Issuu on Google+

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Kliwon, 30 Juli 2012/10 Ramadhan 1433 H

No: 23941 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: 2.500,-

Perolehan Medali Negara Emas Perak Perunggu

AP

TONTOWI Ahmad (kanan) melepas smes di belakang Liliyana Natsir saat mengatasi ganda campuran Korsel Lee Yong-dae dan Ha Jung-eun di London, Minggu (29/7).

Tontowi/Liliyana Amankan Tiket LONDON (Waspada): Ganda campuran peringkat empat dunia Tontowi Ahmad-Liliyana Natsir mengamankan tiket perempatfinal Olimpiade London 2012 dengan membukukan kemenangan kedua pada penyisihan grup. Pada pertandingan Grup C kedua di Wembley Arena, London, Minggu (29/7), Tontowi-Liliyana mengalahkan ganda Korea Selatan Lee Yong Dae-Ha Jung Eun 21-19, 21-12 dalam waktu 38 menit.

Lanjut ke hal A11 kol. 1

Waspada/Arianda Tanjung

RATUSAN remaja menghadang mobil patroli Polsek Sunggal, terkait penangkapan rekan mereka yang diduga terlibat bermain petasan di Jln. Gagak Hitam/ Ringroad, Minggu (29/7). Foto-foto lainnya di halaman A5.

Ratusan Remaja Hadang Mobil Patroli Polisi

China 6 AS 2 Italia 2 Korsel 1 Brazil 1 Belanda 1 Russia 1 Korut 1 Australia 1 Georgia 1 Kazakhstan 1 Jepang 0 Hungaria 0 Prancis 0 Polandia 0 Rumania 0 Kuba 0 Kolombia 0 Inggris Raya 0 Serbia 0

1 3 2 1 1 1 0 0 0 0 0 2 1 1 1 1 1 1 1 0

2 2 2 2 1 0 1 1 0 0 0 2 1 1 0 0 0 0 0 1

Pembubaran Asmara Subuh Ricuh Muda-mudi Masih Padati Kawasan Teladan, 45 Sepeda Motor Diamankan MEDAN (Waspada): Kegiatan “asmara subuh” yang dilakukan muda-mudi masih tampak semarak di kawasan Stadion Teladan, Medan.

Pantauan Waspada, Minggu (29/7), ratusan remaja mengendarai sepeda motor memadati kawasan itu. Sejak usai shalat subuh

Ekonomi Syariah SEJAK Ramadhan pertama sampai hari ini aktivitas masyarakat kita di dalam masjid selalu ramai. Setiap hari rumah Allah itu dipenuhi umat Islam untuk mendapatkan ganjaran pahala yang dijanjikan selama bulan penuh ampunan ini. Ibadah wajib dan sunat dikerjakan dengan kekhusukan. Bukan hanya shalat, tadarus tapi juga iktikaf. Di saat seperti ini pula saya pun diundang berbagai pengurus masjid.

Catatan Gus Irawan

para remaja mulai mendatangi lokasi itu, kemudian mengitari luar stadion dan tak lama kemudian bertemu dengan beberapa rekannya yang lain sesama pengendara sepeda motor, kemudian membentuk kumpulan. Makin lama kumpulan remaja ini semakin ramai, dan masing-masing menunjukkan

Lanjut ke hal A2 kol. 4

MEDAN (Waspada): Pembubaran asmara subuh di kawasan Ringroad, Medan Sunggal, Minggu (29/7), diwarnai kericuhan. Ratusan remaja menghadang mobil patroli polisi yang menangkap sejumlah rekan mereka.

Plt Gubsu Beri Apresiasi 18.000 Perkara PT Sumut Selesai

Informasi Waspada peroleh, peristiwa itu bermula ketika tim gabungan TNI/Polri, Sat Pol PP Kota Medan, Dinas Perhubungan Kota Medan dan Majelis Ulama Indonesia (MUI) melakukan penertiban terhadap sekelompok remaja yang melakukan asmara subuh. Tim gabungan yang mengendarai dua truk, sejumlah mobil patroli dan sepedamotor menghalau ribuan remaja yang berkumpul di sepanjang Jl. Gagak Hitam/Ringroad, Medan Sunggal. Pada saat bersamaan, polisi mengamankan sejumlah remaja diduga bermain petasan. Remaja tersebut dibawa dengan mobil patroli. Lanjut ke hal A2 kol. 1

MEDAN (Waspada): Plt Gubsu H Gatot Pujo Nugroho memberi apresiasi atas kinerja penegakan hukum di provinsi ini. Karena sudah 18.000 perkara di wilayah hukum Pengadilan Tinggi (PT) Sumut diputus. “Kita memberi apresiasi atas kinerja ini,” ujarnya saat menghadiri acara berbuka puasa bersama jajaran Pengadilan Tinggi Sumut dengan Forum Koordinasi Pimpinan Daerah (FKPD) Sumut di Kantor Pengadilan Tinggi Sumut, Jumat (27/7) sore. Ketua PT Sumut Dr Hj Marni Emmy Mus-

Al Bayan

Ramadhan University Oleh Tgk H. Ameer Hamzah

Lanjut ke hal A2 kol. 3

Waspada/gito ap

DUA sepeda motor kapasitas 250 cc diamankan dari kawasan Stadion Teladan, Minggu (29/7) pagi.

JAKARTA (Antara): Kedutaan Besar Indonesia untuk Arab Saudi ataupun Konsulat Jenderal Indonesia yang ada di Jeddah diminta segera membantu sekitar 200 jamaah umroh Indonesia yang terlantar. “Kedutaan Besar Indonesia di Arab Saudi harus secepatnya membantu jamaah tersebut. Jangan biarkan mereka terlantar karena ulah maskapai yang tak bertanggung jawab,” kata anggota Komisi VIII DPR RI, Abdul Hakim di Jakarta, Minggu (29/7).

Politisi Partai Keadilan Sejahtera itu juga meminta kepada pemerintah Indonesia, utamanya Kementerian Perhubungan untuk menindak maskapai penerbangan Saudi Arabian Airlines yang menelantarkan ratusan jamaah umroh sejak kemarin. “Otoritas berwenang, dalam hal ini, Kementerian Perhubungan harus memberikan peringatan, sanksi serta tindakan tegas kepada maskapai

Lanjut ke hal A2 kol. 7

MEDAN ( Waspada): Pembaca Waspada yang militan menjadi pendukung Gus Irawan dan Gatot Pujo Nugroho terus memberikan dukungan signifikan. Posisi terakhir hitungan kupon yang masuk Sabtu (28/7) hingga pukul 16:30, Gus Irawan tetap pada posisi puncak dengan poin 73%. Sementara Gatot Pujo Nugroho 21%.

Lanjut ke hal A2 kol. 3

80%

Waspada/Ist

73%

70% 60% 50% 40% 30%

Zuhur : 12:33 Isya : 19:55

Asar : 15:56 Imsak : 04:54

Magrib : 18:42 Subuh : 05:04

“Shalat lima waktu, dari Jumat (yang satu) menuju Jumat berikutnya, (dari) Ramadhan hingga Ramadhan (berikutnya) adalah penghapus dosa di antaranya, apabila ditinggalkan dosa-dosa besar.” (HR. Muslim)

21%

20% 10% 0%

2%

2%

0%

1%

0%

0%

Waspada/Amir Syarifuddin

PLT Gubsu H Gatot Pujo Nugroho ST (kanan) dan Ketua Pengadilan Tinggi Sumut Dr Hj Marni Emmy Mustafa SH, MH (tengah) serius mendengarkan tausiyah pada acara berbuka puasa bersama jajaran Pengadilan Tinggi Sumut dengan Forum Komunikasi Pimpinan Daerah (FKPD) Sumut, Jumat (27/7) sore.

Umat Islam Ada-ada Saja Istri Persempit Ceraikan Gara-gara Wortel SETIAP pasangan yang Pemahaman hendak berpisah tentu memiliki alasan masing-masing. Bid’ah Namun di Palestina seorang

Chairuman Dan AY Berimbang

Gubsu Pilihan Pembaca Waspada 29 Juli 2012 Sampai Pukul 16:30

Medan dan sekitarnya

Lanjut ke hal A2 kol. 1

Ratusan Jamaah Umroh Terlantar Di Jeddah

Lanjut ke hal A2 kol. 6

MUJTAHID Agung Imam Syafi’i menamatkan baca Alquran pada bulan Ramadhan sebanyak 60 kali. Imam Hambali, 50 kali, Imam Bukhari 40 kali, imam Muslim 40 kali. Imam Nawawi 30 kali. Mereka juga menghafal ratusan hadis Nabi di bulan suci Ramadhan.

tafa, SH, MH mengungkapkan, 18.000 perkara dimaksud meliputi pengadilan-pengadilan negeri se wilayah hukum PT Sumut pada 2011. Sepuluh besar perkara pidana yang telah diputus di Provinsi Sumut meliputi perjudian, pencurian, narkotika, penganiayaan, penggelapan, perbuatan asusila, kejahatan terhadap perlindungan anak, penipuan, kejahatan terhadap pengrusakan barang dan penadahan.

MEDAN BERHIAS: Anggota DPD RI Parlindungan Purba yang juga Ketua Yayasan Bumi Hijau Lestari didampingi Praktisi Lingkungan Dewi Budiati Teruna J Said dari Waspada Green Club berbincang-bincang dengan GM Pertamina Sumbagut Gandi Sriwidodo dalam pertemuannya di kantor Pertamina Jl. KL Yos Sudarso Medan, Jumat (27/7) dalam rangka pelaksanaan program Medan Berhias yang akan dilaunching dalam waktu dekat. Pada kesempatan itu Parlindungan Purba memaparkan,Program Medan Berhias (bersih hijau indah asri) mereka gagas bersama Wali Kota Medan Rahudman serta Prof Dr Ir Abdul Raup MP, guru besar Fakultas Pertanian USU. Program Berhias ini nantinya fokus pada perbaikan lingkungan berbasis pemberdayaan masyarakat secara berkesinambungan. (m08)

MEDAN (Waspada): Adanya kalangan umat Islam yang mempersempit pemahaman tentang bid’ah, termasuk saat ini terkait dengan amalanamalan di bulan Ramadhan, menjadi sorotan Wakil Rois Syuriyah PWNU Sumut Ustadz H. Akhyar Nasution, Lc., MA pada Pengajian Ramadhan Nahdlatul Ulama Sumatera Utara di aula kantor Pimpinan Wilayah NU (PWNU) Jalan Sei Batanghari Medan. “Tidak semua bid’ah itu dhalalah (sesat), karena para ulama mengenal adanya bid’ah hasanah (baik), sebagaimana

Lanjut ke hal A2 kol. 3

pria dilaporkan menceraikan istrinya hanya karena persoalan sepele. Pria yang tidak disebutkan identitasnya itu dilaporkan menceraikan sang istri karena Lanjut ke hal A2 kol. 2

Serampang - Panas-panas teringat es campur - He...he...he...


WASPADA Demi Kebenaran Dan Keadilan

http://epaper.waspadamedan.com

SENIN, Kliwon, 30 Juli 2012/10 Ramadhan 1433 H z zNo: 23941 * Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Pembubaran Asmara Subuh Ricuh

Ratusan Remaja Hadang Mobil Patroli Polisi MEDAN (Waspada): Pembubaran asmara subuh di kawasan Ringroad, Medan Sunggal, Minggu (29/7), diwarnai kericuhan. Ratusan remaja menghadang mobil patroli polisi yang menangkap sejumlah rekan mereka. Informasi Waspada peroleh, peristiwa itu bermula ketika tim gabungan TNI/Polri, Sat Pol PP Kota Medan, Dinas Perhubungan Kota Medan dan Majelis Ulama Indonesia (MUI) melakukan penertiban terhadap sekelompok remaja yang melakukan asmara subuh. Tim gabungan yang mengendarai dua truk, sejumlah mobil patroli dan sepedamotor menghalau ribuan remaja yang berkumpul di sepanjang Jl. Gagak Hitam/Ringroad, Medan Sunggal. Pada saat bersamaan, polisi mengamankan sejumlah remaja diduga bermain petasan. Remaja tersebut dibawa dengan mobil patroli Tidak terima temannya ditangkap, ratusan remaja menghadang mobil patroli polisi tersebut. Sempat terjadi ketegangan antara ratusan remaja dengan sejumlah polisi. Lanjut ke hal A2 kol 3

Waspada/Arianda Tanjung

Kutuk Pembantaian Muslim Rohingya RATUSAN remaja menghadang mobil patroli Polsek Sunggal, terkait penangkapan rekan mereka yang diduga terlibat bermain petasan di Jln. Gagak Hitam/Ringroad, Minggu (29/7).

BANDA ACEH (Waspada): Kesatuan Aksi Mahasiswa Muslim Indonesia (KAMMI) Aceh melakukan demo di Simpang Lima Banda Aceh, Minggu (29/7). Mereka menuntut pemerintah Myanmar menghentikan pembasmian etnis Rohingya di Myanmar. “Kita mengutuk segala bentuk genosida dan kejahatan terhadap kemanusiaan warga Rohingya baik di dalam maupun di luar Myanmar,” ujar Koordinator Aksi KAMMI, Darlis, di sela-sela aksi keprihatinan itu. Kepada pemerintah Indonesia, KAMMI meminta untuk mengakomodasi para pengungsi Rohingya yang terdampar di perairan Indonesia. “Kita harapkan Indonesia terus berjuang dalam ranah diplomasi regional dan internasional dalam memper-

BINJAI (Waspada): Guru besar ilmu hadis IAIN Sumut Prof.Dr. Drs. H. Ramli Abdul Wadid, LC, MA, menilai berkembangnya aliran sesat di Indonesia, dimulai sejak krisis moneter, 2007. Perkembangannya tidak sesuai dengan Alquran dan hadist dan sulit di toleransi. Apalagi HAM merupakan alasan yang digunakan paling ampuh. Hal itu dikemukakan Ramli pada Muzakarah Ramadhan

Lanjut ke hal A2 kol 2

patnya membantu jamaah tersebut. Jangan biarkan mereka terlantar karena ulah maskapai yang tak bertanggung jawab,” kata anggota Komisi VIII DPR RI, Abdul Hakim di Jakarta, Minggu (29/7). Politisi Partai Keadilan Lanjut ke hal A2 kol 4

Al Bayan

Ramadhan University Oleh: H Ameer Hamzah MUJTAHID Agung Imam Syafi’i menamatkan baca Alquran pada bulan Ramadhan sebanyak 60 kali. Imam Hambali, 50 kali, Imam Bukhari 40 kali, imam Muslim 40 kali. Imam Nawawi 30 kali. Mereka juga menghafal ratusan hadis Nabi di bulan suci Ramadhan. Prof Dr Syeikh M. Yusuf Qardhawy adalah ulama besar

Lanjut ke hal A2 kol 2

Medan dan sekitarnya Zuhur : 12:33 Ashar Isya : 19:55 Imsak

HAM Alasan Paling Ampuh Berkembangnya Aliran Sesat

juangkan kesamaan hak,” tutupnya. “Ini bukan lagi soal ras, agama dan negara, tapi sudah jadi persoalan kemanusiaan, kita mengutuk setiap yang namanya kekerasan terhadap kemanusiaan, di manapun itu,” papar Darlis. Dalam aksinya, KAMMI Aceh menuntut kepada Perserikatan Bangsa-Bangsa (PBB) dan Asean turun tangan menghentikan kekerasaan terhadap kemanusiaan di

Ratusan Jamaah Umroh Terlantar Di Jeddah JAKARTA (Antara): Kedutaan Besar Indonesia untuk Arab Saudi ataupun Konsulat Jenderal Indonesia yang ada di Jeddah diminta untuk segera membantu sekitar 200 jamaah umroh Indonesia yang terlantar. “Kedutaan Besar Indonesia di Arab Saudi harus sece-

Guru Besar IAIN Sumut Prof.Dr.H.Ramli Abdul Wahid,MA:

: 15:56 Magrib : 18:42 : 04:54 Subuh : 05:04

“Shalat lima waktu, dari Jumat (yang satu) menuju Jumat berikutnya, (dari) Ramadhan hingga Ramadhan (berikutnya) adalah penghapus dosa di antaranya, apabila ditinggalkan dosa-dosa besar.” (HR. Muslim)

yang diselenggarakan MUI Kota Binjai , Minggu (29/7), dengan thema :Ramadhan dan aliran sesat, di kantor MUI Jl. Olahraga. Muzakarah dibuka Wali Kota Binjai HM Idaham, SH, MSI, diharapkan dapat meningkatkan ilmu dan pengetahuan, sehingga mampu menangkal umat islam di Binjai terlibat oleh aliran sesat. Ramli Abdul Wahid pada Lanjut ke hal A2 kol 1

Antara

PEMBERANGKATAN RELAWAN ROHINGYA. Ketua Action Team for Rohingya ACT dan sekaligus relawan Rohingya Andika Purbo Swasono (kanan) memberikan surat wasiat kepada istri Tri Mardianti (kiri) ketika pelepasan dan pemberangkatan relawan Rohingya di kantor Aksi Cepat Tanggap di Ciputat, Tangerang, Minggu (29/7). Foto kanan: Mahasiswa dari Kesatuan Aksi Mahasiswa Muslim Indonesia (KAMMI) Aceh memerlihatkan foto para pengungsi Rohingya kepada pengguna jalan saat aksi solidaritas di Simpang Lima, Banda Aceh, Minggu (29/7).

Umat Islam Persempit Pemahaman Bid’ah MEDAN (Waspada): Adanya kalangan umat Islam yang mempersempit pemahaman tentang bid’ah, termasuk saat ini terkait dengan amalanamalan di bulan Ramadhan, menjadi sorotan Wakil Rois Syuriyah PWNU Sumut Ustadz H. Akhyar Nasution, Lc., MA pada Pengajian Ramadhan Nahdlatul Ulama Sumatera Utara di aula kantor Pimpinan Wilayah NU (PWNU) Jalan Sei Batanghari Medan. “Tidak semua bid’ah itu dhalalah (sesat), karena para ulama mengenal adanya bid’ah hasanah (baik), sebagaimana diungkapkan Imam Syafi’i bahwa bid’ah hasanah adalah “segala perkara yang bersifat baru, baik, dan sengaja

diciptakan dengan tidak menyalahi Alquran, sunnah, ijma’ dan atsar,” sementara bid’ah yang sesat pun bervariasi, ada yang makruh dan ada yang haram,” kata Akhyar Nasution,

penyidikan terhadap kasus ini,” ujar Kabid Humas Polda Aceh Kombes Pol Gustav Leo, kepada Waspada, Minggu (29/7). Gustav belum bisa menggambarkan ciri-ciri pelaku dan keberadaan para perampok

kesesatan berada di neraka”, bersumber dari HR. Baihaqi, di samping itu ada lagi hadis dari Muslim dan Bukhari yang maksudnya “suatu amalan yang bukan berasal dari Nabi saw. maka ditolak”, menurut H. Akhyar Nasution, harus dipahami dengan seksama, bijaksana, dan tidak sepihak dengan cakrawala yang komprehensif. Misalnya dengan mengaitkan hadis tersebut dengan Alquran, hadis yang lain, dan kesepakatan (ijma’) sahabat, ijma’ ulama dan seterusnya. Lanjut Akhyar Nasution, sesuai dengan paradigma Islam Ahlus Sunnah wal

Lanjut ke hal A2 kol 4

Lanjut ke hal A2 kol 3

Sabtu (28/7). Adapun hadis yang menyebutkan setiap (kullu) bid’ah adalah sesat bersumber dari HR. Bukhari, dan ditambah dengan ungkapan “setiap

Polda Aceh Bantu Usut Perampokan Pegadaian BANDA ACEH (Waspada): Polda Aceh menurunkan tim melacak kasus perampokan bersenjata api terhadap Pegadaian Syariah. “Kasus perampokan tersebut dalam tahap pengembangan, dan kita sudah menurunkan tim untuk melakukan

Ekonomi Syariah SEJAK Ramadhan pertama sampai hari ini aktivitas masyarakat kita di dalam masjid selalu ramai. Setiap hari rumah Allah itu dipenuhi umat Islam untuk mendapatkan ganjaran pahala yang dijanjikan selama bulan penuh ampunan ini. Ibadah wajib dan sunat dikerjakan dengan kekhusukan. Bukan hanya shalat, tadarus tapi juga iktiCatatan kaf. Di saat seperti ini pula saya pun Gus Irawan diundang berbagai pengurus masjid. Ada yang memang memberi saya porsi berceramah, ada pula hanya bersilaturrahmi, bertemu jamaah. Saya nikmati itu sebagai salah satu pola berbaur dengan masyarakat. Memang ada beberapa masjid yang jumlah jamaahnya sampai ribuan ada pula ratusan orang. Semua itu menunjukkan bahwa sesungguhnya kita ini sama tanpa dibedakan oleh pangkat, golongan, harta dan keturunan. Ketika kerap memberikan ceramah tentang Islam saya selalu teringat kembali dengan ekonomi syariah yang selalu ingin kita jadikan basis dan acuan dasar dalam Lanjut ke hal A2 kol 2

Waspada/Amir Syarifuddin

PLT Gubsu H Gatot Pujo Nugroho ST (kanan) dan Ketua Pengadilan Tinggi Sumut Dr Hj Marni Emmy Mustafa SH, MH (tengah) serius mendengarkan tausiyah pada acara berbuka puasa bersama jajaran Pengadilan Tinggi Sumut dengan Forum Komunikasi Pimpinan Daerah (FKPD) Sumut, Jumat (27/7) sore.

18.000 Perkara Di PT Sumut Selesai Plt Gubsu Beri Apresiasi MEDAN (Waspada): Plt Gubsu H Gatot Pujo Nugroho memberi apresiasi atas kinerja penegakan hukum di provinsi ini. Karena sudah 18.000 perkara di wilayah hukum Penga-

Lembaran Alquran Dipakai Untuk Bungkusan Mercon Ulama: Ini Pelecehan Dan Penghinaan PANTONLABU ( Waspada): Warga Aceh Utara menemukan mercon atau petasan yang terbuat dari potongan lembaran kitab suci Alquran. Fakta ini menuai reaksi keras dari ulama. Bahkan ada ulama yang menilai itu perbuatan antek-antek komunis. Informasi dihimpun Waspada, Minggu (29/7), mercon ukuran kecil yang lebih dikenal dengan sebutan mercon cabe itu ditemukan secara tak sengaja oleh Nurdin, 35, pedagang pasar pekan, asal Desa Paya Dua Uram, Kec. Lanjut ke hal A2 kol 6

dilan Tinggi (PT) Sumut diputus. “Kita memberi apresiasi atas kinerja ini,” ujarnya saat Lanjut ke hal A2 kol 6

Ada-ada Saja

Ceraikan Istri Gara-gara Wortel

SETIAP pasangan yang hendak berpisah tentu memiliki alasan masing-masing. Namun di Palestina seorang pria dilaporkan menceraikan istrinya hanya karena persoalan sepele. Pria yang tidak disebutkan Lanjut ke hal A2 kol 1

Serampang Waspada/Musyawir

KETUA MPU Tanah Jambo Aye, Tgk Ramli Syam memperlihatkan potongan lembaran Alquran yang dipakai untuk membungkus mercon, di Pantonlabu, Minggu (29/7) siang.

- Larang anak-anak tu keluar subuh .... - He.... he....he....


Berita Utama

A2 Kota China Batalkan Proyek Air Limbah Yang Menuai Protes QIDONG (AP): Pihak berwenang di China timur membatalkan rencana untuk membangun proyek air limbah setelah ribuan pemrotes yang marah tentang polusi turun ke jalan. Protes itu merupakan konfrontasi terbaru di negara tersebut di mana selama tiga dasawarsa ekspansi ekonomi yang cepat telah datang dengan mengorbankan lingkungan. Sebagian pemrotes di Qidong di provinsi Jiangsu bentrok dengan polisi dan mereka membalikkan mobil patroli polisi. Setelah protes Sabtu (28/7) itu, pemerintah Qidong mengumumkan di websitenya bahwa rencana untuk membangun proyek air limbah tersebut dibatalkan. Kantor berita Xinhua News Agency mengatakan ribuan warga turun ke jalan namun berhasil dibubarkan

setelah pemerintah mengeluarkan pengumuman. Sabtu sore ratusan polisi, sebagian dengan alat anti huruhara, tiba di kota pantai di utara Shanghai dan mengambil posisi di luar perkantoran pemerintah. Proyek air limbah itu merupakan bagian dari satu pabrik pembuatan kertas yang diusulkan perusahaan Jepang, Oji Paper Group di kota Nantong. Pemerintah China tidak mengatakan apakah rencana pabrik itu juga dibatalkan secara permanen. Oji mengatakan dalam pernyataannya Jumat bahwa proyek air limbah tersebut hanya akan dibatalkan setelah melalui berbagai percobaan menggunakan standar nasional. “Perlindungan lingkungan merupakan prioritas utama bagi perusahaan kami,” kata pernyataan tersebut. (m10)

HAM Alasan ....

mengubah-ubah ayat Alquran. Pengurus MUI Kab. Langkat Drs. Ishaq Ibrahim,MA, sebagai moderator menambahkan, aliran sesat di Kab. Langkat, cukup banyak dan pengikutnya banyak juga terdapat warga kota Binjai. Seperti di Bahorok ada 23 aliran dengan bervariasi. Kemudian Suhedi yang mengaku nabi di Kwala, di Tanjung Jati ada mengklaim sebagai Cokroaminoto , yang mengajarkan, puasa tidak wajib, karena menyiksa badan. Istri pertama wajb mencarikan istri kedua kepada suaminya, begitu juga berikutnya. Prof. Ramli Abdul Wahid, menyebutkan kreteria sesat ada 10. Seperti mengingkari salah satu rukun iman dan rukun islam. Meyakini akidah yang tak sesuai dengan dalil syar’i. Kemudian mengingkari Nabi Muhammad sebagai nabi terakhir, mengubah atau mengurangi pokok-pokok

muzakarah yang juga dihadiri Ka Kemenag Kota Binjai H. Al Ahyu, MA, Anggora DPRD, SKPD, Alim Ulama, tokoh masyarakat, pendidik, serta mahasiswa STAI Sekh HA Abd. Halim Hasan, Al Islahiyah, pimpinan organisasi islam , menegaskan, pendidik dan pengurus organisasi Islam, ustad, harus mewaspadai berbagai aliran sesat yang kini subur di tanah air. Termasuk aliran Ahmadiyah, Paham Lia Eden, Inkar Sunnah yang menolak hadist nabi dan berpegang pada Alquran saja, sampai jumlah shalat dan rakaatnya berdasarkan musyawarah dan mufakat jamaah. Aliran Al Qiyadah Al Islamiyah oleh Ahmad Mushaddek. Di Sumatera Utara, terdapat di Marelan, Medan, ada M. Hirfi Nuzlan, mengaku berteman dengan jibril. Soul Training berpegang pada Quran saja, tidak hadist. Aliran Al Haqa di P. Siantar, menekankan kerahasiaan dan pengorbanan dengan Rp 300.000 akan masuk surge. Di Kab. Langkat, ada pengajian yang

Ceraikan Isteri ....

identitasnya itu dilaporkan menceraikan sang istri karena perempuan yang dinikahinya itu lupa menambahkan wortel dihidangan kacang polong favoritnya. Kejadian ini sendiri terjadi pada awal Ramadhan lalu. Demikian seperti dilansir Emirates247, Minggu (29/7). Kisah ini diawali ketika pria itu tiba di rumah sesaat sebelum waktu berbuka puasa. Pria itu langsung menuju ke dapur untuk memeriksa masakan yang akan disajikan oleh sang istri. Ketika ia mengangkat tutup panci ia tidak menemukan adanya potongan wortel yang dicampurkan dengan kacang polong. Pria ini pun langsung memanggil sang istri untuk menanyakan hal tersebut. Sang istri mengaku ia lupa menambahkan wortel. Pria ini pun langsung menceraikan istrinya beberapa menit sebelum ia berbuka puasa. (ok/rzl)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Bf7+, Rh8. 2. Ma8+, Me8. 3. MxM+mat.

Jawaban TTS: TTS Topik

Santapan Ramadhan

Jawaban Sudoku: 6 9 7 4 1 8 5 3 2

1 2 3 5 9 6 4 7 8

4 5 8 3 7 2 6 9 1

7 4 2 8 3 5 9 1 6

5 3 9 7 6 1 8 2 4

8 6 1 9 2 4 7 5 3

3 8 6 2 5 7 1 4 9

2 7 4 1 8 9 3 6 5

9 1 5 6 4 3 2 8 7

Pembubaran ....

Saat itu, Kasat Binmas Polresta Medan Kompol A Hutauruk yang berada di lokasi mencoba mendinginkan suasana dan berdialog dengan para remaja tersebut. Puluhan personel TNI/Polri menghalau kerumunan massa yang menghadang mobil polisi tersebut. Operasi penertiban di kawasan kanal Titikuning dan Ringroad, Medan Sunggal itu dipimpin Kabag Ops Polresta Medan Kompol SF Napitu, SH, SIK, dibantu Kasat Binmas Polresta Medan Kompol A Hutauruk, SH. Sedikitnya 27 personel Polwan, 10 personel Satlantas, 20 personel Sabhara, dua personel Provost, enam personel Reskrim, dua dari Majelis Ulama Indonesia (MUI) dibantu Polsek Delitua dan Polsek Sunggal. Dalam operasi itu, Kabag Ops Polresta Medan Kompol SF Napitu, SH, SIK, sebelumnya memberikan pengarahan kepada para personel di lapangan Mapolresta Jln. HM Said Medan, agar melakukan ibadah yang ditetapkan syariat, seperti naik haji, tidak ke Baitullah. Mengkafirkan sesama muslim, hanya untuk kepentingan kelompoknya. Indikasi awal sesat, bisa di perhatikan , seperti pengajian dilakukan secara rahasia dan tertutup. Ketua MUI Binjai DR. HM Jamil, MA didampingi Sekum Jafar Sidik, Sag menjelaskan, Muzakarah untuk memberikan pencerahan agama dan peningkatan aqidah dan iman, Muzakarah diikuti pimpinan orgasisasi islam, mahasiswa, Ustad, Guru pendidikan islam dan kelompok pengajian kaum ibu , dan majlis taklim se kota Binjai. Muzakarah yang dibuka Walikota HM Idaham, SH, MSi, dilaksanakan setiam Minggu. Pada Minggu ( 5/8) pembicaranya guru besar hukum islam USU, Prof. Dr. H. Hasbalah Thaib, MA. Dengan topik Ramadhan dan ekonomi islam. (a.04)

penertiban itu jangan ada yang bertindak anarkis. Usai mengarahan, personel menaiki empat truk dari Sabhara Polresta Medan dan Sat Pol PP Medan dan Sat Pol PP Pemkab Deliserdang, ada juga mengendarai sepedamotor trail dan mobil. Selanjutnya, personel mengambil titik kumpul di depan Asrama Haji Medan. Setelah itu, mereka menuju ke Kanal Titikuning mengusir ribuan warga yang sedang ngumpul di lokasi itu.

Melihat lokasi sepi, petugas terus menuju ke Jln. Ringroad, Kecamatan Medan Sunggal. Disana, ribuan pengendara sepedamotor baik yang nongrong dan melintas dengan berkomvoi langsung dibubarkan. Mengentasi terjadi hal tidak diinginkan, Kabag Ops Polresta Medan menghimbau kepada warga melakukan asmara subuh dan balapan liar melalui pengeras suara agar meninggalkan lokasi itu dan pulang ke rumah masingmasing. (m36/m25)

Ratusan Jamaah ....

jemaah dari Jeddah. “Seharusnya, sejak kemarin sudah diberangkatkan, tapi hingga saat ini, maskapai belum juga memberangkatkan kami,” kata Daniel Nafis, salah seorang jamaah umroh. Menurut Nafis, maskapai tersebut tidak memberikan alasan yang jelas soal penundaan keberangkatan tersebut. “Padahal paspor, visa sudah ada pada mereka (maskapai). Mereka hanya bilang masih koordinasi,” sebut Nafis. Nafis menyebutkan, akibat ulah maskapai tak bertanggung jawab itu, para jemaah, terutama ibu-ibu, bapak-bapak yang sudah tua dan renta terlihat mulai letih dan tak berdaya. “Sampai saat ini, belum ada bantuan dan advokasi dari konjen ataupun dari KBRI Indonesia,” pungkas Nafis.

Sejahtera itu juga meminta kepada pemerintah Indonesia, utamanya Kementerian Perhubungan untuk menindak maskapai penerbangan Saudi Arabian Airlines yang menelantarkan ratusan jamaah umroh sejak kemarin. “Otoritas berwenang, dalam hal ini, Kementerian Perhubungan memberikan peringatan, sanksi serta tindakan tegas kepada maskapai tersebut,” kata Sekretaris Fraksi PKS itu. Sejak kemarin, ratusan jamaah umroh asal Indonesia terlantar di Jeddah, Arab Saudi. Penyebabnya adalah, jamaah umroh yang menggunakan maskapai Saudi Arabian Airlines dengan kode pener-bangan SV 816 jurusan Jeddah-Jakarta hingga pukul 14:00 waktu setempat belum juga membawa

Polda Aceh ....

tersebut sekarang, “Kita harus hati-hati dan jika salah memberikan keterangan, akan sulit dalam pengusutan kasus ini,” ujarnya dan menambahkan, menjelang Idul Fitri, kata dia, kepolisian akan melakukan operasi ketupat dan cipta kondisi untuk memberikan pelayanan dan rasa aman kepada masyarakat. Sasaran operasi ini adalah tempat-tempat keramaian di seluruh Aceh. Dalam kaitan ini, ia mengimbau kepada perkantoran agar lebih waspada terhadap pelaku tindak kejahatan kriminalitas menjelang hari

raya. Perusahaan perlu memperketat keamanan untuk mencegah hal-hal yang tidak diinginkan. Sementara Manager Area Pegadaian Syariah Banda Aceh Hakim Setiawan mengatakan hingga saat ini, pihak Pegadaian Batoh tengah mengidentifikasi kerugian akibat perampokan itu. Hakim menyebutkan, pihaknya segeraa membentuk tim guna mendata kerugian dan proses ganti rugi kepada nasabah. “Nanti akan ada pr oses ganti r ugi sesuai dengan mekanisme,” ujar Hakim. (cb01)

Jamaah, setelah diteliti secara mendalam berbagai kitab sumber yang ada bahwa hadis tersebut tidak berarti menyebutkan kepada hal/perkara yang baru harus disebut kullu atau semuanya bid’ah, apalagi semua dhalalah (sesat) dan masuk neraka, nauzubillah. Pengajian yang diikuti puluhan nahdliyyin dan Ketua Tanfidziyah PWNU Sumut H Ashari Tambunan, H Musaddad Lubis (katib), KH. Asnan Ritonga (Ketua LBM), H Misran Sihaloho (sekretaris), H Makmur Saleh Pasaribu (mustasyar), H Abbas Pulungan (mustasyar), Abrar M. Dawud Faza (wkl. Katib), H Abdul Rahman Harahap (wkl. ketua), H Jaharuddin Batubara (wkl. ketua), H Takbir Siregar (wkl.

ketua), H Khoiruddin Hutasuhut (wkl. sekretaris), Agus Salim Pardede (wkl. sekretaris), Tatang Arbella (wkl. bendahara), unsur PCNU Medan dan Binjai, LBM, LBH, dan masyarakat sekitar. Secara panjang lebar, detail dan jelas H. Akhyar Nasution memaparkan ada ayat Q.s. al-Kahfi 79 yang sesuai dengan kaidah ilmu balaghoh dan nahwu menerangkan makna “kullu” tidak hanya li al-jami’ (semuanya), tapi juga berarti li al-tabi’it (sebagiannya), maka sesuai dengan pandangan jumhur ulama bahwa tidak semua bid’ah itu sesat, bahkan banyak sekali yang termasuk kategori bid’ah hasanah, seperti jumlah rakaat tarawih 20 dan dikerjakan berjamaah, tawassul, ucapan

sayyidina, bacaan bilal tarawih, mandi ‘balimau’, ziarah kubur, istiqhosah, zikir-wirid, yasinan, dan sebagainya. “Jika ada yang menyebutkan itu sesat dan masuk neraka, beranikah mereka memvonis bahwa para sahabat dan ulama termasuk orang-orang yang sesat dan ahli neraka?”, tanya narasumber yang juga alumni Musthafawiyah dan Timur Tengah ini. Di samping itu Prof. Dr. H. Abbas Pulungan (mantan ketua PWNU Sumut 1996) menyerukan kepada nahdliyyin untuk tetap khusyu’ dan konsisten menjalankan akti-vitas amaliah Ramadhannya yang sematamata hanya karena ibadah kepada Allah dan insya Allah melipatgandakannya di bulan suci Ramadhan ini. (m13)

Ekonomi Syariah ....

adalah ditutupnya 16 bank setelah terjadi rush besar-besaran oleh nasabah bank tersebut sehingga kehilangan likuiditasnya. Di tahun 1997 setidaknya sudah merupakan gambaran bagaimana kejatuhan ekonomi kapitalis. Transaksi yang tidak ada back up, surat utang yang tak terawasi, perdagangan valuta asing untuk spekulasi menjadikan Asia Tenggara waktu itu menjadi negara yang paling parah dihantam krisis. Bahkan di Agustus 1997 nilai tukar rupiah kita yang harusnya masih Rp2.430 per dolar AS kemudian melonjak ke level Rp10 ribu. Seperti ingin menyambut hari kemerdekaan di tahun itu, rupiah pun berkibar-kibar hingga kita membutuhkan uluran tangan IMF (international monetary fund). Itu satu bukti kegagalan ekonomi kapitalis. Kedua, kita masih ingat bagaimana di 2008 bank di AS berguguran. Surat utang yang diterbitkan tanpa pengawasan maksimal, penjualan yang bebas membuat salah satu bank terbesar di AS harus tumbang.

Kita ingat di zaman itu subprime mortgage securities. Kredit perumahan di AS yang juga tak bisa dikendalikan. Membuat salah satu bank terbesar di negara itu Lehman Brothers harus tutup dan mem-PHK ribuan karyawannya. Bukti kegagalan kapitalis selanjutnya tentu krisis Eropa yang kita hadapi sejak tahun lalu. Secara signifikan dampaknya belum begitu dirasakan di dalam negeri. Tapi yakinlah jika kita masih tetap pada aliran ekonomi kapitalis itu bukan tidak mungkin krisis demi krisis akan selalu datang. Apa yang selanjutnya harus kita ketahui? Adalah bagaimana Islam memandang krisis. Di MES, kita memang memiliki beberapa orang praktisi, ustadz dan para dosen yang mampu membahas dan mengagendakan ekonomi syariah sebagai aliran ekonomi. Dalam Islam, krisis bisa terjadi kalau praktik atau aktivitas ekonomi yang dilakukan bertentangan dengan nilainilai keislaman. Seperti riba, monopoli, korupsi dan tindakan yang jelas dilarang Allah

Al Bayan ....

mengwisudakan mahasiswanya dengan lulusan yang bermutu dengan titel Muttaqin. Titel ini tidak bisa diperjualbelikan karena Allah SWT yang menganugerahkannya. Seperti universitas lainnya di dunia, tidak semua mahasiswanya dapat lulus dalam waktu yang bersamaan, ada juga yang tercecer, harus mengulangi lagi sejumlah pelajaran. Universitas Ramadhan juga memakai rumus itu, maka Allah menggunakan redaksi “La’allakum Tattaqun” di ujung ayat Albaqarah 183. La’alla bermakna mudahmudahan alias belum pasti. Jika ingin lulus sempurna, mahasiswa harus bersungguh dengan tugas-tugas yang sudah disyariatkan, baik yang wajib maupun yang sunahnya. Para Imam mujtahid,

seperti Imam Syafi’i, Hambali, Bukhari, Muslim, Abu Daud, Ibnu Taimiyah, Ibnu Qayyim, Imam Ghazali, menganjurkan umat Islam untuk mengurangi tidurnya di malam hari. Waktu malam sangat baik untuk menuntut ilmu agama dan ilmu-ilmu umum yang lain. Allah SWT akan memancarkan cahaya ilmu bagi orang-orang yang ingin me-nuntutnya. Imam Syafi’i Rahimahullah menulis kitab Al Uum pada bulan Ramadhan setelah beliau shalat Taraweh sampai menjelang sahur. Begitu juga Hujjatul Islam Imam Ghazali menulis kitab Ihya Ulumuddin dalam bulan Ramadhan. Ramadhan membuat mata orang-orang beriman tidak mengantuk, sebab setan tidak mampu mendekati mereka. Walahu a’lam.

SWT. Para ahli ekonomi Islam sepakat penyebab utama krisis adalah kepincangan antara sektor moneter dan sektor riil. Sektor keuangan berkembang pesat meninggalkan sektor riil. Tercabutnya sektor moneter dari sektor riil yang terlihat dari banyaknya transaksi derivatif, transaksi di dunia maya atau virtual transaction. Semua itu pada prinsipnya penuh riba. Bursa saham, pasar uang atau transaksi surat berharga lain masuk dalam transaksi virtual yang hanya bisa kita lihat suratnya tapi tidak kita dapatkan barangnya. Lihat sekarang kontrak berjangka harga minyak dunia. Saat ini kita sudah tahu harga minyak di bulan September nanti di level berapa. Sementara yang kita miliki bukan minyak, tapi hanya pengakuan atas harga dan jumlah stok yang diperdagangkan. Di dunia ini 95 persen transaksi itu dilakukan dengan virtual. Hanya lima persen saja yang dilakukan dalam bentuk riil. Sehingga wajar malapetaka ekonomi dunia itu datang dari praktik maisir, gharar dan riba yang diharamkan dalam Alquran. Maisir itu bisa judi dan spekulasi, gharar dalam bentuk transaksi derivatif, bisnis berisiko tinggi serta riba adalah mendapatkan keuntungan tanpa transaksi bisnis. Itulah yang berlaku dalam perekonomian umum. Maka semua itu diharamkan dalam ekonomi syariah. Sektor moneter tidak akan pernah meninggalkan sektor riil. Itulah kuncinya. Ketika kita menerbitkan surat utang memang ada aset yang menjamin. Inilah yang sekilas penjelasan awal tentang pentingnya ekonomi syariah. Dan pastinya ekonomi syariah tidak hanya soal perbankan, tapi juga mencakup bursa saham syar iah, asuransi syariah dan juga produk halal.###

Kutuk Pembantian ....

Myanmar. “Kami juga menuntut pemerintah Indonesia untuk ambil sikap sebagai bagian dari masyarakat ASEAN,” ujar dia. Solidaritas untuk muslim Rohingya yang diikuti tigapuluhan aktivis KAMMI Aceh itu hanya berlangsung beberapa menit. Sebab, mereka kemudian dibubarkan oleh sejumlah polisi yang memakai pakaian sipil karena tidak mengantongi izin. Ketua Umum KAMMI Aceh Faisal Qasim meminta polisi untuk mengizinkan mereka membacakan pernyataan sikap mereka terhadap nasib muslim Rohingya yang mengalami penindasan di Myanmar. Dan pernyataan sikap dilakukan di depan pertokoan di kawasan itu. (b07) perekonomian. Maka topiktopik yang saya ulas dalam setiap pertemuan dengan masyarakat dan para pengurus masjid tak jauh-jauh dari ekonomi syariah. Saya masih melihat bahwa aliran ekonomi inilah yang bisa menyelamatkan ekonomi dunia. Bukan hanya ekonomi Indonesia, tapi dunia secara umum. Sebab sebagai ketua masyarakat ekonomi syariah (MES) Sumut sudah sewajarnya saya kerap mengkampanyekan sistem ekonomi itu. Selalu ingin saya tunjukkan kegagalan ekonomi kapitalis memimpin dunia. Krisis finansial berulang kali menerpa. Menurut Luc Leaven dan Valencia (2008) selama 1970 sampai dengan 2007 telah terjadi 429 krisis yang dibagi menjadi124 krisis perbankan, 208 krisis nilai tukar, 63 krisis utang luar negeri, 26 twin crisis, dan 8 triple crisis. Fenomena krisis di Indonesia dan berdampak signifikan adalah yang terjadi pada krisis moneter 1997-1998. Diantara dampak yang ditimbulkan bagi industri perbankan dunia Islam saat ini. Dalam sebuah ceramahnya di televisi Qatar (Ramadhan, 1999) menyebutkan; Ramadhan ibarat sebuah universitas yang tiap tahun melahirkan sarjanasarjana yang berkualitas, sejak strata 1, 2 dan 3. Kurikulum Ramadhan sangat jelas yakni Tatadrus Quran, membaca, mengkaji dan mentadabburkannya, mendalami hadits Nabi, belajar aklak, dan mengamalkannya. Selain ilmu-ilmu syariah, umat Islam juga belajar ekonomi, astronomi, biologi, tehnologi,fisikologi dan seterusnya. Universitas Ramadhan membebaskan manusia dari jahiliyah ke adabiyah, dari keprimitifan kepada kemodernan yang paling benar. Tiap tahun Ramadhan University

Umat Islam ....

WASPADA Senin 30 Juli 2012

Chairuman Dan AY Berimbang Gus Bertahan Di Puncak MEDAN (Waspada): Pembaca Waspada yang militan menjadi pendukung Gus Irawan dan Gatot Pujo Nugroho terus memberikan dukungan signifikan. Posisi terakhir hitungan kupon yang masuk Sabtu (28/7) hingga pukul 16:30, Gus Irawan tetap pada posisi puncak dengan poin 73%. Sementara Gatot Pujo Nugroho 21%. Sementara untuk posisi ketiga, nama Cornel Simbolon yang sempat bertahan dengan poin 2% melorot menjadi 1%. Sedangkan Chairuman Harahap dan AY Nasution masingmasing naik menjadi 2%. Kedua kubu pendukung sementara ini memiliki kekuatan yang berimbang. Sedangkan nama-nama lain seperti Erry Nuradi, Amri Tambunan, Syah Afandin, Anuar Shah Sutan Bhatoegana dan lain-lain belum juga terdongkrak untuk mendapatkan poin karena jumlah kupon yang dikirim belum signifikan untuk dicatatkan dalam bursa Gu b s u P i l i h a n Pembaca

Waspada. Panitia kembali mengimbau pembaca yang ingin berpartisipasi dalam mengangkat nama calonnya dapat mengisi kupon Gubsu Pilihan Pembaca Waspada yang terdapat di halaman Politik dan Hu-

18.000 Perkara ....

mad, SH, MH dan unsur FKPD Sumut lainnya, Ketua MUI Sumut Prof DR Abdullah Syah, MA, para hakim, panitera dan beberapa SKPD Sumut di antaranya Kepala Badan Kesbangpol Linmas Sumut Drs H Eddy Syofian, MAP. Acara diawali pembacaan ayat suci Alquran, dilanjutkan siraman rohani oleh Al Ustad Dr KH Amiruddin, MS. Setelah berbuka dilanjutkan shalat Maghrib dan Isya serta Tarawih berjamaah di Mushallah Baitul Haq Pengadilan Tinggi Sumut. Murni mengemukakan, untuk perkara perdata termasuk 5 besar adalah masalah sengketa tanah, perceraian, tuntutan ganti rugi, sengketa warisan serta persetujuan/ perjanjian kerja. Hj Marni Emmy Mustafa mengimbau kerja sama antar aparat penegak hukum harus terjalin sehingga ada kesatuan visi dan misi ke depan bagaimana menciptakan Kota Medan ini memberikan rasa aman dan damai serta ketenangan bagi warganya dari tindak kejahatan.

“Dari data yang terungkap ini adalah tugas kita bersama untuk mencari akar permasalahan yang melatarbelakangi terjadinya tindak kejahatan di Provinsi Sumut dan selanjutnya secara bersama-sama pula berupaya semaksimal mungkin menemukan solusi yang tepat untuk mencegah dan mengurangi tindak kejahatan tersebut. Selain kerjasama yang lebih baik antar para aparat penegak hukum, lanjutnya, peran serta masyarakat sangat dibutuhkan. Penyuluhan hukum untuk meningkatkan kesadaran berbangsa dan bernegara, kesadaran masyarakat untuk patuh dan taat kepada hukum dan peraturan perundang-undangan yang berlaku sudah saatnya untuk ditingkatkan. “Di samping itu yang paling penting untuk menemukan solusi memecahkan persoalan- hukum diperlukan adanya kekuatan besar breakthrough, berarti harus menjebol dengan kekuatan yang besar oleh pemimpin,” ujarnya. (m28)

Lembaran Alquran....

menemukan sejumlah mercon yang belum meledak, dibalut dengan kertas sama,” tambah Mahmuddin. Pelecehan Dan Penghinaan Ketua Majelis Permusyaratan Ulama (MPU) Tanah Jambo Aye, Tgk Ramli Syam, yang dikonfirmasi terpisah membenarkan potongan kertas mercon yang ditemukan Nurdin, merupakan lembaran kitab suci Alquran. “Ketika pertama mengetahui kasus ini, saya langsung teringat masa PKI dulu. Modusnya serupa. Dulu lembar Alquran diselipkan di bawah bangku atau alas kaki dengan tujuan terduduki atau terinjakinjak. Dalam kasus mercon ini, pelaku juga bertujuan sama. Mereka ini antek-antek komunis,”tuding Tgk Ramli. Masih menur ut Tgk Ramli, mercon dari lembaran Alquran sengaja diciptakan pihak tertentu untuk melecehkan dan menghina Islam. Pemerintah bersama aparat penegak hukum harus mengu s u t n y a s a m p a i t u n t a s. Siapapun yang terlibat harus

ditangkap dan dihukum sesuai undang-undang berlaku. “Jangan sampai ada bahasa di masyarakat; yang membakar mercon sama dengan membakar Alquran. Kalau ini terjadi, yang rawan ribut bukan saja muslim dengan non muslim. Sesama muslim juga rawan bentrok karena yang membakar mercon juga ada dari kalangan muslim. Jadi, sebelum ribut besar terjadi, sebaiknya polisi menyita semua mercon yang terbuat dari lembaran Alquran, sehingga tidak lagi beredar di masyarakat,”anjurnya. Tgk Ramli juga mengimbau para pedagang mercon tidak lagi menjual mercon yang dibalut dengan lembar Alquran, karena perbuatan itu sama saja dengan membantu pelaku dan uang yang dihasilkan dari menjual mercon seperti itu hukumnya haram. “Jika ada pedagang yang sudah tahu mercon itu terbuat dari lembar Alquran, tapi masih dijual juga, berarti dia juga ikut melecehkan Islam,”tandasnya. (b19)

menghadiri acara berbuka puasa bersama jajaran Pengadilan Tinggi Sumut dengan Forum Koordinasi Pimpinan Daerah (FKPD) Sumut di Kantor Pengadilan Tinggi Sumut, Jumat (27/7) sore. Ketua PT Sumut Dr Hj Marni Emmy Mustafa, SH, MH mengungkapkan, 18.000 perkara dimaksud meliputi pengadilan-pengadilan negeri se wilayah hukum PT Sumut pada 2011. Sepuluh besar perkara pidana yang telah diputus di Provinsi Sumut meliputi perjudian, pencurian, narkotika, penganiayaan, penggelapan, perbuatan asusila, kejahatan terhadap perlindungan anak, penipuan, kejahatan terhadap pengrusakan barang dan penadahan. “Dari sekian kejahatan yang terjadi, 17.935 dilakukan oleh pria, 1.085 oleh kaum wanita dan 869 dilakukan anak-anak,” ujar Murni. Hadir Ketua DPRD Sumut HM Saleh Bangun, Pangdam I/BB Mayjen TNI Lodewijk F Paulus, Kajatisu Dr Noor RahSeunuddon, Aceh Utara, Jumat (27/7) pagi. Hari itu, Nurdin berdagang bedak di Desa Tanjong Dalam, Kec. Langkahan, Aceh Utara. Anak-anak di sekitar lokasi pasar, kebetulan sedang ber main mercon. Tanpa sengaja, Nurdin menemukan potongan kertas mercon yang sudah meledak menyerupai tulisan arab dan setelah diteliti ter nyata isinya ayat suci Alquran. Temuan ini kemudian dilaporkan Nurdin kepada Ketua Pasar Pekan Pantonlabu, Kec. Tanah Jambo Aye, Aceh Utara, Mahmuddin, 45, dan Mahmuddin meneruskan laporan itu ke Ketua Majelis Permusyaratan Ulama (MPU) Tanah Jambo Aye, Tgk Ramli Syam. “Ironisnya, lembaran Alquran yang dipakai untuk membungkus mercon itu masih baru dan jumlahnya tidak hanya satu dua. Hampir semua potongan kertas dari mercon yang sudah dibakar anak-anak tertulis ayat suci Alquran. Bahkan kami juga

kum, kemudian mengirimkan kupon itu ke Kantor Harian Waspada Jl. Brigjen Katamso no. 1 Medan. Pengiriman kupon sebaiknya segera dilakukan karena tenggang waktu yang tersisa semakin sedikit. (tim)

Gubsu Pilihan Pembaca Waspada 29 Juli 2012 Sampai Pukul 16:30


A2

Berita Utama

HAM Alasan Paling Ampuh Berkembangnya Aliran Sesat MA, anggota DPRD, SKPD, alim ulama, tokoh masyarakat, pendidik, serta mahasiswa STAI Sekh HA Abd.Halim Hasan , Al Islahiyah, pimpinan organisasi Islam , menegaskan, pendidik dan pengurus organisasi Islam, ustad, harus mewaspadai berbagai aliran sesat yang kini subur di tanah air. Termasuk aliran Ahmadiyah, Paham Lia Eden , Inkar Sunnahyangmenolakhadistnabi dan berpegang pada Alqur-an saja, sampai jumlah shalat dan rakaatnya berdasarkan musya-warah dan mufakat jamaah. Di Sumatera Utara, terdapat di Marelan, Medan, ada M. Hirfi Nuzlan , mengaku berteman dengan Jibril. Soul Training berpegang pada Quran saja, tidak hadist. Aliran Al Haqa di P. Siantar, menekankan kerahasiaan dan pengorbanan dengan Rp300.000 akan masuk surga. Di Kab. Langkat, ada pengajian yang mengubah-ubah ayat Alquran. Pengurus MUI Kab.Langkat

Pembubaran Asmara ... Tidak terima temannya ditangkap, ratusan remaja menghadang mobil patroli polisi tersebut. Sempat terjadi ketegangan antara ratusan remaja dengan sejumlah polisi. Saat itu, Kasat Binmas Polresta Medan Kompol A Hutauruk yang berada di lokasi mencoba mendinginkan suasana dan berdialog dengan para remaja tersebut. Puluhan personel TNI/Polri menghalau kerumunan massa yang menghadang mobil patroli polisi tersebut. Operasi penertiban di kawasan kanal Titikuning dan Ringroad, Medan Sunggal itu dipimpin Kabag Ops Polresta Medan Kompol SF Napitu, SH, SIK, dibantu Kasat Binmas Polresta Medan Kompol A Hutauruk, SH. Sedikitnya 27 personel Polwan, 10 personel Satlantas, 20 personel Sabhara, dua personel Provost, enam personel Reskrim, dua dari Majelis Ulama Indonesia (MUI) dibantu Polsek Delitua dan Polsek Sunggal. Dalam operasi itu, Kabag Ops Polresta Medan Kompol SF Napitu, SH, SIK, sebelumnya memberikan pengarahan kepada para personel di lapangan Mapolresta Jln. HM Said Medan, agar melakukan penertiban itu jangan ada yang bertindak anarkis. Usai mengarahkan, personel menaiki empat truk dari Sabhara Polresta Medan dan Sat Pol PP Medan dan Sat Pol PP Pemkab Deliserdang, ada juga mengendarai sepedamotor trail dan mobil. Selanjutnya, personel mengambil titik kumpul di depan Asrama Haji Medan. Setelah itu, mereka menuju ke Kanal Titikuning mengusir ribuan warga yang sedang ngumpul di lokasi itu. Melihat lokasi sepi, petugas terus menuju ke Jln. Ringroad, Kecamatan Medan Sunggal. Disana, ribuan pengendara sepedamotor baik yang nongrong dan melintas dengan berkomvoi langsung dibubarkan. Mengentasi terjadi hal tidak diinginkan, Kabag Ops Polresta Medan menghimbau kepada warga melakukan asmara subuh dan balapan liar melalui pengeras suara agar meninggalkan lokasi itu dan pulang ke rumah masing-masing. Apabila masih ada yang memandel, akan dilakukan penilangan oleh Satlantas Polresta Medan.Mendengar arahan Kabag Ops Polresta Medan, ribuan warga yang berkumpul kabur meninggalkan lokasi tersebut. Kapolresta Medan Kombes Pol Monang Situmorang, SH, MSi didampingi Kabag Ops Kompol SF Napitu, SH, SIK, dan Kasat Narkoba Kompol Dony Alexander, SH, SIK, M.Hum mengatakan, penertiban itu dilakukan agar suasana bulan suci Ramadhan di wilayah hukumnya tetap kondusif. Gebrakan ini sesuai instruksi Kapoldasu Irjen Pol Drs HWisjnu Amat Satro, SH, ungkap Monang. Menurutnya, operasi menindaklanjuti keputusan MUI yang mengharamkan asmara subuh selama Ramadhan sekaligus mencegah kerusuhan. (m36/m25)

Plt Gubsu Beri ... “Dari sekian kejahatan yang terjadi, 17.935 dilakukan oleh pria, 1.085 oleh kaum wanita dan 869 dilakukan anak-anak,” ujar Murni. Hadir Ketua DPRD Sumut HM Saleh Bangun, Pangdam I/BB Mayjen TNI Lodewijk F Paulus, Kajatisu Dr Noor Rahmad, SH, MH dan unsur FKPD Sumut lainnya, Ketua MUI Sumut Prof DR Abdullah Syah, MA, para hakim,paniteradanbeberapaSKPD SumutdiantaranyaKepalaBadan Kesbangpol Linmas Sumut Drs H Eddy Syofian, MAP. Acara diawali pembacaan ayat suci Alquran, dilanjutkan siraman rohani oleh Al Ustad Dr KH Amiruddin, MS. Setelah

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Bf7+, Rh8. 2. Ma8+, Me8. 3. MxM+mat.

Jawaban TTS: TTS Topik

Santapan Ramadhan

Jawaban Sudoku: 6 9 7 4 1 8 5 3 2

1 2 3 5 9 6 4 7 8

4 5 8 3 7 2 6 9 1

7 4 2 8 3 5 9 1 6

5 3 9 7 6 1 8 2 4

8 6 1 9 2 4 7 5 3

3 8 6 2 5 7 1 4 9

2 7 4 1 8 9 3 6 5

9 1 5 6 4 3 2 8 7

berbuka dilanjutkan shalat Maghrib dan Isya serta Tarawih berjamaah di Musalla Baitul Haq Pengadilan Tinggi Sumut. Murni mengemukakan, untuk perkara perdata termasuk 5 besar adalah masalah sengketa tanah, perceraian, tuntutan ganti rugi, sengketa warisan serta persetujuan/perjanjian kerja. Hj Marni Emmy Mustafa mengimbau kerja sama antar aparat penegak hukum harus terjalin sehingga ada kesatuan visi dan misi ke depan bagaimana menciptakan Kota Medan ini memberikan rasa aman dan damai serta ketenangan bagi warganya dari tindak kejahatan. “Dari data yang terungkap ini adalah tugas kita bersama untuk mencari akar permasalahan yang melatarbelakangi terjadinya tindak kejahatan di Provinsi Sumut dan selanjutnya secara bersama-sama pula berupaya semaksimal mungkin menemukan solusi yang tepat untuk mencegah dan mengurangi tindak kejahatan tersebut. Selain kerjasama yang lebih baik antar para aparat penegak hukum, lanjutnya, peran serta masyarakat sangat dibutuhkan. Penyuluhan hukum untuk meningkatkan kesadaran berbangsa dan bernegara, kesadaran masyarakat untuk patuh dan taat kepada hukum dan peraturan perundang-undangan yang berlaku sudah saatnya untuk ditingkatkan. “Di samping itu yang paling penting untuk menemukan solusi memecahkan persoalanhukum diperlukan adanya kekuatan besar breakthrough, berarti harus menjebol dengan kekuatan yang besar oleh pemimpin,” ujarnya. (m28)

Drs. Ishaq Ibrahim,MA, sebagai moderator menambahkan, aliran sesat di Kab. Langkat, cukup banyak dan pengikutnya banyak juga terdapat warga kota Binjai. Seperti di Bahorok ada 23 aliran dengan bervariasi. Kemudian Suhedi yang mengaku nabi di Kwala, diTanjung Jati ada mengklaim sebagai Cokroaminoto , yang mengajarkan, puasa tidak wajib, karena menyiksa badan. Istri pertama wajib mencarikan istri kedua kepada suaminya, begitu juga berikutnya. Prof. Ramli AbdulWahid , menyebutkan kreteria sesat ada 10. Seperti mengingkarisalahsaturukunimandan rukun Islam. Meyakini akidah yang tak sesuai dengan dalil syar’i. KemudianmengingkariNabi Muhammadsebagainabiterakhir, mengubah atau mengurangi pokok-pokokibadahyangditetapkan syariat, seperti naik haji, tidak ke Baitullah. Mengkafirkan sesama muslim, hanya untuk kepentingan kelompoknya. Indikasi awal sesat , bisa di perhatikan, seperti pengajian dilakukan secara rahasia dan tertutup. Untuk membendung tumbuhnya aliran sesat di Indonesia, Ustad Ramli Abdul Wahid berharap pembekalan umat Islam dengan ilmu agama, sehingga islam terdefinisi. Sosialisasi aliran sesat dan paham sesat, seperti lembaga pendidikan dan kantor. Ketua MUI Binjai DR. HM Jamil, MA didampingi Sekum Jafar Sidik, Sag menjelaskan, Muzakarah untuk memberikan pencerahan agama dan peningkatan aqidah dan iman, Muzakarahpimpinan orgasisasi Islam, mahasiswa, Ustad, Guru pendidikan Islam dan kelompok pengajian kaum ibu , dan majlis taklim se kota Binjai. Muzakarah dilaksanakan setiap Minggu. Pada Minggu ( 5/8) pembicaranyagurubesarhukumIslamUSU, Prof. Dr. H. Hasbalah Thaib, MA. Dengan topik Ramadhan dan ekonomi Islam. (a04)

Chairuman Dan AY ... Sementara untuk posisi ketiga, nama Cornel Simbolon yang sempat bertahan dengan poin 2% melorot menjadi 1%. Sedangkan Chairuman Harahap dan AY Nasution masingmasing naik menjadi 2%. Kedua kubu pendukung sementara ini memiliki kekuatan yang berimbang. Sedangkan nama-nama lain seperti Erry Nuradi, Amri Tambunan, Syah Afandin, Anuar Shah, Sutan Bhatoegana dan lain-lain belum juga terdongkrak untuk mendapatkan poin karena jumlah kupon yang dikirim belum signifikan untuk dicatatkan dalam bursa Gubsu Pilihan Pembaca Waspada. Panitia kembali mengimbau pembaca yang ingin berpartisipasi dalam mengangkat nama calonnya dapat mengisi kupon Gubsu Pilihan Pembaca Waspada yang terdapat di halaman Politik dan Hukum, kemudian mengirimkan kupon itu ke Kantor Harian Waspada Jl. Brigjen Katamso no. 1 Medan. Pengiriman kupon sebaiknya segera dilakukan karena tenggang waktu yang tersisa semakin sedikit. (tim)

Umat Islam ...

Senin 30 Juli 2012

Pejabat Dan Anggota Dewan Dilarang Terima Parcel

Guru Besar IAIN Sumut Prof.Dr.H.Ramli Abdul Wahid,MA :

BINJAI ( Waspada ) : Guru besar ilmu hadis IAIN Sumut Prof.Dr. Drs. H. Ramli Abdul Wadid, LC, MA, menilai berkembangnya aliran sesat di Indonesia, dimulai sejak krisis moneter tahun 2007. Perkembangannya tidak sesuai dengan Alquran dan hadist dan sulit ditoleransi. Apalagi HAM merupakan alasan yang paling ampuh digunakan bagi berkembangnya aliran sesat. Hal itu dikemukakan Ramli pada Muzakarah Ramadhan yang diselenggarakan MUI Kota Binjai , Minggu ( 29/7) , dengan thema :Ramadhan dan aliran sesat, di kantor MUI Jl. Olahraga. Muzakarah dibukaWali Kota Binjai HM Idaham, SH, MSI , diharapkan dapat meningkatkan ilmu dan pengetahuan , sehingga mampu menangkal umat Islam di Binjai terlibat aliran sesat. Ramli Abdul Wahid pada muzakarahyangjuga dihadiri Ka Kemenag Kota Binjai H. Al Ahyu,

WASPADA

Reuters

PARA pria berdiri di atas kendaraan yang dibalikkan ketika penduduk setempat berkumpul untuk memprotes terhadap rencana pembangunan penampungan air limbah di Qidong, China, Sabtu (28/7).

Kota China Batalkan Proyek Air Limbah QIDONG (AP): Pihak berwenang di China timur membatalkan rencana untuk membangun proyek air limbah setelah ribuan pemrotes yang marah tentang polusi turun ke jalan. Protes itu merupakan konfrontasi terbaru di negara tersebut, di mana selama tiga dasawarsa ekspansi ekonomi yang cepat mengorbankan lingkungan. Sebagian pemrotes di Qidong di Provinsi Jiangsu bentrok dengan polisi. Setelah protes Sabtu (28/7), pemerintah Qidong mengumumkan di websitenya, rencana untuk mem-

bangun proyek air limbah tersebut dibatalkan. Kantor berita Xinhua News Agency mengatakan ribuan warga turun ke jalan namun berhasil dibubarkan setelah pemerintah mengeluarkan pengumuman. Sabtusoreratusanpolisi,sebagian dengan alat anti huruhara, tiba di kota pantai di utara Shanghai dan mengambil posisi di luar perkantoran pemerintah. Proyek air limbah itu merupakan bagian dari satu pabrik pembuatan kertas yang diusulkan perusahaan Jepang, Oji Paper Group di kota Nantong. (m10)

KAMMI Kutuk Pembantaian Muslim Rohingya BANDA ACEH (Waspada): Kesatuan Aksi Mahasiswa Muslim Indonesia (KAMMI) Aceh melakukan demo di Simpang Lima Banda Aceh, Minggu (29/7). Mereka menuntut pemerintah Myanmar menghentikan pembasmian etnis Rohingya di Myanmar. “Kita mengutuk segala bentuk genosida dan kejahatan terhadap kemanusiaan warga Rohingya baik di dalam maupun di luar Myanmar,” ujar Koordinator Aksi KAMMI, Darlis, di sela-sela aksi keprihatinan itu. Kepada pemerintah Indonesia, KAMMI meminta untuk mengakomodasi para pengungsi Rohingya yang terdampar di perairan Indonesia. “Kita harapkan Indonesia terus berjuang dalam ranah diplomasi regional dan internasional dalam memperjuangkan kesamaan hak,” katanya. (b07)

eksistensinya. Ada beberapa kelompok yang sekedar kongkow di pinggir jalan, ada juga yang selalu mengitari bundaran stadion, dan ada pula yang melakukan atraksi ringan dengan sepeda motornya sehingga menjadi perhatian warga. Aparat kepolisian dari Polsek Medan Kota seperti biasanya mengawasi setiap kegiatan dilakukan muda-mudi itu. Polisi juga mengitari luar stadion menggunakan patroli, sebagian yang lain berpakaian preman. Setelah hari mulai terang, petugas mulai melakukan penertiban mengamankan sepeda motor yang tidak memakai plat dan knalpot blong. Suasana penertiban membuat para remaja itu membubarkan diri, tetapi kemudian mengumpul lagi. Petugas kembali berupaya membubarkan kumpulan remaja dengan pengeras suara, namun tidak begitu ditanggapi sehingga kemudian dilakukan penangkapan kepada. Saat penangkapan sepeda motor itu, salah seorang pemuda sempat menolak sepeda motornya yang tanpa plat dan knalpot blong diamankan. Dia tetap bersikeras menahan sepeda motornya ketika polisi hendak mengamankannya, sehingga sempat terjadi adu mulut. Karena tetap bersikeras

polisi mengambil paksa sepeda motor tersebut, tetapi pemuda itu tetap berusaha mempertahankannya, membuat beberapa polisimenjadikesal.Diakemudian dibekap layaknya perampok, kemudian bersama sepeda motornya dibawa paksa ke Mapolsek. KapolsekMedanKotaKompol Sandy Sinurat di lokasi mengatakan,sepedamotoritudiamankan karena tidak dilengkapi plat dan knalpotnya blong. “Juga sudah dirombak-rombaksehinggatidak jelaslagijenisnya,sepertikerangka saja,” sebut Sandy. Dalam sehari ini, setidaknya 45 sepeda motor diamankan dari kawasan Stadion Teladan, termasuk dua di antaranya dari kelompok motor 250 cc. Dua sepeda motor kapasitas cc besar itu diamankan karena menggeber-geber gasnya, dan tak memasang plat di kendarannya. Mereka saat itu bergerombol sekitar belasan orang. Penahanan sepeda motor 250 cc itu juga menjadi perhatian, karena pengendaranya bersama teman-temannya berusaha menghalangi petugas. Karena sepeda motor itu ditahan, mereka kemudian memarkirkan belasan sepeda motor besarnya di depan Mapolsek, dan di antara mereka berusaha melobby petugas untuk melepaskan sepeda motor itu, namun tidak digubris sampai mereka melengkapi kendarannya.(m27)

sesuai dengan paradigma Islam Ahlus Sunnah wal Jamaah, setelah diteliti secara mendalam berbagai kitab sumber yang ada bahwahadistersebuttidakberarti menyebutkankepadahal/perkara yang baru harus disebut kullu atau semuanya bid’ah, apalagi semua dhalalah (sesat) dan masuk neraka, nauzubillah. Pengajian yang diikuti puluhan nahdliyyin dan Ketua Tanfidziyah PWNU Sumut H Ashari Tambunan, H Musaddad Lubis (katib), KH. Asnan Ritonga (Ketua LBM), H Misran Sihaloho (sekretaris), H Makmur Saleh Pasaribu (mustasyar), H Abbas Pulungan (mustasyar), Abrar M. Dawud Faza (wkl. Katib), H Abdul Rahman Harahap (wkl. ketua), H Jaharuddin Batubara (wkl. ketua), H Takbir Siregar (wkl. ketua), H Khoiruddin Hutasuhut (wkl. sekretaris), Agus Salim Pardede (wkl. sekretaris), Tatang Arbella (wkl. bendahara), unsur PCNU Medan dan Binjai, LBM, LBH, dan masyarakat sekitar. Secara panjang lebar, detail dan jelas H. Akhyar Nasution memaparkan ada ayat Q.s. alKahfi 79 yang sesuai dengan kai-

dah ilmu balaghoh dan nahwu menerangkan makna “kullu” tidak hanya li al-jami’ (semuanya), tapi juga berarti li al-tabi’it (sebagiannya), maka sesuai dengan pandangan jumhur ulama bahwa tidak semua bid’ah itu sesat, bahkan banyak sekali yang termasukkategoribid’ahhasanah, seperti jumlah rakaat tarawih 20 dandikerjakanberjamaah,tawassul,ucapansayyidina,bacaanbilal tarawih, mandi ‘balimau’, ziarah kubur, istiqhosah, zikir-wirid, yasinan, dan sebagainya. “Jika ada yang menyebutkan itu sesat dan masuk neraka, beranikah mereka memvonis bahwa para sahabat dan ulama termasuk orang-orang yang sesat dan ahli neraka?”, tanya narasumber yang juga alumni Musthafawiyah dan Timur Tengah ini. Di samping itu Prof. Dr. H. Abbas Pulungan (mantan ketua PWNUSumut1996)menyeru-kan kepada nahdliyyin untuk tetap khusyu’dankonsistenmenjalankan aktivitas amaliah Ramadhannya yang semata-mata hanya karena ibadah kepada Allah dan insya Allahmelipatgandakannyadibulan suci Ramadhan ini. (m13)

Muda-mudi Masih ...

