Page 1

Istana Bantah Presiden Minta Menpora Mundur JAKARTA (Waspada): Juru Bicara Presiden Julian Aldrin Pasha membantah rumor yang berkembang bahwa Presiden Susilo Bambang Yudhoyono meminta Menteri Pemuda dan Olahraga Andi Mallarangeng, mengundurkan diri karena terseret kasus Hambalang. “Tidak benar kalau Menpora mundur atau diminta mundur atau apapun itu. Tidak ada sama sekali. Itu tidak benar sama sekali, tidak ada sumber yang bisa dipercaya mengenai rumor tersebut,” kata Julian di Istana Negara, Jakarta, Minggu(21/10). (vvn)

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Wage, 22 Oktober 2012/6 Zulhijjah 1433 H

No: 24020 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: 2.500,-

Arafah Siap Songsong Wukuf Sudah 1,6 Juta Calhaj Tiba

3 Calhaj Embarkasi Medan Wafat Di Makkah

MAKKAH (Waspada): Ritual haji dalam hari-hari terakhir ini makin sibuk. Ribuan tenda berdinding kain berukuran sekitar empat meter persegi telah berdiri di Padang Arafah. Ratusan petugas dan pekerja bergiat memasang bendera negara dan tanda-tanda Kloter serta pamflet asal jamaah yang akan menempati tenda-tenda tersebut menyongsong kegiatan ibadah Armina (Arafah-Muzdalifah-Mina). Demikian informasi diperoleh Minggu(21/10). ‘“Petugas kita telah mempersiapkan keperluan para jamaah dengan perencanaan yang tersusun rapi untuk Mina, Muzdalifah dan Arafah, mudah-mudahan tidak ada yang jauh meleset dari perhitungan,” kata Abu Haris Mutohar, di Makkah, Sabtu, dalam pemaparan proyeksi ritual ibadah ‘wukuf‘ di Arafah, Mabit di Muzdalifah dan lempar jumrah di Mina. Puluhan pekerja sedang melakukan perbaikan terhadap kompleks yang akan menjadi tenda-tenda jamaah Indonesia Lanjut ke hal A2 kol. 4

Sektor Riil PEKAN lalu saya kira semua kita yang mencermati perkembangan tentang organisasi dunia usaha di Sumut sudah tahu. Apalagi kalau bukan Musprov Kadin Sumut yang digelar di JW Marriot Medan. Hasil yang muncul adalah terpiCatatan lihnya Ivan Iskandar Batubara sebaGus Irawan gai ketua Kadin Sumut untuk periode mendatang. Tentu saja bagi para pebisnis harapan yang muncul adalah agar organisasi ini bisa berperan lebih besar terhadap pertumbuhan ekonomi ke depan. Saya sering menyebutkan bahwa periode 2013 itu adalah momentum bagi ekonomi Sumut untuk melaju lebih kencang. Ditandai dengan harus rampungnya kawasan Industri Sei Mangkei kemudian dioperasikan sekitar 2014, lalu beralihnya status kepemilihan Inalum serta keinginan agar pelabuhan Kuala Tanjung bisa ditingkatkan kapasitasnya. Lanjut ke hal A2 kol. 6

Waspada/Ismanto Ismail

PETUGAS kepolisian mengintrogasi tersangka WAH kasus narkoba yang kabur dari ruang tahanan Mapolsek Medan Area dan ditangkap kembali di Jln. Merbabu, Minggu (21/10) dinihari pukul 01:00 (kiri). Jendela kecil belakang ruang tahanan tempat kaburnya 13 tahunan setelah memotong jerjak besi dengan mempergunakan gergaji besi.

13 Tahanan Kabur, 5 Ditangkap 5 Personil Polsek Medan Area Diperiksa MEDAN ( Waspada): Lima personil Polsek Medan Area diperiksa Propam Polresta Medan dalam kasus kaburnya 13 tahanan dari sel Polsek tersebut. Sedangkan lima tahanan yang kabur berhasil ditangkap kembali. “Lima personil sudah kita periksa,” kata Kasi Propam Polresta Medan AKP Benno Sidabutar kepada Waspada, Minggu (21/10). Dijelaskan Benno, personil yang telah menjalani pemeriksaan, yakni anggota jaga Aipda Amrin (Ka

Jaga), Brigadir Hasan Basri, Briptu Azhar Efendi. Menyusul Kapolsek Medan Area Kompol Sony W Siregar dan perwira pengawas (Pawas) Aiptu M Simanjuntak. “Ketiganya sebagai terduga pelanggar dan sesuai hasil pemeriksaan, petugas jaga tidak melaksanakan Standar Operasional Polisi (SOP) jaga tahanan,” jelas AKP Benno Sidabutar dan menambahkan, Ka Jaga masuk pukul 20:30, dan anggotanya Briptu Azhar Efendi masuk pukul 20:15. Sedangkan yang melaksanakan serah terima jaga Bripka Irwansyah

(jaga siang) dengan Brigadir Hasan Basri. “Perbuatan dimaksud melanggar Pasal 7 ayat 1 huruf C, Perkap 14 tahun 2011 tentang Kode Etik Profesi Polri (KEPP),” jelas AKP Benno Sidabutar. Menurut Benno, hukumannya bisa di PTDH, turun pangkat, pindah tugas dan ancaman teringan perbuatan tercela. Pemeriksaan juga dilakukan terhadap Perwira Pengawas (Pawas) Aiptu M. Simanjuntak (terduga pelanggar) yang tidak melaksanakan tugas hingga tahanan kabur. Propam Polresta Medan,

Panwaslu 33 Kab./Kota Se Sumut Dilantik

Sumut Mendapat ‘Bintang’

Wildan, Ondim, Gus, Fadly Memimpin MEDAN (Waspada): Dari enam partai politik lapis pertama, kedua, dan lapis ketiga, muncul empat nama yang dicalonkan pembaca Waspada. Melalui Partai Apa Pilih Siapa (PAPS), keempat nama tersebut menjadi favorit pembaca Waspada. Sampai pengumpulan kupon PAPS hari Sabtu (20/10) keempat nama tersebut sepertinya secara konsisten diunggulkan pembaca. Mereka adalah Wildan Tanjung yang unggul di Partai Persatuan Pembangunan (PPP), Syah Afandin

Lanjut ke hal A2 kol. 1

Al Bayan

Baitul Asyi Oleh Tgk. H. Ameer Hamzah Apabila anak cucu Adam meninggal dunia, putuslah segala amalnya kecuali tiga perkara: Sedekah jariah, ilmu yang bermanfaat, atau anak saleh yang selalu mendoakan kedua orangtuanya.” (HR:Bukhari). BAITUL ASYI (Rumah Aceh) di Makkah dan sekitarnya adalah nama lain dari harta wakaf para aghniya’ (orangorang kaya) Aceh pada zaman dulu. Mereka adalah para sultan, ulama, uleebalang, dan pedagang) yang menunaikan ibadah haji. Dulu mereka menunaikan ibadah haji membawa harta yang banyak, membeli rumah-rumah orang Arab dan orang Turki yang menjualnya. Kemudian rumah dan tanah itu diwakafkan kepada mukmin Aceh yang menetap di Makkah. Rasulullah SAW bersabda: “Sesungguhnya harta wakaf itu tidak boleh dijualbelikan dan dialihkan serta diwarisi, dan bersedekahlah dengannya kepada fakir miskin serta

Lanjut ke hal A2 kol. 3

MEDAN (Waspada): Ketua Panitia Pengawas Pemilihan Umum (Panwaslu) Pilgubsu 2013 melantik 96 Panwaslu untuk 33 kabupaten/kota se Sumatera Utara di Hotel Grand Kanaya Jl. Darussalam Medan, Minggu (21/10) sore. Hadir dalam pelantikan itu, Ketua Komisi Pemilihan Umum (KPU) Sumut Irham Buana Nasution, Ketua Badan Pengawas Pemilihan Umum (Bawaslu) RI Muhammad, Kaban Kesbangpol Linmas Provsu Eddy Syofyan, unsur sejumlah Pemkab/Kota se Sumut, dan lainnya. Pelantikan ditandai dengan pembacaan kesediaan menjadi Panwas, Ikrar dan pengambilan sumpat jabatan yang dipimpin David Susanto. Seusai pelantikan, Ketua Bawaslu RI Muhammad dalam sambutannya, antara lain mengemukakan, berdasarkan penilaian Badan Intelijen Negara (BIN), Mendagri dan lainnya, maka Provinsi Sumatera

Utara mendapat ‘bintang’. ‘’Namun, ‘bintang’ dimaksud disebabkan potensi kerawanan konflik cukup besar, apalagi terkait mendatang akan diselenggarakan Pilgubsu,’’katanya. Justru itu, lanjutnya, KPU Sumut dan Panwaslu Sumut yang telah setara sebagai penyelenggara dan pengawas

Pilgubsu harus menunjukkan kinerja yang berkualitas, apalagi kelak di Sumut dan 6 provinsi lain di Indonesia bakal dibentuk Bawaslu Provinsi. KPU Sumut maupun Panwaslu Sumut jangan ‘bermain’ agar tidak muncul masalah yang memicu konflik, katanya.

Lanjut ke hal A2 kol. 4

LSI: 77,5% Publik Terima Perbedaan Agama JAKARTA (Antara): Survei terbaru yang diadakan Yayasan Denny JA dan Lingkaran Survei Indonesia (LSI) Community menyebutkan 77,5 persen publik menerima bertetangga dengan perbedaan agama, sedang yang tidak menerima 15,1 persen dan tidak tahu hanya 7,4 persen. Peneliti LSI Community Ardian Sopa didampingi Direktur YDJA Novriantoni Kahar

mengemukakan hal itu kepada pers di Jakarta, Minggu (21/10). Survei menemukan bahwa publik menerima bertetangga dengan penganut Syiah hanya 54,0 persen, menerima penganut Ahmadiyah 48,2 persen dan orang yang memiliki hubungan sesama jenis (kaum homoseksual) hanya 17,1 persen. Lanjut ke hal A2 kol. 4

2.230 WNI Dipulangkan Dari Arab Saudi JEDDAH ( Waspada): Sejumlah besar Warganegara Indonesia (WNI) — umumnya kaum wanita dan anak-anak — yang melanggar peraturan masa tinggal Arab Saudi, telah dipulangkan. Para pejabat Indonesia telah menyelesaikan repatriasi dari 2.230 WNI, termasuk 143 bayi, sesuai dengan satu pengaturan khusus. Perusahaan penerbangan nasional Garuda, yang mengangkut para jamaah calon haji Indonesia, telah digunakan untuk mengangkut WNI yang terkatungkatung itu kembali ke tanah air. Sebanyak enam penerbangan telah menerbangkan kembali para WNI itu kembali dalam tiga hari dari Rabu sampai Jumat.

lanjutnya, melakukan pemeriksaan terhadap Kapolsek Medan Area Kompol Sony W Siregar (terduga pelanggar) dalam perkara pelanggaran etika kelembagaan dalam pasal 7 ayat 1 huruf C, Perkap 14 tahun 2011 tentang KEPP. Namun, para personel tidak ditahan. Lima ditangkap AKP Benno Sidabutar menjelaskan, Propam telah memintai keterangan saksi terhadap tahanan yang sebelumnya melarikan diri yakni WAH, SE dan MS. Lanjut ke hal A2 kol. 7

MEDAN (Waspada) : Tiga orang Calhaj Embarkasi Medan wafat di Tanah Suci. Demikian disampaikan Koordinator Humas Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan, Drs HM Sazli, Minggu (21/10). Menurut Sazli, berdasarkan informasi dari petugas yang ada di Arab Saudi kemarin menyebutkan Calhaj yang wafat atas nama, Sanwirjak bin Alm Kertamenawi,82, asal Asahan yang tergabung dalam kloter 11, manifes 132. Wafat (18/10) pukul 16:30 WAS di BPHI Makkah akibat gangguan sistem pernafasan dan dimakamkan di Syara. Nursu binti Abdul Halim Harahap, 80,asal Medan kloter 08 manifes 190 wafat (18/10) pukul 20:30WAS di BPHI Makkah akibat gangguan sistem pernafasan dimakamkan di Syara.Ruslan Hasibuan bin Tongku Bidaralan,67,asal Padang Lawas kloter 17 wafat (19/10) pukul 02:45 WAS di BPHI Makkah akibat infeksi dan parasit dimakamkan di Syara. Lanjut ke hal A2 kol. 3

UMP Sumut 2013 Rp1,3 Juta/Bulan MEDAN (Waspada): Plt Gubsu H. Gatot Pujo Nugroho menetapkan Upah Minimum Provinsi (UMP) Sumatera Utara 2013 sebesar Rp1.305.000 atau naik Rp105 ribu dari UMP 2012 Rp1,2 juta. Hal itu dikatakan Gatot didampingi Sekdaprovsu H Nurdin Lubis dan Kadis Tenaga Kerja dan Transmigrasi Sumut Bukit Tambunan kepada wartawan di Medan, Sabtu (21/10), sesaat akan bertolak ke Jakarta, untuk selanjutnya berangkat ke Makkah menunaikan ibadah haji .

Dalam kaitan ini, Gatot menginstruksikan Bupati dan Wali Kota segera menetapkan upah minimum kabupaten/ kota (UMK) 2013 dengan mengacu UMP ini. “Kita berharap UMK 2013 kabupaten dan kota se-Sumut sudah harus ditetapkan paling lama 40 hari sebelum tanggal diberlakukan atau paling lambat 20 November 2012,” ujarnya. Dijelaskannya, UMP Sumut 2013 secara yuridis telah

Lanjut ke hal A2 kol. 1

Tahanan Tipikor Meninggal BANDA ACEH (Waspada): Mantan pejabat pelaksana teknis kegiatan (PPTK) dari Dinas Pendidikan Pemuda dan Olahraga Aceh Barat, Said Rasyidin, 52, meninggal dunia, Minggu (21/10) dini hari di RSUZA Banda Aceh. Said Rasyidin merupakan tersangka dalam kasus dugaan korupsi proyek dua SMA di Aceh Barat dari dana otsus tahun 2009. Said yang kini menjabat pengawas di Disdikpora Aceh Barat ini ditahan di Lapas Lambaroe Aceh Besar sejak Oktober lalu untuk mengikuti sidang di pengadilan Tipikor Banda Aceh. Menurut keterangan pengacaranya, Ahyar, awalnya Said Rasyidin sesak nafas dan dirawat di klinik Lapas Lambaroe Aceh Besar, kemudian Said dirujuk ke IGD RS Zainoel Abidin Banda Aceh didampingi perawat klinik Lapas. Lanjut ke hal A2 kol. 6


PLT Gubsu H. Gatot Pujo Nugroho didampingi Sekda Nurdin Lubis dan Kadisnakertrans Bukit Tambunan menjelaskan UMP baru 2013.

IPW Minta Bebaskan 10 Mahasiswa Unpam JAKARTA (Waspada): Ketua Presidium Indonesia Police Watch (IPW ) Neta S Pane, Minggu (21/10) dalam siaran persnya meminta polisi segera membebaskan dan mengusut dugaan pemerasan terhadap 10 mahasiswa Universitas Pamulang (Unpam) Tangerang Selatan, Banten, yang ditahan pasca bentrok dengan polisi yang menolak kehadiran Wakapolri Komjen

Pol Nanan Sukarna di kampus mereka pada Kamis (18/10) lalu. IPW, kata Neta, mendesak Polda Metro Jaya agar mengusut tuntas upaya pemerasan yang dilakukan oknum polisi yang meminta uang Rp10 juta kepada 10 mahasiswa yang ditahan sejak bentrokan meletus.

Lanjut ke hal A2 kol. 6

Ada-ada Saja Takut Terhadap Toilet SEORANG wanita Inggris memiliki rasa takut terhadap toilet sehingga dia selalu lari setiap kali mendengar suara air pada toilet. Hal itu sering membuatnya merasa seperti ingin ditelan oleh toilet. Ney Decino, setiap ingin pergi ke toilet dia selalu memohon anggota keluarganya

Lanjut ke hal A2 kol. 2


PETUGAS kementerian perhubungan mendata TKI untuk dipulangkan ke daerah asal TKI setibanya di Terminal Kedatangan TKI, Bandara Soekarno Hatta, Sabtu (20/10). Selama dua tahun terakhir, banyak WNI, sebagian besar adalah PRT, berkumpul di depan konsulat RI di distrik Rehab di Jeddah biasanya pada

musim haji, meminta agar dikembalikan ke Indonesia secara gratis.

Lanjut ke hal A2 kol. 1

Serampang - Jangan banyak mengeluh di Arafah - He...he...he...

Tahun Depan Jamaah Usia 80 Tahun Prioritas MAKKAH (Antara): Dirjen Penyelenggaraan Haji dan Umroh (PHU) Kementerian Agama Anggito Abimayu mengatakan tahun depan diberlakukan kebijakan jamaah berusia 80 tahun ke atas diprioritaskan sejak awal bersama pendampingnya. “Sekarang prioritas memang jamaah usia lanjut tapi sebagai pengisi kursi kosong dari jamaah batal berangkat sehingga dalam prakteknya sulit menempatkan Lanjut ke hal A2 kol 4

WASPADA Demi Kebenaran Dan Keadilan

SENIN, Wage, 22 Oktober 2012/6 Zulhijjah 1433 H z zNo: 24020 * Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

2.230 WNI Dipulangkan Dari Arab Saudi JEDDAH (Waspada): Sejumlah besar Warganegara Indonesia ( WNI) — umumnya kaum wanita dan anak-anak — yang melanggar peraturan masa tinggal Arab Saudi, telah dipulangkan ke negara asalnya.

Padang Arafah Siap Songsong Wukuf 23 Oktober Izin Terakhir Haji WNA

Para pejabat Indonesia telah menyelesaikan repatriasi dari 2.230 WNI, termasuk 143 bayi, sesuai dengan satu pengaturan khusus. Perusahaan penerbangan nasional Garuda, yang mengangkut para jamaah calon haji Indonesia, telah digunakan untuk mengangkut WNI yang terkatung-katung itu kembali ke tanahair. Sebanyak enam penerbangan telah menerbangkan kembali para WNI tersebut kembali dalam tiga hari dari Rabu sampai Jumat. Selama dua tahun terakhir, banyak WNI, sebagian besar adalah PRT, berkumpul di depan konsulat RI di distrik Rehab di Jeddah biasanya pada musim haji, meminta agar dikembalikan ke Indonesia secara gratis. Kejadian itu juga terjadi lagi selama minggu pertama Oktober, ketika beberapa ratus warga negara Indonesia berkumpul di sekitar pintu masuk konsulat RI. Pasukan keamanan diberitahu dan segera bergegas ke tempat itu untuk mencegah pekerja Indonesia memasuki kompleks konsulat. Konjen RI Zakaria Anshar bersama dengan satu tim yang terdiri dari para pejabat senior mengadakan perundingan dengan pihak berwenang Arab Saudi untuk membahas Lanjut ke hal A2 kol 2

UMP Sumut 2013 Rp1,3 Juta Per Bulan MEDAN (Waspada): Plt Gubsu H. Gatot Pujo Nugroho menetapkan Upah Minimum Provinsi (UMP) Sumatera Utara 2013 sebesar Rp1.305.000 atau naik Rp105 ribu dari UMP 2012 Rp1,2 juta. Hal itu dikatakan Gatot didampingi Sekdaprovsu H Nurdin Lubis dan Kadis Tenaga Kerja dan Transmigrasi Sumut Bukit Tambunan kepada wartawan di Medan, Sabtu (21/10), sesaat akan bertolak


PARA pekerja Indonesia bersiap-siap untuk kembali ke tanahair, Minggu (21/10).

ke Jakarta, untuk selanjutnya berangkat menunaikan ibadah haji ke Makkah. Dalam kaitan ini, Gatot menginstruksikan Bupati dan Wali Kota segera menetapkan upah minimum kabupaten/ kota (UMK) 2013 dengan mengacu UMP ini. “Kita berharap UMK 2013 kabupaten dan kota se-Sumut sudah harus ditetapkan paling lama 40 hari sebelum tanggal diberlakukan atau paling

Sektor Riil PEKAN lalu saya kira semua kita yang mencermati perkembangan tentang organisasi dunia usaha di Sumut sudah tahu. Apalagi kalau bukan Musprov Kadin Sumut yang digelar di JW Marriot Medan. Hasil yang muncul adalah Catatan terpilihnya Ivan Iskandar Batubara Gus Irawan sebagai ketua Kadin Sumut untuk periode mendatang. Tentu saja bagi para pebisnis harapan yang muncul adalah agar organisasi ini bisa berperan lebih besar terhadap pertumbuhan ekonomi ke depan. Saya sering menyebutkan bahwa periode 2013 itu adalah momentum bagi ekonomi Sumut untuk melaju lebih kencang. Ditandai dengan harus rampungnya kawasan Industri Sei Mangkei kemudian dioperasikan sekitar 2014, lalu beralihnya status kepemilihan Inalum serta keinginan agar pelabuhan Kuala Tanjung bisa ditingkatkan kapasitasnya. Selain itu tentu saja kita harus melihat potensi perkebunan sawit berikut industri hulu dan hilir yang sangat besar peluangnya untuk dikembangkan. Harapan Lanjut ke hal A2 kol 2

Al Bayan

Baitul Asyi Oleh: H. Ameer Hamzah Apabila anak cucu Adam meninggal dunia, putuslah segala amalnya kecuali tiga perkara: Sedekah Jariah, Ilmu yang bermanfaat, atau anak saleh yang selalu mendoakan kedua orangtuanya” (HR:Bukhari) BAITUL ASYI (Rumah Aceh) di Mekkah dan sekitarnya adalah nama lain dari harta wakaf para aghniya’ (orangorang kaya) Aceh pada zaman dulu. Mereka adalah para sultan, ulama, uleebalang, dan pedagang) yang Lanjut ke hal A2 kol 2

Tiga Calhaj Embarkasi Medan Wafat Di Tanah Suci

lambat 20 November 2012,” ujarnya. Dijelaskannya, UMP Sumut 2013 secara yuridis telah ditetapkan berdasarkan Keputusan Gubernur Sumut No. 188.44/647/KPTS/2012 Tanggal 18 Oktober 2012 yang ditandatangani Plt. Gubsu. “Upah minimum ini merupakan upah terendah dan hanya berlaku bagi pekerja lajang yang mempunyai masa kerja nol sampai satu tahun untuk jabatan terendah dan pendidikan terendah. Perusahaan yang telah memberikan upah lebih tinggi dari UMP 2013 dilarang untuk mengurangi atau menurunkan upah,” kata Gatot dan menambahkan, keputusan berlaku mulai 1 Januari 2013. Sementara, Sekdaprovsu menjelaskan, UMP baru ini usulan Dewan Pengupahan Daerah (Depeda) Provinsi Sumut, terdiri dari unsur pengusaha (Apindo), perwakilan serikat pekerja, serikat buruh, dewan pakar dan aparat pemerintah. Penghitungan diawali pelaksanaan survei Kebutuhan Hidup Layak (KHL) ke pasarpasar tradisional di kabupaten dan kota se Sumut berpedoman kepada Permenakertrans No. 13/2012. Selanjutnya, Depeda Provinsi Sumut membahas nilai usulan UMP dengan Lanjut ke hal A2 kol 4

MEDAN (Waspada): Tiga orang Calhaj Embarkasi Medan wafat di Tanah Suci. Demikian disampaikan Kordinator Humas Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan, Drs HM Sazli, Minggu (21/10). Menurut Sazli, berdasarkan informasi dari petugas yang ada di Arab Saudi kemarin menyebutkan Calhaj yang wafat atas nama , Sanwirjak bin Alm Kertamenawi,82, asal Asahan yang tergabung dalam kloter 11, manifes 132. Wafat (18/10) pukul 16.30 WAS di BPHI Mekah akibat gangguan sistem pernafasan dan dimakamkan di Syara. Nursu binti Abdul Halim Harahap,80,asal Medan kloter 08 manifes 190 wafat (18/10) pukul 20.30 WAS di BPHI Lanjut ke hal A2 kol 5

MAKKAH (Waspada): Ribuan tenda berdinding kain berukuran sekitar empat meter persegi telah berdiri di Padang Arafah, Sabtu (20/10), sedangkan ratusan petugas dan pekerja sedang memasang bendera negara dan tanda-tanda kloter serta pamflet asal jamaah yang akan menempati tenda-tenda tersebut menyongsong kegiatan ibadah Armina (ArafahMuzdalifah-Mina). ‘“Petugas kita telah mempersiapkan keperluan para jamaah dengan perencanaan yang tersusun rapi untuk Mina, Muzdalifah dan Arafah, mudah-mudahan tidak ada yang jauh meleset dari perhitungan,” kata Abu Haris Mutohar, di Makkah, Sabtu, dalam pemaparan proyeksi ritual ibadah ‘wukuf‘ di Arafah, Mabit di Muzdalifah dan lempar jumrah di Mina. Puluhan pekerja sedang melakukan perbaikan terhadap komleks yang akan menjadi tenda-tenda jamaah Indonesia di Arafah. Maktab-maktab di Mina juga telah dicoba menggunakan alat pendingin udaranya Sabtu serta tulisan tanda penempatan jamaah sesuai kloter dan asal jamaahnya telah terpasang. Lanjut ke hal A2 kol 6

LSI: 77,5 Persen Publik Terima Perbedaan Agama JAKARTA (Antara): Survei terbaru yang diadakan Yayasan Denny JA dan Lingkaran Survei Indonesia (LSI) Community menyebutkan 77,5 persen publik menerima bertetangga dengan perbedaan agama, sedang yang tidak menerima 15,1 persen dan tidak tahu hanya 7,4 persen. Peneliti LSI Community Ardian Sopa didampingi Direktur YDJA Novriantoni Kahar mengemukakan hal itu

kepada pers di Jakarta, Minggu (21/10). Survei menemukan bahwa publik menerima bertetangga dengan penganut Syiah hanya 54,0 persen, menerima penganut Ahmadiyah 48,2 persen dan orang yang memiliki hubungan sesama jenis (kaum homoseksual) hanya 17,1 persen. Ardian mengatakan, survei yang bekerjasama LSI Network itu dilakukan pada 1-8 Oktober

2012 dengan menggunakan metode multistage random sampling, mengambil 1.200 responden dengan teknik w a w a n ca ra , t a t a p m u k a responden dengan kuesioner dan tingkat kesalahan 2,9 persen. Survei dilengkapi dengan riset kualitatif, analisis media dan Focus Group Discussion (FGD). Lanjut ke hal A2 kol 4

Tahanan Tipikor B. Aceh Meninggal


SELUDUPAN MITAN ANTAR PROVINSI: Aparat keamanan membongkar angkutan Minyak Tanah (Mitan) yang dikemas dalam bungkusan plastik dan drum yang terjaring razia polisi di kawasan Bayu diamankan di Mapolres Lhokseumawe. Provinsi Aceh. Sabtu (20/10) malam. Sebanyak 20 ton Mitan seludupan antar Provinsi itu (tidak memiliki surat/dokumen) diangkut dengan enam unit jenis L 300 bak terbuka dari Pangkalan Berandan Provinsi Sumatera Utara Medan tujuan Banda Aceh. Polisi amankan 12 tersangka supirdan kernet angkutan. Berita Di hal. B10

Kasus 13 Tahanan Kabur, 5 Personil Polsek Medan Area Diperiksa Propam 5 Tahanan Ditangkap Kembali MEDAN (Waspada): 5 Personil Polsek Medan Area diperiksa Propam Polresta Medan dalam kasus kaburnya 13 tahanan dari sel Polsek tersebut. Sedangkan, lima tahanan yang kabur berhasil ditangkap kembali. “Lima personil sudah kita periksa,” kata Kasi Propam Polresta Medan AKP Benno Sidabutar kepada Waspada, Minggu (21/10). Dijelaskan Benno, personil yang telah menjalani pemeriksaan, yakni anggota jaga Aipda Amrin (Ka Jaga), Brigadir Hasan Basri, Briptu Azhar Efendi. Menyusul Kapolsek Medan Area Kompol Sony W Siregar dan perwira pengawas (Pawas) Aiptu M Simanjuntak. “Ketiganya sebagai terduga pelanggar dan sesuai hasil pemeriksaan, petugas jaga tidak melaksanakan Standar Operasional Polisi (SOP) jaga tahanan,” jelas AKP Benno Sidabutar dan menambahkan, Ka Jaga Lanjut ke hal A2 kol 1

BANDA ACEH (Waspada): Mantan pejabat pelaksana teknis kegiatan (PPTK) dari Dinas Pendidikan Pemuda dan Olahraga Aceh Barat, Said Rasyidin, 52, meninggal dunia, Minggu (21/10) dini hari di RSUZA Banda Aceh. Said Rasyidin merupakan tersangka dalam kasus dugaan korupsi proyek dua SMA di Aceh Barat dari dana otsus tahun 2009. Said yang kini menjabat pengawas di Disdikpora Aceh Barat ini ditahan di Lapas Lambaroe Aceh Besar sejak Oktober lalu untuk mengikuti sidang di pengadilan Tipikor Banda Aceh. Menur ut keterangan pengacaranya, Ahyar, awalnya Said Rasyidin mengalami sesak nafas dan dirawat di

klinik Lapas Lambaroe Aceh Besar, kemudian Said dirujuk ke IGD Rumah Sakit Zainoel Abidin Banda Aceh didampingi perawat klinik Lapas. Dari hasil diagnosa dokter, Said mengalami gangguan pernafasan/sesak nafas dan akhirnya nyawanya tidak tertolong, pada pukul 01:15 dini hari Said meninggal dunia. Ahyar menyebutkan, pihak keluarga sudah mendampingi Said saat dirawat di rumah sakit. Jenazah Said langsung dibawa pulang ke rumah duka di Kota Meulaboh Kabupaten Aceh Barat. Said ditahan Kejari Meulaboh setelah berkasnya Lanjut ke hal A2 kol 1

Ada-ada Saja

Takut Terhadap Toilet

SEORANG wanita Inggris memiliki rasa takut terhadap toilet sehingga dia selalu lari setiap kali mendengar suara air pada toilet. Hal itu sering membuatnya merasa seperti ingin ditelan oleh toilet. Ney Decino, setiap ingin Lanjut ke hal A2 kol 5

Serampang Waspada/Ismanto Ismail

Waka Poldasu Irjen Pol Drs Cornelis Hutagaol (tengah) memberikan arahan pasca kaburnya 13 tahanan Mapolsek Medan Area kepada Waka Polresta Medan AKBP Drs Pranyoto, SH dan Kasat Reskrim Kompol M Yoris Marzuki, SH, SIK (belakangi lensa), Minggu (21/10) dinihari pukul 01:10.

- Jangan banyak mengeluh di Arafah ....! - He.... he....he....

Berita Utama


LSI: 77,5 Persen....

Ardian menjelaskan, terjadi peningkatan prosentase publik yang tidak menerima bertetangga dengan perbedaan agama yaitu dari 8,2 persen (survei 2005) menjadi 15,1 persen (2012). Begitu juga untuk penerimaan bertetangga dengan penganut Syiah meningkat dari 26,7 persen (2005) menjadi 41,8 persen (2012): dengan Ahmadiyah dari 39,1 persen menjadi 46,6 persen; dengan kaum homoseksual meningkat dari 64,7 persen (2005) menjadi 80,6 persen (2012). Responden yang tidak setuju menggunakan cara kekerasan dalam menegakkan agama sebanyak 79,0 persen (Survei 2005) sedang pada Survei 2012 hanya 59,3 persen. Sedangkan yang setuju penggunaan kekerasan pada 2005 hanya 9,8 persen dan pada 2012 sebanyak 24,0 persen.

UMP Sumut ....

Kasus Tahanan ....

masuk pukul 20:30, dan anggotanya Briptu Azhar Efendi masuk pukul 20:15. Sedangkan yang melaksanakan serah terima jaga Bripka Irwansyah (jaga siang) dengan Brigadir Hasan Basri. Pemeriksaan juga dilakukan terhadap Perwira Pengawas (Pawas) Aiptu M. Simanjuntak (terduga pelanggar) yang tidak melaksanakan tugas hingga tahanan kabur. Propam Polresta Medan, lanjutnya, melakukan pemeriksaan terhadap Kapolsek Medan Area Kompol Sony W Siregar (terduga pelanggar) dalam perkara pelanggaran etika kelembagaan dalam pasal 7 ayat 1 huruf C, Perkap 14 tahun 2011 tentang KEPP. Namun, para personel tidak ditahan. Lima ditangkap AKP Benno Sidabutar menjelaskan, Propam telah memintai keterangan saksi terhadap tahanan yang sebelumnya melarikan diri yakni WAH, SE dan MS. “Dari hasil pemeriksaan terhadap tahanan ini diperoleh kesimpulan gergaji besi yang masuk ke ruang tahanan Jumat 19 Oktober 2012 pukul 15:00 melalui isteri tersangka Benny Sahputra yang ditahan karena terlibat kasus pencurian. Waktu itu yang jaga Aipda Amr in dkk,” jelas Benno Sidabutar. Sementara itu, lima dari 13 tahanan yang kabur, Minggu (21/10), berhasil ditangkap kembali yaitu WAH warga Jl. SM Raja Medan terlbat kasus narkoba tertangkap tak jauh dari markas Polsek Medan

Tahanan Tipikor ....

dinyatakan (P-21) telah lengkap oleh penyidik Polres Aceh Barat dan diserahkan ke Kejari Aceh Barat. Kemudian untuk mengikuti sidang di Pengadilan Tipikor Banda Aceh, lalu dititipkan di Lapas Lambaroe Aceh Besar. Menurut pengacaranya, direncanakan pada Rabu (24/10) mendatang, ada jadwal putusan sela terhadap eksepsi bantahan dakwaan di pengadilan Tipikor Banda Aceh terhadap kasus ini. (cb01)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ....., BaxGh2+. 2. RxB, Kxf3+. 3. Rh1, Bg1+mat.

Jawaban TTS: TTS Topik

Umum Serba “Adi”

Area, Sy warga Jl. M Nawi Harahap Kompleks Pemda Blok H No.177 A terlibat kasus pencurian dan perampokan , diserahkan keluarganya. MS warga Jl. Denai, Gang Damai No.40 Kec Medan Denai kasus penipuan diserahkan orang tuanya dan Kepala Lingkuangan ke Polsek Medan Area. RMS warga Jl. Menteng V I I G a n g M a d r a s a h Kec Medan Denai terlibat kasus pencurian dan kekerasan diserahkan keluarganya kembali ke Polsek, dan CS warga Jl. SM Raja Medan terlibat kasus pencurian dengan kekerasan ditangkap di loket bus KUPJ saat akan ke Perbaungan. Sedangkan, delapan tahanan belum tertangkap yakni BSN warga Jl. Dahlia Pangkalan Susu Kab Langkat terlibat kasus pencurian. Ali Muda Pane warga Jl. Prima Gang Melur Pasar VII Tengah Desa Tembung Kec Percut SeiTuan, RRG terlibat kasus penganiayaan warga Jl. Tangguk Bongkar VIII , Kel Tegalsari Mandala III, Kec Medan Denai. BS terlibat kasus pencurian warga Jl. Sutrisno Gang F No.13 Kel Kota Matsum, Kec Medan Kota. MT terlibat kasus pencurian warga Jl. Tirto Sari Gang Saudara No.21 Kel Bantan, Kec

Medan Tembung. HS terlibat kasus pencurian warga warga Jl. Elang I No.31 Medan Denai. AS kasus kepemilikan senjata tajam warga Jl. Garu I Kec Medan Amplas dan AN terlibat kasus pencurian warga Jl. Lembaga Permasyarakatan Gang Saudara , Kel Tanjung Gusta, Kec Medan Helvetia. S, seorang tahanan kabur yang telah diserahkan kembali oleh keluarganya mengatakan, dia ikut kabur karena dipaksa dan diancam akan dipukul oleh teman-temannya. Bahkan, saat sudah berada di luar sel, S sempat diancam karena hendak masuk kembali ke dalam sel. S tidak tahu, siapa ‘otak’pelaku pelarian ke-13 tahanan tersebut. Sumber di kepolisian menyebutkan, rencana kabur ‘diotaki’ oleh MT. Kanit Reskrim Polsek Medan Area AKP J Banjarnahor membenarkan, lima tahanan telah ditangkap kembali. Sebagaimana diketahui, 13 dari 23 tahanan Polsek Medan Area, Sabtu (20/10) pukul 21:00, kabur dari sel setelah menggergaji jeruji besi ventilasi kamar mandi menggunakan gergaji besi. Gergaji besi tersebut dibawa istri BS, saat membesuk suaminya Jumat (19/10) sore. (h04/m39)

memperhatikan berbagai faktor ekonomi dan ketenagakerjaan dengan penambahan 14 komponen yang sebelumnya 46 menjadi 60 komponen, sehingga UMP diharapkan saling menguntungkan antara pengusaha dan buruh atau pekerja. Sedangkan Kepala Disnakertrans Sumut Bukit Tambunan menambahkan, setelah pembahasan konprehensif dengan memperhatikan nilai PDRB Sumut semester I/2012 dari BPS 6,03 persen dan prakiraan nilai inflasi Sumut 2013 dari Bank Indonesia 4 sampai 6 persen, Depeda Sumut menetapkan nilai usulan UMP Sumut 2013 sebesar 7,03 persen di atas nilai KHL 2012 dengan nilai usulan

2.230 WNI ....

membawa 337 penumpang, namun sehari sebelumnya, seorang wanita hamil melahirkan dan dia tidak dibenarkan menaiki pesawat. Rombongan terakhir dari WNI yang dipulangkan itu ber angkat Jumat malam dengan pesawat Airbus-330, yang mengangkut 333 penumpang, kata Appo Illa, Stasiun Manejer Garuda. Indonesia merupakan negara terbesar mengirimkan jamaah calon Hajinya, sebanyak 296 penerbangan. Pihak berwenang Indonesia telah mengatur

pemulangan dari 18.675 WNI dari Arab Saudi pada tahun 2011, sementara tahun 2010 tercatat 15.000 WNI yang dipulangkan dari Arab Saudi. Sebanyak 8.631 dokumen sebagai pengganti paspor telah dikeluarkan untuk memfasilitasi repatriasi tahun ini. Menurut data yang diperoleh dari Departemen Tenaga Kerja Indonesia, Arab Saudi adalah negara terbesar kedua penampung tenaga kerja Indonesia setelah Malaysia. (an/m10)

Utara. Jangan sampai para pengusaha ini menganggap tak ada peran pemerintah. Sebab dengan peran pengusaha ini jugalah Sumut ke depan bisa dikenal dunia. Mereka jugalah yang bisa meningkatkan daya saing daerah ini dengan wilayah lain. Kalau secara nasional menurut Global Competitiveness Index yang dirilis World Economic Forum (WEF) maupun World Competitiveness dari International Institute for Management Development menunjukkan masih lemahnya daya saing bangsa dibandingkan dengan sejumlah negara Asean apalagi negara-negara maju. Peringkat daya saing Indonesia 2008 sampai 2009 misalnya ada di urutan ke 55. Ini kalah dari Singapura yang ada di peringkat lima, Malaysia di peringkat 21 atau Thailand yang ada di urutan ke 34. Begitupula dari data World Competitiveness kalau kita berada di peringkat 51, kemudian Singapura ada di peringkat 2, Malaysia di urutan ke 19 serta Thailand di level 27. Malah Filipina pun di atas kita yang masuk peringkat 40. Bayangkan tugas berat yang harus diemban pemerintah daerah dan para pebisnis. Dengan data itu kita melihat tantangan yang berat dalam upaya meningkatkan daya

saing menghadapi dunia global demi pertumbuhan yang lebih tinggi. Saya berkesimpulan daya saing nasional juga menggambarkan tentang Provinsi Sumut. Padahal dengan membaiknya peringkat daya saing akan mampu membawa satu daerah pada tujuan kemandirian. Dulu istilahnya berdiri di atas kaki sendiri. Tapi saya cenderung memaknainya sebagai wilayah yang mandiri. Atau provinsi yang mandiri. Provinsi mandiri itu setidaknya punya kemampuan untuk menghasilkan barang dan jasa yang secara potensial bisa diproduksi sendiri, baik karena adanya bahan baku, penguasaan teknologi, ataupun kepemilikan skill sehingga bisa diproduksi secara efisien dan berdaya saing. Lalu kemandirian itu juga adanya kekutan dan kemampuan lebih diistilahkan bargaining position dalam hubungan ekonomi dengan daerah lain. Sehingga dalam hubungan tersebut yang muncul adalah saling menguntungkan dan bisa sama-sama maju. Jadi sekali lagi dengan akselerasi sektor riil dengan perpanduan antara pemerintah dan pebisnis semua tujuan untuk meningkatkan daya saing serta kemandirian bisa tercapai.

mengapa bagi yang mengurusinya untuk memakan hasilnya dengan alakadarnya serta tidak pula menjadikannya m i l i k p r i b a d i n y a .” ( H R : Muslim). Menurut Syeikh Sulaiman Al-Asyi; Jumlah rumah waqaf Aceh di Arab Saudi semuanya 23 tempat. Namun sekarang tinggal 17 bangunan lagi. Selebihnya tidak jelas statusnya. Rumah-r umah yang ada sekarang menghasilkan sewa yang cukup lumayan. Semuanya telah tergabung dalam sebuah yayasan, yakni Yayasan Habib Bugak Al-Asyi yang dikelola orang-orang keturu-

nan Aceh warga Arab Saudi. Setelah bencana tsunami Aceh tahun 2004, yayasan yang kaya raya tersebut telah memperhatikan jamaah asal Aceh, mereka tiap tahun memberi bantuan antara dua jutaan lebih kepada jamaah haji yang terbang lewat Bandara Iskandar Muda tanpa membedakan suku bangsa. Dengan ada bantuan dari yayasan tersebut, jamaah haji Aceh merasa berterima kasih yang tak terhingga. Semoga Allah SWT menyampaikan pahala kepada para pendahulu kita yang mewaqafkan harta-harta tersebut.

masalah itu, yang mana disetujui untuk mengizinkan pekerja Indonesia yang terkatung-katung untuk kembali ke Indonesia, setelah semua masalah surat-surat dokumentasi mereka diselesaikan, seperti masalah keimigrasian dan jadual transportasinya. Rombongan per tama WNI yang direpatriasi itu Rabu terdiri dari 336 penumpang, termasuk 302 wanita, 15 anakanak dan 19 bayi. Penerbangan itu seyogyanya akan

Sektor Riil ....

para anggota terhadap organisasi ini pasti kian tinggi. Keinginan untuk perubahan tentu sangat besar. Semua itulah yang harus diakomodasi pengurus baru nantinya. Saya tentu ikut mendukung progres ke depan Kadin Sumut berikut harapan-harapannya. Kita harus sama-sama mengembangkan sektor riil yang menjadi fundamen dasar bergeraknya ekonomi. Pada prinsipnya para pengusahalah yang berperan penting dalam mendorong pertumbuhan. Dari komponen investasi, konsumsi, ekspor dan impor sebagai pendorong pertumbuhan maka semua itu merupakan bagian dari pengusaha. Kalau saja pengusaha tak mau mendorong sektor riil tentu ekonomi kita akan mandeg. Makanya saya juga miris ketika ada kawan-kawan kita dari pengusaha yang menyatakan bahwa sebenarnya tanpa pemerintah pun mereka mampu bergerak dan berjalan sendiri. Ibaratnya auto pilot. Tanpa peran pemerintah, bisnis mereka akan tetap berjalan seperti biasa. Para pengusaha ini tentu saja harus mendapat respon dari pemerintah daerah. Apa masalah yang mereka hadapi, kemudian keinginan apa yang bisa sama-sama digerakkan untuk kemajuan Sumatera

Al Bayan ....

