. Cakupan keempat substansi tersebut cukup luas. Oleh karena itu, akan dibahas dengan perspektif ekonomi supaya keempatnya terjawab secara implisit. Ekonomi pasar Pertama, dalam ekonomi pasar yang digagas Adam Smith, dikenal dua istilah, laissez-faire dan invisible hand. Seseorang menjual sarapan soto ialah karena ingin mendapat laba untuk memenuhi hajat hidupnya. Bukan untuk membuat kenyang pelanggan. Sedangkan yang membeli soto juga untuk memenuhi kebutuhan hidupnya. Bukan untuk memberi laba bagi penjualsoto.Penjualdanpembelisoto,bertemu padasatukepentingan,yakniinterestpribadi masing-masing. Semua atau kebanyakan orang bersikapdanberperilakusama,yakniinginbebas untuk memenuhi interest pribadinya. Keinginandanusahamendapatkanyanglebih baik setiap individu itulah yang kemudian menyebabkan muncul “invisible hand”. Membuat efisiensi ekonomi pasar dan kemakmuran bagi setiap pelaku ekonomi terwujud.Meskipundalambenaksetiaporang

tidak pernah terlintas tekad dan usaha mewujudkan kepentingan bersama. Adapunmerekayangtidakpunyaakses terhadap sumber daya ekonomi, menjadi urusan pemerintah memfasilitasi atau membuka akses, menyediakan barang dan jasa publik, membuat aturan main supaya ekonomi lebih efisien serta mendorong pertumbuhan dan mencip-takan kestabilan ekonomi. Islamic Center Kedua, dalam konteks membangun perekonomian umat di Kota Medan, strategi membangun jaringan bisnis harus melalui dan dengan instrumen ekonomi pasar. Pemerintah Kota yang diberi kewenangan otonom oleh Peraturan Perundang-undangan bertanggungjawab memfasilitasi dan membangun akses bagi masyarakat, termasuk umat Islam yang jumlahnya mayoritas. Satu dari banyak aspirasi legal umat selama ini ialah membangun infrastruktur dengan sebutan Islamic Center. Fasilitas fisik untuk mengabdi pada Tuhan dengan melakukan berbagai bisnis yang dilengkapi dengan manajemen dan perangkat lunak secara terintegrasi. Kendalautamabagipemerintahmembangun infrastruktur ialah lahan, seperti yang sedang terjadi dalam pembangunan Bandara Kuala Namu dan pembangunan jalan bebas hambatan (Tol). Demikian juga aspirasi pembangunan Islamic Center di Sumatera Utara, dimana lokasi yang memadai dan letaknya stragegis? Ada dua pilihan cepat, lahan Bandara

Polonia jika Kuala Namu selesai, atau Kampus IANSU di Jalan Sutomo. Atas dasar pertimbangan sejarah, waktu, politik, dan psikologi umat, Kampus IAINSU yang sudah lama terbiar itu merupakan pilihan yang termungkin dan terbaik. Satu kali duduk di Masjid IAINSU, saya membayangkan di bagianTimur terdapat Sumatera Islamic Center (SIC) Building berlantai 20 mengalahkan Grand Angkasa dan UHN. Dibangun dengan IDB Loan, atau sumber lain berupa soft loan. Menjadi pusat ekonomi termoderen di Sumatera dan merupakan percontohan pusat bisnis dengan prinsip muamalat. Ada hotel, ada bank, ada pusat pendidikan tinggi ekonomi Islam,adapusatperbelanjaan,perkantoran, gelanggang olah raga, dll. Dengan parkir bawah tanah yang terkoneksi ke Poltabes. Di depan SIC berdiri kokoh masjid yang sudah ada tertata dan terurus indah dikelilingi hamparan parkir hijau. Menjadi satumonumenperadabandikota Medan yang madani dan religius. Menjadi jantung baru ekonomi Sumatera dan sekaligus menjadi simbol kemajuan bagi bangsabangsa Melayu di ASEAN. Peran Pemko Medan Dengan otonomi kota dan kepemimpinan Rahudman-Eldin yang didukung kepemimpinan Syamsul-Gatot, mimpi indah itu amat mungkin diwujudkan dengan prinsip ekonomi pasar. Dengan prinsip ekonomi pasar, gagasan ataupun aspirasi membangun SIC merupakan ide yang sangat layak dan dan dapat diwujudkan. Pemerintah hanya perlu menjalankan tiga perannya dalam perekonomian moderen: Meningkatkan efisiensi dengan mendorong kompetisi, mengendalikan eksternalitas seperti polusi dan menyediakan barang publik. Mendorong keadilan dan kewajaran dengan pajak dan belanja pemerintah melalui redistribusi pendapatan. Membantu pertumbuhan dan kestabilan ekonomi

dengan mengurangi pengangguran, mengendalikan inflasi dan mendorong pertumbuhan melalui kebijakan fiskal dan moneter. Apakah SIC rencana atau khayal besar? Bukan khayal, tapi mimpi yang dapat dirumuskan menjadi rencana dan program. Sebagai perbandingan, berapa tahun lalu ada yang sinis dan mencibir atas gagasan Kampus Bekala dan University Hospital – USU. Dana dari Islamic Development Bank (IDB) belum turun sudah ada yang memfitnah dananya dikorupsi Rektor Rp400 miliar. Tapi sekarang sedang dalam proses menjadi kenyataan. Saya sengaja mengemukakan ilustrasi University Hospital USU supaya Pemko Medan dan Pemprovsu tidak ragu jika ada kritik dan fitnah. Melakukan yang baik itu selalu ada hambatannya. Demikian juga SIC, belum dimulai mungkin saja ada nada sumbang dan bahkan upaya destruktif yang dapat mengendurkan semangat melakukan kemajuan. Dengar dan baca saja sebagai vitamin penambah semangat kerja melakukan kebaikan. Penutup Sebagai ekonom saya menyarankan SIC dibangun sebagai entitas bisnis yang sahamnya dimiliki oleh Pemerintah Daerah, Dunia Usaha dan Hartawan Muslim. Supaya SIC tidak menjadi beban di masa depan, tapi berfungsi sebagai induk perusahaan (holding) yang akan mengelola berbagai usaha di pusat bisnis yang melaksanakan muamalah atau contoh kecil betapa Islam menjadi rahmat bagi alam. Ekonomi kian berputar, tumbuh dan maju dalam ridho dan maghfirah Allah SWT. Insya Allah. Penulis adalah Ekonom Senior, Dekan Fakultas Ekonomi USU dan Regional Chief Economist BNI 46 Wilayah 01. Tulisan ini merupakan pendapat pribadi yang disampaikan dalam Diskusi Ramadan PPKM, 31 Agustus 2010 di Medan

Medan Islamic Center Oleh Shohibul Anshor Siregar Sekitar tahun 80-an Lukman Harun membawa segepok dana untuk pembangunan Islamic Center.Meski dengan serba keheranan orang-orang lokal, akhirnya ditunjuklah sebuah lokasi di Tanah Karo, beberapa kilometer dari ibukota Kabanjahe

S

idi Gazalba, seorang penulis buku, dengan karyanya “Mesjid Sebagai Pusat Ibadah dan Kebudayaan Islam” yang diterbitkan tahun 1962 berusaha sungguh-sungguh untuk mendudukkan fungsi masjid yang bukan sebagai tempat untuk pelaksanaan ibadah (khas) ansich. Karena jika hanya untuk shalat sehari-hari, SidiGazalbamemandangayatyangberbunyi “aynama kuntum fa wallu wujuhakum syathroh” (dimana saja kamu berada dirikanlah shalat), sudah lebih dari cukup memberipenegasantentangtakbegitupentingnya kemegahan bangunan yang dinamai masjid. Lalu mengapa masjid sebagai pusat ibadah dan kebudayaan Islam kini tidak lagi dianggap trend untuk dibicarakan sekaitan upaya kebangunan umat? Bagaimana gagasan subtitutif semacam Islamic Center dipandang bukan sebagai antipoda ruh keumatan? Bagaimana keterkaitan umat Islam Indonesia dalam sejarah kebangsaan dan irama politik kekuasan internasional yang membuatnya terpuruk tanpa harapan untuk bangkit dan memimpin? Tulisan ringkas ini bermaksud mengeksplorasi jawaban-jawaban historis, politik dan ekonomi yang akarnya terdapat pada penterjemahan kedirian suatu bangsa terutama oleh para pemimpin negara dan umat Islam. Daerah-daerah pertumbuhan baru Islam Telaahlahdengancermatdialogpemimpin legendaris Muslim Amerika Malcom X dengan berbagai pihak di negaranya tentang Islam, keIslamanya (kulit hitam) dan seruan persamaan hak untuk keadilan. Simaklah jugapidatoterkenalnya“BallotorBullet”yang menggelegar mendudukkan keniscayaan jaminan konstitusi Amerika yang dianggap perfeksionis untuk kebebasan dan persamaan hak. Dalam sebuah sejarah yang panjang di sana bermunculanlah“martir-martir” atas nama keIislaman seperti kisah unik seorang petinju legendari Cassius Clay yang menjadi MohammadAlikarenakonversikeagamaannya. Atau anak muda pada generasi berikutnya seperti Mike Tyson. Padasisilainkitajugapernahmendengar Maurice Bucaille yang demikian berpengaruh dalam kaitan dakwah Islam sekaitan karya terkenalnya “The Bible, The Qor’an, and Science”. Atau kisah tentang seorang penyanyi legendaris dari kelompok The Cats (Cats Steven) yang menjadiYusuf Islam dan aktifberdakwahsetelahkonversikeagamaannya (Islam).Tentu mereka ini begitu berbeda dengan orang Islam semacam Ahmed Hulusi(asalTurki) yang hijrahnya ke Barat begitu dirasakan berkat intelektualitasnya. Catatan pasti buat mereka ialah bahwa sama sekali tidak dalam kemiskinan yang parah dan kebodohan yang bersangatan semuakonversikeagamaanitumerekaalami. Bukan karena “diumpani paket sembako” atau sedikit modal usaha. Bahkan begitu kentarafaktakesulitanekonomisdanpolitikyang

diciptakan untuk sehubungan dengan konversi keagamaan itu. Mohammad Ali dijebloskan ke penjara karena menolak ber-perang ke Vietnam dengan alasan “saya tak diperbolehkan oleh agama saya membunuh saudara saya sendiri”. Bukan masjid dalam persepsi keIndonesiaan yang menjadi institusi strategis buat mereka, melainkan institusi yang secara internasional dikenal dengan nama Islamic Center. Sosialisasi keIslaman berlangsung di sana, selain ritus-ritus peribadatan. Di sana orang dikhitankan, disyahadatkan dan semuaituberlangsunghampirsembunyi-sembunyi. Selalu ada kesulitan dan itu belum akan reda. Saksikanlah apa yang kelak akan terjadi sehubungan dengan perubahan politik di Belanda. Kemenangan pemimpin politik anti Islam Geert Wilders yang pernah membuat filem Fitna yang menghebohkan itu tentu akan lebih mempersulit. Konon denganberbagairencanaburuksepertipemberlakuan pajak khusus bagi pemakai jilbab yang di hampir seluruh daratan Eropah bahkan sudah dimulai dengan berbagai program termasuk kampanye negatif ber-basis teknologi informasi. Akan tetapi tidak ada keraguan, bahwa meskipun pendeta seniorTerry D Jones dari gereja Dove OutreachWorld Center, Florida, akan terus melakukan hasutan anti Islam ke seluruh dunia, antara lain dengan upacara peringatan 9 tahun tragediWorldTrade Center (WTC) dengan pembakaran Al-qur’an tanggal 11 September nanti, rasionalitas orang-orangdisanadijaminakanterangsang untuk lebih banyak mengetahui Islam. Diyakinipuladenganmekanismeitulahselama ini populasi Islam dunia bertambah jauh lebih pesat. Parapemegangotoritasdinegara-negara besar itu pada umumnya ingin diplomasi berjalan mulus sehingga bukan saja Israel harus diistimewakan dalam aksi sistematisnya memusuhi Islam, tetapi di tangan negara besar seperti Amerika provokasi dengan isu war on terrorismharus dilancarkan termasuk untuk membungkam orang-orang seperti Abu Bakar Ba’asyir. Dia harus disejajarkan dengan bahaya Al-qaeda, dan secara tersembunyi tak mungkin tak terbaca bahwa Islam sebagai idiologi alternatif dunia begitu mencemaskanbagimerekaterutamasetelah usainya perang dingin. Dalam perspektif itulah agaknya pembangunan masjid dan pusat kebudayaan Muslim di Ground Zero (sebuah bangunan/ lahan) berjarak 1 km dari lokasiWTC sedang diperjuangkan. Obama sudah menyatakan dukungannya berdasarkan konstitusi Amerika meski dengan itu ia akan mendapat kesulitan besar dari partai oposisi. Gubernur New York berulangkali melakukan dialog dengan Cordoba Inisiative (sebuah institusi wakil umat Islam) agar lokasi masjid dan pusat kebudayaan muslim dipindahkan.Walikota Manhattan sendiri merasa malu jika

rencana ini gagal, karena dengan ini Amerika telah mempertontonkan kenaifannya dalam pemahaman kebebasan ke seluruh dunia. Fakta-fakta inilah yang tidak dibaca cermat oleh orang-orang di Indonesia ketika pemerintahan dan para tokoh Islam menggagas Islamic Center dan tidak menemukan masjidsebagaiinstitusiyangdapatmewadahi apa pun hasrat memajukan umat. Ini memang sebuah ironi yang nyata. Medan Islamic Center Sekitar tahun 80-an Lukman Harun membawa segepok dana untuk pembangunan Islamic Center organisasi Muhammadiyah. Meski dengan serba keheranan orang-orang lokal, akhirnya ditunjuklah sebuah lokasi di Tanah Karo, beberapa kilometerdariibukotaKabanjahe.Bangunannya pun berdiri dan apa yang dibayangkan sebelumnya tidak mungkin terlaksana karena permasalahan orang di Sumatera Utara berbeda dengan permasalahan orang di New York,London,Parisdankota-kotabesarBarat lainnya yang memerlukan hal serupa. Atas dasar pemahaman dan kebutuhan orang disini, semua keIslaman seolah sudah terselesaikan di masjid, bukan di Islamic Center. Sekaitan dengan itu marilah dengan jujur kita periksa apa yang dilakukan oleh Islamic Center Sumatera Utara kecuali (mungkin) sekadar mengusahakan perolehan status kepemilikan sebidang tanah dari perkebunan yang peruntukannya seakan serba tak jelas. Diataspesimismesepertiitulahsebagian orang memandang kehadiran gagasan perwujudan Islamic Center Medan yang pematangannya didiskusikan (yang sudah digodokselama5tahunolehsebuahtimyang antara lain terdiri dari Prof Dr Basyaruddin dan Prof Dr Muhammad Hatta) Selasa malam yang lalu di Medan . Salah seorang pembicara yang sehariharinya bekerja sebagai dosen ilmu ekonomi JohnTafbu Ritonga menyambar gagasan ini dengan sebuah sikap campuran kritisisme, pesimisme dan romantisisme sekaligus. Ia tidakmauberhentidalamgagasanmembuat icon monumental berbentuk kemegahan bangunantanpa interestdanutilitasekonomi di tengah percaturan dunia yang demikian terbuka. Ia berbicara tentang pasar dan sedikit mencengangkan bagi banyak peserta dialog yang sengaja dibatasi untuk 36 orang itu. Pada gilirannya ia pun memaksa, bahwa perhitungan transaksi ekonomi murni dan perhitunganbenefitbagiumattidakmungkin ditiadakan dan, katanya, jika pendapat saya tidak diakui maka hukumlah ilmu pengetahuan sebagai satu-satunya cara untuk memberi eksplanasi rasional dan prediksi masa depan. Baginya jika Islamic Center dimaksudkan sebagai jawaban keumatan sudah tentulah solusi keumatan yang menjadi core ideas. Penutup Dalam sebuah bedah buku“Selamatkan Indonesia” 3 tahun lalu di Medan, Mukhtar Effendi Harahap menegaskan persempitan peluang bagi negara dunia ketiga seperti Indonesia dengan globalisasi yang dipertuhankan serta dirancang begitu rapih untuk kepentingan negara-negara besar.Terutama dengan semakin diperkuatnya gagasan itu dengan berbagai instrumen dan kebijakan sepertiWashington Concensus,World bank,