Ada-ada Saja ...

diungkapkan Imam Syafi’i bahwa bid’ah hasanah adalah “segala perkara yang bersifat baru, baik, dan sengaja diciptakan dengan tidak menyalahi Alquran, sunnah,ijma’ danatsar,” sementara bid’ah yang sesat pun bervariasi, ada yang makruh dan ada yang haram,” kata Akhyar Nasution, Sabtu (28/7). Adapun hadis yang menyebutkan setiap (kullu) bid’ah adalah sesat bersumber dari HR. Bukhari, dan ditambah dengan ungkapan “setiap kesesatan berada di neraka”, bersumber dari HR. Baihaqi, di samping itu ada lagi hadis dari Muslim dan Bukhari yang maksudnya “suatu amalan yang bukan berasal dari Nabi SAW maka ditolak”, menurut H. Akhyar Nasution, harus dipahami dengan seksama, bijaksana, dan tidak sepihak dengan cakrawala yang komprehensif. Misalnya dengan mengaitkan hadis tersebut dengan Alquran, hadis yang lain, dan kesepakatan (ijma’) sahabat, ijma’ ulama dan seterusnya. Lanjut Akhyar Nasution,

perempuan yang dinikahinya itu lupa menambahkan wortel dihidangan kacang polong favoritnya. Kejadian ini sendiri terjadi pada awal Ramadhan lalu. Demikian seperti dilansir Emirates247, Minggu (29/7). Kisah ini diawali ketika pria itu tiba di rumah sesaat sebelum waktu berbuka puasa. Pria itu langsung menuju ke dapur untuk memeriksa masakan yang akan disajikan oleh sang istri. Ketika ia mengangkat tutup panci ia tidak menemukan adanya potongan wortel yang dicampurkan dengan kacang polong. Pria ini pun langsung memanggil sang istri untuk menanyakan hal tersebut. Sang istri mengaku ia lupa menambahkan wortel. Pria ini pun langsung menceraikan istrinya beberapa menit sebelum ia berbuka puasa. (ok/rzl)

Prof Dr Syeikh M. Yusuf Qardhawy adalah ulama besar dunia Islam saat ini. Dalam sebuah ceramahnya di televisi Qatar (Ramadhan, 1999) menyebutkan; Ramadhan ibarat sebuah universitas yang tiap tahun melahirkan sarjanasarjana yang berkualitas, sejak strata 1, 2 dan 3. Kurikulum Ramadhan sangat jelas yakni Tadarus Quran, membaca, mengkaji dan mentadabburkannya, mendalami hadits Nabi, belajar akhlak, dan mengamalkannya. Selain ilmu-ilmu syariah, umat Islam juga belajar ekonomi, astronomi, biologi, tehnologi,fisikologi dan seterusnya. Universitas Ramadhan membebaskan manusia dari jahiliyah ke adabiyah, dari keprimitifan kepada kemodernan yang paling benar. Tiap tahun Ramadhan University mengwisudakan mahasiswanya dengan lulusan yang bermutu dengan titel Muttaqin. Titel ini tidak bisa diperjualbelikan karena Allah SWT yang menganugerahkannya. Seperti universitas lainnya di dunia, tidak semua mahasiswanya dapat lulus dalam waktu yang bersamaan, ada juga yang tercecer, harus

Al Bayan ...

mengulangi lagi sejumlah pelajaran. Universitas Ramadhan juga memakai rumus itu, maka Allah menggunakan redaksi “La’allakum Tattaqun” di ujung ayat Albaqarah 183. La’alla bermakna mudah-mudahan alias belum pasti. Jika ingin lulus sempurna, mahasiswa harus bersungguh dengan tugas-tugas yang sudah disyariatkan, baik yang wajib maupun yang sunahnya. Para Imam mujtahid, seperti Imam Syafi’i, Hambali, Bukhari, Muslim, Abu Daud, Ibnu Taimiyah, Ibnu Qayyim, Imam Ghazali, menganjurkan umat Islam untuk mengurangi tidur-nya di malam hari. Waktu malam sangat baik untuk menuntut ilmu agama dan ilmu-ilmu umum yang lain. Allah SWT akan memancarkan cahaya ilmu bagi orang-orang yang ingin menuntutnya. Imam Syafi’i Rahimahullah menulis kitab Al Uum pada bulan Ramadhan setelah beliau shalat Taraweh sampai menjelang sahur. Begitu juga Hujjatul Islam Imam Ghazali menulis kitab Ihya Ulumuddin dalam bulan Ramadhan. Ramadhan membuat mata orang-orang beriman tidak mengantuk, sebab setan tidak mampu mendekati mereka. Walahu a’lam.

MEDAN (Waspada): Pemberian parcel di hari lebaran masih menjadi budaya di kalangan masyarakat. Namun, pemberian sekecil apapun kepada pejabat ataupun anggota dewan mengandung makna yang tersirat. Oleh karena itu, untuk menghindari terjadinya peluang praktek Korupsi, Kolusi dan Nepotisme (KKN), seluruh pejabat di jajaran Pemerintah Kota (Pemko) Medan dan anggota DPRD Medandilarangmenerimaparcel baik dari mitra kerja maupun dari bawahannya. Demikian dikatakan Wali KotaMedanRahudmanHarahap dan Ketua DPRD Medan Amiruddinkepadawartawan,Minggu (29/7). “Kita tidak dibenarkan seluruh pejabat di jajaan Pemko Medan menerima parcel. Kita larang itu,” tegas Rahudman. Dikatakannya, dirinya melarang pejabat di jajaran Pemko Medan untuk menerima parcel yang berbentuk keranjang maupun parcel dalam bentuk lainnya. Untuk menegaskan kebijakan tersebut, dalam waktu dekat pihaknya akan mengeluarkan surat edarannya ke seluruh jajaran dan struktur pimpinan Satuan Kerja Perangkat Daerah (SKPD). Apalagi, lanjutnya, seperti tahun sebelumnya Komisi Pemberantasan Korupsi (KPK) sudah memberi peringatan agar pejabat pemerintahan tidak menerima parcel. Larangan yang sama juga dilontarkan oleh Ketua DPRD Medan Amiruddin. “Saya minta anggota DPRD Medan tidak menerima segala bentuk gratifikasi pada lebaran tahun ini, termasuk dalam bentuk parcel, itu harus dihindari, meskipun itu sifatnya sebagai

satu ucapan terima kasih,” tegas Amiruddin. Menurutnya, ucapan terimah kasih tidak seharusnya dengan pemberian parcel. “ Kan pasti akan ada kecurigaan, karena pasti ada sesuatu di balik ucapan terima kasih itu. Kalau mau mengucapkan terima kasih saya pikir tak perlu dengan pemberian parcel,” ucapnya. Dikatakannya, alasan larangan menerima parcel untuk menghindari terjadinya KKN. Karena, orang yang memberi sesuatu kepada pejabat, biasanya mengharapkan suatu balasan dan seharusnya pejabat terkait harus menghindari ini. Menurutnya, walaupun pemberian tersebut nilainya terbilang kecil seperti parcel, tapi hal ini dapat menimbulkan citra negatif bagi sang pejabat. “Parcel kan nilainya tidak besar, tapi masyarakat akan berpandangan negatif bila pejabat menerimanya, ini harus dihindari karena imagenya jelek,” katanya.

Seperti tahun sebelumnya, KPK telah mengingatkan pejabat di seluruh daerah di Indonesia supaya tidak menerima parcel pada lebaran tahun ini. Peringatan ini juga telah dilakukan pada tahun-tahun sebelumnya setiap menjelang hari besar keagamaan. Karena, penerimaan parcel di kalangan pejabat sudah masuk kategori gratifikasi, atau terima uang/barang dan terancam sanksi pidana. Hal ini sesuai UU No 20 Tahun 2001 Tentang Pemberantasan Tindak Pidana Korupsi dengan ancaman pidana penjara seumur hidup atau minimal 4 tahun dengan denda paling sedikit Rp200 juta hingga Rp1 miliar. Dan pemerintah telah mengajukan batasan pemberian minimal Rp250 ribu telah termasuk kategori gratifikasi. Diingatkan pula bagi pejabat yang telah terlanjur menerima parcel supaya segera melaporkan ke KPK untuk menghindari dugaan suap. (m50)

Ratusan Jamaah Umroh ... tersebut,” kata Sekretaris Fraksi PKS itu. Sejak kemarin, ratusan jamaah umroh asal Indonesia terlantar di Jeddah, Arab Saudi. Penyebabnya adalah, jamaah umroh yang menggunakan maskapai Saudi Arabian Airlines dengan kode penerbangan SV 816 jurusan Jeddah- Jakarta hingga pukul 14:00 waktu setempat belum juga membawa jamaah dari Jeddah. “Seharusnya, sejak kemarin sudah diberangkatkan, tapi hingga saat ini, maskapai belum juga memberangkatkan kami,” kata Daniel Nafis, salah seorang jamaah umroh. Menurut Nafis, maskapai tersebut tidak memberikan alasan yang jelas soal penundaan keberangkatan tersebut. “Padahal paspor, visa sudah ada pada mereka (maskapai). Mereka hanya bilang masih koordinasi,” sebut Nafis. Nafis menyebutkan, akibat ulah maskapai tak bertanggung jawab itu, para jamaah, terutama ibu-ibu, bapak-bapak yang sudah tua dan renta terlihat mulai letih dan tak berdaya. “Sampai saat ini, belum ada bantuan dan advokasi dari konjen ataupun dari KBRI Indonesia,” pungkas Nafis.

Ekonomi Syariah ... memberi saya porsi berceramah, ada pula hanya bersilaturrahmi, bertemu jamaah. Saya nikmati itu sebagai salah satu pola berbaur dengan masyarakat. Memang ada beberapa masjid yang jumlah jamaahnya sampai ribuan ada pula ratusan orang. Semua itu menunjukkan bahwasesungguhnyakitainisamatanpadibedakan oleh pangkat, golongan, harta dan keturunan. Ketika kerap memberikan ceramah tentang Islam saya selalu teringat kembali dengan ekonomi syariah yang selalu ingin kita jadikan basis dan acuan dasar dalam perekonomian. Maka topik-topik yang saya ulas dalam setiap pertemuan dengan masyarakat dan para pengurus masjid tak jauh-jauh dari ekonomi syariah. Saya masih melihat bahwa aliran ekonomi inilah yang bisa menyelamatkan ekonomi dunia. Bukan hanya ekonomi Indonesia, tapi dunia secara umum. Sebab sebagai ketua masyarakat ekonomi syariah (MES) Sumut sudah sewajarnya saya kerap mengkampanyekan sistem ekonomi itu. Selalu ingin saya tunjukkan kegagalan ekonomi kapitalis memimpin dunia. Krisis finansial berulang kali menerpa. Menurut Luc Leaven dan Valencia (2008) selama 1970 sampai dengan 2007 telah terjadi 429 krisis yang dibagi menjadi124 krisis perbankan, 208 krisis nilai tukar, 63 krisis utang luar negeri, 26 twin crisis, dan 8 triple crisis. Fenomena krisis di Indonesia dan berdampak signifikan adalah yang terjadi pada krisis moneter 1997-1998. Diantara dampak yang ditimbulkan bagi industri perbankan adalah ditutupnya 16 bank setelah terjadi rush besar-besaran oleh nasabah bank tersebut sehingga kehilangan likuiditasnya. Di tahun 1997 setidaknya sudah merupakan gambaran bagaimana kejatuhan ekonomi kapitalis. Transaksi yang tidak ada back up, surat utang yang tak terawasi, perdagangan valuta asing untuk spekulasi menjadikan Asia Tenggara waktu itu menjadi negara yang paling parah dihantam krisis. Bahkan di Agustus 1997 nilai tukar rupiah kita yang harusnya masih Rp2.430 per dolar AS kemudian melonjak ke level Rp10 ribu. Seperti ingin menyambut hari kemerdekaan di tahun itu, rupiah pun berkibar-kibar hingga kita membutuhkan uluran tangan IMF (international monetary fund). Itusatubuktikegagalanekonomikapitalis.Kedua, kita masih ingat bagaimana di 2008 bank di AS berguguran. Surat utang yang diterbitkan tanpa pengawasan maksimal, penjualan yang bebas membuat salah satu bank terbesar di AS harus tumbang. Kita ingat di zaman itu subprime mortgage securities. Kredit perumahan di AS yang juga

tak bisa dikendalikan. Membuat salah satu bank terbesar di negara itu Lehman Brothers harus tutup dan mem-PHK ribuan karyawannya. Bukti kegagalan kapitalis selanjutnya tentu krisis Eropa yang kita hadapi sejak tahun lalu. Secara signifikan dampaknya belum begitu dirasakan di dalam negeri. Tapi yakinlah jika kita masih tetap pada aliran ekonomi kapitalis itu bukan tidak mungkin krisis demi krisis akan selalu datang. Apa yang selanjutnya harus kita ketahui? Adalah bagaimana Islam memandang krisis. Di MES, kita memang memiliki beberapa orang praktisi, ustadz dan para dosen yang mampu membahas dan mengagendakan ekonomi syariah sebagai aliran ekonomi. Dalam Islam, krisis bisa terjadi kalau praktik atau aktivitas ekonomi yang dilakukan bertentangan dengan nilai-nilai keislaman. Seperti riba, monopoli, korupsi dan tindakan yang jelas dilarang Allah SWT. Para ahli ekonomi Islam sepakat penyebab utama krisis adalah kepincangan antara sektor moneter dan sektor riil. Sektor keuangan berkembang pesat meninggalkan sektor riil. Tercabutnya sektor moneter dari sektor riil yang terlihat dari banyaknya transaksi derivatif, transaksi di dunia maya atau virtual transaction. Semua itu pada prinsipnya penuh riba. Bursa saham, pasar uang atau transaksi surat berharga lain masuk dalam transaksi virtual yang hanya bisa kita lihat suratnya tapi tidak kita dapatkan barangnya. Lihat sekarang kontrak berjangka harga minyak dunia. Saat ini kita sudah tahu harga minyak di bulan September nanti di level berapa. Sementara yang kita miliki bukan minyak, tapi hanya pengakuan atas harga dan jumlah stok yang diperdagangkan. Di dunia ini 95 persen transaksi itu dilakukan dengan virtual. Hanya lima persen saja yang dilakukan dalam bentuk riil. Sehingga wajar malapetaka ekonomi dunia itu datang dari praktik maisir, gharar dan riba yang diharamkan dalam Alquran. Maisir itu bisa judi dan spekulasi, gharar dalam bentuk transaksi derivatif, bisnis berisiko tinggi serta riba adalah mendapatkan keuntungan tanpa transaksi bisnis. Itulah yang berlaku dalam perekonomian umum. Maka semua itu diharamkan dalam ekonomi syariah. Sektor moneter tidak akan pernah meninggalkan sektor riil. Itulah kuncinya. Ketika kita menerbitkan surat utang memang ada aset yang menjamin. Inilah yang sekilas penjelasan awal tentang pentingnya ekonomi syariah. Dan pastinya ekonomi syariah tidak hanya soal perbankan, tapi juga mencakup bursa saham syariah, asuransi syariah dan juga produk halal. ###


WASPADA Senin 30 Juli 2012

Medan Metropolitan

PD Perhotelan – PT Cakrawala Dekatama Sekongkol

Penegak Hukum Harus Teliti Proyek Crystal Square MEDAN (Waspada): Indikasi kecurangan proyek Crystal Square diyakini sangat besar. DPRD Sumut menilai sudah sangat pantas aparat penegak hukum segera meneliti kasus ini. Dugaannya, telah terjadi persekongkolan jahat antara PD Perhotelan dengan PT Cakrawala Dekatama. Anggota Komisi C DPRD Sumut Hardi Mulyonomengatakan itu saat dihubungi Waspada melalui telefon selular, Minggu (29/7). Kepadanya dipertanyakan tentang kejanggalan yang terjadi pada Momorandum of Understanding (MoU) antara PD Perhotelan dengan PT Cakrawala Dekatama terharap pembangunan proyek Crystal Square. Diberitakan sebelumnya, Komisi C DPRD Sumut mensi-

nyalir sangat banyak kejanggalan yang terlihat dari MoU tersebut. Baik pada MoU I maupun MoU II. Isinya sangat merugikan, bahkan menghilangkan hakhak Pemerintah Provinsi Sumatera Utara (Pemprovsu). Disebutkan Hardi, sudah terjadi akal-akalan dari pembuatan MoU antara PD Perhotelan dengan PT Cakrawala Dekatama. Itu merupakan bentuk kejahatan yang harus segera ditangani oleh aparat penegak hukum. “Saya menduga telah terjadi persekongkolan antara PD Perhotelan dengan pengusaha (PT Cakrawala Dekatama),” katanya. Bayangkan, sebut Hardi, Pemprovsu yang dalam hal ini diwakili oleh PD Perhotelan, sepertinya tidak berdaya meng-

hadapi pengusaha. Mereka menurut saja apa yang diminta oleh pengusaha, sehingga hakhak Pemprovsu tidak ada lagi. Membuat atau menyepakati MoU II, menurut dia, boleh saja dilakukan sepanjang tujuannya untuk lebih menguntungkan kedua belah pihak. Namun yang terjadi pada MoU II hanyamenguntungkanpengusaha, dan merugikan Pemprovsu. Pada MoU I, kata Hardi, PT Cakrawala Dekatama berjanji dan bersedia membangun Crystal Square. Yakni berupa ho-tel dan bar yang dijadikan sebagai pendukung sektor pariwisata di daerah ini. Namun kemudian pada tanggal 21 Jaruari 2011, MoU itu diubah kembali de-ngan penambahan objek. Yakni, hotel, rumah sakit, sarana pendidikan

dan swalayan. Dengan disetujuinya MoU II ini, berarti juga sudah menghilangkan fungsi PD Perhotelan. Ke depan perusahaan daerah itu sudah tidak berperan lagi di sana, karena sesuai fungsinya yang diatur dalam Perda No. 23/ 1985, disebutkan bahwa PD Perhotelan dibentuk hanya bergerak di bidang perhotelan. Hal yang paling membuat dewan bingung, tutur Hardi, adalah sikap Pemprovsu yang menurut saja ketika pengusaha mengagunkan lahan yang akan dibangun tersebut ke bank. “Inikan aneh. Berarti PT Cakrawala tidak ada modal. Kalau mengagunkan asset untuk membangun, baguslah PD Perhotelan saja yang membangun. Ngapain pakai pengusaha,” ujarnya. (m12)

A3

140 Juta Petasan Dimusnahkan MEDAN (Waspada): Polresta Medan bekerjasama dengan Brimobdasu memusnahkan 140 juta petasan yang diamankan dari salah satu rumah di Jln. Siskambing Gang Subur Medan, Minggu (29/7). Pemusnahan 140 juta petasan yang dipasok dari Jakarta ke Medan itu dilakukan di lapangan tembak Brimobdasu kawasan Martabe Jalan Djamin Ginting, dengan cara dibakar. Kasat Reskrim KompolYoris Marzuki kepada Waspada mengatakan, petasan senilai hampir Rp100 juta itu dibawa dari Polresta Medan dengan manumpang truk Sat Sabhara Pol-

resta Medan dan Brimobdasu. “Dari Polresta petasan petasan yang masih berada didalam 90 karung tersebut dibawa naik truk polisi menuju ke lapangan tembak Brimobdasu,” katanya. Setelah berada di lokasi, puluhan karung petasan itu disusun kemudian disiram minyak bensin dan dibakar sehingga terdengar suara ledakan petasan. “Pemusnahan ini dilakukan secepatnya karena kalau disimpan di Polresta Medan, sangat membahayakan. Apalagi saat ini cuaca di Medan, sangat terik sehingga bisa menimbulkan ledakan kalau terus disimpan,” ujarnya.

Ditanya mengenai kedua orang yang saat penggerebekan diboyong ke Polresta Medan, Yoris menjelaskan, keduanya sudah dipulangkan. “Cuma Rajinta yang walaupun dipulangkan dikenakan wajib lapor,” sebutnya. Sementara itu, Kanit Ekonomi AKP Bambang Hardi mengatakan, Polresta Medan sudah membuat surat panggilan terhadap suami Ranjita. “Sudah kita layangkan surat panggilan, kalau yang bersangkutan tidak juga memenuhi panggilan sampai dua kali kita buat DPO untuk menangkapnya,” tegasnya. Pemanggilan itu dilakukan

karena saat menjalani pemeriksaan Ranjita mengaku petasan itu milik suaminya yang dipesan dari Jakarta. Seperti diberitakan, Polresta Medan menggerebek rumah yang menyimpan ratusan juta petasan di Jalan Siskambing Gang Subur, Rabu (25/7) malam. Dari lokasi diamankan dua orang pemilik rumah yang kemudian diboyong ke Polresta Medan bersama barang bukti ra-tusan juta petasan. Penggerebekan dipimpin Kasat Reskrim Polresta Medan Kompol Yoris Marzuki bersama Kanit Ekonomi AKP Bambang Hardi dan sejumlah anggota. (m39/m40)

Plt Gubsu Resmikan Kampung Angkat Gubernur Malaka Bantu 60.000 Ringgit MEDAN (Waspada): Ketua Menteri Negeri Malaka Kerajaan Malaysia Datuk Seri Haji Mohd Ali Bin Mohd Rustam yang juga Presiden Dunia Melayu Dunia Islam (DMDI) menyerahkan bantuan 20.000 Ringgit Malaysia (RM) untuk pembangunan Kampung Angkat DMDI Sumut, Sabtu (28/7). Bantuan tersebut merupakan bagian dari 50.000 RM yang dicanangkannya. Selain itu pada kesempatan penyerahan sebagian bantuan yang langsung diberikannya pada peresmian Kampung Angkat DMDI Sumut di Jalan Garuda IV Perumnas Mandala Medan itu, Datuk Seri juga menyerahkan bantuan untuk anak yatim dan kaum dhuafa sebesar 10.000 RM sehingga total bantuan akan menjadi 60.000 RM. Kampung Angkat tersebut diresmikan Plt Gubsu H Gatot Pujo Nugro ST, diwakili Kepala Badan Kesbangpol Linmas Sumut Drs H Eddy Syofian MAP, disaksikan rombongan DMDI dari Melaka Malaysia. Tetamu dari negara jiran ini berbaur dengan masyarakat setempat penuh kekeluargaan. Plt Gubsu menyampaikan penghargaan dan memberikan apresiasi tinggi atas kepedulian Presiden DMDI Datuk Seri Haji Mohd Ali Bin Mohd Rustam, yang begitu respon terhadap kehidupan anak-anak yatim piatu dan kaum dhuafa. Selain bantuan uang, rombongan dari Me-

laka juga menyerahkan bantuan beras dan lainnya sementara dari suatu kelompok masyarakat Melaka juga memberikan bantuan 1.000 RM. Eddy Sofyan berharap kepedulian tersebut dapat berlanjut sehingga kampung-kampung angkat semakin banyak dan bermanfaat bagi anak yatim piatu dan kaum dhuafa di banyak daerah di Sumut. Presiden DMDI Datuk Seri Haji Mohd Ali Bin Mohd Rustam mengungkapkan, sebagai negara serumpun yang mayoritas beragama Islam, sudah sepan-

tasnya DMDI turut memperhatikan kaum miskin, anak yatim piatu agar mereka bisa berbahagia dalam kehidupannya. ”Untuk Indonesia khususnya Sumatera Utara saat ini merupakan rumah kedua saya. Untuk Indonesia saat ini Kampung Angkat kami ada dua yakni di Aceh dan di Mandala serta satu di Malaka. Dengan adanya kampung-kampung silaturahmi semakin terjalin,” ungkap Datuk Seri HM Ali Rustam yang juga merupakan Ketua Menteri Kerajaan Malaka. Ketua DMDI Sumut Said

Aldi Al Idrus menga-takan, DMDI Sumut sangat peduli untuk membantu kaum dhuafa dan anak-anak yatim piatu, sebab itu pihaknya berinisiatif membangun Kampung Angkat agar kehidupan mereka terangkat. ”Kampung angkat ini mer upakan upaya membangun silaturahim dengan kaum dhuafa, anak-anak yatim bahwa mereka semuanya sangat dipedulikan dan dibantu kehidupannya. DMDI siap mewujudkan itu, ungkap Said Aldi yang juga Ketua Rempala Indonesia. (m28)

Waspada/Amir Syarifuddin

KETUA Menteri Negeri Malaka yang juga Presiden Dunia Melayu Dunia Islam Datuk Seri Haji Mohd Ali Bin Mohd Rustam bersama Kepala Badan Kesbangpol Linmas Sumut Drs H Eddy Syofian MAP, mewakili Plt Gubsu foto bersama anak yatim pada acara penyerahan bantuan dan peresmian Kampung Angkat di Mandala Medan).


Medan Metropolitan

A4

WASPADA Senin 30 Juli 2012

Lebaran Fundland Jadi Kado Spesial Di Hari Raya MEDAN (Waspada): PT. Star Indonesia menghadirkan arena hiburan bertajuk Lebaran Fundland di Tapian Daya Medan – Pekan Raya Sumatera Utara (PRSU) mulai 19 Agustus hingga 2 September 2012. Arena hiburan ini menjadi kado spesial bagi keluarga di Hari Raya Idul Fitri 1433 H. General Manager PT Star Indonesia Zulham Effendi Parinduri mengatakan kepada wartawan Minggu (29/7), Lebaran Fundland ini merupakan bentuk apresiasi sekaligus kado spesial bagi masyarakat Sumatera Utara terutama Kota Medan yang ingin mengisi hari libur sekaligus merayakan Idul Fitri 1433 H. Selama penyelenggaraan Lebaran Fundland, kata Zulham, pengunjung bisa menikmati 15 wahana permainan dengan syarat cukup membeli tiket masuk yang disediakan pihak penyelenggara. Wahana permainan yang digratiskan kepada pengunjung diantaranya merry go round, mini train, mini octopus, mini swing, air plane, horse go round, jet 12, cat and elephant dan istana balon, playground, mandi bola dan katak loncat Pada hari pertama Idul Fitri, masyarakat sudah dapat mengunjungi Lebaran Fundland yang dimeriahkan dengan penampilan sejumlah artis mulai pukul 16:00. Di hari kedua dan seterusnya, dibuka mulai pukul 10:00 hingga 23:00. Lebaran Fundland merupakan solusi tepat bagi masyarakat untuk mengisi liburan pada Hari Raya Idul Fitri. Sebab, pengunjung bisa bersantai sekaligus berekreasi bersama keluarga sambil menikmati serangkaian wahanan permainan yang menantang dan memacu adrenalin bagi anak-anak, remaja dan orang dewasa.(m25)

Medan Masih Dilanda Panas 36 Derajat Celcius MEDAN (Waspada): Warga Kota Medan diingatkan harus mewaspadai kebakaran dikarenakan suhu udara panas hingga mencapai 36 derajat celcius masih berlangsung. Demikian dikatakan Kepala Data dan Informasi Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I Stasiuan Bandara Polonia Medan Mega Sirait SP, Sabtu (28/7). “Peluang kebakaran cukup besar mengingat beberapa hari ini kawasan Kota Medan dan sekitarnya dilanda suhu udara panas mencapai lebih kurang 36 derajat celcius,” sebutnya. Kondisi tersebut, kata Mega, tergolong suhu panas tertinggi dalam beberapa bulan belakangan ini, sementara beberapa hari ke depan peluang itu masih besar. Panas yang menyengat ke bagian kepala berlangsung mencapai lebih kurang tiga jam lebih yakni sejak pukul 12:30 hingga 15:30. Selebihnya suhu udara panas turun mencapai rata-rata 35 derajat celcius. Menurut dia, suhu lebih kurang 36 derajat celcius hingga terjadi kelembapan udara mencapai 36 persen. Suhu meningkat dan kondisi udara kering, rentan terjadi kebakaran di kawasan pemukiman padat penduduk dan rumah-rumah daerah pinggir sungai maupun kebakaran lahan. “Saya minta warga agar mengantisipasi pemicu kebakaran seperti membuang puntung rokok sembarangan tempat,” tuturnya. Disebutkan Mega, penyebab suhu panas meningkat karena sulitnya terbentuk awan sehingga sinar matahari langsung mencapai permukaan tanah atau menerpa bumi. Awan sulit terbentuk akibat arus udara keluar dan uap air yang rendah, adanya gangguan cuaca berupa pusat tekanan rendah dibelahan bumi utara, sekitar Laut Cina Selatan (LCS) maupun Filipina,” ujarnya. (m32)

PP Medan Perjuangan Adakan Safari Ramadhan MEDAN (Waspada): Sejak awal bulan suci Ramadhan, Pimpinan Anak Cabang Pemuda Pancasila (PAC PP) Kecamatan Medan Perjuangan mengadakan Safari Ramadhan 1433 H sekaligus berangjangsana ke masjid-masjid melakukan shalat Isya dan tarawih berjamaah, serta bersilaturahmi dengan masyarakat dan jamaah. KetuaPACPPMedanPerjuanganIrSyahrilIrwansyahRosya(Bulek) didampingi sekretaris Irpan SSos, bendahara Widyanarko, Effendi Ma’ruf, Fitri Ariadi, Iyas, Arif, dan Ardian Tanjung, Minggu (29/7) mengatakan, PAC PP Medan Perjuangan telah melakukan Safari Ramadhan di 25 masjid yang ada di Kecamatan Medan Perjuangan. “Safari Ramadhan yang kita laksanakan sekaligus memberi bingkisan 20 potong kain sarung kepada setiap masjid yang dikunjungi, namun ada juga beberapa masjid diberi 30 kotak keramik dan 50 zak semen,” kata Bulek. Menurut dia, pelaksanaan Safari Ramadhan ini dilakukan sesuai anjuran MPC Pemuda Pancasila Kota Medan, agar dapat bersilaturahmi dan sekaligus dapat bertatap muka dengan masyarakat sekitar. Kata Bulek, Safari Ramadhan yang dilaksanakan PAC PP Medan Perjuangan mendapat sambutan positif oleh badan kenaziran masjid (BKM) yang dikunjungi. “Safari Ramadhan yang kami lakukan ini adalah merupakan wujud kepedulian Pemuda Pancasila terhadap masyarakat khususnya rumah ibadah dan warga yang lemah perekonomiannya,” ujarnya. Sebelumnya dalam Safari Ramadhan di Masjid Al-Muhajirin Jln. Pimpinan Gg Langgar Padang, PAC PP Medan Perjuangan selain menyerahkan bingkisan 20 kain sarung juga menyerahkan bantuan 30 kotak keramik. Sementara BKM Masjid Al-Muhajirin Baharuddin SPd mengatakan, pihaknya sangat berterima kasih dan salut kepada PAC PP Kec. Medan Perjuangan yang begitu perduli terhadap rumah ibadah khususnya masjid. (cwan)

Waspada/Irwandi Hrp

KETUA PAC PP Medan Perjuangan Ir Syahril Irwansyah Rosya (Bulek) didampingi sekretaris Irpan dan bendahara Widyanarko menyerahkan bantuan 30 kotak keramik dan 20 kain sarung diterima BKM Masjid Al-Muhajirin Baharuddin SPd.

Waspada/Ismanto Ismail

KASAT Narkoba Polresta Medan Kompol Dony Alexander, SH, SIK, MHum (kanan) memimpin razia di tempat hiburan malam Delta.

Waspada/Ismanto Ismail

PETUGAS Sabhara Polresta Medan memeriksa pengunjung tempat hiburan Elegant.

Polisi Razia Tempat Hiburan Malam Enam Pengunjung Diamankan, Tiga Butir Pil Happy Five Disita MEDAN (Waspada): Polresta Medan bekerjasama dengan Den POM I/5 Medan melakukan razia di empat lokasi hiburan malam di Medan, Minggu (29/7) dinihari. Dalam razia itu, polisi mengamankan enam pengunjung dan menyita barang bukti berupa tiga pil Happy Five yang ditemukan di lantai tempat hiburan tersebut. Razia itu dipimpin langsung Kasat Narkoba Polresta Medan Kompol Dony Alexander, SH, SIK, M.Hum dibantu Kasat Intelkam Polresta Medan Kompol Ahyan, S.Sos, melibatkan personel dari Reserse Narkoba, Intelkam, Sabhara, Provost dibantu Den POM I/5 Medan. Razia pertama dilakukan di tempat hiburan malam Delta Jln. Ir. H. Juanda Medan. Aparat

melakukan pemeriksaan terhadap seluruh pengunjung dengan sasaran narkoba, senjata tajam dan senjata api. Dalam razia itu, salah seorang pengunjung sempat protes kepada wartawan yang melakukan pengambilan gambarnya saat diperiksa polisi. “Jangan syuting-syuting dan kamu buat malu saya. Kalau saya bersalah ada membawa atau memakai narkoba, baru bisa disyting,” kata pengunjung tersebut. Selanjutnya, petugas melakukan razia di tempat hiburan malam Entrance di Hotel Grand Aston Jln. Balaikota simpang Jln. Raden Saleh Medan. Di lokasi ini, salah seorang pengunjung sempat terlibat keributan dengan wartawan yang sedang

melakukan peliputan. Di Elegant Karaoke Jln. Gatot Subroto Medan, polisi menemukan sejumlah wanita dan tiga pria di salah satu ruangan. Di lokasi itu, polisi menemukan bungkusan plastik kecil di kamar mandi yang diduga bekas bungkusan narkoba jenis sabu. Di tempat hiburan malam Tobasa, Hotel Danau Toba, polisi yang melakukan razia menemukan tiga butir pil Happy Five di lantai dan mengamankan dua pengunjung. Kapolresta Medan Kombes Pol Drs Monang Situmorang, SH, MSi, didampingi Kasat Narkoba Kompol Dony Alexander, SH, SIK, M.Hum mengatakan, razia tempat hiburan malam terus dilakukan dengan

Dua Salon Diduga Tempat Maksiat Tetap Beroperasi MEDAN (Waspada): Meski telah dirazia oleh Dinas Pariwisata Pemko Medan, namun salon MC dan R yang berlokasi di Jalan Negara, Kel. Bantan, Kec. Medan Tembung, Minggu (29/ 7), tetap beroperasi. Sejumlah pelanggan masih keluar masuk salon plus-plus tersebut. Pantauan Waspada, kedua salon yang telah berkali-kali dirazia oleh aparat penegak hukum itu tetap buka selama bulan suci Ramadhan. Padahal, pada Jumat (27/7), kedua salon plus-plus tersebut telah dirazia oleh petugas Dinas Pariwisata Pemko Medan dan sejumlah pekerja salonnya juga diangkut. Namun, setelah menjalani pemeriksaan, para karyawati salon tersebut dipulangkan kembali. Kedua salon kecantikan ter-

sebut digerebek petugas karena memberikan pelayan plus-plus terhadap para lelaki hidung belang yang datang berkunjung. Meskipun memiliki label salon kecantikan, namun di bagian bawah salon MC tidak terlihat perlengkapan untuk pangkas rambut, yang ada cuma beberapa cermin yang tergantung di dinding. Selain itu, para pekerja di kedua salon tersebut berpakaian seksi, bercelana pendek untuk menarik gairah pengunjung yang datang. Sementara itu, Ketua Umum Dewan Pimpinan Pusat Forum Peduli Umat (FPU) Sumatera Utara AhmadYani bin Abdul Hamid meminta agar Kapoldasu, Gubsu, Wali Kota dan para ulama jangan tutup mata

dengan keberadaan tempattempat maksiat yang beroperasi selama bulan suci Ramadhan. Banyak tempat maksiat berkedok salon kecantikan, panti pijat dan refleksi yang tetap buka selama bulan puasa ini. “Maksiat merajalela seperti tidak lagi menghargai agama Islam. Jika para ulama dan umaroh dan umat tidak menyikapi kasus ini, yang kita takutkan Allah yang menegur kita semua. Lokasi maksiat di Jalan Negara harus segera diberantas dan ditindak tegas,” sebut AhmadYani. Kata dia, lokasi maksiat harus diberantas dan bukan untuk dilindungi, apalagi keberadaan Salon MC dan R berada di tengah-tengah pemukiman padat penduduk dan tak jauh dari rumah ibadah. (h04)

Dua Pembajak Truk Ditangkap MEDAN (Waspada): Dua pembajak truk ditangkap dari Desa Mencirim, Kutalimbaru, Kab. Deliserdang, setelah diburon sejak 30 Juni lalu. Kedua tersangka berinisial BG dan DPS. Kasubdit III Dit Reserse Kriminal Umum Poldasu AKBP Andry Setiawan kepada Waspada, Sabtu (28/7) mengatakan, keduanya terlibat pembajakan dan perampokan truk di jalan tol Tanjungmorawa, Kab. Deliserdang. Pelaku ketika itu lima orang mengendarai mobil dan menyetop truk yang melintas di jalan tol.

Tiga pelaku lain yang masih diburon berinisial PG, Ad dan G. Kata Andry, dalam aksinya pelaku menghadang dan menyetop truk. Saat itu, 30 Juni dinihari sekira pukul 02:00, kelima pelaku menghadang truk colt diesel BK 8302 CJ. Mereka kemudian menurunkan secara paksa sopir dan kernet truk, kemudian dengan ancaman senjata tajam mereka menutup mata korbannya dengan lakban. Setelah itu kedua korban dibawa dan diturunkan di kebun tebu wilayah

Sunggal. Sedangkan pelaku lainnya membawa kabur truk tersebut. Andry mengatakan, dari pengakuan kedua tersangka, truk itu dijual oleh tersangka PG seharga Rp25 juta. Kasus perampokan truk dalam beberapa bulan ini telah meresahkan sopir dan pemilik angkutan. Sejumlah kasus perampokan pernah terjadi di jalan tol, seperti jalan tol kawasan Cemara beberapa waktu lalu, truk pengangkut crude palm oil (CPO) dibajak, menyebabkan kerugian sekira Rp300 juta.(m27)

sasaran narkoba dan lainnya. Mengenai adanya tempat hiburan malam yang beroperasi pada bulan suci Ramadhan,

Kompol Dony Alexander mengatakan, tempat hiburan itu termasuk salah satu fasilitas hotel. “Kita sudah mengimbuau

pengusaha hiburan agar mematuhi aturan yang berlaku yakni menghentikan ope ra sional pada pukul 02:00. (m36)

Pemprovsu Siap Layani Gugatan FUI MEDAN (Waspada): Pemerintah Provinsi Sumatera Utara (Pemprovsu) siap melayani gugatan Forum Umat Islam (FUI) Sumut terkait gugatan perdata pengambilalihan aset RS Haji Medan di PN Medan. Sepekan sebelumnya Pemprov Sumut sudah memenangkan gugatan yang sama di PTUN Medan. “Baru Selasa lalu kalau tidak salah kita (Pemprov Sumut) dimenangkan dengan gugatan yang sama oleh FUI Sumut. Silahkan saja kalau mau digugat kembali,” kata Staf Ahli Gubernur Bidang Pemberdayaan Masyarakat Zulkifli Taufik yang juga sebelumnya bertindak sebagai Ketua Tim Koordinasi RS Haji Medan kepada wartawan di Kantor Gubsu, Jumat (27/7). Yang jelas, lanjutnya, posisi Pemprov Sumut saat akan melakukan pengambilalihan bukan sebagai pihak yang berhadap-hadapan dengan Yayasan RS Haji Medan. Tapi justru sebagai pihak yang diminta untuk menyelamatkan aset RS Haji Medan, agar tetap bisa melakukan operasional. Karena saat itu RS Haji Medan sedang dalam kesulitan keuangan serta terjadi gejolak yang dilakukan karyawan. ”Sampai sekarang RS Haji Medan itu masih meninggalkan hutang,” katanya. Kepala Biro Bina Sosial dan Kemasyarakatan Setdaprovsu Sakhira Zandi menambahkan, dalam pengambilalihan RS Haji Medan, Pemprov Sumut sudah menjalankan semua proses tahapan yang dibutuhkan selama enam bulan. Jadi, pengambilalihan yang dilakukan bukan tibatiba tanpa dasar hukum. ”Proses pengambilalihan ini sudah kita ikuti semua selama enam bulan. Dan Plt Gubernur juga membentuk tim saat itu,” kata Sakhira yang menjabat sebagai Sekretaris Tim Koordinasi RS Haji Medan saat itu. Jika disebutkan bahwa Pemprov Sumut melanggar aturan, justru apa yang dilakukan

pihaknya sudah sesuai dengan saran dan masukan dari Kementerian Hukum dan HAM (Kemenkumham). Dalam konsultasi langsung ke Kemenkumham disebutkan, bahwa status Yayasan RS Haji Medan sudah tidak lagi sesuai dengan UU Yayasan No 16/2001. Karena itu bisa diambilalih oleh pemerintah daerah dalam rangka penyelamatan aset dan jaminan kelangsungan layanan rumah sakit. Selain itu tim juga telah melakukan kunjungan kerja ke RS Haji DKI Jakarta, RS Haji Surabaya dan RS Haji Ujung Pandang. Ketiga rumah sakit tersebut sudah terlebih dulu dikelola pemerintah. Seperti RS Haji DKI Jakarta selain dikelola Kementerian Kesehatan dan Pemerintah DKI Jakarta, juga diikutsertakan Ikatan Persaudaraan Haji Indonesia (IPHI). Sedangkan RS Haji Ujung Pandang murni telah dikelola oleh pemerintah daerah. Bahkan RS Haji Surabaya sudah mendapatkan APBD dan menjadi sumber pendapatan asli daerah (PAD). Selain itu, dalam setiap pembahasan RS Haji Medan juga melibatkan karyawan, IPHI Sumut, dan MUI Sumut. Saat itu Direktur RS Haji Medan yang lama yaitu MP Siregar juga dengan ikhlas sudah menyerahkannya ke Pemprov Sumut. Begitu juga dengan DPRD Sumut yang juga memberikan opsi agar RS Haji Medan dikelola Pemprov Sumut. Bahkan DPRD Sumut sudah menyatakan kesediaannya untuk membuat peraturan daerah (Perda) RS Haji Medan. Namun karena masih harus proses maka untuk sementara pengambi-lalihan dilakukan dengan Pergub No 78/ 2011. ”Artinya dalam proses pengambilalaihannya Pemprov Sumut sudah melakukan analisis dan kajian baik ilmiah maupun empiris. Kalau digugat juga akan kita ikuti. Tapi yang jelas Pemprov Sumut sudah dimenangkan pengadilan sebelumnya,” tutur Sakhira.(m28)

AMIK MBP Siapkan Lulusan Berkualitas MEDAN (Waspada): AMIK MBP terus berbenah diri sekaligus mempersiapkan agar lulusan dari dua program studi (prodi) yang dikelola yakni manajemen informatika komputer dan teknik informatika komputer, bisa memenangkan persaingan dalam memperoleh pekerjaan yang kian hari kian terbatas jumlahnya baik di pemerintahan maupun swasta. Demikian diungkapkan Direktur AMIK MBP Ny Nursiah SE, M.Si, dalam acara tatap muka dengan Ketua Dewan Pembina Drs Tenang Malem Tarigan M.Si, Ak, Pembantu Direktur II Iswanto Sembiring ST, M.Pd, dan Ketua Jurusan Program Studi Manajemen Informatika Sariadin Siallagan M.Sc, Sekretaris Jurusan Harlen Silalahi S.Pd, S.Kom, serta Humas Drs Romanus Sipayung M.Sc, di ruang rapat kampus itu Jln. Letjen Jamin Ginting, Padang Bulan, Medan, Jumat (27/7). Persaingan yang semakin ketat yang bukan hanya pada tingkat daerah ataupun nasional, tetapi hal itu sudah terjadi merata secara global. “AMIK MBP sebagai perguruan tinggi yang sudah

mempunyai brand atau cap yang mampu melahirkan programmer-programmer handal dan perancang website unggul,” sebut Nursiah yang mengaku kini terus berpacu dalam mempersiapkan lulusan AMIK MBP berkualitas. Dia mengaku, tenaga pengajar (dosen) di AMIK MBP direkrut secara terseleksi, selain memiliki sertifikasi dosen tetapi juga lebih diutamakan yang berpendidikan S1, S2, dan S3. Malah keterbatasan dosen S3, pihaknya masih harus sharing dengan perguruan tinggi negeri dalam menggunakan tenaga dosen tersebut. Sementara itu, Ketua Dewan Pembina AMIK MBP Drs Tenang Malem Tarigan M.Si, Ak mengatakan, pihaknya kini meningkatkan kualitas dosen tetap dengan mengikuti pendidikan sampai S3. “Dalam waktu yang tidak lama lagi, hampir semua tenaga pengajar di AMIK MBP sudah lulusan S2 dan S3, dan sekaligus memperkuat keyakinan kita para lulusan AMIK MBP akan teruji kualiatasnya,” katanya.(m22)


WASPADA Senin 30 Juli 2012

Medan Metropolitan

A5

Waspada/Ismanto Ismail

Waspada/Arianda Tanjung

KONVOI: Meski aktivitas asmara subuh telah dibubarkan personel TNI/Polri, namun sekelompok remaja tetap melakukan konvoi dan beratraksi di jalan raya kawasan Ringroad, Medan Sunggal, Minggu (29/7).

Waspada/Rudi Arman

MAIN PETASAN: Sejumlah remaja bermain petasan di kawasan kanal Titikuning Medan, Minggu (29/7). Aktivitas bermain petasan ini berlanjut setelah polisi meninggalkan kawasan kanal.

Waspada/Rudi Arman

BERJAGA-JAGA: Sejumlah personel Sat Sabhara Polresta Medan dilengkapi tiga mobil patroli berjaga-jaga di kawasan kanal Titikuning, Medan, Minggu (29/7).

Waspada/Hamdani

DIBUBARKAN POLISI: Personel Polresta Medan mengendarai mobil patroli membubarkan sekelompok remaja yang melakukan aktivitas asmara subuh di Jln. Willem Iskandar, Medan Estate, Minggu (29/7).

Waspada/Hamdani

DIKEJAR POLISI : Seorang polisi mengejar dua remaja yang tetap nongkrong di kawasan Jln.Willem Iskandar meski aktivitas asmara subuh di kawasan itu telah dibubarkan petugas Polsek Percut Seituan, Minggu (29/7)

PIMPIN OPERASI: Kabag Ops Polresta Medan Kompol SF Napitu, SH, SIK, memimpin operasi penertiban asmara subuh dan balap liar di kawasan kanal Titikuning dan Ringroad, Medan Sunggal. Operasi tersebut melibatkan 136 personel dari Polresta Medan, Yon Marhanlan Belawan, Den POM I/5, Lanud Medan, Sat Pol PP Kota Medan, Dinas Perhubungan Kota Medan Sat Pol PP Pemkab Deliserdang dan Majelis Ulama Indonesia (MUI) Medan.

Waspada/Arianda Tanjung

BERI NASEHAT: Anggota TNI dari Lanud Medan memberikan nasehat kepada sekelompok remaja putri yang melakukan aktivitas asmara subuh di kawasan Ringroad, Medan Sunggal, Minggu (29/7).

DIBUBARKAN: Anggota TNI dari Yon Marhanlan Belawan membubarkan sekelompok pengendara sepedamotor yang berkumpul di kawasan Ringroad, Medan Sunggal, Minggu (29/7).

Waspada /Arianda Tanjung

Waspada/Ismanto Ismail

DISITA: Kanit Sabhara Polsek Sunggal AKP P Bangun, SH, memeriksa 50 sepedamotor yang disita timsus Reskim Polsek Sunggal dari kawasan Pasar VI Jln. Letjen Jamin Ginting/Padangbulan Medan dan Ringroad, Minggu (29/7).

Waspada/Arianda Tanjung

DIAMANKAN: Dua remaja (kanan) diamankan petugas gabungan TNI/Polri setelah tertangkap tangan bermain petasan di kawasan Ringroad, Medan Sunggal, Minggu (29/7).


A6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

Bursa Automotive

A C : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

D I J UA L C E PAT C H E V R O L E T BLAZER MONTERA ‘05 HITAM

Lengkap (BR, VR, PW, CL, AC, TP, CD, VCD), Siap pakai, Harga Rp. 75 Jt/ bisa bantu BBN HP. 0852.7084.4950 0823.6492.5454 DAIHATSU READI STOCK !!!

XENIA, TERIOS, GRANDMAX, LUXIO, DAPATKAN POTONGAN, HARGA SPESIAL UNTUK PEMESAN DI BULAN INI. TERIMA TUKAR TAMBAH

#PAKET LEBARAN DAIHATSU#

READY STOCK XENI,A TEIOR, PICK UP, LUXIO, SIRION FULL CASHBACK, BONUS TAMBAHAN, SPECIAL PROSES CEPAT, BISA TUKAR TAMBAH Hub. Astra Daihatsu 0812 60 1111 98

ASTRA DAIHATSU PROMO RAMADHAN Ready Stock Xenia, Terios, Luxio, Sirion, Grand Max. Pick Up. DP 15Jt. Diskon besar. Hub. 0852 7695 7747 ALL NEW XENIA (BARU) 1300cc, AC DB, Sensor Parking, CD, MP3, USB, Alarm, Central Lock, Angs. 2.333.100. Pick Up Angs. 2.409.000. Terios Angs. 2.747.000. Hub. Adek - Astra. 0812 6340055. PIN 274CA61C

DAIHATSU Espass Super Van ‘96 akhir. Mobil cantik mulus, terawat original. Jok kulit VR/BR, AC Audio CD MP3 Kenwood. Rp. 40Jt Nego. Call: 0813 7057 2955

“DAIHATSU PAKET MURAH”

Gran Max Pick Up DP 7 Jt-an Angs. 2 Jt-an Gran Max Minibus DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 16 Jt-an Angs. 5 Jt-an Xenia M. Deluxe DP 21 Jt-an Angs. 4 Jt-an Terios TS Xtra DP 21 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061 77402067 DAIHATSU Espass Minibus Thn. 1996. W. Silver, BK Medan, mobil sehat & terawat. Jl. Mustafa Gg. 7 No. 26D Hub. 0852 6040 8971 DAIHATSU PROMO RAMADHAN & LEBARAN

Terios DP Mulai 30 Jt-an atau Angs. 2 Jt-an Xenia DP Mulai 20 Jt-an atau Angs. 2 Jt-an GM Pick Up DP Mulai 11 Jt-an atau Angs. 2 Jt-an Barang Ready, Berhadiah dan data dijemput. Hub. HASIBUAN ASTRA 0812 6362 4634

DEALER RESMI NISSAN MEDAN - ACEH SPESIAL PROMO LEBARAN - DP Rp. 40 jt-an - Angsuran Rp. 3 Jt-an - Ready Stock - Disct Mantap, Proses Cepat !!!

Hub. MHD. ATMA 081370781771 - 061.77553443

FORD Telstar Thn. 84 (GL). Merah Dunhil. AC, TP, VR, BR, Baru, Msn/Body sehat, 22Jt. 061.8456676 / 0815 331 68155 HONDA 100% BARU PROMO LEBARAN

Ready Stock: Jazz, CR-V, Freed, dll. Febrian: 0813 7572 7200 / 0812 6234 9229

ISUZU PANTHER DIJUAL

Mobil Isuzu Panther Th. 96, Grand Royal, mulus, lengkap, musik dan asesoris. BK Medan asli, Harga Rp. 73Juta (nego). Hubungi pemilik langsung HP. 0812 6595 9007

5 CM 6 CM

Rp. 65.000 Rp. 78.000

TOYOTA Kijang LGX Tahun ‘04 Dijual. AC DB, Tangan ke II. Mobil pakai pribadi. Toyota Corolla All New ‘96. Tangan Ke II, Kondisi mulus. Hubungi: Jl. Denai No. 140 Medan 0821 6668 4786 - 0812 632 8374

TOYOTA Altis Thn 2003 Dijual Warna Silver, Harga 130 Jt/ nego HP. 0812.637.2319

TOYOTA BARU ASTRA

Avanza, Innova, Fortuner PURBA: 0813 9789 4633

TOYOTA Avanza Th. 2010 Dijual. W. Hitam, Tipe G. Rp. 147Jt. atau LGX Th. 2001 Solar W. Biru met, Rp. 125Juta. Dua2nya BK Medan Asli. Harga Damai. Hub. 0813 6227 1115 Jl. Amaliun Dpn SD Kartini No. 146

BURSA BUTUH DANA BUTUH DANA/LEASING

Jaminan BPKB Mobil, Pick Up Truk (Colt Fuso) th. 95 Keatas. Multi Finance: 0877 6857 8318

MITSUBISHI Kuda Bls 2000 Coklat Haji Kaleng-kaleng, mobil mulus, jok baru, BK Asli Medan Panjang. Jarang keluar. Harga 87 Jt/Nego. Hub. 0812 6568 818 / 77305875

SUZUKI Carry Thn. 91. Adiputro Tape, Velg Racing, Mbl siap pakai. Hrg. 26Jt. Nego. Hub. No. 0821 6399 9191

TOYOTA Kijang Capsul LSX Solar Thn. 1997. Biru, BK Medan asli. AC DB, PW, Lengkap. Hrg. 88Jt/Nego. Hub. 0812 6545 1974 SALAH SATU DIJUAL Kijang Super Commando Thn. 91. Hrg. Rp. 45Jt Nego. Honda Civic Matic Thn. ‘77. Hrg. Rp. 9 Jt Nego. Hub. 0821 604 37457

TOYOTA Kijang LGX 1,8 EFI, Bensin, Thn. 2001, W. Abu2 mika, BK Pilihan, 1 tangan, lengkap, AC Double Tape, VR, BR, PW, PS, CL, Remot mulus luar dalam. BU Hub. HP. 0852 7600 8094 Mdn.

TOYOTA Kijang Kapsul LSX Diesel Up. Thn. 97. W. Biru met. Siap pakai/Lengkap. H. 92,5 Jt Ng. Hub. 0812 6356 196

DIJUAL KOMPUTER PRIBADI Proc LGA 3.0 GHZ, HDD 500GB, RAM DDR2 266. Mon Acer LED 15” New. Rp. 1.600.000. Hub. 0852 777 999 37

I SHOP - TEL. 4140234

Pusat Komputer FOMIKOM No. 41- 42 CENTRAL NOTEBOOK - TEL. 4140432 Pusat Komputer FOMIKOM No. 99 Plaza Medan Fair Lantai 4 (Carrefour) PROGRAM LAPTOP UNTUK GURU * HARGA KHUSUS * BONUS KHUSUS * TRAINING GRATIS * DEMO GRATIS COMPAQ COREDUO 3 JUTA-AN ASUS SLIM BOOK 3 JUTA-AN SAMURAI NETBOOK 1 JUTA-AN ZYREX MINI 1 JUTA AN ZYREX DUALCORE 2 JUTA-AN

TOSHIBA - ACER - READY STOCK

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

HARGA BELUM TERMASUK PPN 10%

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab PT. Harian WASPADA.

Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602

Terimakasih

BURSA

PHOTO COPY

PELUANG USAHA

BUTUH DANA

Usaha Frencise dari America kami tawarkan dengan harga yang ekonomis. Produck super food, Minuman dari campuran 19 jenis buahbuahan. Mengandung anti oksidan yang tinggi, dapat menangkal berbagai macam penyakit.

1 Jt s/d 10M. Jaminan SHM, SK Camat, Lurah Medan Kota 1 Hr. Cair. Proses Bank/Non Bank. BPKB Motor/Mobil proses cepat, aman Hub. MAYA 0853 6262 2303

Untuk Keterangan lebih jelas kami undang anda. Dalam acara Temu ramah:

BURSA

SERVICE/ASESORIS MOBIL

Mulai Tanggal: 30/07/2012 - 02/08/2012 Tempat Acara: Hotel Novotel Soechi Medan Waktu : Pukul 11.00 s/d 22.00 WIB

‘MULIA JAYA’ POWER STEERING

- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954

PROMO SARUNG JOK MOBIL

SPESIALIS ALAS DASAR, DOORTRIM, LANGIT-LANGIT, AUDIO, ASESORIES MOBIL & KACA FILM

TYPE MOBIL TYPE PROMO PROMO I PROMO II PROMO III

SEDAN Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000

Hubungi : HP: 0812 6067 4709 HP: 0813 7059 1125 Email: mlmrahasia@yahoo.com

LOWONGAN KERJA KE MALAYSIA BURSA

ALAT MUSIK DIJUAL 2nd Power Beta 3 1000W, 2000W, 3600W. Sound Standard 1000Wm 3600W, EQ dod, 60ch, 30ch USA, dbx 60ch, spk BMB 8, 10, 12, DTS Kenwood, Pioneer, Terima Visa 0%. Jl. Indragiri 25 061.7345487

BURSA

TRAVEL/ WISATA REZEKY TRAVEL

-Menerimapengurusan/perpanjangPASPORT - Tiket ferry T. balai - Poklang (Malaysia) - Travel Medan - Tanjung Balai (Pelabuhan) Hubungi: (061) 6647.7734/ 0852.9616.6601 (Roy)

ELITE MOTOR

Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

BURSA

PERCETAKAN

BURSA

PROPERTY

Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik RUMAH DIjual, LB. 14x30m, LT. 15,25x38m, KT 3 bawah, 2 Atas, KM 3, RT, RK, Garasi 3 mobil, SHM, almt Jl. Seksama/ Harapan Pasti Timur 44, Medan Denai Hub. 0823.6943.0158 - 0852.9785.5620

DIJUAL CEPAT/ B.U

GRAND MONACO SIAP HUNI, JL. EKA SURYA JOHOR, TYPE 36, BLOK T-20, SERTIFIKAT HUB. 0821.7859.7597, TP

RUMAH PERMANEN DIJUAL

Lantai 1 (satu) Luas Tanah 1.083m², Luas Bangunan 550m², Surat SHM, Air PDAM, Listrik, Telepon, Terletak di Jl. Karim MS No. 19 (daerah Jl. Ir. H. Juanda Medan), Harga nego Peminathub:HKProperty:Jl.Waringin No.22GMedan,Telp.(061)455.3778, HP. 0821.6881.0756 (Anta) HP. 0812.5337.3337 (Amin)

RUMAH DIJUAL MURAH

TOYOTA Kijang Grand Extra Thn. 95 Dijual. 72Jt Nego. HP. 0812 6077 6718

TOYOTA Kijang Kapsul Model LGX New Bensin 1.8 Thn 2004 Sgt mulus, VR, BR, PS, PW, CL, Remote, E. Miror, AC Double, FUll sound pake TV, Hrg 139 Jt/nego Hub. 0852.7688.3371 Biru Mika Ex dokter

BURSA

KOMPUTER

9 CM Rp. 126.000 10 CM Rp. 140.000

BU T U H DA NA

SUZUKI Carry Futura Minibus 1.3 Dijual. Thn. 92/93. BK Mdn, AC/DB, cantik, jok kulit. Harga 34Jt. Nego. Hub. 0812 6393 235

TOYOTA New Vios 1.5 G Dijual. Th. 06, W. Silver, AC, Tape, CD/TV, VR, Jok kulit, BK Mdn asli, mulus, siap pakai, original. Hrg. 136Jt/ damai. Hub. 0813 7618 8118 pemakai.

Rp. 91.000 Rp. 104.000

FAX.4561347

Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500

BU MITSUBISHI L300 PU

Tahun 2004 warna hitam plat BL mulus. Harga 86 Juta Nego. Hub. 0821 6060 1235

7 CM 8 CM

Senin, 30 Juli 2012

BURSA

PELUANG BISNIS

ALAT² BAKERY

Oven roti, mixer roti, mexin pres, adukan, srikaya, Hub.0812.6393.636 0819.646.878

Jl. Palem 3 Blok Y No. 05 Perum. Kuis Indah Permai Desa Paya Gambar Batang Kuis MURAH BISA NEGO HUB. 0852.6264.9335 0852.7586.9520 Tanpa perantara

TANAH Dijual Uk. 13,50x45,50m², SHM di Jl. Sei Bengawan No. 104 Mdn Sunggal, Harga nego Hub. 0812.640.8316

TANAH DIJUAL

Dijual sebidang tanah SK Camat di Ds. Sialang Kec.Bangun Purba, Deli Serdang letak pinggir jalan Uk. 20x60m (bisa untuk peternakan atau rumah), Harga Rp. 70 Jt/nego Hub. 0813.7019.7019 atau 0812.7397.6977

BURSA

LOWONGAN

PELUANG KESEMPATAN CARI UANG !

LEBARANIDULFITRITINGGAL3MINGGULAGI! - DICARI PRIA/ WANITA UNTUK KERJA SAMPINGANMENAWARKANPRODUKKADO PARCEL PECAH BELAH MEREK LUMINARC UNTUKLEBARANIDULFITRI - MODELNYA CANTIK MENARIK, HARGANYA MURAH! - TOPLES CANTIK TEMPAT KUE CUMA Rp. 31.000,- AJA ! - KOMISINYA BISA PULUHAN JUTA DALAM SEBULAN - HUB:JOSES HP: 7712.8880 / 0813.7065.9340 JL. MERBAU, KOMPLEK RUKO MERBAU MAS NO. 12A (PAS BELAKANG PINTU KELUAR MEDAN FAIR PLAZA)

LT. 4x22m, L. Bangunan 4x16m, Jl. Stasiun Simp. 3 Tani asli, Kp. Lalang Tj. Gusta, pinggir jalan besar, bisa untuk usaha/ kantor, Harga 520 Jt/ nego Hub. 0813.6170.0451

JALANKANGKUNGNO.61MEDAN20153 (BELAKANGGEDUNGBUMIPUTERADI JALAN ISKANDAR MUDA) TELP: 415.7621 - 455.1305

BURSA

KESEHATAN KLINIK TRAPI ALAT VITAL MAK HJ. ICOT Ditangani langsung

H. UST. YUSUF/ H. ABIDIN

KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama

A. Ust OTONG

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333

MINI & EFEKTIF IKLANKAN PRODUK ANDA

WASIRI (Untuk Ambeien)

LOWONGAN KERJA

TANAH

Anda tuntaskan sendiri (Insya Allah): Asam urat, bengkak, maag/ asam lambung (akut), syaraf terjepit, DM/Gula basah (busuk)/kering, stroke, typhus, DBD, wasir, dll dgn produk alami Hub. Pak Ngadi HP. 0813.7500.7177

PT. SAHARA FAJARINDO CORP

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222

RUKO 2½ TINGKAT DIJUAL

TANAH Dijual Uk. 20x90m, Gg. Sado Psr. 3 Marindal I, SHM HP. 0813.6155.5598

Perusahaan MALAYSIA MARINE AND HEAVY ENGINEERING HOLDING SDN. BHD (anak cabang Petronas) yang berada di Johor, Malaysia, memerlukan pekerja laki-laki sebagai tenaga ahli. Dengan persyaratan sebagai berikut: 1. Laki-laki berumur antara 20 - 35 tahun 2. Pendidikan minimal SMU, STM/ sederajat 3. Kontrak kerja 2 tahun 4. Mendapat izin dari orang tua/ keluarga Fasilitas dan gaji: 1. Gaji pokok RM 1000 2. Gaji tidak termasuk lembur 3. Asrama dan transport disediakan gratis 4. Dilindungi oleh asuransi selama bekerja Jika berminat segera mendaftar dengan membawafotocopyIjazah,KTPdanpasphoto masing-masing 2 lembar, curiculum vitae (Daftar riwayat hidup) dan referensi pengalaman kerja dapat dikirim melalui e-mail ke: sfc@saharafajarindo.com atau yunita @saharafajarindo.com atau diantar langsung ke alamat berikut:

BERTAHUN..BELUM SEMBUH ....?