Jawaban Sudoku: 9 4 1 2 6 8 7 3 5

6 8 7 1 5 4 2 9 1

2 3 5 3 9 7 4 6 8

3 7 6 5 1 2 8 4 9

5 2 4 8 3 9 6 1 7

1 9 8 7 4 6 5 2 3

8 1 3 4 2 5 9 7 6

7 6 2 9 8 3 1 5 4

4 5 9 6 7 1 3 8 2

menunaikan ibadah haji. Dulu mereka menunaikan ibadah haji membawa harta yang banyak, membeli rumah-rumah orang Arab dan orang Turki yang menjualnya. Kemudian rumah dan tanah itu diwakafkan kepada mukmin Aceh yang menetap di Mekkah. Rasulullah SAW bersabda: “Sesungguhnya harta wakaf itu tidak boleh dijualbelikan dan dialihkan serta diwarisi, dan bersedekahlah dengannya kepada fakir miskin serta sanak keluarga dan orangorang yang berada di bawah tanggunganmu, tidaklah

Tahun Depan ....

pendampingnya,” kata Anggito di Makkah, Sabtu (20/10), usai mengunjungi persiapan proses ibadah di lokasi Arafah, Muzdalifah dan Mina. Mulai tahun depan, katanya, sejak awal proses seleksi akan diprioritaskan kuota bagi jamaah berusia 80 tahun ke atas bersama pendampingnya. Dengan demikian, masalah yang dihadapi seperti gangguan fisik di Tanah Suci diharapkan akan berkurang, tambahnya.

Ardian mengatakan, survei LSI menemukan ada tiga faktor mengharuskan adanya perhatian serius terhadap meningkatnya intoleransi, pertama, data jumlah kekerasan yang mengatasnamakan agama meningkat dari 62 kasus pada 2010 menjadi 92 kasus pada 2011. Kedua, lembaga kepresiden, politisi dan polisi dinilai responden kurang optimal dalam melindungi perbedaan dan kebebasan. Survei LSI menemukan publik yang menyatakan puas atas kinerja kepresiden 25,1 persen; politisi (37,7 persen) dan polisi (29,5 persen). Ketiga, survei LSI menemukan bahwa ketidaktoleransian publik terhadap isu perbedaan masih tinggi yaitu 31,2 persen, sedangkan publik yang menilai cukup toleran sebanyak 63,1 persen dan yang tidak tahu hanya 5,7 persen. Rp1.294.500. Usulan diserahkan kepada Plt. Gubsu sebagai bahan pertimbangan untuk menetapkan UMP 2013. Selanjutnya, berdasarkan pertimbangan psikologis upah bagi pekerja, pada audiensi Depeda dengan Plt. Gubsu, Plt. Gubsu dan Depeda sepakat menetapkan UMP Sumut 2013 sebesar 7,90 persen di atas nilai KHL terendah 2012 atau 8,75 persen di atas nilai UMP Sumut 2012. Sementara, dalam Keputusan Gubsu dinyatakan, besarnya Upah Minimum Sektoral Provinsi Sumut 2013 akan ditetapkan lebih lanjut dengan mengacu UMP itu. Pada saat Keputusan Gubsu yang baru ini berlaku, Keputusan Gubsu No. 188.44/988/ KPTS/Tahun 2011 tanggal 17 November 2011 tentang UMP Sumut 2012 tak berlaku lagi. (m34)

3 Calhaj....

Mekah akibat gangguan sistem pernafasan dimakamkan di Syara.Ruslan Hasibuan bin Tongku Bidaralan,67,asal Padang Lawas kloter 17 wafat (19/10) pukul 02.45 WAS di BPHI Mekah akibat infeksi dan parasit dimakamkan di Syara. “Dengan demikian, sudah 9 orang jamaah calon haji asal embarkasi Medan yang wafat di tanah suci,”kata Sazli kemarin. Calhaj Tunanetra Tetap Semangat Kemarin, Calhaj Asal Kota Pinang Rantauprapat bernama M Thoha Harahap yang bergabung dalam kloter 18 menyampaikan rasa gembiranya kepada Waspada. Meski kondisinya kurang sempurna, Thoha mengaku tetap semangat dalam menjalankan rutinitas ibadah wajib dan sunnah di Tanah Suci. “Alhamdulillah saya dan isteri sebagai pendamping, bisa melaksanakan berbagai rangkaian ibadah yang wajib dan sunnah. Saya sudah mencium hazar ul Aswad saat umroh, saya juga sudah iku berkunjung ke tempat bersejarah. Dari penginapan ke Masjidil Haram jaraknya 3 kilometer, biar enggak capek kami menentukan waktu yang cocok saja ke Masjidil Haram, karena naik busnya suka berebut. Makanan di sini cocok buat saya, kadang-kadang isteri saya masak sendiri apa adanya karena sistem antrian suka lama,” kata Thoha yang menyampaikan salam untuk semua wartawan yang memberitakannya sebelum bertolak ke Tanah Suci dari Embarkasi Medan. (m37)

Ada-ada Saja ....

pergi ke toilet dia selalu memohon anggota keluarganya untuk menarik keran air untuknya. Fobia aneh ini bahkan memaksanya untuk bekerja dekat dengan rumah sehingga dia bisa lari kembali ke rumahnya, hanya untuk menggunakan toilet. Menurut perempuan berusia 20 tahun itu, dia merasa lebih aman dirumahnya. “Suara air membuatku merasa menggigil sampai ke tulang belakang saya. Ini mengerikan karena saya merasa ingin ditelan toilet. Saya tidak tahan berlama-lama di dalam toilet,” ujar Ney. seperti dikutip oleh The Sun akhir pekan lalu. Ketakutan Ney ini berawal saat usianya baru empat tahun, setelah melihat film di tahun 90an yang berjudul Look Who’s Talking Too. Dalam film itu sebuah toilet hidup dan menjerit dengan mata yang besar dan taring yang tajam. Hal itu yang telah menghantui Ney sejak saat itu. “Sejak aku melihat film itu, aku sudah ketakutan. Ketika aku berusia sekitar 11 tahun aku mengompol saat perjalanan pulang karena saya takut menggunakan toilet di sekolah,” ujar wanita berambut pirang itu. Fobia masa kecilnya itu masih menghantui sampai hari sehingga dia menolak untuk menggunakan toilet umum. (ok/rzl)

WASPADA Senin 22 Oktober 2012

Partai Apa Pilih Siapa (PAPS)

Wildan, Ondim, Gus, Fadly Memimpin MEDAN (Waspada): Dari enam partai politik lapis pertama, kedua, dan lapis ketiga, muncul empat nama yang dicalonkan pembaca Waspada. Melalui Partai Apa Pilih Siapa (PAPS), keempat nama tersebut menjadi favorit pembaca Waspada. Sampai pengumpulan kupon PAPS hari Sabtu (20/10) keempat nama tersebut sepertinya secara konsisten diunggulkan pembaca. Mereka adalah Wildan Tanjung yang unggul di Partai Persatuan Pembangunan (PPP), Syah Afandin (Ondim) unggul di Partai Amanat Nasional (PAN), Gus Irawan di Partai Demokrat, Golkar, dan Partai Demokrasi Indonesia Perjuangan (PDI-P). Sedangkan Fadly Nurzal unggul di Partai Keadilan Sejahtera (PKS). Apa yang disebut partai lapis pertama adalah partai yang memenuhi persyaratan mencalonkan pasangan calon gubernur tanpa harus berkoalisi, yakni Partai Demokrat. Sedangkan partai lapis kedua adalah partai yang harus berkoalisi untuk mencalonkan pasangan calon gubernur, namun memiliki jumlah kursi yang dominan atau di atas 10 kursi. Partai tersebut yakni Partai Golkar, PDI-P, dan PKS. Di partai lapis pertama ini menempati urutan kedua Cornel Simbolon dengan 21 persen, disusul Fadly Nurzal dengan 15 persen, dan ada

beberapa nama yang terakumulasi sebesar 21 persen. Di Golkar, urutan kedua ada Wildan Tanjung dengan 27 p e r s e n , d a n C h a i r uman Harahap dengan 12 persen, disusul 15 persen akumulasi beberapa nama. Urutan kedua di PDI-P juga ada Wildan Tanjung dengan 26 persen, disusul Ondim dengan 8 persen. Ada 17 persen suara dukungan akumulasi beberapa nama lain. Sedangkan di PKS Gatot Pujo Nugroho menempati ur utan kedua dengan 23 persen, dan di bawahnya Gus Irawan dengan 15 persen,

disusul 11 persen akumulasi suara dukungan beberapa nama. Untuk PAN yang telah merumuskan nama yang diusulkan oleh partai, ada Gus Irawan di tempat kedua dengan 28 persen, disusul Wildan dengan 20 persen, sisa suara ada 8 persen. Sementara di PPP ada nama Fadly 35 persen, Gus 27 persen, dll 1 persen. Dipercaya, dukungan pembaca di PAPS akan mengalami akselerasi, terutama menjelang penetapan oleh partai politik. Kejutan-kejutan akan sangat mungkin terjadi. (Tim)

IPW Desak Polda Metro Bebaskan 10 Mahasiswa Unpam J A K A RTA ( Wa s p a d a ) : Ketua Presidium Indonesia Police Watch (IPW ) Neta S Pane, Minggu (21/10) dalam rilisnya meminta polisi segera membebaskan dan mengusut dugaan pemerasan terhadap 10 mahasiswa Universitas Pamulang (Unpam) Tangerang Selatan, Banten, yang ditahan pasca bentrok dengan polisi yang menolak kehadiran Wakapolri Komjen Pol Nanan Sukarna di kampus mereka pada Kamis (18/10) lalu. IPW, kata Neta, mendesak

Polda Metro Jaya agar mengusut tuntas upaya pemerasan yang dilakukan oknum polisi yang meminta uang Rp10 juta kepada 10 mahasiswa yang ditahan sejak bentrokan meletus. Penanganan aksi demo di Unpam, lanjut Neta, polisi bekerja tidak sesuai SOP dalam mengendalikan aksi massa, polisi menggunakan water canon terlebih dahulu sebelum melepaskan tembakan gas air mata dan peluru karet. “Tapi yang terjadi polisi

m a i n h a j a r. M a h a s i s w a dipukuli dan ditembaki gas air mata dan peluru karet,” ujar Neta. Aksi protes penolakan Wakapolri, kata Neta, merupakan bagian dari penyampaian aspirasi mahasiswa yang seharusnya disikapi polisi dengan profesional, bukan arogan. “Karena itu malah akan mbuat Polri terus menerus dicerca dan akumulasi perlawanan mahasiswa kepada Polri kian meningkat,” tambahnya.

Padang Arafah ....

yang sakit dan tidak dapat melaksanakan lempar jumrah. Tim juga mengawasi keseluruhan pergerakan semua jamaah Indonesia, baik jamaah reguler maupun jamaah khusus, kata Abu Haris. Minggu (21/10) seluruh jamaah haji telah berada di Arab Saudi. Indonesia mendapat kuota 211.000 kuota tahun ini, 194.000 jamaah reguler dan 17.000 jamaah khusus. 23 Oktober Izin Terakhir Menteri Dalam Negeri Pangeran Ahmed, juga ketua Komite Tertinggi Haji, telah memperpanjang tanggal untuk memperoleh izin haji bagi para jamaah asing di Jeddah selama dua hari lagi sampai Selasa (23/10), kata Komandan Pasukan Paspor untuk Haji Brigadir Aed Al-Harbi. Pemberian izin terakhir adalah 21 Oktober, namun tanggal tersebut diperpanjang mengingat volume aplikasi untuk tasrih yang tidak dapat diselesaikan pada saat itu. Departemen Paspor menge-

luarkan izin pada hari lembaga tersebut mener ima permohonan. memperbolehkan hari yang sama dia menerima aplikasi. Pangeran Ahmed menyetujui rencana organisasi, keamanan dan kewaspadaan yang dilaksanakan oleh berbagai departemen untuk haji. Rencana tersebut merinci tugas yang tepat dan peran dari masing-masing departemen termasuk jumlah pekerja yang dibutuhkan, sumber daya dan peralatan untuk pelaksanaan ideal rencana, kata Saudi Press Agency, mengutip Penasehat Menteri Dalam Negeri dan Sekretaris Jenderal Komite Agung Haji Saed Al-Harithy. Pangeran Ahmed mendesak departemennya agar memberikan pelayanan terbaik kepada para jamaah seperti yang diinginkan oleh Penjaga Dua Masjid Suci Raja Abdullah dan Pangeran Mahkota Salman, wakil perdana menteri dan menteri pertahanan. (an/m10)

Sejak H-3 petugas telah dipersiapkan melakukan simulasi pergerakan jamaah haji dengan pengaturan waktu yang tepat guna menghindari terjadinya penumpukan. Sebelum prosesi Armina, kata Abu Haris, petugas harus memastikan tidak ada jamaah yang tertinggal di seluruh tempat di kota Makkah, baik dipemondokan, Masjidil Haram maupun tempattempat lainnya. “Akan dilakukan `sweeping` oleh seluruh panitia di sektornya masing-masing dan dipastikan semua telah memakai pakaian ihram menjelang keberangkatan,” kata Abu Haris yang menjadi petugas Satuan Operasi Armina Indonesia, di tempat yang akan menjadi konsentrasi tiga juta jamaah yang melakukan wukuf sebagai rukun haji tersebut. Dalam perencanaan itu juga t el a h diga mba r kan pelaksanaan ‘safariwukuf‘ dan ‘pembadalan‘ bagi jamaah


Berita Utama

WASPADA Senin 22 Oktober 2012

Bangun Kampung Indonesia Di Makkah Terbentur Masalah Perizinan

UMP Sumut ... ditetapkan berdasarkan Keputusan Gubernur Sumut No. 188.44/647/KPTS/2012 Tanggal 18 Oktober 2012 yang ditandatangani Plt. Gubsu. “Upah minimum ini merupakan upah terendah dan hanya berlaku bagi pekerja lajang yang mempunyai masa kerja nol

sampai satu tahun untuk jabatan terendah dan pendidikan terendah. Perusahaan yang telah memberikan upah lebih tinggi dari UMP 2013 dilarang untuk mengurangi atau menurunkan upah,” kata Gatot dan menambahkan, keputusan berlaku mulai 1 Januari 2013. Sementara, Sekdaprovsu menjelaskan, UMP baru ini usu-

2.230 WNI Dipulangkan ... Kejadian itu juga terjadi lagi selama minggu pertama Oktober, ketika beberapa ratus warga negara Indonesia berkumpul di sekitar pintu masuk konsulat RI. Pasukan keamanan diberitahu dan segera bergegas ke tempat itu untuk mencegah pekerja Indonesia memasuki kompleks konsulat. Konjen RI Zakaria Anshar bersama dengan satu tim yang terdiri dari para pejabat senior mengadakan perundingan dengan pihak berwenang Arab Saudi untuk membahas masalah itu, yang mana disetujui untuk mengizinkan pekerja Indonesia yang terkatung-katung untuk kembali ke Indonesia, setelah semua masalah surat-surat dokumentasi mereka diselesaikan, seperti masalah keimigrasian dan jadual transportasinya. Rombongan pertama WNI yang direpatriasi itu Rabu terdiri dari 336 penumpang, termasuk 302 wanita, 15 anak-anak dan 19 bayi. Penerbangan itu seyogyanya akan membawa 337 penumpang, namun sehari sebelumnya, seorang wanita hamil melahirkan dan dia tidak dibenarkan menaiki pesawat. Rombongan terakhir dari WNI yang dipulangkan itu berangkat Jumat malam dengan pesawat Airbus-330, yang mengangkut 333 penumpang, kata Appo Illa, Stasiun Manejer Garuda. Indonesia merupakan negara terbesar mengirimkan jamaah calon Hajinya, sebanyak 296 penerbangan. Pihak berwenang Indonesia telah mengatur pemulangan dari 18.675 WNI dari Arab Saudi pada tahun 2011, sementara tahun 2010 tercatat 15.000 WNI yang dipulangkan dari Arab Saudi. Sebanyak 8.631 dokumen sebagai pengganti paspor telah dikeluarkan untuk memfasilitasi repatriasi tahun ini. Menurut data yang diperoleh dari Departemen Tenaga Kerja Indonesia, Arab Saudi adalah negara terbesar kedua penampung tenaga kerja Indonesia setelah Malaysia. (an/m10)

Wildan, Ondim, Gus, ... (Ondim) unggul di Partai Amanat Nasional (PAN), Gus Irawan di Partai Demokrat, Golkar, dan Partai Demokrasi Indonesia Perjuangan (PDI-P). Sedangkan Fadly Nurzal unggul di Partai Keadilan Sejahtera (PKS). Apa yang disebut partai lapis pertama adalah partai yang memenuhi persyaratan mencalonkan pasangan calon gubernur tanpa harus berkoalisi, yakni Partai Demokrat. Sedangkan partai lapis kedua adalah partai yang harus berkoalisi untuk mencalonkan pasangan calon gubernur, namun memiliki jumlah kursi yang dominan atau di atas 10 kursi. Partai tersebut yakni Partai Golkar, PDI-P, dan PKS. Di partai lapis pertama ini menempati urutan kedua Cornel Simbolon dengan 21 persen, disusul Fadly Nurzal dengan 15 persen, dan ada beberapa nama yang terakumulasi sebesar 21 persen. Di Golkar, urutan kedua ada Wildan Tanjung dengan 27 persen, dan Chairuman Harahap dengan 12 persen, disusul 15 persen akumulasi beberapa nama. Urutan kedua di PDI-P juga ada Wildan Tanjung dengan 26 persen, disusul Ondim dengan 8 persen. Ada 17 persen suara dukungan akumulasi beberapa nama lain. Sedangkan di PKS Gatot Pujo Nugroho menempati urutan kedua dengan 23 persen, dan di bawahnya Gus Irawan dengan 15 persen, disusul 11 persen akumulasi suara dukungan beberapa nama. Untuk PAN yang telah merumuskan nama yang diusulkan oleh partai, ada Gus Irawan di tempat kedua dengan 28 perJawaban Problem Catur, sen, disusul Wildan dengan 20 persen, sisa suara ada 8 persen. TTS Dan Sudoku Sementara di PPP ada nama Dari Halaman Sport. Fadly 35 persen, Gus 27 persen, dll 1 persen. Dipercaya, dukungan pemJawaban Problem Catur: baca di PAPS akan mengalami akselerasi, terutama menjelang 1. ....., BaxGh2+. penetapan oleh partai politik. Kejutan-kejutan akan sangat 2. RxB, Kxf3+. mungkin terjadi. (Tim)

3. Rh1, Bg1+mat.

Ada-ada Saja ...

Jawaban TTS: TTS Topik

Umum Serba “Adi”

Jawaban Sudoku: 9 4 1 2 6 8 7 3 5

6 8 7 1 5 4 2 9 1

2 3 5 3 9 7 4 6 8

3 7 6 5 1 2 8 4 9

5 2 4 8 3 9 6 1 7

1 9 8 7 4 6 5 2 3

8 1 3 4 2 5 9 7 6

7 6 2 9 8 3 1 5 4

4 5 9 6 7 1 3 8 2

untukmenarikkeranairuntuknya. Fobia aneh ini bahkan memaksanya untuk bekerja dekat dengan rumah sehingga dia bisa lari kembali ke rumahnya, hanya untuk menggunakan toilet. Menurut perempuan berusia 20 tahun itu, dia merasa lebih aman dirumahnya. “Suara air membuatku merasa menggigil sampai ke tulang belakang saya. Ini mengerikan karena saya merasa ingin ditelan toilet. Saya tidak tahan berlama-lama di dalam toilet,” ujar Ney. seperti dikutip oleh The Sun akhir pekan lalu. Ketakutan Ney ini berawal saat usianya baru empat tahun, setelah melihat film di tahun 90an yang berjudul LookWho’sTalking Too. Dalam film itu sebuah toilet hidup dan menjerit dengan mata yangbesardantaring yang tajam. Hal itu yang telah menghantui Ney sejak saat itu. “Sejak aku melihat film itu, aku sudah ketakutan. Ketika aku berusia sekitar 11 tahun aku mengompol saat perjalanan pulang karena saya takut menggunakan toilet di sekolah,” ujar wanita berambut pirang itu. Fobia masa kecilnya itu masih menghantui sampai hari sehingga dia menolak untuk menggunakan toilet umum. (ok/rzl)

lan Dewan Pengupahan Daerah (Depeda) Provinsi Sumut, terdiri dari unsur pengusaha (Apindo), perwakilan serikat pekerja, serikat buruh, dewan pakar dan aparat pemerintah. Penghitungan diawali pelaksanaan survei Kebutuhan Hidup Layak (KHL) ke pasar-pasar tradisional di kabupaten dan kota se Sumut berpedoman kepada Permenakertrans No. 13/2012. Selanjutnya, Depeda Provinsi Sumut membahas nilai usulan UMP dengan memperhatikan berbagai faktor ekonomi dan ketenagakerjaan dengan penambahan 14 komponen yang sebelumnya 46 menjadi 60 komponen, sehingga UMP diharapkan saling menguntungkan antara pengusaha dan buruh atau pekerja. Sedangkan Kepala Disnakertrans Sumut Bukit Tambunan menambahkan, setelah pembahasan konprehensif dengan memperhatikan nilai PDRB Sumut semester I/2012 dari BPS 6,03 persen dan prakiraan nilai inflasi Sumut 2013 dari Bank Indonesia 4 sampai 6 persen, Depeda Sumut menetapkan nilai usulan UMP Sumut 2013 sebesar 7,03 persen di atas nilai KHL 2012 dengan nilai usulan Rp1.294.500. Usulan diserahkan kepada Plt. Gubsu sebagai bahan pertimbangan untuk menetapkan UMP 2013. Selanjutnya, berdasarkan pertimbangan psikologis upah bagi pekerja, pada audiensi Depeda dengan Plt. Gubsu, Plt. Gubsu dan Depeda sepakat menetapkan UMP Sumut 2013 sebesar 7,90 persen di atas nilai KHL terendah 2012 atau 8,75 persen di atas nilai UMP Sumut 2012. Sementara, dalam Keputusan Gubsu dinyatakan, besarnya Upah Minimum Sektoral Provinsi Sumut 2013 akan ditetapkan lebih lanjut dengan mengacu UMP itu. Pada saat Keputusan Gubsu yang baru ini berlaku, Keputusan Gubsu No. 188.44/988/ KPTS/Tahun 2011 tanggal 17 November 2011 tentang UMP Sumut 2012 tidak berlaku lagi. (m34)

3 Calhaj Embarkasi ... “ Dengan demikian, sudah 9 orang jamaah calon haji asal embarkasi Medan yang wafat di tanah suci,” kata Sazli. Calhaj Tunanetra Tetap Semangat Kemarin, Calhaj Asal Kota Pinang Rantauprapat bernama M Thoha Harahap yang bergabung dalam kloter 18 menyampaikan rasa gembiranya kepada Waspada. Meski kondisinya kurang sempurna, Thoha mengaku tetap semangat dalam menjalankan rutinitas ibadah wajib dan sunnah di Tanah Suci. “Alhamdulillah saya dan isteri sebagai pendamping, bisa melaksanakan berbagai rangkaian ibadah yang wajib dan sunnah. Saya sudah mencium hazarul Aswad saat umroh, saya juga sudah ikut berkunjung ke tempat bersejarah. Dari penginapan ke Masjidil Haram jaraknya 3 kilometer, biar enggak capek kami menentukan waktu yang cocok saja ke Masjidil Haram, karena naik busnya suka berebut. Makanan di sini cocok buat saya, kadang-kadang isteri saya masak sendiri apa adanya karena sistem antrean suka lama,” kata Thoha yang menyampaikan salam untuk semua wartawan yang memberitakannya sebelum bertolak ke Tanah Suci dari Embarkasi Medan. (m37)

JAKARTA (Waspada): Menteri Agama Suryadharma Ali menegaskan persetujuannya untuk membangun ‘kampung Indonesia’, bagi para jamaah haji Indonesia sehingga masalah pemondokan jamaah haji dapat teratasi. Apa lagi ide membangun kampung Indonesia itu sudah ada sejak era Presiden Pertama RI, Soekarno, namun sayangnya, keinginan membangun kampung Indonesia ini sulit terealisasi karena perizinan. “Membangun kampung Indonesia itu sudah ada sejak zaman Bung Karno, tapi sayang sulit direalisasikan,” ujar Suryadharma di Makkah, sebagaimana rilis yang diterima Waspada di Jakarta, Sabtu (20/10). Menurut Menteri, permasalahan untuk membangun bukanlah masalah dana, karena sudahadabeberapakontraktoryang siap. Pembiayaan , menurutnya tidak ada masalah. Tapi menjadi masalah adalah perizinan.

“Kalau ada izinnya, kita tidak perlu mengeluarkan uang. Sudah ada beberapa kontraktor yang berani membangun. Mereka hanya perlu kontrak jangka panjang. Masalah utama justru terletak pada perizinan pembangunannya,” jelas Surya. Pemerintah Arab Saudi, tambahnya sangat melindungi kepentingan warganya. Jika kita diizinkan membangun kampung Indonesia, maka paling tidak, ada 500 gedung milik warga Makkah yang selama ini digunakan jamaah haji Indonesia, tidak akan terpakai lagi. “Kurang lebih 500 gedung milik warga Makkah tidak akan terpakai lagi. Padahal, bagi masyarakat Makkah musim haji adalah musim panen,” tukasnya. Pemerintah Arab Saudi tentunya tidak ingin warganya tidak terlindungi dan gedung yang mereka miliki tidak menghasilkan lagi. Namun demikian, Surya mengakui upaya ke arah itu tetap terus dilakukan.

Sumut Mendapat ...

kepala daerah tidak macammacam, apalagi terkait Pilkada. Panwaslu kabupaten/kota yang dilantik, yakni Langkat, Binjai, Medan, Karo, Deliserdang, Serdang Bedagai, Tebingtinggi, Pematangsiantar, Simalungun, Tanjungbalai, Asahan, Batubara, Tapanuli Selatan,Tapanuli Utara, Tapanuli Tengah, Sibolga, Nias, Nias Selatan, Nias Utara, Nias Barat, Gunung Sitoli, Padanglawas, PadanglawasUtara,Labuhanbatu, Labuhanbatu Utara, Labuhanbatu Selatan, Dairi, Toba Samosir, Humbahas,Samosir,PakpakBharat, dan Mandailing Natal. (m34)

‘’Tegasnya, KPU Sumut dan Panwaslu Sumut menjadi harapan masyarakat Sumatera Utara,’’ kata Muhammad. Dia juga menyinggung adanya surat edaran Mendagri kepada setiap kepala daerah, baik gubernur maupun bupati berkaitan dengan anggaran Panwaslu. ‘’Jika ada kepala daerah yang menghambat dana anggaran Panwaslu segera lapor ke Mendagri,’’tukasnya. Dia juga menyebutkan, Mendagri dalam surat edarannya tersebut agar

LSI: 77,5 % Publik ... Ardian mengatakan, survei yang bekerjasama LSI Network itu dilakukan pada 1-8 Oktober 2012 dengan menggunakan metode multistage random sampling, mengambil 1.200 responden dengan teknik wawancara, tatap muka responden dengan kuesioner dan tingkat kesalahan 2,9 persen. Survei dilengkapi dengan riset kualitatif, analisis media dan Focus Group Discussion (FGD). Ardian menjelaskan, terjadi peningkatan prosentase publik yang tidak menerima bertetangga dengan perbedaan agama yaitu dari 8,2 persen (survei 2005) menjadi 15,1 persen (2012). Begitu juga untuk penerimaan bertetangga dengan penganut Syiah meningkat dari 26,7 persen (2005) menjadi 41,8 persen (2012): dengan Ahmadiyah dari 39,1 persen menjadi 46,6 persen; dengan kaum homoseksual meningkat dari 64,7 persen (2005) menjadi 80,6 persen (2012). Responden yang tidak setuju menggunakan cara kekera-

Arafah Siap Songsong ... Indonesia di Arafah. Maktabmaktab di Mina juga telah dicoba menggunakan alat pendingin udaranya Sabtu serta tulisan tanda penempatan jamaah sesuai kloter dan asal jamaahnya telah terpasang. Sejak H-3 petugas telah dipersiapkan melakukan simulasi pergerakan jamaah haji dengan pengaturan waktu yang tepat guna menghindari terjadinya penumpukan. Sebelum prosesi Armina, kata Abu Haris, petugas harus memastikan tidak ada jamaah yang tertinggal di seluruh tempat di kota Makkah, baik dipemondokan, Masjidil Haram maupun tempat-tempat lainnya. “Akan dilakukan `sweeping` oleh seluruh panitia di sektornya masing-masing dan dipastikan semua telah memakai pakaian ihram menjelang keberangkatan,” kata Abu Haris yang menjadi petugas Satuan Operasi Armina Indonesia, di tempat yang akan menjadi konsentrasi tiga juta jamaah yang melakukan wukuf sebagai rukun haji tersebut. Dalam perencanaan itu juga telah digambarkan pelaksanaan ‘safariwukuf‘ dan ‘pembadalan‘ bagi jamaah yang sakit dan tidak dapat melaksanakan lempar jumrah. Tim juga mengawasi keseluruhan pergerakan semua jamaah Indonesia, baik jamaah reguler maupun jamaah khusus, kata Abu Haris. Tahun Depan Calhaj Usia 80 Tahun Prioritas Dirjen Penyelenggaraan Haji dan Umroh (PHU) Kementerian Agama Anggito Abimayu mengatakan tahun depan diberlakukan kebijakan jamaah berusia 80 tahun ke atas diprioritaskan sejak awal bersama pendampingnya. “Sekarang prioritas memang jamaah usia lanjut tapi sebagai pengisi kursi kosong dari jamaah batal berangkat sehingga dalam prakteknya sulit menempatkan pendampingnya,” kata Anggito di Makkah, Sabtu (20/10), usai mengunjungi per-

Al Bayan ... sanak keluarga dan orang-orang yang berada di bawah tanggunganmu, tidaklah mengapa bagi yang mengurusinya untuk memakan hasilnya dengan ala kadarnya serta tidak pula menjadikannya milik pribadinya.” (HR: Muslim). Menurut Syeikh Sulaiman Al-Asyi; Jumlah rumah waqaf Aceh di Arab Saudi semuanya 23 tempat. Namun sekarang tinggal 17 bangunan lagi. Selebihnya tidak jelas statusnya. Rumahrumah yang ada sekarang menghasilkan sewa yang cukup lumayan. Semuanya telah tergabung

san dalam menegakkan agama sebanyak79,0persen(Survei2005) sedangpadaSurvei2012hanya59,3 persen. Sedangkan yang setuju penggunaan kekerasan pada 2005 hanya 9,8 persen dan pada 2012 sebanyak 24,0 persen. Ardian mengatakan, survei LSI menemukan ada tiga faktor mengharuskan adanya perhatian serius terhadap meningkatnya intoleransi, pertama, data jumlah kekerasan yang mengatasnamakan agama meningkat dari 62 kasus pada 2010 menjadi 92 kasus pada 2011. Kedua, lembaga kepresiden, politisi dan polisi dinilai responden kurang optimal dalam melindungi perbedaan dan kebebasan. Survei LSI menemukan publik yang menyatakan puas atas kinerja kepresiden 25,1 persen; politisi (37,7 persen) dan polisi (29,5 persen). Ketiga, survei LSI menemukan bahwa ketidaktoleransian publik terhadap isu perbedaan masih tinggi yaitu 31,2 persen, sedangkan publik yang menilai cukup toleran sebanyak 63,1 persen dan yang tidak tahu hanya 5,7 persen. siapan proses ibadah di lokasi Arafah, Muzdalifah dan Mina. Mulai tahun depan, katanya, sejak awal proses seleksi akan diprioritaskan kuota bagi jamaah berusia 80 tahun ke atas bersama pendampingnya. Dengan demikian, masalah yang dihadapi seperti gangguan fisik di Tanah Suci diharapkan akan berkurang, tambahnya. Haji Non Kuota Berkurang Anggito Abimanyu mengatakan kuranganya jamaah nonkuota diharapkan akan mengurangai masalah, sehingga penyeleng-garaan haji tahun ini diharapkan dapat lebih tertib dari tahun-tahun sebelumnya. Tahun ini hasil kerjasama antara Kementerian Agama dan Kedutaan Besar Arab Saudi, ter-catat hanya 120-an visa haji non kuota yang dikeluarkan. Jumlah ini, jauh berkurang dari jumlah jamaah haji non kuota tahun lalu, yang mencapai ribuan orang. Dengan berkurangnya jumlah jamaah haji non kuota diharapkan mengurangi masalah, paling tidak persoalan jamaah haji non kuota berkurang karena biasanya banyak biro perjalanan yang memberangkatkan mereka lari dari tanggungjawab. Sudah 1,6 Juta Calhaj Tiba Para pejabat Arab Saudi mengatakan, sebanyak 1.603.073 jamaah calon haji asing tiba di Makkah Sabtu (20/10) malam. Sementara itu, Menteri Dalam Negeri Pangeran Ahmed, juga ketua Komite Tertinggi Haji, telah memperpanjang tanggal untuk memperoleh izin Haji bagi para jamaah asing di Jeddah selama dua hari lagi sampai Selasa (23/10), kata Komandan Pasukan Paspor untuk Haji Brigadir Aed Al-Harbi. Pangeran Ahmed mendesak departemennya agar memberikan pelayanan terbaik kepada para jamaah seperti yang diinginkan oleh Penjaga Dua Masjid Suci Raja Abdullah dan Pangeran Mahkota Salman, wakil perdana menteri dan menteri pertahanan. (ant/aya/an/m10)

dalam sebuah yayasan, yakni Yayasan Habib Bugak Al-Asyi yang dikelola orang-orang keturunan Aceh warga Arab Saudi. Setelah bencana tsunami Aceh tahun 2004, yayasan yang kaya raya tersebut telah memperhatikan jamaah asal Aceh, mereka tiap tahun memberi bantuan antara dua jutaan lebih kepada jamaah haji yang terbang lewat Bandara Iskandar Muda tanpa membedakan suku bangsa. Dengan ada bantuan dari yayasan tersebut, jamaah haji Aceh merasa berterima kasih yang tak terhingga. Semoga Allah SWT menyampaikan pahala kepada para pendahulu kita yang mewaqafkan harta-harta tersebut.

SebelumnyaKetuaDPRMarzuki Alie mendorong pembangunan kampung Indonesia demi jaminan pelaksanaan ibadah haji dan keamanan jamaah haji Indonesiayangmerupakanjamaahterbesar di Arab Saudi. (aya)

IPW Minta Bebaskan ... Penanganan aksi demo di Unpam, lanjut Neta, polisi bekerja tidak sesuai SOP dalam mengendalikan aksi massa, polisi menggunakan water canon terlebih dahulu sebelum melepaskan tembakan gas air mata dan peluru karet. Aksi protes penolakanWakapolri, kata Neta, merupakan bagian dari penyampaian aspirasi mahasiswa yang seharusnya disikapi polisi dengan profesional, bukan arogan. Polda Bantah Memeras Kabid Humas Polda Metro Jaya Kombes Pol Rikwanto membantah, beredarnya informasi tentang pungutan Rp10 juta kepada setiap mahasiswa yang ditahan. “Itu berita bohong. Nggak perlu dikomentari,” kata Rikwanto melalui pesan singkat menanggapi isu pemerasan tersebut yang diterima wartawan, Minggu (21/10). (j02)

Tahanan Tipikor ... Dari hasil diagnosa dokter, Said mengalami gangguan pernafasan/sesak nafas dan akhirnya nyawanya tidak tertolong, pada pukul 01:15 dini hari Said meninggal dunia. Ahyar menyebutkan, pihak keluarga sudah mendampingi Said saat dirawat di rumah sakit. Jenazah Said langsung dibawa pulang ke rumah duka di Kota Meulaboh Kab. Aceh Barat. Said ditahan Kejari Meulaboh setelah berkasnya dinyatakan (P-21) telah lengkap oleh penyidik Polres Aceh Barat dan diserahkan ke Kejari Aceh Barat. Kemudian untuk mengikuti sidang di Pengadilan Tipikor Banda Aceh, lalu dititipkan di Lapas Lambaroe Aceh Besar. Menurut pengacaranya, direncanakanRabu (24/10) mendatang, ada jadwal putusan sela terhadap eksepsi bantahan dakwaan di pengadilan Tipikor BandaAcehterhadap kasusini. (cb01)

Waspada/Ismanto Ismail

WAKA Poldasu Irjen Pol Drs Cornelis Hutagaol (tengah) memberikan arahan pasca kaburnya 13 tahanan Mapolsek Medan Area kepada Waka Polresta Medan AKBP Drs Pranyoto, SH dan Kasat Reskrim Kompol M Yoris Marzuki, SH, SIK (belakangi lensa), Minggu (21/10) dinihari pukul 01:10.

13 Tahanan Kabur, ... “Dari hasil pemeriksaan terhadap tahanan ini diperoleh kesimpulan gergaji besi yang masuk ke ruang tahanan Jumat 19 Oktober 2012 pukul 15:00 melalui isteri tersangka BS yang ditahan karena terlibat kasus pencurian. Waktu itu yang jaga Aipda Amrin dkk,” jelas Benno Sidabutar. Sementara itu, lima dari 13 tahanan yang kabur, Minggu (21/10), berhasil ditangkap kembali yaitu WAH warga Jl. SM Raja Medan terlbat kasus narkoba tertangkap tak jauh dari markas Polsek Medan Area, Sy warga Jl. M Nawi Harahap Kompleks Pemda Blok H No.177 A terlibat kasus pencurian dan perampokan, diserahkan keluarganya. MS warga Jl. Denai, Gang Damai No.40 Kec Medan Denai kasus penipuan diserahkan orang tuanya dan Kepala Lingkuangan ke Polsek Medan Area. RMS warga Jl. Menteng VII Gang Madrasah Kec Medan Denai terlibat kasus pencurian dan kekerasan diserahkan keluarganya kembali ke Polsek, CS warga Jl. SM Raja Medan terlibat kasus pencurian dengan kekerasan ditangkap di loket bus KUPJ saat akan ke Perbaungan dan WH. Sedangkan, delapan tahanan belum tertangkap yakni BSN warga Jl. Dahlia Pangkalan Susu Kab Langkat terlibat kasus pencurian. AMP warga Jl. Prima Gang Melur Pasar VII Tengah Desa Tembung Kec Percut SeiTuan, RRG terlibat kasus penganiayaan warga Jl. Tangguk Bongkar VIII , Kel Tegalsari Mandala III, Kec Medan Denai. BS terlibat kasus pencurian warga Jl. Sutrisno Gang F No.13 Kel Kota Matsum, Kec Medan Kota. MT terlibat kasus pencurian warga Jl. Tirto Sari Gang Saudara No.21 Kel Bantan, Kec Medan Tembung. HS terlibat kasus pencurian warga warga Jl. Elang I No.31 Medan Denai. AS kasus kepemilikan senjata tajam warga Jl. Garu I Kec Medan Amplas dan AN terlibat kasus pencurian warga Jl. Lembaga Permasyarakatan Gang Saudara , Kel Tanjung Gusta, Kec Medan Helvetia. S, seorang tahanan kabur yang telah diserahkan kembali oleh keluarganya mengatakan, dia ikut kabur karena dipaksa dan diancam akan dipukul oleh teman-temannya. Bahkan, saat sudah berada di luar sel, S sempat diancam karena hendak masuk kembali ke dalam sel. S tidak tahu, siapa ‘otak’pelaku pelarian ke-13 tahanan tersebut. Sumber di kepolisian menyebutkan, rencana kabur ‘diotaki’ oleh MT. Kanit Reskrim Polsek Medan Area AKP J Banjarnahor membenarkan, lima tahanan telah ditangkap kembali. Sebagaimana diketahui, 13 dari 23 tahanan Polsek Medan Area, Sabtu (20/10) pukul 21:00, kabur dari sel setelah menggergaji jeruji besi ventilasi kamar mandi menggunakan gergaji besi. Gergaji besi tersebut dibawa istri BS, saat membesuk suaminya Jumat (19/10) sore. (h04/m36/m39)

Sektor Riil ... Selain itu tentu saja kita harus melihat potensi perkebunan sawit berikut industri hulu dan hilir yang sangat besar peluangnya untuk dikembangkan. Harapan para anggota terhadap organisasi ini pasti kian tinggi. Keinginan untuk perubahan tentu sangat besar. Semua itulah yang harus diakomodasi pengurus baru nantinya. Saya tentu ikut mendukung progres ke depan Kadin Sumut berikut harapan-harapannya. Kita harus sama-sama mengembangkan sektor riil yang menjadi fundamen dasar bergeraknya ekonomi. Pada prinsipnya para pengusahalah yang berperan penting dalam mendorong pertumbuhan. Dari komponen investasi, konsumsi, ekspor dan impor sebagai pendorong pertumbuhan maka semua itu merupakan bagian dari pengusaha. Kalau saja pengusaha tak mau mendorong sektor riil tentu ekonomi kita akan mandeg. Makanya saya juga miris ketika ada kawankawan kita dari pengusaha yang menyatakan bahwa sebenarnya tanpa pemerintah pun mereka mampu bergerak dan berjalan sendiri. Ibaratnya auto pilot. Tanpa peran pemerintah, bisnis mereka akan tetap berjalan seperti biasa. Para pengusaha ini tentu saja harus mendapat respon dari pemerintah daerah. Apa masalah yang mereka hadapi, kemudian keinginan apa yang bisa sama-sama digerakkan untuk kemajuan Sumatera Utara. Jangan sampai para pengusaha ini menganggap tak ada peran pemerintah. Sebab dengan peran pengusaha ini jugalah Sumut ke depan bisa dikenal dunia. Mereka jugalah yang bisa meningkatkan daya saing daerah ini dengan wilayah lain. Kalau secara nasional menurut Global Competitiveness Index yang dirilis World Economic Forum (WEF) maupun World Competitiveness dari International Institu-

te for Management Development menunjukkan masih lemahnya daya saing bangsa dibandingkan dengan sejumlah negara Asean apalagi negara-negara maju. Peringkat daya saing Indonesia 2008 sampai 2009 misalnya ada di urutan ke 55. Ini kalah dari Singapura yang ada di peringkat lima, Malaysia di peringkat 21 atau Thailand yang ada di urutan ke 34. Begitupula dari data World Competitiveness kalau kita berada di peringkat 51, kemudian Singapura ada di peringkat 2, Malaysia di urutan ke 19 serta Thailand di level 27. Malah Filipina pun di atas kita yang masuk peringkat 40. Bayangkan tugas berat yang harus diemban pemerintah daerah dan para pebisnis. Dengan data itu kita melihat tantangan yang berat dalam upaya meningkatkan daya saing menghadapi dunia global demi pertumbuhan yang lebih tinggi. Saya berkesimpulan daya saing nasional juga menggambarkan tentang Provinsi Sumut. Padahal dengan membaiknya peringkat daya saing akan mampu membawa satu daerah pada tujuan kemandirian. Dulu istilahnya berdiri di atas kaki sendiri. Tapi saya cenderung memaknainya sebagai wilayah yang mandiri. Atau provinsi yang mandiri. Provinsi mandiri itu setidaknya punya kemampuan untuk menghasilkan barang dan jasa yang secara potensial bisa diproduksi sendiri, baik karena adanya bahan baku, penguasaan teknologi, ataupun kepemilikan skill sehingga bisa diproduksi secara efisien dan berdaya saing. Lalu kemandirian itu juga adanya kekutan dan kemampuan lebih diistilahkan bargaining position dalam hubungan ekonomi dengan daerah lain. Sehingga dalam hubungan tersebut yang muncul adalah saling menguntungkan dan bisa sama-sama maju. Jadi sekali lagi dengan akselerasi sektor riil dengan perpanduan antara pemerintah dan pebisnis semua tujuan untuk meningkatkan daya saing serta kemandirian bisa tercapai.