IMF, Multinational Corporation yang keseluruhannyamengabdiuntuknegaraadidaya. Nur Ahmad Fadhil Lubis menyergah dengan mengatakan bahwa banyak gagasan yangdapatdikategorikanmenyuarakanbahwa Indonesia sedang berada di persimpangan jalan. Bahkan ada yang mengumpamakan sudah berada di tubir jurang kehancuran. Namun yang tetap bersikap konsisten dan berpendirian teguh berpihak pada kepentingan rakyat (umat) tidak banyak. SyawalGultommenunjukkanekspektasi publik yang sudah sedemikian mengering dansemestinyadipenuhi.Ketikanegaratampil sebagai penanggungjawab perlindungan, penghormatan, pemajuan dan pemenuhan HAM, itu artinya negara memiliki andil penting. Ujung tombak negara adalah pemerintah. Sedangkan Ichwan Azhari menyadarkan bahwa hal yang patut menjadi perhatianbukanlahketidakmampuanuntuk menjadi bangsa yang besar dan setara dengan negara-negara lainnya, namun sebenarnya kitalah yang tidak memiliki kemauan untuk itu. KetikaituJohnTafbupunberkata,perang yang dikecam seluruh dunia justru menjadi stimuluspertumbuhanekonomispektakuler Amerika. Mengingat Amerika merupakan guru demokrasi moderen, maka kritik yang diajukan justru menjadi energi untuk memperkukuh hegemoni. Jangan lupa, tegas John Tafbu Ritonga, Amerika adalah surga bagi ilmuan hingga para pebisnis menjadi stakeholder utama yang memberdayakan inovasi iptek. Penulis Dosen Sosiologi Politik FISIP UMSU, Koordinator Umum ‘nBASIS

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik

SUDUT BATUAH * Ketua DPR: Sinabung belum bencana nasional - Tapi tetap saja bencana * Gubsu jamin keamanan dan kenyamanan pemudik - Nyaman kalau sudah dapat THR, he...he...he * Rombongan DPR RI bantu pengungsi Rp200 juta - Kapan rombongan lain menyusul?

oel

D Wak

WASPADA

Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Plt. Redaktur Opini: Dedi Sahputra. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba, H. Halim Hasan, Diurna Wantana (Sumatera Utara), T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), Nurkarim Nehe, Bustami Chie Pit, Sapriadi (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Balyan Kadir Nasution, Mohot Lubis, Sukri Falah Harahap (Padang Sidimpuan), Sori Parlah Harahap (Gunung Tua), Idaham Butarbutar, Syarif Ali Usman (Sibuhuan), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

 Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 


Opini

WASPADA Senin 6 September 2010

Memberdayakan Nilai Idul Fitri

Susno “Singing General” Oleh Rosihan Anwar

B

ANGSA Indonesia terkenal sebagai bangsa yang punya ingatan atau kenangan singkat. Pada perayaan proklamasi kemerdekaan 65 tahun baru dia menyebutkan lagi beberapa peristiwa di zaman Revolusi, tokoh-tokoh dalam Perang Kemerdekaan (1945-49). Sekedar sebagai ritual, sebuah upacara atau basa-basi. Buat selebihnya segala itu dilupakan lagi. Suatu contoh. Belum begitu lama berselang masyarakat dan pers ribut dan ramai membicarakan skandal Bank Century. Atau korupsi dahsyat oleh pejabat pajak Gayus Tambunan. Atau soal rekening gendut para Jenderal Polri yang diungkapkan oleh media. Kini sepertinya hal-hal itu telah amat jauh berada di masa silam. Dan tidak satu pun diselesaikan secara tuntas dan memuaskan harapan masyarakat yang ingin bebenah diri, membasmi korupsi, dan sebagainya. Ambil sebagai contoh Jenderal Polri Susno Duadji yang beberapa bulan yang lalu jadi buah bibir orang. Ditulis dalam media, ditayangkan wajahnya di televisi. Didengar suaranya di radio. Kini di mana dia ? Dalam tahanan Mabes Polri, kata orang. Sudah jadi tersangka dalam perkara ? Belum itu, jawab orang. Apa yang akan terjadi dengan dia ? Nggak tahulah. Kebetulan saya baca edisi sebuah koran Amerika yaitu International Herald Tribune (10 Mei 2010) atau edisi global The New York Times. Di situ terdapat sebuah berita dengan judul sebesar empat kolom tentara Jenderal Polri Susno Duadji oleh wartawannya Norimitsu Onishi dengan deteline dari Jakarta. Diterjemahkan ke dalam bahasa Indonesia, judul itu berbunyi: “Jenderal yang menyanyi” mengicaukan nada anti-suapan. Subjudulnya berbunyi: “Mantan pejabat polisi menuduh kalangannya sendiri dalam penyelidikan-penyelidikan korupsi Indonesia”. Isi berita itu sudah dimaklumi oleh publik yang membaca koran di negeri kita, sehingga tak perlu dikutip semua atau diulangi di sini. Mengenai Susno dikatakan oleh koran Amerika itu antara lain: “Dianggap tidak ada lagi lantaran sebuah perkara penyuapan, dicela oleh publik, dibuang oleh rekan-rekan pejabat Polri, jenderal itu (Susno) telah melakukan serangan balasan dalam minggu-minggu belum lama berselang dengan mengungkapkan informasi mengenai korupsi di tingkat paling tinggi pihak polisi dan pemerintah. Penyingkapan itu telah membawa kepada suatu penolakan antara Polri dengan Jenderal Susno yang mengklaim memiliki sebuah brankas (peti besi) penuh dengan dokumen-dokumen rahasia mengenai jumlah tidak terbatas tentang perkaraperkara lainnya. Dia mengancam akan mengungkapkan lebih banyak, satu demi satu”. “Soeharto adalah the smiling general, jenderal yang tersenyum” kata Susno, merujuk kepada penguasa militer Indonesia yang memerintah lama. “Saya adalah jenderal yang menyanyi, the singing general” ujar Susno. Namun selama suatu wawancara panjang dengan wartawan Amerika tadi Susno (55) tetap tersenyum. Suatu senyuman yang sedikit sekali menyingkapkan motifnya. Apakah itu suatu gerak berani yang dibikin dari dalam kalangan polisi dengan labirin (suatu susunan yang membingungkan) politik kekuasaan Polri, untuk menjadi Kapolri ? Atau seperti dikatakannya apakah semua itu sederhana saja suatu upaya patriotik untuk berjuang membasmi korupsi yang melumpuhkan negeri ? Adalah pertama kali bahwa seorang anggota Polri telah berpaling secara terbuka melawan rekan-rekannya, kata Bambang Widodo Umar yang telah pensiun dari Polri dengan pangkal Kolonel dan kini mengajar di Perguruan Tinggi Polisi dan di Universitas Indonesia. “Di Indonesia masih taboe atau merupakan larangan bagi seorang anggota sembarang organisasi untuk menggantungkan cucian kotor di depan umum” kata Bambang (63). Dia menambahkan bahwa apa yang telah dilakukan oleh Susno adalah luar biasa, apakah keadaan yang memaksanya bertindak atau apakah sesuatu dari kalangan dalam telah mendorong Susno”. Publik mendengar tentang Susno kurang dari satu tahun yang lalu untuk pertama kali. Para penyelidik dari KPK (Komite Pemberantasan Korupsi) menemukan Susno dalam sebuah tilpon yang disadap telah meminta uang suapan sebanyak satu juta dolar AS. Jenderal yang jadi Kepala Bagian Reskrim itu mengatakan kemudian dia telah mengetahui tilponnya disadap dan bahwa dia sederhana saja sedang “bermain” dengan orang yang menilpon dia. Ketegangan timbul antara Polri dengan KPK. Jenderal Susno membikin keadaan lebih parah dengan perumpamaan (tamzilan) KPK itu adalah “cicak”, sedangkan Polri adalah “buaya”. Kemudian ada laporan bahwa Susno telah merekayasa untuk mengkriminalisasikan dua orang anggota pimpinan KPK. Tekanan meningkat terhadap Presiden SBY dan suara-suara protes dari demo-demo di jalanan telah mengakibatkan dipecatnya Susno sebagai Kabareskrim Polri. Dia nyaris diberhentikan dari Polri. Susno berkata dia telah dijadikan kambing hitam dari cara tidak benar polisi menangani kemarahan publik. Susno bilang dia adalah “korban”. Dia menyangkal tidak pernah merongrong KPK. “Saya cinta KPK” ujar Susno jenderal yang tetap tersenyum. Susno berkata “KPK adalah sangat, sangat serius sungguh-sungguh memerangi korupsi. Polisi dan Jaksa adalah “tidak terlalu serius”. (+++)

Foliopini

Dedi Sahputra dedisahputra@yahoo.com

Hanphone Lebaran Ada pekerjaan baru menjelang Lebaran yang paling banyak dilakukan orang yaitu menceti tombol handphone. Kirim-kirim ucapan selama dan permohonan maaf melalui SMS sudah menjadi budaya sejak handphone jadi “istri kedua” yang setia mendampingi. Hanphone telah sedemikian rupa membuat yang jauh jadi dekat namun pada saat yang sama membuat yang dekat jadi jauh. Hanya dengan pencet tomboltombol di hanphone, kita sudah bisa kirim pesan Idul Fitri kepada ratusan orang pada saat yang sama, di manapun orang yang dituju berada. Betapa teknologi telah membuat hidup menjadi begitu efektif. Namun ketika sedang ngumpul keluarga atau bersama teman, aktifitas tangan menceti tombol itu tak juga berhenti. Orang jadi lebih sering berkomunikasi melalui alat dalam genggaman itu daripada berbicara dengan orang di hadapannya. Kalaupun terpaksa ngomong, sambil kepala tertunduk melototi hanphonenya. Seorang mantan pejabat pernah berkata begini, banyak sekali SMS masuk mengucapi selamat. Pekerjaan saya dari tadi menjawab semua SMS itu. ‘’Nanti kalau tidak dijawab, dibilang sombong,’’ katanya lebih mirip kesombongan itu sendiri. *** Seringkali secara tidak sadar, kita menangkap sebuah kenikmatan yang sangat indah. Dia datang begitu saja tanpa disadari. Kemudian ia masuk ke dalam relung-relung hati dan menetap di sana untuk waktu yang sangat lama, terkadang sampai seumur hidup. Orang baru merasa ingat dia pernah mengecap kenikmatan yang indah itu ketika dia sudah berjarak cukup jauh dengan momen tersebut. Idul Fitri adalah momen yang seringkali memberikan kenikmatan dan keindahan tersebut. Cuma saja orang tidak pernah bisa benarbenar tulus merasakan kenikmatan tersebut. Itu sebabnya seringkali orang merasa bahwa Idul Fitri kali ini biasa-biasa saja, sepi-sepi aja, tidak terlalu istimewa. Padahal dia merasa bahwa dirinya pernah bahagia ketika Idul Fitri datang, tapi entah kapan. Dia ingin kembali ke rasa itu, tapi sulit sekali, bahkan cenderung tak mungkin. Sama seperti sakit gigi. Mungkin kalau kita sudah mengalami sakit gigi, kita baru teringat betapa indahnya mengunyah itu. Tapi selama gigi baik-baik saja, orang tidak akan menganggap istimewa aktifitas mengunyah.

Sesungguhnya Idul Fitri tetap sesuatu yang indah. Dari dulu memang sudah begitu. Hanya mata dan hati kita yang ter-tutupi yang tidak bisa merasakan kenikmatan yang indah itu. Empati adalah kata kuncinya. Kalau Anda berhasil bersih-bersih selama Ramadhan, maka Anda akan lebih peka terhadap apapun itu. Mobil yang baru keluar dari doorsmeer juga akan lebih gampang mendeteksi kotoran. Kalau tertimpuk kotoran burung, si sopir buru-buru akan membersihkannya pada kesempatan pertama. Tapi jika kondisi mobil sedang ikut offroad, maka kotoran kerbau yang menempel sekalipun akan dianggap sepi. Maka kini saatnya bersih-bersih agar persoalan SMS di handphone menjadi tidaksulituntukdisikapisecaralembut.Jangan sampai kemudahan teknologi, meramahan bergaul melalui hanphone justru menjadi pemicu kesombongan Anda. Sesungguhnya ini adalah kecenderungan kita yang menjadikan rata-rata kita hanya sebagai manusia berkualitas parsial. Kita mendalami ilmu agama tapi gagal mengelaborasikannya dengan intelektualitas, kita memiliki kedashatan kecerdasan sekelas cendikiawan tapi lupa melembutkan hati. *** Wahai saudaraku semua. Beberapa hari lagi Idul Fitri datang lagi. Maaf-kanlah saya, untuk segala luka yang terbesit, untuk setiap asumsi yang meleset, untuk semua perilaku yang tidak matching, please... Maafkan juga saya untuk SMS yang gagal terkirim karena jaringan padat ataupun karena kehabisan pulsa. Maafkan saya untuk SMS yang tak terkirim karena nama Anda belum terekam dalam hanphone saya dan maafkan saya untuk tidak mengirim SMS ke hanphone Anda. Sungguh saya mohon maaf. Pintu hatiku, seperti halnya pintu rumah kubuka lebar-lebar. Aku siap menjamu Anda dengan segala keramahan yang aku punyai, menghidangkan dengan semua kelengkapan yang kupersiapkan, mencandai dengan stok humor yang kuingat. Maafkanlah saya. Kalau Anda punya syarat untuk kemaafan itu, percayalah, saya akan mencari jalan untuk memenuhinya, sesulit apapun itu. Akan halnya kesalahan Anda, saya sudah memaafkannya sejak lama, itupun kalau ada. Saya sungguh memimpikan di antara kita semua sudah bersih di hadapan Allah Rabbul ‘Izzati. Karena sesungguhnya kebutuhan kita untuk diampuni Allah adalah jauh lebih besar daripada diri itu sendiri.