Layanan Fardhu Kifayah A. MUBARAKH membutuhkan beberapa karyawan untuk diposisikan sebagai: A. Supir Ambulans/ Supir pribadi Syarat: Pria, mampu membawa mobil ambulans jenazah, memiliki SIM B dan C, menguasai jalanan kota Medan (yang menguasai jalan dalam dan luar kota lebih dipertimbangkan) B. Staff Delivery Syarat: Pria, memiliki SIM C, menguasai jalanan kota Medan, belum menikah C. Penjahit Bordir Syarat: Wanita, pandai menjahit bordir, belum menikah Lamarandiantarataudatanglangsungke: Layanan Fardhu Kifayah A. MUBARAKH Jl. Denai No. 140 Medan (depan Kantor Pos Medan Denai)

Wasiri berani menjamin kesembuhan tuntas ambeien/wasir anda. Sangat berkhasiat dan cepat menghilangkan ambeien. Wasir yang menonjol maupun yang tumbuh di dalam. Redakan rasa sakit, perih dan menghentikan pendarahan waktu buang air besar, mencegah infeksi dan panas dalam serta melancarkan buang air besar. Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887

Harian WASPADA BURSA

PENDIDIKAN

PENDIDIKAN TENAGA KESEHATAN AKADEMI FISIOTERAPI SITI HAJAR MEDAN

PERTAMA DAN SATU-SATUNYA AKADEMI FISIOTERAPI DI SUMATERA YANG TERAKREDITASI B (BAIK) DEPKES DAN BAN PT “MEMBERIKAN BEASISWA PRESTASI DAN KURANG MAMPU DARI DIKTI” PENERIMAAN MAHASISWA/I BARU TAHUN AJARAN 2012-2013 PENDAFTARAN MULAI SEKARANG INFORMASI LEBIH LANJUT HUBUNGI

KAMPUS UTAMA

JL. LETJEND. JAMIN GINTING NO. 2 MEDAN TELP. (061) 822.3939 CP. 0878.6721.1681 - 0811.634.594

STIKes MUTIARA INDONESIA

MENERIMA MAHASISWA/I BARU 1. Magister Kesehatan (M.Kes) 2. Sarjana Kesehatan Masyarakat (SKM) 3. Sarjana Keperawatan (S.Kep) 4. Profesi Ners (Ns) 5. Diploma III-Kebidanan (Am.Keb) Terakreditasi BAN-PT

AKBID - AKPER - AAK - AKAFARMA SARI MUTIARA Terakreditasi BAN-PT & Depkes RI Ujian masuk: 7 Agustus 2012 Informasi selanjutnya & pendaftaran

KAMPUS PENDIDIKAN SARI MUTARA Jl. Kapten Muslim No. 79 Medan Telp. (061) 847.6769 - 845.2687 HP. 0813.6209.2630


Agenda

WASPADA Senin 30 Juli 2012

07.00 Sinema Pagi 09.00 Dahsyat 11:00 Infotainment INTENS 12:00 SeputarIndonesia Siang 12:30 Sinema Siang 14.30 Kabar Kabari 15.00 Silet 15.45 Target Operasi 16.30 Body Bowling 17.00 SeputarIndonesia 17.30 Mega Sinetron :Dalam Mihrab Cinta 18.30 Yang Masih Di Bawah Umur 21.30 Mega Sinetron :Tukang Bubur Naik Haji 22.00 Box Office Movie 00.00 Seputar Indonesia Malam 02.45 Kampung Sahur RCTI04.45 Kampung Sahur RCTI

CATATAN

07.00 Inbox 09.00 Halo Selebriti 10.00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 Liputan 6 Siang 12.30 SCTV FTV 14:00 Liputan 6 Terkini 14:30 Status Selebriti 15.00 Cinta Dan Uya Sama Sama Kuya 15.30 Mutiara Hati Quraish Shihab 17.00 Liputan 6 Petang 17.33 Mengetuk Pintu Hati, Azan Maghrib,Doa Berbuka Puasa 18.00 Para Pencari Tuhan Jilid 6 19.30 SCTV Sinetron :Putih Abu Abu 21.30 Insya Allah Ada Jalan (Maher Zain) 22.30 Liputan 6 Terkini 22.03 SCTV FTV Utama 02.00 Sabar Tingkat 2 (Sahur Bareng Reynaldi) 03.00 Para Pencari Tuhan Jilid 6

07:00 - Disney Club : Handy Manny 08:00 - Serial Pilihan 10:00 - Kisah Unggulan 11:30 - Lintas Siang 12:00 - Layar Kemilau 13:30 - I Drama 15:00 - Diantara Kita 15:30 - Lintas Petang 16:00 - Animasi Spesial 16:50 - Filler Didi Tikus 17:00 - Animasi Spesial : Shaun The Sheep 18:00 - Animasi Spesial : Chaplin And Co 18:30 - Aladdin 19:30 - Dewi Bintari 20:30 - Raden Kian Santang 21:28 - Filler Mnctv Pahlawan Indonesia 21:30 - Putri Nabila 23:00 - Intermezzo 00:00 - Sidik 00:30 - Lintas Malam 01:00 - Sidik Kasus 01:30 – Indahnya Sedekah 02.15 Tauladan Ramadhan 03.00 Kami Bukan Malaikat

07:30 - Fresh & Fun 08:00 - Friends 09:00 - Fenomania 09:30 - Seleb @ Seleb 10:00 - Bread, Love And Dreams 11:30 - Topik Siang 12:00 - Klik ! 13:00 - Tom & Jerry 14:00 - Duckula 14:30 - Woody Wood Pecker 15:00 - ISL 17:30 - Topik Petang 18:00 - Pesbukers 19:30 - Catatan Si Olga 20:30 - Style 21:30 - Pilih Pilih Mantu 22:30 - Black In News 23:00 - Four Wheel Drive 23:30 - Dokumenter 01.30 - Jejak Rasul 02.30 - Ramadhan Di Masjidil Haram 03.00 Sahur Bareng Mamah

07:00 KISS Pagi 08:00 Halo Polisi 08:30 Sinema TV Pagi 10:00 Sinema TV Spesial 12:00 Patroli 12:30 Drama Asia Naughty Kiss 13:30 Drama Asia Protect The Boss 15:00 KISS Sore 16:00 Fokus 16:30 Buaya Show 17:00 Sinema Tv Spesial: 17.30 Rangkaian Jalan Hikmah 18:00 Kisah Sembilan Wali 19:00 Sinetron Unggulan 20:00 Tutur Tinular 22:00 Konser Dangdut 01.30 Rahasia Ramadhan 03.00 Sahur Bersama

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Metro Xin Wen 11.05 e Lifestyle 13.05 Zero to Hero 14.30 Metro Sore 15.30 Public Corner 16.05 Ensiklopedia Islam 16.30 Oase Ramadhan 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Prime Interview 21.05 Top Nine News 22.05 Economic Challenges 23.05 Metro Realitas 23.00 Metro Sports 02.30 Humor Sahur 03.05 Tafsir Al Misbah 04.05 Sukses Syariah

A7 06.30 Apa Kabar Indonesia 09.30 Kabar Pasar Pagi 10.00 Coffee Break 11.30 Kisah Sukses UMKM 12.00 Live News Kabar Siang 13.30 Satu Jam lebih Dekat 14:30 Live News Kabar Pasar 15.00 Best Match La Liga 17.00 Live News KAbar Petang 19.30 Apa Kabar Indonesia Malam 21.00 Live News Kabar Malam 22.00 Live News KAbar Arena 23.30 The Legend 02.30 Radio Show Sahur

06:30 Apa Kabar Indonesia Pagi 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Apa Kabar Indonesia Siang 15:30 Tabliq Akbar 16:30 Live News Kabar Petang 19:00 Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Kabar Arena 22:30 Radio Show 02.00 Radio Show Sahur

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

OnceMelawan“Kiamat” Kecil Industri Musik BANYAK insan musik bertanya dan terheran-heran, mengapa vokalis sekaliber Elfonda Mekel akrab disapa Once, butuh tujuh tahunan melansir solo album perdana Self Title bertajuk Djarum Super Mild Once & His Album?. Padahal, pria flamboyan kelahiranMakassar, 21 Mei 1970 ini, sudah mulai meri-lis single bertajuk Anggun tahun 1995. Setelah lima tahun naik pangkat menjadi vokalis Dewa band – menggantikan Ari Lasso (tahun 2000), Once pun mampu membuktikan potensi besarnya sebagai solois lewat sukses besar single Dealova - lagu tema film Dealova (2005) menjadi hits di Indonesia, Singapura dan Mala-ysia. “Ketika kesempatan merilis solo album terbuka lebar, saya harus menghadapi kenyataan kondisi industri musik nasional tak terlalu baik. Jadi, saya perlu menungu momentum yang tepat. Setelah tertunda tujuh tahu-nan pasca dirilisnya single Dea-lova, akhirnya album perdana beredar juga,” papar Once kepa-da wartawan di Hotel Crowne Plaza - Jakarta Selatan, baru-ba-ru ini. Kendati terkesan terlambat, lanjut vokalis bergelar Sarjana Hukum jebolan Universitas Indonesia tahun 1989 ini, dirinya merasa puas bisa merampungkan solo albumnya yang diedarkan lewat jaringan toko buku Gramedia di seluruh Indonesia maupun secara online. Pasalnya, awal hingga proses akhir produksi dirinya terlibat langsung, baik sebagai penyanyi, pencipta lagu, produser musik hingga aranjer beberapa lagu karya sendiri. “Saya begitu ekspresif. Lantaran leluasa memasukkan nada-nada pilihan sendiri dalam album ini. Ba-ik lewat piano maupun drum,” terang Once seraya menjamin cita rasa solo albumnya berbeda dengan lagulagu sejumlah al-bum bersama Dewa band. “Lantaran bebas mengeluarkan ide musikalitas tanpa ada tekanan dari pihak mana

SERVICE

ELEKTRONIK

GAS

SERVICE KOMPOR A Hok 0812 658 0682

SERVICE

WC WC

KONSTRUKSI TUMPAT/ SEDOT SETIA BUDI HP. 8442246

pun, lagu-lagu solo album ini sangat saya sekali,” tandas Once yang menandai peluncuran debut albumnya melakukan konser intim dengan penggemarnya lewat event Djarum Super Mild Once and His Album di Surabaya Town Square (14/6), dan Hotel Crowne Plaza Jakarta Selatan. Tentang tertunda cukup lama album Once, dua pemerhati industri musik nasional Theo-dore KS dan Andre “Opa” Sumu-al kepada Waspada dengan nada hampir sama ber komen-tar, hal tersebut disebabkan momentum Once keluar dari Dewa band awal Januari 2011 waktunya kurang tepat. “Saat itu industri musik nasional sedang terpuruk. Untung saja, aura kebintanggan sebagai vokalis mampu dipertahankan lewat kiprah soloisnya hingga album perdananya resmi diluncurkan ke pasaran Juni ini,” ujar Andre Opa. “Semoga lewat terobosan baru yakni pemasaran album via toko Gramedia dan Multiply plus dukungan Djarum Super Mild serta Megapro Communications bakal mendukung serangkaian konser promo turnya, Once mampu melawan kiamat kecil yang masih melanda industri musik nasional. Akibat anjloknya penjualan album fisik maupun RBT,” harap Theodore KS, wartawan musik senior ibukota. Album solonya berma-

BURSA

PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Waspada/Agustian Once terikan 10 lagu, Once mengusung enam lagu karyanya sendiri dan ikut memaikan piano yakni nomor Pasti Untukmu, Hidup Ini, Hari Ini Juga, Satu dari Sejuta. Dan lagu Missing You menampilkan Gugun Blues Shelter. Empat lagu lainnya, Hilang Naluri ciptaan Dewiq, I Still Love You (Younky Soewarno), Kucinta Kau Apa Adanya ( Pay dkk) dan Dealova (Opick). Meidi Ferialdi, direktur pemasaran PT Aquarius Musikindo menambahkan, album Once dijamin tak mengecewakan penikmat musik. “Banyak lagu Hits di dalamnya. Meski saat ini pasar industri musik, lagi tidak bagus,” tandas Meidi ber-harap trend penjualan album fisik yang bergairah kembali le-wat jaringan market lain - selain toko khusus CD mampu men-dongkrak omzet penjualan al-bum Once. * (AgusT)

Aktris berusia 39 tahun ini sangat cantik walau hanya mengenakan kemeja putih dan celana panjang hitam. Dengan rambut terurai indah pasti orang-orang tidak percaya bahwa aktris ini kini sudah berusia mendekati kepala empat. Cameron Diaz baru-baru ini membintangi film What To Expect When You’re Expecting bersama aktor Chris Rock. What To Expect When You’re Expecting menceritakan lima pasang calon orang tua mencoba mempersiapkan diri menjadi orangtua. JenniferLopez, AnnaKendrick,JoeManganiello,MatthewMorrison dan Dennis Quaid juga membintanginya. Sementara Cameron Diaz bermain dalam film gress The Counsellor bersama Brad Pitt, Javier Bardem dan Michael Fassbender. Perannya dalam ini menjadi wanita misterius bernama Malkina diisukan sebagai nama teman wanita Brad Pitt. The Counsellor berkisah tentang seorang pengacara terlibat kasus obat-obat terlarang digarap sutradara Ridley Scott. Nur/metro.co.uk

Elton John/metro.co.uk

Elton John Merasa Beruntung Masih Hidup

Sir Elton John merasa dia bisa saja meninggal bertahun-tahun lalu karena penyakit AIDS dideritanya, tapi kini merasa beruntung dia masih hidup hingga sekarang. Pengakuan ini disampaikann pentolan The Rocket Man yang menikahi teman sejenisnya David Furnish dalam International IDS Conference di Washington, Amerika Serikat. Legenda musik ini menyebut beberapa kolega musisinya seperti Freddie Mercury, pentolan band Queen dan aktor Hollywood Rock Hudson meninggal karena AIDS sebelum menginjak usia 60 tahun. Sir Elton, secara rinci mem-

beberkan masa lalunya sebagai bintang musik rock tahun 80an diisinya dengan seks bebas dan mengkonsumsi kokain. Dia menjelaskan sangat terjerumus hingga ke dasar, namun beruntung bisa bangkit. “Saya seharusnya sudah mati, berada dua meter di dalam peti mati. Saya yang terkena AIDS tahun 1980 dan meninggal di tahun 1990 seperti Freddie Mercury dan Rock Hudson,” katanya seperti dilansir laman web thesun.co.uk. “Setiap hari saya berpikir, bagaimana saya bisa bertahan hingga sekarang,” tambahnya. Bintang eksentrik yang sudah bersih dari masa lalunya

(Jonathan Togo), Sgt. Frank Tripp (Rex Linn), Natalia Boa Vista (Eva LaRue) dan Walter Simmons (Omar Miller). Di musim ini akan diajak mengenal lebih dalam karakter Horatio. Episode terakhir musim kesembilan, ketika Horatio yang terluka parah karena tertembak, berusaha menyelamatkan rekannya, Natalie yang terkurung dalam bagasi mobil dan tercebur ke dalam laut. Episode perdana musim ini berjudul Countermeasures, mengi-sahkan upaya Horatio dan tim mengejar Randy North (Ethan Em-bry,) mencelakai Natalie juga pembunuh berantai Jack Todler (Callum Keith Renie) yang menembak Horatio. Dalam keadaan masih terluka, Horatio bertemu dengan

mendiang istrinya, Marisol (Alana De La Garza). Pertemuan yang mengharukan itu seolah mensyaratkan kesiapan Horatio merelakan kepergian istri yang sangat dicintainya, dan melanjutkan hidup. Sementara Natalia masih terguncang, berusaha untuk kembali hidup normal dan mengembalikan kepercayaan dirinya. Sikap Horatio yang sangat melindungi anak buahnya akan terlihat di tiap episode. Ia bersama tim akan menghadapi berbagai kasus yang sangat sulit dan berbahaya. Saluran AXN melalui Indovision (ch. 154), First Media (ch. 32), Telkomvision (ch. 122), Groovia TV (ch. 553), Aora (ch. 415), Centrin TV (ch. 411) dan Skynindo (ch. 31).(m19)

0812 631 6631 Ada Garansi

Jl. P. BRAYAN MEDAN

HP. 0813 7035 7291 Ada Garansi

BURSA

MATERIAL

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

Harian WASPADA

07:30 Selebrita Pagi 08:00 Gak Nyangka 08:30 Ups Salah 09:00 Mendadak Jutawan 09:30 Spotlite 10:30 Warna 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-Citaku 14:00 Dunia Binatang 14:30 Koki Cilik 15:00 Brownies 16:00 Jejak Petualang 16:30 Redaksi Sore 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Jam Malam 00:00 Mata Lelaki 00:30 Sport7 Malam 01:00 Redaksi Malam 04.30 Rahasia Sunnah 05.00 Khalifah **m31/G

CameronDiazBerperan Sebagai Wanita Misterius

Serial CSI Miami Masuki Musim Terakhir Penggemar CSI Miami pasti akan bersedih karena pada akhirnya serial sangat populer ini, bakal memasuki musim pamungkas. Horatio dan seluruh anak buahnya, akan tercerai berai mening-galkan karakter mereka. Deretan kasus kriminal akan mereka hadapi di musim kesepuluh mulai 8 Agustus, tiap Rabu, pukul 20:00 di saluran AXN. Tidak akan ada musim kesebelas juga harus mengucapkan selamat tinggal pada karakter Lt Horatio Caine (David Caruso) atau akrab dipanggil ‘H’, pemimpin tim khusus investigasi, bersama anak buah buahnya Det. Calleigh Duquesne (Emily Procter), Det. Eric Delko (Adam Rodriguez), Det. Ryan Wolfe

08:00 Oggy and The Cockroaches 08:30 Cerita Pagi 09:00 Doo Bee Doo 10:00 Dapoer Cobek 10:30 Obsesi 11:30 Hot Spot 12:00 Global Siang 12:30 Awas Ada Sule 13:30 Petualangan Panji 14:00 Masih Main Kata 15:00 100% Ampuh 16.00 Fokus Selebriti 16:30 Spongebob Squarepants 18:30 Big Movies 21:00 Big Movies 23:00 Big Movies 03.30 Sahur Sambil Senyam Senyum 04.00 Jejak KebesaranMu

CSI Miami

se-lama 22 tahun menunjukkan perjuangannya dalam bertarung melawan ketergantungan obat untuk kasih sayang kepada orang lain. Dia mengimbau penonton untuk menghormati orangorang terjangkit AIDS dan memberikan dukungan yang sama seperti didapatnya saat berada di titik terendah. Dia menyarankan semua orang untuk membagikan pesan tersebut kepada orang lain melalui situs-situs pertemanan seperti Twitter, karena dia sendiri tidak tahu banyak Twitter. “Saya tidak tahu bagaimana caranya. Saya bisa menyanyi, tapi saya tidak bisa nge-tweet,” ujarnya. (ant)

Cameron Diaz/blogspot.com


Politik & Hukum

A8

WASPADA Senin 30 Juli 2012

Semua Cagubsu Rentan Kena Black Campaign MEDAN (Waspada): Menjelang Pilgubsu 2013 semua kandidat diprediksi rentan terkena black campaign (kampanye negatif) oleh lawan-lawan politiknya.

Hal itu dikatakan pakar politik dari Universitas Sumatera Utara Prof. Subhilhar dan Muryanto Amin, dosen Fisip USU, saat dihubungi wartawan secara terpisah, Minggu (29/7). Saat ini

Kriteria Cagubsu Tidak Karbitan MEDAN (Waspada): Kriteria calon Gubernur Sumatera Utara (Cagubsu) ke depan tidak karbitan artinya sosok tersebut muncul ke permukaan hanya ketika mau pemilihan, kata Kepala MTs, MA Pondok Pesantren Modern Darul Hikmah Taman Pendidikan Islam (PPMDH TPI) Jl. Pelajar Medan Yose Rizal,S.Ag,MM menanggapi sosok calon pemimpin Sumatera Utara ke depan, Minggu (29/7). Selain itu, harus memiliki pengalaman khususnya di Ormas maupun Parpol, punya wawasan baik di birokrat, legislatif maupun yudikatif. Keikutsertaannya pun jangan hanya sekadar meramaikan atau dikarenakan banyak memiliki uang. Apalagi Sumut mayoritas umat Islam 60 persen, sehingga tidak ada alternatif lain Cagubsu mendatang harus memiliki sifat Rasul siddiq, amanah, tabligh dan fathonah. Diutamakan harus laki-laki karena sifat emosionalnya lebih jelas dan tegas serta mampu merangkul masyarakat Sumatera Utara yang heterogen baik dari kalangan minoritas maupun mayoritas. Serta bisa mengayomi semua golongan tanpa melihat status sehingga bisa memiliki power yang bermuara bisa memecahkan berbagai masalah yang terjadi, maka pemimpin Sumut ke depan harus punya keberanian dalam arti positif, kata Yose Rizal. Walaupun saat ini sudah muncul nama-nama yang maju untuk menjadi cagubsu, tapi itu belumlah mutlak. Apalagi masyarakat Sumatera Utara sangat kritis dalam menilai sosok pemimpin yang tepat. Masyarakat Sumut tidak mau lagi diimingi dengan janjijanji yang tak jelas oleh para calon. Tapi masyarakat ingin bukti bahwa janji tersebut harus ditepati bila perlu tunjukkan dulu sebelum nantinya menang dalam Pilgubsu. Diimbau kepada masyarakat agar jangan salah pilih, sehingga pemimpin mendatang benar-benar bisa mengayomi, menerima berbagai aspirasi serta membuktikannya dalam mensejahterakan masyarakat Sumut khususnya. Cagubsu juga jangan hanya menyampaikan slogan-slogan yang nantinya tidak sesuai dengan keinginan masyarakat. “Pilihlah tokoh-tokoh muslim yang memiliki kredibilitas yang baik, tidak rakus serta anti korupsi, tidak suka money politics selain mampu meneladani. Dan Jika tidak berpengalaman lebih baik introspeksi diri,” ujarnya. Pemimpin Sumut mendatang memiliki tantangan cukup berat yang harus dipertanggungjawabkan karena banyak sekali persoalan antara lain masalah tanah, guru, sampai kasus perubuhan rumah ibadah yang sampai hari ini belum juga kunjung selesai. Dan sebagai KDH (kepala daerah) harus mampu menyelesaikannya secara tuntas sehingga yang menyangkut kepentingan masyarakat tidak hanya bicara lewat media tapi harus dengan karya nyata di lapangan dan bukan karya kata.(m24)

sudah muncul beberapa nama bakal Cagubsu 2013 seperti Gus Irawan Pasaribu, Gatot Pujo Nugroho, AY Nasution, Amri Tambunan, Cornel Simbolon, Chairuman Harahap, Sutan Bathoegana dll. Menurut kedua pakar politik itu, black campaign bisa terjadi di mana saja. Lewat baliho, spanduk, media cetak, media elektronik, bahkan lewat perkumpulan sekali pun. Dan paling berpeluang untuk black campaign adalah lewat media cetak, jelasnya. Subhilhar mengatakan black campaign dalam pemilihan kepala daerah (pilkada), dalam hal ini P ilgubsu biasanya dilakukan terhadap peserta yang dipandang memiliki potensi atau kans besar untuk memenangkan pemilihan tersebut. Umumnya, kata dia, siapa yang paling berpeluang itulah yang sering jadi bulan-bulanan black campaign. “Hal ini biasanya dilakukan kontestan yang memandang kompetitornya

MEDAN (Waspada): DPW JBMI (Dewan Pimpinan Wilayah Jami’iyah Batak Muslim Indonesia) Sumut menilai berbagai isu tebar pesona para balon (bakal calon) Gubsu pada pilkada tahun 2013 bukan merupakan gagasan atau ide serta wacana baru, tapi hanya sekadar mencari popularitas di tengah masyarakat. “Masyarakat cenderung dijebak oleh isu-isu yang tidak popular dari para balon Gubsu,” kata Ketua DPW JBMI Sumut Aidan Nazwir Panggabean ketika dihubungi Waspada dari Medan saat melakukan safari Ramadhan diMasjidFisabilillahTobasa(Toba Samosir), Minggu (29/7).

langsung tancap gas pulang ke rumahnya, sedangkan keempat pelaku yang mengendarai sepedamotor mengejar korban. Sesampainya di depan rumah korban di Jalan HOS Cokroaminoto simpang Jln. Percut No 157/233, mobil korban dihadang oleh TPS. Keempat pelaku memaksa korban keluar dari dalam mobil dan kemudian menganiayanya hingga kritis. Sejumlah warga yang menyaksikan Rinaldi Abdillah Hutasuhut dianiaya di depan rumahnya sendiri segera menolongnya. Tiga teman pelaku melarikan diri sedangkan TPS dipukuli sejumlah warga. Petugas Polsek Medan Timur yang dipimpin langsung oleh Kanit Reskrim AKP Ridwan Daniel segera menyelamatkan tersangka TPS dari amuk warga. Tersangka TPS yang ditemui di Polsek Medan Timur mengaku nekad menganiaya korban karena cemburu istrinya telah diganggu oleh korban. “Istriku sering diganggunya. Bahkan, korban sempat ngirim sms bahwa akan membelikan Dewi bra,” tutur TPS. Sementara itu, Kapolsek Medan Timur Kompol Patar Silalahi melalui Kanit Reskrim AKP Ridwan Daniel mengatakan, pihaknya telah menangkap tersangka TPS dan tiga lagi teman pelaku masih diburon. “Pelaku utama sudah ditangkap dan tiga pelaku lainnya masih diburon,” sebutnya. Dijelaskan Ridwan, motif penganiayaan tersebut karena tersangka cemburu, istrinya sering digoda oleh korban saat berada di salon. (h04)

Pergantian Kamaluddin Harahap Jadi Polemik

PAN Nilai Saleh Bangun Lancang MEDAN (Waspada): Masalah permintaan pergantian Wakil Ketua DPRD Sumut dari Partai Amanat Nasional (PAN) akhirnya menjadi polemik. Dewan Pimpinan Wilayah (DPW) PAN Sumut menilai Ketua DPRD Sumut H Saleh Bangun sudah terlalu jauh mencampuri urusan internal PAN. Reaksi keras muncul dari DPW PAN Sumut setelah Ketua DPRD Sumut Saleh Bangun mengeluarkan pernyataan. Yakni pihaknya tidak lagi memproses surat DPW PAN Sumut yang minta Kamaluddin Harahap diganti. Alasannya karena Ketua Umum DPP PAN Hatta Rajasa ternyata tetap mempertahankan Kamaluddin Harahap menduduki kursi pimpinan DPRD Sumut. Itu disampaikan Hatta Rajasa, saat ditemui para pimpinan DPRD Sumut beberapa hari lalu di Jakarta. Menanggapi ini, Sekretaris DPW PAN Sumut yang juga Ketua Fraksi PAN DPRD Sumut Parluhutan Siregar berkomentar keras. Katanya, Saleh Bangun bukan saja sudah terlalu jauh mencampuri urusan internal PAN, tapi juga sudah terlalu lancang memberikan keterangan pers mengatasnamakan Ketua Umum DPP PAN Hatta Rajasa. “Padahal dia tidak memiliki selembar dokumenpun untuk menguatkan tindakannya,” kata Parluhutan. Dijelaskan Parluhutan, pengangkatan/pergantian pimpinan dewan dari PAN merupakan otoritas pimpinan partai setingkat. Untuk DPRD Provinsi, kewenangan itu berada di DPW PAN. Berkaitan dengan pergantian Kamaluddin Harahap sebagai wakil ketua DPRD Sumut,

menang dalam pilkada. “Black campaign menjadi negatif karena rekayasa informasi. Informasi yang sesat itu kemudian direkayasa oleh tim sukses dari kandidat yang kemudian menggunakan pihak lain untuk menyampaikan isu negatif kepada masyarakat. Biasanya track record dari kontestan yang menjadi sasaran black campaign,” jelasnya. Baik Subhilhar maupun Muryanto Amin setuju jika black campaign yang cenderung menyudutkan peserta pilkada, harus dihindari. Sebab demokrasi berprinsip pada kompetisi yang sehat di antara para pelakunya. Subhilhar mengatakan, seluruh elemen masyarakat harus mampu menjaga agar setiap kontestan tidak melakukan black campaign. “Peran setiap elemen masyarakat sangat penting. Jika ada kontestan yang sering melakukan black campaign, maka sudah seharusnya jangan dipi-

lih. Karena itu akan merugikan masyarakat,” tegasnya. Oleh sebab itu, jelas Subhilhar, diperlukan peraturan yang tegas yang mengatur tentang pelarangan black campaign di mana saja. Peraturan yang ada saat ini, jelasnya, hanya mengatur pelarangan black campaign saat masa kampanye. “Padahal kegiatan ini sudah dilakukan sebelum masa kampanye. Di sini diperlukan peraturan yang tegas untuk melarang kegiatan black campaign mulai dari pra hingga masa kampanye,” tegasnya. Sementara Muryanto Amin menegaskan, daripada melakukan black campaign, lebih baik para kontestan melakukan debat publik. “Dalam debat publik tersebut masing-masing kontestan dapat mengetahui track record kompetitornya.” Baik Subhilhar maupun Muryanto Amin tidak mau menyebut siapa Cagubsu yang sudah muncul paling berpeluang di-black campaign.(m06)

DPW JBMI: Balon Gubsu Tebar Pesona Cari Popularitas

Gara-gara Cemburu Istri Digoda Pelanggan Salon Dianiaya MEDAN ( Waspada): Merasa cemburu istrinya yang bekerja di salon kecantikan diganggu oleh seorang pelanggan pria, membuat tersangka TPS, 23, warga Jln. Rakyat Gang Perbatasan, Kec. Medan Perjuangan, dan tiga temannya menganiaya Rinaldi Abdillah Hutasuhut, 31, hingga kritis di Jalan HOS Cokroaminoto, Kel. Sei Kera Hulu, Kec. Medan Perjuangan, Minggu (29/7) sekira pukul 11:00. Korban Rinaldi kini dirawat secara intensif di Rumah Sakit Colombia Medan, sedangkan tersangka TPS telah ditangkap petugas Polsek Medan Timur, sedangkan tiga lagi teman tersangka masih diburon. Informasi yang diperoleh di kepolisian, peristiwa penganiayaan tersebut berawal dari cerita Dewi kepada suaminya TPS. Dewi mengaku ada seorang pria yang sering datang ke salon tempat dia bekerja di Jln. Rakyat dan sering mengganggunya. Selain itu, korban juga sering mengirim sms ke HP Dewi. Mendengar keluhan istrinya, tersangka TPS jadi cemburu dan berniat memberi pelajaran kepada korban. Setelah mengetahui ciri-ciri dan mobil yang dikendarai oleh Rinaldi Abdilah Hutasuhut, akhirnya TPS dan tiga temannya menunggu korban yang biasa melintas di Jln. Purwo. Tak berapa lama menunggu, tersangka TPS dan tiga temannya itu melihat korban melintas mengendarai Kijang Innova BK 1647 JA. Begitu melihat mobil korban, keempat pelaku langsung melempari bagian depan dan belakang mobil tersebut hingga kacanya berpecahan. Mengetahui mobilnya dilempari, korban

memiliki kans besar memenangkan pilkada. Dia akan mencari-cari kesalahan kompetitornya dan kemudian menyampaikannya ke publik. Black campaign merupakan langkah yang paling praktis dan gampang, walaupun dosanya banyak,” kata Subhilhar. Hal itu, menurutnya, lumrah terjadi dalam setiap proses pemilihan. Meskipun demikian, menurut Subhilhar, black campaign tersebut sangat bertentangan dengan etika politik dan iklim demokrasi di mana kompetisi yang sehat sangat dianjurkan. Subhilhar menambahkan black campaign terjadi tidak hanya saat masa kampanye pilkada. Justru masa sebelum kampanye, black campaign tersebut sudah dimulai. Pengamat politik dan dosen Fisip USU Muryanto Amin juga mengatakan black campaign akan dialami oleh figur-figur yang dipandang kuat dan memiliki peluang besar untuk

disebutkan Parluhutan, sudah sesuai dengan aturan dan mekanisme PAN. Yakni SK No. 074/ 2009 dan kode etik hubungan anggota dewan dengan partai. Lagi pula, kata Parluhutan, DPP PAN sudah memberikan jawaban atas surat ketua DPRD Sumut yang meminta konfirmasi terhadap surat DPW PAN Sumut yang minta Kamaluddin Harahap diganti. Dalam surat DPP PAN yang ditandatangani Ketua POK Hafizs Thohir dan Sekjen DPP PAN Taufik Kurniawan, disebutkan bahwa apa yang dilakukan oleh DPW PAN Sumut dalam hal pergantian Kamaluddin Harahap sebagai wakil ketua DPRD Sumut, telah sesuai dengan mekanisme dan aturan PAN yang berlaku. Melihat seluruh mekanisme partai telah terpenuhi untuk meminta pimpinan DPRD Sumut mengganti wakil ketua dari PAN Kamaluddin Harahap, rasanya sudah tidak perlu ada lagi polemik terjadi. Harusnya Ketua DPRD Saleh Bangun tidak melakukan proses pergantian saja, sesuai permintaan partai politik. Bukan malah menjadikannya ini sebagai polemik. Atas pernyataan Saleh Bangun, dibeberapa media massa beberapa hari lalu, Sekretaris DPW PAN Sumut Parluhutan Siregar tegas menyebutkan kalau Ketua DPRD Sumut tidak beretika. DPW PAN Sumut mempertimbangkan untuk mengambil langkah hukum, langkah politik dan organisasi yang dipandang perlu untuk menyikapi tindakan Saleh Bangun tersebut. “Karena kita (PAN)nilaiapayangdilakukanKetuaDPRDitusudah sangat lancang. Dia sudah terlalu jauh mencampuri urusan internal PAN,” sebutnya. (m12)

Menurut Aidan (foto), program tebar pesona sudah semacam keharusan bagi setiap balon Gubsu dalam upaya membangun popularitas. Padahal, dalam konteks itu isu yang diusung sudah merupakan kewa-

jiban bagi setiap Gubsu terpilih untuk melaksanakannya, karena itu adalah tuntutan undang-undang. Contohnya isu tentang ekonomi yakni mengangkat usaha kecil dan menengah, pendidikan, peningkatan pembangunan infrastruktur. Namun, setelah terpilih isu-isu itu tidak pernah dapat terwujud sebagaimana diharapkan. “Kini, isu itu diangkat lagi,” tegas Aidan. Dalam kaitan ini, JBMI menilai para balon Gubsu sengaja dibalut dengan isu-isu yang tidak populer dan masyarakat cenderung terjebak dengan strategi itu. Kemudian, ketika mereka terpilih tidak dapat ber-

buat apa-apa, karena memang balon bersangkutan tidak mempunyai kompetensi untuk itu. Aidan juga menegaskan, saat ini ada kesan para balon Gubsu sangat ahli membungkus dirinya dengan isu-isu pembangunan. Bahkan di antara mereka tidak segan-segan melakukan black campaign terhadap saingannya. Padahal, jika dirinya terpilih belum tentu bisa berbuat seperti apa yang dilakukan pemerintah saat ini. Sebagai orang pertama DPW JBMI Sumut, Aidan juga menegaskan, dari hasil pengamatan sejauh ini tak seorang pun balon Gubsu yang mengangkat isu membangun akhlak

Brimobdasu Tangkap Bandar Dan Pengedar Sabu 80,57 Gram SS, Uang Rp7,2 Juta Disita MEDAN (Waspada): Tim Khusus (Timsus) Brimob Poldasu menangkap dua bandar dan pengedar narkoba jenis sabu-sabu (SS) dalam penyergapan secara berbeda. “Polisi menyita barang bukti 80,57 gram sabu, uang Rp7. 250.000, dua timbangan elektrik, dua handphone, cacatan pemesan narkoba jenis sabu, ratusan plastik kecil akan dipergunakan pembungkus sabu, aluminium foil, bong,” kata Kasat Brimob Poldasu Kombes Pol Drs Setyo Boedi MH, SH, M.Hum, melalui Kaden Gegana Brimob Poldasu Kompol Adarma Sinaga SIK, SH, M.Hum kepada Waspada, Minggu (29/7) dinihari. Menurutnya, timsus dipim-

pin langsung Kasi Kasubden I CI Gegana Brimob Poldasu AKP Heriyono SH dan Kasubden IV Detasemen A AKP M Manullang SH, yang sedang melakukan pelacakan pelaku tindak kejahatan mendapatinformasiadanyaperedaran narkoba jenis sabu-sabu. Timsus langsung menuju lokasi dan menangkap seorang pengedar sabu berinisial CN , 27, dalam penyergapan di rumahnya Jln. Sekata Medan. Dari lokasi, disita barang bukti 74,50 gram, dua handphone yakni satu Blackberry warna hitam, Nokia warna merah, bong alat isap, dan kalung warna putih. Dalam pengembangan, ditangkap lagi bandar sabu Tmz, 27, ketika bersama kekasihnya

disebuahrumahyangjugamembuka usaha warnet di Jln. Gaperta Ujung, Helvetia. Dari lokasi itu yang disita 6,7 gram sabu yang disembunyikan di dalam tempat berasdanuangRp7.250.000,buku tambungan BCA, tas kecil warna coklat, dua timbangan elektrik, duahandphone,cacatanpesanan sabu, ratusan plastik kecil pembungkus sabu, aluminium foil, bong dan lainnya. “Kedua tersangka usai menjalani pemeriksan, terus dilimpahkan ke Sat Narkoba Polresta Medan untuk pengembangan lebih lanjut,” sebut Adarma Sinaga sembari mengatakan, Brimob Poldasu tetap membantu dalam pengungkapan berbagai kasus. (m36)

kataannya akan dipertanggungjawabkan tidak hanya pada manusia tapi juga Allah SWT. JBMI meminta masyarakat mencermati, mengapa para balon Gubsu tidak mengangkat isu-isu tentang perbaikan moral bangsa. Sebab, tidak tertutup kemungkinan jika isu itu dibangun di tengah-tengah masyarakat akan menjebak dirinya sendari ketika terpilih atau para sponsor akan meninggalkannya, karena dianggap tidak menarik. Menghadapi persoalan dan fenomena itu, lanjut Aidan, masyarakat Sumut harus cerdas dan selektifdalammenentukanpilihandan jangan terjebak dengan isu-isu yang tidak lagi populer. (m26)

Jurtul Togel Diringkus MEDAN (Waspada): Petugas Reskrim Unit Judi Sila Polresta Medan meringkus seorang juru tulis (jurtul) judi togel dalam penyergapan di kediaman tersangka di Jalan Nogio, Kel. Delta, Kec. Medan Deli Tua, Jumat (27/7). Tersangka RS, 30, kemudian diboyong ke Polresta Medan bersama barang bukti 5 lembar kertas yang bertuliskan nomor judi togel, dua buah pulpen, satu buah buku tafsir mimpi dan uang kontan Rp 127 ribu. Informasi di Polresta Medan Sabtu (28/7), penangkapan berdasarkan LP/257/VII/2012 tanggal 27 Juli 2012. Awalnya, petugas mendapatkan informasi dari masyarakat di kawasan Jalan Nogio ada permainan judi togel. Polisi melakukan penyelidikan dan menangkap tersangka RS dari rumahnya. Kasat Reskrim Polresta Medan Kompol MYoris Marzuki melalui Kanit Judi Sila AKP Edi Safari membenarkan adanya penangkapan tersebut. “Pelaku sudah kita amankan beserta barang bukti. Pelaku dijerat dengan pasal 303 Jo 55,56 KUHP tentang judi togel. Saat ini kita masih melakukan pemeriksaan lebih lanjut,” jelas Edi Safari. (m39)

HT Milwan Buka Puasa Bersama Anak Yatim

Tewas Digilas Truk

MEDAN (Waspada): Ketua DPD Partai Demokrat Sumut HT. Milwan dan keluarga menggelar acara buka puasa bersama anak yatim, kerabat dan jiran tetangga di kediamannya di Jln. Suka Sari, Medan Johor, baru-baru ini. Selain shalat Magrib dan Tarawih berjamaah, HT Milwan dan istri, Hj. Adelina serta putrinya, Hj. Melliana menyisihkan sedikit rezeki mereka untuk anak yatim. Milwan mengatakan, kegiatan di bulan suci Ramadhan ini pada hakikatnya untuk menjalin silaturahmi, sembari berbagi kebahagiaan dengan anak yatim. “Tentu saja buka puasa bersama anak yatim, kerabat dan jiran tetangga ini sebuah momen yang sangat kita dambakan. Sebuah kebahagiaan kita dapat berkumpul seperti ini dalam bulan suci Ramadhan,” ujar Milwan. Turut hadir sejumlah petinggi DPD Partai Demokrat Sumut seperti Bendahara Arif Rahman Marbun, Wakil Sekretaris Farianda Putra Sinik, SE, Direktur Eksekutif Borkat Hasibuan, Ketua DPC Partai Demokrat Labuhanbatu H. Mukhlis Hasibuan dan ratusan undangan lainnya. Audiensi Usai shalat Tarawih berjamaah di kediamannya Ketua DPD Partai Demokrat Sumut HT. Milwan, menerima audiensi rombongan Insan Muda Demokrat Indonesia (IMDI) Sumut. Rombongan IMDI Sumut terdiri Ketua DodiYusufWibisono, Wakil Ketua Abdul Hakim Harahap, Bakhtiar, Rivai Nasution, Arif Tampubolon, M. Khadafi dan Bendahara Bobi Fauzan. Dodi Yusuf mengungkapkan IMDI Sumut memiliki program kerja bersama-sama dengan Partai Demokrat akan ‘membirukan’ Sumut pada 2013 (Pilgubsu) dan agenda nasional 2014 berupa Pemilu Legislatif serta Pemilu Presiden. Sementara HT Milwan mengatakan, sebagai mitra Partai Demokrat, IMDI Sumut harus mampu memperkenalkan organisasi agar dikenal masyarakat. “Jadi harus mampu mempublikasikan diri dengan baik dengan merangkul pihak media,” katanya. Milwan juga berharap IMDI Sumut mampu merangkul unsur muspida dan ormas serta OKP, sehingga masyarakat tahu keberadaan IMDI. “Lakukan konsolidasi terus menerus dan membuat program yang dapat menyentuh masyarakat,” ujarnya. (m25)

MEDAN (Waspada): Bermaksud mendahului mobil Pick Up dari samping kiri, seorang pengendara sepedamotor tewas tergilas truk di Jalan Medan-Delitua Km 8, Jumat (27/7) sekira 17:30. Jenazah Rahmad Maulana, 16, warga Jalan Delitua sudah dibawa ke rumah duka. Informasi yang diperoleh di kepolisian, sore itu Rahmad Maulana mengendarai sepedamotor BK 5297 ACU datang dari arah Delitua menuju Medan. Persis di Km 8 tikungan depan Pekong Budha, korban mendahului mobil Pick Up dari samping kiri. Naas, sepedamotor korban bersenggolan dengan mobil tersebut dan terjatuh. Saat korban terjatuh, dari

KETUA DPD Partai Demokrat Sumut HT. Milwan beserta istri, Hj. Adelina dan putrinya Hj. Melliana memberi santunan kepada anak yatim di kediamannya.

Pengaduan Korban Perampokan Rp30 Juta Diragukan MEDAN (Waspada): Kasus perampokan Rp30 juta yang dilaporkan oleh Rudi, 35, pengusaha botot warga Jln. Japaris Medan, ke Polsek Percut Seituan, diragukan oleh pengusaha servis dinamo. Pasalnya, kronologis yang dilaporkan korban tidak sesuai dengan keterangan dari seorang saksi yang ikut bersama korban saat kejadian. Kepada wartawan, Tapid, 48, warga Jalan Selamat/Tanggukbongkar IX, Kec. Medan Denai, Jumat (27/7) mengatakan, pada Senin (16/7) sekira pukul 17:00, dia telah menjual 500 kg kawat tembaga bekas kepada pengusaha botot Rudi. Dalam transaksinya, kawat tembaga tersebut laku dijual seharga Rp30 juta. Usai menyerahkan tembaga tersebut, Tapid langsung pulang ke rumahnya dan Rudi berjanji akan segera mengantar uang tersebut ke rumah Tapid. Ditunggu beberapa jam, Rudi belum juga muncul, apalagi jarak antara rumah Tapid dengan tempat usaha botot Rudi di Jln. Pukat hanya berjarak beberapa ratus meter saja. Setelah ditunggu, akhirnya Rudi muncul di rumah Tapid. Namun, bukan uang Rp30 juta yang dibawa Rudi, melainkan selembar surat tanda bukti lapor ke kantor Polsek Percut Seituan. Rudi mengaku telah dirampok oleh kawanan perampok saat hendak mengantar uang ke rumah Tapid dengan mengendarai sepedamotor. Saat itu, Rudi berboncengan dengan pegawainya bernama Randy Arsanda yang masih berusia 15 tahun.

bangsa melalui pembangunan pendidikan berbasis agama. Padahal persoalan yang paling mendasar menyebabkan bangsa Indonesia berada pada posisi korupsi di tingkat atas dan krisis ekonomi berkepanjangan adalah masalah akhlak atau moral bangsa terutama para pemimpin. Namun, isu perbaikan akhlak dan moral nyaris tidak pernah diusung oleh balon. Sebagai bangsa yang religius, Indonesia tidak hanya membutuhkan orang-orang pintar dan cerdas, tapi kecerdasan dan pintar itu harus disertai dengan akhlakul karimah yang baik. Dengan begitu, lanjut Aidan, setiap perbuatan dan per-

Kepada polisi, Rudi mengaku uang senilai Rp 30 juta itu disimpannya di dalam plastik dan digantungkan di stang sepedamotor. “Tiba-tiba saja tas plastik berisi uang Rp30 juta itu dirampok orang,” tutur Rudi kepada polisi. Tapid yang tak percaya begitu saja cerita Rudi, diam-diam menanyai Randy tentang peristiwa itu. “Kepada polisi, Rudi mengaku kalau uang tersebut digantungkan di stang sepedamotor, namun menurut Randy Arsanda uang tersebut diletakkan di dalam jok sepedamotor dan tidak ada perampokan,” sebutnya. Karena meragukan adanya peristiwa perampokan tersebut, Tapid melaporkan kasus tersebut ke juru periksa Polsek Percut

Seituan sekaligus menceritakan kejanggalannya. Tapid juga sengaja menghadirkan Randy Arsanda untuk dimintai kesaksiannya. “Saya curiga dengan laporan pengaduan itu karena saksi yang ikut bersama korban tidak melihat uang tersebut digantung di stang sepedamotor, melainkan disimpan di dalam jok sepedamotornya,” ujarnya. Sementara itu, Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan mengaku, pihaknya akan segera memintai keterangan Rudi dan Randy Arsanda sekaligus melakukan pra rekon di TKP. “Penyidik segera mengkonfrontir korban dengan saksi yang dibawanya saat terjadinya aksi perampokan tersebut sekaligus melakukan pra rekonstrukdi di TKP,” tuturnya. (h04)

arahbersamaanmuncultrukColt Diesel BK 8425 DM yang dikendarai Irfan Syahputra, 25, warga Jalan Kapten Sumarsono, Medan Helvetia. Truk tersebut langsung menggilas tubuh korban. Petugas Unit Laka Sat Lantas Polresta Medan Aiptu Supriyanto dan Aiptu Kaspul Nasution yang tiba di TKP langsung membawa korban ke rumah sakit terdekat, namun dalam perjalanan nyawa korban tak terselamatkan lagi. Sopir truk Colt Diesel diboyong ke Sat Lantas Polresta Medan berikut truk dan sepedamotor sebagai barang bukti. “Sopir truk masih menjalani pemeriksaan di ruang penyidik,” sebut Aiptu Kaspul Nasution. (h04)

Waspada/ist


Luar Negeri

WASPADA Senin 30 Juli 2012

A9

DPR Filipina Usulkan PBB Agar Kerahkan Pasukan Ke Spratly MANILA (Waspada): Salah seorang anggota Parlemen Filipina mengusulkan adanya pengerahan pasukan perdamaian Perserikatan Bangsa-Bangsa (PBB) di Pulau Spratly. Pulau tersebut masih menjadi wilayah sengketa antara China dan Filipina. Menurut Ketua Komite Keamanan Nasional di Parlemen Filipina, Rodolfo Biazon, keberadaan pasukan perdamaian ditujukan untuk mewaspadai keteganganChinadanFilipina.Biazon juga menyarankan agar negaranya tidak meningkatkan kekuatan militer untuk menyaingi China. “Filipina harus mengambil jalandamaidanmengedepankan proses diplomasi untuk menye-

Hal itu disebabkan karena secara hukum, Filipina-lah yang memiliki Pulau Spratly dan Dangkalan Scarborough. Filipina beserta tiga negara

ASEAN lainnya, Vietnam, Malaysia dan Brunei Darusallam mengklaim wilayah di perairan Laut China Selatan. Meski demikian, hanya Filipina danVietnam

yang terlihat agresif dalam menanggapi klaim China. ASEAN pun berniat untuk mencari solusi untuk memecahkan masalah sengketa itu. Na-

Seputar ASEAN Badai Tropis Gener Makin Menguat Di Cagayan, Filipina

mun China kembali menegaskan bahwa isu sengketa Laut China Selatanhanyabisadiselesaikanlewat jalur bilateral yakni antara China dan negara yang bersangkutan.

lesaikanisusengketaSpratly.Pulau itutidakhanyabermanfaatdalam sektor perikanan, namun juga kaya akan mineral dan migas,” ujar Biazon, seperti dikutip Gulf Today, Sabtu (28/7). “Haruskah Filipina menghampiri PBB untuk bantuan?” tambahnya. Biazon juga meminta agar negaranya berfokus pada hukum laut internasional ketika melontarkan klaimnya terhadap pulau di Laut China Selatan itu.

Ribuan Orang Protes Pelajaran Patriotisme China Di Hongkong

Pejabat Thai Diizinkan Jenguk Tahanan Warganya Di Myanmar

HONGKONG (AP) : Ribuan orang turun ke jalan di Hongkong untuk memprotes pengenalan pelajaran patriotisme di sekolahsekolah yang dikhawaatirkan akan menjurus pada pencucian otak. Para guru, orangtua, pelajar dan aktivis pro-demokrasi berbaris Minggu (29/7) ke markasbesar pemerintah wilayah otonomi untuk memprotes kurikulum baru, yang menurut pihak berwenang akan dimulai penggunaannya pada saat para pelajar kembali ke sekolah September mendatang. Mereka khawatir pelajaran itu akan digunakan untuk mencuci otak anak-anak guna mendukung Partai Komunis China. Pemerintah telah membantah dan mengatakan pelajaran tersebut bertujuan untuk membangun kebanggaan nasional China. Rencana itu menimbulkan kekhawatiran baru di Hongkong terhadap pengaruh China yang semakin meningkat 15 tahun setelah Inggris mengembalikan pusat keuangan itu kepada China. (m10)

Calon Presiden AS Mitt Romney Tunjukkan Sikap Baik Pada Israel JERUSALEM (Antara/AFP): Calon presiden AS Mitt Romney bertemu dengan pemimpin Israel Minggu (29/7) dalam upaya menunjukkan bahwa dia teman lebih baik bagi Israel daripada Presiden Barack Obama. Romney, yang tiba di Jerusalem Sabtu malam, melakukan pertemuan dengan PM Benjamin Netanyahu Minggu pagi. Setelah itu, dia bertemu dengan Presiden Shimon Peres, para pemimpin oposisi Israel dan kemudian dengan PM Palestina Salam Fayyad. Dia juga akan memberikan pernyataan menyangkut kebijakan luar negeri. Romney telah secara konsisten menyerang kebijakan luar negeri Obama, seperti ketika dia menyebutkan kelemahan Obama dan kebijakan yang salah arah menyangkut Timur Tengah. Tentang itu, Romney mengatakan Januari lalu bahwa presiden asal Demokrat tersebut “mengorbankan Israel” dengan menganggap perbatasan tahun 1967 sebagai posisi dasar perundingan Israel-Palestina. Dia juga menuduh kebijakan Obama terhadap Iran terlalu dititikberatkan kepada hubungan dengan musuh Israel yang dicurigai memiliki ambisi nuklir. Romney menjanjikan akan memberikan sanksi yang lebih keras jika dia terpilih. Obama menunjukkan satu bentuk dukungan bagi Israel di Gedung Putih pada Jumat, yaitu dengan menandatangani undangundang yang menegaskan kerjasama AS dan Israel di bidang keamanan dan militer —sementara para wakil kelompok lobi proIsrael AIPAC berdiri di sampingnya. Para wartawan Israel diundang untuk menghadiri penandatanganan tersebut, demikian juga para juru foto dan wartawan yang terdaftar di Gedung Putih. Upacara penandatanganan itu merupakan peristiwa yang jarang terjadi dalam masa kepemimpinan Obama. Undang-undang, yang memberikan akses istimewa bagi Israel kepada persenjataan dan mesiu AS, “menggarisbawahi komitmen kami yang tak tergoyahkan bagi keamanan Israel,” kata Obama.

Gempa Guncang Perbatasan Myanmar Dan India Serta Pantai Papua Nugini HONGKONG (Antara/Xinhua-OANA): Gempa berkekuatan 6,2 pada skala Richter terjadi pada pukul 02:21 GMT pada Minggu (29/7) di wilayah perbatasan Myanmar-India, kata Observatorium Hongkong. Pusat gempa pada awalnya diyakini terjadi di dekat 22,9 derajat lintang utara dan 94,0 derajat bujur timur, sekitar 300 kilometer baratlaut Meiktila. Belum ada laporan mengenai dampak gempa itu.Gempa berkekuatan 5,1 pada skala Richter sebelumnya melanda negara bagian Kachin, utara Myanmar, Minggu pagi pekan lalu, menurut Departemen Hidrologi dan Meteorologi Nay Pyi Taw. Departemen itu mengatakan pusat gempa terletak 30 kilometer di utara Moenyin, negara bagian Kachin, terjadi pada pukul 08:45 waktu setempat. Tidak ada kerusakan yang sejauh ini dilaporkan, tetapi gempa itu sedikit terasa di daerah itu, kata departemen itu. Sebelumnya, Survei Geologi AS awalnya menentukan gempa tersebut berpusat pada kedalaman 60-kilometer di 25,0383 derajat lintang utara dan 96. 4124 derajat Bujur Timur. Pada hari yang sama, gempa dengan kekuatan 6,6 pada Skala Richter mengguncang wilayah New Ireland, Papua Nugini (PNG), pada pukul 02:06 waktu setempat, demikian keterangan Pusat Jaringan Gempa China (CENC).

MANILA (Antara/PNA-0ANA): Badai tropis “Gener” semakin menguat pada Minggu (29/7) ketika bergerak perlahan mendekati ekstrim Luzon utara, mendorong Biro Cuaca Filipina meningkatkan sinyal peringatan Nomor Dua meliputi Provinsi Cagayan, Calayan dan kelompok pulau Babuyan. Sementara itu wilayah Isabela, Kalinga, Apayao dan Batanes kini memasuki sinyal peringatan badai Nomor Satu. Dalam buletinnya pukul 05.00 pagi waktu setempat, Badan Layanan Atmosfir Geofisika dan Astronomi Filipina (PAGASA) mengatakan, pada pukul 04.00 pusat “Gener” berada di 310 kilometer timur Casiguran, Aurora dan bergerak ke utara-baratlaut dengan kecepatan 15 kilometer per jam.. Badai tersebut terus bergerak di 230 kilometer timur laut Aparri, Cagayan. Gener sedang mengemas kecepatan angin maksimum 85 kilometer per jam di dekat pusat dengan hembusan hingga 100 kilometer per jam. PAGASA mengatakan penduduk dari daerah di bawah Nomor Sinyal Dua diberitahu terhadap kemungkinan ombak besar dan badai gelombang arus yang dihasilkan oleh badai, serta banjir bandang dan tanah longsor. PAGASA mengatakan “Gener” akan membawa hujan lebat di wilayah sepanjang 600 kilometer dan meningkatkan angin musim baratdaya yang akan membawa hujan lebat di Luzon selatan,Visayas dan Mindanao, terutama di bagian barat.“Perahuperahu nelayan disarankan untuk merapat ke pantai,” katanya. PAGASA mengatakan “Gener” akan berada di 210 kilometer utara-timurlaut dari Basco, Batanes, pada Senin pagi.

Reuters

PARA PEMROTES ikut ambil bagian dalam satu pawai protes terhadap pendidikan patriotik China di Hongkong, Minggu (29/ 7). Ribuan orang termasuk orangtua, para guru dan anak-anak sekolah di Hongkong turun ke jalan Minggu untuk menentang pelajaran tersebut, yang akan dimulai pada saat dimulainya tahun ajaran baru September mendatang.

Banjir Akibat Hujan Lebat Dipicu Topan Landa Korut, 88 Orang Tewas SEOUL (AP): Korea Utara mengatakan bahwa hujan lebat yang disebabkan topan telah mengakibatkansekurang-kurangnya 88 orang tewas, ribuan rumah rusak dan menenggelamkan sejumlah besar lahan pertanian. Pengamat yang bermarkas diSeoulKwonTae-jinmengatakan banjir diperkirakan memperburuk kekurangan makanan kronis Korea Utara (Korut) karena datangnya demikian cepat setelah musimpanasparah.Kantorberita resmi Korean Central News Agency (KCNA) mengatakan Sabtu (28/7) bahwa hujan selama bulanlalutelahmerenggutkorban 88 orang tewas dan mengakibatkan lebih dari 60.000 orang kehilangan tempat tinggal. Dikatakannya, kira-kira 4.800 Hapanendisapubanjirdan25.700 Ha terendam banjir. PBB menga-

takanbulanlalubahwaduapertiga dari 24 juta penduduk Korut menghadapi kekurangan makanan kronis. Banjir bandang di Korut disebabkan oleh hujan deras dan angin topan yang menghantam negeri itu selama Juli 2012. KCNA menyatakan,selainmenyebabkan hilangnya nyawa, banjir juga menyebabkankerugianmaterialbagi sekitar 63.000 penduduk yang terdampak. Sejak pertengahan 1990-an, sektor pertanian Korut kerap hancur oleh bencana banjir dan kekeringan. Sebelum hujan lebat dan topan yang melanda negeri itumusimpanasini,Korutbahkan telah mengalami disfungsional sistem distribusi makanan. Inflasi juga tinggi dan menerima sanksi akibat program nuklir serta rudal negaraituyangdiyakiniberkontri-

busi terhadap kelaparan parah yang diderita penduduknya. Kabar yang beredar di Korut menyatakan,pemimpinmudamereka,KimJong-un,berencanauntuk mereformasisistemekonomiyang hancuruntukmembantumendorong kenaikan harga beras, pada saatbanyakkeluargadiKoruttidak dapatlagimengandalkangajiyang mereka terima dari perusahaanperusahaanmiliknegarayangnyaris bangkrut. Kim mengambil alih kepemimpinan Korut Desember lalu setelah ayahnya wafat. Sejak pertengahantahun90-an,sektorpertanianKorutseringmengalamikerusakanakibatbanjirdankemarau. Bahkan sebelum hujan dan topanmelandarnegaraitu,sistem pembagian pangan yang tidak berfungsidenganbaik,inflasiyang sangat tinggi dan sanksi yang dite-

tapkan asing terhadap program nuklir dan rudal Pyongyang telah menimbulkan kelaparan yang parah di Korut. Pemimpinmudaitu,meninggalkan gaya kepemimpinan tertutupayahnya,danmingguinisecaratiba-tibamembenarkanbahwadirinyatelahmenikahdanterlihat menikmati hiburan dalam sebuahpertunjukkanMickeyMouse. Diajugasukamelakukanpercobaan denganmelakukanreformasipertanian dan ekonomi setelah menyingkirkanWakilMarsekalRiYonghokarenamenentangperubahan, kata sumber dari Pyongyang dan Beijing kepada Reuters. Satu laporan PBB baru-baru ini mengatakan, 7,2 juta dari 24 juta penduduk Korut dalam kondisi ‘miskin kronis’ dan satu dari tiga anak-anak tubuhnya kerdil karena gizi buruk.(m23/m10)

Haaretz: AS Dan Israel Bahas Rencana Serangan Ke Iran JERUSALEM (AP): Satu suratkabar Israel Minggu (29/7) melaporkan, pejabat tinggi keamanan Obama telah membicarakan denganPMIsraeltentangrencana AS menyerang Iran. Suratkabar Haaretz mengatakan, Penasehat Keamanan Nasional ASTom Donilon berusaha meyakinkan Israel bahwa Washington telah mempersiapkan tindakan militer jika diplomasi dan sanksi gagal menekan Iran

untuk menghentikan program pengayaan nuklirnya. Haaretz mengatakan, Donilon mengungkap secara rinci tentang rencana itu kepada PM Israel Benjamin Netanyahu dalam satu kunjungan ke Israel awal bulan ini. Seorang jubir pemerintah Israel tidak merespon berita tersebut. Sementara seorang jubir kedutaanAStidakbisadihubungi. Israel dan AS mencurigai program nuklir Iran ditujukan untuk menciptakan bom atom, dan bukanuntuktujuandamaiseperti diklaim Teheran. Calon presiden AS dari partai Republik, Mitt Romney, pun menyatakan dukungannya bagi Israel jika negara itu memutuskan menggunakan militer untuk menghentikan Iran mengembangkan senjata nuklir, kata seorang pembantu senior-

nya. “Jika Israel memutuskan bertindak sendiri, dengan tujuan menghentikan Iran, sang gubernur akan menghormati keputusan itu,” kata pembantu keamanan Romney, Dan Senor kepadawartawanyangmenyertai perjalanan sang calon presiden. Pernyataanitudisampaikanmenjelang rencana Romney bertemu dengan para pemimpin Israel di Jerusalem. Bisa jadi bencana Pemimpin partai oposisi terbesar di Israel Shaul Mofas Sabtu memperingatkan serangan mendahului secara sepihak oleh Israel terhadapinstalasinuklirIrandapat menimbulkan konsekuensi bencana bagi negara Yahudi, demikian laporan media lokal. Serangansemacamitubukan

BANGKOK (Antara/TNA-OANA): Para pejabat konsuler Thai diizinkanmengunjungi92warga Thailand yangditahandiMyanmar Jumat sore, kata juru bicara Bagian Informasi Departemen Luar Negeri, Dirjen Thani Thongpakdee. Para tahanan, yang terdiri 82 pria dan 10 wanita, ditangkap pada 4 Juli di Provinsi Kawthaung, Myanmar yang berhadapan dengan provinsi perbatasan Thailand, Ranong, karena melanggar batas ke wilayah Myanmar. Mereka ditipu oleh calo untuk melakukan pembukaan lahan yang mereka kemudian ketahui berada di luar daerah yang diberi kewenangan oleh pejabat Myanmar kepada Thailand, untuk digunakan sebagai daerah budidaya. Selama kunjungan, para pejabat konsuler membawakan makanan kepada para tersangka dan barang-barang lain yang diperlukan. Para tahanan mengucapkan terima kasih kepada pemerintah Thailand untuk bantuan tersebut, kata Thani. Pada awal pekan ini,pengadilandiProvinsiKawthaung,Myanmartelah menghukum 92 warga Thailand sampai tiga setengah tahun karena tuduhan penebangan hutan dan masuk secara ilegal, dua yang pertama dari lima dakwaan yang dibebankan. Lima tuduhan kesalahan itu meliputi masuk secara ilegal; perambahanhutandanpendudukantanahilegal;menanamtanaman terlarang, termasuk ganja dan kratom; kepemilikan senjata api dan senjata militer, serta gangguan terhadap petugas resmi. Thani mengatakan bahwa beberapa orang Thailand mungkin akan menghadapi hukuman tambahan, karena tuduhan kejahatan lainnya masih menunggu sidang, tapi tanggalnya belum ditetapkan.

40 Gerilyawan Tewas Di Afghanistan Timur SHARAN (Antara/Xinhua-OANA): Sekitar 40 gerilyawanTaliban tewas dan 14 lainnya cedera ketika mereka melancarkan serangan lintas perbatasan terhadap pos pemeriksaan polisi di Provinsi Paktika, Afghanistan Timur, kata jurubicara pemerintah provinsi. “Puluhan gerilyawan menyeberangi perbatasan AfghanistanPakistandanmenyerbupospemeriksaan polisiperbatasanAfghanistan di daerah Abad Nahmat, Kabupaten Gomal pada sekitar pukul 02:00 waktu setempat Sabtu, dan polisi memukul mundur serangan itu. Akibatnya 40 gerilyawan tewas dan 14 terluka,” kata jurubicara Mukhlis Afghan kepada Xinhua. Dia mengatakan, Pasukan Bantuan Keamanan Internasional (ISAF)pimpinanNATO atauhelikopter-helikopterkoalisimendukung polisi dalam memerangi gerilyawan itu. Seorang komandan penting Taliban Afghanistan bernama Zanzer merupakan salah satu yang tewas, tambahnya. Jurubicara itu mengatakan bahwa dua polisi luka ringan dan warga sipil tidak ada yang dirugikan dalam bentrokan di provinsi yang berbatasan dengan Pakistan tersebut. Para gerilyawanTaliban, yang telah melancarkan pemberontakan lebih dari satu dekade, belum membuat komentar tentang hal tersebut. Kekerasan telah meningkat sejakTaliban melancarkan serangan musim semi tahunan pada 3 Mei. Sebelumnya pada hari itu, para pimpinan ISAF NATO dikonfirmasi kehilangan dua tentara dalam serangan pemberontak juga di Afghanistan timur Sabtu pagi.

Virus Ebola Tewaskan 14 Orang Di Uganda hanya akan sangat menghalangi kemampuan Iran untuk membuat senjata nuklir, tapi juga sangat mungkin mengakibatkan perang,demikianperingatanMofaz sebagaimana dikutip Xinhua. Pemimpin oposisi Israel tersebut mengeluarkan peringatan itu dalamwawancaradenganstasiun televisi Israel yang berbahasa Yahudi, Channel 2. Israel dan beberapa negara Barat telah lama mencurigai Iran secara diam-diam membuat senjata nuklir, dan para pemimpin Israel telah berulangkali memperingatkan tentang serangan militer terhadap instalasi nuklir Iran, yang telah berulangkali membantah tuduhan tersebut dan berkeras program nuklirnya semata-mata bertujuan damai. (m23/m10)

KAMPALA (CNN):Virus mematikan Ebola telah menyebabkan sedikitnya 14 orang tewas di bagian barat Uganda bulan ini, demikian menurut pejabat Kementrian Kesehatan, setelah laporan lokal tentang ‘penyakit aneh’ melanda kawasan itu. Total 20 kasus virus tersebut dilaporkan, kata pejabat Sabtu (28/7).Kasus tersebut muncul di Kibaale, distrik di barat tengah Uganda,dimanapasukantugasnasionaldikerahkanuntukmengatasi wabah tersebut. Para pejabat dari Organisasi Kesehatan Dunia (WHO) dan Pusat Kendali Penyakit (CDC) juga mendukung usaha tersebut, kata pejabat kementrian tersebut. Virus Ebola tersebut merupakan penyakit yang sangat menular dan menyebar lewat kontak langsung dengan cairan tubuh. Gejalagejalanya termasuk demam, muntah, diare, sakit perut, sakit kepala, ruam-ruam seperti cacar, mata merah dan pendarahan dari bagian tubuh yang terbuka. Pejabat kesehatan mengimbau publik untuk melaporkan kasus yang mencurigakan dan mencegah kontak dengan siapapun yang terjangkit virus dan untuk membersihkan tempat tidur dan pakaian dari orang yang terinfeksi dengan menggunakan sarung tangan dan masker. Pejabat tersebut juga menganjurkan untuk tidak memakan hewanmati,khususnyamonyetdanuntukmenghindariperkumpulan publik di tempat yang dilanda kasus tersebut.(m23)

Putri Tunarungu Indonesia Raih Lima Besar Putri Tunarungu

Reuters

PARA PEMROTES anti-nuklir melakukan pawai di luar kompleks parlemen Jepang di Tokyo, Jepang, Minggu (29/7). Ribuan orang membentuk ‘satu rantai manusia’ di sekitar kompleks guna menuntut pemerintah agar meninggalkan pembangkit listrik tenaga nuklir.Unjukrasa itu merupakan protes damai terakhir yang paling besar yang tidak pernah terlihat sebelumnya di Jepang.

KAIRO (Antara): Dian Inggrawati Soebangil S. Des dan I Gede Ade Putra Wirawan dari Indonesia meraih peringkat lima besar dalam kontes pemilihan Putra dan Putri Tunarungu Internasional yang berlangsung di Ankara, Turki. Kontes Mister And Miss Deaf Internasional (MMDI) 2012 yang bertema Empowering Today’s Deaf Women and Men di Turki berakhir Jumat malam yang diikuti 23 negara, kata siaran pers KBRI Ankara, yang diterima Sabtu (28/7). AdeWirawan menyabet gelar ‘Mister Deaf Asia’ dan juga gelar ‘Mister Deaf Congenial’ (simpatik). Negarayangikutdalamajang

tersebutselainTurkidanIndonesia, juga Prancis, Jerman, Amerika Serikat,Spanyol,Brazil,Mongolia, Korea,India,Belarus,Israel,Tunisia, Hungaria, Meksiko, Lithiania, Bulgaria,Latvia,Belgia,Romania, Serbia, Mali, dan Mauritania. Dubes RI untuk Turki,Nahari Agustini, yang juga hadir bersama suami dan kedua putra kembarnya pada malam final kontes di Mall Kent Park Ankara itu memberi apresiasi atas capaian putra dan putri Indonesia tersebut. “Meskpipun tidak memperoleh juara utama, namun Dian Inggrawati dan Ade Wirawan telah berhasil masuk ke babak penyisihan lima besar, ini cukup membanggakan,”

kata Dubes Nahari Agustini. Dubes Agustini menambahkan, keberhasilan ini menjadi penyemangat bagi kita semua untuk terus berprestasi di pentas internasional. Juri kontes selain dari para penyandang tunarungu berbagai negara, juga berasal dari wakil pecinta seni dan modeling di Turki. Sebagai juara pertama Miss Deaf International 2012 dari Belarus dan Mister Deaf International 2012 dari Turki. Pada lomba ini yang diutamakan selain penilaian penampilan juga kepribadian dan kecerdasan dalam menjawab pertanyaan-pertanyaan dari para juri, kata Ida Hermawan, orangtua Dian Inggrawati yang

mendampingi peserta Indonesia dalam kontes tersebut. Jawabannya dilakukan dalam bahasa isyarat tunarungu internasional dan diterjemahkan dalam bahasa Turki dan Inggris. Lomba berlangsung selama dua pekan dari dari tanggal 16-28 Juli 2012. Dian Inggrawati, putri pertama dari pasangan Irwanto Hermawan (alm) dan Ratih Prasidhawati adalah lulusan Fakultas Ilmu Komunikasi Jurusan DKV Universitas Persada Indonesia YAI Jakarta. Dian pernah meraih penghargaan Anugerah Peduli Pendidikan dari Kementerian Pendidikan Nasional tahun 2011, dan Runner Up II Miss Deaf World 2011 di Praha, Re-

publik Ceko. Sedangkan Ade Wirawan yang baru pertama kali pentas di dunia internasional merupakan putra pertama dari pasangan I Nyoman Agus Wirawan dan I Gusti Ayu Ngurah Puspini.Ade dikenal lewat ‘Bintang Iklan Film Penyandang Disabilitas’ dan sebagai pegiat tari Bali. Ida Hermawan menjelaskan, keberangkatan mereka atas usaha dan perjuangan Dian dan Ade sendiri. “Mereka mendapatkan bantuan dana dari dermawan untuk membeli tiket pesawat ke Turki, sedangkan saya beli tiket atas biaya sendiri, dan akomodasi selama di Ankara tanggung panitia,” katanya.


A10

Olimpiade London 2012

WASPADA Senin 30 Juli 2012

Hasil Matchday II Sepakbola Putri Grup E Selandia Baru vs Brazil Inggris Raya vs Kamerun Grup F Jepang vs Sweden Kanada vs Afsel Grup G AS vs Kolombia Prancis vs Korut

0-1 3-0 0-0 3-0 3-0 5-0

CASEY Stoney (kiri) merayakan golnya ke gawang Kamerun dengan rekan-rekannya di Millennium Stadium, Cardiff, Wales, Minggu (29/7) dinihari WIB. -AP-

Brazil, GB Melaju Mudah AP

RYAN Lochte dari Amerika Serikat, bersaing dengan perenang China Sun Yang (kiri) dalam memburu emas keduanya dari nomor 200 meter gaya ganti putra di London Aquatic Arena, Minggu (29/7).