WASPADA Senin 22 Oktober 2012

PB HMI Dan GMNI Tolak RUU Kamnas

Indonesia Kekurangan Surveyor JAKARTA (Waspada): Indonesia minim tenaga surveyor. Padahal, banyak pekerjaanpekerjaan yang terkait informasi geospasial (IG) dibutuhkan, seiring terbitnya Undang-Undang (UU) No 4/2011 tentang IG. “Jika tidak, nanti pekerjaanpekerjaan di bidang IG akan diisi oleh orang-orang asing,” kata Kepala Badan Informasi Geospasial, Dr Asep Karsidi, Rabu (17/10), di Jakarta. Dikatakan Asep, profesional di bidang Informasi Geospasial tidak harus selalu dari jurusan geodesi dan geografi. Yang penting ada kaitannya dengan ilmu spasial. Semua untuk memenuhi jumlah SDM di bidang ini. Di sela Seminar dan Forum Ilmiah Tahunan Ikatan Surveyor Indonesia (ISI) dalam rangka HUT ke-40 itu, Asep menambahkan, saat ini kebutuhan SDM di bidang IG juga mencakup ahli di bidang planologi, tata ruang, geologi bahkan di bidang TI. “Ini yang harus diantisipasi organisasi surveyor kita. Jangan sampai kita kewalahan,” tandasnya. Kekurangan tenaga surveyor paling nampak pada Badan Pertanahan Nasional (BPN). Direktur pemetaan tematik BPN, Tri Supriyanto mengatakan, pihaknya membutuhkan 15 ribu surveyor di seluruh Indonesia. Tapi kondisinya saat ini baru ada tiga ribu surveyor. “Sungguh kondisi yang sangat timpang antara kerja dan SDM. Tapi kami sadar kemampuan pemerintah merekrut surveyor berstatus PNS ya cuma segitu. Makanya, kami melakukan kerjasama dengan surveyor berlisensi,” kata Tri. Sementara itu, Ketua ISI, Budhy Hertantiyo, mengatakan, UU No. 4/2011 tentang Informasi Geospasial mengamanatkan pelaksana informasi geospasial (IG) harus memenuhi kualifikasi kompetensi dengan persyaratan tersertifikasi sebagai penyedia jasa di bidang IG. Begitu pula dengan lembaga penyelenggara IG yang harus terakreditasi.(dianw)

AirAsia Indonesia Buka Penerbangan Surabaya–Johor Bahru JAKARTA ( Waspada) : AirAsia Indonesia mulai Jumat (19/10) merayakan penerbangan perdana rute Surabaya – Johor Bahru di Bandara Internasional Juanda, Surabaya dan Bandara Internasional Senai, Johor Bahru, Malaysia. Commercial Director AirAsia Indonesia, Dato’ Bernard Francis dan General Manager Angkasa Pura I Bandara Juanda, Trikora Harjo hadir dalam acara perayaan penerbangan perdana di Surabaya dan melakukan pengguntingan pita yang disaksikan oleh para penumpang serta rekan-rekan media. Di dalam pesawat, para penumpang pertama juga diberikan cupcakes sebagai bagian dari acara perayaan dan bentuk terima kasih AirAsia Indonesia kepada mereka. Penerbangan perdana menuju Johor Bahru berangkat dari Bandara Internasional Juanda pada pukul 09:25 dengan tingkat keterisian penumpang mencapai 91%. Sementara tingkat keterisian penumpang untuk penerbangan dari Johor Bahru menuju Surabaya lebih dari 96%. Johor Bahru kini telah menjadi rute Malaysia ketiga yang dilayani oleh AirAsia Indonesia dari Surabaya setelah Kuala Lumpur dan Penang. (j02)


JAKARTA (Waspada): Pengurus Besar Himpunan Mahasiswa Islam Indonesia (PB HMI) dan Gerakan Mahasiswa Nasional Indonesia (GMNI) secara tegas menolak Rancangan Undang-Undang Keamanan Nasional ( RUU Kamnas).


PARA pemenang lomba HPS, di antaranya Nina Desfani Harahap Purwadi wakil dari Sumatera Utara menerima piala juara umum ke-3.

Hari Pangan Sedunia Ke-32 Di Palangkaraya

Sumut Juara Umum 3 MEDAN (Waspada): Hari Pangan Sedunia ke-32 tahun 2012 ini membawa berkah tersendiri bagi Badan Ketahanan Pangan (BKP) Sumatera Utara karena dalam keikutsertaannya mampu meraih juara ke-3 kategori umum dalam lomba makanan yang berbasis B2SA (beragam, bergizi, seimbang dan aman) setelah bersaing dengan 33 peserta lainnya dari 33 provinsi di Indonesia yang diselenggarakan, Kamis (18/10) di Temanggung Tilung, Palangkaraya. Demi mengejar waktu pelaksanaan penilaian yang diselenggarakan pada pukul 06:00, maka sejak dinihari semua peserta mempersiapkan masakan dari resep-resep yang dikirimkan ke panitia pusat jauh hari sebelum pelaksanaan lomba. Sumatera Utara pada kesempatan kali ini merasa begitu percaya diri dan bersemangat karena didampingi Kepala Badan Ketahanan Pangan Provinsi

Sumatera Utara SetyoPurwadi dan istrinya Nina Desfani Harahap Purwadi dalam lomba tersebut. Ketua Pokja Tiga, Vera Suryana dari PKK Provinsi Sumut sebagai pendamping peserta lomba bekerja keras membimbing peserta. Bahkan ibu Ketua Tim Penggerak PKK Sumatera Utara Ibu Sutiyas Handayani Gatot Pujo Nugroho yang selama persiapan lomba hingga penyajian senantiasa memantau dari Medan dan selalu memberikan bimbingan dan arahan kepada tim. Dengan mengusung tema Manggadong, menkonsumsi umbi-umbian sebelum makan nasi, yang merupakan kearifan lokal Sumut makin menambah kepercayaan diri ibu-ibu PKK Sumut yang digawangi oleh ibu-ibu PKK dari Kabupaten Deliserdang. Dari berbagai resep yang berisi kombinasi berbagai bahan umbi-umbian, mereka membuat makanan umbi-umbian sebagai menu untuk berbagai

tingkatan umur mulai dari balita dan batuda, remaja hingga dewasa dengan sajian yang menarik dan dapat meraih nilai 73 dan meraih juara 3 kategori umum. Sementara itujuara I diraih provinsi Jawa Timur dan juara II diraih Kalimantan Barat. Prestasi kali ini dirasakan istimewa bagi Sumatera Utara karena setelah peringatan HPS tahun 2004 tidak lagi mendapatkan juara dalam lomba masak-memasak. Purwadi dalam percakapan telepon mengutarakan prestasi ini menjadi momentum tepat untuk mendorong program akselerasi diversifikasi pangan berbasis pangan lokal manggadong. “ Forum dan expo pa-ngan – gebyar kuliner nusantara yang akan digelar akhir November 2012 menjadi momentum spesial untuk menasionalisasikan istilah Manggadong sebagai ikon diversifikasi pangan Nasional,” tegas Purwadi.(rel/rzl)

Bahkan PB HMI menyerukan status ’Siaga Satu’ bagi seluruh kadernya untuk menentang RUU Kamnas. ”Bagi setiap kader HMI di seluruh Indonesia untuk bersiaga melakukan aksi secara massif dan kontinyu dalam waktu dekat, demi menentang usaha pemerintah menggolkan RUU Kamnas ,” ujar Sekjend

PB HMI Rizal Akbar Tanjung, Minggu (21/10) di markas PB HMI di Jakarta. HMI menentang RUU Kamnas ini, menurutnya, karena pasal-pasal di dalam draft RUU itu jelas merupakan ancaman kepada kebebasan sipil. Pemerintah berupaya membasmi demokrasi dengan alasan keamanan tetapi menerapkan pendekatan militer,” urainya. Dilanjutkan Rizal, upaya ’mati-matian’ pemerintah menggolkan RUU ini menjadi UU Kamnas sama halnya menggusur demokrasi dengan pendekatan militer. PB HMI tidak bisa tinggal diam kalau sudah ada rencana

keji pemerintah terhadap rakyatnya sendiri. Kami akan melawan,” tegasnya. Selain melakukan aksi massa berdemontrasi, Rizal memastikan kalau PB HMI bersama seluruh jaringan elemen mahasiswa segera menggelar dialog diberbagai kampus termasuk di berbagai kantong-kantong buruh untuk mensosialisasikan betapa berbahayanya RUU Kamnas ini bagi rakyat Indonesia. Ketua PP GMNI EddyWijaya mengakui, GMNI juga berencana menurunkan seluruh kadernya untuk menentang RUU itu. Bagi GMNI kalau sampai disahkan menjadi UU Kamnas, maka

Indonesia kembali ke masa Orde Baru yang penuh tindakan represif militer. ”Pasal 10 dalam draft RUU itu jelas bersifat sapu jagat dengan penerapan tertib sipil, darurat sipil, darurat militer dan perang. Sedangkan pasal 20 jelas-jelas untuk melindungi investasi asing di daerah-daerah. Artinya pemerintah mengorbankan demokrasi demi kepentingan kapitalis asing. Ini berbahaya dan wajib ditentang,” papar Eddy. Dia mengingatkan RUU ini kalau disahkan akan menjadi kuburan bagi ormas-ormas dan LSM yang selama ini mengkritisi kinerja pemerintah. (aya)

Negara Darurat Karena Kejahatan Narkoba JAKARTA (Waspada): Wakil Ketua DPR RI Priyo Budi Santoso menegaskan, masalah kejahatan narkoba merupakan darurat negara yang harus dipangkas sampai ke akar-akarnya. Karena itu sulit diterima kalau republik yang nasional dan religius ini ikut kena dampak bahaya narkoba seperti di Amerika Latin. Priyo menegaskan hal itu ketika menerima Kaukus Masyarakat Peduli Anak dari Kejahatan Narkoba antara lain Asrorun Niam Sholeh (KPAI), Andi Najmi Fuadi (LPBH PBNU), Amirsyah Tambunan (MUI), Ridwan Taiyeb (eLSAS), Ikhsan Abdullah (Advokat), Maria Advianti (KPAI), Muhammad Joni (PAAI), dan lain-lain, di Jakarta, Jumat (19/10). Menurut Priyo yang juga Ketua DPP Partai Golkar itu, kejahatan narkoba di Amerika Latin justru berdampak pada terpuruknya pertumbahan ekonomi karena masalah narkoba dan geng-geng atau mafia yang merajalela di negara itu. Priyo berjanji akan meminta kepada Presiden Susilo Bambang Yudhoyono (SBY) untuk meninjau kembali grasi yang diberikan terhadap bandar narkoba baru-baru ini. Dia menyatakan terkejut dengan langkah Mahkamah Agung (MA) yang berturutturut mengabulkan putusan Peninjauan Kembali (PK) terhadap kejahatan narkoba. “Saya berterima kasih pada

Kaukus, yang bertemu untuk berdialog di DPR RI. Kami memastikan aspirasi dan kehendak yang dicantumkan akan kami proses di DPR,” ujarnya. Menyinggung permintaan DPR untuk menggunakan hak konstitusi bertanya kepada presiden soal alasan pemberian grasi seperti yang didesak Kaukus. “Sudah tentu saya hanya bisa mengatakan, hak konstitusi melekat kepada semua anggota dewan. Kalau pun anggota dewan merasa cukup meminta penjelasan kepada Menteri Hukum dan HAM dan wakilnya, mungkin cukup. Namun, kalau

tidak cukup, anggota dewan bisa menggunakan hak konstitusinya, yaitu hak bertanya atau interpelasi,” tambahnya. Priyo mengatakan, negaranegara lain termasuk di Amerika Latin tersebut sudah berupaya memberantas narkoba. Oleh sebab itu, pemerintah diminta untuk tidak melakukan langkah yang tak bisa dipahami, langkah agak mengalah kepada keinginan untuk mempertegas pembasmian dan pemberantasan narkoba di Indonesia. Bahkan, Asrorun Niam dan Andi Najmi mendukung bandar narkoba itu dihukum mati. Me-

ngapa? Karena sistem hukum pidana Indonesia masih berlaku sebagai hukum positif dan bisa diterapkan termasuk, yang sudah dilakukan pengujian ke MK di mana hukuman mati itu masih eksis, berlaku dan konstitusional. Dengan demikian putusan hakim PK yang menjatuhkan hukum 15 tahun itu justru melanggar konstitusi dan tidak bertentangan dengan putusan MK, yang berarti pula melanggarUUD1945.“Selainituada 10 UU yang diratifikasi terkait hak-hak sipil dan politik pada 28 Oktober 2005, yang membolehkan hukuman mati . (j07)

Medan Metropolitan


WASPADA Senin 22 Oktober 2012

TRAFFIC LIGHT RUSAK: Traffic light (lampu pengatur lalulintas) di persimpangan Jln. Perintis Kemerdekaan – Jln. Sutomo yang rusak sejak beberapa bulan lalu, hingga Minggu (21/10), belum juga diperbaiki. Pemerintah Kota Medan terkesan tidak peduli terhadap kerusakan fasilitas umum tersebut.

Waspada/Arianda Tanjung

Pelaksanaan UU Lalulintas Belum Maksimal Sat Lantas – Dinas Perhubungan Tidak Mampu Atasi Kemacatan Di Medan MEDAN (Waspada): Penyebab utama kemacatan lalulintas di Indonesia adalah ketegasan Polri di dalam menjalankan UU Lalulintas belum maksimal. Demikian dikatakan advokat HMK Aldian Pinem SH, MH, kepada Waspada, Minggu (21/ 10). Menurutnya, ketegasan Polri belum maksimal, volume kendaraan dengan sasaran jalan tidak dilakukan penelitian dan juga tidak dilakukan pengkajian antara kebutuhan bisnis dan publik tidak konek. Contohnya di Kota Medan. Kemacatan arus lalulintas tidak dapat diatasi, karena Sat Lantas

Polresta Medan dan Dishub Kota Medan tidak tegas menertibkan bus-bus yang mangkal atau parkir di pinggir jalan seperti di Jln. Sisingamangaraja, Jln. Letjen Jamin Ginting, Jln. Gatot Subroto, Jln. TB. Simatupang dan lain-lain. Selain itu, lanjut Pinem, masih terlihat parkir mobil berlapis yang menutupi lebih separuh badan jalan. Mobil-mobil ini berhenti di badan jalan dalam waktu relatif lama karena menunggu kepulangan anak sekolah. Ada juga pasar tumpah pagi dan sore yang dibiarkan memakai badan jalan. Menurut Pinem, Sat Lantas dan Dishub harus bertindak tegas agar menciptakan efek jera

Tiga Pemulung Kepergok Mencuri Dihajar Massa MEDAN (Waspada): Tiga pemulung berinisial JG, 17, FA, 18, dan MA, 20, ketiganya warga Jalan Elang, Kec. Medan Denai, dihajar massa karena kepergok hendak melakukan pencurian di rumah Chairul alias Acen ,36, warga Jalan Rahayu, Kel. Bantan, Kec. Medan Tembung, Minggu (21/10) pukul 08:30 WIB. Ketiga tersangka diamankan petugas Polsek Percut Seituan dari amukan warga. Informasi yang diperoleh di kepolisian, sebelumnya ketiga pemulung itu mengintai rumah korban. Setelah memastikan rumah keadaan sepi karena penghuninya masih tertidur, ketiganya mencoba masuk dengan memanjat atap rumah. Saat ketiganya sudah berada di atas atap rumah korban terlihat oleh warga yang langsung meneriaki maling. Ketika pemulung itu kemudian turun hendak melarikan diri. Namun, ketiganya berhasil ditangkap dan seorang di antaranya MA babak belur dihajar massa. Kanit Reskrim Percut Seituan AKP Faidir Chaniago menjelaskan, ketiga pemulung tersebut masih menjalani proses pemeriksaan.”Ketiganya sudah kita amankan, dan akan kita proses sesuai dengan hukum yang berlaku,” sebutnya. (h04)

terhadap pelanggar peraturan lalulintas. “Anehnya lagi, budaya arogansi (anggar jago) seperti mengubah nomor polisi (plat BK) kendaraan sehingga susah diidentifikasi,” tuturnya. Untuk kendaraan seperti itu, polisi harus mengambil tindakan tegas. “Jangan takut apabila pemilik kendaraan itu pengacara, hakim, jaksa, Polri, maupun TNI,” sebut Pinem.

HAM Dia juga menuturkan, Polri dan Dishub harus bertanggungjawab agar jangan terjadi pelanggaran Hak Azasi Manusia (HAM) terhadap pengguna jalan. Misalnya, pengendara kendaraan bermotor yang terjebak macat, selain mengalami kerugian materi seperti beberapa liter BBM habis, juga waktu ter-

buang percuma. Belum lagi akibat kemacatan lalulintas itu, pengendara jadi stress dan mudah emosi. Apabila emosi berkepanjangan biasanya bisa anarkis. “Polemik itu muncul karena kondisi objektif perlalulintasan yang secara kasat mata masih sangat memprihatinkan,” tutur Pinem. Pantauan Waspada di lapangan, parkir mobil berlapis

FPKS Desak TRTB Bongkar Bangunan Hotel Tanpa SIMB MEDAN (Waspada): Fraksi PKS DPRD Medan mendesak Dinas TRTB Kota Medan segera membongkar bangunan baru Hotel Grand Antares Jln. SM Raja Medan, yang diduga tidak memiliki Surat Izin Mendirikan Bangunan (SIMB) dan sudah dikerjakan sejak 3 bulan lalu. Selain itu, pengerjaan bangunan hotel itu juga mengancam keselamatan warga Lingkungan 8, Kel. Sitirejo I, Kec. Medan Kota dan membuat Gang Rukun menjadi sempit. Ketua Fraksi PKS DPRD Medan H Salman Alfarisi Lc, MA, kepada Waspada, Jumat (19/10) mengatakan, tidak ada kompromi bagi bangunan yang dibangun di atas roilen karena melanggar aturan tata ruang dan tata bangunan. “Maka tidak ada alternatif bagi Kadis TRTB Medan Syampurno Pohan, sebagai dinas

yang punya tanggungjawab dan wewenang jangan tinggal diam apalagi melakukan unsur pembiaran,” kata Salman. Dia khawatir terhadap Dinas TRTB Medan, karena bangunan yang sudah dikerjakan sejak 3 bulan itu, SIMB-nya juga tidak ada namun pekerjaan tersebut terus berlangsung. Ada apa dibalik semua ini,” ujarnya. Menurut Salman, jika nantinya terbukti bahwa TRTB Kota Medan ketahuan ada main, sudah selayaknya jabatan Kepala Dinas TRTB dievaluasi kembali, karena telah melakukan unsur pembiaran terhadap bangunan illegal. Disebutkannya, pengusaha Hotel Grand Antares sudah tidak lagi peduli terhadap kepentingan masyarakat dengan seenaknya membangun tanpa memikirkan efek sampingnya. Sementara itu, Camat Me-

dan Kota Parlindungan Nasution ketika dikonfirmasi hanya mengimbau kepada pengusaha maupun perusahaan untuk mentaati aturan yang berlaku. Kata Nasution, pihak Hotel Grand Antares pernah dipanggil dan menyatakan surat izin bangunannya sedang diproses di TRTB Medan. Menurut dia, camat sebagai institusi Pemko Medan bertugas hanya mengimbau, mengingatkan semua pengusaha, perusahaan untuk mentaati aturan-aturan yang berlaku. Karena pengusaha, perusahaan sangat membutuhkan pembinaan. “Diharapkan Dinas TRTB Medan selaku institusi yang paling berwenang segera turun ke lapangan untuk melihat secara langsung bangunan tersebut dan jika izinnya tidak ada maka TRTB harus menyetop pekerjaannya,” sebut Nasution. (m24)

masih terlihat di sejumlah lokasi antara lain di Jln. Thamrin, Jln. Perintis Kemerdekaan, Jln. Nibung Raya, Jln. TB. Simatupang, Jln. S. Parman Medan. Seorang warga menuturkan, parkir mobil berlapis itu terus terjadi dan menyebabkan kemacatan lalulintas. Hal ini membuktikan petugas Sat Lantas dan Dishub Medan tidak

serius melakukan penertiban. Parkir mobil berlapis di sejumlah ruas jalan inti kota itu cukup meresahkan pengguna jalan. Pasalnya, separuh badan jalan tersebut telah “dikuasai” dan digunakan untuk kepentingan pribadi tanpa ada tindakan tegas dari pihak berwenang. Sedangkan penyebab lainnya, tambah warga itu, sebagian

besar bus ke luar kota masih terlihat seenaknya saja parkir di pinggir jalan antara lain Jln. Sisingamangaraja, Jln. Letjen Jamin Ginting, Jln. TB. Simatupang, Jln. Gatot Subroto. Begitu juga bus yang mangkal di terminal liar menanti penumpang jalur luar kota, hingga kini tidak ada dilakukan penindakan secara maksimal.(m36)

Kemen Kominfo Beri Penghargaan ICT Pura Dan PLIK MEDAN (Waspada): Kementerian Kominfo melalui Dirjen Penyelenggaraan Pos dan Komunikasi memberikan penghargaan Teknologi Informasi dan Komunikasi (Information and Communication Technology) serta penganugerahan Pusat Layanan Internet Kecamatan (PLIK) di Hotel Grand Aston Medan, Kamis (18/10) malam. Di antara penerima ICT Pura itu Kabupaten Aceh Barat, Mandailing Natal, Kota Binjai, Tanjungbalai, serta Kota Medan mendapat penghargaan khusus sebagai daerah yang giat menggalakkan ICT. Dirjen Penyelenggaraan Pos dan Komunikasi Syukri Batubara memaparkan, penghargaan ICT Pura merupakan gerakan yang melibatkan segenap pemangku kepentingan di bidang TIK, untuk bersama-sama memetakan serta menghi-

tung indeks kesiapan kabupaten/kota dalam menghadapi era masyarakat digital berbasir TIK. Urgensi program TIK (ICT) Pura memiliki keterkaitan kuat terhadap komitmen Pemerintah RI untuk memenuhi 10 sasaran World Summit on Information Society (WSIS) 2015. Di antaranya, menghubungkan seluruh sekolah dasar dan menengah dengan TIK, menghubungkan seluruh pusat-pusat kesehatan dan rumah sakit dengan TIK, serta lainnya. Sebelumnya, Kementerian Kominfo telah menyelenggarakan berbagai program nasional dalam memenuhi kebutuhan dan hak masyarakat Indonesia untuk memperoleh akses TIK. Kata Syukri, di tahun 2012 ini akan dibangun 120 desa informasi, terutama di perbatasan dan desa terpencil maupun terluar.

Sementara, Prof Zainal Batubara mengemukakan, ICT atau TIK merupakan katalisator untuk percepatan di segala bidang. “ICT Pura mendiagnosa kesiapan kabupaten/kota dalam Teknologi Informasi dan Komunikasi,” ujarnya. Pada negara di wilayah AsiaPasifik termasuk Indonesia, menunjukkan difusi TIK berkorelasi positif cukup kuat dengan tingkat pertumbuhan ekonomi. Penelitian di Asia mengenai dampak TIK terhadap pertumbuhan ekonomi dihitung dengan fokus pada peran peralatan komunikasi. TIK seharusnya sangat potensial untuk dijadikan sektor unggulan, karena Indonesia merupakan negara kepulauan yang menyulitkan terjadinya diseminasi informasi dengan cepat, sehingga dengan demikian dibutuhkan peranan TIK untuk menghilangkan penghalang geografis.(m34)

Kunjungi Pasar, Plt Gubsu Ajak Pedagang Dan Pembeli Ikut KB

Waspada/Mursal AI

PLT. Gubsu Gatot Pujo Nugroho, Deputi Advokasi Pergerakan dan Informasi (Adpin) Badan Kependudukan dan Keluarga Berencana Nasional (BkkbN) Ardianto dan Kepala Perwakilan BkkbN Sumut Drg. Widwiono saat berkunjung ke Pasar Tradisional Air Joman Kab. Asahan, Kamis (18/10).

MEDAN (Waspada): Plt. Gubsu Gatot Pujo Nugroho, Bupati Asahan Taufan Gama Simatupang, Deputi Advokasi Pergerakan dan Informasi (Adpin) Badan Kependudukan dan Keluarga Berencana Nasional (BkkbN) Ardianto serta Kepala Perwakilan BkkbN Sumut Drg. Widwiono berkunjung ke Pasar Tradisional Air Joman Kabupaten Asahan, Kamis (18/10). Kedatangan mereka untuk mengajak pedagang dan pembeli ikut program KB. “Saya, seluruh SKPD Pemprovsu dan Asahan serta BkkbN datang ke sini untuk mengajak ibu-ibu ber-KB dan berbagi cerita dengan saya, BkkbN dan semua yang ada di sini,” kata Gatot Pujo Nugroho dalam acara Grebek Pasar Tradisional Komunikasi, Informasi dan Edukasi (KIE) Kependudukan Keluarga Berencana (KKB).

“Keinginan kita semua adalah agar masa depan anak kita jauh lebih baik dari masa depan kita. Anak ini belahan jiwa, kerinduan kita dan penyejuk jiwa kita. Karena itu, kita harus pastikan anak kita memiliki iman lebih baik termasuk pendidikan dan masa depannya. Karena itu, merencanakan jumlah anak adalah hal yang terpenting,” ujar Gatot. Menurut Gatot, orangtua harus mempersiapkan bekal pendidikan anak-anaknya sehingga mereka bisa bersaing pada era perdagangan bebas. “Ketika bangsa asing masuk ke Indonesia khususnya Sumut, maka anak-anak sudah punya keahlian. Mereka tidak hanya jadi penonton di negeri sendiri, tapi jadi pemenang di era globalisasi,” tambahnya. Karena itu, Gatot menyarankan, agar para orangtua memberi semangat dan moti-

vasi kepada anak dan tidak lupa berdoa. “Saya sarankan, ketika pukul 18:00 sampai 21:00, TV di rumah harus dimatikan. Biarlah pada jam-jam itu, anak pergi ke masjid dan menjadi jam yang efektif untuk belajar,” tegasnya. Sedangkan, Deputi Adpin BkkbN Pusat Ardianto menjelaskan, berbicara soal anak, maka tidak lagi bercerita kuantitas tetapi kualitas. “Agar anak berkualitas, gizi harus bagus agar otak menjadi cerdas, sehingga bisa menyelesaikan pendidikan. Saya minta para orangtua jangan buru-buru menikahkan anaknya. Biarkan dulu mereka menyelesaikan pendidikan setinggi-tingginya, agar bisa mengangkat derajat hidupnya di kemudian hari,” ujarnya. Ardianto menambahkan, angka kematian ibu dan anak cukup tinggi. Hal ini disebabkan, nikah pada usia yang terlalu muda. Dari sisi medis, wanita

berusia di bawah 20 tahun memiliki alat reproduksi yang belum bisa bekerja secara maksimal. “ Selain itu, penyebab kematian ibu, karena melahirkan terlalu tua yakni usia 35 tahun ke atas. Terlalu sering dan jarak melahirkan yang terlalu rapat juga sangat berisiko terhadap kematian ibu dan bayi,” katanya. Sementara itu, Kepala Perwakilan BkkbN Sumut Drg.Widwiono, MKes mengatakan, pasar tradisional dapat menjadi lokasi KIE program KKB karena beberapa argumentasi. Pada dasarnya, pasar tradisional merupakan tempat bertemunya aktivitas banyak orang untuk melakukan transaksi jual beli. “Data BPS 2010, pekerjaan utama bagi 22,5 persen penduduk usia 15 tahun ke atas adalah berdagang. Dan data Asosiasi Pedagang Pasar Seluruh Indonesia (APPSI) 2006, menunjuk-

kan bahwa jumlah pedagang di 13.450 pasar tradisional di Indonesia mencapai 12,6 juta orang. Karena itu, pedagang, pengunjung dan masyarakat sekitar pasar tradisional merupakan potensi sasaran KIE program KKB dan pelayanan KKB,” ungkapnya. Adapun kegiatan yang dilakukan antara lain, rapat persiapan internal hingga memberikan pelayanan KB gratis dengan target 1.000 akseptor baru, Metode Kontrasepsi Jangka Panjang, serta penyerahan Alkes bagi SKPD dan KIE KIT bagi PLKB Kabupaten Asahan. “Tujuannya antara lain mempercepat pencapaian program melalui intensifikasi dan ekstensifikasi KIE program KKB, meningkatkan akses informasi dan KIE program KKB, meningkatkan cakupan pelayanan KB dengan sasaran pengunjung pasar dan lainnya.” (h02)

Medan Metropolitan

WASPADA Senin 22 Oktober 2012


Japto S: Kader PP Waspadai Gerakan Komunis MEDAN (Waspada): Ketua Majelis Pimpinan Nasional Pemuda Pancasila Japto S Soerjosoemarno, SH mengingatkan seluruh kader Pemuda Pancasila bahwa ajaran komunis berpotensi kembali di tanah air dan Partai Komunis Indonesia (PKI) bisa muncul dimana-mana. “Kader PP harus introspeksi diri, kembali ke jati diri (back to zero) dan selalu mewaspadai gerakan komunis. Ajaran komunis bisa saja kembali. Karena itu, seluruh kader PP yang ada di setiap aspek kehidupan sosial dan legislatif harus mewaspadai gerakan komunis. Kalau ada kader yang memiliki niat berbeda, silakan keluar dari organisasi Pemuda Pancasila,” tegas Japto pada pelantikan pengurus Majelis Pimpinan Wilayah Pemuda Pancasila Sumatera Utara masa bakti 2012-2017 di Lapangan Benteng Medan, Minggu (21/10). Menurut Japto, PKI merupakan organisasi tanpa bentuk. Kalau ada gejala adu domba, maka harus segera diperhatikan karena komunis bisa saja ada dimana-mana. “Itulah sebabnya, kader

Waspada/Surya Efendi

ANUAR Shah (Aweng) yang dilantik sebagai Ketua MPW Pemuda Pancasila Sumut periode 2012-2017 menerima pataka dari Ketua Umum MPN PP Japto S di Lapangan Benteng Medan, Minggu (21/10).

PP jangan mau diadudomba. Jangan lagi terjadi bentrok sesama organisasi apalagi mengadu domba. “Saya ingatkan lagi, kita berada di satu posisi dan jangan ada lagi bentrok antarorganisasi,” tegas Japto. Japto juga menyebutkan, musuh utama bangsa kita adalah kebodohan, kemiskinan dan gangguan kesehatan. Mari kita perangi kebodohan dan kemiskinan itu. Hindari terjadinya perseteruan antarsuku/etnis, antarkelompok atau organisasi. Rebutan lahan antarsesama kader PP tidak boleh terjadi. “Kita tidak boleh berbeda. Kita adalah satu, ingat bagaimana Sumpah Pemuda. Kita satu bangsa, satu bahasa dan satu tanah air. Mari kita tingkatkan rasa persatuan, kesatuan dan berbangsa,” tegasnya. Sementara itu, Ketua MPW PP Sumut Periode 2012-2017, Anuar Shah yang akrab disapa Aweng mengatakan, pelantikan dirinya sebagai ketua merupakan sebuah amanah yang harus dipikul dengan penuh rasa tanggungjawab. “Kami memikul tanggungjawab besar baik dunia dan akhirat dalam melaksanakan kepercayaan yang telah diberikan. Mulai hari ini, mari kita bersama-bersama menjadikan PP sebagai organisasi yang baik,” ujar Aweng. Pelantikan pengurus MPW PP Sumut itu dihadiri ribuan kader PP dari 33 kabupaten/kota di Sumatera Utara. Turut hadir pengurus MPW PP Jawa Barat, Kalimantan Timur, Kalimantan Selatan, Kalimantan Barat dan DKI Jakarta serta sejumlah pejabat TNI/ Polri. (h04)

Korupsi Sudah Menjadi Darah Daging MEDAN (Waspada): Korupsi di Indonesia sulit diberantas, karena sudah menjadi darah daging. Upaya pencegahannya hanya dari diri pribadi dengan niat tidak melakukan korupsi. Mantan juru bicara KPK Bambang W Suprojo mengatakan itu dalam seminar hukum nasional bertema“Mewujudkan Strategi Pencegahan dan Efek

Jera Bagi Koruptor Indonesia” diselenggarakan Dewan Pimpinan Cabang (DPC) Perhimpunan Mahasiswa Hukum Indonesia (Permahi) Kota Medan bekerjasama dengan Fakultas Hukum Universitas Dharmawangsa Medan, di Jln KL Yos Sudarso, Sabtu (20/10). Dikatakan Bambang, strategi mencegah terjadinya korupsi, yaitu dimulai dari diri sendiri. “Jika memang niat kita tidak melakukan korupsi maka

170 Gram Emas Raib Digondol Maling MEDAN (Waspada): Sebanyak 170 gram perhiasan emas digondol maling dari kediaman Ratna Br Pinem, 43, warga Desa Simalingkar A, Kec. Pancurbatu, Rabu (17/10) malam. Pencurian yang terjadi sekira pukul 23:30 itu, salah seorang pelaku diduga sepupu Ratna Br Pinem, sempat mengancam Jerfiona Br Barus, 25, menantu korban, dengan menggunakan senjata tajam. Pelaku yang diduga lebih dari satu orang itu menggasak brankas besi yang berisi 170 gram emas dan suratsurat berharga lainnya. Ratna dalam laporannya di Mapolsek Pancurbatu, Kamis (18/ 10) mengatakan, pencurian itu terjadi saat dia dan suaminya berada di Sidikalang. Sedangkan di rumah itu yang ada menantu korban Jerfiona Br Barus. Sekira pukul 22:00, pelaku berinisial LS, 35, datang ke rumah korban dengan alasan mau istirahat sejenak karena lagi kurang enak badan. Pelaku juga mengaku menunggu adiknya bernama Sakti Sembiring. Tak lama berselang, pelaku masuk ke dalam kamar korban yang memang tak dikunci. Namun, pelaku dilarang masuk oleh Jerfiona. Merasa dihalangi, LS mengancam Jerfiona dengan senjata tajam jenis kelewang. Selanjutnya LS dibantu temannya mengangkat brankas berisi emas senilai ratusan juta rupiah, dan surat-surat berharga. Kemudian pelaku dan temannya langsung pergi dengan mobil. Kapolsek Pancurbatu Kompol Darwin Sitepu PB melalui Kanit Reskrim AKP Parulian Samosir saat dikonfirmasi mengatakan, kasusnya masih dalam penyelidikan polisi. (m40)

Seminar Orientasi Penulisan Naskah Sandiwara Radio Dan TVRI MEDAN (Waspada): Kakanwil Kementerian Agama Sumatera Utara Seksi Penyiaran dan Tamadun mengadakan seminar orientasi penulisan naskah sandiwara radio dan TVRI, di hotel Semarak Jln. SM Raja Medan, pada Rabu s/d Sabtu (17- 20/10). Seminar dibuka Kamenag Drs H Abd. Rahim MHum, dan sekaligus sebagai keynote speaker. Sedangkan pada seminar yang berlangsung empat hari itu diisi oleh para nara sumber yakni Prof Mhd Hatta, Indra Tamun, H Arinal MH, dan Raudhah Jambak Spd. Para peserta seminar terdiri dari penyuluh agama, guru kesenian madrasah, dan pimpinan sanggar budaya kabupaten/ kota se-Sumatera Utara. Abd Rahim berharap para peserta seminar mampu menulis naskah yang up to date. Artinya, naskah-naskah yang ditulis bukan sekadar cerita sejarah, tapi lebih luas tentang kehidupan masyarakat dewasa ini. “Dimana masyarakat bangsa kita telah kehilangan jati dirinyasebagaimasyarakatbangsayangberakhlakulkarimah,”katanya. Sementara itu, Ustadz Fachrurrozy Pulungan, sebagai nara sumber pada seminar tersebut menyatakan, sekarang ini perlu digalakkan penulisan naskah sandiwara radio maupun TVRI, yang bernuansa kebangsaan. Naskah-naskah yang selama ini ditampilkan dalan sandiwara radio, maupun TVRI, masih bersifat kesukuan (babat tanah Jawa), seperti “Saur Sepuh, Brama Kumbara, Nini Pelet”, dan lain-lain. Kalaupun ada yang lain, sifatnya masih berupa sejarah Islam. Menurut dia, seharusnya penulisan naskah sandiwara itu, lebih luas karena Indonesia bukan hanya satu suku, dan bukan cuma satu agama. Penulisan naskah yang bertemakan “ Kita Indonesia” bisa dipahami, bahwa Indonesia terdiri dari berbagai suku, bahasa dan budaya, disamping beberapa agama yang dianut dan diakui undang-undang. “Jika hal itu bisa dilaksanakan dan ditampilkan, bukan mustahil, sandiwara-sandiwara seperti itu akan mampu membangun karakter bangsa. Disamping itu narasi yang ditampilkan juga harus lebih memiliki bobot bahasa yang mudah dicerna oleh pendengar maupun pemirsa,” sebut Fachrurrozy. (cwan)


KASI Penyiaran dan Tamadun Kanwil Kementerian Agam Sumut Drs Ismail (kiri) mendampingi nara sumber pada seminar orientasi penulisan naskah sandiwara radio dan TVRI, di Hotel Semarak Jln. SM Raja Medan.

perbuatan korupsi dapat dihindari,” sebutnya. Hanya saja, sampai saat ini belum ada dampak efek jera bagi koruptor. “Hal itu disebabkan undang-undang korupsi yang dibuat pemerintah tidak membuat para koruptor jera. Sebaliknya meskipun para koruptor telah menjalani sidang dan mendapat hukuman, ternyata tak membuat korupsi di Indonesia menurun. Perbuatan korupsi justru semakin merajalela dan menggurita di lembaga negaramaupunswasta,”katanya. Untuk membuat efek jera maka pemerintah harus membuat undang-undang memberikan sanksi tegas. Jika pemerintah tidak tegas dalam pemberantasan korupsi, maka slogan pemberantasan korupsi yang dilontarkan pemerintah sia-sia saja. “Korupsi masalah luar biasa

membuat rakyat menderita. Untuk itu harus dilakukan strategi pencegahan yang luar biasa dengan mematahkan mata rantai korupsi di Indonesia, sehingga korupsi lenyap dari tanah air yang kita cintai ini,” ujar Bambang. Sementara itu, Dekan Fakultas Hukum Universitas Dharmawangsa H. Sunarto SH, M.Hum menjelaskan, seminar nasional membahas tentang korupsi akan menambah wawasan mahasiswa, khususnya fakultas hukum. “Diharapkan ilmu yang diperoleh dalam seminar hukum nasional dapat diterapkan mahasiswa di lingkungan masing-masing sebagai salah satu untuk pencegahan korupsi,” tuturnya. Mata kuliah anti korupsi akan diterapkan pada semester genap, tidak hanya untuk mahasiswa fakultas hukum, tetapi

menjadi pelajaran bagi seluruh mahasiswa dengan berbagai jurusan. Kata dia, kegiatan seminar hukum akan dilakukan secara berkesinambungan. Sementara Ketua DPC Permahi Kota Medan Munawir Hasibuan didampngi Ketua Panitia Andreas mengatakan, seminar hukum merupakan kegiatan rutin bagi mahasiswa fakultas hukum yang tergabung dalam Permahi. Program dilaksanakan empat kali sebulan dengan narasumber ahli hukum Sumut. Sedangkan seminar nasional menghadirkan narasumber nasional dilakukan dua kali dalam setahun. Di jelaskannya, ada beberpa universitas tergabung dalam Permahi, yakni, USU, Universitas Dharmawangsa, Nommensen, UISU, UDA, UMSU, UMN, UPMI, Panca Budi, dan US XII.(m27)

Ibu Dan Anak Korban KDRT MEDAN (Waspada): Ibu dan anak mengadukan kasus kekerasan dalam rumah tangga (KDRT) yang dilakukan GTP, 47, suami korban dan ayah dari anak tersebut. Dalam pengaduannya di Mapolsek Medan Kota, Rosmawati br Manurung, 47, mengaku dipukuli suaminya hanya karena dia tidak mengangkat telepon suaminya. “Dia (GTP) juga memukul anak kami,” sebutnya di Mapolsek Medan Kota, Sabtu (20/10), sambil menahan sakit di sudut matanya yang membengkak. Warga Jln. Saudara simpang Jln. Kemiri itu menyebutkan, peristiwa pemukulan dirinya dan anaknya terjadi Rabu (17/10) malam sekira pukul 22:00. “Saya buka kios grosir di rumah, saat itu lagi ramai pembeli, dan kebetulansuamimenelepon,”katadia. Dikarenakan sibuk melayani pembeli, korban mengaku tidak mendengar deringan telepon. Kemudian, satu jam setelah itu suaminya pulang dan langsung memukul korban hingga sekujur badan memar dan lembam. Bukan hanya istri yang menjadi korban, anak

bungsunya berusia 8 tahun juga dipukul sang ayah. Bahkan dia mengalami memar dan bengkak di bagian mata kirinya setelah dilempar timbangan besi 10 kg. “Dia meraung dan menangis kesakitan,” ujarnya. Karena ketakutan dan kesakitan, bocah itu sempat lari keluar rumah tetapi dikejar ayahnya, kemudian kembali dipukuli menggunakan kayu pada bagian paha. Dia juga diseret masuk ke rumah kemudian dipukulilagi.Namundiaberhasilmelarikan diri ke rumah tetangganya. Tidak tahan dengan kebrutalan suaminya, korban kabur dari rumah bersama anaknya ke tempat pamannya, dan malam itu juga keduanya berobat ke RS Estomihi, kemudian membuat pengaduan ke Polsek Medan Kota dengan laporan STPL/1727/X/2012/SPKT/Sektor Medan Kota. Menurut keterangan korban, suaminya memang ringan tangan. “Bukan kali ini saja, tetapi sering dia memukuli kami hanya karena masalah sepele. Kejam kali dia, gak sanggup lagi aku menahannya, makanya aku buat laporan,” tutur Rosmawati.

Dia mengatakan, selama tiga hari ini, bersama anak bungsunya tinggal berpindahpindah dari rumah keluarga. “Kami takut pulang ke rumah, takut dipukuli lagi, makanya kami tinggal pindah-pindah. Kadang tempat abang, kadang tempat paman,” sebutnya. Kedatangan mereka ke Polsek, Sabtu (20/10) sore, menanyakan tindaklanjut laporan mereka, karena GTP belum juga diamankan. “Kami mau nanya sampai dimana laporan kami. Kok dia belum juga ditangkap,” ujar korban. Sementara paman korban B Sinambela, 48, mengatakan kecewa karena laporan korban belum ditindaklanjuti. “Kenapa gak ditindak lanjuti karena masalah saksi. Macam mana mau bawa saksi, sementara kejadian di dalam rumah, mana ada yang tahu, apa muka lembam gak cukup jadi bukti,” kata dia. Wakapolsek Medan Kota AKP Parulian Sihombing dikonfirmasi mengatakan, pihaknya tetap memproses pengaduan korban. “Kita akan proses, tetapi ya memang perlu saksi,” sebutnya. (m27)

PB Al Washliyah Jadi Nazir 1000 Aset MEDAN(Waspada):Sejak82tahun AlJam’iyatul Washliyah berdiri (30 Nopember 1930) tidak ada lembaga yang mengurus asset Al Jam’iyatul Washliyah. Bahkan lembaga tersebut tidak pernah dibahas pada rakernas maupun muktamar. “Namun pada Muktamar ke XX, baru terbentuk lembaga Majelis Perberdayaan Asset (MPA) PB Al Jam’iyatul Washliyah, sehingga PB Al Jam’iatulWashliyah menjadi nazir asset Al Jam’iyatul washliyah,” kata Ketua Majelis Pemberdayaan Asset (MPA) PB Al Jam’iyatul Washliyah H Darius SH, MH, pada penutupan Rapat Kerja Nasional (Rakernas) majelis pendayagunaan asset PB Al Jam’iyatul Washliyah di Hotel Garuda Plaza Medan, Minggu (21/10). Menurut Darius, lembaga itu dibentuk berdasarkan amanat muktamar ke XX, AD/ART Al Jam’iyatul Washliyah, dan garis-garis besar program kerja PB Al Jam’iyatul Washliyah. Periode muktamar XX. Karena selama ini asset Al Jam’iyatul Al Washliyah mulai dari tingkat menengah sampai tingkat perguruan tinggi banyak dikelolah secara perorangan dan kelompok. Bahkan ada yang mendirikan yayasan dengan membawa nama Al Jam’iyatul Washliyah. Dijelaskannya, dengan adanya rekomendasi dari rakernas ini, maka yayasan-yayasan yang ada akan dileburkan dengan PB Al Jam’iyatul Washliyah. Bila mereka membangkang maka kita akan mengambil langkah advokasi.”Tidak ada kompromi bagi mereka (yayasan) yang membangkang,” sebutnya. Selain itu, tambah dia, kita lakukan inventarisasi, sertifikasi, sampai sejauhmana banyaknya asset Al Jam’iyatulWashliyah di Indonesia. Setelah itu dilakukan validasi, dan akhirnya kita buat data base sehingga kader akan mengetahui asset yang dimiliki Al Jam’iyatul Washliyah. “Sampai saat ini ada sekitar 1000 aset, baik

yang bergerak maupun tidak bergerak yang dimilki Al Jam’iyatul Washliyah,” ujar Darius didampingi pengurus MPA lainnya Drs Hasyim Said, Ibeng S Rani SH, Dedi Suheri Spdi. Kata dia, bahkan yang anehnya, sampai saat ini PB Al Jam’iyatul Washliyah tidak mengetahui seberapa banyak asset yang dimiliki. Karenanya dia mengimbau para kader Al Jam’iyatul Washliyah yang mengelolah yayasan untuk mengembalikannya ke PB Al Jam’iyatul Washliyah. Rakernas kali ini menentapkan, bahwa seluruh aset Al Washliyah harus melekat hak perdatanya kepada PB (pengurus besar) Al Jam’iyatul washliyah, payung hukum hak keperdataan aset disusun oleh MPA, tatacara pendayagunaan dan pengelolaan aset dikelola MPA dan ditetapkan PB. Terhadap asset yang dikuasai pihak lain harus dilakukan musyawarah, bila tidak ada kesepahaman maka ditempuh jalur hukum, melakukan inventarisasi,verifikasi,validasi,danadvokasihukum terhadap aset Al Jam’iyatulWashliyah dimanapun berada, baik aset bergerak maupun tidak. Di samping itu, ada langkah-langkah strategi pada rakernas, MPA PB AlWashliyah membuat dan menyusun pedoman, dan sistem pengelolaan aset semacam SOP (standar operasional prosedur), menetapkan pembinaan, pengelolaan, dan pengembangan aset serta memberikan penegasan terhadap status aset AlWashliyah, membentuk tim advokasi hukum untuk menyelamatkan aset dari pihak lain, baik secara pidana maupun perdata. Sementara Sekretaris PB Al Jam’iyatul Al Washliyah Drs Harris Sambas menyampaikan apresiasi terlaksananya rakernas, sebab rakernas ini merupakan sejarah bagi Al Jam’iyatul Washliyah terutama telah berdirinya lembaga MPA. “Tugas yang diemban MPA ini sudah menjadi amanah, dan harus dilaksanakan dengan baik dan iklhas,” tuturnya. (m26)


SEKRETARIS PB Al Jam’iyatul Washliyah Drs Harris Sambas dan Ketua MPA H Darius SH, MH, foto bersama peserta Rakernas I Majelis Pendayagunaan Asset, di Hotel Garuda Plaza Medan.