Kolom foliopini dapat juga diakses melalui http://epaper.waspadamedan.com

C5

Oleh M. Ridwan Lubis Dari segi filantropi Islam, di akhir bulan Ramadan setiap umat Islam diharuskan untuk membayar zakat fitrah dan bagi yang telah sampai ukuran nisab dan haulnya diwajibkan pula untuk membayar zakat harta

D

alam waktu yang semakin dekat suasana Idul Fitri akan membentuk berbagai perilaku sosial. Dua halpentingyangmenjadiakarIdul Fitri yaitu dorongan untuk bersilaturrahim dan filantropis. Dalam upaya untuk lebih memaknai Idul Fitri sebagai bulan kembali kepada fitrah dan kemenangan (minal‘aidien wa al faizien) maka Idul Fitri identik dengan budaya saling mengunjungi. Dari ajaran silaturrahim ini maka berkembang berbagai fenomena sosial untuk membangun suasana interaksi antar manusia melalui upacara bersalam-salaman yang diteruskan dengan pengiriman surat. Setelah dirasakan silaturrahim melalui surat yang kemudian menjelma menjadi kartu Lebaran dianggap terlalu rumit maka berkembang pula cara yang lebih praktis yaitu menggunakan jasa elektronik baik dengan layanan pesan pendek (short message service), email dan sebagainya. Dampaknya tentu sudah diduga berkurangnya beban tugas layanan pos yang kemudian berubah menjadi meningkatnya secara tajam penggunaan handphone yang berarti melonjaknya satuan biaya komunikasi yang disebut pulsa. Semua pelosok nusantara sampai ke desa-desa telah menambah beban tambahan pengeluaran keluarga yaitu handphone dan pembelian pulsa. Selain dari perubahantingkatkebutuhanmasyarakatterhadap telekomunikasi, perubahan lain adalah padatnyavolumelalulintasdijalanrayaterutama ke JawaTengah dan Jawa Timur yang disebut dengan tradisi mudik Lebaran. Berbagai daerah menggunakan sebutan berbeda. Masyarakat Minangkabau menyebutnya pulang basamo sementara di Jawa

disebut pulang ke udik (hulu) yang disingkat mudik. Para pemudik ini, uniknya, bukan hanya dari mereka yang menjalankan ibadah puasa akan tetapi juga mereka yang sekedar memanfaatkan libur Lebaran untuk ikut mudik ke kampung halamannya. Maka orang yang tidak berpuasa juga ikut mengambil keuntungan dari tradisi silaturrahim yaitu peningkatan belanja keluarga dan pergerakan manusia yang amat padat. Tingginya jumlah angka pemudik mengakibatkan sarana transportasi dan jalan raya seakan tidak mampu menampung padatnya animo masyarakat yang pulang untuk bersilaturrahim kepada sanak saudaranya. Sesuai dengan pakem ilmu ekonomi, semakin tinggi permintaan (demand) sedang pasokan layanan (supply) lebih kecil dari permintaan maka satuan harga yang harus dibayar terhadap layanan menjadi semakin tinggi. Oleh karena sulitnya memperoleh jasa layanan serta mahalnya biaya ongkos transportasi, mengakibatkan munculnya kreatifitas baru masyarakat yaitu mudik dengan menggunakan sepeda motor bersama isteri dan anaknya. Sekalipun cara yang demikian cukup banyak risikonya akan tetapi dengan didasarkan kepada niat yang tulus untuk bersilaturrahim, niat mudik terus dilanjutkan karena semuanya telah membekali diri dengan sikap pasrah kepada Yang Maha Kuasa.

Selanjutnya kampung yang semula lengang karena ditinggal sebagian warganya mengadu nasib di kota-kota besar tiba-tiba berubah menjadi terang benderang dihiasi dengan berbagai asesori model terakhir terutama di kalangan remaja. Rentetan silaturrahim tersebut terus berlanjut dengan berkaca kepada orang-orang desa yang sukses di kota menjadi daya magnit yang sangat kuat untuk menarik minat orang desa melakukan urbanisasi. Maka setiap habis Lebaran, penduduk perkotaan mengalami pertumbuhan yang tidak sebanding dengan fasilitas sosial dan fasilitas umum yang tersedia. Dari segi filantropi Islam, di akhir bulan RamadansetiapumatIslamdiharuskanuntuk membayar zakat fitrah dan bagi yang telah sampai ukuran nisab dan haulnya diwajibkan pula untuk membayar zakat harta. Sekalipun pada mulanya zakat itu dibayarkan dengan barang yang dikonsumsi yang semula adalah gandum menurut tradisi orang arab, akan tetapi karena konsep dasarnya adalah makanan pokok, maka pada masa lalu zakat dibayar langsung dengan beras yang disisihkan dari sebagianyangdikonsumsinya. Namun kemudian, seiring dengan cara pandang masyarakat yang semakin pragmatis, maka beras, jagung atau sagu sebagai makanan pokok tidak lagi praktis digunakan untuk membayar zakat akan tetapi sudah dialihbahasakan dengan sejumlah uang yang disetarakan dengan harga beras yang dikonsumsi. Panitia zakat di berbagai tempat telah mengasumsikan bahwa tingkat kehidupan ekonomi masyarakat berada pada tiga lapisan: rendah, menengah dan tinggi, maka dibuat tigakriteriahargasatuanzakatfitrahyangharus dibayarkan para muzakki. Apabila pada masa lalu kepedulian terhadap warga miskin hanya muncul pada menjelang Idul Fitri yang menyebabkan adanya kebijakan pada kelompok

masyarakat praktisi zakat yang disebut amil untuk langsung menyerahkan dan membagikan zakat fitrah guna memenuhi kebutuhan konsumtif masyarakat. Oleh karena itu diutamakan penyalurannya kepada fakir dan miskin sesuai dengan ketentuan yang berhak menerima zakat (mustahiq zakat). Akan tetapi perkembangan terbaru dari filantrofi Islam ini adalah tumbuhnya berbagai lembaga swadaya masyarakat yang menghimpun dana-dana ibadah ini dan menyalurkannya kepada kelompok masyarakat yang sangat membutuhkan. Lembaga ini muncul dalam berbagai nama Bazis, Lazis, Dompet Duafa, sebagaimana juga Waspada mengambil partisipasi dalam hal itu.. Persoalan yang ingin disoroti dari kasus filantrofi ini adalah sulitnya menggerakkan dana ibadah itu kepada hal yang bersifat produktif untuk membebaskan umat dari kebodohan, kemiskinan dan keterbelakangan. Sebagian masyarakat masih merasa lebih nyaman menyumbang kepada pembangunanmasjidatausekolahdaripadamenyumbang untuk kepentingan beasiswa pelajar atau mahasiswa yang berpotensi padahal perubahan kehidupan umat Islam sangat ditentukanolehlahirnyakelakkelompokpemimpin umat yang professional, berdedikasi dan agamis. Semoga Idul Fitri tahun ini menyadarkan umat betapa berat beban sejarah yang harus dipikul generasi masa kini untuk menjemput hari esok umat Islam yang lebih baik. Beban sejarah itu adalah mewujudkan silaturrahim sebagai semangat yang selalu menjadi citacita untuk memperkuat ukhuwah umat dan meningkatkan wawasan umat terhadap pengumpulan, penyaluran dan pemanfaatan filantrofi Islam Selamat Hari Raya Idul Fitri 1431 Hijriyah. Minal ‘aidien wa al faizien, wa kullu‘amin antum fi khair,mohon maaf lahir dan batin. M. Ridwan Lubis, Dosen UIN Syarif Hidayatullah Jakarta

Lebaran Dan Spirit Mudik Oleh Fery Ramadhansyah Tradisi mudik sangat berkelitan antara sosial,budaya,ekonomi dan keberagamaan

L

ebaran merupakan saat-saat dimana umat Islam bersuka cita. Pasalnya, padaharitersebutseluruhumatIslam bergembira karena telah mengakhiri ibadah puasanya selama sebulan penuh. Setelah selama di bulan Ramadhan menahan lapar dahaga, tepat tanggal satu Syawal semua larangan tersebut dicabut dan kemudian dibolehkankembaliuntukmakandanminum sepanjang hari. Itu makanya, hari raya Idul Fitri di negara kita disebut dengan Lebaran. Konon katanya istilah Lebaran ini berasal dari bahasa Jawa, meskipun sebagian masyarakat di sana lebih akrab menyebuttnya denganRiyadin,Rioyo,ataubada.KataLebaran adalah kata dasar yang berasal dari kata lebar yang artinya selesai. lebih tepatnya selesai melaksanakan ibadah puasa. Dalam kamus besar bahasa Indonesia Lebaran diartikan sebagai hari raya umat Islam yang jatuh pada tanggal 1 Syawal setelah selesai menjalankan ibadah puasa selama sebulan. Satu hal yang tak bisa dipisahkan dari Lebaran adalah kebiasaan mudik yang dilakukan oleh perantau.Tidak afdol rasanya kalau Lebaran tidak bersama orang tua dan sanak saudara. Seperti sudah menjadi hal yang wajib, bagi masyarakat Indonesia berlebaran

denganmudikkembalikekampunghalamannya. Mudik ibarat dua sisi mata uang, kalau sisi yang satu tidak ada maka sisi yang lain tidak berguna.Jadi,mudikbahkanbukanlagipilihan tapi sebuah keharusan. Mudik yang asal katanya dari udik, artinya desa atu kampung. Kemudian istilah ini digunakan untuk kegiatan seseorang kembali ke kampung halamannya. Menurut sejarah, bangsa Indonesia dulunya berasal dari suku Yunnan, China. Sebenarnya sejak masa prasejarah dulu tradisi mudik ini telah dikenal oleh masyarakat Indonesia. Sudah menjadi fitrahbahwamanusiayangdulumaupunsekarangsama-samamemilikikerinduanterhadap sanak saudara. Hanya saja pada masa prasejarah, dengan sifat manusianya yang nomaden dan masih animisme, maka kembalinya ke tanah leluhur bertujuan untuk menyembah arwah nenek moyang. Sejak datangnya Islam di Indonesia, dan masyarakat banyak memeluk agama Islam maka tujuan mudik diubah. Semangat untuk kembali ke kampung yang biasa dilakukan di hari raya Idul Fitri tersebut bertujuan untuk silaturrahmi dengan sanak keluarga. Kegiatan mudik banyak dilakukan terutama oleh masyarakat kota. Sudah sama diketa-

hui bahwa di kota-kota besar lebih banyak pendatang dari pada penduduk asli. Maka tidak heran kalau kota seperti Jakarta bagai kota mati saat hari raya Idul Fitri tiba. Sunyi bukan karena masyarakatnya tidak berhari raya, namun hingar bingar yang biasa dijumpai di sana seketika menjadi sepi karena sebagian besar penduduk di sana mudik Lebaran. Tradisi mudik sangat berkelitan antara sosial, budaya, ekonomi dan keberagamaan. Lebaran yang dijadikan kesempatan orang untuk mudik, setidaknya dimaknai ke dalam beberapa hal. Pertama; Idul Fitri, diartikan sebagai hari raya fitrah. Umat Islam berkeyakinan semasa akhir Ramadhan dan hari pertama bulan Syawal, semuanya bagaikan bayi yang baru dilahirkan kembali dalam keadaanfitrah. Kedua;katafitriyangartinyafitrah mengajak umat manusia kembali kepada fitrahnya yaitu orang tua yang kemudian diartikan menjadi mudik. Said Aqiel Siradj menempatkannya dalam konteks keberagamaan: kembali ke fitrah sebagaiupayakesalehan yangbersifatspiritual vertikal yang konkrit, dimaknai lewat jalan kesalehan sosio-horizontal. Silaturahim menjadi sarana sekaligus hasil. Dalam konteks sosio-horizontal, tradisi mudik bisa menjadi cermin pasang-surutnya kehidupan. Jumlah pemudik bisa dijadikan salah satu faktor walaupun tidak otomatis. Membesarnya jumlah pemudik tidak selalu menjadi cermin kemajuan, bahkan bisa sebaliknya.Itusebabnya,sebagaimigranpenduduk desa yang melakukan migrasi ke kota untuk

mencari nafkah benar-benar memanfaatkan momenLebaran ini dengan mudik untuk melepas kerinduan bersama sanak famili. Tidak sedikit mereka yang mudik juga membawa kendaraan pribadi seperti motor dan mobil ikut bersamanya pulang ke kampung halaman. Ini adalah fenomena sosial bahwa mereka yang bekerja di kota ingin menunjukkan harta yang dimilikinya sebagai bukti sukses selama di kota. Dalam konteks ekonomi kita lihat,kesempatan mudik mendorong orang untuk memperbanyakprodukdanmeluaskanpelayananpelayanan jasa yang sacara langsung bersentuhan dengan orang yang mudik. Dan dalam hal ini maka jasa transportasi adalah yang banyak dibutuhkan. Kemudian jasa komunikasi melaluicelular.Karenaitu,perusahanpenyedia kartu sepertiTelkomsel, Indosat dan lain sebagainyamenawarkantarifsemurah-murahnya. Dalam konteks tradisi dan budaya, mudik juga telah menjadi trademark bagi Indonesia. Jadi kalau ada negara Asia Tenggara lain yang melakukan mudik, maka Indonesialah pionernya. Harapan penulis semoga kegiatan mudik di Lebaran kali ini semua berjalan lancar. Mudah-mudahan pelayanan yang diberikan oleh pemerintah lebih baik. Dan jangan lupa agar senantiasa waspada ketika mudik. Karena mungkinbanyakhalyangtidakdiinginkanbisa terjadi.Makadariituikhtiarlahdanjugaberdoa. Penulis adalah Staff Pendidik YPSA, alumnus univ. Al Azhar- Mesir

Membisniskan Idul Fitri Oleh S. Satya Dharma Disadari atau tidak, umat Islam Indonesia sungguh-sungguh sudah terjebak pada pola bertindak dan berprilaku yang dikehendaki kaum kapitalis