Phelps Frustrasi, Lochte Perkasa LONDON (Waspada): Jagoan renang Michael Phelps gagal mendulang emas pada nomor 400 meter gaya ganti putra di Olimpiade London 2012. Pada final di London Aquatic Arena, Sabtu (Minggu WIB), Phelps bahkan tidak mampu menembus finis tiga besar. Justru rival senegaranya, Ryan Lochte yang tampil perkasa merebut emas dengan mencatat waktu tercepat 4 menit 5,18 detik. Itu merupakan empat keembat perenang berusia 28 tahun tersebut di arena Olimpiade. Perenang Brazil Thiago Pereira meraih perak dengan waktu 4 menit 8,86 detik, perunggu dimenangkan perenang muda Jepang Kosuke Hagino dengan waktu 4 menit 8,94 detik. Phelps keluar dari kolam

renang dan berjalan pelan keluar arena tanpa menoleh ke Lochte, yang memang sudah menjadi pesaingnya dalam delapan tahun terakhir. “Saya merasa baik-baik saja untuk 200 meter pertama. Mereka hanya berenang lebih baik ketimbang saya. Persiapan mereka lebih baik, ini memang membuat saya frustasi. Saya beruntung bisa menembus partai final,” ucap Phelps, seperti dilansir Reuters, Minggu (29/7). Phelps hanya finis keempat dengan 4 menit 9,28 detik dan gagal merebut medali. Catatan waktunya itu lebih lambat lima

detik dari rekor dunia yang dipegangnya. Lochte dan Phelps kembali akan bertemu di nomor 200 meter gaya ganti putra. “Phelps merupakan perenang terbaik di dunia untuk saat ini. Apapun yang terjadi, dia akan selalu diingat sebagai yang terhebat. Saya tahu dia sudah memberikan tenaganya 110 persen,” ucap Lochte. Duel mereka di Olimpiade 2012 disebut-sebut untuk menentukan siapa perenang allround terbaik dunia yang digadang-gadang menjadi rivalitas terhebat di kolam renang London. Terakhir kali Phelps kalah di Olimpiade adalah delapan tahun lalu pada Olimpiade Athena 2004, saat dirinya menempati peringkat ketiga di

belakang Ian Thorpe dan Pieter van den Hoogenband di nomor 200 m gaya bebas. Di London 2012, performa Phelps jauh menurun dibanding Beijing 2008, tempat dia berhasil merebut delapan medali emas. Padahal, dia hanya butuh tambahan tiga medali emas untuk menjadi Olympian terhebat dengan menyamai rekor 18 medali emas milik pesenam Uni Soviet Larisa Latynina. Siman Gagal Dari cabang renang ini, satusatunya atlet Indonesia I Gede Siman Sudartawa, gagal mencapai semifinal, setelah berakhir di urutan ketujuh pada heat kedua nomor 100m gaya punggung, Minggu (29/7). Peraih empat medali emas SEA Games yang berenang di lintasan enam itu mencatat

waktu 55,99 detik. Hasil tersebut lebih buruk dari target yang diharapkan pelatihnya Albert C Sutanto, yakni mencetak angka di bawah 55 detik. Catatan waktu terbaik Siman adalah 55,32 detik yang dihasilkan pada kejuaraan renang Asia Tenggara di Singapura 2012. Perenang kelahiran Bali pada 8 September 1994 itu merupakan spesialis gaya punggung, yang memecahkan rekor SEA Games atas nama Lim Keng Liat (Malaysia) di SEA Games Kuala Lumpur 2001 dengan waktu 56,16 detik). Siman berhak mewakili Indonesia setelah lolos seleksi yang digelar Federasi Internasional Renang (FINA) sebagai salah satu dari lima wakil Asia Tenggara yang tampil di London 2012. (m15/okz/rtr/fina)

CARDIFF (Waspada): Tim sepakbola putri Brazil dan Great Britain (GB) alias Inggris Raya, melaju mudah ke perempatfinal Olimpiade London 2012. Menghadapi putri Kamerun di Millennium Stadium, Cardiff, Wales, Minggu (29/7) dinihari WIB, GB Inggris Raya menang telak 3-0. Casey Stone membuka keunggulan menit 18, Jill Scott menggandakannya lima menit kemudian. Saat pertandingan seperti akan berakhir, Inggris Raya berhasil memperlebar keunggulan menit 82 lewat Stephanie Houghton. Dengan hasil ini Inggris Raya dipastikan lolos dari fase grup bersama Brazil, yang pada laga lainnya di tempat sama mengatasi Selandia Baru 1-0 lewat gol tunggal Cristiane menit 86. Sama-sama mengumpul-

(LOCOG) sedang melakukan penyelidikan tentang itu. “LOCOG sedang melakukan investigasi penuh terhadap apa yang terjadi,” ucap Hunt kepada BBC. Sehari setelah pembukaan yang mendapatkan pujian luas dengan menampilkan antara lain Ratu Elizabeth II, Paul McCartney dan Rowan Atkinson, televisi menayangkan berbagai pertandingan yang sepi penontong sepanjang Sabtu waktu setempat. Orang-orang yang berdatangan ke venue melihat sejumlah kursi kosong di jam-jam awal pertandingan di gelanggang air, bola basket dan pada jam-jam berikutnya di arena tenisWimbledon. “Tampaknya kursi-kursi (kosong itu) adalah kursi yang diperuntukkan bagi para sponsor. Tapi kalau mereka tidak muncul, kami menginginkan publik bisa mendapatkan tiket karena keberadaan mereka akan memeriahkan pertandingan. Jadi kami akan menangani masalah ini sesegera mungkin,” pinta Hunt. Menteri Olahraga Inggris, Hugh Robertson, mengaku terkejut venue tidak dipenuhi penonton. LOCOG biasanya menerakan tanda “sudah habis” beberapa menit setelah tiket mulai dijual kepada publik. Masih Antre Tapi hari Sabtu lalu, sejumlah loket di arena-arena pertandingan masih diwarnai dengan antrean orang yang ingin membeli tiket. “Saya tiap hari mencoba dan terus mencoba mendapatkan tiket pertandingan (sepakbola) untuk Argentina,” ungkap seorang pekerja bidang listrik berusia 34 tahun asal Argentina, Lucas

Klasemen Grup E Brazil Inggris Raya Selandia Baru Kamerun

2 2 2 2

2 2 0 0

0 0 0 0

0 0 2 2

6-0 4-0 0-2 0-8

6 6 0 0

4-1 2-1 4-2 1-7

4 4 3 0

Klasemen Grup F Swedia Jepang Kanada Afsel

2 2 2 2

1 1 1 0

1 1 0 0

0 0 1 2

Klasemen Grup G AS Prancis Korut Kolombia

2 2 2 2

2 1 1 0

0 0 0 0

0 1 1 2

7-2 7-4 2-5 0-5

6 3 3 0

karena hanya menghadapi juru kunci Kolombia pada laga pamungkas, sedangkan Korut harus berhadapan dengan lawan politiknya, Amerika Serikat. (m15/vvn/espn)

India Protes Wanita Misterius NEW DELHI (Antara/Reuters): Seorang wanita misterius bergabung dengan kontingen India pada upacara pembukaan Olimpiade, sehingga membuat kontingen India protes dan menuntut permintaan maaf dari panitia penyelenggara.

Kursi Kosong, Polisi Ciduk 16 Calo Tiket LONDON (Waspada): Organiser Olimpiade 2012 mengungkapkan, kepolisian London telah menciduk sekitar 16 calo yang menjual tiket secara ilegal. Penangkapan dilakukan di area Stratford, dekat Olimpiade Park London bagian timur, juga di Wimbledon daerah selatan, tempat pertandingan tenis sedang berlangsung. “Kami sudah dan akan terus mencari, serta mengambil tindakan terhadap orang yang mencoba untuk mendapatkan keuntungan di ajang Olimpiade ini dengan caranya sendiri,” tegas Detektif Nick Downing, Minggu (29/7). Banyak warga setempat yang frustrasi karena tidak mampu membeli tiket untuk menyaksikan pertandingan Olimpiade. Padahal, banyak kursi kosong pada beberapa venue pertandingan sepanjang Sabtu lalu. “Saya meminta kepada masyarakat untuk berpikir dua kali membeli tiket dari para kriminal itu. Jika Anda melakukannya, maka Anda sama saja membiarkan mereka melakukan tindak kriminalitas,” tegas Downing dalam Eurosport. Pada hari libur sekolah dan setelah beberapa bulan masyarakat mengeluh bahwa ribuan orang Inggris tidak bisa membeli tiket, Menteri Kebudayaan Jeremy Hunt yang menangani Olimpiade, mengatakan kecewa dengan kosongnya kursi. Menurutnya, Komite Penyelenggara Olimpiade London

kan enam angka dari dua laga, Brazil dan GB akan memperebutkan status juara grup pada partai pamungkas Grup E, Selasa (31/7) mendatang. Di Grup G, Amerika Serikat juga berhasil merebut tiga poin pentingsaatmenghadapiKolombia. Putri Paman Sam menang 3-0 sekaligus memastikan tiket mentas di babak delapan besar. Gol-gol dari Megan Rapinoe, AbbyWambach dan Carli Lloyd, menempatkan AS di puncak klasemen Grup G. Prancis berhasil menggeser Korea Utara di peringkat dua, setelah menang 5-0 saat keduanya bertemu. Srikandi Les Bleus menang melalui gol-gol yang dicetak Laura Georges, Elodie Thomis, Marie-Laure Delie, Wendie Renard dan Camille Catala. Peluang Prancis lolos ke babak selanjutnya kian terbuka,

Lopez. Nicolette Robinson, seorang konsultan merek dan desain berumur 47 tahun, mengaku ketika dia masih kecil ingin menjadi pesenam seperti pahlawannya, Nadia Comaneci. Dirinya pun merasa sangat kecewa karena tidak mendapatkan tiket untuk menonton senam di Olimpiade London. “Saya kira setidaknya apa yang bisa saya lakukan adalah melihat mereka (atlet senam). Melihat mereka di televisi sementara setengah stadionnya ternyata sepi, sayang sekali. Kalau bisa saya mau membayar berapa saja supaya bisa melihat mereka,” sesal Comaneci. LOCOG menolak untuk memberikan gambaran mengenai jumlah orang yang hadir di arena-arena pertandingan atau berapa banyak tiket yang terjual. Mereka hanya menyebutkan, yang akan menonton Olimpiade akan mencapai jumlah 11 juta orang. “Saya hadir di Olimpiade Beijing tahun 2008 dan salah satu pelajaran yang kami dapatkan saat itu adalah stadion yang penuh dengan penonton akan membuat suasana terbaik. Terbaik bagi para atlet dan akan lebih menyenangkan untuk para penonton, itu telah menjadi prioritas paling utama,” pungkas Hunt. Padahal hingga awal Juni, sudah 7 juta dari keseluruhan 8,8 juta tiket Olimpiade 2012 dan sekitar setengah dari 2,45 juta tiket Olimpiade bagi para penyandang cacat, kabarnya sudah terjual sejak tahun lalu. (m15/ant/es/rtr)

Ketua Kontingen India, PKM Raja kepada Times, Minggu (29/7) mengatakan, insiden itu telah “mempermalukan kami di depan seluruh dunia.” Foto-foto yang beredar memperlihatkan wanita misterius itu mengenakan atasan merah dan celana panjang biru. Dia berjalan di dekat pembawa bendera, pegulat Sushil Kumar. Sang wanita misterius terlihat kontras dengan anggota wanita kontingen India yang mengenakan kain sari kuning dan blazer biru.

“Dia tidak memiliki urusan untuk berada di sana. Sudah jelas itu merupakan penyusupan. Kami akan mengurus masalah ini dengan panitia penyelanggara,” tekad Raja. “Kami tidak tahu siapa dia, dan mengapa dia diizinkan berjalan masuk. Pawai itu adalah untuk para atlet dan ofisial yang termasuk dalam kontingen. “Ini aneh. Kami akan meminta permintaan maaf. Kontingen India hanya tampil selama sepuluh detik, dan wanita ini menjadi pusat perhatian,” katanya lagi.

Medvedev Dukung Tim Voli Putri Rusia LONDON (Antara/Reuters) :Perdana Menteri (PM) Rusia Dmitry Medvedev mendukung langsung aksi tim voli putri negaranya saat mengatasi tuan rumah Inggris. Medvedev, yang akan bertemu PM Inggris David Cameron dalam beberapa hari mendatang, menghadiri hari pertama dimulainya pertandingan bola voli di Earls Court arena, London barat. Didampingi beberapa staf keamanan, Sabtu (Minggu WIB), Medvedev bergabung dengan 15.000 penonton untuk melihat aksi tim Rusia melibas lawannya 3-0. “Kami tahu dia pasti akan menonton pertandingan itu. Tetapi yang terpenting adalah pertandingan itu sendiri,” ujar Maria Borisenko, salah seorang atlet voli putri Rusia. “Kami benar-benar senang beliau menyempatkan diri menonton di sini dan beliau menyampaikan ucapan selamat kepada kami saat pertandingan berakhir,” tambah Borisenko.

Seebohm Catat Rekor 100m Gaya Punggung LONDON (Waspada): Performa gemilang kembali diperlihatkan perenang Emily Seebohm (Australia), saat menciptakan rekor baru untuk renang 100 meter gaya punggung. Dalam pertandingan Olimpiade 2012 yang berlangsung di London Aquatic Arena, Minggu (29/7), Seebohm berhasil mengukir waktu 58.23 detik, mengalahkan catatan lama atas nama Gemma Spofforth pada Kejuaraan Dunia Renang di Roma. Seebohm lebih cepat dari perenang muda Missy Franklin (Amerika Serikat), yang mencatat waktu 59.37 detik. Sedangkan perenang Belinda Hocking berada di urutan

AP

ketiga dengan catatan waktu 59.61. Pertandingan final nomor ini akan berlangsung, Senin (30/7), dan Seebohm optimis bisa merebut medali emas.

Perenang berusia 20 tahun itu bahkan optimistis bisa berenang lebih cepat lagi. “Ini bukan waktu tercepat yang bisa saya lakukan, tapi Anda tidak pernah tahu apa

yang bisa dilakukan orang lain,” ucapnya. “Catatan waktu itu sangat luar biasa. Ini menunjukkan tahun lalu bukan performa terbaik saya,” tambah Seebohm. Namun rivalnya, Franklin, tidak akan menyerah. “Anda tidak bisa membuang kesempatan yang ada, kami ada di Olimpiade,” gerta perenang berusia 17 tahun itu melalui Eurosport. “Balapan dengan Seebohm memang sangat sulit dipercaya, tapi saya tidak memiliki kontrol atas dia dan begitu juga sebaliknya. Terpenting adalah saya mampu mengontrol diri sendiri,” pungkas Franklin. (m15/okz/es)

Misil Andalan Australia Geser Dominasi AS LONDON (Waspada): Perenang James Magnussen (foto) melakukan debut Olimpiade, Minggu (29/7), ketika ujung tombak tim Australia itu menjadi andalan timnya untuk menggeser dominasi Amerika Serikat di nomor 4 x 100 meter gaya bebas. Pada diri Magnussen, yang dijuluki Si Misil, beserta tandemnya James Roberts, Australia memiliki dua perenang tercepat di dunia tahun ini dengan marjin yang lebar. Mereka bergabung dengan mantan pemegang rekor Eamon Sullivan, dan juara dunia Matthew Targett. Catatan waktu Nathan Adrian, juara 100 meter gaya bebas pada tim AS, masih kalah dari catatan waktu terbaik Si Misil yakni 47, 10 detik, rekor tercepat sejak penggunaan teknologi ‘bosysuit’ dilarang. Namun para atlet AS, yang memenangi delapan dari sepu-

AP

luh medali emas yang diperebutkan di ajang ini, mengatakan mereka tidak akan menyerah begitu saja tanpa bertanding. Andalan AS, Michael Phelps, yang sangat berniat untuk menghapus kekecewaan yang didapatnya di hari pertama London 2012. Phelps memenangi nomor 400 meter gaya bebas estafet

dengan Ryan Lochte, Sabtu lalu, ternyata berubah menjadi ‘no contest.’ Peraih 16 medali emas Olimpiade yang memenangi delapan gelar berturut-turut di Beijing 2008 itu, tergeser ke peringkat empat di bawah kompatriotnya. Perenang muda AS, Missy Franklin, berkompetisi pada tujuh nomor di London, dimulai

dengan program individualnya di nomor 100 meter gaya punggung. Di cabang basket, tim AS yang dihuni pemain-pemain multi jutawan, yang diharapkan dapat mempertahankan medali emas, memulai perjalanannya dengan menghadapi Prancis. Dengan LeBron James, Kobe Bryant, dan Carmelo Anthony, AS favorit untuk meraih medali emas ke-14 dari 18 Olimpiade. Bryant sangat percaya diri timnya mampu meraih medali emas. Dia bahkan menegaskan bahwa tim 2012 lebih baik daripada ‘Dream Team’ di Olimpiade Barcelona 1992, yang saat itu masih diperkuat Michael Jordan. “Orang-orang yang berpikir kami tidak mampu mengalahkan tim itu, mereka gila. Kami mampu mengalahkan mereka,” klaim Bryant. (m15/ant/afp)

AP

Ortu Sempat Minta Menezes Berhenti LONDON (Waspada): Juara Olimpiade 2012 cabang olahraga judo, Sarah Menezes, Minggu (29/7) mengungkapkan bahwa orang tuanya sempat meminta dia berhenti latihan. Sebab olahraga itu, dianggap oleh orangtuanya hanya diperuntukkan bagi kaum pria saja. “Ketika saya memulai (berlatih) judo, orangtua berkata itu adalah olahraga untuk lakilaki. Sepertinya seumur hidup, saya telah menyukai tantangantantangan,” ungkap Menezes. Gadis berusia 22 tahun asal Brazil ini merupakan perempuan pertama dari negaranya yang memenangi medali emas Olimpiade, sebelum mengakui bahwa dirinya harus melewati

serangkaian penghalang untuk meraih kesuksesan. “Kebenarannya adalah studi saya merupakan masalah utama, sehingga saya harus melakukan kesepakatan dengan mereka. Untuk dapat terus menggeluti olahraga ini, saya harus mendapatkan hasil bagus di studiku,” jelas Menezes (foto). Meski awalnya sempat keberatan, namun orangtua Menezes akhirnya mengapresiasi kemampuan putrinya. “Ketika saya mulai bepergian (untuk mengikuti kompetisi), orangtua menyadari bahwa saya memiliki bakat,” katanya lagi. Itu merupakan keputusan bagus untuk menyiapkan pejudo kelas di bawah 48 kilogram

itu, menuju jalan ketenarannya. Memenangi medali perunggu dua tahun sebelumnya di kejuaraan dunia, dia akhirnya menaiki podium tertinggi di London 2012. Kendati baru berusia 22 tahun, Menezes malah sudah pernah berada di peringkat tiga dunia, dan dua kali menjadi juara dunia level junior. Awal tahun ini, dia juga memenangi ajang Grand Slam pertamanya di Moskow. Sekarang dia berkata bahwa kesuksesannya yang telah meningkatkan rasa percaya diri bagi atlet-atlet putri Brazil akan sangat membantunya di masa yang akan datang. Dia pun berharap, medali

emasnya dapat menjadi medali pertama dari banyak medali yang diraih atlet-atlet putri Brazil. “Itu sangat sangat penting, sebab hal itu membutuhkan bertahun-tahun untuk mewujudkannya,” ucapnya. “Sekarang saya berharap medali ini dapat membuka jalan pada (medali) yang lebih banyak lagi. Apa yang berubah adalah kami telah membangun keyakinan bahwa kami dapat menang, sebab semua orang memiliki kekuatan.” “Kami telah berhenti meragukan diri sendiri, dan sekarang kami tahu kami dapat mengalahkan siapapin, dan itulah kuncinya,” pungkas Menezes. (m15/ant/rtr)


Sport

WASPADA Senin 30 Juli 2012

A11

Hamilton Kampiun GP Hungaria HUNGARORING (Waspada): Lewis Hamilton (foto) merebut kemenangan keduanya musim ini, setelah menjadi kampiun balap mobil Formula Satu Grand Prix Hungaria di sirkuit Hungaroring, Minggu (29/7). Driver McLaren-Mercedes asal Inggris itu menjadi juara dengan mengatasi duet tim Lotus, Kimi Raikkonen dan Sebastian Grosjean. Hamilton menyelesaikan 69 putaran pada sirkuit sepanjang 4,381 km itu dengan catatan waktu 1 jam 41 menit 05,503 detik, atau hanya selisih satu detik dari Raikkonen di posisi kedua, dan 10,5 detik di depan Grosjean. Hasil ini juga melengkapi serangkaian akhir pekan mengesankan bagi Hamilton, yang pada

Jumat telah menjadi pebalap tercepat di sesi pelatihan bebas, serta merebut pole position Sabtu. Juara dunia Sebastian Vettel dari Red Bull finish keempat, diikuti pemimpin kejuaraan dunia Fernando Alonso dari tim Ferrari, serta team-mate Hamilton, Jenson Button. Memulai balapan dari posisi pole, Hamilton harus berjuang keras untuk bisa menjadi juara di Hungaroring kali ini, dengan penantang terkuat datang dari

driver tim Lotus. Grosjean membuntuti Hamilton di paruh pertama balapan, sementara di paruh kedua, gilirah Raikkonen yang menjadi ancaman. Raikkonen yang hingga lap ke-35 masih di luar 5 Besar tampil mengesankan setelah para pebalap melakukan pit stop kedua untuk mengganti ban, meski tetap tak mampu menggeser posisi Hamilton sebagai pemimpin lomba. Juara dunia tujuh kali, Michael Schumacer menjadi satu dari dua kontestan yang gagal finish, setelah andalan tim Mercedes itu berhenti di putaran ke-58. Dua lap berikut giliran driver tim HRT Narain Karthikeyan yang mundur. Di klasemen kejuaraan du-

10 Besar GP Hungaria 1. Lewis Hamilton 2. Kimi Raikkonen 3. Romain Grosjean 4. Sebastian Vettel 5. Fernando Alonso 6. Jenson Button 7. Bruno Senna 8. Mark Webber 9. Felipe Massa 10. Nico Rosberg

(Inggris/McLaren) (Finlandia/Lotus) (Prancis/Lotus) (Jerman/Red Bull) (Spanyol/Ferrari (Inggris/McLaren) (Brazil/Williams) (Australia/Red Bull) (Brazil/Ferrari-Ferrari (Jerman/Mercedes)

nia, Alonso masih memimpin 40 poin dariWebber sebagai penantang terdekatnya. Di HungariaWebber hanya finish di urutan ke tujuh. Selepas GP Hungaria, sebagai seri ke-11 dari 20 balapan musim ini, Alonso telah mengoleksi 164 angka, disusulWebber 124, Vettel 122.

1:41:05.503 + 01.0 detik 10.5 11.6 26.6 30.2 33.8 34.4 38.3 51.2

Hamilton yang menambah 25 angka lewat kemenangan di sini, naik ke urutan keempat dengan koleksi 117 angka, atau hanya unggul satu poin dari Raikkonen. Balapan berikut berlangsung di Spa Franchorchamp, Belgia 2 September. (ap/m47)

AP

Visi Pembinaan Atlet Sudah Menuju Olimpiade LONDON (Waspada): Ketua Komite Olimpiade Indonesia (KOI), Rita Subowo, mengatakan pemerintah Indonesia saat ini mempunyai maindset jauh ke depan. Kalau dahulu visi pemerintah hanya sampai pada PON atau SEA Games, sekarang menuju Olimpiade. Hal itu disampaikan Rita di London, Minggu (29/7), sehubungan adanya perubahan visi dari pemerintah tersebut yang dinilainya sangat luar biasa.“Tradisi emas di Olimpiade yang perlu dipersiapkan empat tahun sebelumnya. Bahkan jauh sebelumnya dengan cara mengikutkan para atlet dalam setiap babak kualifikasi Olimpiade,” ujar mantan Ketua

AP

Jadi Urutan 2 Grup B LONDON (Antara): Lifter Indonesia Jadi Setiadi (foto) berakhir di urutan kedua Grup B kelas 56kg putra, setelah menghasilkan total angkatan 277kg saat berkompetisi pada Olimpiade London di Excel London, Minggu (29/7). Dia sebenarnya menghasilkan angkatan yang bagus pada snatch dengan pencapaian 127kg, namun angkatannya pada clean and jerk hanya menghasilkan 150kg. “Secara pribadi saya kurang puas, hasilnya sangat jelek. Itu karena saya terlalu meremehkan. Terlalu yakin jadi hasilnya kurang bagus,” jelas Jadi. Dia juga sempat mengalami kram pada kedua tangannya saat mengangkat beban.

“Mungkin karena pengaruh menurunkan berat badan,” ucap Jadi, yang harus menurunkan berat badannya sekitar empat kilogram, sebelum bertanding. Manajer tim angkat besi Indonesia, Lukman, menilai performa Jadi sudah cukup bagus karena menghasilkan angkatan snatch 127, unggul dua kilogram dari lifter Korea Utara Om Yun Chol yang menempati urutan pertama dengan total angkatan 293kg (125kg snatch dan 168kg clean and jerk). “Pada clean and jerk dia sedikit kurang berjuang, juga terjadi kram pada tangannya di angkatan kedua,” ucap Lukman. Dengan hasil yang diperolehnya, menurut Lukman, be-

rat bagi Jadi untuk memperoleh medali pada kelasnya. “Dengan total angkatan 277kg, cukup berat bagi dia,” tukasnya. Menurutnya, dari enam lifter Indonesia yang bertanding di London, yang paling berpeluang meraih medali adalah Eko Yuli Irawan dan Triyatno, yang masing-masing turun pada kelas 62kg dan 69kg. Selain menempati urutan pertama, Om Yun Chol berhasil mencetak rekor baru Olimpiade untuk angkatan clean and jerk setelah membukukan angka 168kg. Hasil angkatan Grup B tersebut akan diadu dengan hasil Grup A yang bertanding Senin dinihari tadi untuk menentukan peraih medali.

Tontowi/Liliyana ...

mudahan nanti bertemu Denmark untuk penentuan juara grup kami bisa bermain bagus lagi, jadi lebih mempermudah kami untuk langkah berikutnya,” tambah Liliyana. Keharusan Bona/Ahsan Di nomor ganda putra, pasangan Indonesia Bona SeptanoMohammad Ahsan harus memenangi dua pertandingan berikutnya jika ingin lolos ke babak perempatfinal cabang olahraga bulutangkis. Pasalnya, ganda peringkat enam dunia itu, Sabtu (Minggu WIB), kalah pada pertandingan pertama Grup B dari pasangan Thailand Maneepong JongjitBodin Isara 11-21, 16-21. “Mereka bermain sangat bagus terutama pada serangan, tekanannya sangat kuat dan permainan di depannya juga bagus,” ucap Ahsan. “Keluar dari tekanan itu

yang agak sulit. Mereka menang bermain lebih berani,” timpal Bona. Bona pun bertekad untuk memenangi dua pertandingan terakhir dalam Grup B yakni melawan pasangan Korea Selatan Koo Sung Hyun-Yoo Yeon Seong dinihari nanti mulai pkl 00.30WIB, serta ganda Polandia Michal Logosz-Adam Cwalina pada Selasa pkl 18.30 WIB. “Kami akan berusaha melupakan kekalahan ini dan memperbaiki mental agar lebih berani lagi,” tekadnya. Pada pertandingan Grup B lainnya, pasangan Ko-Yoo menang atas ganda putra Polandia Michal Logosz-Adam Cwalina 17-21, 21-7, 21-13. Hasil ini menempatkan pasangan Korea itu di tempat kedua klasemen sementara di bawah ganda Thailand yang menang dua game langsung. (m15/ant/bwf)

(Lanjutan dari hal 1)

“Penampilan kami cukup bagus, mudah-mudahan bisa menjadi juara grup,” harap Liliyana. Sehari sebelumnya, pasangan juara All England itu meraih kemenangan atas pasangan India Diju V-Jwala Gutta juga dalam dua game 21-16, 21-12. Dua kemenangan itu memastikan mereka maju ke delapan besar, karena dua pasangan teratas dari setiap grup yang dihuni empat pasangan itu akan lolos ke babak berikutnya. Meski demikian, TontowiLiliyana berharap memenangi pertandingan ketiga dalam grup mereka atas pasangan Denmark Thomas Laybourn-Kamilla Rytter Juhl, agar dapat menjadi juara grup. “Intinya dua kali penampilan ini kami bagus, mudah-

Problem Catur

TTS TOPIK

Umum KONI Pusat itu. Dikatakan Rita, dalam pelaksanaan SEA Games yang diikuti 11 negara dan Asian Games oleh 44 negara, sementara Olimpiade diikuti 204 negara dan kalau visinya ke Olimpiade maka di SEA Gamas atlet Indonesia harus maju. Rita menilai setiap babak kualifikasi Olimpiade itu penting diikuti dan lebih penting dari hanya mengikuti PON atau SEA Games karena untuk bisa mengikuti Olimpiade harus lolos dari babak kualifikasi. Ia berharap atlet yang ingin mengikuti Olimpiade harus banyak bertanding dalam rangka mengumpulkan poin. “Kalau visinya ke Olimpiade, dalam

Asean Games kita akan maju setelahnya akan masuk babak kualifikasi,” ujarnya. Untuk itu, kata Rita, pembinaan olahraga pada masa datang lebih ditekankan kepada cabang olahraga yang masuk dalam babak kualifikasi. Diakui Rita, selama ini dalam melakukan pembinaan, tidak terarah untuk bisa masuk dalam babak kualifikasi Olimpiade. Sekarang, mulai terarah. “Memang target tahun ini akan dapat mengirim sebanyak 50 atlet. Namun sayangnya, tidak terpenuhi karena babak kualifikasinya tidak diikuti dengan baik. Untuk itu, pada masa datang Komite Olimpiade Indonesia akan mencanangkan

Menang Mudah Kado Ultah Simon LONDON (Antara): Pebulutangkis tunggal putra nomor satu Indonesia, Simon Santoso, menang mudah atas Raul Must dari Estonia pada pertandingan pertamanya di Grup B Olimpiade London 2012. Mentas di Wembley Arena, London, Minggu (29/7), Simon membukukan kemenangan dua game langsung 21-12, 21-8 dalam waktu 36 menit. “Kemenangan ini adalah kado ulang tahun saya,” ujar pebulutangkis peringkat enam dunia, yang pada tanggal 29 Juli ini genap berusia 27 tahun. Meski tidak menghadapi banyak kesulitan, juara Indonesia Terbuka Super Series Premier 2012 itu mengaku agak kendur pada game pertama, pertandingan pertamanya di Olimpiade itu. “Tadi agak kendur pada game pertama karena masih mencoba-coba dan melihat lapangan,” jelas pebulutangkis asal klub Tangkas Jakarta itu. Selanjutnya, Simon akan menghadapi pemain Austria Michael Lahnsteiner pada pertandingan keduanya dalam penyisihan Grup B. “Saya yakin masih bisa menang lagi pada pertandingan berikutnya,” tegasnya. Jika memenangi pertandingan tersebut, Simon akan keluar sebagai juara grup dan lolos ke babak berikutnya serta berpeluang untuk bertemu pebulutangkis peringkat dua dunia Lee Chong Wei. “Saya tidak mau berpikir terlalu jauh, tetapi fokus satu per satu dahulu di penyisihan,” tambah Simon, yang berharap dapat menyumbang medali bagi kontingen Indonesia.

AP

KEBERHASILAN PSKB Binjai mengalahkan Persib Bandung, Persipura Jayapura, PSIS Semarang, dan kalah dari Persipal Palu pada kompetisi PSSI di era tahun1980-an, menjadi kenangan indah sepakbola Kota Binjai. Cerita itu selalu diingat dan dibanggakan sampai saat ini. Kalau saja PSSI saat itu sudah melakukan pembagian divisi, PSKB Binjai akan masuk dalam divisi utama. Sebab, pertandingan itu merupakan babak lima besar di Semarang. Wali Kota Binjai, HM Idaham, di setiap pertemuan de-

ngan insan sepakbola mengingatkan dan berharap kejayaan PSKB bisa kembali. Nasib sepakbola Binjai saat ini sungguh menyedihkan. Harusnya Binjai belajar dari sejarah kejayaan PSKB di masa lampau. Ketika itu, PSKB melakukan pembinaan secara berjenjang dimulai dari kompetisi antarkampung memperebutkan Piala A Manan di Lapangan Merdeka Binjai. PSKB memiliki perjalanan panjang, dimulai dari kompetisi antarkampung, yang kini dikatagorikan sebagai divisi III. Berjuang dari daerah ke daerah, sampai kompetisi antarwilayah

5

4

3

2

1 A

B

C

D

E

F

G

H

MEDAN (Waspada) Ketua Umum Pengurus Provinsi Ikatan Motor Indonesia (IMI), Sumatera Utara, Ijeck, meminta pebalap daerah ini harus dapat meraih medali emas pada Pekan Olahraga Nasional (PON) XVIII/ 2012 di Provinsi Riau, September mendatang. “Kita optimistis bisa menyumbangkan medali emas untuk daerah Sumut pada kegiatan olahraga tersebut,” katanya di Medan, Minggu (29/7), ketika diminta komentarnya pada PON di Provinsi Riau. Ijeck mengatakan, dia yakin pembalap Sumut akan mampu memberikan yang terbaik bagi daerah ini, mengingat pembalap yang diturunkan di PON tersebut adalah pembalap yang tangguh dan memiliki jam terbang cukup tinggi. Wakil Sumut di arena PON XVIII adalah adalah Deri Irvandi (kelas 115 perorangan), M Irvansyah Lubis (kelas 125 perorangan) dan Firman Farera (kelas

di Palembang, Solo, dan Bogor. PSKB harusnya mencapai divisi II setelah tak pernah kalah di Bogor bersama PSPS Pakanbaru, PSB Bogor, Persikabo Bogor, PS Bolamongondow, dan Persipa Palu. Namun PSSI mengubah ketentuan dengan hasil rapat pleno PSSI. Seharusnya lima tim berhak lolos ke divisi II. Tapi PSSI menetapkan hanya empat tim saja sehingga PSKB yang menduduki posisi kelima dinyatakan gagal ke divisi II. Namun berkat perjuangan yang pantang menyerah, akhirnya PSKB lolos juga ke divisi II.

Tapi nasib PSKB apes karena tidak bisa mengikuti kelanjutan kompetisi divisi II di Pulau Jawa, akibat pengurusnya sudah ‘pecah’ dan tak punya dana. Akhirnya, status divisi II turun kembali ke divisi III. Sekarang sepakbola Binjai semakin tak jelas keberadaannya. Ada beberapa orang ingin membangkitkan kembali sepakbola Binjai, tetapi dari mana harus dimulai. Ini juga sebuah pekerjaan rumah pengurus KONI Binjai yang baru. Jika pembenahan dimulai dari PSKB, harus diketahui lebih dulu statusnya di PSSI. PSKB

SANTAPAN RAMADHAN

115 beregu berpasangan dengan Deri Irfandi). “Ketiga pebalap andalan dari Sumut ini juga sering mengikuti kegiatan lomba di Riau, dan telah mengetahui dengan detail mengenai keadaan medan, serta lapangan yang akan dilalui,” ucap dia. Menurutnya, pada PON XVI/2004 di Sumatera Selatan, pebalap Sumut juga berhasil meraih dua medali perak. Di PON XVII/2008 Kaltim, pebalap Sumut tidak memperoleh medali satu pun. Pada PON XVIII/2012 Riau, racer Sumut akan berusaha dan bekerja keras untuk mendapatkan medali emas. “Sumut harus bisa memperoleh medali emas,” ucap Ijeck yang juga pereli nasional. Ditambahkan, ketiga pebalap yang akan mengikuti PON itu kini masih terus rajin latihan dan ditangani pelatih yang berpengalaman. (ant/m47)

bukan lagi sebuah klub perserikatan, tetapi hanya klub bisa seperti Agas, Tandem Putra, Rajawali, Diklat Setia, Bonjol Putra, Binjai Selatan, HP Maju, POP, dan PSSKB yang dulu menjadi anggota PSKB saat berstatus perserikatan. Kemudian, siapa pengurusnya. Kalau tidak berubah, Ketua Umum PSKB adalah Wali Kota Binjai. Berarti, wali kota punya wewenang membenahi PSKB. Pekerjaan kecil tetapi rumit, sebab harus dicari data dan fakta sehingga PSKB bisa mengikuti sistem PSSI untuk dinotariskan.*Riswan Rika

Sudoku MENDATAR

6

AP

satu-satunya medali emas lewat ganda putra Markis Kido dan Hendra Setiawan. “Apakah tra-disi medali emas di Olimpiade dapat dipertahankan Indonesia dan hanya dari badminton yang dapat diharapkan?” tanyanya. (m42/ant)

Tantangan KONI Kembalikan Kejayaan Sepakbola Binjai

Jawaban di halaman A2

7

Tradisi Emas Olimpiade Tradisi emas Olimpiade Indonesia diawali dengan prestasi terbaik Indonesia dalam Olimpiade di Barcelona 1992 saat Susi Susanti dan Alan Budi Kusuma meraih emas untuk tunggal putra dan putri. Kemudian, era medali emas berlanjut di Olimpiade Atlanta 1996 dengan ganda putra Ricky Subagja dan Rexi Mainaki. Pada tahun 2000 di Sydney, ganda putraTony Gunawan dan Chandra Wijaya ganti mempersembahkan emas, sedangkan Taufik Hidayat merebut emas tunggal putra di Athena 2004. Dalam Olimpiade Beijing 2008, Indonesia menyabet

Racer Sumut Harus Raih Medali PON

Putih melangkah, mematikan lawannya yang baru mempromosikan pion jadi Menteri, dalam tiga langkah.

8

tradisi emas di Olimpiade,” ujarnya

1. Kelakuan; Yang diminta Islam agar karimah (baik, terpuji). 4. Masjid tempat makam Nabi Muhammad SAW. 7. Kota tujuan shalat arbain. 9. Jenis binatang haram dimakan. 11. Orang yang hijrah. 12. Guru pria (yang wanita disebut ustazah). 13. Bang; Yang dilakukan muazzin. 14. Huruf ke-6 abjad Arab. 15. Kain pembungkus jenazah. 17. Sabar; Dianjurkan ketika mendapat musibah. 20. Abjad pertama Arab. 22. Orang miskin. 24. Gurun pasir. 25. Maksud, kehendak. 26. Surah Quran yang sering dikutip dalam undangan perkawinan. 28. Salah satu bagian yang dibasuh saat wudhu. 29. Dilihat untuk menentukan idulfitri. 31. Tempat pasti Abu Lahab di akhirat. 32. Neraka paling dasar.

MENURUN

1. Negara tujuan jamaah haji dan umrah. 2. Nama neraka disebut dalam QS Al Humazah. 3. Minuman memabukkan menurut Al Quran. 5. Harap(an), bukan putus ___. 6. Annisa. 7. Sangat marah. 8. Tentara Allah. 10. Potong. 15. Membaca habis Al Quran. 16. Surat yang dibaca setiap rakaat shalat. 18. Minuman mengandung alkohol. 19. Burung pembawa batu panas untuk menghantam pasukan gajah (QS Al Fiil). 21. Nabi yang akan datang membunuh dajjal dll. 22. Raja yang ditenggelamkan Musa. 23. Salah satu Sifat Dua Puluh. 27. Nama depan sahabat Rasulullah yang disebut dalam shalat tarawih. 30. Huruf ke 22 abjad Arab.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sangat mudah (**), bisa diselesaikan dalam waktu tak sampai tujuh menit. Jawabannya lihat di halaman A2 kolom 1.

1 9 2 3 4 1 9 8 4 3 7 8

7 5 8 3 8 6 8 7 9 3 2 5 1 4 6 1 9 4 2 6 4 3

5 8

2 7 1 4 6 8 4 3 3 6 8 5 *202


Sport

A12

WASPADA Senin 30 Juli 2012

Wenger Marah Arsenal Seri HONGKONG (Waspada): Arsitek Arsenal, Arsene Wenger (foto), marah melihat rapuhnya benteng pertahanan pasukannya ketika ditahan seri Kitchee 2-2 pada laga eksibisi di Hongkong, Minggu (29/7).

AP

“Pertahanan kami terlihat rapuh, khususnya pada babak pertama. Pada babak kedua tidak begitu, sebab kami tidak terancam,” ujar Wenger.

URBY Urby Emanuelson (kanan) merayakan gol tunggalnya ke gawang Chelsea dengan rekannya Bakaye Traore (12) di Miami, AS, Minggu (29/7) pagi WIB. -AP-

Tes Bagus Milan Taklukkan Blues MIAMI, AS (Waspada): Urby Emanuelson mencetak gol menit 68 untuk membawa AC Milan mengalahkan Chelsea 1-0 dalam laga eksibisi di Stadion Sun Life, Miami, Amerika Serikat, Minggu (29/7) pagi WIB. Emanuelson mencetak gol melalui kerja sama dengan rekan setimnya, Stephen El-Shaarawy, di depan 57.748 penonton. “Selalu menyenangkan untuk mencetak gol. Malam ini adalah tes yang bagus bagi kami. Kami bermain baik, dan saya gembira dapat mencetak gol,” ucap gelandang Belanda tersebut. Emanuelson menggiring bola ke garis depan menuju kotak penalti Chelsea, lantas mengirim bola ke sisi sayap kiri untuk disambut El-Shaarawy. El-Shaarawy melepaskan tembakan, namun bola masih membentur bek Chelsea. Pantulannya langsung disambar oleh Emanuelson untuk menaklukkan kiper Chelsea dengan tembakan keras. Eden Hazard mendapatkan peluang terbaik untuk menyamakan skor saat duel tinggal menyisakan empat menit. Namun tendangan bebas bintang baru The Blues asal Belgia itu dari depan kotak penalti masih melambung di atas mistar Milan. “Saya pikir Hazard bermain baik sekali. Dia beberapa kali mengancam gawang lawan, permainannya sangat bagus,” ucap Roberto Di Matteo, manajer The London Blues. “Saya sangat gembira dengan cara bermain tim kami. Ini tim yang tumbuh, dan ini langkah yang teramat bagus,” puji pelatih Milan, Massimiliano Allegri. Rossoneri yang tiba di Amerika, Jumat lalu, memainkan pertandingan berikutnya melawan Real Madrid pada laga kesembilan World Football Challenge 2012. Sedangkan Si Biru kembali ke Inggris untuk menjalani laga eksibisi melawan Brighton, sebelum melakoni partai Charity Shield melawan Manchester City pada 12 Agustus. “Inilah tujuan pra-musim, pertandingan-pertandingan ini memberi kesempatan pada pemain-pemain muda,” klaim Di Matteo. (m15/ap/afp)

Pelatih klub London Utara itu mengaku kecewa dengan rapuhnya benteng pasukan Gudang Peluru, padahal sejumlah pemain yang ambil bagian di

tur Asia itu bakal bermain di kompetisi papan atas Inggris dan Eropa. “Kami memiliki banyak pekerjaan untuk dilakukan sebagai unit, agar dapat bertahan dengan lebih baik,” papar pelatih asal Prancis tersebut. KomentarWenger mungkin mengindikasikan bahwa dia akan memasuki bursa transfer

untuk memperkuat lini belakang skuadnya. Apalagi, Arsenal sudah kemasukan lima gol dari tiga pertandingannya di Asia, termasuk satu gol saat melawan tim Malaysia dan dua gol saat dipecundangi Manchester City 0-2 di Beijing, Jumat lalu. “Hari ini kami membiarkan semua orang bermain, dan beberapa pemain saat ini tidak berada di level Liga Premier. Ini proses belajar,” tutur Wenger. Arsenal memulai deul de-

ngan empat bek, yakni Kieran Gibbs, Johan Djorou, Ignasi Miguel, dan Craig Eastmond. Kitchee memecah kebuntuan menit ketujuh, ketika pemain asal Spanyol, Yago Gonzalez Lopez, memasukkan bola ke sudut gawang Arsenal tanpa memberi peluang bagi kiper Wojciech Szczesny. TheoWalcott menyamakan kedudukan menit 23 lewat gebrakan dia ke dalam kotak penalti Kitchee. Tapi Kitchee kembali unggul lima menit kemu-

dian, ketika bek kiri Daniel Cancela Rodriguez melesakkan bola ke bagian atas gawang Gunners, skor 2-1 bertahan hingga turun minum. Arsenal terus berupaya menekan, namun kurang tajamnya daya tembak mereka menegaskan betapa pentingnya keberadaan kapten Robin van Persie, yang tidak dibawa ke Asia setelah mengatakan ingin hengkang dari Emirates Stadium. Menit 77 London Reds akhirnya mampu menyamakan

kedudukan. Winger Gervinho membawa bola di tepi kotak penalti sebelum mengirimnya pada sayap kanan Thomas Eisfeld, yang dengan mudah melesakkan bola ke gawang tuan rumah. “Saya memainkan semua pemain bertahan sepanjang tur ini untuk melihat siapa yang siap. Kami memiliki (Bacary) Sagna, (Laurent) Koscielny, dan (Per) Mertesacker) yang tidak dibawa, maka kami punya tiga bek berpengalaman yang tidak dibawa,” dalih Wenger. (m15/ant/afp)

PSSI Undang Pemain Terbaik JAKARTA (Waspada): Meski sudah melakoni sejumlah ujicoba baik di dalam maupun di luar negeri, PSSI belum menetapkan siapa saja pemain yang akan masuk skuad Timnas Senior Indonesia untuk Piala AFF November mendatang. Menurut Penanggung Jawab Timnas Indonesia, Bernhard Limbong, belum adanya ketetapan pemain yang akan diturunkan di ajang bergengsi dua tahunan tersebut, karena pihaknya masih membuka kesempatan lebar untuk semua pemain terbaik yang ada di tanah air. “Bicara timnas, sudah pasti hanya pemain terbaik yang akan

Pasang Iklan

HP. 081370328259 Email: iklan_waspada@yahoo.co.id

direkrut. Tidak peduli apakah dia dari kompetisi IPL (Indonesian Premier League) atau ISL (Indonesian Super League),” ujar Limbong kepadaWaspada dihubungi melalui telepon selulernya, Minggu (29/7). Ditambahkan, dirinya sama sekali tidak ingin dikotomi IPL dan ISL terus diperdebatkan. Termasuk dengan kompetisi mana yang paling berkualitas di tanah air, apakah IPL yang digulirkan PSSI atau ISL yang sempat menjadi kompetisi ilegal karena berada di luar kontrol PSSI selaku federasi resmi. “Sudahlah. Capek kali kita terus menerus bicara kualitas kompetisi mana yang terbaik.

Sekali lagi, untuk urusan timnas hanya mereka pemain terbaik, tanpa melihat latar belakang dia berkompetisi. Secara kebetulan, ISL telah mendapat pengakuan dari PSSI, sehingga AFC dan FIFA sudah pasti tidak akan mempersoalkan lagi sekiranya kita merekrut pemain dari kompetisi ini,” ucap Limbong. Hanya saja, Limbong mengaku tidak semudah membalikkan telapak tangan dalam melakukan pemanggilan pemain-pemain ISL. Itu karena manajemen klub terus menahan dengan berbagai alasan. Padahal, kompetisi reguler sudah selesai. “Karena itulah melalui ke-

sempatan ini saya ingin memohon agar pemain ISL bisa memenuhi panggilan timnas. Sebab kami ingin membentuk skuad terbaik,” kata Limbong sembari mengatakan pihaknya sudah melayangkan panggilan kepada Firman Utina cs. Hanya saja sejauh ini belum mendapat jawaban. “Harus diketahui, membela timnas itu adalah kewajiban bagi setiap anak bangsa. Karena itu, mangkir dari panggilan timnas adalah tindakan tidak terpuji,” imbuh Limbong tanpa bersedia memberi kepastian hukuman apa yang akan diberikan kepada pemain yang mangkir dari panggilan timnas. (yuslan)


Sumatera Utara

WASPADA Senin 30 Juli 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:33 12:47 12:34 12:41 12:41 12:38 12:34 12:30 12:37 12:36

‘Ashar 15:58 16:10 15:58 16:05 16:05 16:02 15:58 15:54 16:01 16:00

Magrib 18:43 18:59 18:44 18:53 18:52 18:44 18:43 18:38 18:46 18:47

‘Isya

Imsak

Shubuh Syuruq

Kota

19:56 20:13 19:57 20:07 20:05 19:56 19:56 19:51 19:59 20:00

04:52 05:02 04:53 04:57 04:58 05:00 04:54 04:50 04:56 04:54

05:02 05:12 05:03 05:07 05:08 05:10 05:04 05:00 05:06 05:04

L.Seumawe 12:40 L. Pakam 12:33 Sei Rampah12:32 Meulaboh 12:44 P.Sidimpuan12:31 P. Siantar 12:32 Balige 12:32 R. Prapat 12:29 Sabang 12:47 Pandan 12:33

06:22 06:32 06:23 06:27 06:28 06:29 06:23 06:19 06:25 06:23

Zhuhur ‘Ashar 16:03 15:57 15:56 16:08 15:55 15:56 15:56 15:53 16:10 15:57

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:51 18:42 18:42 18:54 18:37 18:40 18:40 18:36 19:23 18:40

20:05 19:55 19:55 20:07 19:50 19:53 19:52 19:49 20:13 19:53

04:56 04:52 04:51 05:02 04:54 04:52 04:53 04:50 05:02 04:55

05:06 05:02 05:01 05:12 05:04 05:02 05:03 05:00 05:12 05:05

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:33 12:34 12:44 12:37 12:34 12:41 12:29 12:39 12:32 12:32

18:40 18:43 18:56 18:45 18:44 18:52 18:38 18:48 18:40 18:41

19:53 19:56 20:10 19:57 19:57 20:05 19:51 20:01 19:52 19:54

04:55 04:55 05:00 04:58 04:53 04:58 04:49 04:59 04:54 04:51

05:05 05:05 05:10 05:08 05:03 05:08 04:59 05:09 05:04 04:01

Panyabungan 12:30 Teluk Dalam12:37 Salak 12:35 Limapuluh 12:30 Parapat 12:32 GunungTua 12:30 Sibuhuan 12:29 Lhoksukon 12:39 D.Sanggul 12:33 Kotapinang 12:28 AekKanopan 12:29

06:26 06:21 06:20 06:31 06:23 06:21 06:22 06:19 06:32 06:24

15:57 15:59 16:08 16:01 15:58 16:05 15:53 16:03 15:56 15:56

06:24 06:24 06:30 06:27 06:22 06:28 06:19 06:28 06:23 06:20

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur ‘Ashar 15:54 16:01 15:59 15:55 15:56 15:54 15:53 16:03 15:57 15:52 15:54

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:35 18:42 18:43 18:39 18:41 18:36 18:35 18:51 18:41 18:35 18:37

19:48 19:54 19:56 19:52 19:53 19:49 19:48 20:04 19:53 19:47 19:50

04:53 05:01 04:55 04:50 04:53 04:52 04:52 04:55 04:54 04:49 04:50

05:03 05:11 05:05 05:00 05:03 05:02 05:02 05:05 05:04 04:59 05:00

06:22 06:30 06:25 06:19 06:22 06:21 06:21 06:25 06:24 06:19 06:19

Kapoldasu Diminta Proses Kapolres Langkat � Soal Berkas P21 Tetapi Tersangka Tidak Ada STABAT (Waspada): Kapoldasu diminta memproses Kapolres Langkat AKBP Leonardus Eric Bhismo terkait kasus penipuan senilai Rp180 juta yang berkasnya sudah P21 di Kejari namun tersangka tidak dapat dihadirkan penyidik kepolisian. Permintaan itu disampaikan Ketua LSM Forum Karya Putra (FKM) Kab. Langkat T. Firmansyah kepada Waspada, Minggu (29/7), setelah beberapa anggota DPRD Langkat yang dimintai

tanggapannya sungkan untuk berkomentar‘’Bagaimanaitubisa terjadi, Kapoldasu harus menyelidikinya,’’ kata T. Firmansyah . Dia menilai jika penahanan tersangka ditangguhkan sebe-

Kriminalitas Meningkat TEBINGTINGGI (Waspada): Selama Ramadhan, tujuh unit sepedamotor bodong (tanpa plat dan kenalpot blong) terjaring razia Polres Tebingtinggi. Setelah diperiksa, ternyata ketujuh sepedamotor hasil modifikasi tersebut ditemukan tidak terdaftar di Samsat Sumut. “Kita akan berkordinasi dengan satuan resmob, untuk mengungkapnya. Dari mana barang bukti ini dikeluarkan, dan tidak tertutup BB itu dari luar provinsi seperti Jakarta. Yang jelas tidak terdaftar di Samsat Sumut,” kata Kapolres Tebingtinggi, AKBP Drs. Andi Rian Djajadi,Sik, kepada sejumlah wartawan, Jumat (27/7). Didampingi Wakapolres kompol I Made ari Pradana, Kapolres mengimbau masyarakat agar melengkapi surat-surat kendaraanya, terlebih menjelang lebaran ini, dimana pengguna sepedamotor di jalan raya akan meningkat. Sementara itu terkait maraknya aksi pencurian sepedamotor yang terjadi belakangan ini, Kapolres Tebingtinggi, AKBP Drs. Andi Rian Djajadi, SIk mengakui kasus kriminalitas meningkat selama Ramadhan. Meningkatnya kriminalitas tersebut seiring meningkatnya kebutuhan masyarakat terlebih menjelang lebaran. “Kita minta bantuan kepada masyarakat agar menjaga diri dan barang-barang miliknya, terlebih menjelang lebaran ini, dimana kebutuhan masyarakat meningkat,” kata Kapolres AKBP Drs. Andi Rian Djajadi SIk. Seperti terjadi baru-baru ini, satu unit mobil Daihatsu Xenia Bk 1978 KO milikViki Eko Arpiandi dilaporkan hilang di depan Masjid Raya Jalan Suprapto Kota Tebingtinggi , Kamis (26/7) siang sekira pukul 14.30. Saat kejadian pemiliknya sedang sholat Zuhur, akibatnya korban mengalami kerugian mencapai Rp 140 juta. Sebelumnya dilaporkan satu unit mobil hilang dari garasi mobil dalam rumah pemiliknya serta dua unit sepeda motor dilaporkan hilang dari tempat terpisah, Senin (23/7). (a11)

Tewas Tenggelam Di Sungai Belutu DOLOKMASIHUL(Waspada): Masyarakat Desa Pekan Dolok Masihul, Kec.Dolok Masihul, Kab.Serdang Bedagai menemukan sesosok mayat laki-laki telah tewas diduga karena hanyut tenggelam di Sungai Belutu, Kec.Dolok Masihul, Sabtu(28/7) pukul 14:00 siang. KorbanadalahKepinSaputraPanjaitan,13,wargaDusunII,Pondok Coklat,Desa SarangTorop,Kec.Dolok Masihul, Kab.Serdang Bedagai. Setelah ditemukan, mayat korban dibawa masyarakat ke rumah orangtuanya untuk dikebumikan. Kasubbag Humas Polres Serdang Bedagai AKP ZN.Siregar yang dikomfirmasi Waspada, membenarkan penemuan mayat anak laki-laki yang diduga hanyut tenggelam di Sungai Belutu. Saat ini, kata Siregar, kasusnya sudah ditangani Polsek Dolok Masihul. (a08)

Ribuan Petasan Diamankan SEIBAMBAN (Waspada): Untuk menciptakan suasana kondusif dalam menjalankan ibadah puasa dan shalat taraweh di bulan suci Ramadhan 1433 H, Polsek Firdaus dipimpin Kapolsek AKP.Helmi Yusuf terus melakukan razia Pekat dan Sabtu (28/7) berhasil mengamanakan ribuan petasan dari berbagai tempat di Kec. Sei Rampah dan Kec.Sei Bamban. Dalam razia beberapa pedagang sempat keberatan dengan alasan mereka mempunyai izin resmi dari penyalur petasan tersebut dari Medan sehingga mereka minta petasan jangan disita. Kapolsek Firdaus,AKP.HelmiYusuf kepada Waspada mengatakan, digelarnya razia menindaklanjuti perintah Kapolres Sergai dalam upayamenjagasituasikamtibmasaman,tertibdankondusifkhususnya selama bulan Ramadhan mengamankan petasan berdaya ledak yang tidak mempunyai izin resmi. “Kita tidak mau suasana tidak kondusif karena suara petasan sangat mengganggu umat muslim melakukan ibadah sholat taraweh, khususnya di wilayah hukum Kec. Sei Rampah dan Sei Bamban,” tegas Helmi Yusuf. (c03)

Aksi Maling Terekam CCTV BINJAI (Waspada): Kondisi swalayan tutup, membuat pelaku pencurian di swalayan Ido Maret Jalan Soekarno- Hatta itu bebas beraksi. Sang pencuri membobol minimarket Indomaret, Minggu (29/ 6) dinihari sekira pukul 02:00. Melalui bagian belakang toko, untuk masuk kedalam. Sang maling bebas memilih apa yang dimaui. Seperti rokok berbagai jenis dan merk, susu dan uang tunai Rp300.000 yang ada di laci. Sampai kerugian ditaksir puluhan juta rupiah. Pencuri kelupaan, ternyata di swalayan itu dipasang CCTV yang dapat memonitor suasana di sekitar minimarket. Pencurian di swalayan Indomaret diketahui karyawannya, Dwi Kusuma Wardani, 20. Ketika memulai tugas Minggu (29/6) pagi, dia melihat ada yang aneh. Apalagi melihat barang berserakan dan berantakan di lantai dua. Pintu juga rusak dan terbuka. Dwi melaporkan hal tersebut kepada pengawas. Kasus pencurian itu dilaporkan ke Polsek Binjai Timur. Dari data CCTV diketahui, pencurian terjadi pukul 03:04. Aksi dilakukan satu orang, memakai kaus warna putih dan celana ponggol. Rambut ikal. Lelaki itu terekam saat membawa dua keranjang aneka barang. Wajah maling jelas terlihat di rekaman CCTV dan oleh Kanit Reskrim Polsek Binjai Timur Ipda Rudi Lapian, yang dikonfirmasi via telepon selularnya, menyebutkan, pihaknya sudah mendata ciri orang yang terekam di CCTV Indomaret, untuk dilakukan pencarian. (a04)

lumnya, bagaimana fungsi dan tanggungjawab penjamin hingga sudah dua bulan berkas kasusnya P21 di Kejari Stabat namun tersangka bersama barang bukti tidak dapat dihadirkan penyidik. Pantauan Waspada di PerumahanTasri Jalan Sudirman Stabat, Minggu siang, rumah tersangka dr IND sudah lama tidak dihuninya dan dikabarkan sudah dijual. ‘’Dia sudah lama tidak tinggal di sini, rumahnya sudah ditempatioranglain,’’kataSatpam Sementara JPU Kejari Stabat yang menangani perkara masih tetap menunggu pelimpahan berkas tersangka bersama barang buktidaripenyidikkepolisianagar persidangan dapat digelar.‘’Hingga saat ini belum ada diserahkan mereka,’’ kata Zulfahmi, SH kemarin.Jaksapenuntutumummenambahkan waktu tunggu mereka tidak berbatas. ‘’Hanya saja jikabeberapapekankedepanmasih seperti ini bagaimana de-

ngan penegakan hukum kita?,’’ tanya Zulfahmi. Kapolres Langkat AKBP Leonardus Eric Bhismo belum dapat dimintai konfirmasinya. Jumat pagi dalam satu kesempatan Leonardus terkesan menghindar buru-buru masuk ke Ruang Provos Mapolres ketika akan ditanyai terkait tindaklanjut sebagaimana dikatakannya tersangka akan dipanggil. Kasus yang menjerat mantan KepalaPuskesmasSawitSeberang itu sebagai tersangka berawal saat dia menjanjikan mampu mengurus salah seorang keluarga oknum Sekcam di Langkat menjadi PNS dengan menyerahkan sejumlah uang. Namun setelah uang tunai Rp180 juta diserahkan, kesepakatan tidak terwujud. Sejalan dengan pengaduan korban tersangka IND kemudian ditahan beberapaharidiMapolresLangkat tepatnya 13 Februari silam, tetapi kemudian dilepas tanpa alasan jelas. Sekretaris Dinas Kesehatan Langkat Zulkifli juga mengatakan telah melayangkan dua kali surat panggilan ditujukan kepada IND untuk hadir memberikan keterangankarenaberbulan-bulantidak melaksanakan tugas. (a03)

Waspada/Ist.

PT Raya Padang Langkat (Rapala) memperoleh penghargaan Green Agro Industry diserahkan Menteri Perindustrian, Mohamad S Hidayat (kiri) kepada Direktur Utama Rapala, Paul Baja Marudut Siahaan. (kanan) BUPTAI Langkat H Ngogesa Sitepu mengucapkan selamat kepada Rapala, dan berharap terus melakukan inovasi dalam menjaga lingkungan hidup.

PT Rapala Terima Green Agro Industry MEDAN (Waspada): Kesadaran perusahaan perkebunan dalam melakukan inovasi dalam peremajaan kelapa sawit harus digalakkan agar tidak ada lagi melakukan pembakaran pohon tua yang mengeluarkan banyak karbon di udara.

Hal inilah yang menjadikan PT Raya Padang Langkat (Rapala) mendapatkanpenghargaanGreen Agro Industry yang diserahkan langsung oleh Menteri Perindustrian,MohamadSHidayatkepada Direktur Utama Rapala, Paul Baja Marudut Siahaan.

Tersangka Pencuri 1 Janjang Sawit Dikeluarkan Dari Sel LANGKAT ( Waspada): Kongres Advokat Indonesia (KAI) membebaskan Ahmad, 31, penduduk asal Sicanggang Langkat dari tahanan. Pria itu dituduh mencuri satu janjang (tandan) kelapa sawit. Upaya tim kuasa hukum Ahmad mengeluarkannya dari tahanan semula mendapat tantangan dari Polsek Sicanggang. Tidak putus asa, puluhan advokat KAI dimotori Auli Zufri, SH, Roman Lubis, SH dan Zainal Ikhwan selaku koordinator, Jumat

(27/7) sore menjumpai Kapolres Langkat AKBP Erik Bismo. Dalam pertemuan itu, semula Erik Bismo yang didampingi Kapolsek Sicanggang tidak bersedia mengeluarkan Ahmad dari tahanan. “Pak Kapolres, kenapa harus ditahan, dia tulang punggungkeluarga,”ucapNeli,advokat. Neli mengatakan, menahan Ahmad sangat bertentangan dengan Peraturan Mahkamah Agung (Perma) No. 2Tahun 2012, yang menyatakan kerugian Rp2,5 jutakebawahtidakdapatditahan.

“Saya pikir tidak mungkin Kapolsek Sicanggang tidak mengetahui Perma ini. Kami juga menolong dia tanpa pamrih, KAI membantu karena rasa kemanusiaan,” ujarnya. Akhirnya Kapolres memerintahkan agar Ahmad dikeluarkan dari tahanan. Selanjutnya puluhan advokat KAI menjemput Ahmad ke LP Tanjungpura, Langkat.“Terimakasihbapak-bapak dari KAI telah membantu saya, hanyaTuhanyangbisamembalas kebaikan bapak,” tutur Ahmad

Ketua DPRD T. Tinggi:

Penggantian Ketua FPG Tidak Ada Masalah TEBINGTINGGI (Waspada): Penggantian Ketua Fraksi Partai GolkarKotaTebingtinggiIr.Pahala Sitorus,MMyangdilakukanPartai Golkar tidak ada masalah dan akan diproses. Dalam waktu dekat komposisi FPG DPRD yang baru segera disampaikan dalam sidang pleno DPRD. Hal itu ditegaskan Ketua DPRD KotaTebingtinggi H. Syahrial Malik, kemarin, terkait adanya penggantian dilakukan Partai Golkar serta surat protes disampaikan Ir. Pahala Sitorus, MM, atas penggantian dirinya. Menurut H. Syahrial Malik, fraksi di DPRD merupakan perpanjangantanganpartaididewan. Atas dasar itu, DPRD tidak berwenang untuk menilai atau mempersoalkan penggantian yang dilakukan partai. Jika pun ada komplain dari anggota DPRD

yang diganti, hal itu merupakan urusan internal Parpol bersangkutan. “Jadi saya kira, kalau ada protes, silakan sampaikan ke partai dan bukan ke institusi DPRD,” tegas dia. DPD Partai Golkar kota Tebingtinggi,melaluisuratNo.PB102/GK-TT/VII/2012 tanggal 23 Juli 2012, hal Perubahan Komposisi FPG ditandatangani Ketua HM Sjafri Chap dan Sekretaris Darmawan Alexander Hasibuan, SH, telah menyampaikan perubahan komposisi ke Pimpinan DPRD kota Tebingtinggi. Adapun komposisi FPG DPRD kota Tebingtinggi yang baru, yakni Ketua Mahyan Zuhri Effendi, Sekretaris Hendra Gunawan, SE, Anggota H. Syahrial Malik, HW Gunadi, SE, Ir.Pahala Sitorus, MM dan Kornel Sihaloho. Sebelumnya, penggantian

ketua FPG DPRD kota Tebingtinggi dilakukan, akibat ketidakpatuhan ketua FPG terhadap instruksiDPDPartaiGolkarNo.50/ GK-TT/IV/2012tanggal9April2012. Isi instruksi itu memuat tiga poin. Yakni, menindaklanjuti instruksi Ketua DPD Partai GolkarTebingtinggi. Lambannya penanganan/ pengusutan kasus korupsi yang belum tuntas dan membongkar sampai tingkat aktor intelektual di KejarikotaTebingtinggi.Menindak lanjuti hal itu diinstruksikan kepadaketuaFPGuntuksegeramengadakan rapat FPG. Namun, surat itu sama sekali tidakditanggapiKetuaFPGhingga berjalan tiga bulan. Akibatnya, berdasarkan PO No.013/DPP/ Golkar/X/2011 tentang Displin Organisasi, ketua FPG DPRD kota Tebingtinggi mengalami pergantian. (a09)

Karyawan SPBU Tewas Bunuh Diri BATANGKUIS (Waspada): Didugakarenaadapermasalahan denganpacarnya,KhairilAmri,22, warga Dusun IV Desa Bintang Meriah Kec. Batangkuis, Sabtu (28/7)pagimelakukanaksibunuh diri menggunakan tali di dalam rumahnya. Informasi berhasil dihimpun Waspada, peristiwa tersebut pertama kali diketahui orangtua kandungnyaEdiSundawa,67,saatbermaksud hendak membangunkan korban guna disuruh kerja. Menurut Edi Sundawa, pagi itu dia bermaksud hendak membangunkan korban yang tidur di bagian belakang rumahnya guna disuruh bekerja seperti biasanya di SPBU Dirgantara Batangkuis. Saat itu ia berusaha memanggil nama korban beberapa kali namun tidak ada juga jawaban dan membuka pintu kamar yang tak terkunci. Namun, setelah beberapa kali dipanggil tidak juga ada jawaban, membuat Edi Sundawa menjadi khawatir terhadap anaknyaini.KekhawatiranEditerjawab saat dia menemukan anaknya sudahtewasdengankondisileher terikat tali. Saat kejadian, ibu korban Faridah Hanum sedang berada di rumah salah satu tetangganya yang baru saja ditimpa musibah kemalangan. Kejadian tersebut langsungdiberitahukanEdikepada istrinya.