40 Persen Rakyat Indonesia Masih Miskin MEDAN (Waspada): Ketua DPP PDI-P Bidang Pemuda dan Olahraga Maruarar Sirait mengatakan, 40 persen rakyat Indonesia masih miskin. Bahkan, lebih 50 persen hanya berpendidikan SMP. Dia mengemukakan hal itu dalam dialog dengan ratusan pemuda dan mahasiswa dari berbagai elemen dalam rangkaian pelantikan Satuan Taruna Merah Putih (TMP) di Balai Rasa Sayang, Hotel Polonia, Medan, Minggu (21/10). Hal tersebut, menurut Maruarar, bisa diatasi, namun bergantung pada kemauan politik para pemimpin di Indonesia. ‘’Justru itu kita harus berani mengatakan yes kepada pemimpin yang benar, dan menyatakan no kepada pemimpin yang tidak benar,’’ tegasnya. Pada kesempatan itu, Maruarar juga memotivasi pemuda dan mahasiswa Sumut agar mampu berprestasi demi bangsa dan negara serta menunjukkan eksistensi sebagai generasi penerus. PDI-P, kata dia, sangat berkepentingan dengan pemuda dan mahasiswa yang akan melanjutkan pembangunan di tanah air. ‘’Karena itu, PDI-P berupaya merekrut pemuda untuk menjadi kadernya,’’ ujar Maruarar. Dia mengajak pemuda dan mahasiswa tidak hanya berpiki-

ran bagaimana bisa menjadi tuan rumah di negeri sendiri, melainkan bisa menjadi tuan rumah di ‘kandang’ orang lain. Menurut Maruarar, saat ini banyak politisi yang ‘menutup mata’ terhadap kebenaran. Bahkan, tidak semua politisi mau menyelesaikan masalah, melainkan lari dari masalah, sehingga terjadi pembiaran atas ketidakadilan. Dia menegaskan, pembangunan yang bersifat fisik, seperti jalan, sekolah, infrastruktur, perlu dibangun. Namun karakter bagi kalangan pemuda dan mahasiswa lebih penting untuk menunjukkan eksistensi Indonesia sebagai negara berdaulat dan merdeka. “Karakter lebih penting. Itulah ciri khas pemuda Indonesia,” kata tokoh politik yang akrab disapa Bung Ara. Pembinaan kalangan pemuda dan mahasiswa juga dilakukan untuk membuktikan kepedulian dalam regenerasi kepemimpinan di tanah air dan mendapatkan calon pemimpin bangsa yang tidak hanya mengejar keuntungan materi dan kepentingan kelompok. Selain itu, katanya, pemuda dan mahasiswa perlu dibina sejak dini karena akan menjadi pemilih potensial dalam Pemilu 2014 yang jumlahnya berkisar 42 persen atau berkisar 92 juta lebih dari total penduduk Indonesiayangmencapai240jutajiwa.

Pembinaan yang dilakukan PDI-P telah berlangsung sejak lama dan bukan hanya menjelang Pemilu. “Tradisi bermanismanis hanya menjelang Pemilu harus dipatahkan,” katanya. Maruarar juga memuji kinerja Bidang Pemuda dan Olahraga PDI-P Sumut yang dikomandai Brilian Moktar dalam mengakomodir dan membina kalangan pemuda dan mahasiswa. ‘’Tidak heran jika Bidang Pemuda dan Olahraga PDI-P Sumut dinilai sebagai yang terbaik di tanah air bersama Jawa Timur dan Kalimantan Selatan,’’ ungkapnya. Dalam acara itu, Maruarar mengkritik DPC PDI-P kabupaten/kota yang belum membina dan mengadvokasi pemuda serta mahasiswa di daerah masingmasing. Kemudian, belum membentuk departemen pemuda dan olahraga. Sebelumnya, Maruarar melantik TMP Kota Pematangsiantar, Tebingtinggi dan enam Komisariat Satma TMP. Selain itu, dilantik juga pengurus Satma TMP komisariat di perguruan tinggi yakni Komisariat IAIN (Ketua M. Zulkarnain Nasution), Komisariat USU (Ketua Ramadhan Padang), Komisariat STIE IBMI (Ketua Rico L Manihuruk), Komisariat Mikroskill (Ketua Dolly Hans Toraja), Komisariat UMA (Ketua Rinaldi

Sitinjak) dan Komisariat Unimed (Ketua Charles Ferdinan Sitohang). Sedangkan, Ketua Bidang Pemuda dan Olahraga DPD PDI-P Sumut Brilian Moktar mengatakan, pemuda dan mahasiswa merupakan kelompok generasi yang memiliki banyak potensi dan idealisme sehingga harus dibina dan direkrut untuk kepentingan bangsa.

Dengan pembinaan tersebut, kata Brilian, diharapkan kalangan pemuda dan mahasiswa tersebut mengetahui hak serta kewajibannya sebagai anak bangsa. Kemudian memahami ideologi dan cita-cita PDIP dalam berpolitik. Brilian memotivasi dan mengajak pemuda dan mahasiswa di Sumut untuk memberikan prestasi dalam pembangunan bangsa dan meman-

faatkan masa muda untuk mencatat sejarah yang baik dan dapat dikenang di masa tua. “Jangan mengaku pemuda jika tidak mampu berprestasi. Jika tidak berprestasi, berarti anda menyia-nyiakan masa muda,” katanya. Brilian menambahkan, kinerja yang dilakukan selama ini masih bersifat normatif dan merupakan kewajiban serta amanah.(m34)

Waspada/Feirizal Purba

KETUA DPP PDI-P Bidang Pemuda dan Olah Raga Maruarar Sirait didampingi Brilian Moktar melantik Taruna Merah Putih.

Medan Metropolitan Sampah Di Medan Sudah Gawat


Senin 22 Oktober 2012

MEDAN (Waspada): Kondisi sampah di Kota Medan sudah gawat. Artinya, untuk mencari Tempat Pembuangan Akhir (TPA) saja, kita sudah kewalahan. Bahkan, untuk membiayai TPA yang sudah ada, membutuhkan anggaran cukup besar melalui APBD. Namun, penyediaan TPA belum juga cukup untuk menyelesaikan persoalan sampah domestik di Medan. “Penyediaan TPA, alat angkut, bak-bak sampah dan perso-

nel yang ditanggung pemerintah, belum juga cukup menyelesaikan persoalan sampah,” kata Ketua Dewan Pengurus Perkumpulan Hijau Sumatera Drs. Safaruddin Siregar kepada wartawan usai memberi sambutan dalam acara Pengelolaan dan Bank Sampah di Kota Medan yang digelar di Hotel Madani Medan, Sabtu (20/10). Menurut Safaruddin, penyelesaian sampah perkotaan harus menjadi pemikiran dan tindakan bersama seluruh elemen masyarakat dalam mewujudkan Kota Medan yang bersih

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

Tiba Dari


CITILINK 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Batam


05.20 08.45 10.30 11.55 14.10 15.55 17.55 18.45 19.55 09.45 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

08.00 09.45 11.10 13.20 14.20 15.10 17.10 19.10 22.00 12.25 17.55

QG-831 QG-833 QG-835 QG-880 QG-882

8.40 18.50 20.05 10.00 14.20

Jakarta Jakarta Jakarta Batam Batam

QG-830 QG-832 QG-834 QG -881 QG-883

08.05 09.05 09.35 13.15 17.55

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Baangkook 9 Bandung 10 Surabaya 11 Bandung

QZ-8050 QZ- 8054 AK- 1351 AK-1355 QZ-8072 AK-5837 AK-1357 QZ-8084 QZ-7987 QZ-7611 QZ-7981

06.05 11.20 08.00 17.25 10.40 18.30 21.25 17.00 08.25 11.35 17.10

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

dan ramah lingkungan. “Penyelesaian persoalan sampah harus dilakukan secara holistik melibatkan seluruh pihak, pemerintahan, pelaku bisnis, organisasi dan masyarakat dengan menggunakan berbagai pendekatan dan upaya penyadartahuan sejak dini tentang sampah,” jelasnya. Selama ini, lanjutnya, sampah selalu dikonotasikan negatif. Padahal, jika dapat memilah, sebagian sampah bisa menghasilkan uang, menyerap lapangan pekerjaan dan lainnya. “Di sini diperlukan kesadaran warga untuk memilah sampah seperti plastik, botol plastik, untuk ditabung di bank sampah. Dengan cara itu, sudah melakukan sedikit cara untuk mengurangi keberadaan sampah di TPA,” ungkapnya. Saat ini, masih minim warga menggunakan bank sampah yang ada di Kota Medan. Memang diakuinya, secara geografis, Medan harus memiliki 100

lebih bank sampah atau setiap kecamatan minimal memiliki lima bank sampah. “Dengan adanya seminar ini, masyarakat bisa mengelola sampah. Kami sengaja mengundang banyak guru, agar nantinya mereka bisa memberi penyadaran kepada siswa, karena yang ingin dijadikan pelopor itu adalah anak sekolah,” ujarnya seraya menambahkan, saat ini Medan masih memiliki satu Bank Sampah yang cukup terkenal yakni di Jl. Pelajar Medan. Sementara itu, Kepala Pusat Pengelolaan Ekoregion Sumatera Kementerian Lingkungan Hidup RI Ir. Muhammad Ilham Malik, M.Sc mengatakan, kondisi TPA semakin mengecil akibat masuknya sampah ke lokasi tersebut mencapai ribuan ton per hari. “Maka mulailah melakukan pemilahan dan diperlukan kejelian kita, seperti sampah plastik, botol-botol dan kertas yang bisa didaur ulang. Jadi, jangan diga-

bungkan dengan sampah kulit pisang dan ikan. Dengan begitu, kita sudah mengurangi sedikit sampah itu di TPA,” jelasnya. Dia menyarankan kaum ibu yang ingin belanja keperluan rumah tangga cukup membawa satu kantong kain saja. “Bayangkan setiap kita belanja, berapa banyak yang kita bawa pulang kantong plastik itu. Dari plastik itu, berapa banyak yang dijadikan sampah. Padahal itu bisa didaur ulang dengan memanfaatkan bank sampah,” kata Ilham. Acara seminar Pengelolaan dan Bank Sampah ini dibuka Ketua Komisi VII DPR RI Drs. Ir. H. Sutan Bhatoegana Siregar. “Beliau sangat peduli terhadap masalah lingkungan hidup khususnya yang menyangkut masalah masyarakat kecil perkotaan di Medan. Kita juga mengundang praktisi lingkungan, direktur bank sampah dan pemerintah dalam seminar ini,” demikian Safaruddin. (h02)



KETUA Komisi VII DPR RI H. Sutan Bhatoegana Siregar didampingi Ketua Dewan Pengurus Perkumpulan Hijau Sumatera Drs. Safaruddin Siregar saat memukul gong sebagai pertanda dibukanya acara Seminar Pengelolaan dan Bank Sampah di Hotel Madani, Sabtu (20/10).

Pemko Akan Tambah Satu Dinas MEDAN (Waspada): Tahun 2013, Pemerintah Kota (Pemko) Medan akan menambah satu unit Satuan Kerja Perangkat Daerah (SKPD) yakni Dinas Pengawas Pembangunan. Saat ini sedang dilakukan revisi terhadap Perda tentang struktur organisasi Pemko Medan. “Itu memang sudah rencana kita, tapi untuk realisasinya tahun 2013. Karena itu membutuhkan proses revisi Perda,” kata Kepala Bagian Hukum Pemko Medan Ikhwan Habibi, Kamis (17/10). Kata Ikhwan, pihaknya sudah berkonsultasi dengan Kementerian Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (KemenPAN-RB) RI untuk mematangkan rencana penambahan dinas baru. Hasil-

nya, pihak Kementerian memberi lampu hijau, hanya saja harus sesuai dengan aturan. “Kalau pihak Kementerian PANRB sudah menyetujui hal ini, hanya saja penambahan dinas itu harus efektif, makanya kita nanti membahas revisi Perda tentang struktur organisasi Pemko Medan,” ujarnya. Menurut dia, untuk melakukan revisi Perda itu, harus melalui proses program legislasi daerah (prolegda). Oleh karenanya membutuhkan waktu yang panjang. Namun, karena Kota Medan sebagai kota metropolitan membutuhkan adanya dinas itu, maka revisi Perda akan segera dilakukan. Sejauh ini, lanjut dia, daerah lain di Indonesia yang sudah memiliki Dinas Pengawas Pem-

bangunan adalah Jakarta. “Kalau daerah lain yang sudah memiliki dinas ini adalah Jakarta, makanya kita mengusulkannya sesuai dengan kebutuhan Medan sebagai kota metropolitan ketiga di Indonesia,” sebutnya. Sebelumnya, Wali Kota Medan Rahudman Harahap sudah mengusulkan penambahan dinas baru di Pemko Medan. Sebab, sebagai kota metropolitan, Medan membutuhkan Dinas Pengawas Pembangunan. Karena, selama ini izin bangunan yang dikeluarkan Dinas Tata Ruang dan Tata Bangunan (TRTB) dinilai tidak akan mampu diawasi oleh Dinas TRTB sendiri. Begitu juga dengan Dinas Bina Marga yang mengeluarkan tender, tak mungkin lagi pegawainya mela-

kukan pengawasan. “Untuk itulah dibutuhkan Dinas Pengawasan Pembangunan ini. Kita harapkan dinas ini akan berisi orang-rang yang memiliki pengetahuan tentang teknik sehingga mutu dan kualitas pembangunan ke depan dapat menjadi lebih baik lagi, dan dapat dirasakan langsung manfaatnya oleh masyarakat, “ tuturnya. Dijelaskan Rahudman, untuk struktur Dinas Pengawas Pembangunan itu sendiri, akan terdiri dari beberapa bidang pengawasan. Seperti ada misalnya bidang pengawasan bangunan, bidang pengawasan reklame dan billboard serta bidang pengawasan taman. “Nantinya,

ada bidang-bidang pengawasannya, itulah nanti dinas ini yang akan melakukan pengawasan ada tender dan proyek tugas merekalah untuk mengawasinya,” katanya. Wakil Ketua DPRD Medan Ikrimah Hamidy mengatakan, untuk melakukan revisi Perda tentang struktur organisasi, maka Pemko Medan harus mengusulkannya terlebih dahulu sehingga dewan bisa melakukan pengkajian. “Nantinya itu harus masuk dulu dalam prolegda 2013, setelah itu akan kita kaji apakah tidak tumpang tindih dengan ketentuan struktur organisasi pemerintah daerah yang sudah diatur dalam UU No 32 tahun

2004 dan petunjuk teknisnya PP No 41 tahun 2007. Kemudian akan dikaji lagi sesuai dengan kekinian daerah, apakah itu dibutuhkan. Kalau memenuhi unsurnya bisa diajukan revisi Perda,” sebutnya. Ikrimah belum bersedia komentarapakahpengusulanDinas PengawasPembangunanitunantinyatumpangtindih.“Kalauditanya overlapping itu masih terlalu dini.Kitalihatdulunantipengusulannya seperti apa, memang pengusulan Dinas Pengawas Pembangunan itu kalau dilihat sekarang tumpang tindih jadinya denganfungsiinspektorat,karena selamainiinspektoratmelakukan pengawasan dan audit internal,” ujarnya. (m50)

Wisata Dan Kegiatan Rohani Keislaman BPN Tidak Hadiri Sidang Lapangan Sengketa Tanah Negara

MEDAN (Waspada): Sumatera Utara memiliki tempat wisata yang sangat potensial untuk dikunjungi. Berwisata menjadi kebutuhan bagi setiap orang saat ini, namun wisata bukan sekadar untuk jalan-jalan, tetapi perlu diimbangi dengan kegiatan rohani keislaman. Demikian disampaikan Direktur OperasionalWillam Sutera(Wisata Ilmiah dan Alam Sumatera) Ali Jonggi Buana bersama Wakilnya Dra Maimanah dan Komisaris Hendra, Sabtu (20/10). Menurut Ali Jonggi, program wisata perdana akan berlangsung 4 November 2012 mendatang dengan titik kumpul di Masjid Raya Medan, menuju Kota Brastagi. Setelah itu makan siang di Hotel Internasional Sibayak Brastagi dan shalat Zuhur bersama. “Tujuan selanjutnya Taman Simalem Resort dan melaksanakan shalat tasbih bersama dan renungan bersama penceramah. Ada juga lucky draw serta menikmati pemandangan di kawasan tersebut. Setelah selesai kembali ke Medan dan sing-

MEDAN (Waspada): Sidang lapangan gugatan perdata lahan sengketa tanah negara terletak di Jln. Binjai Km. 7 Kampung Lalang, Kec. Medan Sunggal, yang dihadiri majelis hakim diketuai Ahmad Guntur SH, MH, dan hakim anggota Sugiarto, SH, MH, tidak dihadiri pihak BPN Kota Medan. Tim pengacara tergugat dua Candra Mangaraja Sitorus dan Catherine Margaretha Sitorus, Ali Hanafiah SH dan rekan dari Kuasa Hukum Kosek Hanudnas III Medan, Sabtu (20/10) mengatakan, seharusnya sidang lapangan itu dihadiri pihak BPN Medan. Sebab diketahui, pada 25 September 2012, PN Medan dengan surat register W2 UI/ 14.539/Pdt.04.10/IX/2012 telah memanggil BPN. Sebelumnya, sebagai saksi dalam perkara tersebut BPN RI/ Pusat menguatkan surat sebelumnya hak pakai No.34 dan No.36 atas nama Tan Tjai Poh telah berakhir sejak 31 Juli 1968. “Namun pada persidangan lanjutan ini pihak BPN kota Medan

tidak hadir,” ujarnya. Begitupun, menurutnya, keterangan dari saksi BPN mengungkapkan bahwa saksi telah menguatkan pada tiga surat sebelumnya. Dimana surat yang dikeluarkan oleh BPN pada tahun 1975, 1980, dan terakhir 12 Oktober 2011 dengan nomor 3824/14.23-300/X/2011 yang menyatakan telah berakhirnya masa hak pakai dari Tan Tjai Poh dengan surat nomor No.34 dan No.36 tahun 1963. “Dengan demikian sudah sewajarnya hak atas lahan tersebut dipergunakan oleh para tergugat dalam hal ini Candra Mangaraja Sitorus dan Catherine Mar garetha Sitor us ,” sebutnya. Pada sidang sebelumnya, Kepala Bagian di Badan Pertanahan Nasional (BPN) Pusat Gembong Joko Mulianto yang didengar keterangannya sebagai saksi ahli menyatakan, tidak mengenal Lurah Kp. Lalang Mangaraja Sitorus yang telah mengeluarkan surat sebelumnya, namun pihaknya tetap

menguatkan surat yang dikeluarkan BPN sebelumnya pada tahun 1975, 1980 dan 2011. Namun, ujar Gembong, dalam hal ini tergugat menggunakan lahan dalam hak pakai dengan surat yang dikeluarkan BPN dengan bukti kepemilikan dari surat tertanggal 12 Oktober 2011 dengan nomor 3824/ 14.23-300/X/2011. Dimana surat tersebut menjelaskan, hak pakai lahan tersebut telah habis masa berlakunya dan kembali menjadi tanah hak bebas hingga pada 31 Juli 1968. Dengan demikian setelah tanggal 1 Agustus 1968 maka tanah tersebut menjadi tanah hak bebas. BPN berkewajiban melihat ke lapangan apakah bisa diusahakan dengan baik atau tidak sesuai dengan permohonan. Majelis hakim Ahmad Guntur menyatakan ketidakhadiran saksi dari BPN untuk perkara perdata sepertinya tidak persoalan. “Lain halnya dengan saksi pidana, saksi sangat penting untuk menghadiri setiap persidangan,” ujarnya. (m38)

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284

10.55 18.25

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283

09.55 17.40

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Batam

Y6-594 Y6-596 7P-568

16.00 18.15 12.25

Jakarta Jakarta Batam

Y6-593 Y6-595 YP-567

13.00 15.15 10.30

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

MANDALA AIRLINE 1 Jakarta 2 Singapura 3. Jakarta 4 Jakarta (5.7)

Sistem Pertanian Organik Harus Membela Petani Kecil

RI-092 RI-861 RI-096 RI-096

06.40 11.00 18.50 16.40

Singapura Jakarta Jakarta Jakarta (5.7)

RI-862 RI-093 RI-097 RI-097

07.20 11.30 19.20 20.55

MEDAN (Waspada): Pemerintah diminta merevisi Rancangan Peraturan Menteri Pertanian (Permentan) tentang Syarat dan Tata Cara Penerapan Sistem Pertanian Organik. Revisi dimaksud yakni memasukkan metode penjaminan produk pertanian organik dengan berbasis komunitas. Dalam hal ini, sistem pertanian organik harus membela petani kecil. Hal itu terungkap dalam rapat dengar pendapat antara Aliansi Organik Indonesia bersama Anggota DPD RI asal Sumatera Utara Parlindungan Purba

Jadwal Perjalanan Kereta Api No KA

Nama KA

U.2 Sri Bilah U.4 Sri Bilah U.6 Sri Bilah U.8 Sri Bilah U.1 Sri Bilah U.3 Sri Bilah U.5 Sri Bilah U.7 Sri Bilah U.10 Sri Bilah U.12 Sri Bilah U.9 Sri Bilah U.11 Sri Bilah U.14 Putri Deli U.16 Putri Deli U.18 Putri Deli U.13 Putri Deli U.15 Putri Deli U.17 Putri Deli U.22 Siantar Ekspres U.21 Siantar Ekspres PLB 7000 Sri Lelawangsa PLB 7002 Sri Lelawangsa PLB 7004 Sri Lelawangsa PLB 7008 Sri Lelawangsa PLB 7010 Sri Lelawangsa PLB 7012 Sri Lelawangsa PLB 7001 Sri Lelawangsa PLB 7003 Sri Lelawangsa PLB 700 Sri Lelawangsa PLB 7009 Sri Lelawangsa PLB 7011 Sri Lelawangsa PLB 7012 Sri Lelawangsa


Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi



Berangkat Datang

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan

08.00 10.30 15.00 22.50 08.05 14.35 16.55 23.25 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 05.00 09.50 12.15 14.40 05.20 08.55 06.30 11.00 13.30 15.50

13.16 15.31 20.18 03.34 13.12 19.49 21.50 04.21 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.22 05.52 10.42 13.07 15.32 07.22 09.47 07.22 11.52 14.22 16.42



PENGELOLA Pengelola Willam Sutera saat meninjau lokasi tujuan wisata rohani di Brastagi. gah lagi di Kota Brastagi,” katanya menyebutkan program ini ditawarkan dengan harga paket Rp200.000 perorang. Sementara Dra Maimanah menambahkan, dalam perjalanan dengan bus, semua peserta akan mendapatkan bimbingan rohani dari pembimbing yang sengaja ditunjuk oleh panitia

serta Kepala Badan Penelitian dan Pengembangan Kementerian Pertanian Haryono, di Jakarta, baru-baru ini. Rapat dengar pendapat itu dihadiri Presiden Aliansi Organik Indonesia Sebastian Saragih, Direktur Utama Aliansi Organik Indonesia Indro Surono beserta beberapa jajarannya. Rancangan Permentan ini dibuat oleh Pemerintah melalui Kementerian Pertanian untuk mengatur tata distribusi pangan organik yang semakin banyak dihasilkan para petani dan semakin banyak dikonsumsi mas-

penyelenggara. “Intinya kita berwisata alam dan wisata rohani serta menggalang ikatan silaturahmi sesama ibu-ibu pengajian yang ada di Medan. Jadi pesertanya bebas, boleh mendaftar langsung ke panitia di 085261761908 (May) atau ke sekretariat Jalan Sei Belutu No 93,” sebutnya. (m37)

yarakat untuk kesehatan. Rancangan Permentan Pasal 35 ayat 1 mewajibkan unit pertanian organik yang menyatakan produknya sebagai organik harus disertifikasi oleh Lembaga Sertifikasi Organik (LSO). Dalam melakukan sertifikasi, LSO mengacu pada Standar Nasional Indonesia (SNI) Sistem Pangan Organik. Menurut Indro, revisi itu mendesak dilakukan untuk mencegah kriminalisasi terhadap petani kecil yang kesulitan melakukan sertifikasi produk organiknya. Kewajiban sertifika-

si oleh pihak ketiga itu membebanibiayapetanikecilyangsudah lama menjadi penggiat organik. Saat ini, sekitar 80 persen dari produk pertanian organik dihasilkan kelompok petani kecil yang tidak disertifikasi pihak ketiga. Selama bertahuntahun, sudah ada sistem penjaminan komunitas yang telah dikembangkan kelompok tani dan diterima konsumen produk organik. Rancanan Permentan tersebut hanya mengakui produk organik yang berlabel kata “Organik” dan mencantumkan logo


DUDUK Dari kiri Ke Kanan: Presiden Aliansi Organik Indonesia Sebastian Saragih, Anggota DPD RI asal Sumut Parlindungan Purba,SH,MM), Ketua DPD RI H. Irman Gusman, SE, MBA, serta Kepala Badan Penelitian dan Pengembangan Kementerian Pertanian RI Haryono.

“Organik Indonesia” pada kemasannya jika telah mendapatkan sertifikasi pihak ketiga. Keberadaan Permentan itu berpotensi menyebabkan petani kecil terpaksa mencantumkan label organik, namun tidak disertifikasi pihak ketiga. Akibatnya, petani kecil akan dikriminalisasi gara-gara tidak melalui proses sertifikasi. Haryono mengemukakan Rancangan Permentan tentang Syarat dan Tata Cara Penerapan Sistem Pertanian Organik masih berpeluang untuk direvisi. Namun, rantai pasok (supply chain) produk organik jangan sampai terhenti. “Draft semuanya bisa diperbaiki dan dibenahi jika itu rasional”, kata Haryono. Menurut Haryono, rantai pasok produk organik sangat beragam. Permintaan produk organik sangat tinggi. Karena itu, keberlanjutan rantai pasok harus dipertahankan dari hulu ke hilir secara berkelanjutan, dari produksi sampai proses pemasaran. Sementara itu, Anggota DPD RI asal Sumut Parlindungan Purba mengatakan, pemerintah harus berada di belakang para petani kecil dan mendukung segala upaya yang dilakukan para pentani itu. “Jangan sampai para petani kecil ini menerima dampak buruk dari peraturan pemerintah. Peraturan dapat diubah dan petani kecil harus dilindungi sehingga mereka dapat terus bertani dan

ketersediaan pangan khususnya produk organik dapat terus terjaga”. Dia berusaha memfasilitasi pertemuan antara Aliansi Organik Indonesia dan Kementerian Pertanian agar aspirasi masyarakat dapat disampaikan langsung kepada pihak yang berkepentingan dan diproses lebih lanjut. Tugas itu sejalan dengan fungsinya sebagai Anggota Dewan Perwakilan Daerah (DPD) yang menjadi wakil rakyat termasuk para petani kecil itu. Parlindungan berharap jangan sampai terjadi monopoli sertifikasi. Sebab, monopoli sangat merugikan para petani kecil. Guna mengantisipasi hal ini, harus dilakukan komunikasi yang intensif antara Kementerian Pertanian dan Aliansi Organik Indonesia. Rapat dengar pendapat ini merupakan lanjutan dari pertemuan sebelumnya yang dilakukan Parlindungan Purba bersama Aliansi Organik Indonesia di Medan beberapa waktu lalu. Parlindungan menyambut baik aspirasi tersebut dan menyampaikannya kepada Menteri Pertanian agar ditindaklanjuti. Sementara itu, Ketua DPD RI Irman Gusman turut mendukung upaya revisi Permentan itu serta meminta agar Rancangan Permentan tersebut lebih pro rakyat kecil dan sektor pertanian harus dimaksimalkan untuk mendorong perekonomian Indonesia.(m25)

Politik & Hukum A7 RE: 90 Persen Kemajuan T Erry: Sektor Perhubungan Negara Ditentukan SDM Sumut Perlu Dibenahi WASPADA

Senin 22 Oktober 2012

MEDAN (Waspada): Pendidikan merupakan dasar dari berbagai dimensi kehidupan manusia. “Tanpa pendidikan, manusia tidak akan dapat menyelesaikan berbagai persoalan kehidupan, termasuk pengentasan kemiskinan dan peningkatan kesehatan masyarakat,” ujar Dr RE Nainggolan dalam orasi ilmiah di Hermina Hall, Medan, Kamis (18/10) dalam rangka Dies Natalis ke-53 UDA. Menurut RE Nainggolan, kemajuan suatu negara 90 persen ditentukan kualitas SDM, hanya 10 persen ditentukan sumber daya alam-nya. Jadi, kualitas SDM yang menetukan maju tidaknya suatu negara. Dia mencontohkan, di era tahun 70-an negara Malaysia banyak belajar dari Indonesia soal pendidikan. Namun, belakangan ini malah terbalik, dan Malaysia yang menjadi tempat belajar bagi mahasiswa Indonesia. “Seperti Jepang dan Jerman misalnya, walau telah hancur lebur pada perang dunia kedua, Negaranya dalam waktu yang tidak terlalu lama telah pulih dan bangkit menjadi negara super power. Demikian juga Cina, Korsel, bahkan India, menjadi negara-negara yang sangat berkembang saat ini,” kata RE Nainggolan. Sebagaimana diketahui kata RE Nainggolan, kondisi pendidikan di Indonesia sampai saat ini belum memberikan hasil yang memuaskan terlebih jika dihubungkan dengan tujuan pendidikan nasional yang tercantum dalam UU No 20 tahun 2003 bab II pasal 3 yang menyatakan, pendidikan nasional berfungsi mengembangkan dan membentuk watak serta peradaban bangsa yang bermanfaat dalam rangka mencerdaskan

kehidupan bangsa. Ceramah ilmiah yang disampaikan Tokoh masyarakat Sumut sekaligus Balon Gubsu ini, mendapat sambutan dari seribuan mahasiswa UDA. Dalam pertemuan yang dihadiri kaum intelektual muda itu diwarnai dengan tanya-jawab. Selain RE Nainggolan, Rektor UDA Prof Dr Binsar Panjaitan dan beberapa nara sumber lainnya juga menyampaikan orasi ilmiah. Hadir dalam acara itu keluarga Besar Yayasan UDA, Ketua dan para Anggota Senat Akademik UDA, Guru Besar Universitas Darma Agung, mewakili Gubsu dan Walikota Medan serta pihak Kopertis Wilayah I. Kata RE Nainggolan, praktek pendidikan di Indonesia diarahkan kepada upaya mengembangkan manusia utuh, manusia yang bukan hanya cerdas dari aspek kecakapan intelektual saja, melainkan juga kepribadian dan keterampilannya, atau dalam istilah penulis insan yang cerdas otaknya, lembut hatinya dan terampil tangannya.”Tanpa pendidikan yang bermutu tidak mungkin tujuan pembangunan sebuah bangsa dapat terwujud dengan baik. Pendidikan bermutu dan pembangunan berkualitas bagaikan dua sisi mata uang yang tidak dapat dipisahkan satu sama lain”, katanya. Usai menyampaikan orasi ilmiah, Tokoh masyarakat RE Nainggolan ‘diulosi’ pihakYasayan UDA sebagai ungkapan terimakasih. Pada kesempatan itu, Rektor UDA Prof Dr Binsar Panjaitan juga menyampaikan semoga perjuangan RE Nainggolan untuk menjadi Sumut-1 berhasil dengan sukses. (m14)


TOKOH masyarakat RE Nainggolan, usai diulosi pihak Yasayan UDA lalu berpoto bersama dengan Rektor UDA Prof Dr Binsar Panjaitan dan pihak yayasan UDA sendiri.

KPU Sumut Diminta Batalkan Hasil Sidang Pleno MEDAN (Waspada): Puluhan orang terdiri dari Himpunan Mahasiswa Al-Washliyah Kota Medan dan Aliansi Masyarakat Penyelamat Demokrasi Indonesia melakukan aksi unjukrasa di Komisi Pemilihan Umum (KPU) Sumut Jln. Perintis Kemerdekaan, Medan, Jumat (19/12). Dalam aksi itu, mereka meminta KPU Sumut membatalkan hasil sidang pleno 15 Oktober 2012, karena tidak sesuai dengan Undang-Undang KPU. KPU Sumut agar memberi kesempatan kepada bakal calon Gubsu perseorangan Hasbulah Hadi memperbaiki dan berikan dukungan. Selain itu KPU diminta menelaah kembali dalam verifikasi data karena dinilai tidak profesional dan tidak faham UU KPU. Aksi itu berlangsung dengan orasi yang disampaikan bergantian oleh elemen pendemo, puluhan polisi termasuk Polwan serta satu unit mobil water canon maupun gulungan kawat berduri disiagakan. Beberapa kali pendemo mencoba membuka pintu pagar besi depan hendak masuk ke kantor KPU Sumut, namun dihalangi para personel kepolisian. Krena tidak satupun pihak KPU Sumut yang datang menemui pendemo guna memberikan penjelasan, akhirnya sebagian besar massa

bergerak ke tengah badan jalan dan sempat menyetop kendaraan yang melintas. Akibatnya, terjadi kemacatan, terlebih aksi demo itu berlangsung menjelang sore. Namun, aksi menyetop kendaraan itu tidak lama karena unsur koordinator aksi bersama beberapa Polantas berhasil meminta mereka kembali ke depan pintu gerbang kantor KPU Sumut. Aksi itu juga diwarnai dengan sejumlah poster maupun spanduk yang dipajang pendemo, isinya antara lain menuding Ketua KPU Sumut Irham Buana tidak layak memimpin lembaga/komisi tersebut. Saat dua orang dari Kantor KPU Sumut ke luar gerbang hendak memberikan penjelasan, mereka ditolak para pendemo. Mereka meminta Ketua KPU langsung menerima aspirasi, akan tetapi yang bersangkutan tidak ada di Medan, dan menurut informasi sedang berada di Jakarta. Sedangkan Kabag Hukum KPU Sumut Maruli Pasaribu kepada pendemo menyatakan menerima pernyataan sikap itu dan akan menyampaikannya kepada komisoner dan Ketua KPU Sumut. Setelah menerima penjelasan singkat tersebut, para pendemo pun membubarkan diri dengan tertib.(m34)

MEDAN (Waspada): Calon Gubernur Sumatra Utara T Erry Nuradi menilai infrastruktur perhubungan darat laut dan udara di Sumatera Utara harus dibenahi untuk memberikan kenyamanan bagi masyarakat yang ada di sana dan menjadi sumber pendapatan daerah.


ERRY Nuradi (tengah) bersama sejumlah relawan Sakti Sumut saat berlangsung silaturrahmi dan penyampaian visi dan misi T Erry Nuradi menjadi Gubsu di Medan Club Jalan Kartini Medan beberapa hari.

Chairuman Berdialog Dengan Tokoh Masyarakat Teluknibung, Tg.Balai TANJUNGBALAI (Waspada): Bakal calon Gubsu dari partai Golkar Dr H.Chairuman Harahap, SH, MH melakukan dialog dengan para tokoh dan masyarakat desa di Kecamatan Teluknibung, Tanjungbalai, kemarin. Dalam dialog itu, Chairuman banyak menerima masukkan dari berbagai elemen masyarakat. “Sebagian besar masyarakat desa pantai atau pesisir di daerah ini masih dihadapkan dengan persoalan kemiskinan, sehingga harus diberi perhatian serius. Masyarakat pesisir masih mengalami berbagai masalah, seperti persoalan kemiskinan,” katanya usai dialog. Menurut anggota Komisi VI DPR RI ini, masalah kemiskinan yang menghimpit masyarakat pesisir seharusnya dapat diatasi melalui penerapan program pemberdayaan ekonomi secara maksimal, terarah dan menyeluruh. Untuk mempercepat proses pengentasan kemiskinan di kalangan masyarakat pesisir mutlak dibutuhkan langkah nyata dan sikap lebih proaktif dari pemerintah dan instansi terkait, termasuk perbankan. Masyarakat pesisir yang

selama ini dominan mengandalkan mata pencaharian dari hasil melaut perlu diarahkan dan diberdayakan ekonominya agar mereka memiliki tambahan sumber penghasilan. Bidang usaha yang efektif diarahkan bagi masyarakat pesisir hendaknya berbasis perikanan dan kelautan. “Usaha mereka perlu terus didorong dan diberi kemudahan dalam hal memperoleh bantuan pinjaman,” ujar mantan Kajati Sumut penyandang gelar doktor hukum dari Universitas Padjajaran dengan predikat cumlaude ini. Penerapan program peningkatan ekonomi masyarakat pesisir tersebut tentunya harus disesuaikan dengan kebutuhan.

Chairuman mengingatkan, pemerintah daerah dan instansi terkait dalam pelaksanaan program pemberdayaan ekonomi masyarakat pesisir harus memperhatikan karakter masyarakat pesisir. Sebab, masyarakat pesisir memiliki karakter berbeda dengan penduduk yang bermukin di daratan, sehingga cara pendekatan dan penanganan masalah mereka tidak dapat disamakan. Pada saat meninjau salah satu perkampungan nelayan di Teluknibung, Chairuman juga melakukan dialog dengan para pekerja usaha reparasi atau bengkel kapal kayu. Ia menilai, usaha jasa reparasi kapal kayu memiliki prospek untuk dikembangkan di Tanjungbalai, seiring bertambahnya jumlah armada kapal kayu. Di sejumlah sentra perikanan laut di Sumatera dan Jawa, kata politisi Partai Golkar ini, usaha reparasi kapal kayu berkembang pesat dan mampu menambah kesempatan kerja bagi masyarakat. “Harus ada upaya nyata mendukung dan mendorong usaha rakyat ini tumbuh dan berkembang,” katanya.(m07/rel)

Kepala SMP 4 Parlilitan Dituntut 2 Tahun Penjara MEDAN (Waspada): Kepala Sekolah (Kasek) SMP 4 Parlilitan Kabupaten Humbang Hasundutan Drs BT, 50, terdakwa kasus tindak pidana korupsi penggunaan dana BOS yang digunakan untuk pembelian mobil sekolah senilai Rp138 juta serta penyaluran dana bantuan siswa miskin (BSM) sebesar Rp20 juta, dituntut 2 tahun penjara oleh Jaksa Penuntut Umum (JPU) Heri, pada persidangan di ruang Cakra I Pengadian Tindak Pidana Korupsi (Tipikor) PN Medan, Kamis (18/10). Selain itu, JPU juga membebani terdakwa dengan uang denda sebesar Rp50 juta, serta diwajibkan membayar uang pengganti Rp158 juta apabila tidak dibayar diganti hukuman kurungan selama 1 tahun penjara. “Perbuatan terdakwa sebagaimana diatur dan diancam atas Pasal 3 ayat (1) jo Pasal 18 UU No.31 Tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi jo Pasal 55 ayat (1) ke1 KUHP jo Pasal 64 ayat (1) KUHPidana,” kata JPU Heri dihadapan ketua majelis hakim Achmad Guntur.

Sebelumnya dalam dakwaan disebutkan, terdakwa BT selaku penanggungjawab dana BOS, diduga telah melakukan penyelewengan dana pendidikan yang disalurkan melalui Dinas Pendidikan Sumut, untuk kepentingan pribadi. Disdik Sumut menyalurkan dana peningkatakan belajar melalui program dana BOS. SMP 4 Parlilitan yang dipimpin terdakwa, mendapat bantuan secara priodik pertiga bulan nilainya secara bervariasi. Modus yang dilakukan terdakwa, membuat laporan pertanggungjawaban dengan cara memuat surat pesanan barang secara tidak benar. Sedangkan penggunaan anggaran itu juga tidak sesuai dengan cara membuat bon faktur. Pada periode Januari- Maret 2008, dana yang disalurkan sebesar Rp29.709.000 diambil oleh terdakwa Rp9.478.500. Kemudian pada periode II April - Juni dana yang disalurkan sebesar Rp24.9577,000 diambil Rp1.850.000, kemudian periode III Januari-Maret 2009 dana yang disalurkan sebesar Rp33. 772.500, sementara yang

diselewengkan Rp12.721.531. Selanjutnya, pada periode IV April – Juni, dana bantuan sebesar Rp36.907.500 diselewengkan senilai Rp6.885.880. Pada Periode V Juli–September, dana yang diberikan Rp36. 907.500 namun oleh terdakwa diambil Rp6.074.8991, pada periode VI Oktober-Desember 2009 senilai Rp34.307.499 diambil Rp9.575.029. Selanjutnya pada priode VII Juli–September 2009, disalurkan Rp22.921.500 dan diambil Rp16.081.500, dan pada periode Januari-Maret 2010 dana disalurkan sebesar Rp35.340.000. dan diambil oleh terdakwa sebesar Rp29.040.000. Selain itu, terdakwa juga didakwa telah melakukan penyelewangan keuangan negara yang diperuntukan kepada siswa miskin (BSM). Dimana pada tahun anggaran 2008 hingga 2012, terdakwa diduga telah mempergunakan dana tersebut untuk kepentingan pribadi. Usai mendengarkan pembacaan tuntutan dari JPU, majelis hakim menunda persidangan hingga pekan depan dalam agenda pembelaan. (m38)

Perawat Ditodong Senpi Ngadu Ke Polisi


STOP TAWURAN PELAJAR: Ratusan siswa Sekolah Menengah Atas (SMA) Negeri 1 Medan menggelar aksi damai di DPRDSU Jln. Imam Bonjol Medan, Kamis (18/10). Dalam aksinya mereka menolak aksi kekerasan antarpelajar (tawuran). Mereka meminta dukungan anggota DPRDSU agar mengajak seluruh siswa di Sumut bergandengan tangan serta menjunjung tinggi rasa persatuan dan kesatuan di tanah air.