B

eberapa tahun lalu sebuah suratkabar Jakartamemuatartikelberjudul“Imlek Perayaan Agama atau Budaya?” yang antara lain menyebutkan;“Imlek, seperti juga Natal,Tahun Baru dan Idul Fitri, sekarang telah menjadi komoditi bisnis.” Membaca artikel tersebut, yang menyejajarkan Imlek, Natal, Tahun Baru dan Idul Fitri dalam satu frasa, yang kemudian memvonisnya sebagai telah menjadi komoditi bisnis, jelas sangat merisaukan kita. Sebab, meskipun bermuara pada kegembiraan, namun dasar filosofis dan pijakan religiusitas keempat hari besar itu sangat berbeda. Imlek adalah perayaan tahun baru berdasarkan sistim Lunar dalam rangka menyambut datangnya musim semi oleh masyarakat Tiongkok. Sedangkan Natal adalah upacara ritual memperingati lahirnya Isa al Masih dan tahun baru merupakan perayaan masuknya 1 Januari dalam penanggalan masehi. Adapun Idul Fitri merupakan ungkapan imaniah umat Islam setelah 30 hari lamanya menyucikan diri dengan berpuasa di bulan Ramadhan. Maka wajarlah kerisauan hati ini saat membaca apa yang diungkapkan penulis artikel tersebut.Terle-bih lagi jika melihat faktafaktayangterjadidalamkehidupanmasyarakat Indonesia saat menyambut datangnya harihari besar tersebut pada beberapa tahun belakangan ini. Penulis menilai vonis bahwa Idul Fitri, sebagaimana halnya Natal, Imlek dan Tahun Baru telah menjadi komoditi bisnis, adalah fakta empiris yang tak bisa dibantah. Harihari besar keagamaan yang seharusnya bernuansa ritual itu, saat ini sungguh-sungguh telah dikuasai oleh kaum kapitalis. Lihatlah bagaimana berbagai prosesi ritual yang seharusnya menyertai hari-hari besar itu justru telah menjadi sekedar upacara seremonial belaka. Memang orang tetap saja ber-

bondong-bondong datang ke Masjid, ke Mushalla, ke Klenteng, ke Vihara atau ke Gereja untuk menjalankan ritual keagamaan karena upacara keagamaan itu sudah merupakan tradisi. Tapi semua upacara itu berlangsung hanya sekedar acara seremonial belaka. Tidak memberi bekas apapun terhadap tingkat ketakwaan umat masing-masing agama itu. Buktinya jelas. Lihatlah bagaimana tindak kejahatan terus meningkat, kemaksiatan tetap merajalela, praktik korupsi tak juga berhenti dan bahkan jumlah kemiskinan tak juga berkurang. Semua itu terjadi karena visi dan persepsi kita atas doktrin agama dan kepedulian terhadap sesama tak sedikitpun berubah. Yang justru menonjol dari semua peringatan hari-hari besar itu adalah pesta dan hura-hura. Mall-mall, pusat-pusat perbelanjaan dan tempat-tempat hiburan penuh sesak oleh orang-orang yang euphoria melepaskan syahwat duniawinya. Sangat memprihatinkan Tapi, benarkah Idul Fitri telah menjadi komoditibisnis? Jikamelihatpadarealitasyang berlangsung di masyarakat, jawabannya bisa jadi benar sekalipun secara teologis kebenaran atas realitas itu sangat memprihatinkan. Sebab Idul Fitri adalah peristiwa maha penting dalam ajaran Islam yang menjadi bagian tak terpisahkan dari prosesi ritual umat Islam setelah sebulan penuh berpuasa. Apalagi, sesuai dengannamanya,IdulFitriadalahperwujudan dari kembalinya “fitrah” manusia sebagai makhluk di hadapan Allah SWT sebagai AlKhalik (Sang Pencipta). Maka hal utama yang seharusnya dilakukan umat Islam dalam Idul Fitri adalah mengumandangkan kalimat-kalimatTakbir, Tahmid dan Tahlil. Yakni kalimat-kalimat tauhid yang berisi pengagungan kepada Allah

SWT dan sekaligus pernyataan rasa syukur atas rahmat dan nikmat yang diberiNya. Barulah, setelah itu, prosesi pengagungan ke-Esaan Allah itu dilanjutkan dengan kegiatan silaturrahmidalambentuksalingmaafmemaafkan antara sanak saudara, kerabat dan tetangga. Dus, dalam keharusan prosesi ritual itu, sesungguhnya tak ada moment hura-hura yang memberi ruang dan bahkan peluang bagi tumbuh dan berkembangnya komoditi bisnis di Idul Fitri. Tapi, entah mengapa, setelah satu bulan lamanya berpuasa, mengekang diri dari segala bentuk hawa nafsu, pada 1 Syawal (saat Idul Fitri itu), umat Islam justru berprilaku bak kuda liar terbebas dari tali kekangnya. Pada hari dimana umat Islam seharusnya mensyukuri keberadaan dirinya karena menjadi fitri, suci, bersih ibarat bayi yang baru lahir tanpa noda, euphoria massal justru terjadi dimana-mana. Pemaknaan Idul Fitri sebagai hari pembebasan sungguhsungguh telah melenceng artinya. Bahkan jauh sebelum hari dimana umat Islam dilepaskan dari kewajibannya untuk berpuasa itu tiba, euphoria 1 Syawal benar-benar telah membuat umat kehilangan akal sehatnya. Semua hal harus baru. Tak peduli apakah yang baru itu mendatangkan manfaat atau menimbulkan mudharat, pokoknya harus baru. Situasi inilah yang kemudian dimanfaatkan kaum kapitalis yang notabene bukan kalangan Islam untuk membisniskan Idul Fitri. Mereka membisniskan hari fitrah itu dengan menyediakan apapun yang dibutuhkan syahwat umat Islam untuk sesuatu yang baru tersebut. Inilah situasi yang akhirnya menyeret Idul Fitri tak bisa lagi menghindar dari menjadi komoditi bisnis. Lihatlah, tak hanya pada saat Idul Fitri, bahkan beberapa hari sebelumnya telah terjadi transaksi bisnis dan perdagangan yang sangat tinggi dengan “gairah” membelanjakan uang sangat besar di kalangan umat Islam. Mereka membeli apa saja yang terkesan baru, bahkan untuk sesuatu yang sesungguhnya sudah mereka miliki. Tak ada keuntungan apapun yang diraih umat Islam dari situasi ini kecuali sekedar pemborosan. Oleh karena itu penulis tegaskan; Euphoria konsumerisme itu sama seka-

li bukanlah bagian dari Idul Fitri. Ephoria itu semata-mata adalah wujud ekspresi umat terhadap penafsiran “kebelinger” atas pembebasan diri dan jiwa baru (fitri) dalam konteks 1 Syawal tersebut. Apalagi bentuk ekspresi yang diimplementasikan dalam wujud baru itu – seperti pakaian baru, sepatu baru, perhiasan baru, perabotan rumahtangga baru atau mobil baru — tidaklah prioritas dalam syariat Islam. Tapi justru penafsiran kebelinger itulah yang dimanfaatkan kaum kapitalis untuk mengeruk duit dari saku umat Islam sampai kandas. Memang, menyebutkan Idul Fitri sebagai komoditi bisnis adalah menyakitkan. Seolah betapa rendah derajat ritual hari besar itu dalam pemahaman teologis kita. Tapi ini adalah fakta. Kondisi riil yang terjadi dalam kehidupan umat Islam Indonesia dewasa ini. Disadari atau tidak, umat Islam Indonesia sungguh-sungguh sudah terjebak pada pola bertindak dan berprilaku yang dikehendaki kaum kapitalis. Yakni menjadi konsumtif, mengutamakan tradisi dan melupakan syariat. Padahal Idul Fitri bukanlah kegiatan budaya. Idul Fitri sepenuhnya adalah bagian tidak terpisahkan dari sebuah prosesi ritual dalam syariat Islam. Idul Fitri adalah puncak pencapaian ketakwaan seorangMuslim setelah dengan penuh keimanan melaksanakan ibadah puasa sebulan penuh di bulan Ramadhan. Bahwa Idul Fitri memberi dampak positif terhadap tumbuh dan berkembangnya transaksi bisnis dan perdagangan, sejatinya hal itu kita anggap sebagai pengaruh positif dari prosesi ritual selama dan pasca Ramadhan. Tapi janganlah dampak positif itu justru melenakan umat hingga terbujuk rayu pada situasi yang justru menodai kesucian Idul Fitri itu sendiri. Kinilah saatnya kita hentikan gerakan membisniskan Idul Fitri itu. Dan media massa – terutama yang pemilik dan pekerjanya adalah orang Islam — punya kewajiban besar untuk memulai gerakan itu. Sungguh. Penulis adalah Sekretaris Jenderal Multiculture Society, Koordinator Gerakan Relawan Medan Hijau (Gerilya-Mu)


C6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM 4 CM

Bursa

AUTOMOTIVE Informasi Pembaca

Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

CHEVROLET Aveo Th. ‘05. Warna silver, Km. 27xxx, A/T, Mbl Ctk sekali, Rp. 95 Jt. Kembar Ponsel. Jl. SM. Raja No. 200. (Dpn UISU). 0812 6038 5555 DAIHATSU Taruna Thn. 2000/Jual Cepat. AC, Tape, VR, BR, PW, BK Mdn, sangat mulus, Tinggal Pakai. Mesin sehat. Hub. (061) 77731399 DAIHATSU TARUNA CSX THN. 99 Warna biru/silver met, AC, Tape, VR, BR, BK Mdn Asli, mesin sehat, Body sgt mulus, original. Jarang pakai. Harga 82,5 Jt. Hub. 0813 7618 8118

# DAIHATSU 100% BARU #

* Xenia DP: 11 Jt Terios DP: 13 Jt * Pick-Up DP: 5 Jt Luxio DP: 7 Jt Proses Cepat, Data dijemput + Hadiah Hub. Kalpin 0852 7041 9000 BAWA PULANG DAIHATSU BARU ANDA !!! Xenia hanya 10 Jt-an/Angsuran 2 Jt-an Terios DP 14Jt-an/Angsuran 3 Jt-an Luxio DP 6 Jt-an/Angsuran 3 Jt-an Pick Up DP 5 Jtan, dll. Ready Stock !!! Manda Astra Daihatsu SM. Raja Medan 0812 6316330 / (061) 66470080

DAIHATSU Taft GTS 1992 Asli BK Medan, Hitam/Mulus. Hub. 0878 6803 4537 DAIHATSU Zebra 1.3 Thn ‘94 W. biru muda, mulus spt baru/sgt cantik, jarang ada An. Sendiri dari Baru/BPKB 1 tgn/ standard/Hub. 061-7794 3668

Rp. 36.000 Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000

ISUZU Panther LM New Thn. 2005. AC, Tape, PS, Silver, BK Mdn Rp. 118Jt. Hub. 91144382 ISUZU Panther Hi-Sporty 25, Hijau ‘97, BK AC DB, PW CL, Jok Sm. Kulit, DP 20Jt. Angsuran: 2,14rb. Sisa 35x. Hub. AISYAH: 0813 7728 0512 ISUZU Panther Hi Sporty Thn. 97. Asli Mdn. AC Double, PW, PS, CL, TP, Full. Sound, CD, Cat Asli. W. Hijau. Jrg. Pakai. Hub. 061.6993 9763 TP ISUZU Panther thn. 95, Body mulus, mesin sehat, siap pakai. Harga 55Juta. BK Medan asli. Hub. 0852 6135 4779/ 061.77410109

KIA PAKET KETUPAT

PICANTO MATIC LIMITED EDITION “DP Rp. 6 Jt’an” CICILAN HANYA RP. 4,1 JT HANYA SAMPAI TGL. 7 SEPT ‘10 Berlaku untuk wilayah Medan sekitarnya Hotline Service: 0813.6165.1801

MITSUBISHI Kuda Diamond Diesel Thn. 2003. Merah Maron Met. BK Ex Mutasi Rp. 105 Jt. Hub. 0816 3113 953 MITSUBISHI L300 MB Sparta Thn 2005, Warna Biru, BK Medan, Velak Racing, BR, VCD, Power sub wofer, Mobil cantik, Siap pakai Hub. 0813.6150.3449

MITSUBISHI Eterna 92 35 Juta, nego. Hub. 061-9114 5520 # MITSUBISHI BARU #

Pajero Sport, Lancer, Grandis, Pick Up L300, Colt Diesel, Triton, Fuso, DP & Bunga rendah, Proses Cepat , Data Dijemput. Hub. 0852 970 12311 (Darma Jaya)

MERCEDES Benz E230 New Eyes, 97/ 98. BK Mdn Tgn-2. BK 2 Angka, 4 A. Bag, ABS, Cool Box, DP 25Jt. Angsuran: 4,1Jtx35. Hub. AISYAH: 0813 7728 0512

- DAIHATSU Sirion, W. Abu2 tua ‘07. Pjk 1 Thn, BPKB 1 tgn, BK Mdn - Tyt. Kjg LGX New Diesel ‘03. W. Hijau lumut, BPKB 1 tgn. Pjk. 1 thn. Mp3, PS, PW, CL, VR, BR, DB, Alarm. Hub. 7630 7755

OPEL Blazer 2005 mulus, hitam, orisinil. BK Medan lengkap. Siap pakai. 1 nama. Harga 90Jt Net. Hub. 0812 6477 946

PROMO LEBARAN DAIHATSU DP RINGAN

OPEL Blazer 97 Mulus, orisinil. Hitam, lengkap. Siap pakai. BK Medan H. 55 Jt. Hub. 0812 6477 946

Xenia DP 10Jt-an/Angs. 2 Jt-an Terios DP 14Jt-an/Angs. 3 Jt-an Gran Max PU & Luxio DP 5 Jt-an Hub. GERY 0813 7694 1988 / 061-77722561 Dapatkan Diskon & Penawaran Dibulan ini

DAIHATSU Xenia Xi Family 1.3 Thn ‘05 W. Hitam, Satu tangan, BK panjang, Mulus terawat baik, Siap pakai Hub. 0813.7016.6232 HONDA CIELO 96 Matic Vitec. Over Kredit Balik DP 24Jt. Honda Maestro 90 putih. Original, komplit, VR 18. Siap pakai. Hub. 0819 619919. Salah satu.