Mengetahui hal ini, istri Edi langsung shock ketika menyaksikan anak semata wayangnya itu tewas dengan kondisi lidah terjulur.OlehEdidibantutetangga sekitar, korban langsung diturunkandandiletakkanditempatyang nyaman. Dari sekitar TKP ditemukan sepucuk surat yang ditulis korban 27 Juli 2012 dan ditujukan kepada keluargadankekasihkorbanyang isinya permohonan maafnya kepada seluruh keluarga dan ke-

kasihnya itu. Kapolsek Batangkuis AKP Ilham Aceh bersama anggotanya yang ditemui Waspada di lokasi menyebutkan, peristiwa yang dialami korban murni bunuh diri dan tidak ada motif lain. Hal itu juga dikuatkan dengan keterangan dokter Erizal yang melakukan pemeriksaan dan hasilnya: korban tewas akibat bunuh diri dengan kondisi lidah korban menjulur keluar dan dari kemaluan korban keluar cairan. (crul)

Tewas Tertimpa Pohon Sawit LUBUKPAKAM (Waspada): Saat ngutip buah brondolan, Anjasmara, 13, warga Kampung Banjaran, Desa Tanjung Garbus, Kampung Kecamatan Pagar Merbau, tewas tertimpa pohon sawit yang ditumbang oleh KebunTGPM (Tanjung Garbus Pagar Merbau), Sabtu (28/7) pukul 11:30. Informasi dihimpun, sebelumnya Anjasrama tengah membantu ibunya sebagai pekerja kilang batubata. Tak jauh dari situ, kebetulan alat berat escavator milik rekanan perkebunan sedang melakukan penumbangan pohon sawit atau repelanting. Anjas tergiur melihat tiga temannya bermain di lokasi penumbangan, sambil memungut brondolan buah sawit dari pohon yang ditumbang. Anjas pun bergabung dengan temannya. Saat pohon sawit tumbang, korban bersama temannya berebut brondolan sawit. Naasnya, ketika berebut brondolan, pohon sawit pun menimpa korban, akhirnya terkapar dalam kondisi luka parah di bagian kepalanya. Warga yang melihat kejadian berupaya mengangkat tubuh korban, selanjutnya dibawa menuju rumah sakit. Namun, Anjas menghembuskan nafas terkahirnya sebelum tiba di rumah sakit. Pihak kepolisian tengah menangani kasus ini, turut diamankan operator escavator. (a07)

menitikkan air mata. SebelumAhmaddikeluarkan dari LP, sempat terjadi keributan disebabkan ulah petugas LP yang dinilai arogan dan kasar. Selain itu, sikap Kepala LP Sitepu, juga terlalu berlebihan. Ahmad ditahan karena laporan Jamil, mandor di kebun kelapa sawit milik seorang pimpinan DPRD Sumut, ke Polsek Sicanggang dengan tuduhan mencuri lima janjang kelapa sawit senilai Rp200.000. Namun barang bukti yang diajukan hanya satu janjang. Nasib Ahmad menarik perhatian advokat tergabung dalam Kongres Advokat Indonesia (KAI) SumateraUtara.KAImenyiapkan 100 advokat jika kasus ini sampai ke pengadilan. “Kita sudah teken kuasa dengan Ahmad untuk membelanya,”tegasAuliaZuhfri,SH,dalam jumpa pers di Kantor KAI Sumut Jalan Nibung Medan, baru baru ini, dihadiri Zainal Ikhwan, SH, M.RomanLubis,SHdanpuluhan advokat lainnya. Menurut Aulia, Ahmad membantah mencuri.Yang dipanen Ahmad sawit abangnya. “Kasus ini penuh rekayasa. Ironisnya, hanya menerima laporan dari Jamil melalui telepon, Kapolsek Sicanggang langsung menangkap Ahmad dan menahannya 20 hari,” kata Aulia. (ihn)

Informasi diperoleh di Medan, penghargaan ini berhasil diraih PT Rapala karena perusahaaninimelakukaninovasidalam peremajaan kelapa sawit dengan tidak melakukan pembakaran terhadappohontua.Penghargaan diterima Hotel Indonesia, Jakarta, kemarin. “Indonesia Green Awards (IGA)2012yangtelahdiumumkan pekan lalu memang menjadi istimewa karena dapat memacu perusahaanperkebunanagarlebih dapat menjaga lingkungan,” ujar Paul Baja Marudut Siahaan, kemarin. Dijelaskanjuga,pihaknyaperlu terus menjaga dan mendorong agar dapat melakukan inovasi didalam peremajaan kelapa sawit

dengan tidak melakukan pembakaran terhadap pohonpohon tua atau replanting. Bupati Langkat H Ngosesa Sitepu mengucapkan selamat kepada Rapala agar terus dapat mempertahankan kepercayaan IGAdanterusmelakukaninovasiinovasi didalam menjaga lingkungan hidup. “Kita harap berbagai sektor terus mendukung tumbuh kembang Kabupaten Langkat yang saat ini terus berbenah diri denganberbagaipenghargaanyang diterima seperti mendpat Plakat Wahana Tata Nugraha (WTN), Manggala Karya Kencana, e-KTP, dan lainnya dan ini harus juga diikuti oleh berbagai sektor lainnya,” ujar bupati. (m38)

120.000 Petasan Disita TEBINGTINGGI (Waspada): Dalam pengamanan taraweh dan sahur selama Ramadhan, petugas Polsek dan Polres Tebingtinggi menggelar razia kepada sejumlah pedagang petasan di Kota Tebingtinggi. Razia berlangsung mulai Senin (23/7) hingga Jumat (27/7) pagi, menjaring ribuan petasan dari berbagai jenis dan merek. Dari 120.000 petasan yang disita, terbanyak petasan jenis mercon cabe, selebihnya petasan jenis smok 1, 2,dan 3 berjumlah 40 ribu butir serta petasan jenis roket. Seluruhnya bernilai Rp15 juta terdiri dariberbagaikemasankotakdanbungkusplastikberasaldaripedagang musiman eceran di pinggir jalan, toko-toko dan pengendara sepeda motor pemakai petasan. “Razia pengamanan taraweh dan sahur ini akan terus berlangsung sampai selesai Ramadhan,” tegas Kapolres Tebingtinggi, AKBP Drs. Andi Rian Djajadi,Sik, didampingi Wakapolres Kompol I Made Ari Pradana, Kasubag Humas AKP Ngemat Surbakti, Kasat Reskrim AKP Lili Astono, Kasat Lantas AKP N. Manalu, dan para Kapolsek kepada sejumlah wartawan, Jumat (27/7). Dari ribuan petasan tersebut, jelasnya, ada yang memiliki izin dan ada yang tidak, selain izin barang, juga harus ada izin penjualan. Dua pedagang diamankan petugas karena sama sekali tidak memiliki izin keduanya. Sedangkan untuk jenis petasan mercon cabe sama sekali tidak diberi izin penjualan karena sangat mengganggu, jelas Kapolres. Razjia tindak pidana menjual belikan mercon tanpa izin sesuai UU No.9 tahun 1933 tentang bunga api dengan ancaman hukuman tiga bulan. Sementara itu, salah seorang pedagang mercon yang diamankan mengaku membeli barang tersebut dari Kampung Keling Medan. (a11)


Sumatera Utara

B2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana

Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David

Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Hajrul Azhari Ritonga, Arianda Tanjung. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

KISARAN (Waspada): Kinerja Manager PT. PLN Ranting Kisaran Suheri dipertanyakan. Pasalnya, pelayanan PLN Kisaran terkait pemakaian listrik rumah tangga kembali mengundang keluhan masyarakat. Hal ini terkait terjadinya pembengkakan pembayaran hingga mencapai 100 persen. “Biasanya pembayaran tagihan listikku, paling mahal Rp200 ribu, tapi tiga bulan terakhir Rp1,1 juta, kok mahal kali,” ujar seorang pelanggan kepada Waspada Jumat (27/7). HalsamadikatakanIndraHS, warga Jalan Amir Hamzah, KisaranTimur.Kendatipemakaiannya rendah, namun tagihan 6 bulan mencapai Rp1,3 juta. “Dua bulan Rp500ribu,adaapaini,”ujarIndra. Dikatakan, kondisi ini diang-

gap sangat memberatkan ditambah lagi dia tidak mengetahui alasanterjadinyalonjakan.Parahnya lagi, sebut Indra, ketika petugas PLN datang, meterannya langsung hendak dicabut tanpa pemberitahuan. Selain itu, petugas terkesan memaksanya untuk mengganti meteran dengan meter prabayar seharga Rp500 ribu. “Aku tidak mau,karenadisuruhbayarRp500 ribudanmeteranlamamaudiambilnya,” ungkap Indra. Selain itu, Indra terpaksa mengeluarkan uang Rp105 ribu untuk perbaikan stud meteran. “Alasan petugas, stud meteranku rusak dan biaya perbaikannya Rp105 ribu. Uang sudah kukasi, ternyata setelah kucek tak ada yang rusak. Ini penipuan,” kata Indra. Manager PT. PLN Ranting Kisaran Suheri dikonfirmasi Waspada melalui saluran telepon

menyarankan pelanggan untuk cross-checkterkaitpembengkakan tagihan listrik. Dia mengakui, hal ini terjadi mungkin akibat human error.“Janganbayardulu,silahkan cross-check ke PLN. Memang petugas diinstruksikan mencatat meteran tiap bulan, tapi saya tidak tahu door to door. Keluhan pelanggan itu tidak salah,” dalih Suheri. Mengenai meteran prabayar seharga Rp500 ribu, Suheri membantah.Menurutdia,bagipelanggan yang ingin mengganti meterannya dengan pra bayar tidak dikenakan biaya apa pun selain token perdana Rp22 ribu. “Masalah ongkos pasang ya ikhlas hati, itu tidak bisa saya salahkan. Kalau adapetugasyangmintabiayaRp500 ribu untuk meteran pra bayar, itu salah dan akan saya tindak,” kilah Suheri. Begitu juga perbaikan meteran,lagi-lagiSuherimengaku tak ada biaya apa pun.(a14)

Polres Tanjungbalai Razia Miras Dan Petasan TANJUNGBALAI (Waspada): Kepolisian Resort Kota Tanjungbalai menyita ratusan botol minuman keras dan petasan dari berbagai tempat, Jumat (27/7) sore. Barang-barang itu dikumpulkan di Mapolres untuk dimusnahkan. “Menindaklanjuti keresahan warga, hari ini kami meraziasekaligusmenyitaminuman keras dan petasan. Kedua barang itu disinyalir kerap mengganggu kekhidmatan masyarakat melaksanakan ibadah Ramadhan,” kata Kapolres Tanjungbalai AKBP Edward P Sirait didampingi Waka Polres Kompol Junaidy di lokasi. Dijelaskan Kapolres, banyak-

nya keluhan masyarakat membuat petugas melakukan langkah antisipasi. Seluruh barang terlarang yang terjaring langsung diamankan. Disebutkan, razia dibagi dua tim dengan jumlah personel 60 orang. Tim dipimpin Kapolres bersama Wakapolres, menyisir pedagang petasan di kawasan Pasar Kawat Jalan Veteran, Jalan Mesjid, dan Jalan Letjen Suprapto. Hasilnya, ribuan bungkus petasan disita. Petasan itu ditemukan di bawah tong sampah Jalan Veteran. Tidak diketahui pemiliknya, karena tidak satu pun pedagang mengaku sebagai pemilik. Kapolres dan anggota me-

lanjutkan razia ke Jalan Letjen Suprapto. Hasilnya, kembali ditemukan ratusan bungkus petasan. Barang-barang tersebut selanjutnya dibawa ke Mapolres. Sementara tim dipimpin Kabag Ops Kompol Nasran dan Kasubbag Humas AKPYani Sinulingga, mengamankan 400 botol minuman keras berbagai merek dari salah satu kios di Jl. Jenderal Sudirman Simpang Seidua, Kec. Datukbandar. Kapolres Tanjungbalai mengatakan, selain untuk menjaga ketentraman berpuasa, operasi miras dan petasan untuk mencegah terjadinya berbagai jenis tindak pidana selama Ramadhan 1433 Hijriah.(a14)

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002

� Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Rp3,5 M Untuk Pendidikan Gratis Tingkat SLTA Di L. Batu RANTAUPRAPAT (Waspada): Dana Rp3,5 miliar pada Tahun Anggaran 2012 dikucurkan untuk mendukung kegiatan program pendidikan gratis bagi pelajar tingkat Sekolah Lanjutan Tingkat Atas (SLTA), yakni SMA dan SMK Negeri di Kab. Labuhanbatu. Wakil Bupati L.Batu Suhari Pane, S.Ip mengatakan itu saat Safari Ramadhan, Jumat (27/7) di Masjid Raya Pekan Labuhan Bilik, Kec. Panai Tengah. Di hadapan masyarakat Labuhan Bilik, Suhari memaparkan, warga jangan lagi takut tidak ada biaya menyekolahkan anak sampai SLTA, sebab Pemkab L.Batu telah membuka peluang sebesar-besarnya bagi masyarakat untuk mendapat kesempatan belajar gratis. Dijelaskan, dana Rp3,5 miliar berguna untuk meningkatkan MOP (Mutu Operasional Sekolah), antara lain untuk biaya les tambahan pelajaran, biaya ujian sekolah, biaya praktek, pengadaan dan penggandaan buku teks pelajaran, kegiatan lomba akademik, kegiatan olah raga, kegiatan sosial budaya, pembiayaan tenaga honorer dan biaya pendidik dan kependidikan. Jadi untuk kegiatan itu tidak ada lagi pungutan bagi masyarakat. Pada Safari Ramadhan itu,Wakil Bupati menyerahkan bantuan Pemkab L. Batu kepada Ketua Badan Kenaziran Masjid (BKM) Raya Labuhanbilik H. Zulpan uang tunai Rp5 juta, 1 unit jam penunjuk waktu shalat, 4 Alquran, 1 tafsir/terjemahan Alquran, 1 buku tentang kisah-kisah nabi, 1 buku khutbah Jumat, 30 buku surat Yasin, dan ditambah 5 Alquran bantuan dari keluarga Wakil Bupati, serta 1 sajadah panjang bantuan dari PT Bank Sumut.(a18/c07)

Waspada/Iwan Has

BUPATI Batubara H. OK Arya Zulkarnain, SH, MM menandatangani berita acara pengesahan LKPD APBD Tahun 2011 dalam sidang paripurna DPRD Batubara.

LKPD Bupati Batubara 2011 Disahkan BATUBARA ( Waspada): Bupati Batubara H. OK. Arya Zulkarnain, SH, MM dalam sambutannya pada LKPD APBD 2011, baru-baru ini mengatakan, gambaran singkat Laporan Keuangan Pemkab Batubara kurun waktu Tahun 2011 telah dibahas dan diteliti serta mendapat pandangan, saran, kritikan dari anggota dewan terhormat. Itu menunjukkan kerjasama

yang disemangati rasa kebersamaan, sehingga proses dalam melakukan pembahasan terhadap Laporan Keuangan PemerintahDaerah(LKPD)Tahun2011 yang sekaligus Ranperda tentang pertanggung jawaban pelaksanaan APBD Kab. Batubara TA 2011 tidak ada kendala, berjalan sesuai aturan yang berlaku. Bupati juga berterimakasih kepada dewan, segenap unsur

Muspida dan instansi vertikal beserta elemen masyarakat khususnya para tokoh agama, tokoh adat, tokoh pemuda dan para insan pers dan LSM, atas dukungan dan kerjasama yang baik sehingga tugas dan tanggungjawab dalam menyelenggarakan pemerintahan, pembangunan dan pembinaan masyarakat di Kab. Batubara berjalan baik,lancar,amandantertib.(a13)

Protes Limbah, Warga Demo PT. Nubika Jaya KOTAPINANG(Waspda):Puluhan warga Dusun Bom, Dusun Karangsari, dan Dusun Sisumut, Desa Sisumut, Kec. Kotapinang, Sabtu (28/7) unjukrasa di Pabrik Minyak Kelapa Sawit (PMKS) PT. Nubika Jaya. Mereka menuntut keadilan atas gangguan limbah pabrik yang mencemari sungai di kampung mereka. Meski sebagian besar pendemo sedang berpuasa, namun itu tidak meluluhkan semangat mereka melakukan long march sejauh satu kilometer dari perkampungan Karangsari menuju perusahaan yang tergabung dalam Permata Hijau Grup (PHG) itu. Namun aksi warga tertahan di pintu gerbang perusahaan. Puluhan petugas sekuriti dan aparat kepolisian dipimpin Kapolsekta Kotapinang, Kompol Janner Panjaitan melakukan pagar betis. Koordinator Aksi, Rudi Har-

tono dalam orasinya menuntut ganti rugi atas kerugian masyarakat akibat banjir diserti limbah perusahaan yang menggenangi rumah warga pada 29 Mei lalu. Menurutnya perusahaan tidak pernah memberi solusi atas pencemaranyangterjadipadaSungai Baba, Sungai Ranggungan, dan Sungai Barumun. Mereka juga menuntut perusahaan menetralisir kembali air Sungai Baba hingga ke Sungai Barumun. Mereka menuntut perusahaan tidak lagi membuang limbah ke sungai. Sempatterjadikericuhansaat satu unit truk sarat muatan TBS kelapa sawit berkecepatan tinggi mengarah ke barisan warga yang berunjukrasa. Namun kericuhan itu dapat dinetralisir petugas sehingga tidak ada tindakan anarkis pendemo. Aksi itu akhirnya diterima

Kabag Umum Permata Hijau Grup (PHG), AsepTatang. Dalam dialog dengan perwakilan warga, Asep mengatakan pihaknya tidak bersediamemberigantirugikarena perusahaantidakpernahmerugikan warga.Namunme-ngenaibantuan, menurutnyaPT.NubikaJayaakan memberikan. “Kalau soal banjir pada29Meilaluitubencana.Kami punkebanjiran.Kamimintawarga agar menginventarisir barangbarang yang rusak akibat banjir. Kita akan ajukan, mudah-mudahan perusahaan dapat membantu,” katanya. Asep juga membantah bahwa pencemaran yang terjadi di Sungai Baba disebabkan limbah pabrik mereka. Menurutnya, pencemaran disebabkan limbah domestik dan limbah rumah tangga. “Kami sudah menerapkan land aplications dalam pengelolaan limbah,” katanya.(c18)

Kawanan Pencuri Sepedamotor Diamuk Massa

Hubungi kami

KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

Senin 30 Juli 2012

Tagihan Listrik Di PLN Kisaran Membengkak

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com

WASPADA

Waspada/Rahmad F Siregar

KAPOLRES Tanjungbalai AKBP Edward P. Sirait, Waka Polres Kompol Junaidy dan Kasat Intel AKP B Simatupang memeriksa ratusan bungkus petasan yang ditemukan di kawasan Pasar Kawat, Jl. Veteran.

DPRD Labusel Diminta Rekomendasi BPK KOTAPINANG (Waspada): DPRD Labusel didesak untuk merekomendasi Badan Pemeriksa Keuangan (BPK) melakukan audit untuk tujuan tertentu (investigatif) terhadap pelaksanaan sejumlah proyek APBD 2011. Pasalnya LHP BPK atas Laporan Keuangan 2011 Kab. Labusel yang diserahkan awal Juli lalu belum menjawab seluruh dugaan penyimpangan yang terjadi. Desakan itu dikemukakan Ketua Ikatan Cendekiawan Muslim se - Indonesia (ICMI) Labusel, Abdullah MN Situmorang kepada Waspada, Minggu (29/7). Menurutnya, sampel proyek yang diperiksa BPK baik secara administrasi maupun kepatuhan terhadap Undang-Undang belum mengarah pada proyek yang selama ini disinyalir bermasalah. “Masih ada keraguan di masyarakat karena sampelnya belum mengena,” katanya. Dicontohkan, BPK harusnya melakukan audit terhadap proyek pembangunan RSUD KotapinangyangdikerjakanPT.Dara Rizky dengan pagu Rp3,98 miliar, proyek pembelian pertapakan kantor Bupati di Desa Sosopan senilai Rp3 miliar, serta proyekproyek lainnya. Karena selama ini proyek tersebut kerap dikritisi masyarakat. Situmorang mengatakan, DPRD Labusel dimungkinkan untuk merekomendasi BPK melakukan audit investigasi. Menurutnya, opini BPK untuk Labusel, yakni wajar dengan pengecualian(WDP),dinilaitidaksesuai dengan kenyataan adanya dugaan korupsi di Labusel. Menurutnya, BPK seringkali

mengalami kesulitan ketika melakukan audit karena kategori audit pun beragam seperti audit kinerja, audit keuangan, audit kelembagaan, dan lainnya. Sementara kata dia, BPK hanya memiliki waktu 30 hari untuk melakukan audit. “Makanya kita menganjurkan DPRD agar pelaksanaan audit terhadap Pemkab Labusel dilakukan dengan perencanaan matang. Artinya, BPK harus bisa menghindari ketidaksesuaian laporan hasil audit dengan temuan fakta di lapangan. Sehingga penyimpangan pengadaan barang dan jasa di Labusel dapat dicegah,” kata dia. Karenanya dia berharap agar DPRD mekomendasi kepada BPK untuk melakukan audit investigasi terhadap Pemkab Labusel, khususnya terkait proyek yang selama ini diduga kuat terjadi tindak pidana korupsi. Dengan audit itu, BPK dapat menyelidiki lebih dalam proyek itu. Humas BPK Kantor Perwa-

kilan Sumatera Utara, Mikael Togatorop yang dikonfirmasi mengatakan,DPRDdanlembaga lainnya dapat merekomendasi pihaknya untuk melakukan audit investigasiuntukmenindaklanjuti adanya dugaan penyimpangan. Dicontohkan, dalam kasus dugaankorupsiKabupatenLangkat, pihaknya melakukan audit investigasi dan hasilnya diketahui bahwa kas Pemkab tekor.“DPRD itu stake holders kita. Jadi mereka dapat merekomendasikan,” katanya. Dijelaskan Togatorop, opini WDP yang diberikan BPK terhadap LK Kabupaten Labusel tidakmenyimpulkanbahwatidak terjadi tindak pidana korupsi pada APBD Labusel. Menurutnya, waktu pemeriksaan yang begitusempitmembuatpihaknya tidak dapat menelusuri persoalan yang lebih mendalam. “Kita terikat Undang-Undang makanya sulit karena hanya 30 hari. Jadi yang kita periksa masih sebatas opini saja,” katanya. (c18)

Tanggulangi Malaria, Dinkes Batubara Lakukan Fogging TALAWI, Batubara (Waspada): Dinas Kesehatan melakukan penyemprotan (fogging) setiap rumah penduduk di Kel. Labuhan Ruku, Kec. Talawi, Kab. Batubara sebagai langkah penanggulangan malaria. ‘’Ini sudah kami lakukan beberapa hari dengan sasaran rumah penduduk dari Dusun II s/dVI,’’ kata Fuad dan Udin, petugas penyemprotan di lokasi, Minggu (29/7). Penyemprotan dilakukan gratis dengan insektisida. ‘’Jika nyamuk hinggap di dinding langsung mati. Kalau untuk air atau di bak mandi jenis abate,’’ katanya. Setiapharipuluhanrumahyangdisemprotdengantenagapetugas empatorang.Namunadajugapendudukyangtidakbersediadilakukan penyemprotan dan seakan mencurigai kedatangan petugas. ‘’Kami ini hanya petugas menjalankan tugas, tidak mungkin melakukan hal lain,’’ katanya.(a13)

MEDANGDERAS(Waspada): Dua orang yang diduga komplotan pencuri sepedamotor diamuk massa di Dusun Pekan, Desa Lalang, Kec. Medang Deras, Kab. Batubara, Minggu (29/7), seorang nyaris tewas dan seorang lagi sempat diselamatkan polisi. Menurut keterangan, siang itu sekira pukul 11:00 warga dikejutkan dengan dilarikannya sepedamotor Honda BK 6274 VAO milik M. Ali dari parkir depan rumahnya. Begitu sepedamotor itu melaju ke arah acses road PT.

Inalum warga coba mengejar, namun tak berhasil.Ternyata ada warga yang melihat, pelaku pencurian sepedamotor itu turun dari mobil Xenia BK 1576 DQ yang berjalan pelan ke arah acses road juga. Kemarahan warga pun ditumpahkan kepada dua orang yangberadadidalammobil,salah satunya AKJ, 38, warga Dusun enam Desa Aras, Kec. Airputih, Kab. Batubara yang mengemudikan mobil diamuk massa hingga babak belur, namun sempat

diamankan petugas polisi pos Desa Lalang. Sementara rekannya yang masih belum diketahui namanya kritis dihajar massa yang marah. Mobil yang mereka tumpangi juga nyaris dibakar massa,tapidicegahpolisidipimpin Kapolsek Pagurawan AKP M Sirait. Kepada wartawan, Sirait membenarkan adanya peristiwa massa yang marah akibat pencurian sepedamotor warga. Petugas masih menyelidiki kasus pencurian sepedamotor ini.(c05)

Pengusaha Tahu Tempe Di Labusel Mengeluh KOTAPINANG (Waspada): Melambungnya harga kacang kedelai di pasar tradisional membuat pengusaha tahutempe di Kab. Labusel mengeluh. Mensiasatinya, pengusaha terpaksa menggunakan berbagai upaya agar tetap beruntung. Wagiman, 62, pengusaha tahu di Lk. Simaninggir, Kel. Kotapinang, Kec. Kotapinang yang ditemui Waspada, Minggu (29/7) mengatakan, sejak awal Ramadhan lalu harga kedelai di pasaran naik Rp65 ribu/karung. Dijelaskan, sebelum Ramadhan harga kedelai per karung ukuran 50 Kg Rp335 ribu, sekarang menjadi Rp400 ribu. Menurutnya, naiknya harga

kedelai membuat keuntungan penjualan tahu-nya menurun. Untuk mensiasatinya, pria paruh baya ini terpaksa memperkecil ukuran tahu buatannya. “Harga penjualan tahu tetap Rp200 per potong,nggakmungkindinaikkan lagi karena pedagang lain nggak naikkan harga,” katanya. Pengusaha tahu lainnya Tuminah warga Lingk. Simaninggir mengatakan, sebelum kenaikan harga kedelai, dalam sehari dia meraup untung Rp200 ribu - Rp250 ribu. Namun kini keuntungan penjualan tahu hanya Rp100 ribu per hari,” katanya. Agar tetap mendapat untung Tuminah memilih menggoreng sendiritahubuatannya.Tahuyang

sudah digoreng tersebut dijual kepadapedagangmakanankagetan yang marak di bulan Ramadhan. “Selebihnya, tahu yang sudah digoreng itu saya jual keliling. Lumayanlah, untungnya masihdapatmenutupikebutuhan keluarga,” katanya. Kepala Dinas Perindustrian, Perdagangan,Koperasi,danUKM (Disperindagkop-UKM),Ahamad Fuadmengatakan,belumtahuapa yangmenyebabkantingginyaharga kedelai tersebut. Namun kata dia, kenaikantersebutbelumberdampaksignifikanterhadapusahatahu dantempe.“Meskiharganaiktapi kita belum mendapat informasi adanya UKM kita yang menutup usahanya,” katanya.(c18)

OK Arya Bantu Pengobatan Penderita Tumor TGTIRAM (Waspada):Tokoh pemuda Kab. Batubara, Muhammad Nur Azmi alias Imek menyampaikan terima kasih kepada Bupati H. OK Arya Zulkarnain, SH, MM atas perhatiannya membawa Kasima, 62, keluarga tidak mampu penduduk Dusun IV, Desa Mandarsyah, Kec. Medang Deras dirujuk ke RSU H. Adam Malik Medan, karena menderita penyakit tumor (mengalami pembesaran perut). ‘’Sampai sekarang nenek Kasima masih dalam perawatan medis akibat tumor,’’ kata Imek kepada Waspada di Tanjungtiram, Sabtu (28/7). Penyakit tersebut dideritanya hampir setahun. Awalnya mengalami pembengkakan kecil sehingga kini semakin membesar terlihat seperti wanita hamil. Dia juga telah dibawa berobat secara medis di tingkat desa maupun paranormal atau dukun kampung, namun tidak sembuh.

Bupati H. OK Arya Zulkarnain, SH, MM yang mendengar hal itu, menurunkan tim ke la-

pangan. Kemudian merujuknyakeRSUHAdamMalikMedan. (a13)

Waspada/Iwan Has

KASIMA, penduduk Dusun IV, Desa Mandarsyah, Kec. Medang Deras penderita tumor dirujuk ke RS Adam Malik.


Sumatera Utara Pemkab Simalungun Terancam Bangkrut WASPADA Senin 30 Juli 2012

SIMALUNGUN (Waspada): Pemerintah Kab. Simalungun diminta menerapkan pola efisiensi dan rasionalisasi Anggaran Pendapatan dan Belanja Daerah (APBD) demi perimbangan anggaran belanja pegawai dengan belanja pembangunan. Hal ini dilakukan demi menghindarkan kebangkrutan akibat beban APBD yang semakin berat. Harapan itu dikemukakan anggota DPRD Simalungun Bernhard Damanik, kepada Waspada, Minggu (29/7), menanggapi revisi Perda Kab. Sima-

lungunNomor17Tahun2008tentang Struktur Organisasi danTata Satuan Kerja Perangkat Daerah. Dikatakan, saat ini Pemkab Simalungun mengajukan tiga

Ranperda kepada DPRD Simalungununtukdibahas danselanjutnyauntukdapatditetapkan menjadi Perda. Ketiga Ranperda tersebut adalah Revisi Perda Nomor 7 Tahun 2011 tentang Pajak Daerah dan Retribusi Daerah, Revisi Perda Nomor 17 Tahun 2008 tentang Struktur Organisasi danTata Kerja Satuan Perangkat Daerah dan Ranperda tentang RT/RW Kab. Simalungun 2012-2031. Khusus menyangkut revisi Ranperda Nomor 17 Tahun 2008tentang Struktur Organisasi dan Tata Kerja Satuan Perangkat Daerah, bahwa Dinas Pasar, Kebersihan dan Pertamanan akan dihapuskan atau dilebur. Tetapi, Pemkab dalam usulannya memunculkansatudinasbaru,yakni Dinas Pertambangan dan Energi. Selain itu, Pemkab Simalungun juga mengusulkan Peningkatan Status Kantor Perizinan Terpadu(eselonIIIa)menjadi Badan Perizinan Terpadu dan

Penanaman Modal (eselon IIb). Kemudian Kepala Satpol PP (eselon IIIa) menjadi Eselon IIb. “Setelah membaca usulan Ranperda ini sangat jelas terlihat akanadanyapenambahanbeban APBD bila Ranperda ini disahkan menjadi Perda,” kata Damanik. Lebihlanjutdikatakan,kondisi saat ini proporsi APBD/ Perbandingan antara Belanja Langsung dengan Belanja Tidak Langsung dalam Buku APBD bahwa Pemerintah Simalungun Untuk membiayai Belanja Pegawai saja sudah melebihi 70 %, ini menunjukkan bahwa begitu beratnya beban APBD untuk pegawai sehingga perbaikan infrastruktur sangat minim hanya sekira 30 persen. Dalam Perda Nomor 17 tahun2008bahwayangmemduduki eselon IIb terdiri dari 37 orang dan eselon III sebanyak 177 orang daneselonIVsebanyak792orang. Akan tetapi dengan Ranperda

yangdiajukanini,makayangakan menduduki eselon IIb adalah 39 orang dan eselon III dan IV akan bertambah juga dengan peningkatan status kedua lembaga dimaksud. Menurutnya, Pemkab Simalungun haruslah melakukan perampingan birokrasi dimana ada beberapa SKPD yang mungkin dapat digabungkan menjadi satu SKPD antara lain Dinas Pertanian digabung dengan Dinas Perkebunan, karena tupoksi dari SKPD tersebut hampir sama yaitu mengurusi sarana dan prasarana pertanian. Kemudian Dinas Tenaga Kerja digabungkan dengan Dinas Sosial, Dinas Pemuda dan Olah Raga digabungkan dengan Dinas Pendidikan atau Parawisata. Sedangkan Dinas TarukimTamben tetap dipertahankan karena pertambangan yang ada di SimalungunhanyaGalianCdanPembangkit Listrik tenaga hidro. (a29)

Dugaan Korupsi DPRD Tapsel Dilapor Ke Polisi Waspada/Alam Tanjung

WALI KOTA Sibolga HM Syarfi Hutauruk didampingi Kapolres Sibolga Kota AKBP Joas Feriko Panjaitan dan Dandim 0211/TT Letkol Godman Siagian, saat melakukan kunjungan di gudang bulog Sibolga.

Aman, Ketersediaan Beras SIBOLGA (Waspada): Kepala Kantor Seksi Logistik (Kansilog) Sibolga Maju Barasa memastikan bahwa stok beras yang ada di gudang Bulog Sibolga hingga saat ini mencapai 1.654 ton. Artinya, stok beras tersebut merupakan jaminan ketersediaan beras di Kota Sibolga dan Kabupaten Tapanuli Tengah (Tapteng) aman hingga empat bulan kedepan. Pernyataan Kansilog Maju Barasa tersebut dikemukakannya kepada Wali Kota Sibolga HM Syarfi Hutauruk saat melakukan peninjauan langsung ke gudang Bulog Sibolga belum lama ini serangkaian sidak di sejumlah pasar tradisional bersamaWakilWalikota Marudut Situmorang, Ketua DPRD Sahlul Umur Situmeang dan unsur Muspida Plus Sibolga di antaranya, Deputi Direktur Bank Indonesia Sibolga, Muhamad Nur, Kapolres Sibolga Kota AKBP Joas Feriko Panjaitan dan lainnya. “Dalam waktu dekat, pasokan beras kita akan masuk lagi 500 ton, sehingga stok beras di kedua daerah (Sibolga-Tapteng-red) benar-benar aman, baik di bulan puasa Ramadhan dan Hari Raya Idul Fitri 1433 H, bahkan hingga empat bulan mendatang,” tutur Maju Barasa didampingi kepala gudang Adlen Lubis. Wali Kota Sibolga, HM Syarfi Hutauruk kepada wartawan mengatakan, ketersediaan beras di gudang Bulog Sibolga tersebut, diharapkan tidak akan terjadi lonjakan kenaikan harga beras di pasaran terutama menjelang Hari Raya Idul Fitri 1433 H. “Untukmenjagakestabilanhargaberas,dalamwaktudekat,Pemko Sibolgabekerjasamadenganbulogakanmenggelaroperasipasarberas, sehingga masyarakat merasa nyaman melaksanakan ibadah puasanya tanpa dihantui kenaikan harga beras,” sebut Wali kota. Syarfi juga mengatakan, selain beras, kebutuhan sembako lainnya termasuk bumbu-bumbuan serta barang kebutuhan yang paling dominan dikonsumsi warga menjelang hari raya juga akan terus dipantau secara rutin oleh Pemko Sibolga melalui Dinas Perindagkop dan UKM dengan menerjunkan petugasnya ke sejumlah pasar tradisional di Kota Sibolga sekaligus melakukan pendataan dan pemantauan harga. (a24)

4.631 Ha Kebun Kopi Karo KABANJAHE(Waspada): Pemerintah Kabupaten Karo melalui Dinas Pertanian dan Perdagangan sentuh sistem budidaya dan pasar (market) kopi, agar kuantitas, kualitasnya dan rutinitas mampu mendongkrak ekonomi kerakyatan khusunya petani kopi. Kabupaten Karo dengan sederet ikon pertanian, salah satunya adalah kopi. Sesuai data 2011 dari Dinas Pertanian dan Perkebunan Karo, luas perkebunan kopi di 17 kecamatan sekira 5.516 hektar, tanaman menghasilkan 4.631 hektar. Tetapi tanaman yang belum menghasilkan 619 hektar, sedangkan yang sama sekali tidak menghasilkan 194 hektar. Sementara hasil produksi budidaya si buah merah ini setiap hektar per tahun mampu mencapai 1.046.278,28 kg. Sedangkan jumlah produksi untuk keseluruhan sekira 4.845.315 ton/tahun. Ranking pertama terluas pertanian kopi ada 17 kecamatan peringkat satu terdapat di Kec Merek dengan luas 1.247 hektar, urutan ke dua Kec. Juhar sebanyak 486 hektar, peringkat ke tiga Kecamatan Munte dengan luas 414 hektar serta urutan terakhir Kecamatan Berastagi sebanyak 119 hektar. Dengan setuhan dimaksud, petani akan disubsidi benih standar yang berlebel, bukan menerapkan sistem benih sapuan yang tidak jelas indukan dan kesehatanya serta transfer teknologi tentang perawatan (pemupukan sesuai kebutuhan) dan pengendalian organisme pengganggu tanaman (penggerek buah). Hal ini disampaikan Bupati Karo Kena Ukur Karo Jambi Surbakti melalui Kadis Pertanian dan Perkebunan, AgustoniTarigan, SP didampingi Kabid Produksi Munarta Ginting, SP kepada Waspada, Jumat (27/7) di Kabanjahe. (c10)

Khitan 17 Anak Yatim SIBOLGA (Waspada): Keluarga besar H. Sulhan Sitompul,MAP/ Hj. Cut Irniani khitan 17 orang anak yatim dan anak-anak dari kalangan fakir miskin di kediamannya Jalan R. Suprapto no 58 Sibolga, Jumat (27/7). Selain itu juga diberikan santunan berupa uang dan kain sarung kepada orangtua anaknya yang ikut di khitan. H. Sulhan Sitompul, yang juga staf ahliWali Kota Sibolga membidangi Pemeritahan, Hukum dan HAM ini mengatakan, awalnya dia dan istrinya ingin menghitankan anak bungsu mereka Ahmad Fazri Ihsan Sitompul yang akan bersekolah di pesantren Medan, namun alhamdulillah ada rezeki dan bermusyawarah keluarga untuk mengundang anak-anak yatim dan anak fakir miskin untuk dikhitankan. “Bagi anak-anak yatim walaupun tidak punya orangtua dalam menjalani kehidupan ini jangan minder, dan teruslah rajin dan giat belajar agar kelak berhasil menggapai cita-cita diinginkan”, tegas Sulhan juga mantan Kadis Kependudukan dan Catatan Sipil Pemko Sibolga ini. Ditegaskan,berdosalahkitaselakuumatmuslimpunyakehidupan berkecukukupan, namun tidak memperhatikan saudara-saudara kita anak-anak yatim dan fakir miskin, padahal sebagian rezeki yang kita peroleh di dalamnya terdapat hak orang lain. (a24)

Sederhana, HUT Ke-9 Nisel TELUKDALAM (Waspada): Masyarakat sangat bersyukur kepada TuhanYang Maha Esa karena ternyata Kabupaten Nias Selatan (Nisel) telah berusia sembilan tahun pada 28 Juli 2012. Peringatan HUT ke-9 Kabupaten Nias Selatan dilaksanakan secara sederhana dan penuh hikmat di Lapangan Orurusa Telukdalam. Tampak hadir Wakil Bupati Hukuasa Ndruru, SP.d, Sekda Drs. Asa Aro Laia, Ketua DPRD Efendi, Kapolres Nias Selatan AKBP Pol. Juliat Permali, Sik. SH. Kasdim Mayor Inf. Delvin Sinaga. Dalam sambutannya, Bupati Nias Selatan Idealisman Dakhi mengatakan, di Kabupaten Nias Selatan sudah banyak kemajuan yang dilaksanakan, seperti halnya uang kulian mahasiswa/i gratis, uang kesehatan gratis, dan infarstruktur. Diminta kepada semua SKPD untuk terlibat secara teknis, agar semua program tersebut dapat terlaksana dengan baik. “Hal itu sudah merupakan komitmen kami dalam meningkatkan kesejahteraan masyarakat Nias Selatan,” ujar Bupati Nias Selatan Idealisman Dakhi kepada Waspada. (ldl)

P. SIDIMPUAN (Waspada): Lembaga Informasi Rakyat (LiRA) melaporkan dugaan korupsi anggaran perjalanan dinas anggota DPRD Kab.Tapanuli Selatan ke polisi. Pasalnya, LSM ini punya bukti tentang seorang anggota dewan yang sudah menerima surat perintah tugas berikut anggaran mengikuti workshop dan bimtek, namun tidak berangkat. “Kita sudah laporkan ke Kapolres Tapsel, dengan bukti awal perjalanan dinas 15 anggota dewan mengikuti workshop dan bimtek sosialiasi UU Pemilu dan UU Partai Politik selama lima hari (14-18/5) di Jakarta. Menurut data kita, setiap orang menerima Rp14 juta,” kata Gubernur LiRA, EdiAryantoHasibuan,didampingi Bupati LiRA, Mara Halim Harahap, Kamis (26/7) sore. Dalam surat laporan LiRA

No: 010/VII/LI-RA/2012 kepada Kapolres Tapsel, AKBP Subandriya, disebutkan bahwa telah terjadi dugaan korupsi dana workshop dan bimbingan teknis (bimtek) pada Sekretariat DPRD Kab. Tapsel tahun anggaran 2012. Sebagai bukti awal, LiRA melampirkan SPT No: 090/709/ 2012 yang ditandatangani Wakil Ketua DPRDTapsel, Abdurrasyid Lubis pada 14 Mei 2012. Dimana dalam SPT itu diperintahkan 15 anggota DPRD Tapsel agar berangkat ke Jakarta mengikuti workshop dan bimtek sosialisasi UU Pemilu dan UU Partai Politik selama lima hari (14-18/5). 15 Anggota dewan itu, H. Abdurrasyid Lubis SH, Borkat S.Sos, H. Mahmud Lubis SAg, Drs. H Fajaruddin Tanjung, Haris Yani Tambunan, Baginda Pulungan, Sawal Pane SE, H. Khoiruddin

Siagian Lc, Ali Imran Hasibuan, H. Robi Agusman Harahap. H. A Rusdy R Harahap SE.MM, HarmeniBatubaraSH,RachmadSaleh Harahap AMD, Husin Sogot Simatupang,danLailatulJam-jam. Namun menurut informasi dan fakta yang ditemukan LiRA di lapangan, ternyata banyak diantara15anggotaDPRDTapselitu yang tidak pergi mengikuti workshop dan bimtek, tetapi tetap saja mengambil uang perjalanan dinasnya dari Sekretariat DPRD. “SalahsatunyaadalahAL.Pada saatseharusnyadiamenja-lankan tugas negara di Jakarta, justru saya melihat dia di pesta pernikahan. SayapunyabuktivideobahwaWakil KetuaDPRDTapselyangmeneken SPT No: 090/709/2012 itu justru tidak pergi mengikuti workshop dan bimtek tersebut,” kata Mara Halim Harahap. (a27)

PAN Buka Pendaftaran Dini Balon Anggota DPRD P. Siantar PEMATANGSIANTAR (Waspada): DPD Partai Amanat Nasional (PAN) Kota Pematangsiantar membuka pendaftaran dini bagi para kader dan para tokoh masyarakat sebagai bakal calon (balon) anggota DPRD. “Pendaftaran dini balon anggota DPRD itu berdasarkan instruksi melalui surat DPP PAN nomor PAN/A/KU-SJ/144/VII/ 2012 bertanggal17Juli2012ditandatanganiKetuaUmumM.Hatta Rajasa dan Sekjen Taufik Kurniawan tentang laporan balon anggota DPRD provinsi/kabupaten/ kota kepada seluruh DPW dan DPD PAN se-Indonesia,” sebut Ketua DPD PAN Pematangsiantar Zainal Purba melalui Sekretaris M.Yusuf Siregar, SH.I selaku Ketua Panitia Pendaftaran Balon Anggota DPRD didampingi salah seorang Wakil Ketua H. Aulul Imran, S.Pd.I di sekretariat DPD PAN itu, Jalan Kartini, Jumat (27/7) sore. Menurut Siregar, beradasarkan surat DPP PAN itu, DPD PAN Pematangsiantar menyikapinya dengan membentuk Panitia Pendaftaran, dimana M. Yusuf Siregar selaku ketua dan Sekretaris Nur-priadi Pendaftaran bagi para balon anggota DPRD itu dibuka 26-30 Juli 2012, sebut Siregar dan bagi para balon anggota DPRD dapat mengambilformulirdisekretariat

DPD PAN dan sesudah mengisinya, formulir harus dikembalikan ke sekretariat DPD PAN selambat-lambatnya 30 Juli 2012. Menjawab pertanyaan, Siregar menyebutkan tidak ada kriteria khusus dari PAN bagi para balon anggota DPRD yang mendaftar dan hanya disesuaikan dengan ketentuan perundang-undangan yang berlaku. Sedang waktu yang terlalu singkat mendaftar sebagai balon anggota DPRD itu, menurut Siregar hal

itu sesuai ketentuan DPP PAN. Mengenai cepatnya pendaftaran balon anggota DPRD itu, karena Pemilu legislatif akan dilaksanakan tahun 2014, Aulul Imranmenyebutkanhalitusesuai Undang-Undang nomor 8 tahun 2012 tentang Pemilu DPR, DPD, DPRD provinsi, kabupaten dan kota, dimana 12 bulan sebelum hari H pemungutan suara, Parpol peserta Pemilu sudah harus menyampaikan daftar balon ke KPU. (a30)

Menkes Diminta Cairkan Anggaran Alat Cuci Darah Untuk Pemko Sibolga SIBOLGA (Waspada): Anggota Komisi IX DPR RI H.Iskan Qolba Lubis,Lc,MA membidangi kesehatan dan tenaga kerja meminta meminta Menkes RI segera mencairkan anggaran alat cuci darah dan ronsen untuk Pemko Sibolga yang sudah disetujui di APBNP. Apalagi, orang yang datang berobat ke RSUD Kota Sibolga sudah banyak yang membutuhkan alat tersebut. Hal itu sangat wajar didukung demi kenyamanan pasien agar tidak lagi jauh-jauh berobat ke Kota Medan. Demikian H.Iskan Qolba anggota FPKS dapil II Sumut saat reses di Sibolga Tapteng, saat menjawab Waspada di Pandan Carita Tapteng, baru-baru ini. Selaku yang membidangi hal itu dia mengaku heran dan terkejut saat menerima berbagai masukan dari masyarakat bahwa Pemko Sibolga sudah mengusulkan alat pencucian darah dan ronsen, namun anehnya Menkes tidak menyalurkannya melainkan memberikan alat lain yang tidak dibutuhkan dan saya nanti akan panggil Menkes mempertanyakan persoalan ini, kata Iskan. Menurut Iskan, pihaknya mendapat informasi dari masyarakat bahwa usulan ini dipersulit oleh Menkes, kalau Dinas Kesehatan Sumut tidak dapat mengatasi ini, maka pihaknya akan segera memanggil Menkes dimana alat itu sangat urgen. (a24)

Jalinsum P. Sidimpuan-Batangtoru Sangat Memprihatinkan TAPSEL (Waspada): Kondisi ruas jalan lintas Sumatera (Jalinsum) antara Kota Padangsidimpuan-Batangtoru (batas Tapanuli Tengah) terlihat sangat memprihatinkan. Amatan Waspada, Minggu (29/7), tepatnya di DesaTano Ponggol, Kec. Angkola Barat, Kab. Tapanuli Selatan (Tapsel) menuju Kab. Tapteng kondisi permukaan jalinsum didapati lubang jalan menganga puluhan meter dengan bentuk memanjang yang sudah menahun. Kondisi demikian sangat dikeluhkan warga yang sering melintas dengan mengenderai sepedamotor di ruas jalan tersebut dan angkutan umum lainnya sering mengalami rusak pada bagian kolongnya. ‘’Kondisi jalan berlubanglubang di sepanjang jalan ini sudah menahun, kami sering jatuh ketika sedang melintas. Ironisnya di Desa Simatorkis ini kami lihat ada proyek jalan miliaran, namun permukaan jalan tidak dikeruk dan langsung ditimbun dan dihotmix yang dikerjakan PT Muslim,’’ ujar Marasobar Siregar warga Desa Simatorkis. Kepala Balai Jalan Nasional (BJN)wilayahTkISumateraUtara (Sumut), Bambang Pardede berulang kali dikonfirmasi tidak menggubris melalui nomor telepon yang diberikannya kepada Waspada saat turun keTapsel bersamaanggotaDPDParlindungan

Purba beberapa bulan lalu. Sumber menyebutkan, proyek jalinsum di Desa Simatorkis pekerjaan jalan sudah habis kontrak, namun pengawas konsultan dan pengawas dari BJN cenderung‘tutup mata’. Kordinator Ormas Gerakan Indonesia Bersatu (GIB)Tabagsel Drs AliuddinHarahapmengharapkanKejaksaanTinggiSumateraUtara(Keja-

tisu)memanggilpihakterkaitkondisi proyekyangdidugadikerjakanasal jadi di Jalinsum Tapsel. ‘’Kita yakin Kejatisu akan memanggil pihak-pihak terkait, menyangkut maraknya proyek Jalinsum di Tapsel yang diduga kuathabiskontrakdandikerjakan tidak sesuai spesifikasi teknis.,” tutur Aliuddin, aktivis anti korupsi di Tabagsel. (c13)

B3

Waspada/Bothaniman Jaya Telaumbanua

SETDA Kota Gunungsitoli sekaligus Ketua Yayasan Perguruan BNKP Gunungsitoli meletakkan batu pertama pembangunan kembali gedung SMA BNKP Gunungsitoli berbiaya Rp7 miliar.

Rp7 M Bangun SMA BNKP GUNUNGSITOLI ( Waspada): Untuk membangun kembali gedung sekolah SMA Swasta BNKP Gunungsitoli yang terbakar 8 April 2012,pihakyayasanmemerlukanbiayaRp7miliar. Sedangkan dana yang berhasil dihimpun hingga saat ini yang berasal dari bantuan pemerintah daerah dan donator, baru mencapai Rp 400 juta. Pernyataan ini disampaikan Sekda Kota GunungsitoliDrs.FirmanHarefa,S.Pd,M.Sisekaligus selaku KetuaYayasan Perguruan BNKP Gunungsitoli saat menyampaikan laporannya pada acara peletakan batu pertama pembangunan kembali gedung SMA Swasta BNKP Gunungsitoli, Sabtu (28/7). FirmanHarefamenyebutkan,untukmeningkatkan pendidikan di SMA Swasta BNKP, selain membangun gedung sekolah yang direncanakan berlantai dua, pihak yayasan juga akan meningkatkan SDM tenaga pengajar serta melengkapi berbagai fasilitas pendukung sebagai salah satu upaya dalam menghadapi dinamika terhadap lonjakan minat pelajar terhadap Sekolah Menengah Kejuruan (SMK). “Konsep awal yang akan dilakukan dalam waktu dekat adalah melakukan pendataan ulang serta menjadikan SMA Swasta BNKP Gunungsitoli menjadi SMA yang proses

belajar mengajarnya menggunakan dua bahasa (Bi Lingual),” jelas Firman. Pada kesempatan itu, Firman Harefa menjelaskan pada peristiwa kebakaran yang yang terjadi 8 April 2012, 9 ruang kelas, 1 ruang guru, 1 ruang tata usaha dan 1 ruang perpustakaan seluruhnya hangus terbakar sehingga untuk membangun kembali sekolah tersebut, yayasan memerlukan biaya Rp7 milliar. Sedangkan biaya yang telah terkumpul dari sumbangan donatur dan alumni SMA BNKP Gunungsitoli, menurutnya, hanya Rp400 juta termasukbantuandariPemkoGunungsitoliRp200 juta. Pada acara peletakkan batu pertama pembangunan gedung SMA‘Swasta BNKP Gunungsitoli turut dihadiri Ephorus BNKP, Pdt. TuhoniTelaumbanua serta sejumlah pimpinan SKPD Pemkab Nias dan Pemko Gunungsitoli. Data berhasil dihimpun, sejumlah alumni dari SMA Swasta BNKP Gunungsitoli yang berdiri pada 1955 itu telah berhasil di berbagai bidang profesi di antaranya mantan pejabat di Kemenkeu, Hekinus Manao, mantan Bupati Nias Selatan Fahuwusa Laia, SH, MH, mantan Sekdakab Nias dan Kadis Sosial Pemprovsu Drs. Silvester Lase serta beberapa pejabat dan pengusaha lainnya. (a25)

Walk Out Saat Reses

Warga Karo Kecam Oknum DPRD SU KABANJAHE( Waspada): Dua oknum anggota DPRD Sumut dari daerah pemilihan X (Kabupaten Karo, Dairi dan Pakpak Barat) yakni Dermawan Sembiring, SE dan Ir Taufan Agung Ginting, MSP yang melakukan walk out saat melaksanakan reses di Kantor Bupati Karo beberapa hari lalu mendapat kecaman dari berbagai elemen masyarakat di daerah itu. “Tindakansepertiitudisaatmelaksanakanreses keDapem-nyatidakpatutdiperlihatkanwakilrakyat yangterhormat. Walkoutdisaatpertemuandengan beberapapejabatdiKantorBupatikontraproduktif dan tidak elegan,” tegas Mantan Ketua Komisi A DPRDKaroperiode1999-2004,JohnAndreasPurba kepadawartawandikantorStafAhliKantorBupati Karo, Jumat (27/7). Dikatakannya, agenda reses menjumpai konstituen ke daerah pemilihan, semestinya produktif sebagai kinerja yang baik di tengah berbagai kritikan terhadap kualitas wakil rakyat, serta berdampak positif dan konstruktif terhadap pemerintahan dan pembangunan di Kabupaten Karo. Bukan malah mempertontonkan sikap cengeng dan kekanak-kanakan. Demikian juga disaat reses “menjaring aspirasi” rakyat, tidak seharusnyaanggotaDPRDSUcenderungmenonjolkan kepentingan partainya. Sebaliknya, sambung John Andreas Purba yang juga Ketua Forum Kader Perjuangan Kabupaten Karo (FKPK) Tanah Karo periode 20112014 itu, Drs Layari Sinukaban tidak pantas terlalu mengagung-agungkan atau membela secara berlebihan Bupati Karo Kena Ukur Karo Jambi Surbakti.“Anggota DPRD SU dari dapem ini tidak perlu terlalu memuji-muji Kepala Daerah secara vulgar dan tidak argumentatif,” tegasnya. Begitu juga kedua anggota DPRD SU, yakni Taufan Agung Ginting dan Dermawan Sembiring tidak selayaknya terpancing emosional dan

demonstratifdenganmelakukanwalkoutdariruang rapat/pertemuan di Kantor Bupati Karo merespon sikaprekankerjanyaDrsLayariSinukaban.Pertemuan itu walaupun resmi tapi sifatnya silaturahmi dan saling memberi masukan, bukan sidang paripurna di gedung DPRD, ujar John Andreas Purba. Lebih jauh dikatakannya, secara kausalitas (sebab akibat/aksi dan reaksi) dari kedua anggota DPRD SU (Dermawan Sembiring dan Taufan Agung Ginting) akhirnya terjebak dalam sikap “sama-sama kontraproduktif” dalam agenda kunjungankerjanyakeKabupatenKaroyangresmi dan dibiayai oleh uang rakyat. Kasus walk out yang dilakukan kedua nggota dewan itu telah menjadi bahanpergunjinganmasyarakat.SedangkanBupati KaroKenaUkurKaroJambiSurbakti“kenagetahnya” dari kasus yang memalukan tersebut. Secara terpisah, pengamat sosial politik dari Universitas Quality Berastagi, MJP Sagala, SH, MS, mengungkapkan, kedua anggota DPRD SU mengambil sikap walk out di saat pertemuan di kantor bupati sangat tidak mendidik dan tidak memberikanpencerahanyangbaikbagimasyarakat. Tindakansepertiituterkesantidakdewasadalam berargumen. Seharusnya pertemuan seperti itu bisa membuka wacana-wacana baru di tengah sorotanberbagaiisufaktualdiTanahKaro.Apayang bisa diperbuat anggota DPRD SU yang berasal dari Dapem X untuk pembangunan Tanah Karo, Dairi maupun Pakpak Barat. Demikian juga sebaliknya, Bupati Karo bisa menyampaikan keluhan atau minimnyaanggaranAPBDSUkeKabupatenKaro. “Kita jangan menutup mata, dibandingkan dengan daerah lain di Sumatera Utara anggaran APBDSUkeTanahKarosangatminim,nahseharusnya itu yang diperdebatkan secara argumentatif,” ujarnyasembarimemujisikapRichardEddyLingga yang tidak terpengaruh “ajakan” teman kerjanya untuk walk out dari pertemuan. (c10)

“Tender Dinas PU Madina Sesuai Aturan” PANYABUNGAN (Waspada): Proses tahapan dan pengumuman tender di Dinas Pekerjaan Umum (PU) Kabupaten Mandailing Natal (Madina) Ta 2012, Nomor: 09/PAN-PI/2012, tanggal 26 Jui 2012, sudah sesuai auturan berdasarkan Perpres No 54 Tahun 2010. Kalaupun ada yang merasa janggal atau kurang puas, kalangan kontraktor silakan menggunakan hak sanggah dan hak banding yang jelas di atur dalam undang-undang. DemikiandisampaikanDewanPertimbangan DPC Gapeksindo Madina, Abdul Muis Pulungan, kepada Waspada, Jumat (27/7) di Panyabungan. Menurutnya, langkah sebahagian oknum jasakonstruksi yang mendatangi bupati di rumah dinas baru – baru ini, itu salah alamat. Karena yang bertanggung jawab terkait proses tender adalah Kuasa Pengguna Anggaran (KPA) dan Ketua Panitia Lelang. Untuk itu diharapakan pihak-pihak terkait supaya bisa menahan diri dan jangan terpancing dengan hal-hal yang kurang jelas. Sementara itu Ketua MPC PP Madina, Syahriwan alias Kocu dijumpai di kantornya mengajak semua pihak supaya mengormati pengumuman tender yang sudah sesuai mekanisme.

“ Saya juga mantan kontraktor dan ketua asosiasi, jadi saya paham betul dalam setiap tender, pihak panitia tidak akan mungkin bisa memberikan rasa puas terhadap semua kontraktor. Karena itu kalangan jasa konstruksi harus paham dan kalah menang dalam tender itu sudah resiko dan hal biasa,” ucap Kocu. Ia berharap masalah kecil yang timbul dalam proses tender dihilangkan, dan masalah besar jika ada diperkecil. Intinya, kalaupun ada masalah selalu ada pintu solusi jika dihadapi dengan tenang dan dewasa. Direktur CV.Dabuar Mura Sakti, H.Hasman Nasution alias UN yang dikonfirmasi di kediamannya mengatakan, proses tender sudah sesuai aturan. Ia berharap masyarakat jasa konstruksi tidak larut dalam persoalan tender yang sudah sahdiumumkanpanitia. Iamengajaksemuapihak supaya sama-sama membangun iklim usaha yang kondusip dalam partisipasi jasa kontruksi sebagai mitra pemerintah dalam konteks pembangunan. “Biasalah kalau dalam tender selalu ada riakriak. Karena itulah seorang kontraktor dituntut berjiwa ksatria dan profesional mengingat kesempatan demi kesempatan untuk masyarakat jasakonstruksi tiap tahun selalu ada,” ucap UN. (c14)

Kemenhut Tawarkan 23.000 Ha, Pemkab Madina Minta 50.000 Ha

Waspada/Ahmad Cerem Meha

RUAS Jalinsum masih kupak-kapik tepatnya di Desa Tano Ponggol, Kec. Angkola Barat, Kab. Tapsel.

PANYABUNGAN (Waspada): Bupati Madina Hidayat Batubara persoalan hutan lindung sudah sering dikeluhankan masyarakat sejak lama. Karena itu, solusinya adalah pengajuan revisi. “Sebenarnya, Kementerian Kehutanan (Kemenhut) sudah menawarkan revisi 23 ribu hektar untuk Madina, namun jumlah itu sangat jauh dari yang dibutuhkan. Setelah disurvei, Madina membutuhkan 50 ribu hektar ,” ucap Hidayat Batubara kepada wartawan di ruang kerjanya, kemarin. Pemkab Madina mengajukan revisi kawasan hutan seluas 50 ribu hektar untuk pemukiman dan perkebunan masyarakat. Untuk itu Bupati MandailingNatal(Madina),HMHidayatBatubara bersama Kepala Dinas Kehutanan dan Perkebu-

nan mengadakan pertemuan dengan Badan Planologi Kehutanan di kementerian kehutanan RI. Pertemuan dalam waktu dekat itu membahas kawasan hutan lindung yang sudah meliputi wilayah pemukiman masyarakat di Kabupaten Madina, baik itu pemukiman dan juga wilayah kebun yang diusahai masyarakat sejak ratusan tahun silam. Dijelaskan,jikapemerintahpusatmengabulkan permohonan revisi dan melepaskan seluas 50 ribuhektarkawasanhutanuntukarealperkebunan warga dan pemukiman penduduk, maka kawasan lainnya akan menjadi peluang strategis bagi investasi investor untuk menambah PAD daerah, yangdipergunakanuntukpembangunankesejahteraan masyarakat. (c14/a28)


Nusantara

B4

WASPADA Senin 30 Juli 2012

ICMI Pertanyakan Sikap Suu Kyi Soal Rohingya JAKARTA (Antara): Ketua Presidium Ikatan Cendekiawan Muslim se-Indonesia (ICMI) Prof. Nanat Fatah Natsir mempertanyakan sikap Aung San Suu Kyi yang tidak bersuara terhadap kejadian pembantaian Muslim Rohingya di Myanmar. “Dia peraih nobel perdamaian dan sempat mengalami sendiri intimidasi dan penindasan yang dilakukan junta militer. Mengapa sekarang diam saja?” kata Nanat Fatah Natsir saat dihubungi di Jakarta, Sabtu (28/7). Dia menduga sikap diam Suu Kyi terhadap kejadian itu karena adanya agenda politik pemimpin oposisi Myanmar itu yang ingin mencalonkan diri sebagai presiden. Menurut dia, Suu Kyi takut tidak terpilih sebagai presiden bila membela suku Rohingya. Mantan rektor UIN Sunan Gunungjati, Bandung itu mengecam sikap junta militer yang mengusir suku Rohingya dari Myanmar supaya pindah kewarganegaraan ke negara lain. Menurut dia, hal itu bertentangan dengan Piagam PBB dan ASEAN. “Pengusiran dan pembantaian itu melanggar hak hidup suku Rohingya dan hak asasi manusia untuk beragama,” ujarnya. Karena itu, Nanat Fatah Natsir mendesak Organisasi Kerja Sama Islam (OKI) untuk segera mengambil sikap terhadap kejadian tersebut dengan mendesak Persatuan Bangsa-Bangsa (PBB) supaya menjatuhkan sanksi kepada Myanmar dan mengusut pembantaian tersebut. “Kalau tidak segera diselesaikan persoalan itu akan menjadi panjang. OKI harus bicara untuk membela Muslim Rohingya,” katanya. Pemerintah Myanmar menolak mengakui suku Rohingya, yang dikatakan “bukan warga negara asli” karena dikategorikan sebagai “pendatang gelap”. Suku Rohingya dikatakan keturunan Muslim Persia, Turki, Benggala dan Pathani, yang masuk ke Myanmar pada Abad VIII. PBB menyatakan diskriminasi yang berlangsung selama beberapa dasawarsa telah membuat suku Rohingya tidak memiliki negara. Pemerintah Myanmar membatasi gerak mereka serta tak memberi mereka hak atas tanah, pendidikan bahkan layanan masyarakat. Menurut laporan, hingga 28 Juni lalu 650 orang Muslim Rohingya meninggal selama bentrokan di wilayah Rakhine, Myanmar barat. Tak kurang dari 1.200 orang hilang dan 80.000 orang lagi kehilangan tempat tinggal.

Hibah Tanah Dari Aceh

Mengingatkan Jumhur Pada Pemberian Pesawat Seulawah

Antara

KETUA Action Team for Rohingya ACT dan sekaligus relawan Rohingya Andika Purbo Swasono (kanan) memberikan surat wasiat kepada istri Tri Mardianti (kiri) ketika pelepasan dan pemberangkatan relawan Rohingya di kantor Aksi Cepat Tanggap di Ciputat, Tangerang, Minggu (29/7). Aksi Cepat Tanggap (ACT) melepas relawan ACT Andika Purbo Swasono untuk membantu medis dan pangan kepada pengungsi muslim Rohingya di Myanmar.

PBNU Desak Presiden SBY Ambil Inisiatif Bantu Rohingya JAKARTA (Waspada): Pengurus Besar Nahdlatul Ulama (PBNU) mendesak Presiden Susilo Bambang Yudhoyono (SBY) mengambil inisiatif untuk menolong dan membantu etnis Rohingya yang makin memprihatinkan dari bahaya pembersihan etnis.

Antara

SOSIALISASI UJI KOMPETENSI GURU: Ratusan guru mengikuti sosialisasi uji kompetensi guru di aula SMAKBO, jalan Binamarga, Kota Bogor, Jabar, Minggu (29/7). Kementerian Pendidikan dan Kebudayaan Nasional akan melaksanakan Uji Kompetensi Guru secara on-line pada 30 Juli hingga 12 Agustus 2012 yang akan diikuti 1.006.211 guru bersertifikat pendidik se-Indonesia dengan maksud untuk pemetaan kompetensi, pengembangan keprofesian berkelanjutan dan sebagai titik awal penilaian kinerja guru.

Blok Migas Mahakam Berpotensi Rugikan Negara Rp1,98 T/Bulan FPDI Perjuangan Desak Pemerintah Ambilalih JAKARTA (Waspada): Fraksi PDI Perjuangan di DPR-RI mendesak pemerintah mengambilalih kontrak karya blok Migas Mahakam, sebab penerusan kontrak dengan pihak asing berpotensi merugikan negara mencapai Rp1,98 triliun perbulan. Untuk itu, pemerintah harus segera menerbitkan Peraturan Pemerintah yang mengatur mekanisme pengelolaan blok-blok migas yang masa kontraknya akan habis termasuk Blok Mahakam. “ Dalam PP itu nantinya, harus ditegaskan bahwa semua blok-blok itu kembali ke negara begitu kontraknya selesai. PP juga harus mengatur pemanfaatan kekayaan alam Indonesia itu dikembalikan ke negara, dan negara bisa menugaskan BUMN memegangnya,” ujar Sekretaris Fraksi PDI Perjuangan, Bambang Wuryanto pada konferensi pers di gedung DPR, Jakarta, Rabu (25/7). Ketua DPP Bidang Energi PDI Perjuangan ini menegaskan, desakan fraksi PDI Perjuangn ini harus dilaksanakan pemerintah sebagai perwujudan pasal 33 UUD 1945 yang mewajibkan bumi dan kekayaan alam dipelihara negara demi semaksimalnya kepentingan rakyat. Bambang Wuryanto mengaku merasa aneh dengan adanya sejumlah pejabat negara yang sudah menyatakan kontrak Blok Mahakam sebaiknya dilanjutkan perusahaan asing atas nama pengalaman pengelolaan. Sementara disisi lain, fakta menunjukkan Pertamina saja sudah memiliki kemampuan mengelola blok migas Prabumulih yang medannya lebih sulit. Bahkan Pertamina saja mampu mengeksplorasi sampai ke Venezuela. Banyak orang Indonesia yang diketahui sebagai pimpinan dan pelaksana pengeboran minyak dipakai di perusahaan minyak Qatar dan Amerika Serikat. “Ini penghinaan karena dianggap anak bangsa tak mampu. Masa setelah puluhan tahun dikatakan anak bangsa tak paham teknologi? Ini harus kembali ke negara,” tegas Bambang. Ketua Kelompok Fraksi PDI-P di Komisi VII DPR, Daryatmo Mardiyanto memaparkan bentuk kerugian negara apabila pemerintah tak mau mengambilalih Blok Mahakam yang selama ini dikontrakkan ke Total E & P Indonesia milik Prancis, dan Inpex Corporation Jepang. Kontrak karya blok itu dimulai pada 31 Maret 1967, atau sebulan setelah Soeharto dilantik sebagai Presiden RI pada 26 Februari 1967. Kontrak itu berdurasi 30 tahun hingga 31 Maret 1997, yang kemudian diperpanjang dan akan berakhir pada 31 Maret 2017. Saat ini, kata dia, Total dan Inpex sudah mengajukan perpanjangan kontrak selama 25 tahun hingga 2042. Dari kontrak yang ada sekarang, jatah kedua kontraktor itu adalah 40 persen produksi minyak dari produksi perhari 93.000 BOD atau 37.200 barel. Dari jumlah itu, dengan asumsi harga minyak perbarel adalah 100 dolar AS maka nilainya 3,72 juta dolar AS. Sedang dari gas di Blok Mahakam, jatah kedua kontraktor mencapai 30 persen dari produksi perhari 2200 MMSCFD atau 660 MMSCFD yang setara 660 ribu MMBTO. Jika diasumsikan harga per MMBTO adalah 5 dolar AS, maka nilai total pemasukan kedua kontraktor perhari adalah USD 3,30 juta dolar AS. Total pemasukan perhari kedua perusahaan dari Blok Mahakam adalah 7,02 juta dolar AS atau sekitar 210,6 juta dolar AS perbulan, atau setara Rp 1,98 triliun perbulan. Pendapatan itu, katanya, bisa bertambah karena, gas dari blok Mahakam dibawa ke Bontang untuk diproses menjadi gas elpiji yang laku seperti kacang goreng seharga 18 dolar AS yang dijual ke Jepang dan Korea Selatan. Apabila kontrak dihentikan pada saat habis masa berlaku pada 2017, jelas Daryatmo, maka uang itu akan mengalir ke kas negara dengan catatan pengerjaan diserahkan ke perusahaan negara. “Kontraktor hanya menjalankan karena semua peralatan itu milik negara. Dia hanya punya kemampuan knowledge. Sehari dia dapat 7 juta dolar AS kalau berlanjut. Ini lobi mereka luar biasa,” kata Daryatmo. (aya)

Pembakaran perkampungan dan pengusiran mereka yang terjadi di Provinsi Rokhine, Myanmar, merupakan aksi yang tidak bisa dibiarkan oleh dunia internasional. Demikian disampaikan Ketua PBNU H. Slamet Effendy Yusuf MSi, pada wartawan di Jakarta, Minggu (29/7) dalam merespon tragedi kemanusiaan etnis Rohingya. “Pembiaran pembantaian terhadap etnik Rohingya seperti selama ini kita saksikan harus dihentikan. Apalagi, apa yang terjadi sekarang ini merupakan

puncak perlakuan diskriminatif yang sudah lama berlangsung terhadap etnis Rohingya, yang beragama Islam,” katanya mengingatkan. Karena itu, menurut Ketua MUI Pusat ini. Indonesia sebagai negara yang dituakan di negara ASEAN, maupun negara muslim terbesar di dunia seharusnya mengambil inisiatif untuk menyelesaikan masalah ini. Jadi, sangat tidak elok jika pemerintah Indonesia hanya menjadi penonton dalam tragedi kemanusiaan ini. Yang pasti, lanjut Slamet, Presiden SBY dalam waktu singkat dan mendesak ini harus melakukan upaya diplomatik konkret, baik secara bilateral maupun multilateral. Bahwa praktek pelanggaran atas prinsip kemanusiaanm seperti dialami oleh etnis Rohingya, harus segera diakhiri. “Dan,

PBNU sangat berharap pemeintah berperan aktif dalam masalah ini,” tambah mantan Ketua Umum PP GP Ansor ini. Selain itu, dia berharap Organisasi Konferensi Islam (OKI) juga memperhatikan tragedi ini secara serius. “OKI harus melakukan langkah konkret untuk melindungi etnis Rohingya, agar tidak terus menerus menjadi sasaran kebiadaban Junta Militer Myanmar. OKI juga harus mendesak PBB agar menjatuhkan sanksi tegas pada pemimpin Myanmar, misalnya mengajukan pengadilan ke dunia internasional atau Inter’ Criminal Court (ICC) dengan tuduhan sebagai upaya pembersihan etnis atau genoside etnis Rohingya, secara sistemtis,” tambah Slamet. Hal yang sama sebelumnya disampaikan oleh Ketua Umum PBNU KH Said Aqil Siroj, yang meminta agar pemerintah

memberi dukungan terhadap nasib muslim Rohingya di Myanmar tersebut. “Pemerintah dapat menggunakan posisinya sebagai pimpinan ASEAN agar pemerintah Myamar memperhatikan nasib muslim Rohingya,” ujarnya. Dikatakan, keyakinan beragama harus dilindungi di setiap negara. Tapi, merupakan fakta yang memperihatinkan ketika muslim menjadi minoritas di sebuah negara, nasibnya seringkali terlunta-lunta dan kurang mendapat perhatian dari pemerintah. “Ternyata di lingkungan ASEAN saja seperti Thailand Selatan, Filipina, atau Myanmar, mereka justru mendapatkan perlakuan diskriminatif dan ketika meminta perhatian pemerintah, Myanmar malah menganggapnya sebagai pembangkangan,” tutur Said.(j07)

1.015.087 Guru Terdaftar Ikut UKG Hari Ini JAKARTA (Waspada): Meski menuai protes dan ancaman boikot dari belasan organisasi guru di sejumlah daerah, Kementerian Pendidikan dan Kebudayaan (Kemdikbud) akan tetap melaksanakan Uji Kompetensi Guru (UKG), 30 Juli sampai 12 Agustus 2012. Secara nasional, UKG 2012 akan diikuti 1.015.087 guru, terdiri dari guru PNS 798.556 orang dan guru swasta sebanyak 216.531 orang.