MEDAN (Waspada): Seorang perawat Maria Marsaolana br Hutagalung, 25, yang kost di Jalan SeiWampu, mengadukan seorang pemuda yang melakukan pengancaman menggunakan benda mirip senjata api di rumah kostnya, ke Polresta Medan, Sabtu (19/10) malam. Laporan polisi itu sesuai No.STTPL/2834/K/X/2012/ SPKT/Resta Medan diterima petugas piket Sat Reskrim Polresta Medan. Informasi di kepolisian, peristiwa pengancaman menggunakan diduga senpi yang dilakukan pria berinisial R, 31, terhadap korban terjadi 18 Oktober 2012, di rumah kos korban Jalan Sei Wampu tepat disebelah

Hotel Aceh. Peristiwa berawal ketika korban Maria yang berada di rumah kostnya didatangi Ria, 29, yang juga kos di rumah tersebut. Tak diketahui penyebab pasti permasalahan tersebut, Ria tiba-tiba melabrak Maria dan memakinya. Tak terima, Maria balas memaki Ria. Keributan antara keduanya terjadi di sekitar rumah kos tersebut. Saat keduanya sedang terlibat perkelahian, tiba-tiba R, pacar Ria, datang ke kos tersebut. Diduga R dihubungi melalui handphone oleh Ria. Tanpa banyak tanya, R langsung mengeluarkan benda diduga senjata api dan mengarahkan ke wajah Maria.

“Saya hanya ribut sama pacarnya, tapi dia datang langsung main todongkan senjata,” kata Maria. Melihat senjata itu, spontan perawat itu berteriak minta tolong, sehingga membuat rekan kosnya yang lain, Juli br Sitepu, 25, dan Fitri, 25, langsung keluar dari kamar dan melihat apa yang terjadi. Keduanya juga spontan berteriak melihat temannya ditodong benda diduga senpi. Diduga panik, Rbergegas meninggalkan lokasi dengan membawa kekasihnya Ria. Sedangkan korban yang merasa tidak senang atas perbuatan R kemudian membuat laporan pengaduan ke Polresta Medan. (m39)

Hal itu dikemukakan T Erry Nuradi dalam sebuah pertemuan dengan para relawan dan simpatisan pencalonan T Erry Nuradi sebagai Gubsu yang berlangsung di Medan Club Jalan Kartini Medan akhir pekan kemarin. Erry menyebutkan, sudah waktunya terminal bus, stasiun KA, pelabuhan laut dan bandara di Sumut dibenahi untuk memberikan kenyamanan bagi masyarakat yang ada di sana, bertahun-tahun kondisi infrastruktur bidang perhubungan itu masih menimbulkan masalah, terutama saat musim liburan sekolah, tahun baru dan kebaran banyak masyarakat yang memanfaatkan jasa transportasi. “Infrastruktur di Sumut harus bercermin dengan Singapura. Siapa saja yang datang ke sana melintas lewat darat, laut dan udaha merasanyaman, karena baik terminal bus atau stasiun kereta api, pelabuhan laut maupun bandara dibangun dengan memberikan kenyamanan bagi setiap orang yang berada di sana,” ujar Erry Nuradi. Bupati Serdang Bedagai itu mengakui, meski tidak dapat langsung menyejajarkan kondisi transportasi di Sumut saat ini sama dengan Singapura, namun setidaknya upaya itu dapat dilakukan. “Tekad membenahi sarana transporti darat, laut dan udara yang nyaman adalah prioritas bagi pemimpin di Sumut, agar propinsi ini dianggap nyaman bidang angkutan transportasi massalnya,” ujarnya. T Erry Nuradi yang telah berhasil membenahi kabupaten Sergai sejajar dengan kabupaten kota yang ada di Indonesia juga berobsesi menjadikan bandara di Sumut menjadi pusat transit bagi wisatawan mancanegara yang hendak berkunjung di Indoesia. ”Bila ini terwujud jumlah

wisatawan yang berkunjung ke Sumut akan meningkat, sehingga mendongkrak pendapatan asli daerah dan ekonomi masyarakat yang membuka usaha di lokasi objek wisata yang dikunjungi para wisman tersebut,” ucapnya. Hadir dalam pertemuan di Medan Club tersebut, Ketua Seruan Aksi Kemenangan T Erry Nuradi (Sakti) Sumut Tasimin MT dan sekretaris Syahrizal SE, Ketua Sumut Berani Ari Sugara, Ketua Konsisten H Solahuddin Nasution, Ketua Ikatan Pedagang Kaki Lima (IKLIM) Medan Maskud, pengusaha muda Tionghoa Van Albert dan Handiman serta ratusan simptisan pendukung lainnya. Pengusaha muda Tionghoa Van Albert mengatakan, pencolonan T Erry Nuradi sebagai Gubsu sangat tepat, mengingat keberhasilan adik kandung almarhum T Rizal Nurdin dalam memajukan pembangunan di Kabupaten Serdang Bedagai bukan hanya retorika. “Kalau kita lihat prestasi beliau memimpin Serdang Begadai, T Erry Nuradi pantas ikut serta dalam bursa pencalonan Gubsu yang akan bertarung pada Pilgubsu Maret 2013 mendatang,” kata Van Albert pengusaha muda Tionghoa asal kota Medan yang hadir dalam acara tersebut. Dikatakan Van Albert, dukungan yang diberikan kepada T Erry Nuradi untuk tampil sebagai calon Gubsu baginya tak berlu diragukan, selain T Erry sebelumnya juga dikenal sebagai pengusaha muda yang sukses, juga selama menjabat sebagai bupati Sergai, sarana dan infrastruktur di daerah yang dimekarkan dari Kabupaten Deliserdang tersebut sangat terlihat. Hal yang sama juga dikatakan Ketua Sakti Sumut Tasimin MT yang optimis terhadap kepemimpinan T Erry Nuradi, karena telah dibuktikan selama menjabat sebagai Bupati Sergai dan tetap akur dengan wakilnya Ir Soekirman selama mepimpin dua periode berturut-turut, sehingga pembangunan di kabupaten pemekaran Kabupaten Deliserdang itu jelas terlihat. (m08/rel)

Luar Negeri A8 Syria: Ledakan Guncang Damaskus, 10 Orang Tewas

WASPADA Senin 22 Oktober 2012

Oposisi Kuwait Boikot Pemilihan Parlemen, Serukan Protes

Brahimi Tak Terima Komitmen Dari Pemberontak Untuk Patuhi Gencatan Senjata AMMAN (AP): Satu ledakan keras melanda Damaskus Minggu (21/10), yang menewaskan 10 orang pada hari ketika utusan perdamaian PBB mengunjungi ibukota Syria itu untuk melakukan perundingan dengan Presiden Bashar Assad mengenai krisis yang melanda negerinya.

London Dilanda Unjukrasa LONDON(AP):PuluhanribudemonstranturunkejalananLondon Sabtu(20/10)dalamsatuunjukrasariuhnamuntertibgunamemprotes satu rencana penghematan yang dilakukan pemerintah Inggris. Sejumlah serikat buruh, juru-kampanye anti-perang, para pemimpin sayap kiri, kelompok masyarakat dan aktivis lainnya membanjiri jalanan London dalam satu unjukrasa menentang pengurangan anggaran untuk sektor publik yang menurut sejumlah pejabat rencana itu bertujuan untuk mengatasi utang Inggris, yang mencapai lebih dari 1 triliun poundsterling (sekitar AS$1,7 triliun). Meski program penghematan telah mencatat keberhasilan sederhana — defisit negara hanya menurun sedikit — ekonomi Inggris telah menyusut selama tiga kuartal berturut-turut di tengah penghematan di dalam negeri dan gejolak ekonomi di benua itu. Brendan Barber, yang serikatnya Trades Union Congress telah membantu untuk menghimpun massa untuk unjukrasa tersebut, mengatakan bahwa pesan protes Sabtu bahwa“penghematan hanya akantimbulkankegagalan.”“Pemerintah membuat hidup sangat sulit bagi jutaan orang karena pemotongan gaji untuk pekerja, sementara orang kaya diberikan pengurangan pajak,” katanya. (m10)

Seorang pejabat yang berbicara dari lokasi kejadian mengatakan satu taksi yang bermuatan bahan peledak meledak 50 meter dari kantor utama kepolisian di kawasan BabTouma. Dia dan pejabat lainnya mengatakan 17 orang lainnya mengalami cedera. Kedua pejabat tersebut yang tak ingindisebutkannamanyakarena mereka tidak punya wewenang untuk memberi keterangan pers. Bab Touma, satu tempat populer bagi para pembeli, adalah satu kawasan yang dihuni sebagian besar oleh masyarakat Kristen Syria. Observatorium HAM Syria yang bermarkas di London melaporkan 10 orang tewas dan puluhan lainnya mengalami cedera,yangmenambahkanbahwa tidak segera diketahui apakah para korban tewas dan cedera adalah warga sipil atau polisi.

Seorang wartawan The Associated Press di lokasi kejadian mengatakan dia melihat ceceran darah di jalanan dan di trotoar bangunan.Diamengatakanpecahan kaca jendela dari beberapa toko bertaburan dan sekurangkurangnya empat mobil terbakar hangus. Tidakadarincianlainnyamengenai serangan itu. Kelompok Muslim militan yang berjuang di pihak pemberontak kadangkadang menyatakan bertanggungjawab atas serangan bom terhadap sejumlah sasaran keamanan di ibukota Syria. Di bagian lain kota itu, Lakhdar Brahimi, yang mewakili PBB dan Liga Arab, telah bertemu dengan Assad sebagai bagian dari usahanya untuk mewujudkan gencatan senjata antara pasukan pemberontak dan pemerintah

selama hari libur Islam, Hari Raya IdulAdha,yangdimulai26Oktober. Dia memberitahu para wartawan setelah pertemuan di belakang pintu tertutup yang dilakukannyadengankelompokoposisi sebelumnya bahwa mereka hanyaberjanji,bukannyakomitmen untuk mematuhi gencatan senjata. “Cuma ada janji untuk hentikan peperangan,” katanya, mengacupadaoposisi.Diamenjelaskan bahwa dia ‘mendapati satu respon luar biasa’ dari para lawan Assad untuk rencana gencatan senjatanya dan semua pihak mengatakan rencana tersebut ‘satu ide baik yang harus didukung.’ Dia menolak mengungkapkan respon Assad atas imbauan gencatan senjatanya itu. Pertempuransengitjugadilaporkan pecah di jalan utama yang

menghubungkanDamaskusdan Aleppo, terutama di sekitar kota Maarat al-Numan Sabtu. Kota ini dikuasai pemberontak selama lebih dari sepekan dan dianggap sebagai jalur pasok penting Aleppo-Damaskus. Warga sipil sangat menginginkangencatansenjatanamun banyak kalangan ragu apakah tentara pemerintah bersedia menyepakati gencatan senjata, kata wartawan BBC Lina Sinjad di Maarat al-Numan. Pemerintah dan pemberontakmenyepakatigencatansenjata pada 12 April, namun tidak lama kemudianterjadipelanggarandan aksi-aksikekerasanterusberlanjut. Perlawanan kelompok pemberontakterhadappemerintahAssad telahberlangsungselama18bulan dandiperkirakankonflikinimenelan korban 30.000 orang. (m10)

Menteri Iran Dipanggil Ke Parlemen Untuk Jelaskan Kematian 26 Siswi TEHERAN (Antara/Xinhua-OANA): Menteri Pendidikan Iran dipanggil oleh anggota parlemen untuk diminta menjelaskan kematian 26 siswi dalam satu kecelakaan lalu lintas, demikian laporan kantor berita setengah resmi, Mehr. Sabtupagi,kantorberitaIRNAdanstasiunTVresmi,IRIB,melaporkan satu bus sekolah yang membawa pelajar terbalik dan jatuh ke dalam lembah di jalan Lordegan-Dehdez di Provinsi Khuzestan, Iran baratdaya, sehingga menewaskan 26 siswi dan melukai 18 pelajar lagi, yang dibawa ke beberapa rumah sakit, kata IRIB. Pengemudikendaraanitukehilangankendalibusakibatjalanlicin, yang mengakibatkan kecelakaan tersebut, kata IRNA sebagaimana dikutipXinhua.Setelahkecelakaanitu,MenteriPendidikanIranHamidReza Haji-Babaii diminta hadir di Majlis (Parlemen) Iran dan bertemu dengan Komisi Penelitian dan Pendidikan pada Minggu (21/10).

Jepang Selamatkan 64 Awak Kapal China Yang Terbakar TOKYO (Antara/AFP): Penjaga Pantai Jepang Minggu (21/ 10) menyelamatkan semua 64 awak China dari kapal kargo mereka yang terbakar, sementara kedua negara tetap dalam sengketa menyangkut sejumlah pulau. Penjaga Pantai diperingatkan oleh pihak berwenang Taiwan, Sabtu malam, tentamg kebakaran di kapal MingYang yang berbobot mati 12.703 ton dan mengirim kapal-kapal patroli dan pesawat ke lokasi itu, sekitar 150 km tenggara Okinawa. Pada pukul 02:30 waktu setempat Minggu satu kapal Penjaga Pantai menyelamatkan21orangyangselamat denganmenggunakan satu rakit penyelamat mentara 43 orang lainya tetap di dek kapal yang terdaftar di Saint Vincent dan Grenadines. Semua awak China diselamatkan pada pukul 03.47 waktu setempat, dengan tiga orang luka ringan, kata Penjaga Pantai itu. Kepala bagian mesin kapal itu melaporkan ia mendengar suara keras disertai ledakan dari mesin utama Sabtu petang. Penjaga Pantai Jepang itu memantau perairan disekitar pulaupulau yang disengketakan, yang dikenal di Jepang sebagai Senkaku sedang China menamakannya Diaoyu, jauh di barat dari kapal kargo yangterbakaritu.PenjagaPantaiitumengatakanempatkapalpemerintah China berada di sekitar perairan kepulauan itu Ahad.

Bunuh Pencuri, Dua WNI Terancam Dihukum Mati SELANGOR (Waspada): Ketidakadilan kembali dirasakan oleh warganegara Indonesia (WNI) di Malaysia. Dua orangWNI diancam hukuman mati di Sengalor, karena membunuh warga Malaysia yang kedapatan mencuri Desember 2010 lalu. Menurut laporan Borneo Post, Jumat (19/10), dua orang WNI tersebut adalah kakak-beradik yang bekerja di sebuah tempat penyewaan Playstation. Frans Hiu dan Dharry Frully Hiu mengaku tidak bersalah atas tuduhan yang diarahkan kepada mereka. “Keduanya akan mengajukan banding atas dakwaan tersebut. Mereka mengaku tidak bersalah dan hanya melakukan hal tersebut sebagai bentuk bela diri,” tulis Borneo Post. Kejadian itu berlangsung ketika Frans dan Dharry tengah tidur terlelap di dalam rumah mereka diJalan4,TamanSriSungaiPelek,Selangor,ketikamenyadariadaseseorang yangmasukkedalamrumahmereka.Sadarseseorangituadalahpencuri, Frans pun melakukan perlawanan. Pencuri yang diketahui bernama R Khartic itu terus berjibaku dengan Frans, sementara Dharry mencoba untuk menyelamatkan diri. Di tengah perlawanan, Frans berhasil meraih leher pencuri itu dan mencekiknya hingga kehabisan napas dan kemudian tewas. Namun tindakan bela diri Frans justru dianggap sebagai aksi pembunuhan. Hakim yang menangani kasus ini, Nur Cahaya Rasha, mengabulkan tuntutan dari jaksa penuntut Zainal Azwar untuk mengeluarkan vonis mati kepada keduanya. Kini Frans dan Dharry terancam hukuman mati dengan cara digantung.(ok/r-m10)

Kerumunan Massa Makamkan Pejabat Intelijen Lebanon

Bentrokan Senjata Di Bekas Pangkalan Khadafi, 26 Tewas TRIPOLI (Antara/AFP): Bentrokan senjata di bekas pangkalan Moammar Khadafi menewaskan setidak-tidaknya 26 orang, sementara nasib seorang bekas stafnya, yang dicari pihak berwajib, tidak diketahui secara pasti. Pemerintah mengumumkan Mussa Ibrahim, jurubicara pemerintah terguling itu, ditangkap di kota Tarhuna, antara Bani Walid dan Tripoli. Tetapi kemudian seorang jurubicara pemerintah mengatakan tidak ada konfismasi tentang penangkapan itu dan dalam satu rekaman video orang yang mengaku bernama Ibrahim membantah berita bahwa dia ditangkap. Pertempuran di sekitar bekas pangkalan Khadafi BaniWalid menewaskan setidaknya 26 orang dan 200 lainnya cedera, kata data AFP Sabtu (20/10). Mohammed Megaryef, ketua majelis nasional,memberikan penilaian suram periode pasca-Khadafi. “Tidak semua daerah berhasil dibebaskan,” katanya dan menambahkan Bani Walid menampung para unsur penjahat dan para pendukung setia bekas pemerintah itu. Megaryef, kepala negara defakto Libya, memperingatkan bahwa para pednukung terutama mereka yang tingal di Bani Walid, tetap menimbulkan ancaman pada negara. “Operasi untuk membebaskan negara itu belum selesai secara tuntas...Bani Walid telah menjadi tempat perlindungan bagi sejumlah besar pelanggar hukum dan kelompok anti-rvolusioner dan tentara sewaan,” katanya. Beberapa jam setelahpidatonya, kantor perdana menteri mengumumkan penahanan Ibrahim. Tetapi ada hal yang membingunkan setelah pemerintah kemudian membantah dan menyiarkan di Facebook satu audiotape orang mengaku Ibrahim, di mana dia juga menghormati Khadafi, yang tewas 20 Oktober 2011.

KUWAIT (Antara/Reuters): Kelompok oposisi di Kuwait menyatakan mereka akan memboikot pemilihan anggota parlemen 1 Desember, dan menyebut perubahan dalam sistem pemungutan suara yang diumumkan oleh pemerintah sebagai ‘kudeta terhadap undang-undang dasar.’ Kuwait telah dicabik oleh pergolakan kekuasaan antara pemerintah, yang dikuasai oleh keluarga As-Sabah, dan parlemen hasil pemilihan umum. Kerusuhan tersebut telah menghalangi rencana pembangunan dan melumpuhkan sistem politik di negeri itu. Pemerintah Kuwait, dalam satu pertemuan luar biasa di kota Kuwait, Sabtu (20/10), memerintahkan pemilihan umum diselenggarakan pada 1 Desember, dan memutuskan untuk mengubah peraturan pemilihan umum guna memungkinkan setiap pemberi suara untuk memilih hanya satu calon dan bukan empat. Oposisi, yang terdiri atas tokoh Islam, liberal dan suku yang meraih mayoritas di parlemen dengan 50 kursi dalam pemilihan umum terakhir pada Februari, menolak perubahan tersebut. Mereka menyerukan pawai protes pada Minggu, kata Ahmed Ad-Dayen, politikus oposisi, sebagaimana dikutip Reuters.


SEJUMLAH kendaraan yang rusak berat terlihat setelah satu bom mobil meledak di distrik Bab Touma di Damaskus Pusat Minggu

(21/10) dalam foto yang disiarkan oleh kantor berita nasional Syria SANA. Satu bom mobil meledak dekat satu kantor polisi di distrik itu Minggu, kata saksimata dan televisi pemerintah beberapa orang tewas dan cedera dalam serangan itu.

Iran Dan AS Bantah Tentang Rencana Perundingan Nuklir DUBAI (AP/Antara/Reuters): Iran Minggu (21/10) membantah laporan di suratkabar Amerika Serikat bahwa pihaknya berencana melakukan pembicaraan langsung dengan AS mengenai program nuklirnya, yang dipersengketakan. Gedung Putih Sabtu juga membantah laporan suratkabar tersebutyangmenyatakanASdan Iran‘untuk pertama kali telah menyepakatipembicaraanlangsung’ mengenai program nuklir Iran. Gedung Putih menyatakan tetap terikat komitmen untuk bekerjasamadengannegarabesarguna menyelesaikan percekcokan tersebut. Gedung Putih bergerak cepat untuk membantah laporan tersebut, yang disiarkan dua hari sebelum Presiden Barack Obama dijadwalkanmenghadapipenantangnya dari partai Republik Mitt Romney, dalam debat yang di-

pusatkan pada kebijakan luar negeri. The New York Times melaporkan, mengutip pejabat Presiden AS Barack Obama, bahwa Amerika Serikat dan Iran secara pokokmenyepakatiperundingan satu-satu mengenai program nuklir Iran, meskipun Gedung Putih dengan cepat membantah laporan tersebut. “Kami tidak melakukan diskusi atau perundingan dengan Amerika,” kata Menteri Luar Negeri Iran Ali Akbar Salehi dalam konferensi pers Minggu. “Pembicaraan(nuklir)sedangberlangsung dengan kelompok negara P5+1. Selainitu,kitatidakmemilikidiskusi denganAmerikaSerikat,”katanya. Beberapa putaran pembicaraan tahun ini antara Iran dan negara-negarakuatdunia,dijuluki P5+1, telah gagal untuk menghasilkan terobosan baru. Negara Barat dan Amerika

menuduh Iran melakukan pembuatan senjata nuklir di balik kedok program nuklirnya, sedangkan Iran berkali-kali menegaskan bahwa program nuklirnya adalah untuk kepentingan damai. Dalam laporannya The New York Times mengatakan AS dan Iran ‘telah menyepakati untuk pertama kalinya perundingan langsung’ mengenai program nuklir Iran. Suratkabar tersebut menyebutkanbahwalaporannya ituberdasarkanketeranganbeberapa pejabat pemerintah Presiden AS Barack Obama. Beberapa pejabat Iran telah berkeras pembicaraan takkan dimulaisampaisetelahpemilihan umum AS 6 November sebab mereka ingin mengetahui presidenASmanayangakanberunding dengan mereka, kata seorang pejabat senior pemerintah di Washington kepada NewYork Times Sabtu.

Harian itu menyatakan kesepakatan tersebut adalah “hasil dari pertukaran pendapat secara rahasia antara pejabat Amerika dan Iran” yang bermula hampir sejak awal masa jabatan Presiden Barack Obama pada 2009. Amerika Serikat dan negara lain Barat telah menuduh program nuklir Iran ditujukan untuk membuat senjata nuklir. Namun Teheran berkeras program nuklirnyabertujuandamai.Israeltelah menyatakan negara Yahudi itu akan menggunakan kekuatan militer untuk mencegah Iran menjadi negara nuklir. CalonpresidendaripartaiRepublikMittRomneytelahmenyerangObamakarenagagalmencegah ambisi nuklir Iran. Kedua calon itu dijadwalkan bertemu pada Senin (22/10) dalam debat terakhir mereka, yang direncakan dipusatkan pada kebijakan luar negeri. (m10)

BEIRUT (AP): Tentara membawa peti mayat yang dibungkus dua bendera Lebanon melalui satu lapangan di Beirut Pusat yang dipadati ribuan warga yang berduka Minggu (21/10) untuk mengikuti upacara pemakaman seorang pejabat senior intelijen dan pengawal pribadinya. Keduanya tewas dalam satu ledakan bom mobil yang banyak orang mempersalahkan dilakukan oleh rezim di negara tetangganya Syria. Tentara memasang rintangan jalan dan menjaga di sekeliling Lapangan Syuhada, di mana peti mayat Brigjend.Wissam al-Hassan dan pengawal pribadinya disemayamkan sebelum dimakamkan. “Kami datang untuk masa depan Lebanon untuk menunjukkan bahwa kami tidak takut,” kata Arama Fakhouri, seorang desain interior dari Beirut di tengah teriakan kerumunan itu. Banyak orang meneriakkan bahwa al-Hassan adalah seorang syuhada yang dibom saat berusaha untuk melindungi Lebanon. Al-Hassan, 47, adalah seorang tokoh penentang keras Syria di Lebanon. Dia mengepalai penyelidikan yang menjurus pada penahanan mantan menteri penerangan Michel Samaha, seorang politisi Lebanon yang merupakan salah seorang sekutu paling loyal Syria di Lebanon. Warga mendesak agar PM Najib Mikati untuk bertanggungjawab secara pribadi menyusul serangan yang menewaskan delapan orang dan melukai 78 lainnya. Salah satu korban tewas adalah Kepala Intelijen Lebanon Brigjend Wissam Al-Hassan. Kelompok oposisi Future Movement menuntut agar PM Mikati untuk segera mengundurkan diri. Mereka menilai perdana menteri tidak mampu memberikan rasa aman yang cukup kepada rakyat. Namun pihak Lebanon sendiri banyak yang menuduh Suriah berada di balik serangan mematikan tersebut. (m10)

5.000 Bikshu Berdoa Bagi Mendiang Raja Sihanouk PHNOM PENH (Antara/Xinhua-OANA): Sekitar 5.000 biksu berkumpulSabtu(20/10)soredidepanIstanaKerajaanuntukmelantunkan dan memanjatkan doa bagi mendiang Raja Norodom Sihanouk. Biarawan dari pagoda di Phnom Penh itu disambut dan mendapat ucapan terima kasih dariWakil PM dan Menteri Istana Kerajaan Kong Sam Ol. Ribuan rakyat pelayat Kamboja juga menghadiri upacara berdoa di depan Royal Palace pada Sabtu, yang merupakan hari keempat berka-bunguntukmendiangRaja-Bapa.MantanRajaNorodomSihanouk yang paling dihormati di Kamboja meninggal karena sakit pada usia 90 tahun di Beijing pada Senin dan jenazahnya diangkut ke Phnom PenhRabusore. Negarainimengumumkanberkabungselamasepekan dari17-23OktoberdanjenazahBapaRajaakandibaringkansetidaknya tigabulandiIstanaKerajaansebelumdikremasi.Lahirpada31Oktober 1922, Sihanouk memerintah negeri itu dari 1941-1955 dan lagi dari tahun 1993 sampai pengunduran sukarelanya pada 7 Oktober 2004 untuk mendukung putranya, Raja Norodom Sihamoni saat ini.

Gema Internasional

Romney Mengubah Nada Bukan Kebijakan

The Associated Press

MEMPROTES PEMERINTAH DI LEBANON. Para pemrotes antipemerintah Lebanon melambaikan bendera nasional dan bendera partai ketika mereka berdiri di patung Syuhada dalam satu protes, di pusat kota Beirut, Lebanon, Sabtu (20/10), sehari setelah satu bom mobil menewaskan Brigjend. Wissam al-Hassan dan mencederai sekurang-kurangnya tujuh orang lainnya. Pemerintah Lebanon menyatakan satu hari berkabung untuk para korban bom Sabtu itu, namun para pemrotes turun ke jalan, membakar ban dan memasang perintang jalan.

MITT ROMNEY memang lihai mengkomunikasikan pesan-pesannya walaupun dihadapannya ada sang incumbent Barack Obama. Pesannya seolah-olah ditujukan kepada publik atau rakyat Amerika yang telah memiliki hak pilih. Dia pandai dan ligat memanfaatkan media televisi. Nada suara yang menggelora serta dibantu dengan gerak tangan untuk memperkuat pernyataannya. Dalam hal ini Barack Obama memang keteter dibikinnya. Pesan yang muncul dalam perdebatan di Denver telah menjadi strategi kampanyenya menghadapi debat ke dua dan ke tiga (terakhir). Di Denver dia seolah-olah seorang bipartisan yang suka berjanji, prihatin tentang kehidupan orang-orang

kebanyakan khususnya mereka mendiami daerah-daerah kumuh. Sehari kemudian dia minta maaf atas komentarnya yang telah dibuatnya sebelumnya. Romney berbicara tentang mobilitas sosial: “Gap antara si kaya dengan si miskin semakin lebar.” Romney menghendaki agar kaum papa ini masuk ke dalam kelas menengah. Ucapan ini membingungkan sehingga memunculkan tema-tema yang populis. Jadi jelas di sini bahwa Romney menemukan dirinya sebagai inner centrist. Partai Demokrat menuduh Romney mengarang-ngarang suatu kepalsuan yang pada dasarnya menunjukkan kebohongan sama sekali. Bahkan Obama setelah mendengar oce-

han Romney,mengajukan tantangan: “If you want to be president, you owe the American people truth.” Kalau diikuti ucapan kampanye Romney yang disiarkan baik langsung maupun siaran tunda seringkali dia meningkatkan nada suaranya dengan penekanan tertentu, tetapi sayang bukan penekanan kebijakan politiknya apabila terpilih menjadi presiden AS. Dia selalu menekankan pada tax reforms bukan pemotongan pajak belaka. Romney tidak pernah menentang semua regulasi finansial pemerintah federal. Artinya dia akan tetap bernaung di bawah regulasi yang telah dikeluarkan oleh pemerintah, padahal prtainya, Partai Republik tidak bermaksud untuk tujuan tersebut.

Romney menyangkal dan hanya membuat sindiran saja. Memang kita tidak bisa menganggap seseorang salah apabila dia menjadi orang-orangan (straw man). Dalam sajiannya pada acara debat pertama ini, jelas sekali bahwa dia berusaha menampilkan sikap konservatifnya yang moderat tak lain ditujukan kepada kelompok independent voters, kelompok yang sangat menentukan suara mereka kepada siapa diberikan dalam pilpres November depan. Romney ingin agendanya lebih kreatif khususnya mempromosikan kesamaan kesempatan dan mobilitas sosial. Saya (penulis) beranggapan inilah sifat political persuasion untuk memperoleh dukungan positif. Apa benar itu persuasi

politik yang positif? Tergantung pada para pemilik suara. Menilik pada strategi Mitt Romney menghadapi lawan (incumbent) Obama tampaknya Romney berhasil menjatuhkan mental Obama dengan bombardemennya yang disampaikan secara terstruktur, terarah sehingga timbul kesan Obama dalam keadaan terdesak dan bersifat defensif. Nyata sekali, setelah debat pertama, hasil polling menunjukkan kemenangan yang menyolok bagi Romney. Tetapi saya (penulis) melihat bahwa untuk mencapai tujuan, Romney tak segan mengumbar janji-janji politik sebagaimana juga sering kita dengar dari mulut tokoh-tokoh – dari tingkat atau level mana pun mereka berada – hanyalah untuk merengkuh

dukungan bagi mereka. Apa yang didemonstrasikan Romney dalam kampanye pilpres Amerika ini, bukan tak mungkin menjadi ‘pegangan’ atau strategi yang menarik. Mengubah ‘nada’ suara kampanye pada saat-saat tertentu menjadi lebih mengemuka sebagaimana dicontohkan oleh Romney. Rakyat Amerika menjadi terpaku dan menganggap Romney benar adanya. Memang politik selalu benar adanya dan kadang melupakan hakiki yang sebenarnya hanyalah untuk memenangkan pertandingan di arena politik dengan mengorbankan etika, sikap santun asal tujuan tercapai. (Kosky).


WASPADA Senin 22 Oktober 2012


Benny Sihotang Ketum PSMS MEDAN (Waspada): Benny Harianto Sihotang terpilih secara aklamasi sebagai Ketua Umum PSMS Medan periode 2012-2016 melalui rapat anggota luar biasa klub anggota PSMS, Minggu (21/10). Dalam rapat yang dihadiri 25 dari 40 klub anggota PSMS tersebut, Benny terpilih secara aklamasi setelah dua kandidat lainnya, Wahyu Wahab dan Freddy Hutabarat, mengundurkan diri usai menyampaikan

visi-misinya di hadapan peserta. Karena hanya tersisa Benny sebagai calon ketum, pimpinan sidang melalui kesepakatan peserta rapat menyepakati Benny Sihotang sebagai Ketua Umum PSMS terpilih mengggantikan

Tontowi/Liliyana Gagal ODENSE, Denmark (Waspada): Untuk kedua kalinya, pasangan Tontowi Ahmad/Liliyana Natsir gagal di final turnamen kelas Premier Super Series musim ini. Pasangan pelatnas Cipayung ini kalah 23-21, 24-26, 11-21 dari Xu Chen/Ma Jin (China) di Denmark Terbuka, Minggu (21/10). Dengan kegagalan tersebut, maka Indonesia juga hampa gelar dari turnamen ini. Sebelumnya, Tontowi/Liliyana juga pernah gagal di final turnamen Premier Super Series Indonesia Terbuka. Satu-satunya sukses Tontowi/Liliyana di turnamen Premier Super Series terjadi di turnamen klasik All England pada Maret lalu. Keberhasilan mereka sekaligus mencatat sejarah untuk pertama kalinya ganda campuran Indonesia bisa juara setelah era Christian Hadinata/Imelda Wiguna tepat 33 tahun silam. (m33/tsw)

Drs H Rahudman Harahap. Usai terpilih, Benny mengatakan pihaknya dalam sepekan ini akan segera membentuk susunan kepengurusan serta secepatnya membentuk tim Ayam Kinantan yang akan ditangani oleh ahlinya. Benny bertekad membawa PSMS menjadi klub profesional sesuai fanatisme orang Medan. Karena, menurutnya, semangat yang ada pada masyarakat Kota Medan saat ini dapat dijadikan modal untuk memajukan klub sarat nilai historis tersebut. “Kalau ingin PSMS kembali menjadi tim yang disegani di Indonesia, satu-satunya cara adalah membuat klub ini sebagai tim yang profesional. Kita akan tinggalkan carut-marut yang selama ini ada di manajemen PSMS,” katanya. Ia juga mengatakan akan menjalankan PSMS secara terbuka, baik soal keuangan maupun manajemen klub. Untuk itu, keuangan PSMS akan selalu diawasi oleh tim audit independen. Dalam memimpin PSMS, Benny akan merangkul semua

pihak yang memiliki potensi memajukan klub kebanggaan masyarakat Kota Medan itu termasuk Wahyu Wahab dan Freddy Hutabarat dalam kepengurusan. “Cita-cita saya hanya satu, yakni membawa kembali PSMS ke puncak kejayaan. Untuk itu, saya tidak bisa bekerja sendiri dan butuh dukungan semua pihak yang peduli akan kemajuan PSMS,” kata Dirut PD Pasar Medan ini. Sebelumnya, Rahudman Harahap mengatakan untuk membangkitkan kembali PSMS di kancah nasional diperlukan kepengurusan yang andal dan solid serta mampu memecahkan berbagai persoalan yang selama ini ada di tubuh klub. “Mengenai pemain, jadilah pemain yang benar-benar profesional sesuai dengan tugasnya. Pemain tidak boleh dibebani dengan persoalan hal-hal non teknis lainnya. Mengenai manajemen dan lainnya, biarlah menjadi tanggung jawab pengurus,” kata Wali Kota Medan tersebut. (m17)

LPI Dongkrak Gengsi

Tekad Chris Rusak Rekor Chonlatarn JAKARTA (Antara): Juara dunia tinju kelas bulu super WBA, Chris John (foto), bertekad merusak rekor tak terkalahkan calon penantangnya dari Thailand, Chonlatarn “The Pride of Thailand” Piriyapinyo, saat keduanya duel di Marina Bay Sand Singapura, 9 November mendatang. “Saya akan torehkan sejarah menjadi petinju pertama yang mengalahkannya. Dan itu akan menjadi kekalahan pertama bagi Chonlatarn,” ucap Chris kepada wartawan di Jakarta, Minggu (21/10). Chris hingga memiliki rekor 47 kali menang dan belum ter-

kalahkan, serta akan mempertahankan sabuknya buat ke-17 kali. Sedangkan Chonlatarn memiliki rekor 44 kali menang dan belum pernah kalah. Menurut Chris, dirinya saat ini dalam kondisi siap tarung dan tidak mengalami kendala fisik sama sekali. “Saya satu bulan berlatih di Australia juga di Indonesia, dan masih ada sparring dalam latihan,” klaim The Dragon. “Di akhir latihan nanti menjelang pertarungan, mudahmudahan saya tidak mengalami drop, dan ini yang saya sangat harapkan,” katanya lagi. Tentang targetnya untuk

menjatuhkan lawan, Chris tidak mutlak mengatakan pada ronde berapa, namun yang dia pentingkan adalah menjadi pemenang. “Saya tidak memiliki target meng-KO dia. Menurut saya kemenangan sudah cukup memberi kepuasan kepada saya,” tambahnya. Sebab menurut dia, calon lawannya dikenal sebagai petinju tangguh. “Lawan saya dari Thailand itu punya rekor yang bagus, dia belum pernah kalah. Dia memiliki fisik yang prima, dan counter serta fighter nya sangat luar biasa,” pungkas Chris.


Petinju Indonesia lainnya, Daud “Cino” Yordan, juga akan bertarung untuk mempertahankan gelar dunia kelas bulu IBO melawan Choi “Mongolian Terminator” Tseveenpurev pada hari dan di tempat yang sama.


BIMA Anugrah Siswanto (tengah) mendapat juara lima kelas Bebek Pemula Murni 110 cc Kejurda Road Race IMI 2012, Minggu (21/10).

Rival KONI Asahan 5 Besar Kejurda Road Race Sumut terbang untuk racer muda Asahan tersebut. Sofian Siregar, berlaga pada kelas MP4, terjatuh mengakibatkan motornya rusak dan gagal melanjutkan lomba. Sementara Ahmad Faisal Batubara di kelas Suzuki FU hanya menjadi finalis. “Kita sudah tampil dengan maksimal dan hal ini akan men-

Problem Catur

jadi motivasi bagi racer untuk tampil lebih baik,” ujar Manajer Tim Rival KONI Asahan, Kedeng dan Bardan, didampingi Mekanik Hery Koces kepada Waspada. “Kita akui untuk saat ini ada penurunan, namun demikian kita akan terus mendongkrak agar para racer bisa tampil lebih sempurna,” jelas Kedeng. (a15)


Hitam melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2. 8







STADION Harapan Bangsa Lhong Raya menjadi saksi keperkasaan anak-anak SMPN 1 Peusangan kala melakoni partai babak 33 Besar Liga Pendidikan Indonesia (LPI) Grup A barubaru ini. Ini tahun kedua mereka merajai kompetisi pelajar itu setelah musim lalu pasukan Darmawan finish ketiga nasional. “Insya Allah, tahun ini kita target juara LPI, apalagi kita sudah punya pengalaman tahun lalu,” ujarnya menjawab Waspada baru-baru ini. Dua kali berlaga di kompetisi ini praktis membuat gengsi Darmawan membumbung tinggi, sebab kompetisi ini dikuti 8.000 sekolah di Indonesia. Bahkan, tahun pembinaan 2011-2012 ini,

bang sempat memimpin klasemen, sebelum akhirnya harus puas dengan posisi kedua di bawah Medan Kota dengan perolehan 25 emas, 28 perak, dan 47 perunggu. Medan Kota sendiri menjadi juara umum dengan total 26 emas, 25 perak, dan 36 perunggu. Camat Medan Helvetia, Arrahman Pane SSTP, pun mensyukuri prestasi yang diraih atlet, sehingga menempatkan kecamatannya pada posisi dua terbaik pada Porkot Medan 2012 tersebut. “Walau target juara umum belum terwujud, prestasi atlet sudah seolah-olah menyamai juara umum,” katanya didampingi Sekretaris Camat Ny Susi Agustina Marpaung. (m22)









“Bagi kepala sekolah itu juga menjadi bukti kesuksesan dalam pembinaan dan punya gengsi tersendiri kala tim sekolahnya berlaga di level nasional,” katanya. Lain pula dengan sikap pelatih asal Aceh yang kini membesut Persija Jakarta, Iwan Setiawan. Kebetulan, saat Iwan pulang kampung, LPI sendiri memang sedang menggelar babak 33 Besar di delapan kota. Kompetisi ini juga tak luput dari amatan mantan pelatih Persiraja itu. Arsitek berkacamata kelahiran Medan, 5 Juli 1968 ini menyebutkan event seperti LPI sangat membantu untuk menyaring bibit-bibit muda. Menurutnya, LPI itu berdampak positif dan sejatinya menjadi contoh

agar ada pihak lain ikut bergerak sama-sama membangun sepakbola Indonesia. Melihat kiprah LPI, Iwan menaruh harapan besar, agar event-event seperti LPI ini bisa memfasilitasi bakat-bakat muda Indonesia. Hal serupa juga diungkapkan mantan bomber Persiraja era 1980-an, Zulkifli Alfat. “LPI ini sangat positif bagi perkembangan sepakbola di tanah air, tapi harus lebih serius lagi dalam pembinaan, terutama oleh lembaga berkompeten,” ujar mantan pelatih Timnas U-19 AFF mendesak lembaga terkait seperti Dispora Aceh lebih peduli pada pengembangan usia dini. *Munawardi Ismail

Waspada/Aidi Yursal

CAMAT Arrahman Pane bersama Ketua KONI Medan Helvetia Ir H Lilik Ismadi dan Sekretaris Camat Ny Susi Agustina Marpaung foto bersama di sela penutupan Porkot Medan 2012 di Lapangan Merdeka, Sabtu (20/10).

Alvin Sumringah Naik Podium SENTUL (Waspada): Pebalap senior Alvin Bahar yang membela tim Honda Racing Indonesia sumringah di seri kelima Kejurnas Balap Mobil “Autostages Indonesian Series of Motorsport 2012” di Sirkuit Internasional Sentul, Bogor, Minggu (21/10). Sukses finish ketiga di kelas bergengsi Indonesian Super Production (ISP), Alvin ibarat mendapat berkah dari langit. Pasalnya, juara nasional tiga kali beruntun ini start dari posisi sembilan hingga rasanya cukup sulit untuk naik podium.

Kenyataannya, pada seri kelima, Alvin yang tampil dengan suspensi baru dan kombinasi ban GT Radial akhirnya finish ketiga setelah Roy Haryanto dan Fitra Eri. Usai balap, Alvin mengaku tak habis percaya bisa naik podium mengingat mengawali lomba dari urutan sembilan dari total 12 peserta. Bersaing ketat dengan pebalap satu timnya, Rio Saputro, Reynaldo P Koesoemo, dan SunnyTS,membuatAlvinbisamelaju sampai posisi lima besar. Mendekati akhir lap, Alvin pun harus bersaing ketat dengan Fitra Eri

dan Arya Setyaki hingga akhirnya finish di belakang Roy dan Fitra. “Ini berkah bagi saya setelah gagal di seri sebelumnya. Bersyukur dengan suspensi baru dan kombinasi ban GT Radial Champiro SX1 dan SX 2 membuat mobil lebih tangguh hingga bisa bersaing ketat mendapat hasil maksimal. Di seri enam akan lebih berat, tapi saya akan berusaha maksimal juara untuk mengamankan posisi tiga besar klasemen umum,” ujar Alvin yang juga tampil di kelas Honda Jazz One Make Race bersama Rio. (yuslan)

Kejuaraan Dayung PODSI Sergai Digelar 31 Oktober 2012 SEIRAMPAH (Waspada): Pengkab Persatuan Olahraga Dayung Seluruh Indonesia (PODSI) Sergai akan menggelar kejuaraan dayung sampan tradisional III memperebutkan trofi Bupati Sergai di Sungai Bedagai, Desa Pekan Tanjungberingin, 31 Oktober nanti. Demikian dikatakan Ketua Umum Pengkab PODSI Sergai Drs Joni W Manik didampingi Sekretaris Asrul Rasimin, dan Ketua Panitia Sudarno SSos kepada Waspada usai rapat pengurus PODSI dan panitia di Aula Kantor BPBD, Jl Negara Desa Firdaus, kemarin. “Kejuaraan itu nantinya dirangkai dengan pelantikan pengurus Pengkab PODSI Sergai periode 2011-2015 oleh Ketua Umum Pengprov PODSI Sumut,” ujar Joni yang juga Kepala BPBD Sergai. Ketua Panitia, Sudarno SSos, menambahkan panitia sudah mulai membuka pendaftaran peserta di Tempat Pelelangan Ikan (TPI) Tanjungberingin. Untuk acara technical meeting akan digelar 30 Oktober 2012. (c03)



1. Kota yang terbersih dan terindah. 3. Kekal; Tidak bekesudahan. 5. Seni memasak tingkat tinggi dengan cita rasa seni. 7. Mahakuasa. 10. Ideologi. 11. Siaran suara atau bunyi melalui udara. 12. Berkemampuan sangat baik. 13. Panggilan lebih ramah untuk adik. 14. Bersifat menonjolkan kekuasaan dan kekuatan. 16. Hakim yang mengadili perkara yang bersangkut paut dengan agama Islam. 17. Waktu yang belum lama berlalu; Baru saja. 19. Adat kebiasaan turun temurun. 20. Perusahaan Daerah Air Minum di Medan. 22. Singkatan Ikatan Da’i Indonesia. 23. Bentuk perkawinan yang menggambarkan si suami untuk sementara tinggal pada kerabat istri sampai jujurnya lunas (dalam adat Batak).


tercatat sebanyak 300 dari 497 kabupaten/kota yang telah menggulirkan kompetisi di wilayah masing-masing. Bicara gengsi juga diakui Panitia LPI Aceh, Saiful Bahri, SPd. “Kompetisi LPI ini jauh lebih bergengsi, karena masing-masing pemain mengusung nama sekolahnya. Sebab semua pemain harus satu sekolah, tidak boleh diisi pemain dari sekolah lain,” sebutnya. Selain itu, masing-masing pemain juga tampil atas nama sekolahnya di nasional yang merupakan wakil dari nama kabupaten atau provinsi. Karena itu, dia berharap ke depan lebih banyak sekolah yang membina dan mendidik pemain usia remaja.