HONDA City M/T Thn. 2006 Hitam. Plat B. Rp. 133Jt. Hub. 0812 6594 2789 HONDA ACCORD PRESTIGE ‘87

BK Mdn asli, W. Putih Cat 95% Orisinil, Rp. 27 Jt/nego Hub. 0811.648.960

HONDA MAESTRO ‘90

BK Mdn W. Hitam, Sangat mulus, Rp. 42 Jt/nego Hub. 0852.6183.6680/ 7650.5129

HYUNDAI Accent 00/Black. Tangan pertama, Hrg. 58,5 Jt/Net. Hub. 0813 3440 9141 HYUNDAI Verna Thn. 2001, Silver, BK Mdn asli, lgkp TV, VCD, Audio, Kondisi bagus, siap pakai. Rp. 63Jt. Hub. 081 376 390 633

HYUNDAI New Accent 04. W. Hitam met. A/C, RT, VR, PW, Kond. Sgt mulus, BPKB A/n. Sendiri. BK Medan / Pjk Panjang. Hub. 0813 9672 1118

MERCY Boxer 90 - 230-E. BK Asli Medan, kondisi mulus. Hub. 061.9158 5545

SUZUKI Carry 86. W. biru, BK Medan, Siap pakai. 14Jt Nego. Carry 84 W. biru, BK Medan, Pajak Baru Bayar Bln 8, ban 80%. Tape + Power, ada palang atas lampu Stop. Mulus, mesin sehat, bisa jalan jauh. Mudik lembaran Hrg. 14 Jt. Nego. Hub. 0812 6496 881

SUZUKI Carry Minibus 87 BK Medan, warna biru, VR. HP. 0812 6460 8899

7 CM 8 CM

Rp. 91.000 Rp. 104.000

TOYOTA Kijang Innova Thn. 2008 Type-E Bensin. Hubungi: Katamso Elektronic. HP. 7869870 - 0811 619 608 TOYOTA Corolla SE Salon thn. 86. Silver, orisinil Rp. 28Jt. Nego. Hub. 061-77143432 TOYOTA Innova E 205 W. Kuning muda metalik. BK Medan H. 135Jt. Hub. 0818 18 4540 / 0813 6212 9905 TOYOTA Kijang Capsul Model LGX Bensin 1.8 Th. 2002. Mulus, orisinil, Full Acesories, VR, BR, PS, PW, CL, RMT, E. Miror, AC DB, Full Sound Sistem, Hrg. 116Jt Nego. Hub. 061.6967 9753

TOYOTA Kijang G Thn. 95 Wrn. Abu-abu. Metalik BK Medan, mulus, siap pakai. Betul terawat. Hub. 0813 96101 939 TOYOTA Kijang LSX Bensin thn. 2003. W. Hijau botol. BK Medan. Hub. 0812 6587 7895

9 CM Rp. 126.000 10 CM Rp. 140.000

Bursa

AKSESORIS MOBIL

POLES KACA Di Jl. Glugur Petisah, Petisah No. 18 M. Golden Medan. Hub. 061-9125 7035

‘MULIA JAYA’ POWER STEERING

- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954

TOYOTA Kijang Kapsul LSX Up Plush, Thn ‘99 Bensin, W. Biru, BK Medan, Lengkap, AC double, PW, PS, CL, PR, BR, Model LGX, Mulus, Original, B.U Hub HP. 0813.9795.1579 Medan

PT. SINAR MAS MULTIFINANCE. Jaminan Khusus BPKB sepeda motor bunga 1,5%, Discon, 1x cicilan Hub. 0812.656.8635

TOYOTA Kijang Commando Short, 6 Speed Thn ‘91 akhir, BK Medan lengkap, Siap pakai, Hrg 48,5 Jt/damai HP. 0812.649.1529

TOYOTA KIJANG 2002 (DIESEL)

Type LSX, Plat BK, Kondisi sangat terawat (TP) HP. 0812.6001.0001 DIJUAL MURAH 15Jt Mobil Angkot Lin Mdn - Delitua Hub. 0812 6077 0912 (Rudy)

Bursa

SEPEDA MOTOR

SUZUKI Carry ST 100 Thn ‘84/85 Dijual segera, W. Biru Metalic, Kondisi sangat mulus, VR, Ban baru, Rp.12,5 Jt/nego Hub. 0813.9642.3289

DIJUAL SEPEDA MOTOR MOGE

TOYOTA Kijang Grand Rover Diesel Thn. 98. AC Central, Tape, VR, PS, PW, CL, Jok kulit, BK Mdn Ex Mutasi Rp. 75 Jt. Hub. 0813 7508 8798

HONDA Supra X Th. 2001. Hitam, mulus, siap pakai. 5,6Jt/Ng. Hub. 0882617 83 780

TOYOTA Kijang Kencana Thn. 1996. AC, Tape, VR, PS, PW, CL, Abuabu met, BK Mdn Rp. 55 Jt. Hub. 91327433 Jl. Biduk 57

TOYOTA Starlet Thn. 1997 1.3 Dijual W. Merah tua. BK Medan. Hub. 0852 6239 3765

HONDA X-11, 1100CC TAHUN 2000 HUB. 0813.9689.1700

HOND A PR OMO LEB ARAN HONDA PROMO LEBARAN Revo 110 DP 700 Angs. 495 Supra X 125 DP 1 Jt Angs. 593 Blade DP 1 Jt Angs. 567 Beat DP 1 Jt Angs 527 Vario CW DP 1,5Jt Angs 604 Hub. 0812 6027 4771 / 061.76917181

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG: 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6409.1777

Jl. Sei Wampu 88 Medan TELP: (061) 4511.700

Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

Bursa

“H. MOHD. RAWAL”

Bursa

KOMUNIKASI M-Kios dan All Operator Dg.Harga. 5.4250/10: 9250/15: 14250 20: 19250/25: 24250/50: 47250 100: 91250

PUSAT PENGOBATAN SPESIAL ALAT VITAL

Bursa

PENGOBATAN

KOMPUTER

H/0812 3732 2403 - 081 211 650 123

HUB. 0816.314.5371 - (061) 9102.7176

SMS KE: 061-76 700 700 KAMI CARIKAN TERMURAH Luar Medan bisa Transfer

Latop baru: Cor2dvdrw14”/250 Gb +wcam=3.6jt Tv Lcd baru bisa monitor remot speker @997rb - HP. 0812 65-66-1579 Jl. rantang 20c Cpu baru (warnet) amd3200+/80/512@1,2jt (2core575rb-Mb=359rb)-250gb=359rb Lcd=698rb(G19”=1,1jt-acer19”=1,2jt.samsung19”=1,3jt (bisa tukar/tambah) Latop dell co2du=2xjt-compaq co2du=2xjt axio co2du=2xjt, ibm/compaq=1xjt Latop acer1co2tom=2xjt -as4520=2xjt, tos cor2dvd=2xjt.compaq=1xjt

Bursa

SUZUKI Vitara 4x4 Thn ‘92/93 Abu², BK Medan asli, Lengkap siap pakai, Harga 68 Jt/damai Hub. 0812.6545.1974

A. AMARUDIN

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

ANDA BUTUH DANA

RENTAL MOBIL

KIA TRAVELO (BISA 12 PENUMPANG)

SABANG TRAVEL

Menjual Tiket Pesawat Dalam dan Luar Negri

Jaminan Apa Saja, Sertifikat Tanah. Spd. Motor, Take Over Mobil. Hub. 061-8222774, HP. 0816 314 1807

SUZUKI Aerio M/T Thn. 2003 Hitam. BK Mdn Rp. 88Jt. Hub. 0856 6450 1214

DISEWAKAN HARIAN/ MINGGUAN

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

BUTUH DANA CEPAT

DIJUAL PULSA MURAH

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

Bursa

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633

ANGKOT KPUM 48 Dijual. Lin P. Mandala - P. Martubung. Espass Thn. 97. Harga Rp. 22 Jt. Hub. 0811 619 601

PU 1.5 DP 10 Jt-an. Angs. 2 .946.300,APV DP 12 Jt-an Angs. 4.830.000,NB: Proses mudah & cepat data dijemput Hub. 0812 654 0809 / (061) 77722121

HARGA BELUM TERMASUK PPN 10%

BUTUH DANA

SUZUKI Baleno Next G. Th. 2003. Warna hitam, BK Medan, mulus. Mesin halus (Br. Service). Harga nego. Hub. 0812 609 7164

DEALER RESMI SUZUKI MOBIL.

FAX.4561347

TRAVEL/WISATA

BUTUH DANA Jaminan BPKB Mobil sepeda motor, Becak. Bunga 1,5%. BPKB Aman, Data Dijemput, Proses Cepat. HP. 061.66477734, 0813 9779 1077 Maaf TP

TOYOTA Kijang Tahun 1996 warna putih, super standard, body kaleng, jual cepat (BU). Hub. 0813 6112 9222

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

ANDA BUTUH DANA TUNAI

TOYOTA Kijang Krista Diesel Thn. 2000. BK Mdn, W. biru. Toyota Avanza Tipe S. 1.5 BK Lbhn. Batu. W. Hitam. Peminat Hub. 061.77756099

TOYOTA Kijang LGX 2002 Diesel, kondisi 90% mulus. Harga 120Jt. Hub. 0813 7017 9722

11 CM Rp. 165.000 12 CM Rp. 180.000

Senin, 6 September 2010

Harian

WASPADA Tempat Iklan Anda

SPECIALIST AMBEYENT TANPA OPERASI PUTUS SAMPAI KE AKAR2NYA DIJAMIN TDK SEMBUH UANG KEMBALI GARANSI

Ciri2 Ambeyen: Disekeliling Dubur Ada Benjolan Seperti Daging Tumbuh/Jerawat, Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur Seperti Luka, Solusinya Datang dan Berobatlah ke

“H. MHD. RAWAL”

Pelanggan Yang Terhormat HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli TI-HA TI apabila anda ingin produk anda, dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih

BUKA AGEN TIKET PESAWAT DOMESTIK DAN INTERNATIONAL, ONLINE, PRINT TIKET SENDIRI, PROFIT TINGGI,RENT CAR, RESERVASI HOTEL, MODAL 300RB SAJA, DAFTAR klik www.spt.suryaprimatour.com CALL/SMS DANIS 081328674378, 085640620478

SARANG WALET GOA/ GEDUNG

SPECIALIST MATA TANPA OPERASI

Dicari Getah Jernang Asli/ Mutu Super, Jumlah tidak terbatas Hub. 0811.633.982

Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll

Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan sampai tuntas, Insya Allah Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar web: ffaridar aridar awal.com aridara

HILANG/TERCECER TERCECER/HILANG

Telah tercecer/Hilang sebuah BPKB mobil Rocky warna hitam, BK 96FJ. atas nama Ir. Jeremias Sinaga dikawasan Helvetia Medan. Bagi yang menemukan diminta mengantarkan ke Jalan Beringin Tengah No. 56 Helvetia Medan. Dan akan diberikan hadiah sepantasnya.

Service

GETAH JERNANG

BUTUH MINYAK TANAH NON-SUBSIDI???

HUBUNGI: UD. TUJUH PULUH AMT PT. PERTAMINA RETAIL I JL. SM. RAJA KM 5,5 NO. 10 (DEPAN UNIVA) TELP. (061) 788.2870 / 0813.9796.6059 MEDAN Harga Ter Murah

Model Terbaru

KONSTRUKSI

WC

TUMPAT/ SEDOT

77442112

Jl. Gatot Subroto Medan Ada Garansi

WC 0812 642 71725

MOBIL SEDOT

PAK ADI

Jl. BRAYAN MEDAN

HP.

WC TUMP TUMPAAT, Sal. AIR, K. Mandi Tel. 081361718158, 0813 6230 2458 NARO SERVICE Jl. Sisingamangaraja

WC

TUMPAT/ PENUH HUB: 7870341 K. Mandi. Westafel, Dll SM. Raja BERGARANSI

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663

NB. MOBIL BISA MASUK/ GARASI PAKEM. B-346/DSP.5/11/2008

Service

Jl. Prof. H.M. Yamin S.H No. 251 A Simpang Pahlawan Tel.(061) 4563067 Cabang I

Jl. Bunga Harum (Benteng) No. 26 Suka Jadi Telp. 0761-45368 -HP. 0812 6568 700 Pekan Baru Telp. (0761) 45368 HP. 0812.656.8700 Cabang II: Komp. Perhub. Laut Jl. Baruna II/II Telp. 0765 36906 HP. 0852 6201 0594, 0812 60311 695 Dumai

ASLI DARI BANTEN

Bursa

PELUANG BISNIS PELUANG USAHA

Dicari/ mau beli sarang walet GOA/ Gedung Hub. 0811.633.982

PUSAT:

DITANGANI LANGSUNG

BPK. HARYONO Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

KRISNA WATER

PELUANG BISNIS 1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & Ro Rp. 22 Jt s/d 38Jt 2. Air Pegunungan 6700 s/d 7000 Liter Rp. 230.000 / Tangki Menyediakan Mesin RO dan Yamaha Hubungi:

ELEKTRONIK

AC AC

MANDIRI TEKNIK

Reperasi, Service, Spare Part AC, Kulkas, Mesin Cuci 061.7676 4660: 0812 6557 521

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat

AHLI

TV

TV

Samsung, LCD, LG, Sharp TOSHIBA Polytron, Sony, TCL, Dll Siap ditempat & Bergaransi MASTER TV, 77621674

RIDWAN AHLI TV PROF. 0812 6303 4400 RUSAK?

Toshiba, Sony, Digitec, Polytron, LG, dll Hub. PRIMA TV - 0813 7629 5870 Siap Ditempat - Garansi

SERVICE GAS Kompor + W. Heater GAS Hub. AHOK 77770544

Bursa

BUSANA/ ACCESORIES

PECI MURNI TEMPAHAN ISTIMEWA H. ADAM AKIL HSB

BUKA: 08.00-22.00 WIB Jl. Setia Budi No. 49 A 8223975

PECI MAHKOTA MENJUAL PECI TEMPAHAN Berbagai Model Dan Warna

Jl. Prof. H.M. Yamin SH. No. 340 / Jl. Serdang Dibuka Sampai Jam 10 Malam Depan Gg. Sado Medan

Bursa

ALAT MUSIK

4525462

CV. HYDRO UTAMA

Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410

MINI & EFEKTIF IKLANKAN PRODUK ANDA

Bursa

ALAT PENGAMAN

FD CD

KIRIMKAN... DATA IKLAN MINI ANDA

DALAM BENTUK

DIGITAL

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)


Ekonomi & Bisnis

WASPADA Senin 6 September 2010

H-5, Harga Daging Sapi Dan Ayam Kembali Melonjak MEDAN (Waspada): Lima hari (H-5) menjelang lebaran 1 Syawal 1431 H, harga daging sapi dan ayam broiler kembali melonjak tajam setelah terbatasnya pasokan dari pihak penyalur di rumah potong hewan (RPH) dan peternakan ke pedagang pengecer di pasar tradisional, Minggu (5/9). Harga daging ayam pekan lalu masih bertengger di posisi Rp18 ribu per kg, naik menjadi Rp25 ribu per kg di Pasar Sambas. Sementara itu di Pusat Pasar harga daging ayam broiler naik menjadi8 Rp23 ribu per kg.