Kepala Badan Pengembangan Sumber Daya Manusia Pendidikan dan Penjaminan Mutu Pendidik (Kepala BPSDMP dan PMP) Kemdikbud, Syawal Gultom mengatakan, UKG bertujuan sebagai pemetaan penguasaan kompetensi, kemampuan pedagogik dan profesionalitas guru. “UKG juga sebagai entry point penilaian kinerja guru dan sebagai alat kontrol pelaksanaan

penilaian kinerja guru,” kata Syawal di Jakarta, Jumat (27/7). Ditambahkan Syawal, UKG Bukan merupakan resertifikasi atau uji kompetensi ulang apalagi memutus tunjangan profesi. “Tidak ada tujuan memutus tunjangan sertifikasi. Sama sekali tidak. UKG bersifat pemetaan dan penilaian kinerja guru,” tegas Syawal. Terkait ancaman boikot

Toilet Umum Bersih Belum Jadi Prioritas Pemda JAKARTA (Waspada): Jumlah toilet umum bersih di negeri ini masih bisa dihitung jari. Bahkan di tempat-tempat umum saja masih banyak toilet yang jauh dari kata bersih apalagi nyaman. Sampai Yayasan Lembaga Konsumen Indonesia (YLKI) menilai keberadaan toilet umum bersih priotitas pemerintah daerah (pemda). Pengurus harian Yayasan Lembaga Konsumen Indonesia, Sudaryatmo mengatakan penyediaan toilet umum bersih di Indonesiaa masih kalah dengan negara tetangga. Pihaknya kerap mendapat keluhan masyarakat terkait minimnya fasilitas toilet umum bersih terutama di ruang publik. “Contohnya banyaknya keluhan toilet di bandara. Akhirnya kami sampaikan keluan itu dan menjadi salah satu poin dalam renovasi bandara,” jelasnya di sela-sela sosialisasi penghargaan Sapta Pesona Toilet Bersih Taman Rekreasi Buatan 2012 yang digelar Kementerian Pariwisata dan Ekonomi Kreatif (Kemenparekraf) di Hotel Grand Sahid, Jakarta, baru-baru ini. Minimnya ketersediaan toilet umum bersih, lanjutnya, berdampak pada kenyamanan masyarakat. Semestinya, pembuatan toilet disesuaikan dengan jumlah penduduk. “Di negaranegara Eropa, rasio jumlah toilet dengan penduduknya satu toilet untuk sekitar 50 orang. Sementara di Indonesia belum begitu. Pemerintah, industri pariwisata dan instansi di tanah air perlu mencontoh itu,” imbaunya. Dalam kesempatan ini,YLKI mendorong pemda, instansi dan pelaku usaha sektor wisata untuk menyediakan tolilet umum dalam kondisi bersih sebagai salah satu bentuk layanan bagi masyarakat. Ketua Asosiasi Toilet Indo-

nesia, Naning Adiwoso mengatakan, ketersediaan toilet bersih umum merupakan salah satu faktor penunjang pertumbuhan industri pariwisata. Menurutnya, wisatawan jauh lebih respek dengan daerah yang memiliki toilet umum bersih, terlebih wisatawan mancanegara. “Semakin bersih dan banyak public toilet, semakin besar kemungkinan wisatawan mancanegarauntukdatang,”ungkapnya. Sebaliknya, tambahnya, tak akan ada wisatawan yang mau datang kembali ke suatu negara kalautoiletnyarata-ratatakbersih. Pernyataan ini, lanjutnya sudah ditegaskan oleh World Toilet Organization yang mengatakan toilet yang bersih terbukti mampu mendatangkan lebih banyak wisman. “Green toilet sudah menjadi tren dan kebutuhan warga dunia,” katanya mengingat ketersediaan toilet bersih itu juga menjadi penangkal penyebaran penyakit di tengah perubahan cuaca yang terjadi di kawasan Asia. Penghargaan Sapta Pesona: Toilet Umum Bersih Taman Rekreasi 2012 yang digelar Kemenparekraf diikuti sebanyak 62 taman rekreasi dari seluruh Indonesia. Mereka berlomba untuk mendapatkan penghargaan Toilet Umum Bersih. Kegiatan penilaian digelar mulai 14 Mei samapi 9 September 2012. Setelah itu, pemberian penghargaan akan dilaksanakan di Jakarta pada 27 September 2012, bertepatan dengan peringatan Hari Pariwisata Dunia. Dirjen Pengembangan Destinasi Pariwisata Kemenparekraf, Firmansyah Rahim menjelaskan penghargaan ini bertujuan untuk meningkatkan mutu pelayanan kepada para wisatawan juga sekaligus memberikan apresiasi dan meningkat-

kan motivasi kepada pengelola taman rekreasi, dalam rangka mewujudkan sadar wisata. Kegiatan ini, lanjutnya merupakan kelanjutan dari PenghargaanToilet Umum Bersih di bandara, museum, dan kebun binatang yang terlaksana sejak 2007. Firmansyahberharapdengan adanya pemberian penghargaan ini makin mendorong masyarakat untuk lebih peduli dalam menggunakan toilet umum. Kepala Dinas Pariwisata DKI Jakarta Arie Budiman berharap pelaku usaha pariwisata wajib memiliki toilet bersih karena menjadi salah satu infrastruktur wisata. “Industri pariwisata harus menyadari pentingnya toilet bersih bagi kenyamanan pengunjungnya,” seraya menambahkan bahwa di Jakarta ada 11 taman rekreasi yang berpartisipasi pada penghargaan toilet bersih Taman Rekreasi 2012. “Ke depan, saya berharap makin banyakk industri wisatata yang menjadi peserta toilet bersih ini,” imbaunya Dewan juri yang terlibat dalam Penghargaan Sapta Pesona Toilet Umum Bersih di Taman Rekreasi Buatan 2012 terdiri atas Naning S. Adiwoso (Ketua Asosiasi Toilet Indonesia/ ATI), Eni Budiardjo (Asosiasi Toilet Indonesia/ATI), Sudaryatmo (Yayasan Lembaga Konsumen Indonesia/YLKI). Selain itu Gunawan Wibisono (Perhimpunan Usaha Taman Rekreasi/PUTRI), Hasanuddin Harahap (Asosiasi Pengusaha Hiburan Indonesia/ ASPEHINDO), Hawwid Raden (Gabungan Industri Pariwisata Indonesia/GIPI), Hilda Sabri (Media Bisnis Indonesia), Nani Sumaryati (Pemerhati Toilet Indonesia), dan Titiek Ediati sealku Pemerhati Toilet Indonesia. (Adji K.)

sebagian guru karena menganggap UKG memberatkan dan tidak berdasar hukum kuat, Syawal dengan tegas membantah. Ia berpendapat, semua pihak yang menolak dan mengancam akan melakukan boikot sebaiknya membaca dan memahami peraturan perundangan yang ada sebelum memberikan tudingan negatif pada UKG. Syawal menegaskan, UKG sudah sesuai konstitusi karena secara eksplisit tertulis di pasal 7 UU Guru dan Dosen nomor 14 ayat 1 butir A dan G. Serta di pasal 14 ayat 1 butir D dan K dalam UU yang sama. Sementara di PP 74, penetapan UKG ada di pasal 2 dan pasal 3 ayat 1. “Karena tujuannya baik, saya tidak khawatir dengan ancaman boikot. Karena dalam sosialisasi, para guru sadar bahwa UKG tepat untuk menilai kompetensi guru,”tandas Syawal. Dalam satu hari, UKG dilaksanakan dalam tiga gelombang yakni pukul07:00,10:30dan14:00. Sedangkan tahap-tahapanya disesuaikan dengan jenjang pendidikan. Untuk SMP pada 30 Juli sampai 2 Agustus; SMA/SMK, 3 sampai 6 Agustus sedangkan TK/SD/SDLB pada 7 hingga 11 Agustus.(dianw)

KUALA SIMPANG (Waspada): Pemberian hibah tanah dari pemerintah kabupaten AcehTamiang untuk pembangunan gedung Pos Pelayanan Penempatan dan Perlindungan Tenaga Kerja Indonesia (P4TKI) Aceh Tamiang, mengingatkan Kepala BNP2TKI pada pemberian pesawat Seulawah dari rakyat Aceh untuk menjadi pesawat kepresidenan pertama. “Rakyat Aceh iuran dan melalui pemimpinnya saat itu menyerahkan pesawat Seulawah kepada Presiden Soekarno untuk menjadi pesawat kepresidenan pertama,” katanya saat berdialog dengan TKI purna dan keluarga TKI di kantor Kecamatan Seruway, Kabupaten Aceh Tamiang, Jumat (27/7), dalam rangkaian hari ke-4 Safari Ramadhan BNP2TKI 24 Juli - 3 Agustus 2012 ke Sumut, Aceh, Riau, dan Kepri. Jumhur menceritakan, dahulu rakyat Aceh memberikan pesawat Seulawah yang merupakan pesawat kepresidenan pertama. Sekarang kembali pemerintah kabupaten memberikan hibah untuk institusi pemerintah pusat di daerah. “Aceh selalu memelopori untuk membantu pemerintah pusat,” katanya. Kepala BNP2TKI menyampaikan terima kasih dan penghargaan setinggi-tingginya atas nama pemerintah pusat terhadap perhatian dan hibah dari Pemerintah Kabupaten Aceh Tamiang. Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia (BNP2TKI) menerima tanah hibah seluas 1.000 meter persegi dari Bupati Aceh Tamiang Abdul Latief. Penyerahan tanah hibah itu disampaikan Bupati kepada Kepala BNP2TKI Moh Jumhur Hidayat saat meninjau lokasi tanah hibah itu di Desa Desa Bundar, Kecamatan Karang Baru, Kabupaten Aceh Tamiang. Tanah hibah yang berdekatan dengan kantor pemerintahan setempat akan dibangun Pos Pelayanan Penempatan dan Perlindungan TKI (P4TKI) Aceh Tamiang - unit tugas dari BNP2TKI di tingkat kabupaten/kota dan merupakan unsur dari Balai Pelayanan Penempatan dan Perlindungan TKI (BP3TKI) Banda Aceh di tingkat provinsi. Sebelum meninjau lokasi tanah hibah itu, Jumhur bersama Abdul Latief meresmikan Kantor P4TKI Aceh Tamiang yang sementara menempati gedung sementara di bekas Dinas Sosial yang juga bekas Istana Raja Karang.(j07)

BNP2TKI Mengupayakan Tambahan Kuota TKI Di Korea KUALA SIMPANG (Waspada): Kepala Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia (BNP2TKI) Moh Jumhur Hidayat mengupayakan penambahan kuota penempatan TKI ke Korea Selatan menyusul banyaknya permintaan serta respon positif pengusaha di sana. “Berbagai perusahaan Korea yang mempekerjakan TKI puas atas kinerja TKI yang rajin, sopan dan ramah,” kata Jumhur di Aceh Tamiang, Sabtu (28/ 7), dalam rangkaian Safari Ramadhan BNP2TKIV 24 Juli - 3 Agustus 2012 ke Sumut, Aceh, Riau dan Kepri. Tahun ini, pemerintah Indonesia melalui BNP2TKI mendapat kuota dari pemerintah Korea Selatan melalui HRD of Korea untuk menempatkan 10.500 TKI terampil dan semiterampil untuk dipekerjakan di sektor industri, manufaktur, jasa, dan pertanian di negeri ginseng itu. Hingga bulan ini sudah 5.108 TKI yang ditempatkan di Korea Selatan dan sisanya menunggu penyelenggaraan tes kemampuan bahasa Korea berbasis komputer (Employment Permit SystemTest of Proficiency in Korean Computer Based Test/ EPS-TOPIK CBT) yang diselenggarakan HRD of Korea sebagai lembaga pemerintah Korea Selatan yang menentukan kelulusan calon tenaga kerja asing untuk bisa bekerja di negeri itu. Jumhur menceritakan setiap penyelenggaraan tes yang tiap tahun diadakan beberapa kali di lima kota secara serentak selalu diikuti lebih dari 10 ribu pencari kerja di Korea sehingga kuota sebanyak 10.500 masih kurang dibanding peminatnya. Kepala BNP2TKI telah menyampaikan penambahan kuota TKI ke Korea Selatan saat menerima Direktur HRD Korea untuk Indonesia Min Kyung Ill pekan lalu di Jakarta. Min Kyung Ill menyambut positif keinginan itu bahkan akan mengupayakan supaya jumlah TKI di Korea menempati urutan pertama apalagi pekerja dari Indonesia dikenal rajin dan disiplin. Jumhur mengatakan Min Kyung Ill pernah menjadi Direktur HRD of Korea untuk Filipina dan Vietnam.(j07)

Pembebasan Sementara Bea Masuk Kedelai Langkah Yang Tepat JAKARTA (Waspada): Ketua DPR Marzuki Alie menilai, pembebasan sementara bea masuk untuk kedelai sebesar 5 persen merupakan langkah yang tepat untuk melindungi industri kedelai saat ini. “Kekacauan ini dimulai karena adanya gagal panen di Amerika Serikat sedangkan permintaan China terhadap kedelai sangat besar,”papar Marzuki Alie, saat berbuka puasa dengan wartawan unit DPR-RI, di kediamannya Jalan Widya Chandra, Jakarta, Kamis, (27/7). Menurut Marzuki, dengan pembebasan bea masuk diharapkan harga kedelai dapat turun di pasaran dan setelah stabil baru bea masuk dapat ditetapkan kembali. “Ini untuk mengamankan dan melindungi kedelai di pasaran, sebenarnya apabila tidak impor, petani tentu diuntungkan namun dengan catatan tidak dijual ke tengkulak,”paparnya. Walaupun sudah ada langkah sementara, Marzuki meminta pemerintah terus merespons kelangkaan kedelai ini hingga tidak terjadi kelangkaan produk tahu dan tempe di pasaran. “Yang penting kecepatan respons. Apabila tidak berhasil harus dievaluasi segera,”katanya. (aya)

Waspada/dianw

MUSHAF ALQURAN: Menteri Pendidikan dan Kebudayaan Mohammad Nuh memberikan secara simbolik mushaf Alquran kepada perwakilan dari Rumah Yatim disaksikan oleh Director of Communications and Corporate Affairs APP, Suhendra Wiryadinata (dua dari kanan) dan manager Kids PT Fast Food Indonesia, Vickri Rachmat di Store KFC Kemang, Jakarta Selatan, belum lama ini. Alquran tersebut merupakan wakaf dari Asia Pulp And Paper (APP) dimana Alquran tersebut diproduksi di atas kertas Quran Paper berkualitas yang dapat bertahan hingga 100 tahun.


Aceh

WASPADA Senin 30 Juli 2012

Hubungan Darat Bireuen-Takengen Mengkhawatirkan

Penganiaya Pasutri Lansia Dipastikan Segera Menyerah BIREUEN (Waspada): Kapolres Bireuen AKBP Yuri Karsono, SIK memastikan para pelaku penganianya pasangan suami istri lanjutusiadiDesaCotSaleuetPeusangan,SiblahKrueng,kabupaten setempat, beberapa waktu lalu hingga tewas, dipasti-kan akan menyerahkan diri secara baik-baik dalam dua hari ini. Dirinya berkeyakinan, setelah melihat perkembangan di lapangan dan pihaknya melakukan pendekatan di lapangan serta dengan menghimbau kepada mereka secera baik-baik untuk menyerahkan diri secara baik-baik. “Insya Allah, para pelaku telah berniat baik akan menyerahkan diri secara massal dalam dua hari ini. Kita juga sangat menyambut baik niat baik mereka,” katanya kepada Waspada, Jumat (27/7). Sebagaimana diberitakan sebelumnya, Maimunah Abdullah, 73, warga Desa Cot Saleut, Peusangan Siblah Krueng, Bireuen, Sabtu (21/7) dini hari, meregang nyawa bersama suami tercintanya Ahmad Johan, 70, di pinggir jalan desa setempat. Setelah dikeroyok massabeberapasaatsetelahdijemputdarirumahnya,karenadiduga keduanya telah mengamalkan ilmu sihir dan sering menyantet warganya, sehingga warganya marah dan mengeroyoknya. Didampingi Kasat Reskrim, Iptu Benny Cahyadi, Kapolres Bireuen, dalam kesempatan tersebut mengatakan, munculnya keinginan para pelaku untuk menyerahkan diri, karena aparat penegak hukum memberi waktu kepada mereka menyerahkan diri sebelum ditangkap. Karena data tentang mereka telah dikantongi polisi. (cb02)

Pemilik Salon Jadi Perantara 100 Gram Shabu Diciduk BIREUEN (Waspada): Tim Opsnal Polres Bireuen, Kamis (26/7) sekira pukul 19:45 berhasil menciduk R, 32, alias Maya, seorang ibu rumah tangga yang juga pemilik sebuah salon di Kecamatan Jeunieb, kabupaten setempat, karena diduga selama ini sering menjadi perantara transaksi shabu. Barang bukti shabu seberat 100 gram atau senilai Rp 78 juta berhasil disita dari tangannya. “Berhasilnya kita tangkapnya ibu ini, setelah kita kembangkan kasus tertangkapnya Z, 19, warga Pante Lhong Jeunieb, Rabu (26/7) sekira pukul 22:00 darinya juga ikut disita 0,4 gram shabu informasi dari masyarakat,” Kasat Narkoba Polres Bireuen, Iptu Indra Asrianto kepada Waspada, Jumat (27/7). Berdasarkan keterangan yang diperoleh dari tersangka Z, lalu pihaknya, mengembangkan terus, sehingga mendapat keterangan, Z memperoleh barang haram itu dari tersangka IRT tersebut. “Setelah itu, tim terus melakukan upaya untuk berhasil menangkap tersangka dengan cara memancingnya saat itu dia membawa benda shabu seberat 100 gram, pada saat itulah dia ditangkap tanpa bisa berkutik lagi,” jelasnya. Menurut Kasat, beradasarkan keterangan sementara tersangka, dia hanya memperoleh fee saja setiap transaksi, sedangkan pemiliknya masih terus diburu.”Dalam pengembangan pasca menciduk tersangka R, pihaknya juga meringkus S, 37, warga Desa Ulee Rabo, kecamatan yang sama, kasus ini terus kita kembangkan,” pungkas Kasat Narkoba. (cb02)

Waspada/Abdul Mukthi Hasan

KASAT Narkoba Polres Bireuen, Iptu Indra Asrianto memperlihatkan shabu paket 100 gram dan paket hemat 0,4 gram di ruang kerjanya, Jumat (27/7), yang disita dari tiga tersangka yang ditangkap.

40 Warga Terima Beras Dari Pam ExxonMobil LHOKSUKON (Waspada): 40 warga Gampong Paya Beurandang Kecamatan Tanah Luas dan Alue Drien, Kecamatan Lhoksukon, Aceh Utara menerima bantuan dari Satuan Tugas (Satgas) Pengamanan ExxonMobil. Bantuan itu diberikan di Kantor Pam Exxon di Gampong Landing, Kecamatan Lhoksukon, Kamis (26/7). Dir Pam Ovit Polda Aceh, Kombes Pol Drs Murianto melalui Kepala Pelaksana Harian (Kalahar) Pam ExxonMobil AKP Mugianto menyebutkan, masing-masing warga menerima satu sak beras ukuran 15 kilogram. Begitu juga uang tunai kepada pemerintahan gampong untuk mendukung kegiatan meunasah kedua gampong. Bantuan ini, kata Mugianto, khusus diberikan untuk masyarakat miskin dan kaum duafa di kedua gampong tersebut secara rutin, karena kedua gampong ini merupakan lingkungan Pam Exxon. Maka, ia berharap tidak melihat bantuan ini dari segi nilai bantuannya. (cmk)

Waspada/Mustafa Kamal

KOMBES Pol Drs Murianto menyerahkan bantuan beras kepada fakir miskin di kantor Pam ExxonMobil di Gampong Landing, Kecamatan Lhoksukon, Kamis (26/7)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur***

12:45

FY 3401 Penang ****

FY3400 Penang ****

14:30

Fire Fly

14:10

* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.

B5

Waspada/Abdul Mukthi Hasan

KONDISI jalan Bireuen-Takengen di Km 25 terancam putus akibat diterjang longsor. Bila tidak segera diatasi, maka hubungan darat Takengen-Bireuen akan putus.

Perlakuan Penegak Hukum Beda Kasus Rumah Guru Dan Duafa

BANDA ACEH (Waspada): Pembangunan rumah guru terpencil di 18 kabupaten/ kota yang sempat heboh karena diisukan fiktif ternyata nilai kerugian negara hanya sekira Rp300 juta. Sementara, pembangunan rumah dhuafa berbiaya Rp237 miliar yang diduga sarat masalah, tapi hingga kini belum tersentuh hukum. Dua kasus hukum tapi mendapat perlakuan berbeda itu terungkap dalam seminar ‘bedah kasus korupsi’ pembangunan rumah guru terpencil dan rumah duafa yang dilaksanakan GeRAK Aceh, Kamis lalu di Banda Aceh. Untuk rumah guru terpencil yang dikuliti oleh GeRAK Indonesia sebelumnya, pagu proyek senilai Rp 20,1 M, tapi karena ada dua proyek yang gagal yakni rumah dinas Kepala Dinas Pendidikan Aceh dan rumah guru terpencil di Aceh Tamiang. Hingga nilai kontrak rumah

guru terpencil berkurang menjadi Rp18,5 M. Dari 18 Kab/kota, hanya satu kabupaten, yakni Aceh Selatan lima unit pembangunan rumah yang terbengkalai, satu unit tidak dikerjakan dan empat unit selesai, sedangkan di 17 kab/kota selesai 100 persen. Kini, kasus rumah guru terpencil ini sedang dalam proses penyelidikan Kejaksaaan Tinggi Aceh dan kemungkinan dalam pengembangan pemeriksaan saksi-saksi bakal ada penambahan tersangka baru dari sebelumnya yang sudah ditetapkan sebagai tersangka yakni KPA, ZN atau ZS dan PPTK, SR. Sedangkan kasus pembangunan rumah duafa yang diduga terjadi korupsi karena tidak dilakukan tender bebas, melainkan melalui mekanisme penunjukan langsung (PL), sampai sekarang belum ada tindak lanjut proses hukum. Padahal, dari segi kerugian uang negara diduga jauh lebih besar, sebab anggarannya cukup fantastis, yakni Rp237 miliar bersumber dari APBA 2008. “Kami mempertanyakan kepada pihak aparat penegak

hukum mengapa kasus dugaan korupsi sebesar ini belum ada penanganan khusus,” kata Koordinator GeRAK Aceh, Askhalani didampingi GeRAk Indonesia, Akhiruddin Mahyuddin. Bila dibandingkan dengan kasus pembangunan rumah guru terpencil yang kerugian negara lebih kecil dari pada kasus rumah duafa, yang diperkirakan kerugian negara mencapai miliaran rupiah. “Kenapa sampai sekarang kasus rumah duafa belum juga tersentuh hukum,” papar koordinator GeRAK Jakarta ini yang akrab disapa Udin. Atas kasus itu, GeRAK mendesak aparat penegak hukum terutama KPK mengusut tuntas secara transparan kasus pembangunan rumah duafa demi kesejahteraan bersama masyarakat Aceh juga menyelamatkan aset dan uang negara. Seminar korupsi rumah guru terpencil dan pembangunan rumah duafa dihadiri pejabat dari BPK RI perwakilan Aceh, Polda Aceh, perwakilan dari organisasi mahasiswa, LSM, dan tokoh pendidikan. (b01)

10 Mayam Emas Melayang Dijambret Pembeli Rokok BLANGPIDIE (Waspada) : Memakai perhiasan emas mungkin ada baiknya tidak terlalu mencolok dan berlebihan, sehingga mudah memancing niat munculnya kejahatan. Seperti kasus yang menimpa Nila, 42, IRT yang juga memiliki satu unit kios di kediamannya di Desa Tokoh, Kecamatan Manggeng, Aceh Barat Daya pada Minggu (29/7), sekira pukul 15:25, IRT itu menjadi korban penjambretan yang dila-

kukan oleh dua orang pembeli yang tidak diketahui identitasnya. Akibat aksi itu wanita paruhbayakehilangan10mayam emas dan hanya bisa tercenung karena kejadiannya sangat cepat. Kapolres Abdya AKBP Eko Budi Susilo yang dihubungi Waspada membenarkan kejadian yang berlangsung di bulan suci ramadhan sehingga korban tidak memiliki kecurigaan sedikitpun saat kedua pelaku yang menggunakan sepedamotor

yang datang ke kiosnya untuk membeli rokok. “Korban asal Desa Tokoh, Kecamatan Manggeng saat itu didatangi kedua pelaku yang membeli rokok di kiosnya, secara tiba-tiba pelaku langsung menarik emas yang diperkirakan seberat 10 mayam yang ada di leher korban. Kedua pelaku saat ini masih dalam pengejaran, petugas kita juga sudah ke TKP untuk melakukan identifikasi,” jelas Kapolres. (cb05)

BIREUEN (Waspada): Hubungan jalur darat antara Kabupaten Bireuen dengan dataran Gayo (Bener Meriah dan Aceh Tengah) terancam putus. Pasalnya, ruas jalan lintas antara dua kabupaten bertetangga tepatnya di Km 25 hanya tinggal sebelah kiri jalan arah Bireuen yang longsor. Pantauan Waspada, Jumat (27/7), ruas jalan Bireuen-Takengen tepatnya di tikungan tajam Km 25, Kec. Juli, Kab. Bireuen, tanggul penahan pinggir patah dan sebagian jalan terlihat terancam ikut amblas ke dalam jurang yang terjal. Sedangkan di pinggir jalan telah dipasang plang dan ujungnya juga sudah ada rambu-rambu lalu lintas. Saat itu sejumlah kendaraan yang datang dari arah Takengen ataupun dari Bireuen begitu tiba di lokasi harus ekstra hati-hati. Karena ruas jalan sebelah utara terlihat sangat mengkhawatirkan. “Sebagian saja jalan ini amblas, maka mobil tidak bisa jalan lagi, kecuali kendaraan roda dua saja yang bisa,” kata Anwar, seorang penumpang Minibus L-300 yang berangkat

ke Takengen dari Kota Bireuen. Para pengguna jalan berharap seperti pada Km 27-30 yang telah dibangun beberapa waktu lalu oleh seorang kontraktor asal Bireuen, sekarang giliran di Km 25 juga terjadi hal yang sama. Sebelumnya Pejabat Pembuat Komitmen (PPK) pembangunan Jalan Bireuen-Takengen, Safaruddin kepada wartawan mengatakan, untuk membangun jalan Bireuen-Takengen yang longsor membutuhkan dana yang cukup besar, karena kawasan itu juga harus mengeruk kaki gunung untuk memperlebar ruas jalan seperti yang pernah dilakukan di Km 27-30. “Jalan Bireuen-Takengen statusnya jalan nasional dan beberapa waktu lalu kami sudah melaporkan kondisi jalan longsor di Km 25 itu kepada pihak terkait di Jakarta, sekarang mereka sedang mencari solusinya,” katanya. Jalan Bireuen-Takengen di beberapa titik longsor yang pernah terjadi atau beberapa ruas yang ruasnya rusak sebagiannya sedang ditangani, bahkan di kawasan Krueng Simpoe jalannya sedang dibangun yang baru. (cb02)

Pemerintah Aceh Dinilai Tak Serius Perjuangkan Kasus Pelanggaran HAM LHOKSEUMAWE (Waspada): Pemerintah Aceh di bawah pimpinan dr Zaini Abdullah dan Muzakir Mannaf ( Zikir ) dinilai tak serius memperjuangkan nasib penyelesaian kasus pelanggaran Hak Azasi Manusia ( HAM ) yang terjadi di masa lalu. Sejumlah kalangan masyarakat Aceh juga turut merasa heran, lantaran Pemerintah Aceh sampai saat ini masih terkesan tidak memiliki itikad baik untuk menuntaskan kasus pelanggaran HAM yang terjadi sebelum konflik bersenjata api meletus. Hal itu diungkapkan salah seorang pengamat politik keamanan Aceh Aryos Nivada, Jumat (27/7) terkait terkatung-katungnya nasib para keluarga korban pelanggaran HAM. Karena sampai saat ini rakyat Aceh masih menanti dengan penuh harapan, agar pemerintah segera

menuntaskannya. Sikap tak seriusnya Pemerintah Aceh menyelesaikan kasus pelanggaran HAM yang dialami rakyatnya itu, dapat dirasakan setiap adanya pertemuan Gubernur Aceh dr Zaini Abdullah danWakil Gubernur Muzakkir Mannaf ( Zikir ) dengan Presiden SBY. Karena dalam pertemuan tersebut, Pemerintah Aceh tidak sama sekali menyingggung persoalan HAM Aceh masa lalu. “Pemerintahan Aceh belum punya itikad baik untuk menyelesaikan kasus HAM Aceh. Bisa kita lihat ketika pertemuan dengan Presiden isu HAM tidak dibicarakan,” ujar Aryos. Sehingga dengan tidak adanya keluhan yang disampaikan oleh pemimpin Aceh. Maka agenda kasus pelanggaran HAM itu akhirnya tidak lagi menjadi masalah yang perlu diprioritaskan oleh pihak Pemerintah Pusat.(b16)

Pembangunan Masjid Kemukiman Bireuen Terus Dipacu BIREUEN (Waspada) : Pembangunan masjid Kemukiman Bireuen berlokasi di Desa Bireuen Reuluet terus dipacu. Insya Allah awal Januari 2013 akan dapat difungsikan sebagai masjid rumah ibadah kemukiman Bireuen. Ketua panitia pembangunan Drs H Ridwan Khalid dalam penjelasannya di hadapan ratusan jamaah tarawih Meunasah Kota Bireuen Rabu (25/7) malam mengimbau warga Bandar BiWaspada/H.AR Djuli reuen agar berkenan mem- PEMBANGUNAN Masjid Kemukiman Bireuen di Desa Bireuen berikan sumbangan baik Reuluet Kecamatan Kota Juang terus dipacu saat ini sudah rampung berupa dana, bahan bangu- dikerjakan 25 persen. nan, semen, besi dan lainlain. Sumbangan dimaksud dapat diserahkan Menjawab pertanyaan Waspada Ridwan melalui geuchiek enam gampong masing- Khalid didampingi bendahara H Abubakar yang masing sudah resmi sebagai panitia pem- akrab disapa Tubaka mantan anggota DPRK bangunan masjid Kemukiman Bireuen. Bireuen, Geuchiek Bireuen Reuluet Asykari, Dikatakan, pembangunan masjid berlokasi Drs Murdani, Ir Yan Fitri, MT menjelaskan di Desa Reuluet bukan masjid desa akan tetapi pembangunan masjid kemukiman Bireuen sebagai masjid kemukiman Bireuen yang mem- berukuran luas 2400 meter bujur sangkar dibabahawi enam Gampong, Bandar Bireuen, Bire- ngun diatas sebidang tanah wakaf dan tanah uen Meunasah Capa, Bireuen Meunasah Blang, dibeli dengan swadaya masyarakat. Bireuen Meunasah Dayah, Bireuen Meunasah Dikatakan, masjid kemukiman Bireuen Reuluet dan Gampong Tgk Digadong. mulai dibangun sejak tahun 2007 akan menelan Dalam kesempatan singkat usai melak- dana sebesar Rp 4,5 miliar. Sumbangan masyasanakan shalat Isya akan memasuki shalat tarawih rakat sebesar Rp 1,6 miliar sudah dimanfaatkan berjamaah,RidwanKhalidmenyerahkansejumlah untuk pembangunan fisik saat ini sudah ramamplop sumbangan kepada Geuchiek Bandar pung dikerjakan 25 persen menelan dana Rp Bireuen Adnan Adam untuk dibagikan kepada 1,63 miliar panitia masih terhutang pihak warganya yang akan menyumbang. ketiga.(b12)

Kisah Miris Dari Dalam Sumur Tanpa Dasar SESEKALI di tengah malam ketika warga lagi nyenyak tidur, sering terdengar suara meraung-raung yang membahana memecahkan kesunyian malam di ujung perkampungan pemukiman penduduk. Suara bersumber dari lokasi rig pengeboran minyak, satu-persatu pipa disusun untuk dimasukan dalam perut bumi oleh para perkarya yang sedang berdinas malam mengabdi dalam pengeboran minyak bumi dan gas ( migas) PT Pertamina EP Field Rantau untuk menghasilkan devisa bagi pendapatan negara. Para pekarya menjalankan tugas secara bergantian atau aplusan yang memang penggantian shifnya sudah disusun skedulnya oleh Pertamina bersama pihak perusahaan atau vendor yang mempasok tenaga perkarya untuk ikut mengabdi di ladang minyak dan gas milik PT Pertamina . Pada awalnya suasana kerja masih berjalan tanpa adanya gejolak antara Perkarya yang dipasok vendor pemenang kontrak kerja dengan PT.Pertamina. Namun sejak dua tahun terakhir ini mulai muncul gejolak yang menyedot perhatian dari semua pihak terkait di Provinsi Aceh, khususnya bagi Pemerintah Kabupaten Aceh Tamiang, aparat keamanan, pekarya,Pertamina dan masyarakat di Aceh Tamiang. Bahkan, kasus pergelokan antara pekarya dengan PT.Pertamina EP Field Rantau sudah bergulir “sengketanya” sampai ke Mahkamah Agung ( MA) di Jakarta. Sampainya kasus ke MA karena hasil persidangan di

Pengadilan Negeri Hubungan Industrial ( PHI) Banda Aceh memenangkan gugatan pekarya atau tenaga kontrak ( outsorcing) terhadap PT Pertamina. Berdasarkan catatan Waspada, para pekarya sudah pernah menggelar unjuk rasa di Aceh Tamiang dan sampai ke Banda Aceh. Mereka sudah berulangkali berdemo mulai dari 30 Desember 2010 hingga 1 Mei 2012. Menurut para pekarya, hakhak mereka sebagai pekerja sudah diatur dalam UU Nomor 13 Tahun 2003 dan berbagai peraturan lainnya. Utusan tenaga kontrak itu mengungkapkan, ratusan tenaga kontrak Pertamina Rantau itu pada hari Jumat (23 Desember 2011) memenuhi panggilan sidang ke VIII agenda sidang menghadirkan saksi-saksi dari pihak tergugat ( PT Pertamina EP Field Rantau) di PHI Banda Aceh untuk menyelesaikan perselisihan Hubungan Industrial Pekerja Kontrak PT Pertamina EP Field Rantau dengan perusahaan. Namun, beber para pekarya itu lagi , setelah mereka pulang dari Banda Aceh , ternyata pada tanggal 24 Desember 2011 pihak PT Pertamina Rantau menerbitkan surat yang ditujukan kepada vendor yang isinya menyatakan semua telah mangkir massal dan semua diskorsing selama tiga hari serta ada ancaman intimidasi yang menyatakan surat itu merupakan surat peringatan terakhir karena meninggalkan lokasi pekerjaan tanpa izin dari perusahaan. Ka.Layanan Operasi dan

Humas PT.Pertamina EP Field Rantau, Tergiah Sembiring pasca aksi demo tersebut menyatakan kepada Waspada , tidak benar Pertamina Rantau melarang tenaga kontrak itu untuk masuk kerja.Namun, pihak Pertamina memang ada ikatan kontrak dengan pihak vendor. Alhasil pada 17 Januari 2012 gugatan yang diajukan oleh perkarya di Pengadilan Negeri PHI Banda Aceh yang sudah lama ditunggu-tunggu membuahkan hasil. Pengadilan memenangkan gugatan pekarya terhadap PT Pertamina EP Field Rantau. Namun, apa yang hendak dikata, wajah mereka yang sebelumnya sempat ceria karena obsesi mereka bakal diangkat sebagai karyawan PT Pertamina Rantau, ternyata 275 pekarya itu belum bisa menikmati hasil gugatannya sehubungan dengan hasil sidang putusan yang dipimpin oleh Hakim Ketua, Syukri, SH. M. Hum dan Hakim Anggota Firmansyah danYuheri Salman. Pasalnya, PT Pertamina melakukan upaya hukum berupa pengajuan kasasi ke Mahkamah Agung ( MA). Cukup Alasan Tergiah menegaskan, putusan PHI Banda Aceh masih belum mempunyai kekuatan hukum tetap, dan PT Pertamina EP Field Rantau masih mempunyai hak untuk mengajukan upaya hukum lanjutan yang dijamin oleh undang undang. PT Pertamina mengajukan upaya hukum selanjutnya yaitu mengajukan Kasasi Ke Mahkamah

Agung. Tergiah menyatakan , karenanya cukup beralasan PT Pertamian EP mengajukan upaya hukum lanjutan dengan Kasasi ke Mahkamah Agung (MA) atas putusan dan ini artinya putusan hakim bukan merupakan hasil final dari gugatan tenaga kerja Outsourcing. Munculnya upaya kasasi membuat ratusan pekarya Pertamina Rantau, Kabupaten Aceh Tamiang itu gerah bercampur kecewa. Akibatnya mereka kembali menggelar unjuk rasa di tiga lokasi yaitu Dinas Sosial Tenaga Kerja dan Transmigrasi Aceh Tamiang, Kantor Bupati Aceh Tamiang dan Kantor DPRK Aceh Tamiang,Selasa 1 Mei 2012. 249 orang pekerja telah dibiarkan tidak bekerja lagi dan Pemutusan Hubungan Kerja ( PHK) pacsa adanya putusan PHI Banda Aceh itu. Kepala Dinas Sosial dan Tenaga Kerja Kabupaten Aceh Tamiang, Basyaruddin,SH menerangkan, menyikapi keinginan perkarya yang harus kita lakukan adalah memanggil Pertamina dan mempertanyakan alasan mengapa perkarya diberhentikan. Selanjutnya kita surati ke PHI terhadap permasalahan ini.Jadi, kita harus tentukan waktu untuk memanggil pihak Perta-mina,” tegas Basyaruddin. Bupati Aceh Tamiang, Drs H Abdul Latief menegaskan, sebelum habis masa kontrak seharusnya pihak Pertamina tidak dapat memberhentikan pekarya begitu saja.” Persoalan ini harus dituntaskan dengan jelas,” saran Latief. Kuasa Hukum Pekarya,

Ramli Husen,SH &Associates menyatakan,Pengadilan PHI telah memutuskan, menyatakan Perjanjian Kerja Waktu Tertentu ( PKWT) yang dibuat antara perusahaan penyedia jasa tenaga kerja dengan penggugat demi hukum beralih menjadi Perjanjian Kerja Waktu Tidak Tertentu ( PKWTT). Ada Kriterianya Menurut kuasa hukum pekarya, Penerimaan dan pemberitahuan Nomor Registrasi perkara kasasi PHI, maka permohonan Kasasi dalam perkara a quo telah terdaftar pada Kepaniteraan Mahkamah Agung RI dengan Reg.Nomor:230 K/ Pdt.Sus/2012,akan tetapi sampai saat ini perkara belum diputus Mahkamah Agung RI. Presiden Direktur PT Pertamina EP,Syamsu Alam ketika tampil sebagai narasumber pada acara Lokakarya Jurnalistik Industru Hulu Migas yang diselenggarakan PT Pertamina EP dan Lembaga Pers Dr Sutomo ( LPDS) Jakarta di Novotel Hotel, Mangga Dua,Jakarta Pusat pada 12-14 Juni 2012 menampilkan makalahnya berjudul “ Peran Strategis Pertamina EP Mendukung Pertumbuhan Ekonomi Nasional” Pada kesempatan itu, wartawan Waspada dari Kabupaten Aceh Tamiang yang mengikuti acara itu menanyakan langsung kepada Prisiden Direktur PT Pertamina EP, Syamsu Alam yang didampingi Manager Legal dan Relations PT Pertamina EP, Aji Prabudi tentang kasus yang dialami oleh pekarya di PT Pertamina EP Field Rantau.

Menurut Syamsu Alam, Untuk menjadi karyawan tetap di PT Pertamina tentu saja tidak bisa dengan cara seperti yang dimohon oleh perkarya di Pertamina EP Field Rantau, Kabupaten Aceh Tamiang yang meminta mereka supaya semuanya dapat diangkat secara langsung oleh PT Pertamina. Sedangkan Manager Legal dan Relations PT Pertamina EP, Aji Prabudi yang ikut menimpali pertanyaan yang diajukan Waspada pada acara itu menyatakan, kasus yang terjadi antara perkarya dengan PT Pertamina Rantau Kabupaten Aceh Tamiang itu pada saat ini pihak PT Pertamina sedang melakukan upaya kasasi Ke Mahkamah Agung ( MA) pasca adanya putusan dari Pengadilan Negeri PHI Banda Aceh yang memenangkan perkarya. “ Sampai saat ini memang belum ada keputusan kasasi dari MA tentang kasus ini, maka kita tunggu saja MA untuk memutuskannya,” kata Aji Prabudi dalam acara yang diikuti jurnalis mediacetakdanelektronikpeliput MigassertaHumas PTPertamina se Indonesia di Novotel Hotel ,Mangga Dua,Jakarta Pusat itu . Merujuk dari fakta-fakta di atas, berdasar analisis Waspada terhadap kasus ini, sudah jelas terlihat Panji “sengketa” yang terus berkibar itu tidak ubahnya seperti kita melemparkan batu ke dalam sumur minyak tanpa dasar,sebab batu yang dilemparkan ke dalam sumur tanpa dasar sudah pasti tidak jelas kapan batu yang dilempar itu sampai ke tujuan. Muhammad Hanafiah


Aceh

B6

WASPADA Senin 30 Juli 2012

Keuchik Protes Pengurangan Kuota Raskin

IKAT Aceh Hari Ini Gelar Doa Untuk Muslim Myanmar IDI (Waspada): Menyikapi tindakan kekerasan yang dilakukan pemerintah dan kaum Buddhis Myanmar terhadap umat Muslim Rohingya di negara bagian Rakhite, Myanmar, Ikatan Alumni Timur Tengah (IKAT) Aceh akan menggelar acara doa untuk Muslim Myanmar, Senin (30/7) petang di Sekretariat IKAT di kawasan Beurawe, Kota Banda Aceh. Acara terbuka untuk umum tersebut akan dirangkaikan dengan pembagian paket Ramadhan kepada 80 keluarga miskin (Usrah Faqirah) yang ada di Gampong Beurawe dan sekitarnya. “Nantinya acara akan diakhiri dengan ifthar jama’i (buka puasa bersama) keluarga besar IKAT Aceh dan masyarakat sekitar serta para tamu undangan,” jelas Sufrizal Nurdin, Ketua Panitia Pelaksana Ramadhan IKAT Aceh kepada Waspada, Jumat (27/7). Ketua IKAT Aceh, M Fadhil Rachmi, Lc, mengatakan, kegiatan ini digelar sebagai bentuk solidaritas dan keprihatinan IKAT sebagai sesama muslim. “Dengan doa ini kita juga ingin menggunggah segenap lapisan masyarakat terutama para pemangku kebijakan baik tingkat lokal maupun nasional untuk take action terhadap problematika ummat Islam di Myanmar ini,” katanya. Menurutnya, kekerasan terhadap muslim Rohingya merupakan tindakan diskriminatif dan merupakan perbuatan biadab serta tidak berperikemanusian. “Indonesia sebagai negara yang menjunjung tinggi HAM juga ketua ASEAN harus proaktif memberi teguran keras kepada Myanmar dan mendesak negara itu menghormati HAM,” tandas Fadhil Rachmi. (b24)

MADAT (Waspada): Para kepala desa atau Keuchik seKecamatan Madat, Aceh Timur, memprotes kebijakan pemerintah soal pengurangan kuota penerima beras miskin (raskin) yang mulai diberlakukan sejak Juni 2012. Pengurangan kuota Rumah Tangga Miskin (RTM) hingga 75 persen dari kuota sebelumnya, dinilai seperti buah simalakama bagi para keuchik. Kebijakan itu rawan menimbulkan konflik dan kecemburuan sosial di tengah masyarakat. “RTM yang sebelumnya menerima raskin, lalu tiba-tiba tidak kebagian lagi, pasti komplain. Ujung-ujungnya yang jadi sasaran aparat desa, terutama Keuchik,” kata Mukhtar Usman, Koordinator Keuchik Madat, yang juga Keuchik Desa Tanjong Minjei, Kec. Madat, Minggu (29/7). Pria berkumis tebal yang akrab disapa Keuchik Adek ini berharap, kebijakan pemerintah soal pengurangan kuota RTM ini, ditinjau ulang. Setidaknya, kebijakan itu disosialisasikan terlebih dahulu, sehingga masyarakat tidak salah paham dan tidak serta merta menyalahkan aparat desa. Sementara Camat Madat, Russamin SE, yang dihubungi terpisah mengaku belum tahu pasti soal kebijakan tersebut. “Para camat di Aceh Timur baru akan rapat membahas masalah ini, Selasa mendatang,” katanya. Kalaupun kebijakan itu diberlakukan, sambung Russamin, kemungkinan besar itu karena adanya data baru yang dianggap lebih akurat. “Diakui atau tidak, data RTM lama banyak yang salah, sehingga penyaluran raskin juga kurang tepat sasaran,”tandas Camat.(b19)

Kasatlantas Polres Bireuen Diganti BIREUEN (Waspada): AKP Thomas Nurwanto, SH yang selama ini menjabat Kasatlantas Polres Aceh Barat resmi menjadi Kasatlantas Polres Bireuen menggantikan AKP H Suharmadi yang dipindahkan ke Polres Pidie untuk menduduki jebatan yang sama. Hal itu terungkap dalam upacara sertijab dan pengukuhan tiga anggota Polres Bireuen di depan Mapolres setempat, Jumat (27/ 7) yang dipimpin langsung Kapolres Bireuen, AKBPYuri Karsono, SIK. Dalam acara yang diikuti sejumlah perwira dan anggota Polres lainnya, sebelumnya Kapolres mengingatkan kepada anggotanya yang dipindahkan ke tempat yang baru hendaknya meningkatkan kinerjanya dan berterimakasih atas kerjasama selama ini. Selain Kasatlantas yang diganti dalam acara sertijab tersebut, Kabag Ops, Kompol Nur Azhari, SH menjadi Waka Polres Aceh Jaya, dam tempatnya diisi AKP Siswara Hadi, SIK. Kemudian Ipda Mawardi yang selama ini bertugas sebagai perwira di Polres Bireuen dikukuhkan menjadi Kapolsek Samalanga menggantikan AKP Djauhari Ahmad yang memasuk masa pensiun. (cb02/b17)

Waspada/Abdul Mukthi Hasan

KAPOLRES menyemat pangkat di bahu para angggotanya dalam acara sertijab di Mapolres setempat, Jumat (27/7).

Kader PKS Buka Puasa Di Simpang Ulim SIMPANG ULIM (Waspada): Puluhan kader Partai Keadilan Sejahtera (PKS) dan sejumlah tokoh Aceh Timur buka puasa bersama anggota DPR-RI dari PKS, H Raihan Iskandar, Lc .MM, di Desa Pucok Alue Dua, Kec. Simpang Ulim, Jumat (27/7) malam. Acara digelar di rumah Sekretaris PKS Aceh Timur, H Mulyadi M Yusuf, dihadiri Ketua DPRK Aceh Timur Tgk Alauddin SE, Ketua PKS Aceh Timur, Ismuha, anggota DPRA dari PKS Mahyaruddin Yusuf, unsur Muspika Simpang Ulim, imum mukim dan sejumlah tokoh masyarakat Pucok Alue Dua. Meski sederhana, acara berlangsung khidmat. H Raihan Iskandar sempat memaparkan tausiyah singkat tentang keutamaan Ramadhan, menyantuni 20 anak yatim dan terakhir acara ditutup dengan doa serta buka puasa bersama.(b19)

Suara Petasan ‘Bak’ Perang Di Kota Idi, Jamaah Tarawih Terganggu IDI (Waspada): Suara petasan di Kota Idi dan sekitarnya sangat mengganggu jamaah shalat tarawih di Masjid Agung Darusshalihin Idi Rayeuk. Meski sudah terjadi sejak Ramadhan pertama, kini tokoh masyarakat Idi Rayeuk telah menyurati Kapolres Aceh Timur untuk menghentikan suara petasan di sana. Rahmad Hidayat kepada Waspada, Jumat (27/7) menjelaskan, saat umat muslim melaksanankan ibadah shalat tarawih terdengar bunyi petasan bagaikan kota yang sedang berperang. Tak hanya sekedar mengganggu kosentrasi jamaah, tetapi sebagian jamah juga jantungan saat mendengar letusan petasan dengan suara tinggi di seputaran masjid. Sementara itu, sejumlah tokoh masyarakat Idi Rayeuk telah melayangkan surat permohonan untuk menindaktegas aksi petasan di Kota Idi Rayeuk. Dalam surat itu juga ditandatangani 10 Keuchik dan mengetahui Imum Mukim Kota Idi dan Camat Idi Rayeuk. (b24)

Waspada/Muhammad H. Ishak

PENJUAL petasan di Kota Idi, Aceh Timur, Jumat (27/7).

Untuk Banda Aceh & Sekitarnya Senin, 10 Ramadhan 1433 H/30 Juli 2012 Berbuka : 18.58 Wib Imsak : 05.04 Wib Catatan: Calang, Sinabang (+1 menit), Sabang, Jantho (-1 menit), Sigli, Blang Pidie, Meureudu (-3 menit), Takengon, Tapaktuan, Singkil (-4 menit), Bireuen, Simpang Tiga Redelong (-5 menit), Blangkejeren, Subulussalam (-6 menit), Lhokseumawe, Kutacane (-7 menit), Langsa, Idi, Kuala Simpang (-9 menit). (b04)

Waspadai Makanan Dan Minuman Berwarna Mencolok Waspada/Muhammad H. Ishak

BUPATI Aceh Timur Hasballah M. Thaib (baju hitam) tampak serius mendengar pembicaraan via telepon antara warga dengan pihak rekanan terkait terbengkalainya Jembatan Gantung dengan nilai Rp3 miliar lebih di Desa Cek Mbon, Kecamatan Peureulak Kota, Sabtu (28/7).

Telan Rp3 M, Jembatan Gantung Cek Mbon Masih Terbengkalai PEUREULAK (Waspada): Meski telah menelan anggaran lebih dari Rp3 miliar sejak tahun 2010, namun jembatan gantung di Desa Cek Mbon, Kecamatan Peureulak Kota, Kab. Aceh Timur hingga kini masih terbengkalai dan belum bisa dimanfaatkan. Terkuaknya keterbengkalaian sarana transportasi di pedalaman Aceh Timur itu saat Bupati Aceh Timur Hasballah M. Thaib meninjau jalan dan jembatan di sejumlah titik di Kecamatan Peureulak Kota dan Peureulak Timur, Sabtu (28/7). Bupati berjanji akan memanggil Kepala Dinas Pekerjaan Umum

(PU) Aceh Timur dan pihak rekanan untuk mempertanggungjawabkan anggaran yang sudah dihabiskan untuk pembangunan jembatan itu. Sebagai langkah awal dan sikap Kepala Daerah (KDh) di Aceh Timur, kini Bupati akan menelusuri berbagai anggaran yang diprioritaskan untuk pembangunan jembatan gantung itu sejak dua tahun yang silam dan akan mencari penyebab belum rampungnya jembatan itu. Bupati Aceh Timur kepada Waspada menjelaskan, jembatan gantung dengan panjang lebih dari 120 meter itu di Cek Mbon Kecamatan Peureulak Kota diperkirakan dibangun sejak tahun 2009. Dana APBK yang dikucurkan secara bertahap dari tahun ke tahun dan sifatnya lan-

jutan hingga tahun 2013. Namun hingga tahun 2012 pembangunan jembatan penghubung antar desa itu belum rampung, bahkan telah terbengkalai sejak Januari lalu. Menurut Bupati Hasballah, jika tidak dilanjutkan pembangunannya maka miliaran rupiah anggaran yang dialokasikan oleh pemerintah akan mubajir. Disisi lain, Bupati menilai pembangunan jembatan itu hanya sebatas proyek bersambung yang hanya untuk diambil keuntungan. “Kita akan panggil rekanan yang membangun jembatan ini untuk mempertanggungjawabkan anggaran yang sudah diambil tetapi jembatan belum siap,” kata Bupati Hasballah seraya menambahkan, jikapun nantinya dalam laporan rekanan dan

konsultan pengawas sesuai dengan rencana dan anggaran dihabiskan sesuai dengan persentase proyek maka Pemkab Aceh Timur siap melanjutkan pembangunannya. Dalam kunjungan bupati masa kerja 100 hari itu, Hasballah M. Thaib juga sempat meninjau sejumlah fasilitas umum lainnya yang terbengkalai seperti jembatan Alue On, Kecamatan Peureulak Timur yang kondisinya rusak parah serta meninjau Puskesmas Pembantu (Pustu) Seuneubok Pempeng, Kecamatan Peureulak Kota. Kabarnya, Pustu itu sejak lima tahun tidak difungsikan dan kini sudah terbengkalai. Bahkan pembangunan Pustu itupun tidak sesuai dengan jumlah anggaran yang dialokasikan. (b24)

3.000 Ha Sawah Di Pidie Terancam Gagal Panen SIGLI (Waspada): Sekira 3000 hektare sawah di Kabupaten Pidie dipastikan puso atau gagal panen. Hal ini disebabkan kemarau panjang yang masih melanda daerah itu. Seluas 3.000 hektare sawah yang terancam panen, meliputi Kecamatan Kembang Tangjong seluas 1.100 Ha, Simpang Tiga 813 Ha, Peukan Baro seluas 1.000 Ha dan Indrajaya 1000 Ha. Ismail, 45, petani asal Desa Raya Paya, Kecamatan Simpang Tiga, Minggu (29/7) mengatakan, kekeringan yang melanda Kabupaten Pidie telah terjadi sejak empat bulan lalu. Berbagai upaya untuk mencari sumber air di sepanjang Daerah Aliran

Sungai (DAS) Krueng Baro Raya dan Krueng Tiro selalu gagal, karena sumber air yang bersumber di hulu memang tidak ada akibat musim kemarau. Karena itu, sebut Ismail, lahan padi yang mengalami puso di berbagai kecamatan di Pidie diperkirakan akan terus bertambah, karena tidak adanya sumber air yang bisa dialirkan ke sawah-sawah. Para petani berharap ada bantuan suplai air, sekaligus memberi dana ganti rugi untuk para petani yang tanaman padi mereka mengalami gagal panen. “Kami sebagai petani berharap kepada Bupati Pidie, supaya dapat membantu kami

yang mengalami gagal panen,” katanya. Amir, 37, petani Simpang Tiga lainnya mengatakan, terjadinya gagal panen di Pidie disebabkan Pemkab Pidie melalui dinas terkait tidak tegas dalam mengatur masa tanam kepada para petani, sehingga petani yang sawahnya berada di hilir menanam padi pada saat musim kemarau. Padahal, pada musim kemarau lebih baik Pemkab Pidie melalui dinas pertanian mengarahkan masyarakat petani untuk menanam jenis palawija. Sebenarnya, persoalan pertanian di Pidie masih berkutat pada persoalan saluran yang

masih dangkal. Menurut Amir, banyak saluran pembuang tersier tidak pernah diperhatikan hingga menyebabkan kedangkalan. Padahal setiap tahun dana untuk membersihkan saluran—saluran tersebut selalu dianggarkan DPRK. Karena itu, bila Pemkab Pidie sayang terhadap masyarakat petani, mulai sekarang semua saluran harus diperbaiki, baik skunder, tersier dan pembuang tersier. Bila hal itu tidak dilakukan mulai sekarang maka bila musim penghujan datang air akan tergenang yang dapat menyebabkan tanaman palawija mati. (b10)

LHOKSEUMAWE (Waspada): LSM Perlindungan Konsumen Lhokseumawe mengingatkan masyarakat terhadap penganan berbuka puasa yang berwarna mencolok. Karena selama ini tidak pernah ada pengawasan khusus terhadap makanan dan minuman yang dijual bebas, sehingga disinyalir terdapat banyak makanan menggunakan pewarna tekstil untuk menarik perhatian konsumen. Ketua LSM Perlindungan Konsumen Lhokseumawe, Syahrial NS kepada Waspada, Minggu (29/7) mengungkapkan, berbagai jenis makanan dan minuman untuk penganan berbuka puasa diberi pewarna berlebihan. “Pedagang sengaja membuat makanan dan minuman berwarna mencolok untuk menarik perhatian pembeli,” ungkap Syahrial. Namun tidak ada yang mengatahui jenis pewarna apa yang digunakan. Oleh sebab itu, tambah dia, kita harus mewaspadai terhadap penggunaan pewarna yang biasa digunakan untuk tekstil. Karena menurut dia, pewarna tersebut berbahaya bila dikonsumsi. Sebelumnya, LSM Perlindungan Konsumen Lhokseumawe tersebut mengaku juga telah mengingatkan dinas terkait untuk melakukan pengawasan terhadap penganan berbahaya selama Ramahan. Namun sampai sekarang, upaya itu belum dilakukan.(b15)

Usai Tarawih, Bayi Dibuang LHOKSEUMAWE (Waspada): Teganya, warga di Jalan Darussalam Kecamatan Banda Saki, Kota Lhokseumawe dikejutkan dengan temuan bayi yang baru berusia 3 hari. Bayi itu diletakkan persis di depan Panti Asuhan Muhammadiyah Lhokseumawe, Sabtu (28/7) sekira pukul 22:15. Informasi yang diperoleh Waspada di Rumah Sakit (RS) Sakinah Lhokseumawe menyebutkan, bayi berjenis kelamin laki-laki itu ditemukan petugas Panti Asuhan setempat sekira pukul 22:15 malam setelah orang tak dikenal (OTK) meletakkannya di depan pintu gerbang. Diperkirakan, bayi itu adalah hasil hubungan gelap dan lahir tiga hari yang lalu. Dinilai adanya aksi pembuangan bayi dan pihak Panti Asuhan tidak melayani penitipan bayi sehingga bayi itu diantar oleh pihak Panti Asuhan didampingi personil kepolisian dari Polsek Banda Saksi ke RS Sakinah Lhokseumawe yang berjarak 1 kilometer dari Panti Asuhan. Setiba di RS Sakinah, bayi itu langsung diperiksa kesehatannya dan dirawat di ruangan bayi serta dimasukan ke inkubator. Menurut pengakuan petugas di sana, bayi itu dalam keadaan sehat dan tidak ada tanda penyiksaan ataupun luka di tubuhnya. Hingga kini bayi itu masih dalam perawatan pihak medis. “Bayinya sehat,” kata petugas RS Sakinah. (b24)

Irvansyah, Sejak Lahir Hanya Menjerit Dan Menangis IRVANSYAH adalah anak kedua dari dua bersaudara. Kini dia sudah berusia lima tahun. Anak dari pasangan Mahidin – Halimah itu sebelumnya berdomisili di Birem Bayeun, namun karena tuntutan kebutuhan kelurga yang tinggi keluarga itu kini bermukim di Simpang Jernih, sebuah desa di pinggiran Aceh Timur. Saat dijumpai Waspada Rabu (25/7) lalu, Mahidin mengisahkan berbagai keluhan yang dialami anak laki-lakinya. Mahidin sehari-hari ini hanya bisa menjad buruh kasar di sana, meski hanya mampu menghasilkan Rp50.000 per hari dari upah, namun Mahidin tetap mempertahankan hidup bersama dua anaknya dan seorang istri. Menurut Mahidin, Irvansyah mengalami gangguan penglihatan dan gangguan komunikasi sejak lahir. Kini, dia hanya bisa mampu menjerit dan hanya mampu menangis serta merengek-rengek bersama ibu dan ayahnya. Sifat amarah selalu menyelimuti dirinya. Meski menetap di sebuah kios gampong (desa pinggiran— red), namun kondisi Irvansyah sudah dimaklumi oleh masyarakat disana yang menjadi kebisaan menjerit dan menangis, meski terkadang tengah malam. Dari beberapa kali konsultasi dengan pihak medis di sana, lanjut Mahidin, bola mata

Irvansyah terjadi katarak sehingga dia tidak bisa melihat. Sementara urat sarafnya keras sejak kecil. Selain itu, pendengarannya jugaa terganggu, sehingga terkadang Ivansyah memukul kepalanya sendiri dengan keras. “Anak saya (Irvansyah— red) terganggu pendengaran, penglihatan dan gangguan komunikasi sejak kecil,” kata Mahidin. Tiga panca indra Irvaansyah terganggu sejak kecil. Pihak medis seperti telah menyerah dengan kondisi Irvansyah yang sejak kecil mengalami gangguan sejak kecil. Secara ilmu medis, ketiga panca indranya karena pertumbuhannya yang tidak normal. Sehingga penglihatan, pendengaran dan komunikasinya terganggu. Kini Irvansyah hanya mampu menjerit dan menangis. Orangtuanya berharap agar pihak medis mampu mengobati anaknya, sehingga bisa menimba ilmu pengetahuan sebagaimana teman seusianya. Ketua Ikatan Dokter Indonesia (IDI) Aceh Timur, dr H Zulfikri, M.Kes saat dikonfirmasi menjelaskan, kejadian yang muncul pada seseoraang anak karena perkembangan bahasa, pendengaran dan penglihatan yang tidak stabil sesuai dengan usia pertumbuhan. Untuk perkembangan bahasa seseorang akan mempengaruhi perkembangan bicara.

Menurut dr Zulfikri, untuk perkembangan bahasa biasanya dipengaruhi situasi dan kondisi lingkungan dimana anak dibesarkan. Kelainan bicara merupakan salah satu jenis kelainan atau gangguan perilaku komunikasi yang ditandai dengan adanya kesalahan proses produksi bunyi bicara. Kelainan proses produksi menyebabkan kesalahan artikulasi fonem, baik dalam titik artikulasinya maupun cara pe-

ngucapannya, akibatnya terjadi kesalahan seperti penggantian atau substitusi atau penghilangan ataupun omosi. “Kita belum bisa memastikan penyebabnya dan penyakit yang dideranya, karena kita belum melihatnya. Tapi, kebiasaan kondisi itu terjadi karena adanya gangguan dan pertumbuhan yang tidak normal,” tandas dr H Zulfikri. Muhammad H. Ishak

Waspada/Muhammad H. Ishak

IRVANSYAH yang sudah berusia lima tahun belum mampu bicara, mendengar dan melihat secara normal karena terjadi gangguan serta memiliki kelainan sejak lahir. Foto direkam, Rabu (25/7).

Waspada/Muhammad H. Ishak

TENAGA medis RS Sakinah Lhokseumawe memperlihatkan bayi dibuang di depan Panti Asuhan Muhammadiyah Jalan Darussalam, Kecamatan Banda Sakti, Sabtu (28/7) sekira pukul 22:15.

Kuah Pliek U Mampu Bangkitkan Gairah Dan Kekebalan Tubuh KUAH PLIEK U merupakan kuah khas masyarakat Aceh. Kalau melihat dari warnanya, siapa pun tidak akan mau mencicipi kuah tersebut. Namun sekali mencoba dipastikan akan ketagihan. Rasa kuah pliek U terbilang cukup unik, karena campuran berbagai rasa dan kaya akan vitamin serta zat-zat yang dapat membangkitkan gairah dan kekebalan tubuh. Makan kuah pliek U sama dengan makan puluhan jenis sayuran. Bahan-bahan untuk membuat kuah pliek U yaitu Buah nangka muda, santan kelapa, daun melinjo, buah melinjo, udang, rebung bambu dan rebung kala, boh trueng cawing, dengan bahan utamanya Pliek U serta beberapa sayuran lainnya. Jika ada yang mengatakan, kuah Pliek U melambangkan kekerabatan dan keanekaragaman dalam masyarakat Aceh yang dikumpulkan dalam satu kuali itu sangat benar. Karena itupula yang membuat rasa kuah Pliek U sangat unik, dan terbukti hari ini, kuah tersebut disukai oleh siapa pun dari manapu dia berasal. Pliek U dibuat dari kelapa yang didiamkan beberapa hari, lalu diperas dan diambil minyaknya, sedangkan sisanya dijemur. “Saya pernah tinggal lama di Pulau Jawa, dan ketika itu saya sangat rindu sekali dengan kuah Pliek U. Pengen sekali makan kuah itu, tapi saya tidak bisa memasaknya. Mendengar sebutan kuah Pliek, jadi ngences rasanya,” kata Kusyairi, 40, warga Keude SP Jalan Seunuddon, Aceh Utara. Kuah Pliek U bukan hanya enak dinikmati pada hari-hari tertentu, tapi juga enak jika dikonsumsi saat berbuka puasa. Kuah Pliek U akan menjadi lebih enak jika dimakan dengan nasi panas dan ikan asin. Selamat mencoba. Maimun Asnawi


Aceh

WASPADA Senin 30 Juli 2012

Arus Lalin Dan Pasar Macat Jelang Buka Puasa

Mantan Bupati Aceh Besar Jadi Kakanwil BPN Kalsel BANDA ACEH (Waspada): Mantan Bupati Aceh Besar periode 1999-2004 H Sayuthi Is dilantik dan diambil sumpahnya sebagai Kepala KantorWilayah Badan Pertanahan Nasional (BPN) Provinsi Kalimantan Selatan. Pelantikan oleh Kepala BPN Hendarman Supandji di Jakarta, Kamis (26/7) lalu. Dalam pembicaraan dengan Waspada melalui handphone, Sabtu (28/7) sore, H. Sayuthi Is menyatakan, serah-terima jabatan dengan Kakanwil BPN Kalimantas Selatan yang lama akan belangsung di Banjarmasin, 2 Agustus mendatang. Sayuthi Is yang sebelumnya adalah Direktur Wilayah Pesisir, Pulau-Pulau Kecil, Perbatasan danWilayahTertentu (WP3WT) BPN Pusat mengharapkan doa dan dukungan masyarakat Aceh, khususnya masyarakat Aceh Besar, agar diberikan kesehatan dan kekuatan oleh Allah SWT untuk kelancaran dan kesuksesan melaksanakan tugas-tugas sebagai Kakanwil BPN di Kalimantan Selatan. Sebelum bertugas di Kantor BPN Pusat, H. Sayuthi Is pernah menjabat Asisten I Setdaprov Aceh dan Kepala Kantor Wilayah BPN Aceh. (b05)

Disbudpar Sabang Buka Pendaftaran Calon Duta Wisata 2012. SABANG (Waspada): Dinas Kebudayaan dan Pariwisata Kota Sabang, mengatakan sejak 26 Juli pihaknya telah membuka pendaftaran pemilihan calon Cut Abang/Cut Adek sebagai duta Wisata Kota Sabang. Kabid Pemasaran dan Promosi Disbudpar Kota Sabang M. Ali Taufik dalam percakapan dengan wartawan jumat (27/7) mengatakan, pihaknya sudah membuka pendaftaran sejak Kamis 26 Juli hingga 7 Agustus 2012 mendatang. Dia menjelaskan persyaratan yang harus dipenuhi untuk seleksi duta Cut Bang dan Cut Adek antara lain pria dan wanita berusia 16 -25 tahun dan belum pernah menjadi duta wisata.(b31)

Tugas Luar, Bupati Aceh Singkil Absen Safari Ramadhan Pertama RIMO, Aceh Singkil(Waspada): Bupati Aceh Singkil H Safriadi berhalangan hadir bersama rombongan tim 1 Safari Ramadhan perdana ke Masjid Kampung Sebatang, Gunung Meriah, Aceh Singkil, Kamis (26/7) Safriadi dilaporkan sedang bertugas ke luar daerah “Beliau sedang ada tugas ke Jakarta,” jelas Khaldum, Kabag Humas dan Protokoler Setdakab. disela jelang buka puasa di Tanah Merah, rumah Camat Gunung Meriah. Ketua tim 1 Safari Ramadhan ke Gunung Meriah kemudian dipimpin Kapolres Aceh Singkil AKBP Bambang Syafrianto didampingi ketua MPU Ustadz H Rasyiduddin, Asisten Tata pemerintahan Drs Azmi dan pejabat eselon dua lain yang tergabung dalam tim 1 Empat Tim Safari Ramadhan kabupaten Aceh Singkil secara bersamaan turun ke Empat kecamatan, Kamis (26/7) Tiga tim lainnya, meliputi Tim 2, dipimpin Wakil Bupati Dulmusrid didampingi ketua DPRK melakukan kunjungan ke Masjid Kampung Kuta Tinggi, Kec Simpang Kanan.Tim 3, diketuai Sekdakab Drs HM Yakub KS. MM bersama rombongan berkunjung ke Masjid Kampung Pemuka Baru, Kec. Singkil. Tim 4, dipimpin Dandim Letkol Afson R Sirait didampingi KajariYuswadi dan rombongan berkunjung ke Masjid Kampung Biskang, Kec. Danau Paris(b27)

PUGAR Latih Kader Audit Kesehatan TAKENGEN (Waspada): LSM PUGAR melakukan training auditor sosial warga, terhadap program Jaminan Kesehatan Aceh (JKA). Kader masyarakat dari kabupaten Aceh Selatan, Aceh Besar, dan Aceh Tengah , selama dua hari mendapat pemahaman bagaimana melakukan pengawasan terhadap program pemerintah, khususnya JKA. Pj Bupati Aceh Tengah Mohd. Tanwier, menyambut positif upaya yang dilakukan PUGAR, selama dua hari di Hotel Penemas, Takengen, Sabtu dan Minggu ( 28-29/7). Menurut bupati, keterlibatan masyarakat dalam upaya memperbaiki program sangat dibutuhkan. Menurut KetuaYayasan PUGAR Aceh, Muhammad Hamzah, program JKA di Aceh telah menyedot dana ratusan miliar rupiah. Namun ironisnya penyediaan fasilitas pendudukung belum memadai. Kondisi ini tidak hanya terjadi pada Puskesmas, tetapi pada RSU tingkat kabupaten dan provinsi. PUGAR dan Tifa sudah melaksanakan training ini sejak,2011. Pada saat itu masih terkonsentrasi di Aceh Besar dan Pidie. Pada 2012 dilaksanakan untuk di Aceh Besar, Aceh Tengah, Aceh Selatan. Tujuannya kegiatan guna memastikan supaya hak warga dalam mendapatkan layanan kesehatan benar-benar terjamin dan diberikan sesuai dengan standar, sebut Hamzah. (b32)

Kepala Daerah Perlu Kedepankan Keteladanan Dan Kepentingan Umat REDELONG (Waspada): Berbagai persoalan yang masih kerap terjadi di tengah-tengah masyarakat, seperti memudarnya nilai etika dan kehidupan sosial masyarakat, pencurian, kasus miras, peredaran petasan ilegal, dan sejenisnya,bisa dituntaskan dengan keteladanan yang ditunjukkan oleh para pemimpinnya. Hal ini seperti yang dikatakan anggota DPR-RI asal Aceh H. Raihan Iskandar, Lc.MM kepada Waspada, Minggu (29/7.” Mereka harus mau turun ke bawah melihat realitas yang terjadi di masyarakat. Mereka perlu mengedepankan hidup sederhana. Bisa menjaga empati masyarakat, di tengah kesulitan ekonomi dengan melambungnya harga-harga saat Ramadhan dan jelang Idul Fitri ini,” sebut anggota DPR-RI dari PKS ini. Selanjutnya, terpilihnya mereka menjadi Kepala Daerah adalah karena masyarakat mengharapkan agar mereka bisa menyejahterakan masyarakat. Janj-janji mereka selama kampanye untuk berjuang demi masyarakat harus ditunaikan saat mereka berkuasa. Oleh karena itu, kebijakan-kebijakan yang nantinya dijalankan haruslah berorientasi untuk kepentingan masyarakat. Misalnya, mereka harus meningkatkan kualitas pendidikan, hidup, dan ekonomi masyarakat. (b33)

Menkes Puji Soal Penerapan Area Bebas Rokok Di Banda Aceh BANDA ACEH(Waspada):Menteri Kesehatan RI dr Nafsiah Mboi, Sp.A, MPH memuji langkah Wali kota Banda Aceh dalam menerapkan “ kawasan tanpa rokok “ beberapa waktu lau di Kota Banda Aceh. “Kebijakan peraturan Wali kota sangat relevan terhadap program WHO tentang pencegahan dan pengurangan angka kematian akibat merokok,” ungkap Nafsiah ketika mencanangkan Pos Pembinaan Terpadu Penyakit Tidak Menular (Posbindu PTM) di Alue Deah Teungoh Kecamatan Meuraxa Banda Aceh, Rabu (25/7), sore. Kata dia, saat ini semakin banyak orang terserang penyakit tidak menular karena menjalankan gaya hidup yang tidak sehat. Salah satunya adalah merokok. “Dari asap rokok, seorang bapak dapat terkena penyakit impotensi, hipertensi, diabetes, stroke, kanker, dan penyakit lainnya, di tengah-tengah masyarakat “, jelas Menkes. Pada kesempatan itu, Menkes memberi apresiasi kepada Pemko Banda Aceh atas pencanangan Posbindu PTM tersebut. Menurutnya dengan hadirnya Posbindu PTM di Gampong Alue Deah Teungoh akan mampu mendeteksi secara dini faktor risiko penyakit tidak menular di masyarakat. Adapun sasaran pemeriksaan penyakit tidak menular tersebut, kata dia, adalah remaja umur 18 tahun keatas. Ia juga berharap melalui Posbindu PTM ini angka stroke di provinsi Aceh dapat dikurangi.(b02)

B7

Waspada / Rusli Ismail

RUAS JALAN dalam Kota Banda Aceh selama Ramadhan, selain dipadati kenderaan juga dipadati para pedagang musiman yang menjual berbagai jenis penganan berbuka. Suasana kepadatan arus kenderaan Simpang Lima Banda Aceh, Sabtu (28/7) macet total. Padahal di hari-hari biasa suasananya agak lengang.