Pujian Untuk Prestasi Medan Helvetia MEDAN (Waspada): Walau gagal tampil menjadi juara umum pada Pekan Olahraga (Porkot) Medan 2012 dengan hanya selisih satu emas dengan Medan Kota, Ketua KONI Medan Helvetia Ir H Lilik Ismadi bersama Camat Arrahman Pane SSTP menyambut posisi runner-up dengan rasa syukur dan bangga. “Kalau ada pihak yang menyebutkan sungguh “menyakitkan” hanya gara-gara selisih satu emas Medan Helvetia gagal juara umum, barangkali ucapan itu sah-sah saja,” kata Lilik Ismadi di sela penutupan Porkot Medan 2012, Sabtu (20/10). Kontingen Medan Helvetia yang turun dengan 253 atlet dengan mengikuti 24 dari 33 ca-

KISARAN (Waspada): Tim Rival KONI Asahan menduduki urutan lima kelas Bebek Pemula Murni 110 cc pada Kejurda Road Race Sumut berkat Bima Anugrah Siswanto di Sirkuit Multi Fungsi Jl Pancing, Medan, Minggu (21/10). Walaupun bukan urutan pertama, hasil ini sudah maksimal mengingat sedikitnya jam

Waspada/Arianda Tanjung

WALI KOTA Medan Drs H Rahudman Harahap MM memberi selamat kepada Ketua Umum PSMS Terpilih Benny Sihotang (kiri), Minggu (21/10).

1. Lebih baik; Terbaik; Gelar untuk orang besar. 2. Kekuasaan; Kewibawaan;

Sewenang-wenang. 3. Saudara kandung atau kerabat yang lebih muda. 4. Pertemuan antara bujang dan gadis pada upacara adat suku Pubian di Lampung. 5. Berkekuatan amat besar atau luar biasa (tentang negara, bangsa). 6. Tanda isyarat untuk membangunkan pasukan (prajurit dsb). 8. Pemain andalan yang sangat berbakat. 9. Pemancaran gelombang yang membawa tenaga melalui ruang atau zantara; Pengobatan dengan zat radioaktif. 12. Jalan raya yang lebar, biasanya dengan deretan pohon di kiri-kanannya; Bulevar. 13. Unggul; Besar (kata dalam bentuk terikat) 15. Kecanduan secara fisik dan mental terhadap suatu zat. 18. Persetujuan atau perjanjian tertulis untuk menghentikan sengketa atau perkara. 19. Dinding dari bambu yang dianyam (Minang). 21. Berkat dari Tuhan.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan dalam waktu tak sampai tujuh menit. Jawabannya lihat di halaman A2 kolom 1.

9 1 2 8 7 5

1 8 2 6 5 3 4 5 8 7 5 9 1 3 4 2 8 2 9 6 4 6 9 9 1 5 8 9 3 6 8

2 3

4 9 6 1 3 2 *212

Sport Messi… Messi… Messi…



Senin 22 Oktober 2012

MADRID (Waspada): Hatrik ke15 Lionel Messi di La Liga Primera, Sabtu (Minggu WIB), mewarnai laga menegangkan urat syaraf dengan total sembilan gol saat 10 pemain Barcelona akhirnya menang 5-4 atas tuan rumah Deportivo La Coruna.


SUPERSTAR Real Madrid Cristiano Ronaldo merayakan gol penaltinya ke gawang Celta Vigo di Santiago Bernabeu.

Mestinya Madrid Menang Telak MADRID (Waspada): Bek Sergio Ramos mengklaim, mestinya Real Madrid menang telak atas tamunya Celta Vigo pada jornada 8 La Liga Primera di Stadion Santiago Bernabeu. “Jika kami lebih beruntung, hasilnya bisa lebih bagus. Tapi kami harus segera melupakannya, karena kami telah bekerja dengan baik,” tutur Ramos, seperti dilansir Football Espana, Minggu (21/10). El Real menang 2-0 dalam duel Sabtu (Minggu WIB) tersebut, berkat gol Gonzalo Higuain menit 11 dan penalti Cristiano Ronaldo menit 68. Ramos malah senang tidak kebobolan, karena Los Blancos diganggu virus FIFA ketika menjamu Celta. Beberapa pilar Real terutama di jantung pertahanan mengalami cedera, sehingga entrenadorJose Mourinho sampai menurunkan Michael Essien di posisi bek kiri. “Orang-orang mungkin terkejut, namun

cedera membuat kami beradaptasi. Michael Essien dan saya bermain di level yang tinggi dalam waktu lama. Kami yakin dengan bek sayap,” jelas Ramos. “Keyakinan sangat besar di kamp latihan. Liga masih sangat panjang dan segalanya masih bisa terjadi. Tak ada tim yang secara matematis memenangkan gelar sekarang,” optimisme bek andalan Timnas Spanyol itu. Menurut Aitor Karanka, asisten Mourinho, kokohnya pertahanan Los Blancos menjadi salah satu kunci sukses Iker Casillas cs. Padahal, Madrid kehilangan Marcelo, Fabio Coentrao dan Alvaro Arbeloa. “Empat pemain belakang kami bermain sangat baik. Celta hanya memiliki satu sundulan pada akhir laga,” klaim Karanka dalam Marca. “Ramos tahu di mana posisinya, Varane melakukan tugasnya dengan baik dan Pepe selalu bermain seperti biasanya. Berbagai posisi bisa Essien mainkan, malam ini memang terlihat,” katanya lagi. (m15/vvn/fe/marca)

Pemain Barca, Javier Mascherano, mendapat kartu merah menit 49, saat kedudukan 3-4 untuk keunggulan tim tamu di Municipal Riazor Stadium. Namun permainan tak ada habisnya dari Messi, Pemain Terbaik Dunia tiga kali, memastikan El Catalan belum terkalahkan hingga jornada 8. Messi, yang tengah menantikan kelahiran anak pertamanya, telah mencetak 71 gol bagi klub dan negaranya tahun 2012 ini. Dia berarti hanya tinggal empat gol lagi untuk menyamai rekor Pele (Brazil) tahun 1959 silam. “Dia (Messi) langsung pergi ke rumah sakit untuk menyaksikan kelahiran anak pertamanya itu,” ujar Direktur Olahraga Barca Andoni Zubizarreta, seperti dikutip dari Reuters, Minggu (21/10). Bek Jordi Alba yang membuka keunggulan Barca menit ketiga, lantas disusul gol Cristian Tello menit delapan. Messi membawa tim tamu unggul 3-0 menit 18, tapi gol penalti Pizzi menit 26 menghidupkan lagi semangat juang tim tuan rumah. Ales Bergantinos sempat membuat skor 2-3, namun Messi berhasil menyarangkan

Senin, 22 Oktober (GMT) Sevilla v Mallorca


Minggu, 21 Oktober Getafe v Levante Sabtu, 20 Oktober Malaga v Valladolid Real Madrid v Celta Valencia v Ath Bilbao Deportivo v Barcelona

0-1 2-1 2-0 3-2 4-5


MESIN gol Barcelona Lionel Messi (tengah) protes keputusan wasit Paradas Romero di Municipal Riazor Stadium, La Coruna, Spanyol, Minggu (21/10) dinihari WIB. gol keduanya untuk memaksakan kedudukan menjadi 2-4 saat rehat. Gol Pizzi menit 47 ditambah keluarnya Mascherano menit 49, membuat Super Depor kembali merepotkan anak asuh Tito Vilanova. Messi melengkapi hatriknya menit 77, namun Alba membuat gol bunuh diri dua menit kemudian hingga suhu

memanas lagi hingga berakhirnya laga. Messi pun mengecam keputusan wasit Jose Luis Paradas Romero, yang dinilainya banyak merugikan El Barca. Di antaranya ketika dia memberi La Coruna penalti dan mengusir Mascherano. “Seharusnya tidak ada hukuman penalti dan Mascherano

tidak pantas dikeluarkan. Tapi, wasit melihat sebaliknya dan apa yang terjadi, terjadilah,” kritik Messi. Entrenador Tito Vilanova juga mengaku, tidak dapat membayangkan keputusan kontroversial wasit Jose Paradas. “Penalti merusak ritme kami. Sebelum itu, saya tidak pernah melihat tim saya bermain

sangat baik seperti dalam 20 menit awal,” jelasnya kepada Sport. “Saya memasukan Xavi (setelah Mascherano diusir wasit) karena dengan 10 pemain, saya ingin lebih banyak mengontrol bola. Dia segar dan bisa melakukan tugas tersebut,” pungkas Vilanova. (m15/ant/rtr/sport)

Persiba Jawara Batik Cup SOLO (Waspada): Persiba Bantul sukses merebut gelar juara turnamen Batik Cup I, setelah mengalahkan Persis Solo Selection 2-0 di Stadion Manahan Solo, Minggu (21/10). Dua gol kemenangan Persiba dicetak Busari dan striker I Made Wirahadi. Asisten Pelatih Persiba, Albert Rudiana, mengaku cukup

senang atas keberhasilan yang dicapai anak asuhnya. Menurutnya, sukses di Batik Cup ini akan melecut motivasi Marcio Souza cs untuk menoreh prestasi terbaik kala berlaga di Indonesian Premier League (IPL) musim kompetisi 2012/2013. “Stamina anak-anak terkuras habis di pertandingan tadi. Meski menang, tadi bukanlah

kemenangan mudah. Lini pertahanan Persis sangat ketat dan disiplin, sehingga menyulitkan kami. Untungnya, kami bisa mencetak gol,” beber Albert. Pelatih Persis, Eduard Tjong, menyebut penyebab kekalahan timnya karena faktor fisik yang tidak prima. Hal tersebut karena masa recovery yang minim, karena cukup ter-

kuras saat menghadapi Tim-nas U-23 di semifinal. “Anak-anak kehabisan tenaga. Di sisi lain, lawan yang dihadapi adalah tim yang berkualitas sehingga pemain sulit tampil prima, khususnya lini pertahanan,” tandas Eduard sembari mengatakan fisik yang tidak bugar membuat pertahanan timnya kewalahan. (yuslan)


KETUA Umum KONI Sumut H Gus Irawan Pasaribu memberikan apresiasi atas penyelenggaraan Kit Futsalismo 2012 Region Medan dengan pelaksana lokal Harian Waspada bekerjasama UKM Olahraga Unimed.

Harapkan Wakil Medan Juara Nasional Kit Futsalismo 2012 Waspada/Hamdani

PARA pemain Unimed yang menjuarai kategori Perguruan Tinggi, menyalami para undangan sebelum naik ke podium juara di GSG Unimed, Sabtu (20/10) malam.

Bank Sumut Juara Baru MEDAN (Waspada): Bank Sumut tampil sebagai juara baru kategori klub umum ajang Kit Futsalismo 2012 Region Medan setelah menaklukkan tim favorit Isori FC 3-0 di Gedung Serba Guna (GSG) Unimed, Sabtu (20/10) malam. Sukses skuad asuhan pelatih Syahazazi Gultom itu tidak diraih dengan mudah. Perlawanan ketat diberikan Isori yang dikoordinir Rico Simanjuntak. Pemain bertubuh mungil yang dinobatkan sebagai Best Player ini sangat merepotkan Feri San-toso cs sebagai salah satu tim peserta Liga Futsal Indonesia. Babak pertama pun berakhir tanpa gol. Memasuki 20 menit kedua, permainan kedua tim tetap ngotot. Upaya Bank Sumut yang diperkuat sejumlah mantan pemain PON seperti Harianto Sergai, Dicky Putra, dan Feri Santoso untuk mencetak gol kerap menemui jalan buntu. Bank Sumut baru bisa memecah kebuntuan di paruh babak kedua lewat tendangan keras Harianto Sergai yang akhirnya dinobatkan sebagai top skor ajang dengan torehan delapan gol. Unggul 1-0 menambah semangat tim runner-up ajang serupa di tahun 2010 itu untuk terus meningkatkan se-

rangan. Hasilnya, lima menit berselang, Anca sukses memperbesar keunggulan timnya. Isori yang sudah tertinggal dua bola berusaha meningkatkan serangan. Aksi individu Rico Simanjuntak beberapa kali mengancam gawang lawan. Beruntung Bank Sumut memiliki kiper berkelas seperti Dicki Putra yang selalu mampu menggagalkan beberapa peluang emas Isori. Saat laga sepertinya akan berakhir dengan skor 2-0, Kapten Tim Bank Sumut, Feri Santoso, berhasil mencetak gol spektakuler hasil tendangan bebas jarak jauh lebih dari setengah lapangan untuk mengakhiri laga dengan skor 3-0. “Kami mengalami kesulitan dalam mencetak gol, terlebih setelah absennya striker Citra Kusuma akibat akumulasi kartu merah. Hal ini akan menjadi bahan evaluasi kami sebelum tampil di babak Champion Games Kit Futsalismo pada November 2012,” ujar Syahazazi Gultom. Pada kategori pelajar SLTA, SMK Mulia menjadi satu-satunya tim yang mampu mempertahankan gelar juara dua kali berturut. Sebelumnya, juara bertahan Lintas Angkasa dan USU gugur di babak semifinal dan penyisihan. SMK Mulia kembali berhak tampil di babak Champion Game setelah menaklukkan

SMA UISU 7-3. Sedangkan di kategori perguruan tinggi, Universitas Negeri Medan (Unimed) turut menjadi juara baru dengan menumbangkan runnerup tahun lalu, Universitas Muhammadiyah Sumatera Utara (UMSU) 3-1. (m42)

MEDAN (Waspada): Ketua Umum KONI Sumut, Gus Irawan Pasaribu, berharap tim futsal Bank Sumut, Unimed, dan SMK Mulia yang sukses menjuarai ajang Kit Futsalismo 2012 Region Medan, mengukir prestasi terbaik pada babak Champion Game di Jakarta, 13-17 November mendatang. “Setidaknya salah satu tim bisa juara di tingkat nasional. Kita semua tentu merindukan prestasi itu,” ujar Gus seusai menutup Kit Futsalismo 2012 Region Medan di Gedung Serba

Guna (GSG) Unimed, Sabtu (20/10) malam. “Terakhir kali SMK Mulia yang tampil juara di ajang Kelme Futsalismo 2007. Kebetulan saat itu saya yang melepas keberangkatan mereka ke Jakarta,” tambah mantan Dirut PT Bank Sumut tersebut. Menurutnya, Kit Futsalismo hendaknya dapat terus digelar di Kota Medan karena sangat bermanfaat dalam meningkatkan pembinaan. Menurutnya, semakin banyak kompetisi yang digelar, maka akan semakin

baik pembinaan satu cabang olahraga. “Sebaliknya, kompetisi yang minim akan berdampak negatif terhadap prestasi satu cabang olahraga. Intinya, untuk meningkatkan prestasi olahraga adalah dengan meningkatkan frekuensi kompetisi,” pungkas Gus. Ir H Kamaluddin Harahap MSi, Wakil Ketua DPRD Sumut, sependapat dengan Gus Irawan. Menurut peraih penghargaan “Tokoh Olahraga Sumatera Utara” pada peringatan Haornas


TIM Bank Sumut merayakan sukses menjuarai kategori Klub Umum dengan Darius Sinathrya (2 kiri), Wakil Ketua DPRD Sumut H Kamaluddin Harahap, Rafriandi Nasution, dan Prof Dr Agung Sunarno (kanan).

2012 tingkat Sumut tersebut, ajang Kit Futsalismo sangat positif untuk menggairahkan kompetisi dan meningkatkan prestasi futsal daerah ini. “Bagus sekali kejuaraan ini, kalau bisa setiap tahun berlangsung di Medan. Kita wajib mem-

berikan apresiasi serta mendukung perjuangan para wakil Region Medan untuk menjadi juara nasional di Jakarta,” kata Kamal, Ketua Pengprov yang telah dimenangkan BAORI dalam perkara dualisme kepengurusan PSSI Sumut. (m42)

Hatrik Gus Gagalkan Kemenangan Tim Kamal MEDAN ( Waspada): Hatrik gol Gus Irawan Pasaribu menggagalkan kemenangan tim Kalamuddin All Stars dalam laga eksibisi yang berakhir imbang 7-7 pada final Kit Futsalismo 2012 Region Medan di GSG Unimed, Sabtu (20/10) malam. Dalam duel bertajuk “Sumut Peduli SOIna” yang melibatkan anak-anak penyandang tunagrahita itu, tim Gus Irawan All Stars tertinggal 1-4 atas Kamaluddin Harahap dan kawan-kawan, sebelum Gus memasuki lapangan. Tim Kamal semula bagaikan menang mudah dengan permainan berkelas dari selebritis Darius Sinathrya dan mantan pelatih PSMS dan tim sepakbola PON 2012 Sumut , Rudi Saari. Gus Irawan All Stars turut didukung PR II Unimed Charil Azmi Hutasuhut, Ketua Kontingen PON 2012 Sumut Jhon Ismadi Lubis, Pembantu Dekan II FIK Unimed Mesnan MKes, Ketua Bapopsi Sumut Sakiruddin, Ahmad Nasoha (Coca Cola), Kapten Tim PON Sumut Hardiantono, Ketua Umum KONI Asahan Nurkarim Nehe, dan lainnya. Sedangkan Kamaluddin All Stars diperkuat Darius, Rudi Saari, Ketua BFD Sumut Rafriandi Nasution, Ketua Kontingen Peparnas 2012 Sumut Prof Dr Agung Sunarno, Gunarko Hartoyo (CV Indako Trading Co), Erwisnyah (Waspada), dan kiper Austin Tumengkol (Puket II STIK-P). Babak pertama, Kamaluddin cs memimpin 2-1 lewat gol Rudi dan Darius. Sakiruddin membalasnya dengan memanfaatkan umpan terukur Nurkarim Nehe. Skor 2-1 bertahan hingga berakhir babak pertama. Memasuki babak kedua, Darius tampil trengginas dengan mencetak satu gol cepat dan memberikan umpan bagi gol Kamal. Di paruh babak kedua, Gus Irawan akhirnya hadir di lapangan dan langsung membantu timnya mengimbangi Darius cs. Gus sukses mencetak hatrik, gol pamungkasnya tepat saat bel berbunyi tanda berakhirnya laga. Dua gol tim Gus Irawan All Stars lainnya tercipta lewat kaki Mesnan dan aksi Sakiruddin. Kubu Kamaluddin menambah tiga gol andil Rafriandi, Rudi Saari, dan Kamaluddin. (m42)


WASPADA Senin 22 Oktober 2012


Berkat Sukses Redam Serangan Balik Juventus Vs Napoli 2-0 TURIN, Italia (Waspada): Bek Giorgio Chiellini menilai, sukses meredam serangan balik Edinson Cavani dan kawan-kawan menjadi kunci kemenangan 2-0 Juventus atas Napoli pada giornata 8 Liga Seri A. “Cavani, Goran Pandev dan Marek Hamsik mungkin kombinasi serangan terbaik dari para saingan kami di Italia. Tapi kami bermain bagus untuk menghentikan serangan balik mereka,” ucap Chiellini dalam laman resmi Juve, Minggu (21/10). Mentas di Juventus Stadium, Sabtu (Minggu WIB), I Bianconeri baru bisa membobol gawang I Partenopei lewat gol bek Martin Caceres

menit 80 dan dimantapkan penyerang Paul Pogba menit 82. “Napoli memasuki laga dengan mentalitas yang sama seperti di final Coppa Italia dan Piala Super Italia. Mereka menarik kami keluar, lalu melakukan serangan balik,” jelas Chiellini, bek sentral La Vecchia Signora dan Gli Azzurri. Kemenangan dalam laga seru itu membuat Si Nyonya Tua sendirian memuncaki klasemen Seri A dengan koleksi 22 poin. Napoli tiga poin di bawahnya, sehingga mengurangi kesempatan Partenopei untuk merampas mahkota The Old Lady. “Saya rasa pertandingan ini sedikit dibesar-besarkan. Na-

mun kita telah melihat laga bagus dan tidak melewati batas. Kami menang, tapi tidak pernah mudah untuk menghadapi Napoli,” pungkas Chiellini. Menurut pelatih Napoli Walter Mazzarri, Hamsik cs mengontrol laga sebelum terjadinya sepak pojok yang berbuah gol sundulan Caceres. “Andrea Barzagli biasanya maju ke kotak pertahanan kami, tapi mereka mengubah taktik,” tuturnya. “Pemain kami tidak melihat Martin Ceceres maju dan menyundul bola. Kelalaian kami menguntungkan mereka,” tambah Mazzarri kepada Football Italia. Dia juga mengaku salah, sebab tidak memasukkan pemain muda Lorenzo Insigne lebih ce-

pat. Insigne masuk menit 85, ketika Partenopei sudah ketinggalan 0-2. “Saat itu saya berharap masih bisa memperkecil ketertinggalan dengan serangan balik Goran Pandev. Tendangan Edinson Cavani juga membentur mistar gawang, jika tidak, mungkin kejadiannya akan berbeda,” ratap Mazzarri. (m15/vvn/fi) SUNDULAN bek Martin Caceres membuka keunggulan Juventus atas Napoli di Juventus Stadium, Turin, Italia, Minggu (21/10) dinihari WIB. -AP-

Gebrakan Mantap Inter MILAN, Italia (Waspada): Formasi anyar pelatih Andrea Stramaccioni kembali memakan korban. Kali ini, Catania yang menjadi tim yang dikalahkan Inter Milan dalam lanjutan Seri A di Stadion San Siro, Minggu (21/10). Inter pun sukses merebut empat kemenangan beruntun. Kedua gol Inter di pertandingan ini disumbangkan Antonio Cassano menit 28 dan Rodrigo Palacio lima menit sebelum laga usai. Menghadapi Catania, Stramaccioni tetap mempertahankan formasi 3-5-2 di mana trio bek tengah dipercayakan kepada Andre Ranocchia, Walter Samuel, dan Juan. Posisi kapten Javier Zanetti sedikit dimajukan mengisi lini tengah bersama Gaby Mudingayi, 19-Esteban Cambiasso, dan Joel Chukwuma Obi. Rodrigo Palacio dan Diego Milito diandalkan di lini serang, sedangkan Antonio Cassano bertindak sebagai playmaker. Sejak awal, dominasi pertandingan langsung dipegang penuh Inter. Pola penyerangan mengandalkan kecepatan dan umpan-umpan terobosan

Cassano menjadi andalan Inter membongkar pertahanan Catania. Palacio memperoleh peluang pertama bagi Inter pada menit 19. Cassano mengirim umpan terbosan lambung dan disambut tandukan Palacio. Namun, tandukannya terlalu lemah, sehingga mampu diantisipasi Mariano Andujar. Menit 23, giliran Diego Milito mengancam gawang Catania. Cassano memberikan umpan untuk Milito yang menyambutnya dengan tendangan setengah voli. Namun, lagi-lagi bola mampu diselamatkan Andujar. Kebuntuan Inter akhirnya pecah pada menit 28. Diawali dari skema serangan balik cepat, Milito menyisir sisi kiri pertahanan Catania. Umpan

Hasil Minggu (21/10) Lazio vs Milan Cagliari vs Bologna Atalanta vs Siena Chievo vs Fiorentina Inter Milan vs Catania Palermo vs Torino Parma vs Sampdoria Udinese vs Pescara

Klasemen Liga Seri A 3-2 1-0 2-1 1-1 2-0 0-0 2-1 1-0

Hasil Sabtu (20/10) Juventus vs Napoli


pendek Milito kepada Esteban Cambiasso diteruskan untuk Cassano yang tak terjaga. Gol kedua Inter akhirnya hadir lima menit sebelum laga berakhir. Menerima umpan lambung terobosan Milito, tembakan keras setengah voli Rodrigo Palacio bersarang di pojok kiri gawang Catania. Hingga pertandingan berakhir, keunggulan dua gol Inter tetap tak berubah. Kemenangan ini tak mengubah posisi Inter di klasemen sementara Seri A. Nerazzurri sementara berada di posisi empat dengan 18 angka dan Catania menempati peringkat lima. Di laga lain, Parma menjauh dari zona degradasi menyusul

Juventus 8 7 1 0 19-4 22 Napoli 8 6 1 1 14-5 19 Lazio 8 6 0 2 15-8 18 Inter Milan 8 6 0 2 13-6 18 Fiorentina 8 3 3 2 9-7 12 AS Roma 7 3 2 2 14-11 11 Catania 8 3 2 3 9-13 11 Sampdoria 8 3 2 3 10-10 10 Torino 8 2 4 2 9-5 9 Genoa 7 2 3 2 8-8 9 Udinese 8 2 3 3 8-11 9 Parma 8 2 3 3 8-11 9 Atalanta 8 3 1 4 7-12 8 Cagliari 8 2 2 4 5-11 8 AC Milan 8 2 1 5 9-10 7 Bologna 8 2 1 5 9-11 7 Pescara 8 2 1 5 6-15 7 Chievo 8 2 1 5 7-15 7 Palermo 8 1 3 4 6-11 6 Siena 8 2 2 4 9-10 2 *Siena minus 6 poin, Atalanta 2, Sampdoria, dan Siena 1 angka kemenangan 2-1 atas 10 pemain Sampdoria. Malapetaka Il Samp berawal dari kartu merah Sergio Romero di babak pertama, sehingga memudahkan Amauri mencetak gol dari hadiah penalti. Amauri mencetak gol kedua sebelum Sampdoria memperkecil kekalahan lewati penalti Eder.

Rossoneri Resah



KIPER Catania Mariano Andujar (kanan) berusaha menggagalkan usaha striker Inter Milan Antonio Cassano dalam lanjutan Seri A di San Siro Stadium, Milan, Minggu (21/10).

Minggu, 21 Oktober Sunderland v Newcastle


Sabtu, 20 Oktober Tottenham v Chelsea Fulham v Aston Villa Liverpool v Reading Swansea v Wigan West Brom v Man City West Ham v Southampton Man United v Stoke City Norwich v Arsenal

2-4 1-0 1-0 2-1 1-2 4-1 4-2 1-0

Klasemen Liga Premier Chelsea 8 Man United 8 Man City 8 Everton 7 Tottenham 8 West Brom 8 West Ham 8 Fulham 8 Arsenal 8 Swansea 8 Newcastle 8 Liverpool 8 Sunderland 7 Stoke City 8 Norwich 8 Wigan 8 Aston Villa 8 Southampton8 Reading 7 QPR 7

7 6 5 4 4 4 4 4 3 3 2 2 1 1 1 1 1 1 0 0

1 0 3 2 2 2 2 1 3 2 4 3 5 5 3 2 2 1 3 2

0 2 0 1 2 2 2 3 2 3 2 3 1 2 4 5 5 6 4 5

19-6 21-11 17-9 14-8 15-12 12-9 12-9 16-11 13-6 14-12 9-12 10-12 6-8 8-9 6-17 8-15 6-13 13-24 8-14 6-16

22 18 18 14 14 14 14 13 12 11 10 9 8 8 6 5 5 4 3 2

ROMA ( Waspada): Kalah lagi ketika mengunjungi markas SS Lazio pada giornata 8 Liga Seri A, Sabtu (Minggu WIB), membuat kubu AC Milan dilanda resah. “Saat ini kami dalam kondisi agak rapuh, baik dalam performa permainan maupun mental,” ungkap bek Daniele Bonera, seperti dilansir Biancoceleste, Minggu (21/10). Tumbang 2-3 dari Lazio di Stadion Olimpico Roma tersebut, menjadi kekalahan kelima I Rossoneri dari delapan laga Seri A. Ini hasil terburuk keempat dalam sejarah klub, kondisinya mirip musim 1942-42, 1930-31 dan 1938-39. Hancurnya Milan tak terlepas dari buruknya koordinasi di lini belakang, terbukti skuad Massimiliano Allegri telah kebobolan 10 gol hanya dari delapan laga. “Pelatih selalu berada dalam tekanan. Namun itu wajar dan kami harus segera bangkit di

klasemen,” harap Allegri dalam Football Italia. Rossoneri malah sempat tertinggal 0-3 lewat gol-gol Hernanes menit 25, Antonio Candreva (41') dan Miroslav Klose (49'). Mereka hanya sanggup mencetak dua gol balasan melalui aksi gelandang Nigel De Jong menit 61 dan striker Stephan El Shaarawy menit 79. “Kami harus segera kembali merebut poin, jika tidak kami akan kembali terjebak ke zona degradasi. Jelas, kami juga harus menghindari kesalahan tertentu,” ujar Allegri. “Malam ini tim menciptakan peluang dan bekerja keras, maka saya pikir ada beberapa sisi positif dari laga ini. Kami harus membayar dari dua tendangan ke gawang yang didapat Lazio di babak pertama,” tambah pelatih berusia 45 tahun itu. Meski kalah lagi, posisi Allegri menurut Wakil Presiden Milan Adriano Galliani, tetap aman. “Ini saat yang sulit dan kami harus tetap tetap tenang, supaya kami bisa mengatasinya. Tentu saja kami sepertinya tidak per-


STRIKER Lazio Miroslav Klose (kiri) menambah derita AC Milan di Stadion Olimpico, Roma, Minggu (21/10) dinihari WIB. nah beruntung, tapi keadaan ini akan berubah pada akhirnya,” dalih Galliani. “Kami harus melihat ke depan, seperti pada Rabu nanti saat kami bermain melawan Malaga di Liga Champions. Kami berharap masa sulit ini segera berlalu. Ada beberapa sisi positif terutama Nigel De Jong dan Stephan El Shaarawy yang bermain bagus,” katanya menambahkan. Namun beberapa media

Italia terus memberitakan bahwa Rossoneri segera memecat Allegri dan mendatangkan mantan pelatih Barcelona Josep ‘Pep’ Guardiola. “Pelatih akan tetap di tempatnya dan dia harus menemukan cara terbaik tim untuk meraih poin dan bangkit dari momen ini. Tidak ada keinginan sama sekali untuk mengganti pelatih,” pungkas Galliani. (m15/okz/fi/tf)

Gunners Kecewa Jadi Tumbal Norwich Wozniacki Puas Imbangi Stosur LONDON (Waspada): Norwich City membuat kejutan dalam laga Liga Primier, Sabtu (Minggu WIB), setelah menaklukkan raksasa Arsenal 1-0 di Carrow Road lewat gol tunggal Grant Holt menit 20. Manager Arsene Wenger mengaku kecewa, karena The Gunners bisa menjadi tumbal bagi kemenangan pertama Norwich pada musim ini. “Permainan kami sangat mengecewakan. Saya merasa kami kurang tajam, tapi kami tak menyalahkan siapa pun atas kesalahan yang kami buat,” beber Wenger melalui Sky Sports, Minggu (21/10). Gunners gagal total menciptakan peluang untuk membalas gol tuan rumah The Canaries, padahal Wenger punya penyerang papan atas model Olivier Giroud, Gervinho, Andrei Arshavin dan Lukas Podolski. “Norwich bermain sangat baik dalam bertahan. Mereka sangat fokus dan memiliki komitmen. Kami sebenarnya lebih menguasai bola, tapi tak banyak


KAPTEN Norwich Grant Holt (kiri) membobol gawang Arsenal di Carrow Road, Minggu (21/10) dinihari WIB. peluang yang kami buat,” sesal pelatih asal Prancis itu. Wenger pun hanya bisa berharap, pasukannya bisa melakukan perbaikan ketika melawan FC Schalke di Liga Champions, Rabu (24/10). “Kami harus bangkit dengan permainan

lebih baik,” harapnya. Dengan kekalahan ini, Arsenal harus tertahan di papan tengah klasemen sementara dengan raihan 10 poin. Norwich keluar dari zona degradasi berkat gol tunggal kapten Holt. (m15/sky/espn)

MOSKOW (Waspada): Unggulan ketiga Caroline Wozniacki (foto) dari Denmark memenangi PialaWTA Kremlin pada Minggu (21/10), dengan mengalahkan unggulan teratas Samantha Stosur (Australia). Wozniacki, mantan peringkat satu dunia, menang 6-2, 46, 7-5 untuk meraih gelar ke-20 sepanjang kariernya sekaligus gelar kedua musim ini untuk menyamai catatan head-to-head dengan Stosur yang juga peringkat kesembilan dunia menjadi 3-3. Di awal permainan, Wozniacki yang saat ini menduduki peringkat 11 dunia melakukan break untuk memimpin 3-0. Stosur membalas di game kelima, namun gagal menyamakan skor saat lawannya melakukan dua break lagi untuk memenangi set pertama dalam waktu 37 menit. Stosur, juara AS Terbuka 2011, bangkit dan memenangi set kedua saat pertandingan sudah berlangsung selama satu jam 20 menit. Petenis Australia berusia 28 tahun itu memulai set penentu dengan break untuk unggul 2-0, namun Wozniacki balas mematahkan servisnya untuk menyamakan kedudukan. Pada game kesembilan, Wozniacki membuat break yang menentukan untuk memenangi set dan pertandingan yang berdurasi dua jam 13 menit ketika Stosur mengirim bola keluar lapangan. “Ini merupakan pertandingan yang berat dan nyaris berakhir sebaliknya. Anda memenangi sesuatu, saya memenangi sesuatu, namun itulah olahraga,” kata Wozniacki yang menerima trofi perak Cartier dan cek senilai 122 ribu dolar. Final putra mempertemukan unggulan kedua Andreas Seppi (Italia) melawan unggulan keempat Thomaz Bellucci (Brazil). Dalam pertarungan rubber set, Seppi mengungguli Bellucci 3-6, 7-6, 6-3. (m33/ap)




WASPADA Senin 22 Oktober 2012

Pedrosa Dominasi Trek Basah SEPANG, Malaysia (Waspada): Andalan tim Repsol Honda asal Spanyol, Dani Pedrosa, kembali melanjutkan dominasinya setelah memenangkan MotoGP Malaysia di Sirkuit Sepang, Minggu (21/10). Di atas trek basah, Pedrosa juga mengatasi rekan senegara sekaligus rivalnya, Jorge Lorenzo (Yamaha).

Cortese Kunci Gelar Moto3 SEPANG, Malaysia (Waspada): Perlombaan yang seru terjadi di kelas Moto2 pada MotoGP Malaysia di Sirkuit Sepang, Minggu (21/10). Di kelas Moto3, Sandro Cortese (foto) mengunci titel juara musim ini. Di Moto2, balapan ditunda sekitar setengah jam dari jadwal semula karena hujan deras mengguyur sirkuit. Lintasan yang kemudian basah itulah melahirkan banyak insiden sepanjang lomba. Takaaki Nakagami menjadi pebalap pertama yang tergelincir seusai start di tikungan pertama. Setelah itu, bergantian

Johann Zarco, Xavier Simeon, dan Mika Kallio yang berjatuhan dari motornya masing-masing. Nakagami terjatuh lagi setelah bersenggolan dengan Eric Granado, sedangkan Anthony West perlahan tapi pasti bergabung ke grup depan di urutan empat. Pimpinan klasemen sementara, Marc Marquez, tertahan di posisi keenam dengan Pol Espargaro terlempar di peringkat 12. De Angelis memenangi balap Moto2 yang dipangkas menjadi 15 dari 19 lap. Peringkat kedua diraih Anthony West (Australia), sedangkan Gino Rea

Lorenzo Merasa Beruntung SEPANG, Malaysia (Waspada): Pebalap Yamaha, Jorge Lorenzo, mengakui dirinya sangat beruntung tidak mengalami kecelakaan menjelang bendera merah dikibarkan pada lap ke14 MotoGP Malaysia, Minggu (21/10). Pasalnya, Lorenzo nyaris jatuh di tikungan 15 sebelum mampu mengendalikan M1 tunggangannya. Pebalap Spanyol ini sudah beberapa kali tidak nyaman dalam lomba yang direncanakan berlangsung 20 putaran itu. Saat balapan tersisa enam

lap, Lorenzo mengalami guncangan hebat saat masuk tikungan terakhir. Beruntung karena Lorenzo lolos dari ancaman kecelakaan setelah hujan deras mengguyur trek dan bendera merah dikibarkan. Jika tidak, juara dunia 2010 ini mungkin jatuh atau disalip Casey Stoner. Dengan finish di posisi kedua pada seri ke-16 dan unggul 23 poin, tugas Lorenzo di dua seri tersisa sedikit lebih ringan. Lorenzo hanya perlu minimal finish di posisi ketiga saat balapan di Australia dan Valencia. (m33/auto)

Tirta Prima Juara KRAPSU Diduga Ada Manipulasi Usia MEDAN (Waspada): Klub renang Tirta Prima Medan memastikan juara umum Kejuaraan Renang Antar-Perkumpulan se-Sumatera (KRAPSU) VI di Kolam Renang Selayang Medan, Minggu (21/10) malam. Tirta Prima memperoleh juara umum dengan 27 emas, 18 perak, dan 25 perunggu. Posisi kedua diperoleh PR Belibis Riau dengan raihan 22 emas, 30 perak, dan 10 perunggu. Tempat ketiga ada TSCC Bengkulu dengan 12 emas, 10 perak, dan 8 perunggu. KRAPSU yang digelar mulai Sabtu (20/10) diikuti 42 klub se-Sumatera plus undangan dari PR Pari Sakti Jakarta yang menurunkan enam perenang. Namun perenang Pari Sakti Jakarta tidak masuk dalam rekapitulasi perolehan medali, karena hanya try out. Pelaksanaan KRAPSU yang diikuti 469 perenang itu turut dinodai upaya manipulasi usia dari Riau pada KU-5. Menanggapi hal itu, Drs Setiady Tish yang juga anggota dewan hakim membenarkan adanya protes dari salah satu ofisial klub. Menurut Setiady, salah satu perenang asal klub Riau memiliki dua akta kelahiran berbeda. Akta kelahiran pertama disebutkan kelahiran Mei 2002 dan pembuatan akta tercatat pada Juli 2003, sedangkan akta kedua disebutkan lahir Mei 2003 dan pembuatan tercatat 2010. Melihat hal ini, dewan hakim memutuskan untuk menyerahkan persoalan kepada Pengprov PRSI Riau. “Jika terduga terbukti memanipulasi usia, maka perenang didiskualifikasi dan medali emas yang diperolehnya batal. Jadi sekarang ini masih dalam proses,” kata Setiady. Ketua Harian PRSI Sumut, Rudi Rinaldi SSos, berharap KRAPSU ini dapat dilaksanakan secara berkesinambungan setiap tahunnya sekaligus sebagai ajang pemanasan mengikuti Kejuaraan Renang AntarPerkumpulan se-Indonesia (KRAPSI) yang digelar di Jakarta, Desember mendatang dan

KRAPSU VII di Sumatera Barat pada Oktober 2013. “Kita berharap pelaksanaan KRAPSU yang sempat tertunda selama 15 tahun ini dapat dilaksanakan berkesinambungan sesuai tujuan mendongkrak prestasi renang se-Sumatera,” ujar Rudi. Koordinator KRAPSU, Raja Nasution, berharap kejuaraan dapat kembali melahirkan perenang-perenang andal ke depannya bukan hanya mengharumkan nama daerah, namun bangsa dan negara. (m18)


(Inggris) menduduki peringkat ketiga. Ajang Moto3 sendiri resmi didominasi Sandro Cortese. Pebalap KTM asal Jerman ini meraih catatan waktu 40:54.123 sekaligus mengungguli Zulfahmi Khairuddin (Malaysia/KTM) dan Jonas Folger ( Jerman/ Kalex). (m33/mgp)


JAWARA MotoGP Malaysia, Dani Pedrosa (tengah), pose bersama runner-up Jorge Lorenzo (kiri) dan Casey Stoner (kanan) saat seremoni pemenangan di Sirkuit Sepang, Minggu (21/10).

Pedrosa memenangi balapan yang dihentikan di tengah lomba, karena hujan yang mengguyur dengan catatan waktu 29 menit 29,049 detik atau unggul 3,774 detik atas Lorenzo. Hasil di Sepang juga menjadi kemenangan keenam bagi Pedrosa musim ini sekaligus membuat defisit angka menipis hanya 23 poin di Lorenzo masih memimpin. Bersaing di lintasan licin Sepang yang diguyur hujan, lomba tetap menjadi milik Lorenzo dan Pedrosa dengan juara dunia Casey Stoner mengamankan podium terakhir. Lorenzo, meraih pole position, mempertahankan posisi pertama selepas start diikuti Pedrosa. Pedrosa berhasil melewati Lorenzo di putaran ke-10 dan terus melesat meninggalkan pesaing utamanya itu. Sementara hujan yang semakin lebat membuat beberapa rider harus terjungkal, termasuk Andrea Dovizioso (Yamaha Tech 3) dan Stefan Bradl (LCR Honda) menyusul Cal Cruthclow (Yamaha Tech 3) serta Ben Spies (Yamah) yang sudah duluan berhenti. Pada lap ke-14 saat balapan tersisa enam putaran, bendera merah akhirnya dikibarkan pertanda lomba dihentikan dari rencana 20 putaran. Saat ben-

dera merah berkibar, balapan belum dinyatakan selesai. Namun, setelah menunggu setengah jam hujan tidak mereda, direktur lomba menyatakan balapan selesai dan menetapkan Pedrosa sebagai pemenang. Selepas MotoGP Malaysia, Lorenzo masih memimpin kejuaraan dunia dengan total 330 poin diikuti Pedrosa (307) dan Stoner (213). (m47/ap)

Hasil MotoGP Malaysia Dani Pedrosa Jorge Lorenzo Casey Stoner Nicky Hayden Valentino Rossi Alvaro Bautista Hector Barbera Aleix Espargaro James Ellison Karel Abraham Danilo Petrucci Michele Pirro Andrea Dovizioso

(Spanyol/Repsol Honda) (Spanyol/Yamaha Factory) (Australia/Repsol Honda) (AS/Ducati Team) (Italia/Ducati Team) (Spanyol/Honda Gresini) (Spanyol/Pramac Racing) (Spanyol/ART CRT) (Inggris/ART CRT) (Rep Ceko/Cardion AB) (Italia/Suter-BMW CRT) (Italia/FTR-Honda CRT) (Italia/Yamaha Tech 3)

29:29.049 29:32.823 29:36.193 29:39.567 29:45.808 29:46.325 30:19.331 30:20.634 30:25.725 30:26.671 30:31.854 30:31.940 30:58.038

Klasemen Pebalap Jorge Lorenzo Dani Pedrosa Casey Stoner Cal Crutchlow Ben Spies Andrea Dovizioso Alvaro Bautista Stefan Bradl Nicky Hayden Valentino Rossi

(Spanyol/Yamaha) (Spanyol/Honda) (Australia/Honda) (Inggris/Yamaha) (AS/Yamaha) (Italia/Yamaha) (Spanyol/Honda) (Jerman/Honda) (AS/Ducati) (Italia/Ducati)

321 poin 299 230 205 197 170 137 135 129 107

Sumatera Utara

WASPADA Senin 22 Oktober 2012


Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:12 12:25 12:13 12:20 12:19 12:16 12:13 12:08 12:15 12:15

15:30 15:44 15:31 15:39 15:38 15:33 15:30 15:26 15:33 15:33

Magrib 18:13 18:25 18:14 18:20 18:20 18:19 18:14 18:10 18:17 18:15



Shubuh Syuruq


19:22 19:35 19:23 19:29 19:29 19:28 19:24 19:19 19:26 19:25

04:43 04:58 04:44 04:52 04:51 04:45 04:43 04:39 04:46 04:46

04:53 05:08 04:54 05:02 05:01 04:55 04:53 04:49 04:56 04:56

L.Seumawe L. Pakam Sei Rampah Meulaboh P.Sidimpuan P. Siantar Balige R. Prapat Sabang Pandan

06:08 06:23 06:09 06:17 06:16 06:11 06:09 06:04 06:11 06:12

Zhuhur ‘Ashar 12:18 12:11 12:10 12:22 12:09 12:10 12:10 12:07 12:25 12:11

15:37 15:29 15:28 15:40 15:26 15:28 15:28 15:24 15:44 15:28



Imsak Shubuh Syuruq


18:18 18:13 18:12 18:23 18:13 18:12 18:13 18:10 18:25 18:14

19:28 19:22 19:21 19:32 19:22 19:21 19:22 19:19 19:34 19:23

04:50 04:42 04:41 04:53 04:39 04:41 04:40 04:37 04:58 04:41

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

05:00 04:52 04:51 05:03 04:49 04:51 04:50 04:47 05:08 04:51

06:16 06:08 06:07 06:19 06:04 06:06 06:06 06:02 06:23 06:07

Zhuhur ‘Ashar 12:11 12:13 12:23 12:15 12:12 12:19 12:07 12:18 12:11 12:10

15:28 15:31 15:42 15:33 15:31 15:38 15:25 15:36 15:28 15:28





Shubuh Syuruq


18:14 18:15 18:23 18:18 18:14 18:20 18:09 18:19 18:13 18:12

19:23 19:24 19:32 19:27 19:23 19:29 19:19 19:29 19:22 19:21

04:41 04:43 04:55 04:46 04:44 04:51 04:38 04:49 04:41 04:41

04:51 04:53 05:05 04:56 04:54 05:01 04:48 04:59 04:51 04:51

Panyabungan Teluk Dalam Salak Limapuluh Parapat Gunung Tua Sibuhuan Lhoksukon D.Sanggul Kotapinang Aek Kanopan

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:06 06:09 06:20 06:11 06:09 06:16 06:03 06:14 06:06 06:06

Zhuhur 12:08 12:15 12:13 12:09 12:11 12:08 12:08 12:17 12:11 12:06 12:08

‘Ashar Magrib 15:25 15:31 15:31 15:27 15:28 15:25 15:24 16:36 15:29 15:23 15:25

18:12 18:19 18:15 18:11 18:13 18:11 18:11 18:18 18:14 18:09 18:10



Shubuh Syuruq

19:21 19:28 19:24 19:20 19:22 19:20 19:20 19:27 19:23 19:18 19:19

04:37 04:44 04:43 04:40 04:41 04:38 04:37 04:49 04:42 04:36 04:38

04:47 04:54 04:53 04:50 04:51 04:48 04:47 04:59 04:52 04:46 04:48

06:03 06:09 06:09 06:05 06:07 06:03 06:02 06:15 06:07 06:01 06:03

Aksi Perompakan Mengganas Polres Langkat Patroli Di Perairan P. Susu PANGKALANSUSU (Waspada): Aksi perompakan dan penyadaraan di laut yang cenderung mengganas, tentu saja meresahkan masyarakat khususnya nelayan tradisional. “Kita berharap, pelaku yang selama ini kerap melakukan aksi perompakan dan sekaligus penyanderaan terhadap para nelayan tradisional dapat segera tertangkap,” ujar Kapolres Langkat AKBP Leonardus Eric Bhismo sembari menaiki speed boat Polair menuju tengah laut.