Harga daging sapi di Pusat Pasar, Pasar Petisah dan Pasar Sambas juga telah mengalami kenaikan rata-rata mendekati Rp70 ribu per kg, sementara itu pekan lalu harga daging sapi di Pusat Pasar masih berada di posisi Rp65 ribu per kg. Menurut MJ salah seorang pedagang daging sapi di Pusat Pasar naiknya harga daging sapi saat ini akibat dibatasinya pasokan dari pihak penyalur atau distributor ke pedagang pengecer. Sementara itu minat masyarakat terhadap daging sapi menjelang harai besar keagamaan khususnya menjelang lebaran semakin meningkat tajam, sehingga harga daging sapi setiap harinya selalu mengalami peningkatan, sebutnya. Disamping terbatasnya pasokan, penyediaan sapi untuk kebutuhan daging di Medan

saat ini didominasi sapi impor dari Australia setelah mengalami proses penggemukan oleh importir dan petani lokal lalu dijual ke pedagang pengecer, ujarnya. Sedangkan pasokan sapi lokal saat ini semakin sulit dan harga jualnya lebih mahal dibanding daging sapi dari Australia sehingga para pedagang lebih banyak melirik daging asal sapi impor tersebut. Harga daging ayam di Pusat Pasar Medan kembali naik secara berkala, setelah turun menjadi Rp17 ribu per kg saat ini kembali menjadi Rp24 ribu per kg. Diperkirakan harga daging ayam saat H-1 akan melonjak mendekati Rp30 ribu per kg. Menurut Siregar salah seorang penjual daging ayam broiler di Pusat Pasar mengatakan, harga daging ayam

Qatar National Bank, Bank Kesawan Teken Kesepakatan MEDAN (Waspada): Seiring strategi Qatar National Bank (QNB) melakukan pengembangan bisnis secara global, barubaru ini, QNB telah melakukan penandatangan Surat Kesepakatan dengan PT Bank Kesawan, Tbk (Bank Kesawan). Dalam kesepakatan tersebut disebutkan bahwa QNB akan menjadi Pembeli Siaga (“Standby Buyer”) pada Penawaran Umum Terbatas (“Rights Issues) yang akan menjadikan QNB sebagai pemegang saham pengendali Bank Kesawan. “Saat ini Bank Kesawan sedang melakukan persiapan administrasi dan regulatory untuk pelaksanaan penawaran umum terbatas untuk memperoleh dana sebesar Rp730 miliar untuk lebih memperkuat lagi struktur permodalan yang akan memberikan keleluasaan

dalam menyelaraskan objektif bisnisnya,” jelas Gatot Siswoyo, Direktur Utama Bank Kesawan dalam siaran persnya Minggu (5/9). Dengan kerjasama ini, Bank Kesawan akan dapat lebih mempertajam rencana bisnisnya serta melakukan penyelarasan dari aspek sistim prosedur, manajemen risiko yang mengacu kepada standar “best practice” secara global. Kedua belah pihak, yaitu QNB dan Bank Kesawan juga sepakat untuk merealisasikan kesepakatan ini setelah seluruh proses administrasi rampung dan diperolehnya persetujuan dari instansi terkait termasuk rampungnya proses due dilligence dengan menunjuk pihak ketiga yang independen. Saat ini Bank Kesawan memiliki 34 jaringan kantor

PROGRAM MAGISTER SASTRA PROGRAM STUDI SASTRA INGGRIS

FAKULTAS SASTRA UISU (TERAKREDITASI) JL. KARYA BAKTI NO. 34 MEDAN JOHOR TELP. (061) 7784.3302 - 0813.6175.9371 0812.6044.9749 - 0812.6596.483 BERDIRI SEJAK 2004

MENERIMA MAHASISWA BARU T.A. 2010/ 2011 TAMATAN S1 SASTRA INGGRIS/ LINGUISTIK/ PEND. BAHASA INGGRIS Biaya Kuliah : Rp. 3.000.000/ Semester Hari/ Jam kuliah : Jumat (14.00-21.00 WIB) Sabtu (08.00-17.00 WIB) Pendaftaran : 20 September s/d 30 Oktober 2010

Dekan, Ketua Prodi, dto dto Prof. Drs. Jumino Suhadi, MA, Ph.D. Drs. H. Darman Sitepu, MA

Bursa

PENDIDIKAN

POLITEKKES YRSU Dr. RUSDI JURUSAN FISIOTERAPI PRODI D - IV FISIOTERAPI (Sarjana Saint Terapan)

PELOPOR PENDIDIKAN FISIOTERAPI DI SUMATERA

Menerima Mahasiswa/I Baru T.A. 2010/ 2011

Pendaftaran dimulai dari sekarang s/d September 2010 Informasi/ Pendaftaran: 1. KAMPUS A Jl. H. Adam Malik, No. 140-142 Telp. (061) 661.4941 2. KAMPUS B Jl. H. Sutan Oloan No. 1 Pondok Surya Telp. 846.4282 08.00-15.30 Wib Setiap Hari kerja CP: 0812.6445.0973 - 0852.9725.2579 0813.6220.5812

Bursa

LOWONGAN KERJA

BUTUH SGR

APOTEK 24 JAM BUTUH APOTEKER ASISTEN APOTEKER LAMARAN KIRIM: JL. DR. MANSUR UJUNG NO. 1 (SEBELAH PT. ADHY KARYA) MEDAN 20122 VIA POS

LOWONGAN KERJA KE MALAYSIA BIDANG ELEKTRONIK (OPERATOR PRODUKSI)

Perusahaan GLOBETRONICS SDN.BHD (Company) yang berada di Bayan Lepas Penang & Kuala Lumpur Malaysia, memerlukan pekerja perempuan sebagai Operator Pengeluaran Dengan persyaratan sebagai berikut: 1. Perempuan berumur antara 19 - 28 tahun 2. Pendidikan SMA/ sederajat 3. Kotnrak kerja 2 tahun 4. Mendapat izin dari orang tua/ keluarga Fasilitas dan Gaji 1. Gaji memuaskan 2. Ada tunjangan kehadiran, shift, kemahiran & lembur 3. Levi disubsidi 4. Asrama, transport dan rumah sakit disediakan 5. Dilindungi oleh asuransi selama bekerja Testing & Interview dilaksanakan pada tanggal 21 September 2010 Jika berminat ssegera mendaftar dengan membawa fotocopy Ijazah, KTP dan pasphoto masing-masing 2 lembar dapat diantar langsung ke alamat berikut:

PT. SAHARA FAJARINDO CORP JALAN KANGKUNG NO. 61 MEDAN 20153 (BELAKANG GEDUNG BUMI PUTERA DI JLN ISKANDAR MUDA) TELP. (061) 415.7621 - 455.1305

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

DIBUTUHKAN

Guru Pesantren yg sudah berkerluarga mahir Bahasa Arab/ Inggris, bersedia di temaptkan di Pondok Pesantren, Pendidikan min S1 Antar lamaran lengkap ke: Jl. Karya Bakti No. 103 Medan Johor HP. 0852.751166 - 0813.6104.3334 Bu Aisyah

DICARI AGEN PEMASARAN Sepatu, Harga Pabrik, Keuntungan s/d 100%, Info lihat di: gandielshoes.blogspot.com 0813.2121.2727 (Tdk SMS)

DIBUTUHKAN DRAFTER & TUKANG BUBUT

Sebuah Perusahaan yang bergerak dibidang Industri Permesinan membutuhkan:

A. 2 orang Tenaga Drafter B. 2-3 orang Tenaga Tukang Bubut

Dengan ketentuan: 1. Laki-laki (A, B) 2. Umur 20 thn - 30 thn (A) 3. Umjur 25 thn - 40 thn (B) 4. Minimal tamatan STM & sederajat (A, B) 5. Mahir dalam menggunakan AUTO-CAD 3D dan Microsoft Office (A) 6. Diutamakan yang berpengalaman (A) 7. Berpengalaaman dibidang bubutan minimal 3 tahun (B) Yang berminat harap mengirimkan: 1. Surat lamaran ke PT. KKS 2. Daftar Riwayat Hidup 3. Pasphoto warna 4x6: 2 lbr 4. Gaji yang dinginkan Harap menghubungi HP. 0812.6422.0116 Paling lambat 1 minggu setelah iklan ini terbit

Bursa

PROPERTY Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

RUMAHDIJUAL/ B.U

Siap huni di Griya Martubung 1½ Tkt Jl. Tempirai Sejati No. 184 Block VI Lbr 17 Panjang 12, 4 KT, 1 KP, Fasilitas Gas alam, PLN, PAM, Harga Rp. 185 Jt/nego Hub HP. 0812.6013.4738

RUMAH DIJUAL JL. SAKURA I NO. 20 TANJUNG SELAMAT Tanah 228m, Bangunan 5x15 2 Kamar Tidur, Listrik 900 W Telp. (061) 7728.0227 0812.6554.4579

cabang yang tersebar di seluruh Indonesia, dengan total aset sekitar Rp2,3 triliun per 30 Juni 2010, dan shareholders’ equity sebesar Rp180 miliar dengan tingkat CAR sebesar 12 persen. Arqaam Capital, sebuah lembaga yang bergerak di investment banking dan berbasis di Timur Tengah telah ditunjuk Bank Kesawan pada Juli 2010 yang lalu untuk memfasilitasi perjanjian ini khususnya dalam melakukan pendekatan kepada calon pembeli siaga guna mendukung rencana bisnis Bank Kesawan kedepan. Kedua belah pihak telah sepakat memberikan informasi tentang kesepakatan ini kepada para pemangku kepentingan (Stakeholders) melalui media. Diharapkan kesepakatan ini dapat terealisasi pada kuartal I di 2011.(rel)

selama sepekan terus mengalami peningkatan, dikhawatirkan mendekati Rp30 ribu per kg menjelang H-1 lebaran. Naiknya harga ayam tersebut akibat meningkatnya permintaan masyarakat dan para pedagang pengecer ke pihak peternakan ayam sehingga

Ribuan Pedagang Jamu Mudik Gratis

harga ayam telah mengalami kenaikan di tingkat distributor, sebutnya. Kondisi tersebut telah mendorong peningkatan harga jual ayam setiap harinya di tingkat pengecer, akibatnya harga selalu mengalami fluktuasi setiap harinya.(m40)

Kebutuhan Daging Di Kisaran 1 Ton Per Hari KISARAN (Waspada): Kebutuhan daging di Kota Kisaran menghadapi lebaran mencapai 1 ton per hari, namun kebutuhan itu dapat terpenuhi lokal, sehingga tidak perlu mengambil dari luar daerah. “Bila satu hari sebelum lebaran maka kebutuhan daging sapi meningkat mencapai 1 ton per hari sehingga otomatis harga naik Rp75 ribu - Rp80 ribu per kg,” ungkap pedagang daging di Pasar Tradisional di Jalan Diponegoro, Kisaran, Hanfi Harahap ditemui Waspada, Minggu (5/9). Sedangkan untuk kebutuhan selama Ramadhan ini, kebutuhan daging sapi meningkat dari biasanya mencapai 800 ribu per kg, dengan harga yang masih normal Rp 65 Ribu per kg. “Tapi syukurlah kebutuhan itu dapat terpenuhi, dan tidak

perlu mengambil dari luar daerah, apalagi dari luar negeri, karena di Asahan banyak peternak sapi, sehingga warga tidak terlalu khawatir tidak kebagian daging sapi,” ungkap Harahap Sama halnya dengan penjelasan yang diungkapkan pedagang ayam potong di pasar yang sama, Linda menyatakan kebutuhan ayam potong ikut juga meningkat mencapai 1 ton per harinya, saat satu hari lebaran, dan peningkatan itu akan di dampingi dengan bnaiknya harga Rp20 ribu- Rp 22 ribu per kilo, yang sebelumnya harga saat ini hanya Rp 18 ribu per kg. “Bila sudah lebaran kebutuhan daging pasti akan melonjak tinggi namun itu diikuti dengan harga yang ikut juga meningkat, sehingga diharapkan warga bijak dalam belanja saat lebaran,” Linda. (csap)

Banyak Warga Tebus Barang Di Pegadaian RANTAUPRAT (Waspada): Menjelang Hari Raya Idul Fitri 1431 H yang sudah semakin dekat, nasabah Pegadaian Rantauprapat ramai-ramai menebus benda berharga berupa emas yang digadaikan. Hal ini pun berbanding terbalik dengan suasana pegadaian di wilayah lain ketika menjelang lebaran. “Menjelang hari raya ini banyak mereka (nasabah) menebus barang karena saya perhatikan sejak seminggu puasa nasabah mulai menebus barang,

fenomena ini yang berbeda dari daerah lain,” kata Iswandi, Kepala Perum Pegadaian Rantauprapat, Jumat (3/9). Omset Pegadaian, lanjutnya, tidak mengalami kenaikan yang signifikan, karena volume nasabah yang menebus dan menggadaikan barang berbanding 30 persen. “Artinya jika ada tujuh nasabah yang menggadaikan barang dalam satu hari itu juga ada sepuluh nasabah yang menebus barangnya,” kata Iswandi. (c01)

RUMAH DIJUAL

Jl. Amal No. 56 Medan Sunggal, LT. 6x30m, LB. 5x24m, Surat Sertifikat Hak Milik, Hrg 290 Jt/damai Hub. 0813.6213.1218/ B.U

DISEWAKAN

Rumah Komp. Tasbi I Blok HH No. 23, 3 KT, 1 KM, RT, Carport, Khusus muslim Hub. 0812.6913.0459 (061) 414.9371 DIK ONTRAKKAN CPT MURAH DIKONTRAKKAN

1 Rmh, Cantik, Besar Jl. Bahagia No. 63, Teladan Tim, 4 K. TIdur, 2 K. Mandi, PAM, Listrik, Rp. 12 Jt/ thn, Rp. 20 Jt/ 2 thn 1 Rumah Cantik Jl .Bahagia No. 63A, 3 K. Tidur, 2 K. Mandi, PAM, Listrik, Rp. 7 Jt thn, Rp. 12 Jt/ 2 thn dan Materan PAM tersendiri, 200m dari pusat Pertokoan dan hunian Cina The Fortune Wellcome langsung Waiting you, Thanks Pemilik

RUKO 2 PINTU DIJUAL

PERUMAHAN TERLARIS DI KOTA BINJAI HUNIAN DI DALAM TAMAN

UMAR BAKI RESIDENCE

(Akses langsung Jl. Umar Baki Jend. Sudirman Binjai) Tinggal 3 unit dari 23 unit (bonus THR senilai 10 Jt + Bingkisan lebaran) Cp. Fitri: 0813.7533.5853 - Maya 0812.6082.0303

PROMO LEBARAN..!!!