Pemerintah Aceh Stop Sementara Izin Tambang Dan Perkebunan Termasuk PT Kalista Alam BANDA CEH (Waspada): Pemerintah Aceh untuk sementara menghentikan penerbitan izin-izin yang terkait dengan pertambangan dan perkebunan. Sementara bagi izin-izin yang sudah, sedang dan akan dikeluarkan semua akan dikaji ulang. “Gubernur Zaini Abdullah menyatakan akan menyetop sementara penerbitan izin-izin pertambangan dan perkebunan,” ungkap Makmur Ibrahim, Kepala Biro Hukum dan Humas Setda Aceh, kepada Waspada, Jumat (27/7) di Banda Aceh. Penegasan itu, sebut Makmur, disampaikan gubernur dalam rapat dengan dinas dan

badan terkait yang berlangsung Kamis (26/7) di ruang rapat gubernur. “Rapat ini akan dilanjutkan pada Selasa pekan depan membahas yang lebih teknis,” sebutnya. Karo Hukum dan Humas Setda Aceh ini mengatakan Gubernur Zaini Abdullah juga menegaskan terhadap izin-izin yang telah, sedang dan akan dikeluarkan akan dievaluasi kembali. “Gubernur akan mengkaji ulang semua izin-izin tersebut,” ujarnya. Terkait dengan izin perkebunan PT Kalista Alam di kawasan Rawa Tripa, Kabupaten Nagan Raya, yang telah menjadi isu nasional, sebagaimana disampaikan gubernur, kata Makmur, termasuk yang akan evaluasi bersama PT Surya Panen Subur II. Kata dia, dalam perizinan

PT Kalista Alam itu ada klausul yang menegaskan tidak boleh membakar dalam membuka lahan. Berbagai informasi di media massa tentang isu pembakaran ini, dan sejumlah tim yang melakukan investigasi ke Rawa Tripa. “Tapi itu semua akan dievaluasi kembali, dan kalau memang terbukti nanti setelah dievaluasi izin perusahaan perkebunan tersebut bisa saja dicabut karena melanggar izin karena larangan membakar hutan ini ada peraturannya,” imbuh Makmur. Sejak awal kepemimpinan ‘Zikir’ sudah menyatakan akan mengevaluasi kembali masalah perizinan terkait pertambangan dan perkebunan di Aceh. Termasuk komitmennya menangani illegal loging guna menjaga lingkungan hidup. (b06)

Bank Aceh Luruskan Analisis GeRAk Soal Kredit Macet BANDA ACEH (Waspada): Dugaan PT Hananan Prakarsa mendapat kucuran kredit Rp1,5 miliar melanggar ketentuan perbankan dan macet dalam pengembalian yang dibeberkan oleh GeRAK Aceh ditepis oleh Dirut Bank Aceh, Islamuddin. “Kita memberikan kredit kepada PT Hananan Prakarsa sesuai prosedur. Jadi, tidak ada masalah, apalagi perusahaan sudah melunasi kewajibannya,” kata Dirut Bank Aceh ini menanggapi pertanyaan Waspada, Jumat (27/7) sehubungan ada tudingan dari GeRAK Aceh perusahaan ini mendapat kemudahan kucuran kredit yang berpotensi merugikan keuangan daerah karena macet. Islamuddin juga menjelaskan, nilai kredit yang diberikan kepada perusahaan itu bukan Rp1,5 miliar, melainkan Rp700 juta. Angka Rp1,5 miliar itu nilai plafon. “Juni lalu sudah lunas, jadi tidak benar terjadi macet

pembayaran,”katanya. Walau ia akui, sempat jatuh tempo sekitar tiga minggu akibat keterlambatan pencairan dana proyek dari perusahaan itu. GeRAK Aceh sebelumnya merilis analisis pemberian kredit kepada PT Hananan Prakarsa berbau KKN, melanggar ketentuan perbankan dan kebijakan itu dilanggar secara sengaja oleh managemen Bank Aceh untuk mempermudah pencairan dana segar kepada perusahaan itu. Misalnya, hasil rapat direksi pencairan kredit diputuskan, 17 Oktober 2011, tapi pada 14 Oktober kredit sudah cair, selain itu agunan tidak cukup dan atas nama orang lain dan tidak mengcover nilai pinjaman serta sejumlah kejanggalan lain. Dia ntaranya, sebut GeRAK, nota dinas Irfan Sofni secara khusus mencantumkan nama perusahaan yang disetujui untuk mendapat kredit. Nota ini,

menurut Koordinator GerAK Aceh, Askhalani, PT Hananan Prakarsa mendapat fasilitas khusus atau prioritas. Sehingga pemberian kredit ini, kata Askhalani beraroma KKN dan mengabaikan prinsip kehati-hatian perbankan. Tapi hal itu juga dibantah oleh Direktur Operasional Bank Aceh, Irfan Sofni yang ditemui Waspada sebelum ia berangkat umrah, kemarin. “Posisi saya saat itu, menggantikan posisi Dirut (pejabat pengganti) karena Islamuddin sedang dinas luar. Dan saya tidak boleh meloloskan kredit, karena tidak dalam kapasitas sebagai Dirut.” Bagi Irfan Sofni, soal ini tidak ada nilai beritanya. Sebab, kata dia, kredit sudah lunas, pihak perusahaan juga mencantumkan agunan berupa ruko yang nilainya lebih besar dari jumlah kredit yang diberikan dan semua persyaratan sudah dilengkapi perusahaan untuk mendapat fasilitas kredit. (b01)

BANDA ACEH (Waspada) : Arus lalulintas di sejumlah jalan utama dalam Kota Banda Aceh dan sebagian Aceh Besar, sejak awal puasa hingga hari ke 8 Ramadhan 1433 H, Sabtu (28/7) cukup padat pada sore hari menjelang berbuka puasa. Akibatnya, kemacetan pun terjadi di sejumlah jalan utama diantaranya Jalan Mohd. Jam, Jln.Tgk Dibaroh, Jalan Diponegoro, Jalan Tgk. Chik Pante Kulu, Jln. Panglima Polem, Jln. Supratman, dan sejumlah jalan lainnya dalam Kota Banda Aceh. Suasana kemacetan juga terjadi di jalan utama Lambaro,KecamatanInginJaya,Kabu-patenAceh Besar, sehingga harus mendapat pengawasan/ pengaturan khusus dari aparat kepolisian dan DinasPerhubungan, kataBasri,wargaBandaAceh kepada Waspada, Sabtu (28/7).

Seperti di simpang Jalan Mohd Jam/Tgk.Dibaroh, jika pada hari biasa tidak ada petugas di sana. Namun, selama Ramadhan ini setidaknya ada 2 sampai 4 petugas polisi pegawai Dishub harus bekerja keras mulai pukul 16:00 sampai menjelang berbuka puasa. Pantauan Waspada, pada sore hari, warga membanjiri Kota Banda Aceh dan Pasar Lambaro, Aceh Besar sehingga badan jalan yang sempit tak mampu menampung ledakan pengunjung yang berlalu lalang melintas. “Kebanyakan masyarakat menggunakan kendaraan untuk jalan-jalan menikmati suasana sore sambil menunggu waktu berbuka. Dan sambil pulang menyempatkan diri membeli penganan berbuka. Selain juga ada yang berbelanja berbagai kebutuhan,“kata seorang petugas Satlantas kepada Waspada, Sabtu (28/7). (b09)

Anggota DPD RI Terima Laporan Calon Bidan PTT Di Aceh Tengah TAKENGEN (Waspada): Merasa dirugikan karena hasil kelulusan dinyatakan batal oleh pihak terkait. Sebanyak puluhan calon bidan Pegawai TidakTetap (PTT) AcehTengah kembali membuat pengaduan kepada anggota DPD RI. “Kami akan tindaklanjuti setiap laporan calon bidan PTT Aceh Tengah ini. Bahkan kita telah meminta kepada mereka untuk membuat pengaduan secara resmi, tidak melalui lisan. Sehingga memudahkan proses pengusutannya,” ungkap Mursid, anggota DPD RI kepada Waspada, Minggu (29/7), setelah menerima laporan para calon bidan PTT di Takengen. Menurutnya, berdasarkan laporan para calon bidan PTT dan orangtua bidan ke pihaknya, terjadi kejanggalan mengenai pernyataan dr Sukri Maha, Kadis Kesehatan Aceh Tengah yang menyebutkan, pengumuman batal. Hal itu karena ada pemalsuan tanda tangan, stempel dan kop surat. “Harusnya hasil pengumuman bidan PTT melalui internet tersebut dinyatakan palsu atau tidak sah, apabila telah dilakukan tes forensik ke Mabes Polri. Namun apabila hal itu belum

dilakukan oleh Dinkes Aceh Tengah, hal ini saya duga salah satu kejanggalan yang harus ditelusuri,” jelasnya. Karena itu lanjut Mursyid, setelah menerima laporan resmi dari para calon bidan PTT atau orang tua calon bidan, pihaknya akan segera mempertanyakan mekanisme pengumuman kelulusan yang sebelumnya telah dikeluarkan oleh Menkes RI via online. Sementara di hadapan anggota DPD RI, puluhan calon bidan PTT juga menyebutkan akan melakukan demo kembali ke kantor DPRK Aceh Tengah. Mereka akan meminta peran semua pihak yang menanggani kasus tersebut untuk berbuat jujur, transparan dan tidak mengutamakan kepentingan pribadi. “Besok (Senin 30/7-red) kami akan kembali melakukan demo ke DPRK. Kami berharap pihak terkait tidak bermain-main dalam menanggapi tuntunan yang telah disampaikan sebelumnya. Dan kami berharap tidak ada perubahan mengenai hasil pengumuman bidan PTT yang sebelumnya telah kami lihat di internet,” kata para calon bidan PTT. (cb09)

Pinjaman Pemkab Ke Bank Aceh Bayar Gaji 13 Jadi Perbincangan Hangat KUTACANE (Waspada) : Pinjaman atau longgar tarik yang diajukan Bupati ke Bank Aceh senilai Rp22 miliar ,untuk membayar gaji 13 ribuan Pegawai Negeri Sipil (PNS) yang sempat melakukan demo, jadi perbincangan hangat dan dituding sarat masalah. Pasalnya, selain dipenuhi kejanggalan dan membuat perwakilan ribuan PNS mengadukan kasus gaji 13 ke pihak kepolisian, proses pencairan pinjaman atau kredit longgar tarik yang diajukan Bupati ke Bank Aceh dinilai janggal. Khabarnya, kata seorang PNS senior di Agara, untuk membayar gaji 13 , Pemkab harus mengajukan pinjaman ke Bank Aceh senilai Rp22 M, kendati sebelumnya di Januari lalu, Pemkab telah mengajukan pinjaman senilai Rp30 M. Sedangkan dana gaji 13 yang disisihkan setiap tahunya dari DAU, ditengarai telah digunakan untuk dana Pilkada Bupati/Wakil Bupati, akibat tak mampunya keuangan daerah, Bupati terpaksa mengajukan pinjaman kredit longgar tarik ke Bank Aceh. Pinjaman yang diajukan Bupati ke Bank Aceh, timpal sumber Waspada lainnya, sangat mengherankan dan sangat bertentangan dengan PP No.30 Tahun 2011 tentang pinjaman daerah dan batas waktu jabatan Bupati serta Peraturan Menteri Keuangan No.127/PMK.07/ 2011. Masalahnya, jabatan Bupati H Hasanuddin hanya sampai 1 September 2012, sedangkan angsuran dan bunga hutang yang harus dibayar daerah sampai Januari 2013, setiap bulannya senilai Rp4.380.666.667. Hal itu jelas bertentangan dengan PP 30/2011,” lantas siapa yang harus membayar beban utang daerah, jika H

Hasanuddin tak terpilih lagi jadi Bupati,” ujar sumber Waspada. Disetujuinya pinjaman Daerah Agara ke BPD Aceh juga santer disebut-sebut tidak disetujui salah seorang pimpinan di DPRK Agara.Wakil Ketua DPRK Nazaruddin kepada Waspada, Kamis (26/7) mengaku, tak pernah dilibatkan dan dimintai persetujuannya soal kredit longgar tarik senilai Rp20 M yang diajukan ke Bank Aceh untuk membayar gaji 13 PNS, demikian juga pinjaman Pemkab Agara tahap I senilai Rp.30 M yang diajukan Bupati pada Januari lalu. Sebab itu, untuk menghindari jeratan hukum dan tak ingin ikut-ikutan membebani keuangan daerah, Nazar mengaku telah melayangkan surat keberatan ke Badan Kehormatan DPRK tentang pinjaman Pemerintah Daerah ke PT Bank Aceh tanggal 16 Juli lalu.” Saya tidak diminta hadir untuk rapat pleno tentang pembahasan pinjaman ke PT Bank Aceh dan saya juga tidak menandatangani persertujuan peminjaman tersebut,” ujar Nazaruddin. Pinca Bank Aceh Kutacane Bantah Ikut Terlibat Pimpinan Cabang Bank Aceh Cabang Kutacane, Armada.SE yang disebut-sebut ikut berperan mengucurkannya kredit longgar tarik yang membebani keuangan daerah Agara tersebut, kepada Waspada, Kamis (26/7) membantah ikut terlibat dalam kasus gaji 13 yang diawali dengan kredit longgar tarik,” saya tidak tahu apakah Pemkab Agara ada meminjam ke BPD Aceh , apalagi kalau ditanyakan jumlahnya , saya jelas tidak tahu, karena itu kewenangan PT Bank Aceh di Banda Aceh,” ujar Armada.(b26)

Takengen Atau Takengon? PEMDA Aceh Tengah sampai kni masih menggunakan Takengon sebagai ibukota Kabupaten Aceh Tengah. Sementara DPRK Aceh Tengah dalam perayaan hari jadi kota di negeri dingin yang ke-435, memasang baner besar, menuliskan Kute (kota-) Takengen, bukan Takengon. Mana yang benar, Takengen atau Takengon? Penetapan hari jadi Takengen sebagai kota, menurut DPRK Aceh Tengah bukanlah kehendak penguasa, namun setelah melalui proses yang sangat panjang. Seluruh tokoh Gayo diundang dan menyampaikan pandangannya. Tim Panmus dibentuk dewan, untuk menentukan hari jadi Kute Takengen. Walau Takengon merupakan peninggalan Belanda, namun Pemda Aceh Tengah masih tetap menabalkan nama itu sebagai ibu kota resmi Aceh Tengah secara pemerintahan. “Dari seluruh media yang ada, hanya Waspada yang berani melakukan terobosan. Mengembalikan sejarah Gayo dengan menyebutkan Takengen, bukan Takengon. Kami ucapkan terima kasih kepada Waspada dan kami sudah sampaikan piagam penghargaan, walau ke pribadi wartawannya,” kata Muhammad Ridwan, anggota DPRK Aceh Tengah, menjawab Waspada, Kamis (26/7) di Takengen. Menurut ketua Panmus pe-

netapan HUT Kute Takengen ini, sejak diputuskan dalam qanun dua tahun lalu, Waspada aktif menyuarakan proses penetapan HUT dan sudah menabalkan nama Takengen. Mengapa Pemda Aceh Tengah masih tetap dengan nama Takengon? “Mengubah nama Takengen dari Takengon, walau hanya satu huruf prosesnya panjang dan rumit. Harus ada hukum resmi. Harus dirubah dalam lembaran negara, karena nama Takengon sudah dituangkan dalam lembaran negara,” kata Ridwan. “Dana untuk merubah satu huruf itu cukup besar dan melalui proses panjang. Makanya untuk sementara kita tetapkan Takengon nama lain dari Takengen,” jelas Samar Nawan, anggota DPRK Aceh Tengah lainnya. Demikian bila ada wacana merubah nama Kabupaten Aceh Tengah menjadi Kabupaten Tanoh Gayo. Prosesnya panjang dan membutuhkan biaya. “Makanya untuk sementara kita pakai yang ada saja dulu, yakni Takengon, walau orang Gayo tetap tahu yang sebenarnya Takengen,” tutur Samar. Penetapan Takengen sebagai ibu kota Kabupaten Aceh Tengah, sudah dilakukan DPRK setempat pada akhir 2010. Sebelumnya makna kota di negeri dingin itu diterjemahkan beragam. Ada yang menyebutkan

Takingen, Takengon dan Takengen. Namun setelah lahir qanun, akhirnya ditetapkan nama Takengen dan tahun awal berdirinya kota ini, 1.577 Masehi atau 435 tahun lalu. Hampir semua tokoh masyarakat yang diundang dewan, saat penetapan hari jadi Kute (kota) Takengen menceritakan bahwa Kute Takengen sudah ada pada masa Kerajaan Linge. Keturunan reje (raja) Linge inilah yang melahirkan raja terkemuka Aceh Darussalam. “Sudah menjadi catatan sejarah putra Linge, Meurah Johan yang mendirikan kerajaan Aceh Darussalam. Sebelum raja Aceh Darussalam, Sultan Iskandar Muda wafat, Takengen sudah ada,” papar M Jihad, tokoh masyarakat dari Bintang dan Rasyidin, tokoh masyarakat Linge. Iskandar Muda wafat, kata Jihad, tahun 1636 M. Sebelumnya Qurata Aini atau yang lebih dikenal dengan sebutan Datu Beru yang merupakan anak dari reja Linge, sudah bolak-balik ke kuteni reje (sekarang Banda Aceh). Empu Beru wafat pada 1.500 M. Kata-kata Takengen, keluar dari mulut Sengeda anak reje Linge yang mengantarkan gajah putih ku Kute Ni Reje. Sengeda menempuh rute dari Linge via Serule, menuju arah timur Danau Lut Tawar. Di sanalah terucap kata-

Waspada/ Bahtiar Gayo

DPRK Aceh Tengah memasang spanduk besar saat menyemarakkan HUT Kute Takengen, bukan Takengon. kata “sentan ku engon (saat kulihat), maknanya alam yang indah. Dan dibulatkanlah musyawarah (keng ni pakat). Takengen sendiri merupakan perpaduan dua kalimat itu, indahnya alam Gayo dengan bulatnya musyawarah. Dari Tekengen berubah menjadi Takengon seperti saat sekarang ini, merupakan peninggalan penjajahan Belanda. Pihak kolonial merubah huruf e menjadi o sehingga nama Takengen berubah menjadi Take-

ngon. Perubahan nama yang ditabalkan Belanda bukan hanya Takengen, namun Bebesen diubah menjadi Bobasan. Remesen diubah menjadi Ramasan. Belang Gele dirubah kolonial menjadi Blang Golo. Namun karena nama Bebesen, Blang Gele dan Remesen tidak tertuang dalam lembaran negara, untuk mengembalikannya ke nama asalnya sangat mudah. Berbeda dengan perubahan dari Takengon menjadi

Takengen. Harus dituangkan dalam lembaran negara dan membutuhkan biaya besar. Menurut Muhammad Ridwan, pemakaian nama Takengon tidak menjadi masalah, bila belum dirubah ke Takengen, karena orang Gayo tahu maknanya. Tidak ada tutur kata di Gayo, baik dalam didong (seni khas daerah), saer, melengkan (pepatah Gayo) yang menyebutkan Takengon, tetapi semuanya sejak dahulu kala tetap menyebutnya Takengen. (b32)


Opini

B8 TAJUK RENCANA

Perberat Hukuman Koruptor

P

emberantasan korupsi harus menghasilkan efek deterrence (penangkalan atau efek jera), tidak cukup hanya hukuman badan tapi harus dikembangkan dengan biaya sosial korupsi sehingga para koruptor menanggung biaya sosial yang dihasilkan dari perbuatannya. Fakta membuktikan hukuman yang bersifat nonbadan seperti denda, uang atau ongkos perkara tidak sepenuhnya dapat merefleksikan dampak korupsi yang ditimbulkan koruptor. Menurut perhitungan Mahkamah Agung, pada periode 2001- 2009 negara harus mengeluarkan biaya untuk mencegah dan menangani korupsi sejumlah Rp73 triliun, namun biaya yang dibebankan kepada koruptor hanya Rp5,32 triliun. Hal itulah yang membuat KPK prihatin, seperti diutarakan Wakil Ketua KPK Bambang Widjojanto. Menurut pakar “Crime Economics” dari Universitas Gadjah Mada Rimawan Pradiptyo yang juga hadir dalam jumpa pers bersama pimpinan KPK, Kamis lalu, ada selisih Rp67,7 triliun yang akhirnya dibebankan kepada para pembayar pajak. Jelas ini tidak adil. Uang demikian besar seharusnya dapat membantu masyarakat miskin, menggerakkan perekonomian kaum dhuafa sehingga kesenjangan sosial tidak semakin melebar. Masalah penangkalan atau efek jera memang positif dan harusnya diprioritaskan oleh semua aparat penegak hukum, terutama KPK. Begitu juga upaya memiskinkan para koruptor yang selama ini hukuman bagi pencuri uang negara sangat ringan, sehingga selesai menjalani hukuman badan 1-2 tahun sudah bisa menghirup udara bebas dan masyarakat tetap mengelu-elukannya, mengapa? Hal ini disebabkan harta kekayaannya masih banyak (melimpah), sehingga mereka gambang memberi bantuan sembako dll sementara kondisi ekonomi rata-rata masyarakat masih miskin maka koruptor pun tetap dihormati masyarakat. Nah, kalau kita sungguh-sungguh ingin memberantas korupsi yang perlu disadarkan terlebih dahulu adalah aparat penegak hukumnya. Mereka harus mengerti apa yang disebut dengan extra ordinary crime, kejahatan yang sangat luar biasa. Sayangnya, hukuman kepada para koruptor oleh para hakim kita pada umumnya ringan sehingga tidak menimbulkan efek jera. Malah membuat korupsi semakin membudaya, dan itulah yang terjadi di negeri kita dewasa ini. Anehnya, terhadap pelaku kejahatan tergolong extra ordinary hakim tak berani menjatuhkan hukuman maksimal. Jangankan hukuman mati, hukuman seumur hidup, atau 20 tahun penjara saja nyaris tak terdengar. Inilah paradoksnya hukum di Indonesia, sebaliknya terhadap pencuri beberapa kilogram kakao, mencuri semangka, Intisari para aparat penegak hukum sangat serius menegakkan efek jera. Seharusnya hukuman berat dan hukuman Perilaku korup membu- tambahan dengan merampas dan menyita kekayaan serta sanksi sosial diterapkan daya di Indonesia dise- harta bagi para koruptor. Sehingga efek jeranya babkan lemahnya pene- benar-benar mencuat. Para pelakunya kakeluarganya menderita, lingkungan gakan hukum tak me- pok, kerjanya takut mengulang kesalahan mantan bosnya, termasuk di masyarakat mereka nimbulkan efek jera dikucilkan. Bila perlu semua pelaku koruptor diharuskan melakukan kerja bakti mengorek parit, menyapu jalan, mengutip sampah, lengkap dengan identitasnya dipublikasikan media massa. Bukan dengan memberi pakaian tahanan ala KPK, takkan ada dampaknya bagi koruptor! Justru itu, mindset aparat penegak hukum, terutama polisi, jaksa, hakim harusnya berubah. Terkait hukuman para koruptor harus ditambah dengan hukuman maksimal, segera ditangani, divonis berat, jangan diberi grasi, sehingga menimbulkan efek takut di semua elemen masyarakat, terutama eksekutif, legislatif, dan judikatif. Hanya dengan begitu kita bisa sedikit optimis kejahatan korupsi menjadi semakin berkurang. Jika tidak, kejahatan yang memiskinkan rakyat dan dapat membangkrutkan negara itu akan semakin marak di semua departemen, seakan korupsi merupakan gaya hidup dan budaya bangsa kita. Kondisi seperti itulah yang tampaknya tumbuh di masyarakat. Hal ini memperkuat hipotesis bahwa hukuman yang diberikan kepada para koruptor selama ini sangat ringan sehingga tidak menimbulkan efek jera. Padahal, efek jera itu penting. Seharusnya dijadikan pedoman bagi semua hakim dalam menjatuhkan hukuman agar para koruptor tidak lagi melakukan kejahatan yang sama dan orang lain yang menyaksikannya pun jadi takut untuk berbuat kejahatan dalam bentuk dan jenis yang lain. Hemat kita, Pasal 2 ayat 2 UU Tindak Pidana Korupsi ada dasarnya menjatuhkan hukuman mati bagi koruptor. Namun pasal ini tidak pernah dijadikan acuan sehingga hukuman yang dijatuhkan sangat minimal sekali.Wajar kalau kejahatan korupsi semakin parah di negeri kita seakan kerja KPK sama sekali tidak menakutkan bagi para koruptor. Apalagi kini para koruptor di pemerintahan semakin canggih dalam upaya menghilangkan jejak dengan tidak menggunakan alat komunikasi agar tidak terlacak alat sadap KPK, para koruptor tidak menggunakan transfer bank, melainkan menggunakan sandi khusus dan pembayaran tunai. Jangan sampai aparat penegak hukum, khususnya KPK, mendapatkan dua alat bukti. Sehingga banyak pejabat yang luput dari jerat hukum. Kalaupun namanya disebut-sebut saksi namun sulit dijadikan tersangka.Kasus yang menimpa Ketua Komisi XI dari fraksi PDI Perjuangan (PDIP), Emir Moeis dari PDIP, menurut hemat kita, kejadian langka. Sebab, baru ketahuan setelah berjalan 8 tahun terkait kasus dugaan suap proyek Pembangkit Listrik Tenaga Uap (PLTU) Tarahan, Lampung tahun 2004.+

APA KOMENTAR ANDA SMS 081362240523

Faks 061 4510025

Facebook Smswaspada

+6285262118082 BERCERMINLAH PADA JASAD. Umur begitu singkat,disaat kita tak mampu berhitung. Jasad yg dulu gagah perkasa,kini harus siap tinggal dalam tanah berteman cacing2. Perhiasan yg begitu indah melekat di badan,kini hanyalah kain kafan. Dan kerenda yg siap menghantar ke”NEGERI IMPIAN” Mempertanggung jawabkan segala perbuatan. “KUBURAN bukanlah tempat untuk Membanggakan PANGKAT/KETURUNAN.karena itu adalah tempat untuk MENYIMPAN AMALSOLEH. takkan terbebas darinya siksaan,kecuali orang yg banyak berbuat Baik,Iklas&Bersih Hatinya” Belum terlambat untuk memesan tempat. Disaat hidup tak pernah lepas berkhayaL&Mengharap pd sesuatu yg tak pasti,hanya kematianlah yg pasti.Bukan janji2,tapi bukti. Saat jasad akan masuk ke Liang lahad&kita pergi,selamat tinggal semuanya. ESOK/ LUSA KAMI AKAN KEMBALI. “Semoga kesejahtraan tetap bagimu wahai ahli kubur dari orang2 Mukmin&orang2 Islam.InsyaAllah kami akan bertemu dengan mu”(HR MUSLIM). +6285275437438 Kasus Pemukulan Irwandi,Polisi tdk serius mengusut dan sepertinya takut sama PA,masak udh hampir satu bulan kejadian katanya masih dlm proses penyidikan dan pengembangan,kenapa pelakunya blm ditangkap? +6282164682695 Yth Waspada,bpk Ustad2 dll, gimana Shalat sunnat taraweh di bulan Ramadhan ditiada kan.di ganti dg amalan yg lain membaca Al-Qur’an dan Hadist?.karna Rasulullah SAW tidak menetapkan(berjama’ah shalat tsb). +628126537298 Ass...Yth..Waspada, apakah boleh kami mengirim pooling gubernur Sumut Pilihan Pembaca Waspada atas nama Hasbullah Hadi, karena namanya tak ada di kolom itu.Terimaksih. +6282167683272 Asalamualaikum wr.wb. terima kasih kami warga Langkat. Atas keperdulian bapak Bupati Langkat yg mau memperhatikan dan membamtu korban bencana alam di desa Pertumbukan Kec. Wampu. Kab.langkat .membantu saudara kami muklis .yg terkena bencana alam angin kencang hingga merubuh kan sebuah rumah saudara kami muklis.atas perhatian bapak Bupati Langkat kami sekeluarga mengucap kan ribuan terima kasih. +6282367832219 Assalam. . , “Sucikan hati dgn kebaikan dan ketulusan” semoga dgn Ramadhan kemaafan dan Ampunan menyertai kita semua. USMANDANI & KELUARGA. +6285261616845 Maunya kepada dr Arifin Sakti Srg kalau mengatakan hadis taraweh yg 23 rakaat di Masjid nabawi maupun di masjidil harom itu hadisnya palsu itu jangan melalui waspada langsung saja ke masjidil harom yg masih berlangsung sholat teraweh 23 rakaat tersebut pakai bahasa arab sambil gembar gembor saya yakin langsung ditangkap dan diarak ke masjid kisos jedah baru lah tamat ceritanya.

WASPADA Senin 30 Juli 2012

Perbandingan Pola Perilaku Oleh M Ridwan Lubis Masyarakat dapat meniti jalan tengah di antara sikap tamak yang menjadi sebagian ciri masyarakat industri dengan sikap malas yang menjadi sebagian ciri masyarakat tradisi.

S

alah satu yang menjadi perhatian pengamat atau ahli ilmu sosial adalah terjadinya berbagai perubahan dalam pola kehidupan masyarakat. Tonnies yang kemudian dikembangkan Talcott Parsons (Nurcholish Madjid, 1987) mengemukakan ada empat variable pola untuk membandingkan antara masyarakat tradisi dengan moderen. Pertama, affectivity ke affective neutralitity yaitu pola kehidupan masyarakat yang berpindah sikap bertindak karena ingin memperoleh kesenangan segera ke sikap bertindak untuk menunda memperoleh kenikmatan yang segera itu. Dengan adanya affective neutrality menandai ciri hubungan-hubungan yang bersifat kontrak (contractual), tidak pribadi (impersonal) serta penuh dengan perhitungan (calculating) pada masyarakat industri. Pendeknya segala sesuatu diukur dengan pertimbangan untungrugi. Apabila masyarakat perdesaan faktor kesukuan dan kekerabatan menjadi dominan sedang industri hubungan kekerabatan itu berubah menjadi hubungan kesamaan profesi, kantor, organisasi,dan sebagainya. Namun apabila diamati lebih seksama ternyata masyarakat perkotaan sebagian dari masyarakat moderen sekarang ini juga tidak sepenuhnya me-

ninggalkan suku dan kerabat. Lihat misalnya upacara pesta pernikahan yang dilakukan kalangan terpandang di perkotaan merasa belum lengkap upacara peresmian pernikahan itu sebelum didahului prosesi yang bersifat adat istiadat. Karena itu, maka kelompok adat yang semula sifatnya sukarela berubah menjadi ladang usaha jasa. Kedua, dari particularisme ke universalisme. Industrialisasi mengikis rasa keeksklusifan kelompok, suku, ras, warna kulit. Hal ini disebabkan karena warga masyarakat industri menjadikan dasar pertimbangan pada faktor kemampuan bukan pada latas belakang dan asal usul seseorang. Karena itu, betapapun tingkat kebangsawanan seseorang namun apabila masuk pada kumpulan masyarakat industri maka mereka cenderung pada pertimbangan pragmatis. Dampaknya memang akan terasa pada terjadinya degradasi pertimbangan nilai baik agama maupun moral. Akibat selanjutnya adalah masyarakat lebih bersikap permissive yang berpandangan serba boleh. Ketiga, perubahan dari ascription ke achievement. Kelanjutan dari pola yang kedua kemudian berubah kepada yang ketiga yaitu yang paling mudah sekarang ini yaitu yang dikenal dengan sebutan nepotisme. Kata nepotisme pada mulanya bermakna

keponakan atau singkatnya kerabat dengan mendahulukannya dibanding dengan orang lain. Semakin moderen sebuah masyarakat akan mengubah pola bersikap masyarakat dari sistem kekerabatan atau prestise kepada system penghargaan karena prestasi. Oleh karena itu, sesungguhnya masyarakat masih memiliki optimisme bahwa masyarakat akan menjadi lebih baik karena mereka sedang berjalan menjadi masyarakat industri yang sedang mencari bentuk untuk menghargai prestasi. Keempat, dari diffuseness ke specivicity yaitu perubahan dari pola hubungan sosial yang sangat luas kepada pola hubungan yang lebih khusus. Seorang pemimpin pada masyarakat tradisi adalah memimpin masyarakat dalam segala hal mulai dari urusan pertanian, perkawinan, pergaulan sosial yang semuanya berada dalam kendali seorang pemuka masyarakat. Pendek kata, seorang pemimpin pada masyarakat tradisi adalah laksana ayah pada sebuah keluarga. Kapanpun seorang ayah adalah tetap sebagai ayah yang ingin melakukan pengendalian terhadap keluarga bahkan terhadap anak-anak sekalipun mereka telah berumah tangga. Sebaliknya, pada masyarakat industri, pola hubungan seorang pemimpin hanya dalam hal-hal tertentu. Peran ayah pada masyarakat industri berubah menjadi seorang guru yang hanya berperan di ruangan kelas. Apabila sudah selesai kegiatan belajarmengajar maka guru tidak berperan lagi karena sudah ada pemeran lain yang melakukan pengendalian terhadap anak muridnya. Seorang anak yang telah memasuki jenjang perka-

winan maka ia akan memikul tanggung jawab dalam pembinaan kelangsungan kehidupan keluarganya. Demikian dalam proses belajarmengajar setiap anak diberi peluang untuk mengembangkan kreativitas serta berani melakukan berbagai inovasi berdasarkan sistim keilmuan yang sudah ada. Dalam kaitan para pemimpin mulai dari keluarga, sekolah maupun masyarakat luas tidak lagi menerapkan pola asuh yang dapat menciptakan perasaan bersalah (guilty feeling) kepada seorang anak apabila mereka melakukan sebuah kesalahan. Tindakan berbuat kesalahan harus diberikan peringatan berupa persuasive, teguran dan tindakan lainnya akan tetapi semuanya adalah kepemimpinan yang bersifat mendidik bukan tindakan yang mematikan dinamika, kreatifitas dan inovasi. Kesimpulannya, pola kehidupan pada masyarakat tradisi memiliki kelebihan dan kekurangan sebagaimana juga pada masyarakat industri memiliki kelebihan dan kekurangan. Oleh karena itu diperlukan kearifan seseorang yang telah diberi kepercayaan masyarakat sebagai pemimpin. Sehingga masyarakat dapat meniti jalan tengah di antara sikap tamak yang menjadi sebagian ciri masyarakat industri dengan sikap malas yang menjadi sebagian ciri masyarakat tradisi. Tetapi menjadi orang yang memiliki jiwa kesatria dalam bentuk semangat kewirausahaan yang dilandasi oleh kesadaran penghayatan terhadap agamanya. Penulis adalah M Ridwan Lubis, Guru Besar UIN Syarif Hidayatullah Jakarta.

(Bukan) Bangsa Tempe Oleh Aldwin Surya Rapat kedelai oleh pemerintah tidak patut digelar secara khusus jika akar masalah dan sinyal yang diberikan produsen dan pedagang tempe dan tahu disikapi secara rutin.

T

empe dan saudara kembarnya tahu, menjadi topik perbincangan hangat seminggu terakhir ini. Dua makanan khas Indonesia berbahan dasar kedelai ini bahkan dijadikan alasan produsen dan pedagang melakukan demonstrasi. Pasalnya, bermuara kepada kenaikan harga kedelai sehingga memengaruhi biaya produksi. Kenaikan biaya produksi ini akhirnya memengaruhi harga jual kepada konsumen. Di Jawa Tengah produsen yang masih bertahan menyiasatinya dengan mengurangi ukuran tempe dan tahu. Sebagian lagi merumahkan beberapa pekerjanya dan yang lain malah bangkrut kemudian menutup usahanya. Ironis memang. Padahal profesi sebagai produsen dan pedagang tempe dan tahu sudah dilakukan sejak lama, bahkan turun temurun sehingga mereka tidak paham mengapa keadaan itu bias terjadi. Tempe dan tahu sebagai kuliner rakyat Indonesia harus berhadapan dengan kenaikan bahan dasarnya (kedelai) yang harus dipasok dari luar negeri (impor) bukan dipenuhi dari dalam negeri. Konon, lahan kedelai di dalam negeri semakin berkurang karena mengalami alih fungsi lahan menjadi properti yang lebih memiliki nilai komersial. Barangkali keadaan ini bagian dari pesatnya pembangunan. Lahan untuk tanaman kedelai sudah berubah menjadi gedung perkantoran, perumahan, rumah dan toko atau pabrik. Pemilik lahan dan para petani seakan tidak kuasa menahan serbuan kaum kapitalis yang memburu tanah dan kemudian membelinya dengan harga relatif murah. Himpitan kehidupan yang bermuara kepada kondisi ekonomi keluarga membuat banyak pemilik lahan dan petani menjual tanah mereka. Boleh jadi tindakan itu dipicu oleh anggapan bahwa tanaman kedelai tidak lagi memiliki nilai komersial. Ada faktor ikutan yang memicunya seperti bibit, pupuk, biaya tenaga kerja, saluran distribusi, peran tengkulak/ pengumpul dan harga jual yang dikendalikan oleh pedagang besar. Dalam kasus rendahnya produktivitas petani kedelai di Indonesia, faktor-faktor itu terjadi secara parsial atau malah secara bersama-sama. Akumulasi peningkatan permintaan kedelai oleh produsen yang identik sebagai pelaku usaha skala mikro dan kecil tidak dapat dipenuhi oleh pasokan dalam negeri. Akibatnya, pemerintah mengambil jalan pintas dengan menempuh melakukan kebijakan impor dari beberapa negara. Bukan mencoba mencari solusi dan resolusi atas akar masalah yang terjadi. Kebijakan impor kedelai tentu saja disambut gembira oleh kaum importir. Mereka bahkan berani menjamin pasokan akan dipenuhi berapa pun besarnya permintaan kedelai dari Indonesia. Pasokan impor kedelai yang memenuhi pasar di dalam negeri untuk sementara (jangka pendek) dinilai mampu mengatasi persoalan pasokan kedelai. Para produsen dan pedagang terus bekerja karena pasokan kedelai dan harganya di pasar masih terjangkau. Namun, keadaan seperti ini tidak

berlangsung lama. Saat para importir ingin menaikkan harga bahan baku (kedelai), maka pasokan dibatasi. Persoalan pun muncul. Akibatnya, ketersediaan kedelai di dalam negeri terbatas. Jika ada harganya meningkat dengan cepat. Pemerintah pun terpaksa menggelar rapat tempe dan tahu (kedelai) untuk mencari solusinya. Inilah konsekuensi logis yang turut dimainkan oleh importir, seakan mekanisme pasar untuk kedelai sedang berlangsung. Padahal jika disimak lebih lanjut, rapat kedelai oleh pemerintah tidak patut digelar secara khusus jika akar masalah dan sinyal yang diberikan produsen dan pedagang tempe dan tahu disikapi secara rutin oleh pemerintah. Gizi Kedelai sebagai bahan dasar tempe dan tahu memang mengandung gizi tinggi. Dalam banyak literatur orang dapat menemukan penjelasan kandungan gizinya. Para kader pos pelayanan terpadu (Posyandu) di kawasan kota, pinggiran kota dan di desa dengan fasih mampu menjelaskannya. Begitu juga para ahli gizi, mahasiswa akademi gizi, kebidanan, keperawatan, penggiat dan ibu rumah tangga. Di jenjang sekolah menengah pertama dan sekolah menengah atas, para peneliti muda tidak pernah surut mengaji tentang tempe, tahu dan produk turunannya. Semua itu menyiratkan bahan dasar kedelai yang kemudian diolah menjadi produk turunannya memang sehat dikonsumsi, mudah diolah dan harganya murah. Begitu murahnya harga tempe dan tahu sehingga menjadi makanan rutin para pekerja upah rendah seperti pekerja pabrik, penarik becak, buruh kasar, pemulung, dan pekerja musiman. Meski hanya makan dengan lauk tempe, tahu dan sedikit sayur, tubuh mereka sehat dan kuat. Keadaan ini tentu bertolak belakang dengan guyonan yang mengidentikkan orang lemah sebagai bangsa tempe, mental tempe. Terus, jika ada orang yang kelihatan kurang bersemangat disebut sebagai orang dengan semangat tempe. Padahal makan tempe dan tahu tidak identik dengan pendapatan rendah, kuliner berselera rendah dan harga murah. Produk ikutan dengan bahan dari tempe dan tahu dewasa ini sangat beragam. Bahkan menjadi kudapan yang disajikan di berbagai hotel, mal, restoran mewah dan bergengsi. Cobalah tanya kepada para koki (chef), pasti akan diberi penjelasan tentang ragam kuliner yang dapat disajikan dari tempe dan tahu. Di Jepang, tahu Jepang yang diolah menjadi makanan sehat justru digemari oleh beragam kelas sosial dan usia. Semua sebutan “miring” yang cenderung menyepelekan tempe dan tahu memang tidak enak didengar kuping karena penggemar tempe dan tahu justru menjadi orang dengan pribadi dan tubuh yang kuat. Para ibu hamil bahkan dianjurkan meminum air tahu (soya) karena terbukti baik bagi ibu dan pertumbuhan janin yang kemudian menjadi satu generasi baru bagi bangsanya. Tanpa perlu dilakukan kajian, tempe dan tahu pernah mengisi kecukupan gizi bangsa Indonesia baik yang masih dalam masa pertumbuhan maupun masa dewasa. Boleh jadi, para pejabat dan pemim-

pin nasional di Indonesia tumbuh kembang dan mungkin hingga kini sebagian gizinya dicukupi dari tempe dan tahu. Karena itu, sangat naïf jika pemerintah dan bangsa Indonesia tidak reaktif terhadap pasokan kedelai, misalnya dengan membiarkan lonjakan harga kedelai. Krisis pasokan kedelai patut disikapi dengan serius tidak hanya jangka pendek tetapi juga jangka panjang. Sikap serius itu idealnya menyentuh para produsen dengan keuntungan rendah yang terus mengabdikan diri mereka untuk pertumbuhan satu generasi melalui kecukupan gizi yang berasal dati tempe dan tahu. Lihat juga para pedagang di pasar yang hanya mendapat sedikit keuntungan. Padahal para pedagang itu juga berperan dalam pembentukan tubuh yang sehat pada satu generasi yang telah mengkonsumsi air tahu (soya) melalui ibunya. Tempe dan tahu memang terbukti sebagai lauk yang sehat, meski ada praktik oleh orang tertentu yang menggunakan boraks untuk membuat tahu lebih kenyal dan awet. Karena itu, peran pemerintah melalui instansi terkait, yayasan lembaga konsumen Indonesia (YLKI) maupun praktisi kesehatan dan gizi patut terus dilakukan secara optimal. Tujuannya adalah membuat tempe, tahu dan produk turunannya menjadi makanan bergizi yang dikonsumsi berbagai kelas sosial bukan makanan orang dan bangsa yang memiliki kelas sosial dan semangat rendah. Penulis adalah Guru Besar Universitas Prima Indonesia, Pemerhati Perkotaan.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Bupati Langkat: Dengar aspirasi masyarakat - Tapi jangan pula masuk kiri keluar kanan * KAHMI: Cagubsu harus bebas korupsi - Biar tak bertambah alumni hotel prodeo * Indonesia terancam krisis pangan - Padahal kata orang tanah kita tanah surga

oel

D Wak


Opini

WASPADA Senin 30 Juli 2012

Menemui Teman-teman Seakidah Di Tanah Air Assalamualaikum Wr. Wb. Belakanganinidiberbagaimassmediaramaimemberitakan,bahwabanyakterjadiperbuatan korupsi hampirdisemuaaspekkehidupan.Korupsi ditingkat Kementeriansampaieselon terendah. Tingkat gubernur, bupati/walikota sampai aparat terbawah juga ditemukan. Di DPR, DPRD Tk.I,II ikut juga berpartisipasi. Barangkali di lembaga judikatif/urusan penegak hukum pun tidak terkecuali. Bisa jadi kejahatannya dalam bentuk lain yang merupakan kelanjutan dari perbuatan korupsi di jajaran eksekutif dan legislative akan ditemukan juga. Semuanya perbuatan itu merusak tatanan Negara dalam membangun dirinya untuk mewujudkan cita-cita bangsa. Islammenjelaskankejahataniniberawaldarinafsuyangtidakterkendali.Untukmengantisipasinya manusia dalam agama Islam diwajibkan puasa sebulan penuh setiap tahun. Tragisnya korupsi tersebut,ternyata di Kementerian Agama paling menonjol,sampai-sampai dana haji dan pencetakan Quran ikut dimainkan. Dipikir-pikir sungguh berani mereka ini membuat kerusakan dihadapan Allah SWT. Akan tetapi barangkali belum sejahat apa yang dilakukan kaum Ad, Tsamud dan Fir’aun dalam ukuran Rabbi, sehingga kita belum dapat peringatanNya yang keras atau kita tidak sadar bahwa peringatan itu telah ada tetapi tak digubris pemuka-pemuka bangsa ini. Pelaku korupsi ini ternyata banyak diperankan justru oleh pemeluk Islam. Penganut Islam sadar atau tidak, rela mendustakan agamanya, karena lebih menyenangi kehidupan dunia yang sangat megah di akhir-akhir ini. Nampaknya budaya kita lebih condong mencontoh budaya Barat ataupun masyarakat sekulerdimanakehidupanmewahmenjadiimpian.Merekayangberduitlebihsukamenghamburhamburkan kekayaannya daripada menolong orang miskin lagi papa. Mereka berkali-kali menunaikan ibadah haji atau umroh.Apabila ada kenalannya berstatus kaya atau berpengaruh meninggal dunia atau pesta, lalu berlomba-lomba mengirim karangan bunga menjadi trendi, sehingga Nampak egonya dimana-mana. Ini tentu mengundang dan memelihara pola hidup serakah setiap pribadi muslim yang pada gilirannya akan melupakan akidahnya sebagai muslim. Penulis pernah berhadapan dengan tokoh-tokoh Organisasi Islam termasuk di negeri ini namanya HA S M dan HA M A.Mereka berperan sebagai pimpinan pusat,lalu dengan seenaknya memerintahkan pimpinan oraganisasinya di Sumatera Utara,yaitu Drs.H.F N berperan sebagai KetuaWilayah,untuk menguasai tanah seluas 3 hektar di Desa Tanjung Anom,yang asal usulnya dari mana jelas tertulis dan telah terdaftar di Badan Pertanahan Nasional (BPN) Lubuk Pakam, dan bukan mereka punya. Untuk melaksanakan tugas ini Drs.H. F N menunjuk H. P N ,SH. Konon sebagai pengacara beliau ini terkenal hebat sepak terjangnya di Sumut. Sebagai pengacara, membawa persoalan ini ke Pengadilan Negeri (PN) Lubuk Pakam. Meskipun pada PN mereka kalah akan tetapi di Pengadilan selanjutnya, mereka selalu menang hingga di tingkat PK. Didalam Alquran perbuatan ini jelas diharamkan Allah. Salah satu ayat yang menjelaskan hal ini dalam Alquran adalah surat Al-baqaroh ayat 188. Namun demikian hingga saat ini, mereka merasa bangga dan menjadi pahlawan organisasi. Atas perbuatan ini, seolah-olah mereka tak bersalah dihadapan Allah, Illahi Rabbi. Wahai sahabat sekalian, apa gerangan yang terjadi pada pemeluk Islam. Inikah tandatanda Alquran perlahan ditinggalkan sebagai petunjuk ? Demi sebidang tanah,demi kebesaran organisasi yang katanya berazas Quran seenaknya mengabaikan ketentuan Allah. Perbuatan ini persis seperti tingkah seorang pengendara di jalan raya,seenaknya menerobos lampu merah. Menu paradigma Alquran, sungguh kedamaian di muka bumi ini tidak akan ada jika permasalahan orang miskin dan anak yatim tidak ditangani pemeluknya secara terorganisir. Dengan penanggulangan ini,masyarakatnya tidak takut akan kelaparan,kebodohan,kehilangan hak-haknya dan keamanan pribadi beserta keluarganya maupun harta kekayaan mereka. Tanggungjawab ini ada ditangan seluruh pemeluknya dalam satu kesatuan gerak, secara terorganisir, teradministrasi dalam satu system manajemen yang diatur Alquran. Penanganan sendiri-sendiri tidak akan berdampak nyata pada kehidupan suatu bangsa,bahkan kita terkecoh akan tindakan tersebut,karena merasa telah melakukan kewajiban tersebut ternyata kemiskinan semakin meluas dan kekacauan semakin terasa didalam kehidupan. Oleh karena itu, wahai teman seakidah kami ajak bersama berjuang fisabilillah untuk mencapai kedamaian tersebut lewat penanggulangan kemiskinan, pemberdayaan ekonomi umat Islam dan mengingatkan teman-teman yang mengabaikan Quran dalam kehidupannya. Medan, 26 Juli 2012. Ir.H. Rosman Ali Nasution Sekjen. PW Himpunan Jama’ah Masjid Indonesia (HJMI) Sumut.

Foliopini

*** Mata perempuan itu menyorot sayu. Air bening mengalir dari sudut-sudut mataitu.Keningnyabekerut, bibirnya bergetar. Kerudung hijau yang membalutkepalanyameneduhkanperasaannyayang sedang berguncang hebat. Tampak jelas penderitaan di wajanya. Dia memang baru saja kehilangan suaminya yang dibantai rezim penguasa di Myanmar. Perempuan itu salah satu yang berhasil selamat dengan mengungsi ke perbatasan Bangladesh diTaknaf.Tapi tidak dengan ratusan orang saudara-saudaranya. Mereka tewas dibantai. Harian Metro Malaysia mengutip seorang saksi mata yang bernama Ahmad menyebutkan ada sekitar 115 ribu Muslim Rohingya saat ini berada di kamp pelarian di lima wilayah.Seorangaktivislainmenyebutkansudah ada 2 ribu orang tewas dan diperkirakan 10 ribu orang hilang dan 60 orang diperkosa di daerah Mandao. Dalam tayangan video yang ditampilkan media tersebut terlihat huru-hara penyerangan terhadap Muslim Rohingya. Asap mengepul membubung tinggi ke udara. Di sana-sini wajahwajah takut, sebagian berusaha memadamkan api. Di akhir tayangan terlihat banyak orang di dalam sebuah danau keruh. Di antara mereka

Ijtihad Tidak Mesti Sama (Tanggapan Tulisan Prof M.Ridwan Lubis) Oleh Dr Suhrawardi K Lubis, SH, SpN, MH Usulan rumusan baru kebijakan politik keagamaan,untuk menyatukan penentuan hilal Ramadhan dan Idul Fitri/ Adha, dan penetapannya melalui Keputusan Presiden sungguh berlebihan.

O

pini harian Waspada, Senin (23/7) dengan judul ‘Mengatasi Perbedaan’ yang ditulis oleh M Ridwan Lubis, Guru Besar UIN Syarif Hidayatullah Jakarta menarik untuk dicermati. Kenapa menarik? Secara implisit beliau mengemukakan bahwa terjadinya perbedaan penetapan awal Ramadhan menjurus kepada perselisihan di akar rumput. Selain itu beliau juga mengemukakan terjadinya perbedaan karena terjadinya krisis kepemimpinan ulama, khususnya MUI (Majelis Ulama Indonesia). Kemudian, beliau memberi solusi dengan menawarkan rumusan baru kebijakan politik keagamaan di Indonesia, khususnya dalam penetapan hilal. Solusi yang ditawarkan adalah mengubah bentuk sidang istbat dari sistem terbuka menjadi tertutup dan terbatas, kemudian hasil sidang tersebut ditetapkan melalui Keputusan Presiden. Perselisihan Akar Rumput Dalam opini dengan judul ‘Polemik Hari Besar Keagamaan’ di harian Waspada pada Senin, 5 September 2011, beliau juga mengemukakan terjadinya perbedaan yang mengarah kepada perselisihan di akar rumput. Dalam opini ‘Mengatasi Perbedaan’, hal yang sama juga diutarakan kembali. Statemen beliau mengenai terjadinya perbedaan yang mengarah kepada perselisihan sebenarnya perlu dipertanyakan. Sebab realitas di akar rumput, apa yang dikemukakan tersebut tidak terjadi alias jauh panggang dari api. Isu perselisihan hanya dibesar-besarkan segelintir elit saja. Kemudian dikemas sedemikian rupa oleh segelintir media menjadi isu yang menarik. Akhirnya dalam beberapa saat menjadi bahan perbincangan di segelintir elit akar rumput. Sebenarnya kalau elit tidak mempersoalkan, di tingkat akar rumput tidak

ada masalah sama sekali. Apalagi kalau kalangan elit ikut menjelaskan bahwa persoalan perbedaan tersebut berkaitan dengan persoalan keyakinan agama. Di kalangan akar rumput sebenarnya sudah sejak lama terbina kebhinnekaan, tetapi mereka tetap bersatu. Hal itu terbukti dengan semboyan Bhinneka Tunggal Ika yang ada di kaki burung garuda yang menjadi Lambang Negara Kesatuan Republik Indonesia. Kalangan akar rumput sudah terbiasa dengan perbedaan, perbadaan bukan lagi sesuatu yang mesti dipersoalkan. Apalagi persoalan tersebut merupakan persoalan keagamaan yang merupakan wilayah ijtihad. Dalam hal ijtihad, tentu akan kecil kemungkinannya untuk tidak terjadi perbedaan. Ijtihad Sama? Dalam opininya, sebenarnya M Ridwan Lubis sudah mengakui bahwa persoalan penentuan hilal merupakan wilayah ijtihad. Namun anehnya, beliau masih ngotot agar jangan terjadi perbedaan. Padahal, wilayah ijtihad merupakan wilayah yang memberi peluang untuk mengkaji dan menganalisisnya sesuai dengan kemampuan keilmuan dan keyakinan masing-masing. Hasil ijtihad tergantung kepada metode analisis yang dipakai. Pemakaian metode terpulang kepada keyakinan masing-masing. Pemakaian metode bukan karena egoisme, tetapi terpulang kepada metode yang diyakini kebenarannya oleh orang yang menggunakan metode tersebut. Kalau metode yang dipergunakan untuk menganalisis sesuatu, apakah mungkin hasil ijtihadnya sama? Tentu, akan jauh panggang dari api. Artinya, mengatasi perbedaan dalam hal ijtihad merupakan sesuatu yang tidak mungkin. Apalagi menentukan awal Ramadhan dan hari Idul Fitri/Adha merupa-

kan persoalan yang berhubungan dengan persoalan keyakinan keagamaan. Bahkan, Rasulullah SAW sendiripun secara limitatif mengemukakan bahwa ada kemungkinan terjadi perbedaan hilal Ramadhan dan hari Idul Fitri/Adha. Kemungkinan terjadinya perbedaan ini dapat diketahui dari Hadis Rasulullah SAW yang artinya‘Apabila kamu melihat hilal Ramadhan maka berpuasalah, apabila kamu melihat hilal Syawal maka berbukalah, dan apabila tak terlihat olehmu maka hitunglah 30 hari’ (HR. Bukhari Nomor 1909, dan HR. Muslim Nomor 574). Selain hadis di atas, ada hadis lain yang mengemukakan sebagai berikut: ‘Sesungguhnya satu bulan itu adakalanya 29 hari’ (HR. Bukhari Nomor 1913 dan Muslim Nomor 575). Hadis lain yang mengutarakan tentang kemungkinan terjadinya perbedaan adalah hadis yang mengemukakan ‘…sebagian orang mengatakan, bulan sudah tiga hari, sebagian yang lain mengatakan bulan sudah dua hari. Ibnu Abbas bertanya, menurut kamu bulan sudah muncul berapa hari? Kami menjawab, sekian dan sekian. Maka Ibnu Abbas mengatakan, ‘Sesungguhnya Rasulullah SAW pernah bersabda: Sesungguhnya Allah membentangkan bulan agar bisa dilihat, maka mulailah hitungan pada malam kamu melihatnya’ (HR. Muslim Nomor 577). Apabila dicermati dengan seksama, dari hadis-hadis di atas sebenarnya dapat diketahui bahwa berpeluang untuk terjadinya perbedaan dalam menentukan hilal Ramadhan dan hilal Syawal. Karena Rasulullah mengemukakan mulailah hitungan pada malam kamu melihatnya. Melihat di sini tentunya dapat dalam bentuk rukyat maupun dalam bentuk hisab dan itu terpulang kepada keyakinan masing-masing. Intinya, perbedaan tersebut bukan disebabkan krisis kepemimpinan ulama, khususnya MUI. Shaum & Id Ranah Agama Usulan rumusan baru kebijakan politik keagamaan, untuk menyatukan penentuan hilal Ramadhan dan Idul Fitri/Adha, dan penetapannya melalui Keputusan Presiden sungguh berlebih-

an. Sebab seperti dikemukakan di atas, menyangkut penetapan hilal yang berkaitan dengan pelaksanaan awal dan akhir ibadah puasa Ramadhan merupakan ranah keyakinan keagamaan. Apalagi ada hadis yang mengemukakan ‘Sesungguhnya pada dua hari Raya ini (Idul Fitri dan Iedul Adha) Rasulullah SAW melarang berpuasa, namun hari berbuka sehabis puasa dan hari untuk makan sembelihan korban (HR. Bukhari Nomor 1990 dan HR. Muslim Nomor 622). Intinya, Rasulullah SAW melarang berpuasa pada hari tersebut. Demikian juga kalau sudah masuk Ramadhan, diwajibkan untuk berpuasa. Oleh karena itu, kalau seseorang/ sekelompok orang meyakini sudah masuk hilal Ramadhan lantas dia berpuasa dan meyakini sudah masuk hilal Syawal kemudian ia berbuka harus disalahkan? Kemudian, karena dianggap salah (padahal belum tentu salah menurut Allah SWT) lantas dipaksa harus sama dengan keyakinan keagamaan orang lain? Dalam posisi tersebut di atas, apakah mungkin keyakinan dalam menjalankan agama seseorang atau sekelompok orang dapat diatur dengan Keputusan Presiden? Apalagi persoalan tersebut persoalan Ijtihadiyah. Jangan-jangan nanti akan ada pula usulan agar jumlah rakaat shalat Taraweh harus ditetapkan dengan Keputusan Presiden. Sebab, sekarang ini jumlah rakaat shalat Taraweh yang dilaksanakan di tengah masyarakat terjadi perbedaan. Ada yang melaksanakan dengan 11 , ada yang mengamalkan 23 rakaat (plus witir). Kemudian, untuk atas nama kesatuan dan persamaan lantas jumlah rakaatnya harus disamakan dengan Keputusan Presiden. Oleh karena itu, lebih elok kalau urusan keyakinan keagamaan diserahkan saja kepada keyakinan masingmasing orang atau kelompok orang. Biarkan saja terjadi perbedaan. Jangan paksakan harus sama dengan cara menetapkannya dengan Keputusan Presiden. Banyak lagi persoalan-persoalan kenegaraan dan kebangsaan yang mesti mendapat perhatian Presiden. Semoga! Penulis adalah Wakil Ketua PWM-SU Dan Pengajar Pascasarjana UMSU.

Penindasan Muslim Myanmar – ASEAN - OKI Oleh Fajar As

Dedi Sahputra dedisahputra@yahoo.com

Rohingya & Pluralisme Karena efek suatu pesan itu selalu bersifat tertunda, maka pengulangan dalam berbagai wujudnya menjadi hal yang strategis—sebelum ia menempel lekat-lekat di benak terdalam. Dan betapa dahsyatnya efek pengulangan itu. Setelah hampir 30 tahun, saya masih mengingat dengan jelas enam digit nomor sekolah SD Inpres kami dulu.Andatakakanpernahmenyangkaseberapa sering saya mengulang-ulang mengingat nomor itu dulu. Maka benarlah Sayyid Quthb, bahwa jiwa manusia itu membutuhkan sentuhan terus menerus dan berulang-ulang dengan berbagai gaya bahasa dan corak. Sentuhan-sentuhan itu hendakmembangkitkanjiwauntukmenunaikan taklif yang sulit dan urgen. Saya pernah menceritakan kepada Anda, Joseph Gobbels pun tahu soal pengulangan ini. Begitulahcaranyamemenangkanwacanapublik atas tabiat haus darah Hitler. Gak beda dengan perilaku psikopat Goerge Bush yang akhirnya memenangkan wacana publik melalui akselerasi massif komunikasi massa negara imperialis itu. Dunia masih aman-aman sajameskiribuannyawadan kerusakan harta benda tak terkira telah disebabkannya. Simsalabim, alakazam, dan jadilah terorisme sebagai the common enemy.

B9

mengangkattangan berdoamemohonbantuan. Tangisan penderitaan mereka seolah berbanding terbalik dengan respons yang terjadi. Sebagian orang tak begitu peduli, bagi mereka peristiwa mengerikan itu sebatas data tentang kejadian kerusuhan. Ada yang peduli, merasa miris tapi tak juga beranjak dari kursinya untuk melakukan sesuatu. Tapi ada juga yang peduli, berusaha membantu, apapun itu, yang penting membantu—tapi sayang jumlahnya sedikit. Ada lagi yang lucu, tokoh demokrasi Myanmar Aung San Suu Kyi, peraih Nobel perdamaian. Dikenal sebagai pejuang yang gigih membebaskan Myanmar dari penguasa yang otoriter. Dia jamak merasakan penjara yang dingin, perlakuan yang keras dan beragam penderitaan untuk tujuan yang didewakan itu: demokrasi. Sayakatakanlucu,karenatakterdengarsuara nyaringnya. Dia bahkan tetap tak menyinggung tentang Rohingya ketika berkunjung ke berbagai negara di Eropa seperti ke London, Dublin, Paris dan Oslo. Saya tidak tahu, apakah karena dia sedang jalan-jalan, lagi asyik-asyik, jadi tak mau dipusingkansoal-soalrumit di kampung halamannya. *** Salah satu yang sering muncul dalam perdebatan adalah dikotomi keimanan denganperilakusosial.Apakah orang beriman selalu baik perilaku sosialnya? Apakah untuk berperilaku sosial yang baik harus beriman? Lha, nyatanya banyak orang beriman tapi korupsi juga. Sampai pengadaan Alquran pun dikorupsi. Jadi benar toh, untuk jadi baik, tak perlu beriman? Jika Anda setuju dengan paragraf di atas, itu artinya Anda telah terjebak dalam logika sekulerisme, pluralisme, liberalisme (sipilis) yang “membajak” jargon kaum atheis. Bagi mereka, keimanan itu harus dipisahbataskan dengan perilaku sosial. Keduanya kemudian dihitung berattimbangannyadenganukuranyangmereka khayalkan sendiri. Perilaku sosial tidak pernah mau dilihat sebagai efek dari keimanan. Karena itu akan merusak ukuran-ukuran dan hasil yang diinginkan nantinya. Ini sama merusaknya ketika mengomentari penderitaan Muslim Rohingya yang dibantai.Atauberteriak-teriaktentangpluralisme ketika seorang bocah Palestina bolong kepalanya karena tembak tentara Israel. Adakah di antara Anda yang pernah mendengar nada keprihatinan dari orang-orang yang selama ini bersuara keras tentang pluralisme..? Kalau tidak ada, mari sama-sama kita teriak: Persetan dengan ide pluralisme itu.(Vol.334/ 30/7/2012)

Kolom foliopini dapat juga diakses melalui http://epaper.waspadamedan.com

Negara-negara ASEAN hanya sibuk mengurusi isu-isu internal masing-masing dan hanya bersatu bila menyetujui rekayasa pihak Eropa Barat dan Amerika Serikat.

N

egeriMyanmar(dahulubernama Burma) telah berpuluh tahun tercatat sebagai negara terburuk dalam penegakan hak asasi manusia dan demokrasi.Administrasinegarainiterkenal sebagai negara militeris dan totaliter yang sangat kejam (sama dengan rezim Soeharto di Indonesia) yang telah sedemikian rupa membungkam total demokrasi, penindasan warga yang sistematis dan berlanjut yang disertai oleh penculikan pemenjaraan massal, dan pembunuhan yang direncanakan. Keadaan ini telah menimbulkan pelarian dan pengungsian politik massal di mana para warga Myanmar memohon suaka kepada Badan Pengurusan Pegungsi Perserikatan Bangsa-bangsa yang memang proaktif membantu para pengungsi untuk meninggalkan Myanmar. Banyakkelompokpengungsitersebutyang berada di kawasan Indonesia di mana sebagian dari mereka saat ini diasramakan di Pancurbatu, Kecamatan Pancurbatu, Kabupaten Deliserdang, Sumatera Utara. Kondisi ini mendapat perlawanan keras dari Aung San Su Ky (tokoh demokratis Myanmar) di mana ketika tokoh besar ini berhasilmemenangkanpemilihanumum anggota parlemen, bahwa Junta Militer Myanmar telah menyingkirkan pilihan rakyat Myanmar tersebut dan telah mengenakantahananrumahkepadaAung San Su Ky selama puluhan tahun. Tekanan-tekanan ekonomi dan politik internasional telah sedemikian rupa efektif yang mengakibatkan kesulitan dan malapetaka ekonomi yang memaksa terjadinya perubahan drastis di Myanmar—Junta Militer telah mengalah dan bersedia memulihkan demokrasi di Myanmar— ditandai diadakannya pemilihan anggota parlemen yang baru, serta peluang terbentuk dan bergeraknya partai politik. Ternyata rakyat Myanmar sangat bergembirakarenapemilihanumumterakhirtelah berhasil kembali dimenangkan Aung San Su Ky dan Parlemen Myanmar telah diungguli oleh suara pengikut-pengikut tokoh besar ini. Betapa rakyat Myanmar memperoleh peluang besar untuk mewujudkan kemerdekaan dalam arti yang sebenarnya, kendati masih ada satu malapetaka besar yang masih tertinggal yang kelihatannya masih memerlukan perhatian dan penanganan besar dari tokoh Aung San Su Ky. Malapetaka besar itu adalah kasus penindasan dan kekerasan masssal yang dilakukan terhadap etnis Muslim Rohingya Myanmar. Rohingya Etnis Rohingya yang adalah etnis Myanmar penganut Agama Muslim yang bermukim di Barat Daya Myanmar telah bertahun-tahun mengalami penindasan dantindakkekerasanwargaMyanmarnon Muslim. Fakta-fakta menunjukkan bahwa sekitar 92.000 warga Rohingya (Muslim)

terpaksa mengungsi oleh karena lebih kurang 10.900 rumah milik Warga Muslim telah dibakar, dan ribuan Warga Muslim juga telah dibunuh dengan sengaja. Masjid-masjid juga tidak luput dari penghancuran.karenaituapayangdialami Muslim Rohingya ini telah dapat dikategori sebagai kejahatan kemanusiaan massal yang direncanakan (macrocriminal) yang seharusnya absolut harus ditangani oleh Komisi Hak Asasi Manusia/Dewan KeamananPerserikatanBangsa-bangsa(PBB) yang ternyata tidak perduli terhadap malapetaka kemanusiaan yang sangat besar ini. Berbeda benar dengan sikap PBB terhadap tragedi yang terjadi Libya dan Suriah di mana sangat beringas bertindak menghukum administrasi Moammar Khadafi dan Bashar al Assad. Kejadian ini adalah anomali dan malapetaka besar yang melilit administrasi PBB. Lembaga ini terlihat sudah sangat mengingkari Pernyataan Umum Hak-hak Manusia (Universal Declaration of Human Rights) yang dideklarasikan pada awal pembentukan PBB. Kenyataaniniadalahsuatutantanganbesar yang harus diperjuangkan oleh kelompokkelompokpejuangHakAsasiManusiaserta Pencinta Demokrasi yang sebenarnya. Indonesia Fakta lain menunjukkan di mana administrasi Republik Indonesia saat ini telah melakukan kelalaian sangat besar yang dalamkenyataannyatelahberpalingsangat jauh yang dalam kenyataannya telah berpaling dari sejarah besar Bangsa Indonesia sebagaiPeloporUtamadanNegaraterbesar ASEAN. Terutama merujuk kepada PEMBUKAAN Undang-undang Dasar RI (Ikut Melaksanakan Ketertiban Dunia). Sungguhtidakterlihatlangkah-langkah proaktif dari Menteri Luar Negeri dan Presiden Republik Indonesia untuk menangani malapetaka yang dialami oleh MuslimRohingyaMyanmar.Dalampertemuan yang digelar oleh International Concern Group for Rohingyas (ICGR) di Bangkok, Thailand pada 26 sampai tanggal 27 Juni 2012,bahwayanghadirdaripihakadministrasi negara adalah dari Malaysia (yang diwakili oleh Duta Besar Malaysia di Bangkok, Thailand). Pertemuan ICGR di mana dari Indonesia dihadiri oleh tokoh Muhammad Adil Abdullah (dosen Fakultas Hukum Universitas Syiah Kuala, Banda Aceh) yang adalah tokoh utama ICGR yang berfungsi Executive Secretary, telah menuntut agar PBB dan ASEAN bertindak sangat cepat untuk menekan administrasi negara Myanmar agar menghentikan penindasan dan kekerasan massal terhadap warga Muslim Rohingya. ASEAN ASEANsebagaiAsosiasiNegara-negara Asia Tenggara ini dibentuk untuk mewujudkan demokrasi, penegakan hak asasi manusia,dankemerdekaanyangsejatibagi

segenap rakyat negara-negara ASEAN. Terutama sebagaimana dikemukakan di depan, merujuk kepada PEMBUKAAN UUD RI bahwa ASEAN absolut harus melaksanakan prinsip-prinsip demokrasi dan penegakan hak asasi manusia. Sungguh memprihatinkan, karena dalam kenyataannya, bahwa ASEAN sejak berdiri sampai saat ini terlihat tidak memiliki prinsip yang utuh dan malah hanya merupakan arisan setiap tahun yang tidak membukukan kemajuan. Malah belakangan ini ASEAN terlihat hanya sibuk dan terlibat polaekonomiliberalyangdipaksakanoleh Eropa Barat dan Amerika Serikat. ASEAN terlihat lumpuh total melakukan diplomasi yang positif terhadap administrasi militeris dan totaliter Myanmar selama berpuluh-puluh tahun, kendati negara-negara ini berada di depan batang hidungnya sendiri. Runtuhnya rezim militeris dan totaliter di Republik Indonesia dan Myanmar adalah akibat malapetaka ekonomi yang adalah bagian dari kegagalan total sistem monopoli kapitalisme yang didalangi oleh Eropa Barat dan AmerikaSerikat.Kendatiantarnegaratelah sangat terbuka dengan berlangsungnya teknologi komunikasi rumit dan supra canggih, bahwa malapetaka penindasan dankekerasanmassaldansistematisterhadapWargaMuslimRohingyaternyatatidak mendapatperhatiandanpenanganandari ASEAN. Negara-negara ASEAN hanya sibuk mengurusiisu-isuinternalmasing-masing dan hanya bersatu bila menyetujui rekayasa pihak Eropa Barat dan Amerika Serikat. Dan oleh karena betapa sia-sianya ASEANinidibentukmemangtelahsaatnya kekuatan-kekuatan demokratis, penegak hak asasi manusia, dan pejuang-pejuang kemerdekaan yang sejati di Indonesia membangun paradigma dan aksi untuk mengevaluasi ulang manfaat dari ASEAN. Bila Asosiasi ini tidak lebih dari satu arisan maka potensi negara Republik Indonesiatidakperludipergunakanuntukasosiasi ini.