Kapolres Langkat bersama Wakapolres Kompol Kompol Drs Safwan Khayat, Kasat Reskrim, Ptovost, Kasat Polair, serta puluhan personel anggota melaksanakan patroli laut di perairan Pangkalansusu, kemarin. Patroli laut yang menggunakan dua unit perahu motor kayu

Waspada/Riswan Rika

WALI KOTA Kota Binjai HM Idaham, SH. MSi menerima piala ICT Pura.

Binjai Peroleh Penghargaan ICT Pura BINJAI (Waspada): Wali Kota Binjai, HM. Idaham, SH, M.Si menerima penghargaan ICT Pura dari Kementerian Komunikasi dan Informasi (Kemenkominko RI). Penghargaan diserahkan, Kamis (18/10) di Hotel Grand Aston Medan oleh Dirjen Penyelenggara Pos dan Informatika, Syukri Batubara. Menurutnya, pada ICT Pura tahun ini, ada 165 kabupaten dan kota yang telah terpilih diikutsertakan. Hasilnya ada 30 daerah mendapatkan penghargaan. Untuk kategori madya, ada 9 daerah, yakni, Kota Binjai, Kab. Garut, Kota Kediri, Kota Batu, Kota Tanjungbalai, Kab. Pekalongan, Kab Sinjai, Kota Tebingtinggi dan Kota Sukabumi.Direktur Jenderal Penyelenggaraan Pos dan Informatika, Syukri Batubara menyatakan penghargaan ini merupakan gerakan yang melibatkan pemangku kepentinganTIK. Program ini merupakan kebutuhan mendesak bagi pemerintah.“Agar kita memiliki kumpulan data indikator di bidang TIK yang lengkap, termutakhir dan terukur hingga tingkat kabupaten dan kota,” kata Syukri Batubara. (a04)

Lebam Dipukuli Suami, Istri Lapor Polisi STABAT (Waspada): Sumiati, 48, warga Desa Tanjungputus Kec. Padangtualang membuat pengaduan ke Mapolres Langkat Jumat (19/10) karena sering dipukuli suaminya, PA. Keputusan mengadukan PA kepada pengayom masyarakat itu karena sudah tidak tahan terlalu sering dipukuli, bahkan saat ditanyai polisi di Ruang SPK Mapolres, korban memperlihatkan memar bekas pukulan di bagian punggungnya. Sumiati mengatakan suaminya sering memukulinya jika tidak diberi uang, sebab PA sama sekali tidak memiliki pekerjaan. Korban sehari-hari berjualan lontong sayur untuk memenuhi kebutuhan keluarga. Menindaklanjuti pengaduan, Kasubag Humas Polres Langkat Iptu J Aruan mengatakan akan memeriksa sejumlah saksi terkait. (a03)

dan satu unit speed boat ini untuk melihat secara langsung sampai sejauhmana tingkat keamanan di wilayah perairan Langkat. Sebelum menggelar patroli, Kapolres menyambangi masyarakat pesisir di Desa Pulaukampai. AKBP Leonardus Eric Bhismo menjawab Waspada terkait aksi perompakan dan penyanderaan yang dilakukan komplotan penjahat bersenjata terha-

dap nelayan tradisional asal Langkat di perairan Aceh mengatakan, pihaknya telah melakukan koordinasi dengan Polres Aceh Timur. Sejumlah nelayan berharap, Polair maupun Kamla dari TNIAL dapat memberikan rasa aman dari gangguan perompak kepada para nelayan. Mereka berharap, komplotan perompak yang kerab merampas alat tangkap serta menyandera nela-

Wabup DS Lantik 22 KUPT Disdikpora Kecamatan LUBUKPAKAM (Waspada): WabupDeliserdangH.Zainuddin Mars mengaku masalah pendidikan di Kab. Deliserdang dihadapkan dengan berbagai masalah dan tantangan yang cukup besar. Dan salah satunya adalahmasalahmutupendidikan yang secara umum masih harus didorong peningkatannya. Karena itu, secara khusus kita telah memiliki obsesi untuk menjadikan sektor pendidikan di Deliserdang mampu bangkit berdiri sejajar dengan daerah lain melalui keberadaan sekolahsekolah dan siswa-siswa yang berkualitas. Hal itu disebutkan Wabup ketika mengambil sumpah serta melantik 22 pejabat eselon IV sebagai Kepala Unit Pelaksana Teknis (KUPT) di 22 Kecamatan jajaran Disdikpora Kab. Deliserdang yang sebelumnya menjabat sebagai Kepala Cabang Dinas (KCD) Disdikpora, di Balairung Pemkab Deliserdang, Lubukpakam, Jumat (19/10). Selain itu secara bersamaan juga dilantik 22 Kasubbag Tata Usaha UPT Kecamatan serta dua KasubbagTata Usaha UPT Sanggar Kegiatan Belajar (SKB) Disdikpora Kab. Deliserdang. Hadir pada pelantikan itu Kadis Dikpora Hj. Sa’adah Lubis SPd, MAP, Sekretaris Disdikpora Drs. Jaswar MPd, Kabid Pemuda dan Olahraga Drs. H. Asli Rambe, SH, MPd, Kabid PLS Drs. H. Zul Syahrial, MPd dan sejumlah pejabat Pemkab lainnya. Kepada semua jajaran pendidikan dan berbagai pihak lainnya, diharapkan dapat terlibat dalam memajukan dunia pendidikan, diantaranya melalui peran dan fungsiparaKepalaUPTDisdikpora dan semua jajaran yang menjadi perpanjangan tangan dari tingkatkabupatendapatmemberi kontribusi tersendiri dalam membangun dan mengatasi berbagai permasalahan pendidikan kita.

Waspada/HM Husni Siregar

WABUP Deliserdang H. Zainuddin Mars, didampingi Kadis Dikpora Hj. Saadah Lubis MAP memberikan ucapan selamat kepada KUPT Kecamatan Dinas Dikpora yang baru dilantik di Balirung Pemkab. Pejabat eselon IV di lingkunganDisdikporaKab.Deliserdang yang dilantik di antaranya Sahbudin, SPd sebagai KUPT Disdikpora Kec. Labuhan Deli, Tikwan Siregar MPd (KUPT Kec. Pantai Labu), Salmiah Lubis, SE, MM (KUPT Kec Delitua), Parimpunan Siregar, SPd (KUPT Kec. Tanjungmorawa), Drs. Tohap Manalu (KUPT Kec. Gunung Meriah), Ruzlah MPd (KUPT Kec. Hamparan Perak), Frida Decori, S.Pd (KUPT Kec. Pancurbatu), Drs. H. Hamdan Lubis (KUPT Kec . Lubukpakam), Drs. Hofni (KUPT Kec. Beringin) dan Dra. Romaito Siregar sebagai KUPT Kec Batangkuis. Sedangkan Kasubbag Tata UsahapadaUnitPelaksanaTeknis (UPT) Disdikpora Kecamatan di antaranya Sukemi (KasubbagTU UPT Kec. Hamparan Perak), Bahari, SE (Kasubbag TU UPT Kec. Galang), Rosmartiana, SE (KasubbagTUUPTKec. Sunggal),Anggiat Timbul Sirait, S.Sos (Kasubbag TU UPT Kec. Labuhan Deli), Delimasni Pintu Batu, SE (Kasubbag TU UPT Kec. Percut Seituan), Drs. H. Ibnu Hajar,SPd (KasubbagTU UPT Kec. Tanjungmorawa), Nasiruddin Dalimunthe, Sag

Warga Karo Mendukung Pencalonan HT Erry Nuradi Menjadi Cagubsu TIGANDERKET (Waspada): Kunci Sembiring Pelawi, salah seorang tokoh masyarakat Karo Kec. Tiga Nderket, mengatakan, masyarakat di Kec.Tiga Nderket, Kab. Karo menyambut baik pencalonan HT.Erry Nuradi menjadi calon Gubernur Sumatera Utara (Cagubsu). “Tetapi, ada pesan kami, Pak. Jika nanti Bapak HT. Erry Nuradi berhasil memimpin Sumut, janganlah lupa lihat-lihat kami di Kab. Karo. Untuk itu kami masyarakat Karo siap membantu dan mendukungnya,” kata Kunci . Pernyataan itu disampaikannya saat Bupati Serdang

Bedagai HT. Erry Nuradi menghadiri acara Gendang Guro Guro Aron Kerja Tahun 2012 Desa Tiga Nderket yang diadakan di Pasar Tiga Nderket, Jumat (19/10) malam. HT Erry Nuradi diundang menghadiri acara ini, karena masyarakat merasa simpatik terhadap Ir. HT. Erry Nuradi MSi yang merupakan bakal calon Gubernur Sumatera Utara. Pada kesempatan itu warga memasangkan bulang-bulang dan uwis gara (kain merah) kepada Bupati Sergai HT. Erry Nuradi pertanda rasa syukur, karena kata mereka, ada suku Karo yang maju menjadi calon Gub-

Waspada/Eddi Gultom

MASYARAKAT Tiga Nderket, Kab. Karo memasangkan bulangbulang dan uwis gara pada acara kerja tahun yang diadakan di Pasar Tiga Nderket.

yan dengan modus meminta uang tebusan segera dapat ditangkap. “Kami sudah sangat rentan mengalami aksi kejahatan yang dilakukan komplotan bersenjata di perairan Aceh Tamiang dan Aceh Timur,” ujar seorang nelayan seraya menegaskan, ia siap menunjukan kepada aparat lokasi wilayah perairan yang rawan terjadi aksi prompakan jika memang dibutuhkan. (a02)

su periode 2013/2018. Bupati Serdang Bedagai Ir. HT. Erry Nuradi MSi yang dimintapanitia kerja tahun untuk menyampaikan pidatonya didampingi Ketua Karang Karuna Sumatera Utara Solahuddin Nasution mengatakan, bahwa dirinya adalah adik kandung AlmarhumLetjen(Purn)HT.Rizal Nurdin mantan Gubernur Sumut yang mendapat musibah pada tahuan 2005 di mana pesawat Mandala yang ditumpanginya jatuh pada masa itu, sehingga beberapa orang putra terbaik bangsa termasuk H. Raja Inal Siregar yang juga mantan Gubsu meninggal dunia. Selain itu Erry Nuradi juga menceritakan bahwa dia sudah tujuh tahun menjadi Bupati Sergai yang merupakan kabupaten baru di Sumut. Namun walaupun dengan dana anggaran yang sangat terbatas, tetapi Alhamdulillah selama dalam kepimpinannya sudah banyak mendapatkan perobahan. Di bidang pendidikan, katanya, Kab. Serdang Bedagai saat ini sudah menerbitkan Perda Wajib Belajar 12 tahun sehingga anak usia sekolah dari tingkat SD, SMP dan SMA tidak lagi dikenakan biaya SPP. Hal itu dilakukan agar tidak ada lagi alasan bagi anak untuk tidak bersekolah walaupun ekonomi orang tuanya tergolong lemah. Selain menerbitkan Perda Wajar 12 tahun Kab. Serdai telah

membangun sarana dan prasarana sekolah, membangun infrastrutur memberikan Jamkesda, Jamkesmas sehingga masyarakat berobat tidak lagi mengeluarkan dana tetapi gratis. Pada kesempatan itu HT. Erry Nuradi juga memuji keberhasilan pembangunan di Kab.Karo. “Pembangunan di Kabupaten Karo saat ini juga saya lihat sudah baik karena tadi ketika melintas jalannya pun mulus. Namun apa bila saya diizinkan Tuhan Yang Maha Esa menjadi Gubernur Sumatera Utara keadaan yang sudah baik ini akan lebih ditingkatkan lagi,” kata Erry. Jadi Calon Gubsu Tiga tokoh masyarakat Serdang Bedagai (Sergai), masingmasing H. Bahrum Abbas Lubis (tokoh masyarakat), Drs. H. Sabari (tokoh agama Islam) dan Pdt. Jawarman Simarmata (tokoh agama Kristen), yang ketiganya warga Kec. Sei Rampah, Kab. Serdang Bedagai, sangat mengharapkan agar Bupati Sergai HT. Erry Nuradi dapat menjadi calon Gubsu periode 2013 - 2018. Alasannya, menurut mereka, karena pimpinan muda ini sebelum dan sesudah menjadi pimpinan di kabupaten yang mempunyai moto Tanah Bertuah Negeri Beradat ini, sifatnya sangat merakyat dan peduli dengan masyarakat arus bawah. (a08)

(KasubbagTUUPTKec.Beringin), RoslelyBungamari (KasubbagTU UPT SKB Sibolangit) dan Jawamen Kasubbag TU UPT SKB Petumbukan Kec. Galang). (a06)

Waspada/Ibnu Kasir

KETUA DPD Partai Golkar Langkat H. Ngogesa Sitepu, SH kelihatan menyulangi Eswin Sukarja salah seorang unsur pengurus DPD Partai Golkar Sumut dalam acara syukuran HUT Ke 48 Partai Golkar di Gedung PWP Pertamina Pangkalanbrandan.

Ngogesa: Golkar Konsisten Berbuat Untuk Masyarakat STABAT (Waspada): Segenap kader dan simpatisan Partai Golkar hendaknya tetap konsisten dengan apa yang diperbuat semaksimal mungkin untuk kepentingan masyarakat agar diingat dan dicintai mereka. Jangan sakiti hati masyarakat yang akan membuat kita dijauhi mereka, karenanya kita semua meyakini perbuatan baik itu pasti menghasilkan yang baik. Sebaliknya bila kita berbuat tidak baik pasti hasilnya tidak baik pula. Demikian, Ketua DPD Partai Golkar Kab Langkat H Ngogesa Sitepu SH mengemukakan hal itu dalam acara Syukuran HUT Ke 48 Partai Golkar di gedung PWP Pertamina Pangkalanberandan, Sabtu (20/10). Lebih lanjut Ngogesa mengemukakan, semboyan Suara Golkar Suara Rakyat haruslah terus dihayati dengan karya nyata. Sehingga, masyarakat merasa bahwa keberadaan Partai Golkar merupakan milik mereka juga. “Seluruh kader partai diminta untuk tetap semangat

menjaga serta menjunjung tinggi cita-cita dasar kelahiran Golkar, dan mampu menerjemahkan di tengah tengah masyarakat yang dewasa ini penuh dengan perubahan dan dinamika demokrasi,” katanya. Sementara itu Eswin Sukarja dari unsur DPD Partai Golkar Sumut mengemukakan harapannya kepada seluruh Kader Golkar Langkat agar memiliki tanggung jawab dan loyalitas, sehingga memunculkan kesadaran untuk bekerja keras tanpa harus dipaksa untuk membesarkan partai. “Tanpa adanya kerja keras dari kita semua tentunya partai akan tinggal kenangan belaka,” ujarnya. Sebelumnya Sekjen DPD Partai Golkar Langkat H. Hasanudin Nano dalam laporannya mengatakan, kegiatan menyambut hari jadi partai berlambang pohon beringin untuk yang ke-48 ini, diisi dengan beberapa rangkaian kegiatan yang bertujuan untuk konsolidasi partai. (a01/a02/c01)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Hajrul Azhari Ritonga, Arianda Tanjung. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

L.Batu Juara I Lomba Kreasi Daur Ulang Bahan Bekas RANTAUPRAPAT (Waspada): SMAN 2 Kec. Rantau Selatan, Kab. Labuhanbatu meraih juara I Lomba Kreasi Daur Ulang dari Bahan Bekas se-Provsu pada Pekan Raya Lingkungan Hidup dan CSR Expo 2012 Provsu di Pendopo USU pada 5-7 Oktober lalu. Kepala Badan Lingkungan Hidup (BLH) L.Batu Romiduk Sitompul SH melalui Kepala Bidang Penyuluhan dan Kelembagaan Lydia B Purba SKM menyampaikan itu kepada Waspada, Jumat (19/10) di Rantauprapat. Lydia memaparkan, SMAN 3 Rantau Utara, juga meraih juara II Lomba Cipta Lagu Bernuansa Lingkungan, MTsN Rantauprapat juara Harapan I Lomba Puisi Lingkungan Hidup dan SD Swasta Buddies Jayanti juara II Lomba Melukis Lingkungan Hidup. Selain itu, L.Batu juga meraih juara II Lomba Stand Pameran Terbaik, padahal baru pertama kali mengikuti pameran tingkat Provsu tersebut. Stand pameran L.Batu itu hampIr 80% terdiri dari bahan bekas yang bernilai ekonomis tinggi, baik rangka maupun isi standnya. Masih di even yang sama, MIN Padang Bulan, Kec. Rantau Utara menerima penghargaan Adiwiyata dari Plt. Gubsu H Gatot Pujo Nugroho ST. Sebelumnya, L. Batu pun meraih empat prestasi dari enam kegiatan yang diperlombakan pada kegiatan Kemah Hijau Tahun 2012 pada 11 sampai 15 Juli 2012 di Bukit Kubu, Berastagi. Lydia yang menjadi koordinator kontingen L. Batu pada even tersebut, menambahkan, berbagai prestasi yang diraih L. Batu itu tidak terlepas dari dukungan Bupati dr H Tigor Panusunan Siregar SpPD yang memiliki ide-ide brilian terhadap kegiatankegiatan yang diperlombakan.Atas berbagai prestasi itu, menirukan Kaban BLH Romiduk Sitompul, Lydia mengimbau kepada seluruh sekolah agar meningkatkan prestasi di bidang lingkungan hidup secara rutin untuk mencegah kerusakan lingkungan sekaligus melestarikan lingkungan untuk masa yang akan datang. (a18)

WASPADA Senin 22 Oktober 2012

Pedagang Ikan Basah Tj.Tiram Butuh Air Bersih T.TIRAM (Waspada): Pedagang ikan basah bernaung dalam Ikatan Persaudaraan Pedagang Ikan (IPPI) Tanjungtiram Batubara mengharapkan bantuan Pemkab Batubara agar membangun sumurbor/air bersih. “Kebutuhan air bersih kalau bisa diber i pr ior itas mengingat air dipergunakan setiap hari, sekaligus menjaga kebersihan lingkungan pajak/ TPI,” sebut Ketua IPPI Tanjungtiram, Abd Rahman Atoy, Sabtu (20/10). Pihaknya sudah mengajukan proposal melalui Koperin-

dag-UKM Batubara minta bantuan sumur bor keperluan pedagang. Apalagi sumur bor lama sudah tidak berfungsi sedangkan pedagang memerlukan air untuk membersihkan meja jualan dan jalan di pasar tersebut. Dia juga mendapat informasi bahwa dalam waktu tidak

lama Pemkab Batubara akan membangun kamar pendingin untuk mengawetkan ikan basah dengan biaya APBN Otomatis. Katanya, bila sudah ada kamar pendingin, kualitas ikan terjaga tidak lagi memakai pengawet seperti tawas, boraks sampai formalin yang membahayakan kesehatan. Dan harga ikan tetap stabil menguntungkan nelayan setempat. Wak Imo, warga desa pemekaran Pahlawan/Bogak, Minggu (21/10) mengatakan sumor bor di TPI sudah rusak perlu direhabilitasi atau dibuat sumur bor baru keperluan pedagang ikan di sana. (a12)

Pengedar Narkoba Sp. Gambus Diringkus LIMAPULUH (Waspada): Seorang pengedar narkoba yang memasarkan barang dagangannya di sekitaran Desa Simpang Gambus, Kec. Limapuluh, Kab. Batubara, Minggu (21/10) sekira pukul 01.30 dinihari diringkus petugas Reskrim Polsek Limapuluh. Menurut keterangan Kapolres Asahan AKBPYustan Alpiani, melalui Kapolsek Limapuluh AKP MA Ritonga membenarkan penangkapan tersangka AR, 33, warga Dusun VI Desa Simpang Gambus, Kec. Limapuluh, dari

sebuah rumah permainan bola biliar. “Berkat laporan dari masyarakat yang melaporkannya kepada kita, selanjutnya anggota menyelidiki kebenaran informasi tersebut dan akhirnya berhasil diringkus tersangkanya, ujar Ritonga. Dari tangan tersangka disita berupa satu unit HP merek GStar, uang kontan Rp464 ribu, satu paket plastik kecil sabu yang ditemukan dari kantong celana, tiga paket plastik kecil sabu dan satu potong pipet plas-

tik di dalam kotak rokok yang terbuat dari piber. Lebih lanjut diungkapkannya, kotak rokok itu ditemukan di bawah bangku dekat tersangka bermain biliar. Saat ini tersangka diamankan di Rumah Tahanan Polisi (RTP) Polsek Limapuluh. “Atas penangkapan ini kami dari Polsek Limapuluh mengucapkan terima kasih kepada warga masyarakat yang memberi informasi dan peduli terhadap bahaya dari penyalahgunaan narkoba, terangnya. (c05)

Kakanwil Kemenagsu Diminta Tegas RANTAUPRAPAT(Waspada): Terkait adanya permintaan sekitar 20 ormas Islam agar kepala Kantor Kementerian Agama (Kakan Kemenag) Kab. Labuhan Batu H Azaman Harahap diganti dikarenakan munculnya reaksi serta fitnah kepada sejumlah calon haji beberapa tahun lalu, ketegasan Kakanwil Kementerian Agama Sumut (Kakanwil Kemenagsu ) H Abdul Rahim dipertanyakan. Ketua BKPRMI Barani Pane, ketua GPII Ahmad Zaki Nasution, H Syahrial Yusdek, H Anas Rambe kepada Waspada Kamis

(18/10) mengatakan, mereka saat ini meminta agar Kakanwil Kemenag Sumut segera mengambil sikap demi kondusifnya Kab. Labuhanbatu. Sebab, beberapa bulan yang lalu sempat terjadi demontrasi ratusan jamaah haji dan ormas Islam, bahkan telah ditangani oleh DPRD setempat. “Kita minta agar Kakanwil Kemenag Sumutdapatmenepatijanjinyayang diucapkannya saat kita beraudensi ke sana,” kata Barani dan Zaki Nasution di Rantau-prapat. Kejadian beberapa bulan yang lalu yang sempat menim-

bulkan perhatian masyarakat dan dikhawatirkan akan terulangkembali, bahkan dengan massa serta permasalahan yang lebih besar. “Mari sama-sama kita saling menghargai dan menepati janji kita khawatir akan ada gelombang massa yang lebih besar lagi,” tambah beberapa ketua ormas. Sebelumnya, 9 Juli lalu, perwakilan dari 20 ormas Islam Kab, Labuhanbatu beraudensi kepada Kakanwil Kemenag Sumut H Abdul Rahim dalam rangka meminta agar mencopot jabatan Kakan Kemenag Labuhanbatu. (c07 )

Warga Kecewa Pengerjaan Drainase Asal-asalan TALAWI, Batubara (Waspada): Pekerjaan drainase/riol di sisi Jl. H. Maulana, Kampung Kodah, Kelurahan Labuhan Ruku, Kec Talawi, Kab Batubara dinilai masyarakat asal-asalan. Di samping tumpukan material berupa batu koral maupun pasir keperluan pembangunan memakan badan jalan, sehingga menjadi sempit, ruas jalan juga rusak akibat dilindas truk membawa material bangunan. ‘’Lihat itu, badan jalan rusak dan retak akibat di lintasi truk muatan material bangunan keperluan proyek,’’ tukas beberapa warga setempat kepada Waspada, Minggu (21/10) sambil menunjukan kondisi jalan yang rusak. Pembangunan drainase/ riol saat ini dalam tahap pekerjaan kontraktor CV BJ bersumber dari APBD Tahun 2011 senilai Rp383 juta lebih. Pemakai jalan perlu hatihati saat melintas, terutama bagi pengendara sepeda motor, karena bahan bangunan keperluan proyek siap mengancam bahaya. Mereka menyesalkan pekerjaan drainase dinilai asalasalan. Begitu juga dalam pekerjaan diduga tidak menggu-

Waspada/Rahmad F Siregar

PEMIMPIN BRI Cabang Tanjungbalai Berliana M Panjaitan dan staf berfoto bersama dengan nasabah pemenang undian hadiah utama mobil Grand Max minibus dalam Pesta Rakyat Simpedes di lapangan Sultan Abdul Jalil Rahmadsyah.

Nasabah Unit Veteran Raih Mobil Pesta Rakyat Simpedes TANJUNGBALAI (Waspada): Nasabah Bank Rakyat Indonesia (BRI) Cabang Tanjungbalai, Unit Kerja Veteran, Abner Togatorop memenangi undian hadiah utama mobil Grand Max minibus dalam Pesta Rakyat Simpedes di lapangan Sultan Abdul Jalil Rahmadsyah. Pengundian dilakukan dengan disaksikan ratusan masyarakat, perwakilan nasabah BRI, petugas berwenang dan Wali Kota Tanjungbalai Thamrin Munthe serta Ketua TP-PKK Tanjungbalai Dra. Hj. Armaini Jannah, Sabtu (20/10). Sementara, untuk hadiah utama II berupa sepedamotor Byson, juga diraih nasabah BRI unit kerja Veteran, Helpandrianis. Kemudian, hadiah utama III berupa enam unit sepedamotor Mio diraih nasabah unit Pulo Rakyat Chairul Amri Pasaribu, unit Teluknibung Hasbullah, unit Simpangempat Ramlan MR, unit Aektarum Surya Romadhon Syah, unit Airbatu Romanni dan unit Tanjungleidong Zuraidah Zein. Pemimpin BRI Cabang Tanjungbalai, Berliana M Panjaitan mengatakan, Pesta Rakyat Simpedes diselenggarakan rutin tiap satu semester. Acara itu, menurut Berliana, merupaka wujud apresiasi dan terima kasih BRI kepada masyarakat yang selama ini telah menjadi nasabah setia tabungan Simpedes sehingga melegenda di kalangan masyarakat, khususnya pedesaan. Selain itu, Berliana berharap, kegiatan itu menjadi sarana komunikasi pemasaran untuk memperkuat dan mempertahankan brand dan positioning Simpedes yang meliputi akuisisi, meningkatkan loyalitas nasabah serta memperluas jangkauan pasar Simpedes, menjawab tantangan persaingan dan menegaskan BRI sebagai market leader di sektor mikro. “Kemeriahan yang kami selenggarakan dalam Pesta Rakyat Simpedes ini semoga mempererat tali hubungan silaturahmi antara BRI dengan para nasabah, khususnya penabung di wilayah kerja BRI Tanjungbalai yang akhirnya dapat menumbuhkan minat menabung dari masyarakat,” kata Berliana. Tumbuh Pesat Pada kesempatan itu, Berliana mengucapkan terima kasih kepada seluruh nasabah, khususnya nasabah Simpedes yang tepat memberikan kepercayaan kepada BRI untuk menyimpankandananyadalambentuktabungan. Menurutnya, di wilayah kerja BRI Cabang Tanjungbalai, tabungan Simpedes tumbuh pesar dari posisi Desember 2010 sebesar Rp159,7 miliar menjadi Rp201.042.556.679 pada posisi Desember 2011, dan melonjak lagi di

posisi September 2012 menjadi Rp204.650.128.061 atau naik sekitar 1,8 persen dari posisi tahun sebelumnya. Selain itu, lanjut Berliana, BRI juga menyalurkan kredit ke masyarakat untuk mensukseskan program pemerintah, baik Kredit Usaha Rakyat maupunKreditprogramlainnya.Untukpinjaman, danayangdisalurkanpadaDesember2010mencapaiRp278.313.474.591,Desember2011Rp300.541.937.683 dan September 2012 Rp326.933.722.130 atau terjadi kenaikan sebesar 8,78 persen. Sementara untuk KUR, pada Desember 2010 Rp21.011.418.529, Desember 2011 Rp42.312.446.684 dan September 2012 Rp51.477.189.322 atau naik 21,66 persen. Untuk pinjaman komersial, pada Desember 2010 Rp239.754.669.179, dan Desember 2011 Rp235.108.614.847 serta September 2012 Rp254.916.549.874 atau naik 4,6 persen. Kemudian, pinjaman pensiunan (Golbertab) pada Desember 2010 Rp17.547.386.883, dan Desember 2011 Rp23.120.876.152 serta September 2012 Rp29.540.032.934 atau naik 27,76 persen. Berliana menambahkan, hingga saat ini kantor Cabang BRI Tanjungbalai memiliki 11 kantor unit dan 3 kantor teras serta 1 unti mobil teras keliling. Kemudian, 15 ATM yang tersebar di 10 unit kerja di kantor Cabang Tanjungbalai. “Ini semua tujuannya untuk memudahkan para nasabah BRI bertransaksi Real Time Online yang tersebardiperkotaandanpedesaan,”kataBerliana. Sementara,Wali Kota Tanjungbalai Thamrin Munthe, memberikan apresiasi tinggi kepada BRI atas meningkatnya jumlah simpanan di bank konvensional itu. Menurut peraih gelar Doktor di IAIN Sumut itu, kepercayaan masyarakat terhadap BRI kian tinggi. “Masyarakat semakin percaya dengan BRI, buktinya jumlah simpanan meningkat. Kepercayaan ini harus tetap dijaga, dan BRI harus terus semakin terasa keberadaannya bagi masyarakat Kota Tanjungbalai, terutama dalam penyaluran CSR,” kata Thamrin Munthe. Dikatakan Thamrin, bank tersebut akan tetap eksis dengan menjaga dan meningkatkan pelayanannya kepada nasabah. Pada kesempatan itu, Thamrin juga mengajak BRI Cabang Tanjungbalai untuk berpartisipasi dalam program Pemko Tanjungbalai yang hendak mewujudkan kota wisata dengan membuka akses dari pelabuhan Teluknibung. “Program ini merupakan salah satu upaya meningkatkan pendapatan masyarakat. Dan, kami yakin BRI akan ambil bagian dalam program ini,” kata Thamrin Munthe. (a14)

Pansus DPRD Labusel LPjP APBD 2011 Tidak Berujung

Waspada/Iwan Has

BANGUNAN drainase/riol di Jalan H Maulana, Kampung Kodah, Kelurahan Labuhanruku, Kec Talawi, Kab. Batubara dinilai warga dikerjakan asal-asalan. nakan cerocok. Sedangkan pekerja hanya menggunakan bambu sebagai penopang bangunan agar tidak ambruk semasa dalam pekerjaan. Proyek tersebut, kata warga, sempat terhenti, dan diha-

rapkan pihak rekanan dapat menjaga mutu dan kualitas bangunan, sebab Jl. H Maulana, Kampung Kodah bakal dikembangkan dengan membangun jalan lingkar menuju termina. (a13)

KOTAPINANG (Waspada): Rapat paripurna penyampaian hasil Panitia Khusus (Pansus) DPRD Labusel untuk LPjP APBD 2011 Pemkab Labusel yang digelar di gedung DPRD, Jumat (19/10) diwarnai unjuk rasa. Karena tidak ada kata sepakat, paripurna diskor sampai batas waktu tidak ditentukan. Aksi tunggal yang dilakukan seorang warga, Rijal Sembiring itu dalam orasinya mengatakan, DPRD harus jeli membahas LPjP APBD 2011. Menurut Rijal, banyaknya temuan BPK dalam LHP LKPD 2011 menunjukkan bahwa LPjP APBD 2011 yang diajukan Pemkab harus dibahas tuntas. Sementara pada paripurna yang dipimpin Wakil Ketua DPRD Zainal Harahap yang dihadiri Wakil Bupati Maslin Pulungan, anggota dewan, SKPD, dan unsur Muspika itu Pansus dalam laporannya yang dibacakan Simon Silalahi menyatakan, Pansus tidak dapat bekerja maksimal karena tidak kooperatifnya SKPD. Menurutnya, seluruh SKPD yang diundang Pansus, tidak membawa dokumen pendukung seperti DPPA. Dijelaskan, alasan SKPD di antaranya, dokumen tidak dibawa, tidak dibenarkan dibawa, dan bendaharanya tidak di tempat. “Karenanya Pansus meminta kepada pimpinan DPRD agar diberikan pertambahan waktu

pembahasan LPjP APBD 2011, jawaban kepala daerah atas pemandangan umum fraksi agar dikembalikan karena belum ditandatangani pejabat terkait, dan seharusnya pejabat terkait mendampingi Pansus dalam pembahasan agar tidak ada kekeliruan dalam pembahasannya,” katanya. Paripurna sempat tertunda tiga jam setelah diskor pada pukul 12.00 Wib. Semula paripurna dijadwalkan kembali pukul 14.00 Wib namun Pemkab baru tiba di DPRD pukul 16.30 Wib dan paripurna dibuka kembali pukul 17.00Wib. Pada kesempatan itu, Wakil Bupati Maslin Pulungan meminta kepada DPRD agar paripurna diskor hingga, Kamis (25/10). “Waktu empat hari kerja itu akan digunakan untuk berkonsultasi mengenai harapan DPRD terkait pembahasan ini,” katanya. Sementara itu, Ketua Pansus Hari Maryono meminta pertambahan waktu 15 hari untuk membahas LPjP APBD 2011. Namun permintaan Pemkab dan Pansus itu dikritisi oleh sejumlah anggota DPRD lainnya. Karena tidak ada kesimpulan, Wakil Ketua DPRD Zainal Harahap memutuskan menskor paripurna itu hingga batas waktu yang tidak ditentukan. “Yang jelas masyarakat tahu apa yang sebenarnya terjadi,” kata Zainal yang ditemui usai paripurna. (c18)

Mengenang Labuhanruku, Pusat Pendidikan Masa Lalu LABUHANRUKU,Batubara (Waspada): Bagi generasi penerus bergelut di bidang pendidikan di Kab. Batubara mungkin tidak mengetahui bahwa ‘Labuhanruku’ bekas ibukota Kewedanaan Batubara sebagai pusat pendidikan masa lalu. Mengapa disebut ‘pusat pendidikan’ masa lalu? Menurut sumber layak dipercaya bahwa di kota bekas kekuasaan Kontreleur Belanda itu digodok tenaga guru untuk diterjunkan ke pelosok desa memberikan pengajaran/pendidikan. Waktu itu, tiga tahun setelah diproklamirkan Kemerdekaan RI tepatnya pada 1948 kekuasaan pemerintahan kewedanaan Batubara dipimpinseorangputraLabuhanruku menjadi ‘wedana’ yaitu almarhum H. Usman Ys. Sebagai putra daerah almarhum H. Usman Ys beberapa tahun menjadi Bupati Asahan berkantor di Tanjungbalai itu

bersama beberapa tokoh masyarakat Batubara (Tanjungtiram, Talawi, Limapuluh, Airputih, Medangderas) sepakat mendirikan gedung sekolah di Labuhanruku. “Mengandalkan semangat gotongroyong masyarakat Batubara dengan mengumpul botol, kertas dan uang ‘seketip’ (10 sen) waktu itu setiap Senin selama tiga tahun bangunan sekolah berhasil didirikan” tambah sumber kepada Waspada, Minggu pekan lalu. Waktu itu gedung sekolah yang siap dibangun diberi merk ‘SMP Bahara’ tahun 1950. Kenyataan gedung dipergunakan menggodok tenaga guru tahun 1950 - 19 53 disebut Kursus Pengantar Kursus Pengajar Kewajiban Belajar (KPKPKB). Kemudian pemerintah menjadikan Sekolah Guru B (SGB) tahun 1954 - 1960. Pada saat itu pemuda yang tamat SR ditam-

pung di SGB dididik selama 4 tahun, bisa juga dilanjutkan ke tingkat SGA di Tanjungbalai tiga tahun. Disaat itu kota Labuhanruku menjadi ramai ratusan calon guru berdatangan dari Pagurawan, Indrapura, Simpangdolok, Perupuk, Tanjungtiram, Sei Balai, Tinjowan menempa ilmu pendidikan, didaktik metodik, ilmu jiwa sampai mata pelajaran ilmu ukur, aljabar, sejarah, geografi, seni suara, menggambar dan olahraga. “Walaupun hanya 4 tahun di SGB ternyata tenaga guru SD ini cukup trampil, piawai mendidik muridnya, disiplin dan berwibawa,” ujar sumber, mereka tak sempat mengenyam enaknya dana sertifikasi seperti dirasakan para guru zaman ini. Yang jelas bahwa guru tamatan SGB ini semuanya sudah banyak meninggal dan pensiunan meninggalkan kader-kader,

pendekar bidang pendidikan menempati posisi tertentu ditingkat SD/SMP/SLTA sampai ke Perguruan Tinggi (PT) dan banyak lagi yang tak dapat disebut satu persatu. Tepatnya tahun 1958 di gedung sekolah yang sama mulai dibuka ruang belajar murid SMP Negeri I Labuhanruku terus berlanjut sampai sekarang menjadi SMP Negeri I Talawi. Mengenang semangat juang tanpa pamrih putra daerah pendahulu yang giat memajukan pendidikan menjadi catatan sejarah di Batubara bahwa Labuhanruku sebagai pioner menjadi pusat pendidikan masa lalu Karena itu pula masyarakat Labuhanruku mengharapkan Pemkab Batubara di bawah kepemimpinan Bupati Batubara H. OK Arya Zulkarnain, SH, MM dapat membangkitkan ‘batang terendam’ 62 tahun silam

Waspada/Helmy Has

BANGUNAN peninggalan gedung SMP Bahara tahun 1950 ‘saksi bisu’ Labuhanruku sebagai pusat pendidikan masa lalu di Batubara. dikembalikan Labuhanruku menjadi pusat pendidikan masa kini dengan mendirikan sebuah

Perguruan Tinggi (PT) Universitas Batubara. Insya Allah ...... terkabul. (Helmy Has)

Sumatera Utara Jalinsum Di Sosa Terputus



Senin 22 Oktober 2012

Ratusan Kendaraan Terjebak Macet SOSA (Waspada): Jalan Lintas Sumatera (Jalinsum) terputus, tepatnya di Desa Siborna Bunut, Kec. Sosa, Kab. Padanglawas (Palas), Sabtu (20/10) pagi, sehingga ratusan kendaraan terjebat macet, baik yang menuju Pekanbaru, Riau maupun menuju Medan.

Tuntaskan Persoalan PT. DIS Dengan Warga PANYABUNGAN (Waspada): Tim Pembina Pembangunan Perkebunan Kabupaten (TP3K) Pemkab Mandailing Natal, diminta turun tangan melakukan identifikasi lahan, sehingga terlihat jelas kebun plasma yang diperuntukkan bagi masyarakat. “Adanya pengaduan pengurus empat koperasi yang tergabung dalam PT. DIS (Dinamika Inti Sentosa) bergerak di bidang perkebunan kepala sawit ke DPRD Madina sangat tepat, karena akan memperjelas status keempat koperasi terhadap kebun plasma itu,” ujar anggota Komisi II DPRD Madina Ir.Ali Mutiara Rangkuti di Panyabungan, baru-baru ini. Menurutnya, apa yang dituntut pengurus koperasi untuk perpanjangan izin sangat bangus, karena akan memperjelas status kebun plasma yang sangat diinginkan warga demi peningkatan taraf hidupnya. “Saya yakin Bupati Madina Hidayat Batubara sangat mengapresiasi PT.DIS yang bermitra dengan masyarakat tergabung dalam empat koperasi itu. Sebab, kondisi ini akan meningkatkan perekonomian masyarakat, hanya saja, ada persoalan tumpang tindih lahan yang belum selesai. Jika ini selesai, saya yakin bupati akan merekomendasikannya,” terangnya. (a28)

Pemkab Ajak Pers Majukan Madina PANYABUNGAN (Waspada): Pemerintah Kabupaten Mandailing Natal mengajak wartawan untuk dapat berperan sebagai investigatif yang membantu pemerintah, mendorong kemajuan pembangunan melalui usul dan ide-ide kreatif yang bersifat meransang semua pemangku kepentingan bahu-membahu memajukan daerah. “Peran pers sangat dibutuhkan dalam upaya percepatan pembangunan Madina. Mari memberi masukan positif dan informasi yang akurat mengenai program pembangunan akan dijalankan, termasuk kritikan atas semua program telah dilaksanakan oleh pemerintah,” ujar Wakil Bupati Madina Dahlan Hasan Nasution di Panyabungan, Kamis (18/10). Ia menjelaskan, fungsi pers sebagai sosial kontrol sangat penting demi pekerjaan pembangunan daerah agar berjalan baik. Media sangat penting dalam sebuah pemerintahan dan Pemkab Madina memberikan apresiasi sekaligus mengharapkan dukungan pers untuk mensosialisasikan peran pemerintah untuk pembangunan daerah. “Masih banyak pekerjaan rumah yang mesti diselesaikan untuk membangun Madina yang lebih maju, berkeadilan dan bermartabat, karenanya wartawan diharapkan dapat selalu responsif dalam mengakomodir kebutuhan masyarakat, sehingga pembangunan dilakukan benar-benar dapat menyentuh langsung ke akar permasalahan, “ ujarnya. (a28)

PKS Palas Motivasi Kader Melalui Konsolidasi Partai SIBUHUAN (Waspada); Dewan Pimpinan Daerah (DPD) Partai Keadilan Sejahtera (PKS) Kab. Padanglawas (Palas) memotivasi kader melalui konsolidasi partai, untuk melahirkan kader partai militan dan siap memperjuangkan kepentingan rakyat. Demikian KetuaDPDPKSKab.PalasH.PuliParisanLubis,Lcdidampingisekretaris H. Ali Juman Lubis, Lc, kepada Waspada, Sabtu (20/10). H.Puli Parisan Lubis, LC mengatakan, untuk memotivasi kader PKS, DPD PKS Kab Palas melaksanakan konsolidasi partai diikuti 11 Dewan Pimpinan Cabang (DPC), termasuk dari Kec. Barumun, Ulu Barumun, Lubuk Barumun, Sosopan, Sosa, Hutaraja Tinggi, Batang Lubu Sutam, Aeknabara Barumun, Barumun Tengah, Huristak dan Kec. Sihapas Barumun. Sekaligus persiapan untuk mendukung calon Gubernur Sumatera Utara periode 2013-2018 berasal dari partai PKS, dengan harapan akan mendapat dukungan dari masyarakat, sehingga tetap dipercaya memimpin Sumatera Utara lima tahun ke depan. Ustad H. Ei Hasan Nasution, Lc, anggota dakwah wilayahVI Provinsi Sumatera Utara mengungkapkan, PKS sebagai partai dakwah siap melayani dan memperjuangkan kepentingan rakyat. (a33)

Polres Tapsel-TNI Gelar Pengobatan Gratis Katarak P.SIDIMPUAN (Waspada): Polres Tapanuli selatan (Tapsel) bersama TNI-AD menggelar pengobatan gratis operasi katarak kepada warga Tapanuli, Labuhanbatu di Rumah Sakit (RS) TNI Losung Batu, Padangsidimpuan, Sabtu (20/10). KapolresTapselAKBPSubandriyaMHbersamaKetuaBhayangkari DianingKusumastutySubandriya,KepalaRumahsakitTNI-ADLosung Batu Mayor CKM dr Adri Pasmawi dan romobongan Kodam menuturkan kepada wartawan, kegiatan pengobatan gratis katarak mata sebagai aksi sosial kedua instansi itu.‘’Ini sebagai gerakan sosial yang sifatnya kepedulian terhadap masyarakat dalam rangka HUT ke-60 TNI dan HUT ke-67 Bhayang-kara. Tahap awal dilaksanakan pemeriksaan kepada warga,” ujar Kapolres Tapsel. Saat ini, lanjut Kapolres, dalam tahap pemeriksaan kepada warga yang datang dari berbagai daerah di Sumatera Utara, antara lain warga dari wilayah Tabagsel yaitu Kab. Mandailing Natal, Padanglawas, Padangsidimpuan, Padanglawas Utara, Labuhan-batu, Labusel, Labura sekitarnya, Sibolga, Tarutung, Tapanuli Tengah. Kapolres mengungkapkan, pengobatan katarak mata ditangani dokter khusus didatangkan dari Nepal, dokter kepolisian dan dokter dari TNI-AD.’’Pengobatan gratis sudah dua kali digelar TNI-AD di Rumah sakit ini, sedangkan kerjasama Polres Tapsel dengan TNI-AD baru kali in. Masyarakat kita yang mengidap penyakit katarak agar segera berobat ke RS TNI ini,’’ujar Kapolres. (c13)

Informasi dihimpun Waspada di lapangan, terputusnya jalan yang menimbulkan kemacetan itu mulai Sabtu (20/ 10) pagi sekira pukul 09.00 sulit dilalui, bahkan untuk kendaraan yang bermuatan tidak bisa melintas. Dikatakan warga, sejak satu bulan belakangan, kerusakan jalan itu semakin parah, sekalipun belakangan ini telah dilakukan penimbunan oleh masyarakat sekitar bekerjasama dengan pihak perusahaan perkebunan yang ada di daerah itu, termasuk PT Mazuma Agro Indonesia (PT MAI). Tetapi, banyaknya kendaraan yang melintasi jalan lintas itu,

baik kendaraan pribadi, bus, dan truk angkutan yang bermuatan berat, lama-kelamaan jalan amblas tidak mampu menahan beban kendaraan yang melintas, apalagi saat truk bermuatan berat tidak sedikit yang melewati jalan tersebut. Kata warga, jalan yang rusak parah itu baru satu tahun yang lalu diperbaiki oleh pemerintah, informasinya dari Dinas Bina Marga Provinsi Sumatera Utara, tetapaikini sudah amblas tidak bisa dilalui. “Mungkin pengerjaannya kurang baik, tidak sesuai dengan standar yang diharapkan, sehingga tidak mampu bertahan lama,” ujar warga.