DISKON BESAR-BESARAN, HARGA MIRING Sofa Tamu 321.............Rp. 1.300.000 Sofa Tamu 211.............Rp. 1.000.000 Sofa Tamu L..................Rp. 1.300.000 Model dan warna bervariasi !! dan tersedia kursi tamu jepara asli & lemari kristal Jepara asli, Buruan..!!! Hub. (061) 7653.2188 - 661.6802 - 661.8116

Harian

BAMBU PRANCAH DIJUAL

Bagi yang berminat dapat memesan sama kami, Dalam partai kecil/ besar Hub HP. 0813.6374.2952

WASPADA Bursa

MATERIAL BANGUNAN

TANAH TANAH UNTUK DIJUAL 1 bidang Tapak perumahan luas lebih kurang 800m² (32x25m) di Kpng Setia. Ling III Perluasan Timur Kel. Serbalawan, Kec. D.B. Nanggar, Kab. Simalungun, Harga tanah 200 Jt (Rp), 1 lagi tapak perumahan sama lebar yg sama dan didaerah yg sama, tanah bersebelahan, Harga 200 Jt (Rp) Hubungi Yunihar Telp. 0813.6247.9061

DIJUALCEPAT/ B.U

Tanah Uk. 15x20m, Jalan Panglima Denai Gg. Ilham No. 5 Medan Hub. 0813.7098.9802 (TP)

Bursa

PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

JAKARTA (Waspada): Sebagai bentuk kepedulian dan ucapan terima kasih kepada para pedagang jamu, PT Sido Muncul kembali menyelenggarakan kegiatan Mudik Gratis Bersama Pedagang Jamu seJabotabek. Kegiatan Mudik Gratis yang ke-21 kalinya ini diadakan di area parkir barat, Pekan Raya Jakarta (PRJ) Kemayoran Jakarta, Minggu, (5/9). Para pemudik dilepas Menteri Perhubungan Republik Indonesia Freddy Numberi, Menteri Tenaga Kerja Muhaimin Iskandar, Menteri Kordinator Bidang Kesejahteraan Rakyat Agung Laksono, Menteri Negara Pemberdayaan Perempuan dan Perlindungan Anak Linda Amalia Sari, Gubernur DKI Jakarta Fauzi Bowo dan Kepala Badan Pengawasan Obat dan Makanan (POM) Dra Kustantinah. Seperti tahun-tahun sebelumnya, pelepasan pemudik dihibur bintang-bintang iklan Sido Muncul seperti Donny Kesuma, Rieke Dyah Pitaloka, Lula Kamal,Yuni Shara dan artis lainnya. Para pemudik juga diberikan berbagai hadiah hiburan. Kegiatan mudik gratis ke21 yang diselenggarakan oleh PT Sido Muncul diikuti sekira 18.000 pedagang jamu seJabotabek beserta keluarganya dan para pedagang asongan. Dengan menggunakan 280 unit bus, keberangkatan para pemudik secara serentak akan diberangkatkan dari Jakarta, Bandung, Bogor, Tangerang dan Cikampek dengan tujuh kota tujuan yaitu Cirebon, Kuningan, Tegal, Banjar Negara, Solo, Wonogiri dan Yogyakarta. Kegiatan mudik gratis Sido Muncul bersama pedagang jamu se-jabotabek dimulai sejak 1991. Sebagai pionir kegiatan Mudik Gratis, Sido Muncul akan terus melakukan tradisi ini. Awalnya kegiatan mudik ini hanya untuk para pedagang jamu bersama keluarganya. Namun seiring waktu berjalan sejak 2004 bersamaan dengan adanya divisi baru (divisi food) di Sido Muncul, mudik gratis juga diikuti pedagang asongan yang menjual produk-produk Sido Muncul. Direktur Utama PT Sido Muncul Irwan Hidayat mengatakan selain telah menjadi tradisi perusahaan dan bagian dari ucapan terima kasih kepada para penjual jamu, acara mudik gratis ini sebagai bentuk partisipasi untuk membantu pemerintah dan masyarakat dalam menyelenggarakan lebaran. Sebagai perusahaan jamu

Waspada/Ist

MUDIK GRATIS PEDAGANG JAMU: Suasana pelepasan sekira 18.000 pemudik dari kalangan pedagang jamu di Jakarta, kemarin. Mereka dilepas oleh beberapa orang menteri yang menyempatkan diri hadir di acara tersebut. dan farmasi, Sido Muncul melalui produk-produk unggulan Tolak Angin dan Kuku Bima Energi pada bulan Ramadhan ini terus mensosialisasikan produk-produknya dengan kegiatan CSR yang dilakukannya. Bersama Kacang Dua Kelinci, Tolak Angin berbagi kasih dengan 5000 anak panti asuhan di 5 kota di Jawa Tengah, Semarang, Kendal, Purwodadi, Kudus, Wonosobo dan Yogyakarta dengan memberikan bantuan senilai Rp150 Juta. Di Jakarta, Tolak Angin kembali berbagi kasih bersama

2000 anak panti asuhan dengan memberikan bantuan Rp150 Juta. Bantuan lain juga diberikan oleh Sido Muncul untuk masyarakat tidak mampu dan lembaga sosial di wilayah NTT sebesar Rp370 Juta saat peluncuruan iklan terbaru Kuku Bima Energi dengan tema budaya versi Kolam Susu. Untuk para pengungsi meletusnya gunung Sinabung Sido Muncul kembali memberikan bantuan senilai Rp200 Juta yang diserahkan melalui Menko Kesra Agung Laksono dan Posko pengungsian.(rel/m13)

Lebaran, Carrefour Tetap Buka

DIJUAL CEPAT

Rumah Permanen Jl. Perjuangan No. 17 Tanjung Sari Medan, Pinggir jalan LB. 110m², LT. 150m², Cocok utk tempat usaha Harga nego Hub. 0813.9684.3780

Uk. 10x28m², 2½ Lantai, Harga Rp. 900 Jt/ bisa nego) Jl. Denai No. 81 (5 Rumah dr Sp. Mandala By Pass) Hub. 0852.7075.7571 0852.7550.1504

C7

Harian

WASPADA Mau Menjual Rumah, Tanah, Kendaraan, Barang

Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:

Harian

WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347

MEDAN (Waspada) : Selama libur lebaran pusat perbelanjaan Carrefour di Medan tetap akan buka meski tak sepenuh hari biasa. Pada tanggal 10 September diperkirakan jatuhnya Hari Raya Idul Fitri, jaringan hipermarket asal Perancis tersebut baru buka mulai pukul 13.00 s/d 22.00. Begitupula sehari menjelang lebaran, Carrefour buka seperti biasa jam 09.00 tutup pukul 20.00. Namun demi mengantisipasi lonjakan pelanggan berbelanja menjelang lebaran, mulai tanggal 5 s/d 9 Se p t e m b e r h i p e r m a r k e t tersebut buka mulai pukul 09.00 s/d 24.00. Store Manager Carrefour Citra Garden, Achmad Fauzi didampingi Store Manager Carrefour Medan Fair, Mursalim di Medan, Sabtu (4/9) menyatakan hal ini untuk mengantisipasi lonjakan pembelanjaan umat muslim dikota Medan menjelang hari besar keagamaan. “Hal ini merupakan bagian dari layanan kami,” ujar Mursalim usai pelepasan dua truk bantuan berupa sembako dan peralatan mandi dari Carrefour diperuntukkan para pengungsian korban Gunung Sinabung,

Waspada/Hamzah

Store Manager Carrefour Citra Garden, Achmad Fauzi didampingi Store Manager Carrefour Medan Fair, Mursalim di Medan melepas bantuan sembako dan keperluan mandi kepada pengungsi korban bencana Gunung Sinabung, Kabupaten Karo. Kabupaten Karo. Dia melanjutkan menjelang lebaran angka jumlah pengunjung mencapai tiga puluh lima persen lebih banyak dari hari biasa. “Begitupun kita tetap memberikan diskon hingga 50 persen dengan gebyar midnight sale bertujuan untuk memberikan kepuasan terhadap pelanggan,” lanjutnya. Sementara Achmad Fauzi melanjutkan selain memberikan diskon menjelang hari besar keagamaan Carrefour juga

peduli dengan korban bencana alam dengan memberikan bantuana kemanusiaan. Sementara Camat Medan Baru Rislan Indra didampingi Lurah Titi Rantai Harry I Tarigan ISTP mengungkapkan, bantuan adiberikan pihak Carrefour kepada korban gunung Sinabung adalah bentuk kepedulian masyarakat dan pengusaha dari Medan Baru. “Semoga bantuan sembako ini sampai ke tujuan dan dapat dimanfaatkan dengan baik oleh para pengungsi,” tegasnya. (m38)

XL Siap Hadapi Mudik MEDAN ( Waspada): XL telah menyiapkan secara penuh infrastrukturnya dengan menaikkan kapasitas jaringan hingga dua kali lipat menghadapi lonjakan traffic selama masa mudik dan Hari Raya Idul Fitri 1431H. Francky Rinaldo PakpahanGeneral Manager Sales Northern Sumatera didampingi Haris Muda Dalimunthe-Manager Optimalisasi jaringan berbicara dengan wartawan Jumat (3/9) sore usai melakukan drive test menyebutkan, dari hasil pelacakan ke lapangan, tim telah menyatakan kesiapannya menghadapi lonjakan percakapan, SMS maupun data, ujarnya.

Francky Pakpahan memperkirakan peningkatan pengiriman SMS menjelang lebaran bakal meningkat sampai dua kali lipat. Tidak cuma SMS, tapi juga percakapan maupun data dipastikan terjadi juga pergerakan signifikan sampai suasana mudik berakhir. Dari hasil drive test dilakukan di beberapa ruas jalan kota Medan dengan melewati gedung-gedung tinggi, jaringan XL tetap mampu melakukan panggilan dengan cepat dalam sistem komunikasinya tercatat angka 65,94 untuk GSM dan 64,5 di jaringan 3G. Uji jaringan dilakukan untuk memastikan semua

layanan XL bisa dimanfaatkan secara maksimal lebih 900 ribu pelanggan di kota Medan selama Ramadhan dan Lebaran ini diperkirakan bakal digunakan 10 juta panggilan permenit setiap harinya dan 50 juta pengiriman SMS dilakukan 5 juta pelanggan di Sumbagut. Pada uji jaringan ini, XL melakukannya dengan menggunakan mobile yaitu menumpang kendaraan bergerak memakai peralatan dan metode standar diakui secara regulasi. Pengukuran dilakukan untuk mengetahui kekuatan dan kualitas sinyal di sepanjang jalur dilalui pada layanan 2G dan 3G dari voice call dan SMS. (m09)


C8

Ekonomi & Bisnis Arus Mudik Jelang Membidik Pergaulan Lebaran Meningkat

Inspirasi Bisnis

JIKA dalam sebulan, jumlah kartu nama baru yang anda koleksi kurang dari satu kotak, waspadalah. Bisa jadi anda sedang membuang waktu dengan sia-sia. Saya fikir, tak hanya untuk praktisi bisnis, siapapun yang berpotensi mendapat manfaat dari pergaulan dan pertemanan, seharusnya mematok diri untuk bisa bertemu dan bergaul dengan sebanyak-banyaknya orang lain. Tiap hari bertambah kawan baru. Tiap hari kawan yang lama semakin dekat dan semakin akrab. Sebagai mahluk sosial, kita membutuhkan banyak orang yang bisa mendukung dan memudahkan kehidupan kita. Dengan pemikiran semua orang pasti memiliki keistimewaan yang bisa bermanfaat, maka kita harus bertemu dan berteman dengan siapa saja. Tak usah memilih untuk bertemu dan berkawan pada awal mulanya. Biarkan saja seleksi alam memilihkan bagi anda, mana diantara mereka yang cocok dan baik untuk anda. Tidak semua jaringa itu akan memberikan anda uang langsung, tapi mereka bisa jadi adalah perantara dan pendukung bisnis yang bagus. Sebutlah orang baru yang anda temui adalah pekerja di sebuah percetakan, dari pekerja itu anda bisa mendapat ilmu dan trik-trik mencetak yang murah dan bagus. Mungkin anda berteman dengan seorang pegawai negeri yang bekerja di bagian tata kota yang notabene bukan segmen pasar yang anda bidik, tetapi tunggulah hingga suatu saat anda akan berurusan dengan izin mendirikan bangunan dan apapun yang berhubngan dengan regulasi penataan kota. Disaat itulah anda akan merasakan keuntungan pernah berkenalan dengan pegawai negeri itu. Mungkin anda mendapatkan teman baru, seorang teller bank yang tidak berhubungan dengan bisnis anda saat ini. Tunggulah hingga anda bisa terbebas dari antrian yang panjang di bank, kemudahan mendapat informasi dari bank dan info-info istimewa tentang kebijakan bank. Pada saat itulah anda akan terasa disayang Tuhan karena anda mengenal seorang teller bank. Coba bayangkan jika anda mengenal seorang direktur bank, kepala polisi, petugas pemeriksa pajak, kepala desa, camat, bupati, pemilik grosir pakaian jadi, importir, pengelola swalayan besar, atau artis terkenal. Saya yakin anda bisa membayangkan potensi-potensi dukungan apa yang bisa didapatkan atas kedekatan itu. Ilustrasi saya dengan satu kotak kartu nama yang biasanya berisi 100 lembar kartu adalah gambaran ideal terendah untuk mengasilkan jaringan luas dan potensial. Sebutlah anda bergaul selama 25 hari dalam 1 bulan, maka idealnya rata-rata anda harus bertemu empat yang baru setiap hari. Ya, empat orang baru setiap hari, tanpa meninggalkan kawan lama dan kawan yang baru bertemu kemarin. Menyebutkannya sangat mudah, tetapi memerlukan keteguhan hati untuk bisa melakukan hal itu. Konon selama ini hanya salesman yang tangguh, pekerja sosial dan politisi saja yang biasanya bisa melakukan pekerjaan ini. Tetapi saya yakin, siapapun bisa mengerjakan hal ini dengan baik, asal memang fokus, bersunguh-sungguh dan benar. Dari pengalaman saya diarea penjualan saya mencatat halhal penting berikut ini: Target Benar bahwa siapapun orangnya akan tetap ada manfaatnya.

Pengamat & Praktisi Manajemen

Cahyo Pramono

Baik dia orang baik ataupun orang jahat. Baik itu buruh kasar hingga pejabat tinggi yang terhormat. Tetapi, seharusnya kita memiliki acuan-acuan dasar berupa kriteria orang-orang yang seharusnya kita temui dengan sengaja. Siapa sebenarnya yang menjadi pihak langsung yang akan memberikan keuntungan kepada diri atau bisnis anda. Mereka adalah pihak pertama yang memberikan uang atau jasa kepada anda secara langsung. Merekalah orang-orang yang harusnya dikejar untuk ditemui. Baru selanjutnya mereka-mereka yang tidak langsung memberikan dukungan atau manfaat langsung ke anda. Merekamereka adalah para pemengang kekuasaan yang mempengaruhi proses bisnis anda. Atau mereka-mereka yang mensuplai kebutuhan bisnis anda. Lalu mereka yang memberikan pengaruh atas keputusan pembelian. Juga tidak bisa dilepaskan adalah orang-orang yang dimasa yang akan datang akan menjadi orang-orang penting yang berposisi sebagai pihak langsung maupun pihak tidak langsung dalam hubungannya dengan kita. Dalam menentukan target yang akan ditemui, saya ingin menggambarkan ketika anda menanam padi, pasti akan juga tumbuh ilalang dan rumput liar. Tapi saat anda menanam rumput liar dan ilalang, tidak pasti padi akan tumbuh bersamanya. Jadi, pilihlah sasaran yang benar, dan bersedialah dengan sasaransasaran ‘sampah’ yang akan juga ter-temui dalam prosesnya.