OKI Organisasi Konperensi Islam (OKI) sebenarnya adalah satu organisasi yang sangat-sangat kuat dan tangguh bila memang diorganisir dan mampu untuk menyatupadukan paradigma dan potensi negara-negaraIslam.Sungguhsangattepat kritikyangdikemukakanolehShriMahathir bin Mohamad, bahwa Israel (Negara Kecil) dapat mengalahkan negara-negara Islam adalah disebabkan kegagalan fatal negaranegara Islam untuk menyatupadukan paradigmadantindakannegara-negaraIslam utama—yaitu negara-negara Arab plus Iran,MalaysiadanBruneiDarussalamyang menguasai kekuatan maharaksasa yang dapat menghitam-putihkan perekonomiandunia—yaitucadangandanproduksi minyak bumi yang sampai saat ini dan berpuluh-puluh tahun ke depan menjadi andalah penggerak industri-industri, transportasi, dan kegiatan militer. Betapa memprihatinkan oleh karena kekuatan monopoli kapitalisme, liberalisme, dan neoliberalisme selama beratus tahun berhasil memecah-belah kekuatan negara-negara Islam pemilik cadangan dan produksi utama minyak bumi dan berhasilmendominasibisnisminyakbumi tersebut yang berarti dapat mendominasi pergaulanantarbangsadanumatmanusia. Sampai tulisan ini disusun tidak terlihat konsepdanlangkahOKIuntukmenyentuh akar kekuatan dan kekalahan fatal yang dialami oleh negara-negara Islam. Termasuk dalam menyikapi penindasan dan kekerasan massal yang ditujukan kepada umat Muslim Rohingya, bahwa OKI dan ASEAN masih terbatas menghimbau dan masih tidak terlihat langkah ekonomi politik, yang signifikan. Sebenarnya betapa mudah bagi ASEAN dan OKI untuk melakukan penekanan terhadap rezim Myanmar agar menghentikan total penindasan dan kekerasan terhadap warga Muslim Rohingya. Penulis adalah Pengamat Ekonomi – Politik Internasional.


B10

WASPADA, Senin, 30 Juli 2012 30 Juli 2012

Semarak Ramadhan

31 Juli 2012

10

Imsak 04:54 Shubuh 05:04 Maghrib 18:42

11

Imsak 04:54 Shubuh 05:04 Maghrib 18:42

Tawazun Alquran Allah-lah yang menurunkan kitab dengan (membawa) kebenaran dan (menurunkan) neraca (keadilan). Dan tahukah kamu, boleh jadi hari kiamat itu (sudah) dekat? (Q.S. al-Syura ayat 17)

Oleh Achyar Zein menghormati. Tawazun Alquran ini berlaku juga dalam hal penilaian terhadap perbuatan-perbuatan yang dilakukan oleh manusia. Alquran tetap memuji perbuatan baik meskipun yang melakukannya orang-orang non Muslim. Sebaliknya, Alquran mengecam perbuatan jahat meskipun yang melakukannya adalah orang Muslim. Cara yang dilakukan oleh Alquran ini merupakan isyarat bahwa yang benar tetap benar dan yang salah tetap salah sebagai salah satu sikap“tawazun” yang dipilih oleh Alquran. Sikap ini menunjukkan bahwa Alquran tetap berpihak kepada siapapun selama yang bersangkutan berada di dalam kebenaran. Demikian juga ketika Alquran menggunakan kata“zawj” untuk suami isteri yang pada prinsipnya adalah “mitra atau partner”. Kemudian Alquran membuat semacam tamsilan bahwa suami isteri adalah ibarat pakaian, sawah dan petani serta bagian dari jasmani masing-masing. Pernyataan Alquran tentang hak dan kewajiban seorang isteri seimbang dengan pernyataannya kepada suami. Demikian juga pernyataan Alquran tentang pengabdian anak kepada orang tua seimbang dengan pernyataannya kepada orang tua dalam hal mendidik anak. Konsep “tawazun” inilah yang menjadi salah satu ciri khas Alquran sehingga semua manusia merasa butuh kepadanya karena diperlakukan secara seimbang. Oleh karena itu, siapapun yang taat kepada aturan-aturan Alquran pasti mendapat imbalan, sebaliknya siapa yang ingkar pasti akan mendapatkan azab.

Rubrik Tanya Jawab MUI Kota Medan

Nikah Lewat Telefon DR. H. Ahmad Zuhri, Lc. MA (Ketua Komisi Fatwa MUI Kota Medan) Pertanyaan. Apabila seluruh syarat dan rukun nikah terpenuhi hanya saja wali dan calon suami saling berjauhan karena tempat tinggalnya jauh, apakah boleh akad nikah dilakukan lewat telepon ? Jawaban. Kasus ini adalah bahagian dari fikih kontemporer. Tidak ditemukan sama sekali hukum nikah via telpon dalam kitab-kitab klasik. Melihat sikap dan pandangan ulama kontemorer, terjadi dua pendapat. Diantara mereka ada yang membatalkan atas kekhawatiran dan karena bukan satu majlis. Tetapi ada juga yang mengatakan sah karena sudah memenuhi rukun nikah. Pada zaman sekarang banyak terjadi penipuan danpemalsuansehinggasuaraataupercakapanpun bisa dipalsu dan ditiru bahkan satu orang terkadang mampu menirukan beberapa percakapan atau suara baik suara laki-laki atau perempuan, anak kecil ataupun orang dewasa dan para pendengar menyangka bahwa suara-suara tersebut keluar dari banyak mulut, ternyata suara-suara tersebut hanya dari satu lisan saja. Karena dalam syariat selalu besikap hati-hati, maka Lajnah ad-Daim Saudi Arabia melihat bahwa akad nikah dari mulai ijab, kabul dan mewakilkan lewat telepon sebaiknya tidak disahkan. Demi kemurnian syari’at dan menjaga kemaluan dan kehormatan agar orang-orang jahil dan para pemalsu tidak mempermainkan kesucian Islam dan harga diri manusia. Adapun Syaikh Muqbil pernah ditanya dengan nash pertanyaan sebagai berikut: Apakah sah perwakilan melalui telepon ketika akad (nikah), persaksian, dan talak (cerai)? Beliau menjawab: (Syah) jika diyakini bahwa itu adalah betul suara dia (yang bersangkutan). Jika tidak (yakin), maka sungguh telah ditemukan ada orang yang mampu

meniru suara. Saya telah dikabarkan tentang seseorang di Shon’a yang mampu meniru suara fulan dan suara fulan. Maka perkara-perkara ini tidak bisa dijadikan sandaran karena kadang ada seorang lelaki -sebagaimana yang kami katakandia memiliki kemampuan untuk mengubah suaranya”. [Tuhfatul Mujib soal no. 39, karya Syaikh Muqbil rahimahullah] Sesungguhnya dalam tinjauan fiqh syafi Ijab qabul dalam akad nikah melalui telepon atau teleconfrence hukumnya tidak sah, sebab tidak ada pertemuan langsung antara orang yang melaksanakan akad nikah. Keharusan para pihak, calon pengantin harus dalam satu majelis ini untuk meminimalisir penipuan atau untuk meyakinkan terjadinya pernikahan. Dalam kitab Kifayatul Akhyar II/51 dijelaskan : (cabang) disyaratkan dalam keabsahan nikah, hadirnya 4 orang: wali, calon suami dan dua orang saksi yang adil. begitujugadalamkitabTuhfatulHabibalaSyarhil Khatib III.335 disampaikan Dan sebagian dari hal-hal yang diabaikan dari syarat saksi dalah mendengar, melihat dan cermat (pernyataan penyusun : dan cermat) maksudnya cermat atas ucapan wali pengantin putri dan pengantin putra. Tidak cukup mendengar ucapan mereka di kegelapan karena mengandung keserupaan. Ketidak absahan ini bukan berarti hukum Islam mengesampingkan teknologi, namun dibalik kecanggihan teknologi juga ada kemudahan dalam memanipulasi.bisasajasuaranyadirubah,didubling olehsuaraoranglain,pastinyakitasudahmengetahui banyak tentang hal ini. Bagaimana bila salah satunya berhalangan hadir? perlu diketahui pula, bahwa ketidak mampuan hadir dapat diganti dengan cara mewakilkan baik melalui surat, utusan orang atau telepon. Dalam Kantor Urusan Agama biasanya juga disediakan blangko tauliyah bil kitabah. Wallahu a’lam.

Tanya Jawab Konsultasi Zakat 1433 H

Zakat Deposito Soal : Assalamu’alaikum Wr.Wb. Saya ingin bertanya tentang zakat deposito apabila sudah cukup nishabnya , maka dikeluarkan zakatnya 2,5 %.Tapi bagaimana bila deposito tersebut kita miliki untuk jangka panjang, apa harus dizakatkan tiap tahunataucukupsatukalisajadiawal?Zakatdihitung dari pokok atau pokok + bagi hasil? Terima kasih. (08163144XXX) Jawab : Wa’alaikumussalamWr.Wb. Penanya dan pembaca yang terhormat, kita bersyukur kepada Allah SWT yang memberikan kepada kita rejeki yang cukup untuk keperluan hidup yang asasi (hawaij ashliyah) berupa sandang (pakaian), pangan (makanan dan dimasukkan pendidikan sebagai makanan akal) dan papan (tempat tinggal, walaupunsebagiankitamasikmengontrak).Bahkan di antara kita ada yang mendapatkan karunia berlebih dari Allah SWT, sehingga ia bisa menabung danmendepositokanuangnyadibank-banksyariah. Tentu kita patut mensyukurinya sebagaimana mestinya, para Ulama’ mendefinisikan syukur :”menggunakan segala pemberian dan nikmat dari Allah sesuai dengan kehendak-Nya”. Dan yang Allah kehendaki dari apa yang kita miliki, di antaranya adalah mengeluarkan zakat dari sebahagian rejeki tersebut, termasuk yang didepositokan. Uang yang didepositikan di bank disamakan denganemassimpanan.Sedangkandalilyangterkait dengan emas, Rasulullah Saw bersabda :”Apabila engkau memiliki dua ratus dirham, dan sudah setahun, maka zakatnya lima dirham. Dan tidak wajib atasmu sesuatu (emas) hingga engkau memiliki dua puluh dinar, dan sudah setahun, maka zakatnya setengah dinar”. (HR. Abu Daud) Para Ulama’ menjelaskan 20 dinar emas sama dengan 85 gram emas, sedang 200 dirham perak sama dengan 600 gram perak. Dengan demikian simpanan yang senilai dengan 85 gram emas, sudah mencapai nishab (batas minimal wajib zakat). Emas simpanan dan uang yang didepositokan, jika mencapai nishab setiap tahun dikenakan zakat 2,5 %. Jadi bukan sekali saja mengeluarkan zakat deposito di awal tahun. Dan zakat deposito diambil dari pokok + bagi hasil yang diterima di tahun itu, bukan pokoknya saja.Hikmahnya tentu orang yang punyatabungandandepositoyangmelewatinishab tergolong orang kaya. Agar harta tidak hanya berhentidikalanganorangkayasaja,disyari’atkanlah zakat sebagai jembatan antara orang kaya yang Allah beri rejeki lebih dengan orang miskin. Tentu

Diasuh oleh :

Ustadz H Muhammad Nuh (Dewan Syari’ah LAZ Peduli Ummat Waspada) LAYANAN JEMPUT ZAKAT (Khusus Kota Medan):08126375062 Pembayaran ZIS Via Bank Zakat, Infak/Sedekah BMI 211-00044-15 BMI 211-00002-15 BSM 006-002240-7 BSM 006-000832-1 BNI Syariah 009-2687629 BNI 005-7504808 Bank Mandiri 106-0002203803 BRI 0693-01-000055-30-9 Bank Sumut Syariah 611-01-04-000024-0 BCA 022-1750828 Keterangan : Rubrik ini terbit setiap hari selama Ramadhan yang dikelola oleh LAZ Peduli Ummat Waspada. Bagi anda yang ingin konsultasi zakat melalui rubrik ini dapat dikirim ke alamat kami : Jl. Brigjend Katamso No. 1 Medan 20151 (Gedung Harian Waspada) Telp/fax. (061) 4511936 / 08126375062 atau e-mail : Muhammadnuh66@gmail.com

dengan zakat diharapkan pada saatnya secara bertahap akan terkurangi jumlah orang-orang miskin, bahkan jika mungkin mereka akan menjadi muzakki (orang yang berkewajiban zakat) atau minimal bisa hidup secara wajar. Betapa bahagianya kita bila dengan idzin Allah ikutberkontribusimeningkatkankehidupansebagian masyarakat kita yang belum beruntung, menjadi lapang atau minimal teratasi kebutuhan hidupnya yang asasi. Dengan kesyukuran yang demikian, Allah akan menambahkan lagi rejeki dan keberkahan-Nya. Firman-Nya :”Sesungguhnya jika kamu bersyukur, niscaya Aku akan menambah (nikmat) kepadamu, tetapi jika kamu mengingkari (nikmat-Ku), maka pasti adzabKu sangat berat”. (Ibrahim/14:7).

12

Imsak 04:54 Shubuh 05:04 Maghrib 18:42

2 Agustus 2012

13

Imsak 04:54 Shubuh 05:04 Maghrib 18:42

3 Agustus 2012

14

Imsak 04:54 Shubuh 05:04 Maghrib 18:42

4 Agustus 2012

15

Imsak 04:55 Shubuh 05:05 Maghrib 18:41

Gubsu Ajak Generasi Muda Kembali Ke Masjid

Kajian Tafsir Alquran

Alquran senantiasa memberikan informasi secara seimbang yang dalam tulisan ini disebut dengan “tawazun”. Melalui konsep “tawazun” ini kelihatan bahwa setiap ketetapan Alquran senantiasa bersifat adil dan objektif. Aturan-aturan Alquran berlaku kepada siapa saja tanpa adanya diskriminatif sedikitpun. Kata “tawazun” berasal dari kata “wazn” yaitu “timbangan atau neraca”. Makna yang dapat ditangkapdarikatainiadalah“keseimbangan”dalam berbagai hal termasuk dalam bidang aturan dan lain-lain.Tawazun,kadang-kadangjugadiidentikkan dengan keadilan yaitu meletakkan sesuatu sesuai pada tempatnya. Menurut al-Khazin, bahwa yang dimaksud dengan “tawazun atau al-mizan” adalah keadilan. Dinamakan demikian karena al-mizan adalah timbanganuntukmembagidanmenyamakanukuran. Pendapat al-Khazin ini menunjukkan bahwa setiap informasi dalam Alquran pasti seimbang. Konsep “tawazun” ini dapat dilihat dari keseimbangan pernyataan Alquran tentang pemberi dan penerima harta. Satu sisi Alquran mewajibkan kepada orang-orang kaya memberikan sebagian hartanya kepada orang miskin. Pada sisi lain, melarangorang-orangmiskinhanyamengharapkan pemberian orang-orang kaya. Contohlain,Alquranmenghimbauagarpemilik rumah memuliakan tamu, akan tetapi pada kesempatanyanglainAlquranmengajarkankepada tamu agar menghormati pemilik rumah. Konsep “tawazun” dalam tataran ini adalah bahwa pemilik rumah dan tamu memiliki kewajiban untuk saling

1 Agustus 2012

Waspada/Agusdiansyah Hasibuan

Plt Gubsu Gatot Pujonugroho menyerahkan tali asih kepada pengurus MUI dan anak yatim di Masjid Nurul Huda Desa Pematang Panjang, Kec. Limapuluh, Kab. Batubara, Sabtu (28/7). Gubsu mengajak alim ulama merangkul generasi muda masuk ke masjid.

Tadarus Menggema Di Bireuen BIREUEN (Waspada): Setiap Ramadhan, tadarus menjadi tradisi bagi masyarakat Aceh, khususnya Bireuen. Mereka (masyarakatnya) sudah mempersiapkan diri menyambut bulan suci ini. Imam Besar Masjid Agung Bireuen Tgk H Muhammad Ishaq dan Pimpinan Dayah Cot Tarom alias Abu Cot Tarom mengemukakan itu kepada Waspada usai shalat tarawih di Masjid Agung, kemarin. Dikatakan, pada bulan Ramadhan yang penuh rahmat dan magfirah, umat muslim agar lebih memfokuskan diri meningkatkan ibadah wajib maupun ibadah sunah kepada Allah. Memang selama ini setiap masjid dan meunasah di Bireuen dipadati jamaah melaksanakan shalat wajib dan shalat tarawih berjamah, tadarus serta berzikir mendekatkan diri kepada Allah, menjaga serta menegakkan syariat Islam sercara kaffah. “Kebiasaan ini diharapkan tetap terjaga, dan beribadah karena Allah Ta’ala,” sebut Ishaq. Dikatakan, peningkatakan ibadah di bulan Ramadhan, selain atas kesadaran setiap mukmin juga menyahuti seruan

Muspida plus Bireuen yang disampaikan Dinas Syariat Islam. Kadis Syariat Islam Bireuen DR Tgk Saifullah, SAg, M.Pd dalam seruan bersama unsur Muspida plus antara lain mengimbau umat muslim lebih mendekatkan diri kepada Allah, melaksanakan shalat wajib dan shalat sunat serta ibadahibadah lainnya di bulan suci ini. Bagi yang berjualan panganan berbuka puasa, dijual setelah shalat Ashar pukul 16:00. Malam harinya setelah usai berbuka puasa seluruh warung, toko dan kegiatan usaha lainnya harus ditutup dan dapat dibuka kembali usai shalat tarawih. “Bagi masyarakat non muslim di Bireuen diimbau menghomati umat Islam melaksanakan ibadah puasa,” pintanya. Empat Golongan Dirindukan Surga Di tempat lain, Ustadz Arman mengatakan, ada empat golongan yang dirindukan surga. Mereka, para pembaca Alquran

yang menunaikan hak Alquran, orang yang senantiasa menjaga lidah, orang yang rajin bersedekah dan orang berpuasa. Ustadz Arman mengatakan itu pada tausyiah safari Ramadhan Majelis Permusyawaratan Ulama (MPU) Subulussalam dan Musyawarah Pimpinan Kecamatan (Muspika) Penanggalan, Sabtu (28/7) di Masjid Al Iman, Jontor, Kec. Penanggalan. Dia mengatakan, hak Alquran menurut salah seorang ulama, pembaca menghatamkan dua kali setiap tahun. Dijelaskannya, Ramadhan bulan rahmat, bulan ampunan dan pembebasan dari api neraka, sehingga keistimewaan ini harus dimanfaatkan dengan banyak membaca Alquran dan sabar, rajin bersedekah, memelihara lidah dan semua anggota tubuh atau panca indera dari perbuatan dosa. Mewakili MPU, Bambang Chairuddin mengatakan, safari Ramadhan lebih sebagai forum silaturahmi. Dikatakan, MPU satu di antara empat lembaga keistimewaan di Aceh yakni Baitul Mal (BM), Majelis Pendidikan Daerah (MPD)dan Majelis Adat Aceh (MAA). (b12/b28)

Semarak Ramadhan Di Masjid Baiturrahman Johor MEDAN (Waspada): Kegiatan Ramadhan di Masjid Baiturrahman Perumahan Johor Indah (PJI) sangat beragam. Pelaksanaan shalat sunah tasbih dan pemberian 500 paket sembako dilaksanakan jamaah pengajian Rodhitam Mardhiah seKota Medan, dipimpin Hj Fauziah Noor, shalat tarawih dan cermah disampaikan para tokoh terkemuka di Medan. Demikian disampaikan Ketua Badan Kenajiran Masjid (BKM ) Baiturrahman, Sugiri, Sabtu (28/7). “Ini merupakan rangkaian dari beragam kegiatan amal Ibadah dilaksanakan BKM masjid Baiturrahman dalam menyemarakkan Ramadhan,” katanya. Dia menambahkan, mengutip salah satu Hadits Nabi Muhammad SAW, “Siapa yang bergembira, bersuka cita di bulan Ramadhan, maka Allah akan menyiapkan syurga-Nya di akhirat kelak,” kata Sugiri menyebutkan, sebelum ini telah

Waspada/Ist

Jamaah Masjid Baiturrahman, Johor saat mengikuti kegiatan shalat tasbih, Sabtu (28/7). dilaksanakan kegiatan wisata se-dekah ibu-ibu BKM ke Serang Jaya dan Banda Aceh, sunatan massal terhadap 30 anak kurang mampu, santunan kepada kaum dhuafa di Masjid Baiturrahman dan juga Kampung Nelayan, Belawan. Disebutkannya, beberapa tokoh Sumut juga turut meramaikan kegiatan di sini, antara

LIMAPULUH (Waspada): Menjelang tahun 2015 , mau tidak mau kita harus mampu bersaing dengan negara lain, khususnya kawasan Asean. Banyak pengaruh luar yang masuk , dan dampak akan dirasakan generasi muda. “Maka itu kita harus persiapkan anak-anak kita dan ajak mereka kembali ke masjid.” Plt Gubsu Gatot Pujonugroho mengatakan itu saat safari Ramadhan Pemerintah Provsu di Masjid Nurul Huda, Desa Pematang Panjang, Kec. Limapuluh, Kab. Batubara, Sabtu (28/7). Hadir Bupati Batubara, Dandim 0208 As Letkol. M Ali, Kapolres Asahan AKBP Yustan Alfiani, Ketua MUI Batubara H Ghazali Yusuf, Lc, tokoh masyarakat dan agama se-Batubara. Gatot mengatakan, dengan berada di masjid generasi muda dilatih untuk membaca dan memahami Alquran. Kitab ini terbukti mampu mempersiapkan umat Islam untuk maju, tetapi Alquran kini lebih banyak dimanfaatkan orang di luar Islam. “Salah satu ayat di dalam Alquran yang memacu umat Islam untuk siap bersaing adalah untuk saling berlomba-lomba berbuat kebaikan. Dari situ umat Islam harus siap berkompetisi, persiapkan diri dengan Alquran, maka kita akan lebih siap menghadapi perkembangan zaman,” ujar Gatot. Acara yang dibuka pembacaat ayat suci Alquran oleh qori internasional Fadhlan Zainuddin, diisi pemberian tali kasih oleh Gatot kepada unsur pengurus MUI se- Batubara dan anak yatim. Kemudia dilanjutkan tausiah disampaikan KH Amirudin.(c05)

Ramadhan, Bulan Segala Bulan KABANJAHE (Waspada): Ramadhan adalah bulan segala bulan_ yakni bulan bertuah, bulan ibadah, bulan mujahadah, bulan rohmah, bulan maghfiroh, bulan Alquran , bulan Lailatul Qodr dan bulan sedekah, terutama bagi umat Islam yang menjalaninya. Ustad Drs Mardinal Tarigan, MA mengatakan itu saat menyampaikan ceramah dihadapan tokoh agama, masyarakat, para pimpinan ormas yang menghadiri buka puasa bersama di halaman Mapolres Tanah Karo, Jumat (28/7). Dia menyampaiakan keutamaan puasa dan kedudukan orangorang yang berpuasa di sisi Allah. “Atas keikhlasan dan kesabaran mereka dalam menjalankan ibadah puasa dengan menahan lapar dan dahaga serta mengendalikan hawa nafsu dengan sekuat tenaga, maka Allah mengistimewakan mereka dengan memasukkan mereka ke dalam surga melalui pintu khusus bernama “Al-Rayyan” yang berarti pengairan, segar, dan juga pemandangan yang indah.” Barang siapa memberi nafkah isterinya di jalan Allah, maka akan dipanggil dari pintu surga, ‘Wahai Hamba Allah! Ini adalah pintu kebaikan.’ Barangsiapa termasuk ahli shalat, maka akan dipanggil dari pintu al-Shalah. Barangsiapa termasuk ahli jihad, maka akan dipanggil dari pintu al-Jihad. Barangsiapa termasuk ahli puasa, maka akan dipanggil dari pintu al-Rayyan. Dan barangsiapa termasuk ahli sedekah, akan dipanggil dari pintu al-Shadaqah. Sementara, Kapolres Tanah Karo AKBP Marcelino Sampouw, saat itu mengatakan, buka puasa bersama di halaman Mapolres Tanah Karo merupakan kesempatan terbaik bagi personil Polres intropeksi atas kinerjanya dalam memberikan perlindungan, pelayanandan penegakan hukum kepada masyarakat. (c10)

Warnet Tempat Menunggu Berbuka Dan Sahur BANDA ACEH (Waspada): Sejumlah warung internet (Warnet) di Kota Banda Aceh pada bulan puasa ini dipadati pengunjung. Mereka berselancar sambil menanti waktu berbuka puasa dan sahur. Makmur, penjaga warnet di Banda Aceh, Minggu (29/7) mengatakan, sebagian besar pengunjung merupakan pelajar tingkat menengah pertama, menengah atas dan mahasiswa. Mereka mengisi waktu libur sekolah dengan bermain internet, sambil menanti masuknya waktu berbuka dan sahur di malam hari. “Semua terisi penuh sejak pukul 09:00 pagi, tapi sepertinya hanya untuk bermain sambil menanti waktu berbuka,” katanya. Dikatakan, remaja yang datang ke tempatnya cenderung bermain game online, membayar sampai Rp10.000 untuk pemakaian selama 3 jam. Irwandi, mahasiswa salah satu perguruan tinggi di Banda Aceh menyatakan, hampir dua jam lebih mengelilingi Kota Banda Aceh mencari warnet, namun semua penuh. Bahkan ada yang antre menanti sampai 1,5 jam. Selain itu, katanya, di awal Ramadhan atau hari pertama dan tiga hari Ramadhan tidak seluruhnya warnet di Banda Aceh buka, sehingga kebutuhan masyarakat akan akses internet betumpu pada lima warnet yang buka di Banda Aceh. “Saya hampir tiga jam berputar-putar mencari warnet yang kosong, tapi tidak ada. Kalau pun ada yang buka harus antre seperti ini, “katanya. Sementara, Icut, warga Lamlagang mengaku sengaja meluangkan waktu libur sekolah sambil bermain di warnet, daripada memilih bermain sepeda motor yang hanya membuat letih tubuh, bahkan lebih banyak mudhrat daripada manfaatnya. (b09)

lain H Gatot Pujonugroho, hadir saat shalat tarawih sekaligus memberikan sambutan Ramadhan sekaligus menyerahkan infaq untuk kegiatan masjid. “Juga Ketua Masyarakat Ekonomi Syari’ah Sumut H Gus Irawan Pasaribu, dijadwalkan akan mensosialisaikan tentang Ekonomi Syari’ah di masjid ini,” katanya. (m37)

Safari Ramadhan KNPI Medan

Puasa Tingkatkan Keimanan MEDAN (Waspada): Dewan Pengurus Daerah Komite Nasional Pemuda Indonesia (DPD KNPI) Kota Medan melanjutkan safari Ramadhan 1433 H ke sejumlah masjid di Kota Medan, Sabtu (28/7) malam. Kali ini ke Masjid Al Ikhlas Jln. Raharja, Kel. Tanjung Sari, Medan Selayang. Sebelumnya, Jumat (27/7) rombongan mengunjungi Masjid Al Istigna Jln. Bahagia, Kel. Titi Rante, Medan Baru. Ketika itu rombongan disambut Ketua KNPI Medan Baru Dedi Ahmad Wiliardi dan sejumlah pengurus. Di masjid itu ceramah agama

disampaikan Ustadz Zulvi Mahja Pohan. Di Masjid Al Ikhlas, rombongan dipimpin Ketua KNPI Medan Zulham Effendi Siregar disambut Camat Medan Selayang Zul Fahri Ahmadi, Lurah Tanjungsari Lorentinus, Ketua Badan Kenaziran Masjid (BKM) Al Ikhlas Sugito, dan Ketua KNPI Medan Selayang Suarsim. Zulham mengatakan, safari Ramadhan merupakan kegiatan rutin mereka setiap tahun guna menyemarakkan Ramadhan. Dia berharap melalui program itu dapat meningkatkan karak-

Waspada/ist

Ketua KNPI Kota Medan Zulham Effendi Siregar menyerahkan bantuan, diterima Ketua BKM Al Ikhlas Sugito, disaksikan sejumlah pengurus KNPI Medan.

ter pemuda serta meningkatkan nilai keimanan dan ketakwaan kepada Allah SWT. Kata dia, tahun ini ada lima masjid yang dikunjungi secara bergiliran. Setelah Masjid Istigna dan Al Ikhlas, menyusul masjid di Medan Labuhan dan Medan Polonia. “Puncaknya peringatan nuzul quran di masjid kawasan Medan Johor,” katanya. Camat Medan Selayang Zul Fahri Ahmadi menyampaikan apresiasinya pada KNPI Medan. Apalagi acara itu bekerjasama dengan pihak kecamatan. “Kegiatan ini penting untuk menjalin tali silaturahmi sesama muslim, apalagi di bulan penuh kebaikan ini,” sebutnya. Al-Ustad H Bahran Tanjung dalam tausyahnya mengingatkan kegiatan safari Ramadhan jangan sebatas acara seremonial saja, tetapi harus dapat membangun tali silaturahmi. Zulham saat itu menyerahkan bantuan 70 sak semen, kain sarung, Alquran dan jam dinding, diterima Ketua BKM Masjid Al Istigna Ramlan Lubis dan Ketua BKM Masjid Al Ikhlas Sugito.(m27)

Waspada/Andi Aria Tirtayasa

Pengurus F.SPTD-K.SPSI (AGN) Sumut bersama anak-anak panti asuhan usai buka puasa bersama di Panti Asuhan Zending Islam Indonesia di Jln. Sisingamangaraja, Jumat (27/7).

F.SPTD-K.SPSI (AGN) Buka Puasa Bersama Anak Panti Asuhan MEDAN (Waspada): Pengurus Federasi Serikat Pekerja Transportasi Darat-Konfederasi Serikat Pekerja Seluruh Indonesia (F.SPTD-K.SPSI AGN) Sumut mengadakan buka puasa bersama dengan yatim piatu di Panti Asuhan Zending Islam Indonesia Jln. Sisingamangaraja, Jumat (27/7). Ketua F.SPTD-K.SPSI (AGN) Sumut Franciscus Napitupulu di dampingi Sekretaris Zaki Hamdani mengatakan, kegiatan itu bertujuan meningkatkan tali silaturahmi sesama umat beragama sekaligus merealisasikan salah satu program kerja organisasi dalam bidang keagamaan dan sosial. “Apa yang kami berikan semoga bisa membantu kehidupan anak-anak panti asuhan dan mendorong mereka lebih bersemangat dalam kehidupan sehari-hari demi mencapai cita-citanya,” sebutnya. Sekretaris Zaki Hamdani menambahkan, selain mengajak anak-anak panti asuhan makan bersama, pengurus F.SPTD-K.SPSI (AGN) juga memberikan uang santunan. Pengurus Panti Asuhan Zending Islam Indonesia, Mirhan Nasution mengucapkan terimakasih kepada pengurus organisasi tersebut karena telah peduli dengan kebaradaan anak-anak yatim piatu di panti asuhan tersebut. “Semoga bantuan ini bermanfaat bagi anak-anak penghuni panti asuhan ini,” sebutnya.(h04)


B11

WASPADA, Senin 30 Juli 2012 5 Agustus 2012

16

Imsak 04:55 Shubuh 05:05 Maghrib 18:41

6 Agustus 2012

17

Imsak 04:55 Shubuh 05:05 Maghrib 18:41

7 Agustus 2012

18

Imsak 04:55 Shubuh 05:05 Maghrib 18:41

8 Agustus 2012

19

Imsak 04:55 Shubuh 05:05 Maghrib 18:41

9 Agustus 2012

20

Imsak 04:55 Shubuh 05:05 Maghrib 18:40

10 Agustus 2012

21

Imsak 04:55 Shubuh 05:05 Maghrib 18:40

11 Agustus 2012

22

Imsak 04:55 Shubuh 05:05 Maghrib 18:40

12 Agustus 2012

23

Imsak 04:55 Shubuh 05:05 Maghrib 18:40

13 Agustus 2012

24

14 Agustus 2012

Imsak 04:55 Shubuh 05:05 Maghrib 18:39

25

Imsak 04:55 Shubuh 05:05 Maghrib 18:39

15 Agustus 2012

16 Agustus 2012

26

27

Imsak 04:54 Imsak 04:54 Shubuh 05:04 Shubuh 05:04 Maghrib 18:39 Maghrib 18:39

17 Agustus 2012

28

Imsak 04:54 Shubuh 05:04 Maghrib 18:38

18 Agustus 2012

29

Imsak 04:54 Shubuh 05:04 Maghrib 18:38 * Waktu untuk Medan.

Ramadhan Mulia Prof. Dr. Syahrin Harahap, MA

Muliakanlah Orang-orang Penting Disekitarmu

Waspada/Surya Efendi

TADARRUS MASSAL: Ratusan santri Pesantren Ar-Raudhatul Hasanah Jln. Setia Budi Ujung, Medan, Jumat (27/7) membaca kitab suci Al Quran. Tadarrus massal diikuti sedikitnya 1.200 santri tersebut, merupakan kegiatan rutin yang dilaksanakan pada bulan Ramadhan.

Safari Ramadhan Majelis Pakar KAHMI

Perkembangan Islam Terpesat Di Eropa MEDAN (Waspada): Rektor IAIN Prof. Dr. Nur Ahmad Fadhil Lubis mengatakan, sekarang ini agama Islam tengah berkembang pesat di negara Eropa. “Ketika masjid di Indonesia banyak yang terbengkalai, di Ne-gara Eropa masjidnya tambah cantik karena mereka memba-ngun,” kata Nur Ahmad Fadhil Lubis sebagai narasumber pada safari Ramadhan Majelis Pakar Korps Alumni Himpunan Ma-hasiswa Islam (KAHMI) Sumut sekaligus berbuka puasa, shalat taraweh dan diskusi ba’da shalat taraweh di Raz Plaza Convention Hall Jalan Dr. Mansyur Medan, Sabtu (28/7). Kegiatan bertema “Peran dan posisi umat Islam Indonesia” menjawab konsep de Islamisasi internasional dihadiri berbagai elemen umat Islam. Dijelaskan Nur Ahmad Fadhil Lubis, ada semangat keislaman di negara Barat karena mereka baru memeluk agama Islam dan islamnya mendapat tekanan, sementara di Indonsia Islamnya sudah bertahun-tahun dan turun-temurun, jadi sudah rutin dan kita terperangkap dengan rutinitas sehingga semangat kita beragama itu seperti terima jadi saja. “Sedangkan di Barat untuk memeluk agama Islam merubah pola hidup dan mendapat banyak tantangan. Mereka jadi sangat dinamis,” katanya. Untuk menghilangkan agar

Prof. Dr. H. Nur Ahmad Fadhil Lubis bersama Drs H Sofyan Raz, Ak, MM bersama pengurus Majelis Pakar Kahmi Sumut saat menyantap hidangan berbuka puasa bersama di Raz Plaza Jalan Dr. Mansyur Medan, Sabtu (28/7). -Waspada/Rudi Arman-

umat Islam tidak berlandailandai, Prof. Nur Ahmad Fadhil Lubis menyatakan harus melakukan penyadaran bahwa Islam itu adalah agama yang dinamis, cocok dengan jaman global, modern, jangan dibawa dengan agama yang kolot. Kemudian, perlunya pembinaan anak sejak dini dengan belajar agama Islam. Ini merupakan upaya kita yang perlu dibudayakan dan jangan sempat agama kita dianggap sesuatu yang kolot. Sudah tidak perlu lagi. “Memang betul ada dalam cara kita beragama sudah tidak cocok lagi. Ini yang perlu diperbaharui, salah satu contoh perempuan dulu diajarkan untuk masak saja. Ini kan tidak cocok lagi di jaman sekarang. Siapapun yang punya potensi silahkan,” sebutnya. Kemudian, bagaimana kita memperlakukan kelompokkelompok di antara umat Islam hanya karena perbedan yang satu pakai usholih yang satu tidak, asyik berkelahi sesamanya. “Ini sebenarnya tidak perlu di-

perdebatkan,” katanya mengingatkan. Sekarang terjadi proses globalisasi, kita ingin melihat bagaimana posisi umat Islam dalam proses globalisasi itu dan upaya kita agar umat Islam bisa menjadi partisipan atau subjek. Contohnya, kopi punya umat Islam, yang julan orang Yahudi, sehingga yang jadi miliader orang Yahudi. “Inilah proses globalisasi.Yang punya kebun kelapa sawit kita yang menentukan harga bukan kita.” Jadi, sebutnya, proses globalisasi ini sesuatu yang tidak bisa kita tolak, yang penting sekarang umat Islam memperkuat persamaan dan persatuan agar umat Islam tidak dimainmainkan. Meningkatkan pengetahuan juga. Kemudian agama Islam itu bukan hanya agama hanya untuk satu suku, agama Islam itu bukan untuk orang Arab tapi universal. Sedangkan Ketua Majelis Pakar Kahmi Sumut Drs H Sofyan Raz, AK, MM mengatakan, pertemuan ini merupakan pro-

gram setiap tahun Majelis Pakar Kahmi Sumut pada bulan Ramadhan dengan buka puasa bersama diadakan tiga kali. “Pertama dilaksanakan di Raz Plaza Convention Hall di Jalan Dr, Mansyur Medan, kedua di rumah dinas Gubsu H Gatot Pujonugroho di Jalan Sudirman dan ketika di rumah H Gus Irawan Komplek Tasbi,” jelas Sofyan Raz. Tujuan dari kegiatan ini mengumpulkan semua elemen umat Islam untuk bersilaturahmi. “Mereka ini orang sibuk semua, tapi kami memanfaatkan pertemuan ini dengan membicarakan konsep dan peran umat Islam Indonesia,” katanya. Menurut Sofyan Raz, dengan diskusi seperti ini diharapkan bisa menelurkan pikiranpikiran yang bagus untuk pembangunan umat Islam di Sumut, Indonesia dan internasional. “Minggu depan kita berharap narasumbernya Pak Jimly, dan minggu depannya lagi Pak Hasyim Muzadi,” kata Sofyan Raz didampingi sekretaris Ir H Awaluddin Thayab, M.Sc. (m39)

Indahnya Nafar Ramadhan Bersama MTA NAFAR merupakan agenda rutin diselenggarakan Majelis Tafsir Alquran (MTA) di bulan Ramadhan. Kegiatan ini diikuti segenap warga MTA dari semua umur, bermacam pendidikan dan profesi berkumpul menjadi satu. Ribuan para Nafirin (sebutan untuk peserta nafar) disebarkan ke berbagai cabang atau perwakilan MTA di seluruh Indonesia. Dibagi dalam tiga periode sehingga efektif dan merata. Dengan Nafar diharapkan mempertebal silaturahim,

memperdalam ilmu dan wisata hati bagi yang mengikutinya. Kesungguhan diperlukan untuk mengikuti kegiatan tersebut, karena peserta Nafar harus rela meninggalkan segala kegiatan, keluarga dan urusan dunia untuk fokus meniti jalan lurus ke akhirat. Peserta nafar juga sudah dibekali materi dan jadwal yang akan dilaksanakan sampai selesai. Secara umum diawali pengenalan atau ta’aruf antar warga nafar, kemudian mengenal lokasi dan juga para

warganya. Tidak kalah penting pemberian materi dari ustadzustadz yang ditunjuk dari Majelis Pusat. Selain berusaha disiplin melaksanakan amalan harian, belajar memperbaiki tajwid, saling mempererat persaudaraan dan lainnya. Ada sesi khusus yakni wisata/anjangsana, berkunjung ke tempat saudara-saudaranya yang telah mapan dalam usaha. Seperti pelaku wirausaha dan bisnis. Sehingga bisa saling menyerap ilmu, pengalaman, menambah relasi untuk dilan-

jutkan/diterapkan di daerah masing-masing. Khusus untuk MTA wilayah Sumut, kegiatan nafar pada Ramadhan dilaksanakan dua periode. Periode pertama 25 s/d 29 Juli 2012 dan periode kedua 1 s/d 5 Agustus 2012. Peserta dan daerah tujuan Nafar kali ini dari perwakilan Deliserdang, Karo, Langkat, Binjai, Tapanuli Utara, Batubara, Simalungun, Cabang Patumbak, Cabang Percut Seituan, Cabang Tanahseribu, cabang Sidamanik dan dari provinsi Jambi serta Aceh. (m07/rel)

Berbuka Puasa Dengan Anyang

Waspada/Anum

Anyang makanan khas berbuka yang disukai banyak orang.

USAI meminum seteguk air atau makanan yang manis, akan lengkap bila sajian anyang menjadi pilihan. Makanan yang dipercaya mampu membangkitkan selera makan bagi yang berpuasa itu bisa didapat di berbagai tempat jajanan berbuka puasa. Makanan yang identik dengan masyarakat Melayu dan Minang itu menjadi menu favorit saat bulan puasa. Itulah sebabnya para pedagang musiman seolah tak ingin melewatkan kesempatan ini. Seperti pengakuan Erna, yang menjajakan makanan berbuka di Jln. KL Yosdarso Glugur, Medan. Anyang yang dia

buat ini khas Minang dijual Rp5.000/porsi. Berbahan pakis, toge dan kelapa serta bumbu yang dihaluskan dan ditebar cabai merah potong, anyang buatan Erna laris di pasaran. “Saya menjualnya saat bulan puasa saja, kalau sehari-hari hanya jualan ikan dan ayam bakar,” katanya mematok harga setiap potong ayam bakarnya Rp6.000 dan berbagai jenis ikan bakar, di antaranya ikan kembung. Meski laris, Erna tidak gegabah untuk menjual aneka makanan berbuka terlalu banyak. “Hanya yang laris saja dijual,” kata dia. (m37)

Sebagai konskuensi dari Ramadhan sebagai bulan mulia, maka partisipannya umat Islam diminta untuk mendaratkan pola kehidupan yang lebih salingmemuliakan. Salah satu komunitas yang terasa sangat penting dan signifikan kehadirannya dalam kehidupan kita selama Ramadhan dan harihari berlalu kehidupan kita, adalah para pembantu, termasuk pembantu rumah tangga (PRT )atau profesi yang sama sebagai pembantu bagi keluarga seperti sopir pribadi, sekretaris pribadi, ajudan pribadi dan lainlain. Mereka dengan setia, dan semoga tulus, menemani ibu rumah tangga menyiapkan konsumsi Ramadhan bagi keluarga. Mereka melakukan tugas mulia tersebut dengan penuh tanggung jawab. Dalam kondisi kita yang lemah, ternyata orang-orang ini dengan lincah melaksanakan tugasnya. Dari sinilah kita dapat berkata, ‘jika mereka melakukan tugas-tugas yang begitu mulia, tidakkah selayaknya mereka dihormati dan dimuliakan ? Persoalan memuliakan orang penting ini perlu dibicarakan dalam konteks Ramadhan, sebab mereka terdiri dari ‘pahlawan-pahlawan sosial’ yang kurang mendapat porsi pembicaraan yang layak, kecuali jika ada kasus-kasus kemanusiaanseperti penganiayaan, penyiksaan, dan lain sebagainya. Memang seringkali pandangan manusia terhadap orang lain sangat dipengaruhi oleh status sosial dan kepemilikan harta. Dalam hal ini, pembantu rumah tangga sering mendapat perlakuan tidak wajar, tidak dihormati, apalagi dimuliakan, hanya karena mereka dianggap sebagaipembantu. Hal ini sering berawal dari kesalahan sebagaian kita dalam menentukan pentingtidaknya orang lain dalam hidup kita. Kita sering hanya menganggap penting seseorang karena pangkat dan kedudukan serta kepemilikannya terhadap harta. Barangkali bias pandangan ini juga dikarenakan hantaman materialisme yang telah merasuki hati dan mata kita yang telah demikian dalam. Cara pandang yang berbau materialistik ini telah memunculkan sikap-sikap yang kurang terpuji dari par amajikan. Diantaranya: Pertama, berbicara seenaknya, membentak dan

menghardik dengan kalimat yang tidak pantas, bahkan masih ada yang menyakitinya. Sikap kasar ini sering tidak saja muncul dari sang majikan, tetapi juga anggota keluarga; istri, anak-anak, bahkan kemanakan (nepos). Kedua, memberi tugas melebihi kewajaran atau diluar kontrak dan perjanjian, karena meskipun orang penting itu diminta untuk membantu sang majikan namun dalam kenyataannya seringkali semua anggota keluarga memandangnya rendah. Ketiga, tidakmemberikan haknya berupa gaji atau tunjangan hari-hari besar, dan banyak lagi perlakuan yang cenderung kurang memuliakan. Rasulullah Saw mengisyaratkan keharusan majiakn dan keluarganya memuliakan orangorang penting ini. ‘Jabir bin Abdullah mendengar Nabi berpesan agar berbuat baik kepada para pembantu: “Berilah makan seperti yang kalian makan. Berilah pakaian seperti yang kalian pakai. Dan jangan menyiksa makhluk Allah.’ [HR. Baihaqi]. Demikian pentingnya sikap memuliakan orang-orang penting ini hingga Rasulullah Saw tidak segan-segan mencium tangan para petani’. Nuansa Ramadhan sejatinya mengembalikan kita kepada jati diri sesungguhnya; Jika bukan karena kelebihan kemampuan membeli makanan, ternyata kita semua sama, lemah dan tak memiliki apa-apa. Jika bukan karena secarik kertas SK menduduki jabatan dan posisi tertentu, sebenarnya kita sama tidak memiliki fasilitas apa-apa untuk dibanggakan, dan jika bukan karena kebetulan kita mendapat kelebihan rezeki dari Allah, ternyata kemampuan fisik kita juga sama, lemah jika kurang makaanan dan minuman. Meskipun perlu disadari bahwa didepan Tuhan kita sama sebagai makhluk yang dimuliakan-Nya. Begitulah, sebagai bulan kemuliaan Ramadahan sangat layak kita jadikan sebagai momentum perubahan sikap agar lebih baik dan santun kepada orang-orang penting di sekitar kita, karena mereka turut men-support, keberhasilan, popularitas, dan bahkan keselamatan kita. WaAllahua’lamu bi al-Shawab


Ekonomi & Bisnis

B12 Tinjauan Ekonomi

Jhon Tafbu Ritonga Pengamat Ekonomi

Peran Partai Dalam Pembangunan (1) Setelah memperhatikan cara partai-partai selama ini menetapkan sosok yang akan menjadi calon Wakil Rakyat, Kepala Daerah (KDH) dan Capres, saya makin khawatir Pilkada dan Pemilu tidak berguna dalam pembangunan ekonomi. Sebaliknya partai menjadi perusak atau penyebab ketertinggalan dan kemunduran ekonomi bagi Indonesia. Sejak reformasi partailah yang membuat rakyat masih tetap banyak melarat di tengah negara yang melimpah sumber daya ekonominya. Proposisi yang belum ada dalam buku teks Ekonomi Pembangunan. Sejalan dengan studi literatur dan pemerhatian empiris selama ini, saya sampai pada kesimpulan bahwa masalah krusial dalam Pilgubsu 2013 ialah cara partai dalam menetapkan Cagubsu. Proses penetapan calon oleh partai sangat tidak rasional, jika Gubsu dianggap sebagai KDH yang mengurus pemerintahan di daerah. Dengan sistem demokrasi sekarang, kemampuan dan kualitas pilihan masyarakat sangat ditentukan pilihan partai. Sementara partai sendiri memilih calon belum berdasarkan kapasitas dan perilaku amanah sang calon. Memilih yang mampu dan baik secara benar orang yang akan mengepalai instansi dan lembaga pemerintah sangat menentukan masa depan rakyat karena pemerintah merupakan kunci pembangunan di semua bidang, terutama ekonomi. Oleh karena itu, upaya meningkatkan pengelolaan pemerintahan untuk pembangunan ekonomi dalam sistem demokrasi Indonesia sangat ditentukan oleh partai-partai, baik kecil maupun besar. Negara-negara maju yang menjadi contoh praktik demokrasi dan menjadi pendonor sekarang ini sangat memperhatikan kondisi partai-partai di negara sedang membangun seperti Indonesia. Hal mana jelas karena makin banyak fakta di banyak negara yang menunjukkan bahwa partai justeru menjadi akar dan sarang korupsi yang meluas. Sebagaimana makin banyak dibongkar media massa, pengadilan dan KPK makin lama kian banyak politisi yang diadili dan divonis korupsi. Bukti tertulis dan lisan di pengadilan sebagaimana dikabarkan media massa menunjukkan, terdapat hubungan kuat koruptor dengan partainya. Karena dalam partai pasti banyak tokoh yang masih bersih. Karena bukti tertulis dan lisan yang diungkapkan di pengadilan sering juga bias. Maka, partai tidak bisa di vonis selaku sarang koruptor dan harus dibubarkan. Partai sebagai organisasi juga tidak bisa dimasukkan ke penjara karena secara fisik tidak ada. Hanya Tuhan kelak yang menghukum pelaku-

nya yang tidak ada bukti ikut korupsi. Namun jelas partai tidak bisa dipisahkan dari keberadaan mereka sebagai kepala negara, menteri, KDH, dan anggota DPR dan DPRD. Jika anggota DPR atau DPRD ternyata sudah lama sebagai koruptor, atau setelah menjadi anggota DPR/DPRD menjadi koruptor, tentu saja komunitas rakyat yang tidak memilihnya tak bisa mempersalahkan kenapa rakyat lain telah memilih koruptor. Hasil penelitian dan bukti yang bisa dilihat secara empiris menunjukkan bahwa lembaga legislatif merupakan hulu sumber korupsi, dan bahkan ladang praktik korupsi. Secara individu dan secara bersama-sama. Kondisi ini tumbuh, bertahan dan berkembang antara lain karena media massa sebagai pelaku penting pengawasan sosial sejauh ini belum mampu berfungsi kuat. Bahkan juga tidak lepas dari self interest para insan media sebagai entitas bisnis. Sebagaimana partai belum bisa dipersalahkan, tentu entitas media juga demikian. Media massa sebagai entitas industri samasama dihidupkan oleh manusia, sebagaimana juga politisi mendirikan dan menggerakkan partai. Oleh sebab itu keberadaan partai, organisasi, lembaga dan entitas apa saja sangatlah tergantung pada manusianya. Jika dikendalikan oleh seorang, beberapa dan apalagi banyak orang yang koruptif, niscaya hasil kerjanya juga jauh dari bermanfaat bagi masyarakat. Secara logis dan secara moral partai sebagai organisasi yang merekrut dan mencalonkan wakil rakyat, KDH dan Kepala Negara menjadi pihak yang paling bertanggung jawab atas kegagalan pemerintah daerah dan pemerintah pusat sejak reformasi. Partai berkoalisi bisa saling bela diri, tapi secara moral semua bertanggung jawab atas kegagalan Indonesia sebagai negar. Perbaikan bisa dilakukan, dan sangat bisa, yakni melalui perbaikan sistem. Satu di antaranya ialah sebagaimana dengan proses yang sedang dilakukan oleh partai-partai di Sumatera Utara merekrut Balongubsu mendatang. Tuhan memang pasti akan membalasnya kepada setiap pengelola partai sesuai porsinya masing-masing. Tapi, rakyat yang masih hidup dalam lingkaran kemiskinan sangat tidak mampu mengubah keadaan diri dan keluarganya. Untuk Sumatera Utara harapan mereka ialah pada Gubsu 2013-2018. Di dunia ini, setiap orang bisalah berhujah dan membela diri dengan banyak dalih. Tapi Tuhan Maha Melihat, Maha Mengetahui dan Maha Membalas. Ini pulalah yang membuat rakyat jelata masih selalu optimis. Walluhu a’lam.

Harga Kacang Tanah Naik MEDAN (Waspada) : Meski lebaran masih lama, namun harga komoditas pelengkap cemilan lebaran sudah mulai naik harga. Saat ini harga kacang tanah kupas di pasar-pasar tradisional di Medan dan sekitanya sudah naik hingga 15 persen. Bila harga normalnya hanya berkisar Rp21.000 per kg, namun memasuki Ramadhan ini harganya melonjak menjadi Rp23.000 per kg. Diperkirakan, harga kacang tanah itu akan kembali mengalami kenaikan sesaat menjelang lebaran. Rudi, pedagang di Pusat Pasar Medan, mengaku naiknya harga kacang tanah saat ini dikarenakan tingginya permintaan dari masyarakat sementara pasokannya yang masuk sedikit. “Kacang tanah selalu diburu

pembeli saat ramadan hingga menjelang lebaran, sebagai bahan pembuatan kue kering atau dijadikan sebagai kacang tojin, karena itu permintaannya sangat tinggi sekarang,” ujarnya kepadaWaspada, akhir pekan lalu. Menurutnya, kenaikan harga tersebut terjadi sejak sepekan yang lalu. Selain itu, lanjut Rudi, untuk harga kacang jenis biasa pun juga mengalami kenaikan. Untuk kacang jenis biasa yang awalnya hanya Rp16.000 naik jadi Rp17.000 per kg. Ditempat terpisah, Naibaho, pedagang di Pasar Sukaramai Medan, mengatakan selain harganya naik, kacang tanah impor untuk sekarang banyak membanjiri pasar di Sumut. “Sejak menjelang Ramadhan, pasokan kacang tanah

impor, khususnya dari India memang cukup banyak, bahkan semakin banyak masuk ketika mendekati Idul Fitri. Hingga sekarang juga masih tetap banyak karena permintaan tetap tinggi dan bahkan akan naik mendekati Natal dan tahun baru,” katanya. Ditambahkannya, kacang impor dari India itu terdiri dari dua jenis yakni masih dalam keadaan kulit arinya sudah terkupas dan belum terkupas. Yang membedakan kacang impor adalah butirannya yang lebih besar dari kacang lokal. Menurutnya, sebenarnya konsumen lebih suka kacang lokal dengan alasan rasanya yang lebih manis dan gurih, meski butirannya jauh lebih kecil dari produk impor.(cdu)

WASPADA Senin 30 Juli 2012

Pedagang Kolang-kaling Bermunculan MEDAN (Waspada) : Pedagang kolang-kaling mulai bermunculan di sejumlah pasar tradisional Kota Medan. Pantauan Waspada, Jumat (27/7), kemunculan pedagang kolang kaling ini semakin menambah semarak suasana di pasar-pasar tradisional selama Ramadhan. Saat ditemui, Ratna, pedagang kolang-kaling di Pusat Pasar Medan, mengatakan kehadiran mereka memang menjadi ciri khas setiap Ramadhan. Dia mengaku, sudah dua hari sebelum Ramadhan berjualan kolang kaling. “Setiap Ramadhan memang saya jual kolang-kaling, sebab permintaan kolang-kaling selalu tinggi di bulan Ramadhan. Di hari pertama Ramadhan saja permintaan kolangkaling cukup meningkat tajam, meningkatnya bisa mencapai 50 persen. Permintaan tersebut datang dari penjual es dan ma-

Waspada/Hamzah

MULAI NAIK : permintaan kolang-kaling selalu tinggi di bulan Ramadhan sehingga tidak jarang harga mengalami peningkatan dari hari biasanya yang sebelumnya Rp6000 per kg menjadi Rp8000 per kg. syarakat sebagai menu untuk buka puasa,” ujarnya. Untuk harga kolang-kaling itu sendiri, Ratna menjualnya dengan harga yang bervariasi. Untuk kolang-kaling ukuran besar biasanya Ratna menjual Rp7.000 sampai Rp8.000 per kg,

sedangkan kolang-kaling ukuran kecil Ratna menjualnya denga harga Rp12.000 hingga Rp13.000 per kg. Menurutnya, permintaan kolang-kaling tersebut akan terus meningkat hingga menjelang lebaran nanti. Untuk

Di Takengen Meningkat TAKENGEN ( Waspada): Selama memasuki bulan suci Ramadhan 1433 H permintaan konsumen terhadap kolang kaling meningkat di sejumlah pasar tradisionil di Aceh Tengah. Menurut seorang pedagang di Pasar Inpres Takengen, larisnya jenis buah hutan itu karena sebagian konsumen kerap menjadikannya sebagai bahan olahan untuk menu berbuka puasa. “Memang setiap memasuki bulan puasa daya beli terhadap kolang kaling meningkat di pasar ini. Di lapak saya ini setidaknya sebanyak 100 kg kolang kaling habis terjual per harinya,”

jelas Alamsyah, menjawab Waspada, Rabu (25/7). Menurutnya, meski permintaan konsumen meningkat sejauh ini, namun daya jual kolang kaling masih bergerak stabil seperti tahun sebelumnya Rp12.000 per kg. “Kami juga menjual secara eceran, tapi nilai jualnya sedikit lebih mahal Rp3.000 per gelas atau setara 1,5 ons.” “Buah ini, mayoritas di pasok dari Simpang Layang, Biruen. Sementara, dari para agen kami membelinya Rp12.000 per kg,” sebutnya. Dia katakan, untuk meme-

nuhi tingginya permintaan pasar setidaknya dibutuhkan sekitar setengah ton kolang kaling perpekan. Bahkan kadangkala bila pesanan bertambah di lapaknya, ia akan melakukan pemesanan mencapai hampir satu ton per pekan. “Rata-rata keuntungan yang kami raih hanya Rp2.000 per kg. Jumlah ini memang terbilang lumayan, tapi dengan catatan semua barang di lapak habis terjual. Namun kalau kurang laku, kami juga akan merugi , karena kolang kaling cepat berubah warna dan membusuk,” ucap Alamsyah. (cb09)

Ramadhan Momen UKM Musiman Raup Untung MEDAN (Waspada) : Ramadhan selalu dimanfaatkan warga sebagai ajang merintis usaha, hal ini sudah menjadi alternatif tepat bagi sebagian warga yang ingin mendatangkan untung besar di bulan Ramadhan. Tidak heran bila UKM musiman pun mulai bermunculan meramaikan penjuru nusantara, khusunya Sumut, seiring dengan mengisi kemeriahan Ramadhan. Hal ini dikatakan Kepala Dinas Koperasi dan UMKM Medan Tunggar, Jumat (27/7). “Bulan Ramadan dapat disebut juga sebagai bulan UKM, karena menjamurnya berbagai kegiatan ekonomi masyarakat. Tentunya semua

itu tidak terlepas dari tujuan untuk mendapatkan keuntungan, apalagi untuk para UKM yang bergerak dibidang makanan,” ujarnya. Menurutnya, kondisi itu dapat dilihat dari penjualan berbagai jenis makanan berbuka puasa yang menjamur hampir di seluruh daerah. Uniknya, kegiatan yang menggerakkan UKM seperti itu tidak pernah berlangsung pada bulan-bulan sebelumnya, meski menjelang hari besar nasional. Sebagian besar makanan yang dijual tersebut merupakan produksi UKM yang dimasak langsung oleh masyarakat, bukan produksi perusahaan tertentu.

Demikian juga dengan penjualan berbagai jenis pakaian, baik di pasar tradisional maupun pusat perbelanjaan modern yang akan semakin marak ketika mendekati berakhirnya Ramadan. Berbagai jenis pakaian yang diperjualbelikanpada Ramadan tersebut sebagian besar berasal dari aktivitas “home industry” masyarakat. Untuk mendukung itu semua, menurut Tunggar, Pemko Medan saat ini telah melakukan hal yang besar untuk para UKM, salah satunya dengan mengadakan Ramadhan Fair yang t e r l e t a k d i Ma s j i d Ra y a , Ramadhan Fair di Marelan, dan kegiatan lainnya. (cdu)

mengantisipasi tingginya lonjakan tersebut, saat ini Ratna telah menyiapkan stok kolang-kaling yang telah didatangkannya dari daerah Binjai, Pematangsiantar, dan sebagian Deliserdang. “Biasanya dalam seminggu saya hanya menyetok 30 karung

, namun kali ini saya mulai menyetok barang hingga 50 karung dalam seminggu,” ujarnya. Ditempat terpisah, Indri, pedagang kolang-kaling di Pasar Halat Medan, juga mengatakan hal yang sama. Menurutnya, sebanyak 20 goni sudah disediakan untuk memenuhi permintaan dari masyarakat yang mulai ramai pada minggu ketiga puasa dan diperkirakan akan terus meningkat menjelang Lebaran. Sementara itu, kolang-kaling yang dipasarkan di Medan, lanjutnya, biasanya didatangkan dari Sipirok Padang Sidempuan, dan Tapanuli Selatan, sebab daerah tersebut memang penghasil kolang-kaling terbesar.Ditambahkannya, kolangkaling diminati masyarakat karena rasanya yang menyegarkan dan dapat membantu perlancar saluran pencernaan. Dari berjualan kolang-kaling tersebut, biasanya Indri mampu meraup omset mencapai Rp100.000 hingga Rp200.000 per hari. Menu-rutnya, kolang-kaling biasa dibuat jadi manisan yang dapat disantap dengan campuran es buah dan makanan lainnya. (cdu)

Telkomsel Tambah 3.500 BTS 3G MEDAN (Waspada): Telkomsel fokus melayani kebutuhan pelanggan terhadap akses komunikasi terbaik melalui persiapan, penambahan kapasitas dan monitoring kualitas jaringan. Dengan maraknya gaya hidup digital, Telkomsel menambahkan BTS (Base Transceiver Station) 3G total lebih dari 3.500 di seluruh Indonesia. Selain mengedepankan jaminan kualitas terhandal, Telkomsel juga menghadirkan produk khusus Ramadhan Kartu As dan simPATI dengan fitur dan layanan sangat unik. Dari tahun ke tahun trafik SMS, suara, data maupun MMS mengalami peningkatan yang signifikan di atas 30 persen pada tahun 2011. Sepanjang perayaan lebaran 2012 Telkomsel telah siap melayani lonjakan trafik diprediksi akan terjadi menjelang Lebaran maupun pada saat hari ‘H’ Lebaran. Head of Network Services and Quality Group Telkomsel juga selaku Operation Commander Telkomsel Siaga 2012 Hendri Mulya Sjam menuturkan, Jumat (27/7), merupakan komitmen Telkomsel memberikan layanan terbaik, khususnya dalam mengantisipasi lonjakan trafik Lebaran. Telkomsel melakukan penambahan kapasitas jaringan, pada HLR,VLR, IN, SMS Center, jumlah MSC dan lain sebagainya. Upaya ini merupakan komitmen melayani kebutuhan masyarakat Indonesia agar tetap nyaman selama bulan Ramadhan dan lebaran. Telkomsel menambah BTS hingga saat ini berjumlah lebih dari 49.000, termasuk penambahan lebih dari 3.500 BTS 3G (BTS node B) tersebar dari Sumatera hingga wilayah Timur Indonesia dengan bandwith 23 Gbps (giga bit per second) untuk kenyamanan mobile Broadband communication. Hal ini dilakukan Telkomsel karena histori trafik data melonjak tinggi dari tahun 2010 ke tahun 2011, dari 41 terabyte ke 101 terabyte. Lebaran tahun ini, diperkirakan trafik akses data menjadi 160 terabyte. Total BTS 3G Telkomsel di seluruh Indonesia adalah lebih dari 12.700 unit.(m19)

Pedagang Musiman Ramaikan Ruas Jalan BANDA ACEH (Waspada) : Selama puasa Ramadhan, pedagang musiman menjajakan berbagai jenis kue dan makanan di Kota Banda Aceh turun ke jalan menggelarkan dagangan untuk orang berpuasa. Akibat menjamurnya para pedagang musiman itu sehingga membuat beberapa ruas jalan dalam kota yang sebelumnya sepi, menjadi macet total selama bulan Ramadhan yakni mulai pk.15.30 hingga menjelang berbuka puasa. Pantauan Waspada hingga, Rabu (25/7), di sepanjang Jalan Tgk. Dibaroh, Simpang Jalan Mohd. Jam Banda Aceh macet total sejak pk.16.30 hingga pk.18.30 menjelang berbuka karena dipenuhi meja dan rak jualan di kiri dan kanan jalan. Suasana kemacetan dan kesemrautan pedagang musiman yang menjajakan penganan berbuka juga terjadi di hampir semuar ruas jalan dalam kota Banda Aceh selama Bulan Ramadhan. Di Jalan Kartini, Jalan Supratman, kawasan Peunayong dan sejumlah jalan dalam Kota Banda Aceh lainnya, dipadati gerobak dan meja penjual makanan dan kue untuk berbuka puasa. Hal sama juga terjadi di Pusat Pasar Keutapang dan Lambaro, Kecamatan Ingin Jaya, Kabupaten Aceh Besar, suasana Ramadhan betul-betul diramaikan para pedagang musiman yang berjualan berbagai jenis penganan berbuka. Tradisi menjual makanan untuk berbuka puasa di Aceh termasuk di Banda Aceh sudah cukup membudaya sejak lama. Masyarakat muslim di daerah itu malas membuat makanan di rumahnya karena alasan terlalu repot. Apalagi banyak pekerjaan yang harus diselesaikan setiap harinya terutama PNS. Sehingga memilih membeli makanan dan minuman berbuka di pasar. (b09)

Ikan Segar Serba Lima Ribu Ada Di Langsa IKAN SEGAR, bagi mayoritas warga Kota Langsa merupakan makanan sehari-hari sebagai lauk utama temannya nasi. Bisa dikatakan, sehari tanpa makan ikan segar terasa kurang lengkap. Apalagi pada bulan puasa, makan nasi tanpa lauk ikan di waktu sahur sungguh tak terbayangkan sulitnya melewati kerongkongan ketika nasi ditelan. Bagi keluarga berada yang berkantong tebal, masalah pemenuhan kebutuhan ikan untuk keluarganya memang tak jadi soal. Mereka bisa membeli dengan harga berapa pun pada pedagang di pasar ikan. Karena setiap hari ikan-ikan di pasar tidak pernah putus dijual orang, kalau ikan lagi banyak bisa dibeli dengan harga yang murah dan ketika ikannya kurang harganya menjadi mahal. Persoalan yang besar untuk mendapat ikan segar justru menjadi milik keluarga orang yang kurang mampu. Harga ikan di pasar antara Rp 25 ribu hingga Rp50 ribu per kg bukanlah hal sepele bagi mereka. Karena jika pendapatan seorang kepala keluarga hanya Rp50 ribu per hari ketika dipaksakan untuk membeli ikan, otomatis kebutuhan yang lain terpaksa harus dikorbankan. Berawal dari kesulitan memperoleh ikan segar dengan harga murah untuk kebutuhan rumah tangganya sendiri, sekelompok ibu dari Gampong Sungai Lueng, Kecamatan Langsa Timur menemukan solusinya dengan mencari ikan sendiri ke bangkabangka, atau menunggu orang menjaring ikan di bibir kuala, dengan memungut ikan-ikan kecil yang ditinggalkan. Ternyata hasil dari yang mereka usahakan semacam itu lamalama melebihi dari mereka butuhkan. Ibnu Sa’dan


Waspada, Senin 30 Juli 2012