Platform Setelah sasaran sudah ditentukan. Langkah berikutnya adalah konsentrasi pembagian waktu dan alokasi energi yang harus diberikan dalam kontek ‘bergaul’ ini. Saya biasanya membagi tiga kelompok/platform yang akan saya temui. Ketiga kelompok itu adalah buying platform, working platform dan market platform. Buying platform adalah mereka-mereka yang sudah berhubungan dengan kita serta sudah menjadi pembeli/ pelanggan kita. Working platform adalah mereka-mereka yang sudah berhubungan dengan kita tetapi belum deal dan belum menjadi pembeli/pelanggan kita. Market platform adalah mereka-mereka yang belum berhubungan dengan kita dan juga belum menjadi pembeli/ pelanggan kita. Saya akan memberikan perhatian sebesar 20 persen untuk buying platform, 35 persen untuk working platfom dan 45 persen untuk market platform. Jika saya menargetkan bertemu 10 orang dalam satu hari, maka saya akan bertemu dengan dua orang pelanggan lama (dan kadang sekadar bertelefon saja pun cukup), lalu calon pembeli yang sedang saya prospek sebayak tiga atau empat orang dan orang-orang yang belum saya kenal sesuai kriteria yang saya susun sebanyak empat atau lima orang. Dengan pembagian konsentrasi ini, kita akan berkompetisi dengan waktu untuk mendapatkan jaringan sebanyakbanyaknya tanpa harus melupakan atau meninggalkan jaringan lama yang sudah terbentuk. Kesalahan kebanyakan penjual, adalah mengunjungi lebih banyak orang-orang yang‘menyenangkan’ saja. Mereka berulangulang mengunjungi orang yang sama di kantor yang sama karena mereka baik, mungkin nyaman diajak ngobrol, atau karena mereka selalu menyuguhkan makanan / minuman yang enak. Bagaimana dengan anda? Konsultasi & Pelatihan; tj@cahyopramono.com

Melirik Pusat Dagangan Kue Lebaran Di Padangsidimpuan TIDAK terasa Idul Fitri tinggal tujuh hari lagi. Seiring itu pula masyarakat secara umum disibukkan dengan berbagai aktivitas untuk memenuhi berbagai macam kebutuhan mulai dari sandang maupun pangan. Tujuannya untuk mempersiapkan diri dan keluarga menyambut hari lebaran. Dalam kebutuhan pangan, biasanya kue lebaran menjadi hal prinsipil dibicarakan kaum ibu. Selaku ibu rumah tangga, mereka merasa rumahnya belum lengkap tanpa kehadiran kue labaran. Karena itu dua minggu sebelum lebaran, aktifitas memasak berbagai jenis kue biasanya telah dimulai dan menjadi kebiasaan rutin tiap tahun. Bagi yang memilki waktu luang memasak kue dengan selera sendiri. Lalu bagaimana dengan ibu rumah tangga yang sibuk dengan pekerjaan, dagang, maupun aktivitas yang menyita waktu lainnya? Tentunya solusi untuk itu perlu difikirkan supaya aroma khas kue tetap tercium di rumah. Bagi kaum ibu khusunya di Padangsidimpuan sekitarnya tak usah khawatir. Karena sekarang ini pusat jualan kue khusus lebaran telah hadir di kota tepatnya di sepanjang Jl. Thamrin menuju Pasar Sangkumpal Bonang dulunya dikenal Pasar Baru. Di kawasan itu, tenda-tenda pajangan jual kue hampir 500

meter berjejeran tertata rapi di bahu jalan raya. Begitu turun dari kendaraan, mata kita langsung disuguhkan dengan keberadaan bebagai jenis kue bermacam rasa. Tentukan selera karena kue yang diinginkan tersedia di sana. Harga terjangkau mulai dari harga Rp20.000- Rp150.000. Pantauan Waspada, Jumat (3/ 9) di sepanjang Jalan Thamrin, minat masyarakat pembeli sangat tinggi. Menurut Diana, pembeli kue di tempat itu didominasi pegawai negeri sipil maupun swasta, dan warga dari perantauan yang pulang kampung untuk oleh-oleh. Karenanya tidak mengherankan kalau belakangan ini kawasan Jalan Thamrin itu jadi langganan macet disamping Jalan Patricia Lumumba. Diana menjelaskan peda-gang kue di kawasan itu tidak lagi memasak kue secara sendiri-sendiri, tapi sudah harus merekrut anggota supaya target kue bisa dicapai. “Kita sudah kewalahan masak sendiri, makanya kita nyari anggota dari kalangan remaja dan juga ibu rumah tangga yang punya waktu luang. Hitung-hitung membantu ekonomi tetangga menyambut lebaran karena mereka digaji mulai dari Rp20.000 sampai Rp.35.000 per hari. Gaji mereka ditentukan dengan keahlian memasak dan bannyaknya masakan.,” ucapnya. ● Sarmin Harahap

H-7, Aktivitas Sejumlah Bank Meningkat P.SIDIMPUAN (Waspada): Aktivitas di sejumlah bank pemerintah dan swasta di Padangsidimuan dalam pantauan Waspada, Jumat (3/9) terus mengalami peningkatan dari hari-hari biasa. Hal itu dapat dilihat dari jumlah antrian nasabah di ruang lobby bank dan tempat parkir. Bank yang berada baik di kawasan Jalan merdeka, Jalan Sudirman, maupun di kawasan Kelurahan Sadabuan Kota Padangsidimpuan, situasinya hampir sama. Bahkan antrian sering terlihat di depan lokasi Anjungan Tunai Mandiri (ATM). Mereka memilih transaksi melalui ATM karena tidak sabar menunggu, dan menginginkan peroses yang cepat. Menjelang hari raya selalu

padat dan sibuk. Hal itu terjadi karena keberadaan bank di Padangsidmpuan tidak saja melayani nasabah dari Kota Padangsidimpuan, tapi juga nasabah dari Kabupaten Tapanuli Selatan. Kesibukan juga diakibatkan karena banyaknya transasksi keuangan didominasi non pemerintah untuk kebutuhan lebaran dalam skala besar. Kemudian, kebiasaan masyarakat menukarkan uang receh dan menunggu transfer uang dari berbagai daerah dan negara, makin memicu aktifitas padat di bank meningkat. Ibu Salmah Hasibuan misalnya saat berdialog dengan Waspada di Bank Sumut menuturkan, ia mengikuti antrian untuk mengambil uang kiriman dari anaknya di Jakarta. (csh)

WASPADA Senin 6 September 2010

Waspada/Sarmin Harahap

KUE LEBARAN: Pusat jualan kue lebaran di Kota Padangsidimpuan, tepatnya di Jalan Thamrin sekitar Pasar sangkumpal Bonang, yang ramai dikunjungi masyarakat. Di kawasan itu terdapat berbagai jenis kue dengan harga bervariasi. Foto direkam, Jumat (3/9).

Pasar Tradisional Di Madina Padat PANYABUNGAN ( Waspada) : Kurang lebih sepekan menjelang Hari Raya Idul Fitri 1431 H / 2010 M, aktivitas perdagangan di pasar-pasar tradisional di Kabupaten Mandailing Natal semakin menunjukkan gairahnya. Pusat-pusat perbelanjaan tradisional diserbu masyarakat sejak pagi hingga sore hari,para pedagang sibuk melayani permintaan pembeli khususnya pakaian maupun keperluan lebaran lainnya. Kepadatan pengunjung juga tampak dari tempattempar parkir yang dijejali mobil dan sepeda motor. Dari pantauan Waspada di sejumlah pasar tradisional di daerah itu antara lain Pasar Baru Panyabungan Sihepeng, Simangambat, Mompang,Kotanopan Muarasipongi, Malintang, Maga, Laru ,Kayu Laut serta beberapa pasar lainnya ,tampak dijejali pembeli sejak pagi. Menurut pengamatan Waspada, Kamis ( 2/9),terlihat kesibukan yang mencolok dari pembeli, kalangan pedagang pakaian yang sejak jauh hari sibuk mempersiapkan barang dagangannya mendapatkan ketiban rezeki. Ka l a u p a d a h a r i - h a r i sebelumnya kebanyakan warga mengunjungi pedagang bahan pokok, kini sebaliknya menyerbu pedagang pakaian. Kalangan pedagang mau-

pun toko pakaian kelihatan sibuk menyambut dan melayani kehadiran pembeli, karena pada bulan inilah saatnya mereka bisa menjual dagangannya untuk persiapan lebaran nanti. “Memang kami mengharapkan mulai minggu inilah dagangan kami laku terjual. Sebab perhitungan kami, pegawai negeri atau buruh lainnya sudah menerima gaji dalam dua hari terakhir, rasanya minggu inilah kami sibuk melayani konsumen,” ungkap Hasan Nasution di Pasar Baru Panyabungan Kamis (2/9). Pedagang pakaian anakanak itu mengaku, lumayan memperoleh keuntungan hasil jualannya yang sengaja dipersiapkan dalam menyambut Idul Fitri yang akan datang. “Mudahmudahan dari hari pekan Kamis hari ini ,banyak pakaian anakanak yang terjual,” katanya. Pengakuan yang sama juga disampaikan beberapa pedagang pakaian muslim di pusat pasar itu, seperti tahun lalu ada peningkatan penjualan menjelang lebaran. Kebanyakan yang laku itu busana muslim seperti baju koko, kain sarung dan lainnya,” ungkap Nursiah boru Lubis. Soal harga, kata pedagang itu, bervariasi tergantung kualitas pakaian. Harga itu mulai dari Rp50.000 hingga Rp350.000. ( a24)

MEDAN (Waspada): Menjelang hari Raya Idul Fitri yang jatuh diperkirakan pada tanggal 10 September 2010 jumlah penumpang domestik berangkat dan datang di Sumatera Utara meningkat.

Data data Badan Pusat Statistik (BPS) Sumatera Utara jumlah penumpang domestik berangkat dari Sumatera Utara melalui Bandara Polonia Medan selama bulan Juli 2010 mencapai 236.892 orang, atau naik sebesar 8,31 persen. “Jika dibandingkan dengan bulan Juni 2010 mencapai 218.708 hal ini menunjukkan peningkatan. Secara kumulatif jumlah jumlah penumpang berangkat Januari-Juli 2010 mencapai 1.440.106 orang, atau naik 21,00 persen dibandingkan periode sama tahun 2009 sebesar 1.190.211 orang,” ujar Kepala BPS Sumatera Utara, Alamuddin Sidabalok, di Medan,

kemarin. Demikian pula dengan penumpang domestik datang di Sumatera Utara bulan Juli 2010, lanjutnya, mencapai 230.441 orang, atau mengalami kenaikan sebesar 7,19 persen jika dibandingkan bulan sebelumnya yaitu sebanyak 214.974 orang. “Selama Januari-Juli 2010 penumpang domestik datang mengalami peningkatan sebesar 32,40 persen dibandingkan dengan periode yang sama tahun sebelumnya, yaitu naik dari 1.010.614 orang menjadi 1.338.029 orang,” ujarnya. Penumpang angkutan udara tujuan luar negeri, lanjutnya kembali, baik menggunakan penerbangan nasional maupun asing, pada bulan Juli 2010 mengalami penurunan sebesar 13,36 persen dibandingkan bulan Juni 2010, yaitu dari 56.186 orang turun menjadi 48.682 orang. Jumlah penumpang tujuan luar negeri selama Januari – Juli 2010 mencapai 323.699 orang, atau naik 30,50 persen dibandingkan periode yang sama tahun 2009 sebesar 248.037 orang. “Sedangkan kedatangan

penumpang dari luar negeri selama bulan Juli 2010 mengalami kenaikan 11,98 persen dibandingkan bulan Juni 2010, yaitu dari 50.129 orang naik menjadi 56.133 orang. Jumlah penumpang luar negeri datang selama Januari – Juli 2010 di Sumatera Utara mengalami peningkatan sebesar 27,21 persen dibandingkan dengan periode yang sama tahun sebelumnya, yaitu naik dari 259.735 orang jadi 330.411 orang,” ujarnya. Sementara jumlah penumpang angkutan laut antara pulau (dalam negeri), Alamuddin Sidabalok menyatakan berangkat pada bulan Juli 2010 tercatat sebanyak 7.205 orang, tidak mengalami perubahan bila dibandingkan bulan sebelumnya yang juga sebanyak 7.205 orang. “Secara kumulatif jumlah penumpang berangkat selama bulan Januari – Juli 2010 mencapai 44.216 orang, atau naik 13,63 persen dibanding periode sama tahun 2009 . Sedangkan jumlah penumpang datang pada bulan Juli 2010 tercatat sebanyak 6.379 orang, atau naik hingga 23,53 persen dibandingkan bulan sebelumnya yaitu sebanyak 5.164 orang,” lanjutnya.

Selama Januari-Juli 2010, terangnya kembali, jumlah penumpang datang mencapai 27.736 orang mengalami penurunan sebesar 24,78 persen dibandingkan periode yang sama tahun sebelumnya mencapai 36.873 orang. “Jika dilihat dari transportasi barang melalui laut, selama bulan Juli 2010 angkutan barang antarpulau untuk kegiatan muat barang sebesar 85.212 ton, atau mengalami peningkatan sebesar 34,39 persen dibandingkan bulan Juni 2010 yang sebesar 85.212 ton. Secara kumulatif jumlah barang yang dimuat selama bulan Januari – Juli 2010 mencapai 421.474 ton, atau turun 4,60 persen dibanding periode yang sama tahun 2009 (441.790 ton),” ujarnya. Sedangkan kegiatan bongkar barang pada Juli 2010, lanjutnya, mengalami kenaikan sebesar 5,25 persen, yakni dari 483.828 ton pada Juni 2010 jadi 509.247 ton pada Juli 2010. Selama Januari – Juli 2010 barang yang dibongkar mencapai 3.382.121 ton, mengalami penurunan 9,70 persen dibanding periode sama tahun sebelumnya. (m38)

Kolang-kaling Kian Diminati TANJUNGBALAI ( Waspada) : Seminggu menjelang Lebaran, buah aren atau biasa disebut kolang-kaling, kian diminati warga Kota Tanjungbalai. Bukan hanya umat Islam, etnis Tionghoa juga menyukai kolang-kaling, karena selain cita rasanya yang lezat, juga bermanfaat bagi kesehatan. Menurut warga, kolang-kaling bermanfaat untuk menguatkan tulang dan sumsum. “ Bukan hanya umat Islam, kaum Tionghoa banyak yang memesan kolang-kaling, katanya untuk menguatkan tulang dan sumsum,” kata pedagang kolangkaling di Pasar Suprapto Kota Tanjungbalai, Duwi, 35, kepada Waspada, Jumat (3/9). Lebih lanjut dikatakan Duwi, kolang-kaling ini hanya muncul saat Ramadhan. “Memang setiap Ramadhan mem-

Waspada/Rasudin Sihotang

DISERBU : Menjelang lebaran, buah kolang-kaling diserbu para ibu rumah tangga di Kota Tanjungbalai untuk dijadikan manisan. Selain cita rasanya yang lezat, buah aren ini juga bermanfaat bagi kesehatan, khususnya menguatkan tulang dan sumsum. Foto direkam, Jumat (3/9). bawa berkah bagi kami, hasil penjualan kolang-kaling ini bisa

sampai Rp300 ribu per hari, cukuplah untuk membeli ke-

perluan lebaran,” ujar Duwi. Dia menambahkan, kendati hanya Ramadhan, namun ibu dua anak ini tetap setia berdagang kolang-kaling. “ Sudah 10 tahun hanya kolang-kaling ini saja yang kujual, “ tutur Duwi. Alasan Duwi setia dengan kolang-kaling, selain untungnya menjanjikan, risikonya juga kecil. “Kolang-kalilng tahan lama, seminggu masih bisa dijual kendati harganya merosot hingga Rp4.000 per kg,” kata Duwi. Dijelaskan, kendati sudah seminggu, bukan berarti kolang-kaling itu tidak layak konsumsi. “Rasanya tetap sama, hanya lebih keras sedikit daripada kolang-kaling yang baru dipetik,” ujar Duwi sambil menambahkan, kolang-kaling miliknya, paling lama bertahan hanya tiga hari, karena ludes diserbu konsumen. (a37/crs)

Waspada, Senin 6 September 2010  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you