Syahrul Hasibuan bersama H. Oloan Hasibuan, anggota DPRD Kab. Padanglawas kepada Waspada menyampaikan agar kondisi jalinsum di wilayah Padanglawas segera diperbaiki demi kelancaran arus transpotasi. Untuk itu sangat diharapkan perhatian Pemprovsu Sementara Kanit Lantas Polsek Sosa, Aipda M.H Siregar bekerjasama dengan masyarakat setempat dan personil polantas dari Polsek Barumun membantu para pengguna jalan, sekaligus melaksanakan perbaikan dengan menimbun badan jalan. Pada pukul 12:00, kemacetan berhasil diatasi. (a33)

Tapal Batas Madina-Tapsel Bisa Menjadi ‘Bom Waktu’ PANYABUNGAN (Waspada): Untuk mengantisipasi kemungkinan terjadinya halhal yang tidak diingini, Plt Gubsu Gatot Pujo Nugroho dituntut sigap dan tanggap menuntaskan sengketa tapal batas Kab. Mandailing Natal (Madina) dan Kab. Tapanuli Selatan (Tapsel) khususnya yang meliputi wilayah Kec. Siabu dan Kec. Tano Tombangan. “Permasalahan tapal batas kedua kabupaten jangan dibiarkan berlarut-larut, karena dikhawatirkan akan menjadi ‘bom waktu’ dan membuat kemelut berkepanjangan di tengah masyarakat kedua daerah,” ujar Ketua Komisi I DPRD Madina Iskandar Hasibuan menjawab Waspada di Panyabungan, Minggu (21/10). Ditegaskan, persoalan tapal batas kedua daerah harus ada kepastian dari pemerintah. Disarankan Iskandar Hasibuan agar Plt Gubsu Gatot Pujo NugrohobersamaBupatiMadinaHM Hidayat Batubara SE dan Bupati TapselH.SyahrulMPasaribuserta seluruh elemen terkait segera duduk bersama untuk menyelesaikan tapal batas itu. Dia mengingatkan, agar persoalan tapal batas ini tidak dibiarkan semakin berlarutlarut. Karena, jika tidak segera dituntaskan, sangat berpotensi memicu hal tidak diinginkan antara warga yang bersentuhan langsung dengan tapal batas. Politisi PDI-P ini mengungkapkan, sebenarnya ada dua lokasi yang menjadi persoalan tentang tapal batas antara Madina dan Tapsel, yakni di Kec. Si-

abu tepatnya di Desa Bonandolok dan Kel. Simangambat. Kemudian, di wilayah Kec. Muara Batang Gadis meliputi Desa Singkauang I dan Batu Mundom. “Untuk meminimalisir kemungkinan terjadinya halhal tidak diingini di antara warga yang bersentuhan langsung dengan tapal batas tersebut, perlu adanya ketegasan dari pemerintah menuntaskan tapal batas tersebut dengan tetap berpedoman kepada kesepakatan dan tanda-tanda yang ada ,” ujar politisi PDI Perjuangan itu. Iskandar mengatakan, sejak 2007, Pemkab Madina dan Tapsel dengan difasilitasi Pemprovsu sudah bertemu untuk menyelesaikan tapal batas itu, terutama berada di Kec. Siabu dan Muara Batang Gadis. Dalam pertemuan itu ada beberapa point yang telah disepakati dan harus dilaksanakan kedua Pemkab termasuk membentuk tim penyelesaian batas daerah ( PBD ) kabupaten. Dalam pertemuan itu juga disepakati bahwa tidak ada pembukaan lahan baru atau perusakan baru pada lokasi yang tidak jelas batasnya dan belum disepakati kedua kabupaten.“Tapi amat disayangkan, pertemuan itu tidak pernah lagi ditindaklanjuti sehingga membuat komplik di antara warga,” ung-kapnya. Selain itu terangnya, dua kelompok Muspika masing-masing dari Kecamatan Siabu Madina dan Tano Tombangan Tapsel, sudah pernah menggelar rapat membahas tapal batas kedua kabupaten di aula kantor camat Siabu pada pertengahan

Juli 2012 lalu. Pertemuan juga dihadiri kepada desa dan sejumlah tokoh masyarakat dari desa-desa bersentuhan langsung dengan tapal batas. Tidak terkecuali, unsur terkait dari kedua Pemkab dan kuria Panyabungan Tonga. Dalam pertemuan itu kedua belah pihak telah sepakat bahwa tapal batas mengacu kepada ketentuan telah ditetapkan Residen Tapanuli pada 1929 hingga 1931. Kemudian disepakati peninjauan langsung ke lokasi sekaligus membuat pilar, karena pada tahun 19291931 Residen Tapanuli telah membuat delapan pilar sebagai penanda tapal batas kedua daerah ,” ujarnya. “Batas yang dibuat oleh Residen pada waktu itu sudah berkekuatan hukum karena sudah dileges oleh Kejaksaan Tinggi, sehingga tidak ada pemasalahan di antara kedua kabupaten yang dulunya adalah satu ini, begitu juga dengan masyarakat yang besentuhan langsung,” tambahnya. Sementara Bupati Madina yangdikomfirmasimelaluiKabag Tata Pemerintahan Ha-san Basri terkaittapalbatasinimengatakan, tindaklanjutnyapenyelesaiannya hanya tinggal penandatanganan MoU antara Bupati Madina dan Bupati Tapsel. “Tapal batas Madina-Tapsel sekarang ini hanya menunggu tanda tangan dari Bupati Madina Hidayat Batubara di dalam MoU yang sudah ada. Kalau Bupati Tapsel H. Syahrul M Pasaribusudahmenandatangani, tinggal Bupati Madina saja,” paparnya. (a28)

Wali Kota Sibolga Ajak Warga Hidup Bersih Dan Sehat SIBOLGA (Waspada): Wali Kota Sibolga Drs HM Syarfi Hutauruk mengajak masyarakat berperilaku hidup bersih dan sehat dengan membudayakan membuang sampah pada tempatnya, sehingga Kota Sibolga tidak kotor dan warga yang tinggal di sekitarnya menjadi nyaman, aman dan indah. Demikian dikatakan Wali Kota Sibolga Drs. HM Syarfi Hutauruk, Jumat (19/10) di depan Masjid Agung Kota Sibolga saat

menerima dari PT Askes Cabang Sibolga, BI,BNI, Bank Syariah Sumut Cabang Sibolga, Bank Sumut Cabang Sibolga, para Camat se-Kota Sibolga dan lainnya sehingga terjumlah 522 buah tong sampah yang akan disebar di setiap kelurahan. Selain itu, kata wali kota, Pemko Sibolga sedang menggalakkan penanaman pohon di setiap inti kota untuk dilakukan penghijauan agar menjadi lingkungan yang sehat dimana

Waspada/Alam Tanjung

KEPALA PT Askes Cabang Sibolga dr. Kiki Cristmar Marbun bersama pimpinan perbankan Sibolga saat menyerahkan bantuan secara simbolis tong sampah kepada Wali kota Sibolga Drs. HM Syarfi Hutauruk.

tanaman pohon merupakan paru-parunya Kota dalam mengantisipasi pemanasan global. Turut hadir Wakil Walikota Sibolga Marudut Situmorang, ketua tim PKK Ny. Delmeria Harun Syarfi Hutauruk, ketua DPRD Syahlul U.Situmeang para SKPD, pimpinan perbankan, kepala PT Askes Cabang Sibolga dr. Kiki Cristmar Marbun, para Camat dan Lurah se-Kota Sibolga. Kepala PT (Persero) Askes Cabang Sibolga dr. Kiki Cristmar Marbun menyerahkan 100 buah tong sampah yang diterima langsung oleh Wali Kota Sibolga untuk disebar di setiap inti Kota Sibolga. Dr. Kiki Critsmar Marbun mengatakan, PT Askes sebagai BUMN punya program bina lingkungan salah satu tanggungjawab sosial kepada masyarakat, termasuk bantuanbantuan rumah ibadah yang semuanya terkonsentrasidipusatdivisiregional I. “Kita berterimakasih kepada Pemko Sibolga telah menjalin kerjasama yang baik dalam mendukung program-program PT Askes Cabang Sibolga khususnya tentang pelayanan bagi peserta Askes dan kedepan akan lebihditingkatkan,jelasKiki. (a24)

Pilkada P. Sidimpuan, Daganaki Juo Do Nabotul, Bah! USAI sudah pemungutan suara Pilkada Kota Padangsidimpuan dilaksanakan, Kamis (18/10). Berbagai lembaga yang melakukan quick count, real count, dan bahkan data yang masuk ke Tim Desk Pilkada Kota Padangsidimpuan, menempatkan pasangan calon nomor tiga, Andar Amin Harahap SSTP. MSiMuhammad Isnandar Nasution S.Sos, sebagai pemenangnya. Pasangan birokrat-politisi ini diperkirakan meraih 46,4 persen dari total suara sah. Menyusul kemudian pasangan calon nomor empat, Dedi Jaminsyah Putra Harahap SSTP.MSP-H. Affan Siregar SE, dengan raihan 36,8 persen. Setelah itu pasangan calon nomor dua, Rusydi Nasution SST.MM-Ir. Riswan Daulay MM dengan raihan 8,4 persen. Memang, Komisi Pemilihan Umum (KPU) belum menetap-

kan pemenangnya, karena tahapan untuk itu masih akan dilakukan Kamis (25/10). Tapi biasanya penetapan KPU itu tidak jauh melenceng dari hasil quick count, real count, dan data Tim Desk Pilkada. Berbicara mengenai calon wali kota peraih suara terbanyak pertama (Andar), kedua (Dedi), dan ketiga (Rusydi). Mungkin masyarakat Padangsidimpuan masih ingat bagaimana isu, dan tudingan, yang menyebut ketiganya terlalu muda dan belum pantas memimpin kota ini. Hal ini karena Andar Amin Harahap, alumni Sekolah Tinggi Pendidikan Dalam Negeri (STPDN) masih berusia 30 tahun. Kemudian Dedi Jaminsyah Putra Harahap, yang juga teman seangkatan Andar di STPDN, masih berusia 31 tahun. Sedangkan Rusydi Nasution, kini menjabat Vice President Bank

CIMB Niaga Indonesia, ketika mendaftar ke KPU masih berusia 39 tahun. Sementara calon No.1, Mohammad Habib NasutionSoripada Harahap (1 persen), No.5, Amir Mirza HutagalungNurwin Nasution (0,5 persen), No.6, Chaidir Ritonga-Mara Gunung Harahap (6,0 persen), baik calon wali kota maupun calon wakil wali kotanya sudah mendekati dan melebihi usia 50 tahun. Di berbagai kesempatan atau pertemuan bersama masyarakat, para tim sukses maupun calon yang lebih tua sering mengatakan bahwa pemimpin ideal kota ini harus berusia di atas 40 tahun. Biasanya, pada ujung kalimat selalu ada penegasan yang mengingatkan bahwa Nabi Muhammad diangkat menjadi Rasulullah pada usia 40 tahun. “Ulang pili hamu daganak”

(jangan pilih anak-anak). “Ra de hamu koum dipimpin daganak?” (apakah saudara mau dipimpin anak-anak? ). “Pilih pemimpin berpengalaman dan matang, bukan anak-anak”. Kalimat seperti ini sangat sering terdengar di saat Pilkada kemarin. Bahkan pada hari pencoblosan, tersebar spanduk di inti kota dengan tulisan ‘Jangan pilih calon pemimpin remot, karena wali kota itu bukan TV yang perlu diremot’. Namun tampaknya strategi isu mengenai usia ini tidak berpengaruh banyak. Terbukti, Andar sebagai calon wali kota paling muda di antara enam calon, bisa meraih suara terbanyak. Kemudian Dedi yang lebih tua setahun dari Andar meraih suara terbanyak kedua, dan Rusydi yang lebih tua sembilan tahun dari Andar berada di posisi ketiga raihan suara ter-

banyak. Terlepas dari apa strategi ketiga anak muda ini untuk mementahkan dan melakukan serangan balik atas isu mengenai usia itu. Namun yang jelas peraih suara terbanyak pertama, kedua, dan ketiga, di Pilkada ini sudah seperti diurutkan mulai dari usia yang paling muda, Andar (30), Dedi (31), dan Rusydi (39). “Daganaki juo do nabotul bah ! (anak-anak itu juga yang betul !). Buktinya mereka yang meraih suara terbanyak. Kita tidak membahas bagaimana strategi mereka di Pilkada, namun terbukti kebanyakan rakyat kota ini justru memilih mereka yang masih muda-muda,” kata Tanuwir Hutabarat dan Mawardi Hasibuan, warga Pijorkoling, Kec. Sidimpuan Tenggara. Sukri Falah Harahap

Waspada/Idaham Butarbutar

RATUSAN kendaraan terjebak macet akibat jalan terputus di Desa Siborna Bunut, Kec. Sosa, Kab. Padanglawas.

Mahasiswa Tuding Perencanaan Proyek Dinas PU Palas Asal Jadi SIBUHUAN (Waspada): Mahasiswa tergabung dalam Gerakan Aliansi Mahasiswa (GAM) Kabupaten Padanglawas (Palas) mensinyalir, perencanaan proyek di Dinas Pekerjaan Umum (PU) dan Pertambangan Energi (Pertamben) Kabupaten Padanglawas asal jadi. Demikian disampaikan mahasiswa tergabung dalam GAM Palas MYakub Hasibuan saat melakukan aksi di depan kantor Dinas PU dan Pertamben Palas Jalan Jenderal Sudirman Sibuhuan, Kamis (18/10). Mereka menduga, oknum Kabid Bina Marga Dinas PUD yang juga Pejabat Pembuat Komitmen (PPK) ‘bermain mata’ dengan rekanan dalam memuluskan pelaksanaan tender proyek bidang bina marga dinas PU dan Pertamben Palas, selain bermain dengan pihak panitia lelang, juga dengan rekanan konsultan perencanaan. Sehingga dalam perencanaan proyek kuat dugaan terjadi rekayasa, dimana Rencana Anggaran Biaya (RAB) bersama gambar proyek yang akan dikerjakan sangat tidak sesuai dengan

kondisi lapangan. Mahasiswa pengunjukrasa juga meminta agar anggaran proyek pemerintah Palas TA 2012 dijadikan SILPA, karena melihat rentang waktu yang tinggal 49 hari lagi, sehingga tidak memungkinkan untuk mencapai pelaksanaan proyek pembangunan berkualitas. Mereka meminta aparat penegak hukum supaya mengusut tuntas oknum yang terlibat dalam proses tender yang disinyalir berbau KKN. Juga mengusut dugaan rekayasa konsultan perencanaa terhadap objek pelaksanaan proyek. Aksi mahasiswa berlangsung satu jam lebih mendapat pengawalan ketat dari personel Polri dan Satpol PP. Aksi mahasiswa berjalan baik, tertib dan aman, meskipun sempat terjadi dorong-dorongan. Sementara Kadis PU dan pertamben Palas Ir. Ulil Fadil Naustion saat menerima mahasiswa pengunjukrasa mengatakan, pelaksanaan proyek sudah sesuai Perpres No 54 Tahun 2010 dan Perpres No 70 Tahun 2011, tentang pengadaan barang dan jasa. (a 33)

Air Sumur Diduga Mengandung Mercury, Warga Hutabargot Memilih Air Galon PANYABUNGAN (Waspada): Karena takut terkena penyakit mengkonsumsi air sumur yang diduga terkontaminasi mercury, banyak penduduk desa di Kec. Hutabargot, Kab. Mandailing Natal (Madina) saat ini mengkonsumsi air mineral galon untuk kebutuhan minum. Banyak warga saat ini tidak menggunakan air sumur untuk kebutuhan minum, karena khawatir air sumur telah terkontaminasi akibat banyaknya penggunaan zat kimia jenis mercury yang digunakan penambang tradisional dalam mengolah batu mengandung emas di pemukiman penduduk menggunakan mesin galundung. Demikian disampaikan warga Desa Simalagi berinisial R, 41, kepada wartawan barubaru ini di Panyabungan. Warga tersebut menjelaskan, saat ini di sejumlah desa di Kec. Hutabargot tidak lagi mengkonsumsi air sumur untuk diminum. Banyak warga semakin khawatir atas pemakaian mercury oleh penambang emas secara bebas, tidak hanya mengancam kualitas air

sumur, tapi juga diduga kuat telah mencemari air sungai di desa itu. Bahkan di pemukiman penduduk saat ini ditemukan ratusan unit galundung yang beroperasi , dan seluruh galundung itu menggunakan mercury untuk menghancurkan bijih emas dari bebatuan hasil tambang mereka di atas gunung. Hal senada disampaikan warga Desa Hutabargot Julu berinisial A, 22. Dikatakan, sejak dua bulan lalu mereka tidak lagi mengkonsumsi air sumur, tetapi memilih berlangganan dengan depot isi ulang air mineral yang datang dari Kota Panyabungan. Kondisi yang dialami dan dikhawatirkan warga di Kec. Hutabargot saat ini diharapkan menjadi motivasi bagi Pemkab Madina, untuk secepatnya mencari solusi dari ancaman bahaya mercury akibat pengoperasian galundung (mesin pemisah emas dari batuan), yang tidak saja ada di Kec. Hutabargot, tapi juga ratusan galundung ditemukan beroperasi di Kota Panyabungan. (c14)

Warga Palas Meninggal Dengan Luka Di Leher Keluarga Minta Polisi Usut Tuntas MEDAN (Waspada): Polisi diminta mengungkap penyebab kematian Ilham Habibi Pulungan, 22, warga Jalan Padang Luar, Kec. Sibuhuan, Kab. Padanglawas (Palas). Saat ditemukan meninggal dunia, di leher korban ditemukan luka seperti bekas tikaman senjata tajam dan bagian kepala bonyok diduga pukulan benda keras. “Kami mencurigai penyebab kematiannya karena luka-luka dialaminya. Kami tidak yakin dia tewas kecelakaan lalu lintas (lakalantas), tetapi dibunuh. Karenanya kami mendesak Polres Tapsel dan Polsek Barumun mengungkap kasus sebenarnya,” kata paman korban, Syawaluddin Siregar di dampingi keluarganya Mahmud Harahap kepada wartawan di Medan, Minggu (21/10). Dia menyebutkan, pihak kepolisian Barumun menyimpulkan Ilham meninggal karena lakalantas saat menggendarai sepedamotor. Namun fakta di lapangan, kondisi korban tidak mengalami luka lecet maupun patah tulang layaknya orang lakalantas. Sepedamotornya juga tidak ada yang rusak, dan anehnya kunci sepedamotor ditemukan di saku celana korban. “Bagaimana kami percaya Ilhman meninggal karena lakalantas, sepedamotornya saja tidak rusak. Luka lecet pun tak ada, tapi luka seperti tikamanbendatajamadadileherkanannya.Kalau dia meninggal tabrakan, me-ngapa kunci keretanya ada di saku celananya,” sebutnya. Syawal menceritakan, kematian korban diketahui Minggu (23/9) sekira pukul 23:00. Korban saat itu berboncengan sepedamotor dengan temannya Selamat, hendak pulang ke rumahnya dari Sibuhuan. Mereka beriringan dengan dua temannya yang juga menaiki sepedamotor, yakni Onang-onang dan Pelak. Namun di jalan lintas Sibuhuan-Sosa, korban ditemukan tewas mengenaskan dengan luka seperti bekas tikaman di leher dan kepalanya bagaikan terbentur benda keras, karena bonyok. Ketika itu, Selamat hanya mengalami luka lecet di dagu. Sementara korban dilarikan ke RS Permata Madina Sibuhuan, namun nyawanya tidak tertolong. “Herannya, Selamat mengaku tidak tahu kejadian dengan alasan pingsan,” kata Syawal. Selamat, kata dia, mengaku terkejut karena dirinya sudah berada di rumah sakit. Tapi menurut pihak rumah sakit, Selamat yang mengantarkan korban ke rumah sakit. Bahkan Selamat

Waspada/gito ap

KELUARGA korban menunjukkan dua foto saat Ilham Habibi Pulungan, 22, ditemukan tewas di jalan raya lintas Sibuhuan-Sosa Kab. Padanglawas (Palas) kepada wartawan di Medan. Pihak keluarga yakin Ilham merupakan korban pembunuhan. sendiri yang mencari dokternya. “Saya menduga ada permainan. Bukan itu saja, Selamat selalu berbelit-belit saat memberikan keterangan kepada polisi,” sebutnya. Menurut Syawal, ada dugaan polisi mengaburkan penyebab kematian korban. Alasan itu diperkuat dengan ucapan Kapos Lantas Barumun Aipda Edy Sofyan Nasution, mengatakan “ngapain diusut kematian korban, lebih baik urus saja asuransinya”. Selain itu, kata Syawal, setelah tiga hari tewasnya korban, dia mendatangi Aipda Edi Sofyan menanyakan berita acara pemeriksaan (BAP), tapi Edi mengatakan BAPnya sudah diserahkan ke Lantas Polres Tapsel. Karena BAP-nya sudah diserahkan ke Polres Tapsel, dia bersama keluarga lainnya datang dan menemui seorang personel Lantas Polres Tapsel, Briptu Tiwi. Namun Briptu Tiwi menuturkan BAP-nya belum diserahkan. “Ini ada apa,” kata dia berharap polisi menjelaskan kasus sebenarnya. (m27)


Sumatera Utara

WASPADA Senin 22 Oktober 2012

FPDIP DPRD P. Siantar Tolak RPAPBD 2012 PEMATANGSIANTAR (Waspada): Fraksi PDI Perjuangan (FPDIP) DPRD Kota Pematangsiantar menyatakan dengan tegas menolak Rancangan Perubahan (RP) APBD TA 2012 menjadi Peraturan Daerah (Perda), karena menganggap perubahan anggaran belum berpihak kepada kepentingan rakyat.

Lakalantas, Dua Pelajar Luka Berat PEMATANGSIANTAR (Waspada): Satu unit sepedamotor Yamaha Mio BK 5601 AAG yang dikenderai dua pelajar, diduga menabrak satu unit sepedamotor Honda Revo BK 6817 TAG sehingga mengakibatkan dua pelajar itu mengalami luka berat. Kecelakaan lalu lintas itu terjadi di Jalan Sangnawaluh, Kel. Pahlawan, Kec. Siantar Timur, Kota Pematangsiantar, Kamis (19/10) pukul 20:45. Informasi diperoleh, korban Andre Sitorus, 16, pelajar, warga Jalan Bah Binonom, Kel. Sigulanggulang, Kec. Siantar Utara, Kota Pematangsiantar yang mengamudikan sepedamotor Yamaha Mio dengan membonceng Ucok Parningotan Saragih, 16, pelajar, warga Jalan Bah Tongguran, Kel. Sigulanggulang tabrakan dengan sepedamotor Honda Revo dikemudikan Lambok Franto Sihombing, 33, yang membonceng istrinya Anita Sijabat, 33, keduanya warga Jalan Sulawesi, Desa Dolok Sinumbah, Kec. Hutabayu Raja, Kab. Simalungun. Sedangkan Edwin H Purba, 44, warga Ujung Raya, Desa Raya Bayu, Kec. Raya, Kab. Simalungun dan Alfred Elpen Turnip, 40, warga Sirpang Sigodang, Kec. Panei, Simalungun mengalami cedera sesudah sepedamotor Suzuki Smash BK 2920 WW ditabrak bus Intra BK 1444 TS dikemudikan Harianto Sihombing, 32, di persimpangan Jalan Jend Sudirman dengan Jalan Kartini, Kel. Proklamasi, Kec. Siantar Barat, Pematangsiantar Kamis (18/10) pukul 13:30. Kapolres Pematangsiantar AKBP Albert TB Sianipar, S.Ik, MH saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu, Kasat Lantas AKP Hendrik Situmorang, MM dan Kanit Laka Iptu Sudeng Wahyudi S, SH, Jumat (19/10) menyebutkan kecelakaan lalau lintas di dua tempat terpisah itu masih dalam penyelidikan. (a30)

Dipertanyakan, Penanganan Kasus Korupsi Pengadaan Mobil KB Pemkab Samosir SAMOSIR (Waspada): Penanganan kasus korupsi pengadaan mobil KB Pemkab Samosir 2010 bersumber dari APBN senilai Rp500 juta oleh Kacabjari Pangururan, diduga kurang profesional. Hal ini dilihat dari penahanan tunggal mantan Kepala Badan Keluarga Berencana (KB) Kab Samosir E.T yang ditahan sekira dua bulan lalu di Rutan Pangururan tanpa bendahara dan PPK. Korupsi ini merugikan negara yang disebut-sebut hanya sepuluh juta, namun sangat disayangkan penahanan tersangka korupsi pengadaan mobil KB hanya dilakukan untuk satu orang pejabat teras yang berperan sebagai Kuasa Pengguna Anggaran (KPA), sehingga menimbulkan pertanyaan apakah tidak ada pihak lain ikut terlibat. “Diduga kuat bendahara dan PPK Kasus Tipikor Pengadaan mobil KB ini dijadikan ATM berjalan, dimana hingga berita diturunkan PPK dan bendahara belum dijadikan tersangka,” ujar Ketua LSM ACI Kab Samosir P. Naibaho kepada Waspada, di Pangururan.Masyarakat Samosir meminta Jamwas Kejagung RI agar memantau dan mengawasi secara ketat penanganan kasus korupsi pengadaan mobil KB Samosir yang dananya berasal dari pemerintah pusat. Pantauan Waspada, Jumat (19/10) pukul 09:52, mantan Kepala KB Kab Samosir E.T tiba di Kantor Cab Kejaksaan Negeri Pangururan yang dijemput dari Rutan Pangururan untuk menjalani proses lanjutan. Kacabjari Pangururan R.Dayan Pasaribu, SH saat dikonfirmasi Waspada, Jumat (19/10) terkait siapa aja lagi tersangka kasus korupsi mobil KB, Kacabjari tidak member jawaban. (c11)

Kepergok Mencuri, ABG Tikam Korban PEMATANGSIANTAR (Waspada): Akibat tertangkap basah melakukan pencurian di dalam kamar korban, seorang anak baru gede (ABG) yang masih duduk di bangku kelas 1 SMP, AS, 15, warga Desa Silinduk, Kec. Dolok Batunanggar, Kab. Simalungun diduga gelap mata kemudian menikam leher korbannya. Perbuatan nekat itu diduga dilakukan AS di dalam kamar rumah Suroso di Desa Silinduk, Kec. Dolok Batunanggar, Simalungun Jumat (19/10) pukul 23:00 terhadap korban Marini Sukaria, 21. Akibat tikaman di leher itu, korban terpaksa mendapat perawatan di RSU Horas Insani, Kota Pematangsiantar. Informasi diperoleh, AS melakukan pencurian di rumah Suroso dengan cara membuka secara paksa jendela kamar tempat korban tidur. Di dalam kamar, AS mengambil uang Rp 47.000 dari dalam tas yang digantungkan di dinding kamar. Namun, korban yang sedang tidur saat itu terbangun akibat mendengar suara berisik di dalam kamarnya. Melihat korban bangun, AS yang ketakutan perbuatannya diketahui warga dan penghuni rumah lainnya, menghujamkan pisau yang dibawanya ke leher korban. Korban berteriak histeris. Tidak saja keluarganya, para tetangga pun berdatangan. AS pun ditangkap dan dilaporkan ke Polsek Serbelawan. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP H. Panggabean, SH, Kasat Reskrim AKP Ronny Nicholas Sidabutar, S.Ik dan Kapolsek Serbelawan AKP K. Manurung, Sabtu (20/10) menyebutkan kejadian itu masih dalam proses pemeriksaan. (a30)

Disperindag Tak Tanggap, Pedagang Mengadu Ke Bupati TANJUNGPURA (Waspada): Dinas Perindustrian dan Perdagangan (Disprindag) Kab. Langkat dan Satpol PP hingga kini tidak juga mengindahkan pengaduan pedagang resmi terkait aktivitas penjualan daging ilegal di pusat pasar tradisonal Tanjungpura. Sabir Ali, salah seorang pedagang baru-baru ini menyatakan, keberadaan pedagang daging ilegal sudah setahun lalu dilaporkannya ke Disperindag, namun hingga kini tidak juga ada tindakan konkrit. Padahal, usaha yang dijalankan pedagang liar ini melanggar Perda. Ia menolak rencana yang ditawarkan Kabid Perdagangan Disprindag, Nanang Hadi Irawan, untuk menempatkan pedagang liar ke lapak resmi. “Ini bukan solusi,” ujarnya mengaku tak habis pikir kenapa Disperindag memberikan proteksi berlebihan kepada pedagang ilegal ini. Karena aspirasinya tidak juga didengar Disperindag, Sabir Ali, melalui kuasa hukumnya, Syahrial, SH dari Lembaga Bantuan Hukum Citra Langkat membuat laporan tertulis kepada Bupati Langkat, H. Ngogesa Sitepu, SH yang intinya memohon penertiban terhadap pedagang liar. Syahrial, SH menyatakan, kliennya telah mengajukan surat keberatan dan mohon penertiban kepada Disperindag serta Satpol PP, namun hingga kini tidak kunjung mendapatkan perlindungan hukum. Malah sebaliknya, inst nasi yang berkompeten ini terkesan memberikan kesempatan pada pedagang liar. Menurut Syahrial, aktivitas pedagang liar ini tidak hanya merugikan kliennya, tapi juga Pemkab Langkar dari sektor retribusi. Karenanya, untuk ketertiban menjalan usaha di pasar tradisonal, Syahrial memohon kepada Bupati Langkat agar segera mengambil tindakan tegas.(a02)

Sikap FPDIP itu disampaikan melalui Ketua FPDIP M. Rivai Siregar, SE selaku juru bicara saat rapat paripurna tentang pengesahan RP APBD Pematangsiantar TA 2012 di ruang sidang DPRD, Jalan H. Adam Malik, Jumat (19/10) sore. Rapat dipimpin Ketua DPRD Marulitua Hutapea, SE didampingi Wakil Ketua Zainal Purba dibantu Sekretaris DPRD Mahadi Sitanggang, SH dan tidak dihadiri Wakil Ketua Timbul M Lingga, SH yang berasal dari PDIP. Dijelaskan, FPDIP, secara normatif penyusunan dan pembahasan RPAPBD itu belum memenuhi aspek yuridis normatif seperti diatur di Permendagri Nomor 59 Tahun 2007 tentang pedoman pengelolaan keuangan daerah yang formulasinya dirumuskan kepala daerah dalam rancangan kebijakan umum PAPBD. Kemudian, sesudah membaca dan mencermati jawaban eksekutif terhadap pandangan umum fraksi-fraksi, laporan komisi-komisi dan Badan Anggaran (Banggar) terhadap pem-

bahasan Rancangan Peraturan Daerah (Ranperda) tentang PAPBD, FPDIP memberikan catatan-catatan penting dan strategis terhadap RPAPBD yakni RPAPBD belum sesuai dengan harapan masyarakat banyak, dibuktikan dengan besarnya jumlah belanja pegawai dan program yang tidak menyentuh atau tidak mampu menjawab problematika kehidupan masyarakat. Proses penganggaran RPAPBD tidak terukur dan kecenderungan mengabaikan prinsip pengelolaan keuangan daerah, dibuktikan dengan jumlah belanja pegawai yang fantastis Rp 426.667.459.648,59, melambungnya anggaran belanja pegawai di pos belanja tidak langsung dan belanja langsung tidak didukung perbaikan kinerja, pengelolaan pendapatan asli daerah (PAD) tidak dikelola dengan baik dan berpotensi disalahgunakan seperti halnya di Dinas Perhubungan, Informasi dan Telekomunikasi (Hubkominfo), Dinas Pasar dan SKPD lainnya yang mengelola PAD.

Menurut FPDIP, dengan bertambahnya jumlah pegawai honorer dari 1.700 orang menjadi 2.075 orang membuktikan Pemko sudah secara nyata melanggar ketentuan PP Nomor 48 Tahun 2005 dan PP nomor 43 Tahun 2007 yang berakibat terhadap pemborosan anggaran. Sesudah fraksi lainnya yakni Fraksi Kebangsaan (FK), Fraksi KaryaPeduliNurani(FKPN,Fraksi Demokrat dan Fraksi PAN membacakan pendapat akhir fraksi masing-masing, terjadi saling interupsi ketika Ketua DPRD bertanya apakah RPAPBD itu dapat diterima dan dijadikan Perda. Para anggota DPRD itu ada yang berpendapat agar divoting saja pengesahannya dan ada berpendapat tidak perlu dita-nya lagi, karena dari lima fraksi, empat fraksi menyatakan dapat menerima RPAPBD menjadi Perda. Akhirnya, dilakukan voting dan hasilnya, dari 25 anggota DPRD yang hadir termasuk pimpinan, hanya dua orang yang menolak yakni dari FPDIP hingga RPAPBD itu ditetapkan sebagai Perda. (a30)

PAD Gunungsitoli Rp15 M, Meningkat Tiga Kali Lipat GUNUNGSITOLI (Waspada): Pendapatan asli daerah (PAD) Kota Gunungsitoli, meningkat tiga kali lipat pada 2012. Jika pada 2011 PAD Gunungsitoli Rp5,1 miliar, pada 2012 menjadi Rp15 miliar. Demikian Asisten I Pemerintahan Pemko Gunungsitoli Kurnia Zebua pada acara Workshop Kebanksentralan Wartawan Ekonomi dan Bisnis Sumatera Utara bersama Bank Indonesia Wilayah IX Sumut-Aceh, di Gunungsitoli, Nias, yang berlangsung mulai Jumat-Minggu (19-21/10). Peningkatan PAD tersebut merupakan hasil intensifikasi penarikan retribusi bahan galian non mineral dan minuman beralkohol, karena selama ini potensi retribusi belum tergarap secara maksimal. Menurutnya, PAD Gunungsitoli masih berpotensi meningkat hingga Rp25 miliar pada 2013, terutama terkait dengan pengesahan peraturan daerah

(Perda) yang antara lain mengatur retribusi tambang dan Perda-Perda lain yang efektif berlaku Januari 2013. “Sebagaimana tercantum dalam profil dan potensi Kota Gunungsitoli, daerah ini memiliki potensi tambang batu bara 2.000 hektar, batu gamping 470 hektar, batuan pasir dan kerikil 85 hektar, serta tanah liat 14 hektar. Potensi retribusi tambang tersebut yang akan dimaksimalkan untuk pembangunan Gunungsitoli,” katanya. Kurnia mengatakan, hasil PAD itu akan diteruskan untuk pembangunan Sumber Daya Manusia (SDM) Gunungsitoli yang memiliki jumlah penduduk berdasarkan hasil pencacahan sensuspenduduk2011berjumlah 125.566 orang, terdiri dari 61.651 laki-laki dan 63.915 perempuan, 30 persennya masih berada di dalam lingkaran kemiskinan. Dia juga mengatakan, hingga kini pihaknya belum mempunyai tempat pembuangan

akhir (TPA), sehingga masih banyak warga yang membuang sampahnya di pinggir laut. “Pemerintah Kota Gunungsitoli telah menjalin kerjasama dengan United Nation Development Program (UNDP) untuk membangun TPA di atas lahan 13 hektar yang sedianya rampung akhir tahun ini. Sebelum ada TPA, warga terbiasa membuang sampah ke laut, dan mereka beranggapan bahwa laut tidak akan rusak meskipun warga ramai-ramai membuang sampah,” katanya. TPA tersebut, katanya, selain untuk membuang sampah juga untuk mendaur ulang sampah menjadi barang-barang yang dapat dimanfaatkan warga. Selain itu, lanjut Kurnia, pihaknya akan mereklamasi pantai untuk mencegah kerusakan lebih jauh. Hasil reklamasi ini akan dijadikan ruang terbuka hijau. “Tahun depan, reklamasi akan dimulai dengan menimbun pantai 2 km,” katanya. (m41)

Dua Bocah Terlantar Di Pelabuhan Gunungsitoli GUNUNGSITOLI (Waspada): Dua bocah diduga sengaja ditinggalkan orangtuanya, Ales Zebua, 5, dan Andika Surya Zebua, 4, ditemukan warga terlantar di Pelabuhan Laut Gunungsitoli, beberapa hari lalu. Kedua bocah yang sedang kebingungan di depan Kantor Kesatuan Penjaga Laut dan Pantai (KPLP), ditemukan pertama sekali oleh salah seorang anggota KPLP Pelabuhan Gunungsitoli sekira pukul 20.30 usai melaksanakan tugas pengamanan pemberangkatan kapal KMP Belanak menuju Pelabuhan Sibolga. Kedua bocah malang tersebut kemudian diserahkan anggota KPLP ke Kantor Pos KP3 Pelabuhan Laut Gunungsitoli, dan kemudian secara bersama-sama mencari orangtua Ales dan Andika di sekitar Pelabuhan Gunungsitoli. Namun, karena keberadaan orangtua dan alamat kedua bocah malang itu tidak ditemukan, kedua anak tersebut dibawa Kepala KP3 Pelabuhan Gunungsitoli, Bripka. Hasiholan Simamora ke Mapolres Nias. Kapolres Nias, AKBP.Mardiaz Kusin Dwihananto, S.ik, M.Hum yang dikonfirmasi wartawan, membenarkan penemuan kedua anak tersebut di Pelabuhan Gunungsitoli. “Karena kedua orang tua anak tersebut tak kunjung kita temukan, begitu juga dengan

alamatnya, maka dengan terpaksa kedua anak tersebut kita titipkan di Panti Asuhan Bhakti Luhur yang terletak di Jln Diponegoro Km 5, Desa Sihareo Tabaloho, Kecamatan Gunungsitoli, Kota Gunungsitoli, di bawah pengawasan Pengurus Panti Asuhan S. Erosvita Rosalina Alina”, ungkapnya. Kapolres menambahkan dari pengakuan kedua bocah tersebut, keduanya sengaja ditinggalkan oleh ibunya di Pelabuhan Gunungsitoli bersama

sebuah koper yang berisi pakaian,karena kedua orangtuanya sedang bertengkar. Kapolres mengimbau orangtua yang merasa kehilangan dua anak laki-lakinya dengan ciri ciri menggunakan kemeja merah gelap, dan yang seorang menggunakan kaos kream berkerah dan bergaris, serta berambut hitam lurus berponi, dan berwarna kulit kuning langsat, segera melaporkan ke Polres ataupun Pos Pelabuhan Angin Gunungsitoli. (a25)

Relawan Gus Irawan Kerja Bakti Di Pekuburan Sei Bilah P. BRANDAN (Waspada): Puluhan orang yang mengatasmakan dirinya tim relawan Berjuang 23 pendukung Gus Irawan, melakukan kerja bakti di Perkuburan Sei Bilah, belum lama ini. Sejak pukul 09.00 hingga pukul 12.00 para relawan bekerja membersihkan seluruh areal perkuburan yang selama ini kurang terawat. Tim relawan juga membawa peralatan dari rumah masingmasing berupa parang, gergaji, cangkul dan pisau guna memotong rumput-rumput liar yang menyemak di sekitar perkuburan. Para relawan awalnya membersihkan perkuburan yang letaknya paling akhir yang berbatasan dengan pepohonan nipah. Mereka menebas dan memotong rumput liar dan pohon kecil serta sampah daun nipah yang ada di sekitar perbatasan itu. Aksinya ini mendapat respon dari beberapa penduduk setempat sembari menyatakan bahwa perkuburan itu selama ini jarang dibersihkan sehingga tampak kumuh dan semrawut. Ketua Relawan Berjuang 23 Gus Irawan Rahmad A, melalui koordinator bakti sosial Agus Beni mengatakan, aksi sebagai bentuk solidaritas dan inisiatif sendiri dari tim relawan. “Kegiatan ini merupakan kesadaran sendiri dan sebelumnya kegiatan ini sudah kami sepakati bersama. Kami bekerja sukarela tanpa ada paksaan,” ujar Agus.(c01)

Waspada/Hasuna Damanik

KETUA Korpri Simalungun Gideon Purba, menerima pataka dari pengurus Korpri Sumatera Utara.

Gideon Purba Ketua Korpri Simalungun SIMALUNGUN (Waspada): Sekretaris Daerah (Sekda) Kab. Simalungun, Drs. Gidion Purba, MSi, terpilih secara aklamasi menjadi Ketua Korpri Simalungun, pengganti antar waktu periode 2011-2016 pada acara musyawarah kabupaten luar biasa di Griya Hapoltakan Pamatang Raya, Jumat (19/10). Pemilihan berlangsung tertib dan aman, dihadiri Ketua Dewan Pengurus Korpri Sumatera Utara H Nurdin Lubis,SH diwakili Wakil Ketua I DR H Arsyad Lubis, MM, Bupati Simalu-

ngun JR Saragih, Ketua TP PKK Simalungun Ny Angreini JR Saragih, para asisten, pimpinan SKPD, camat dan ratusan anggota Korpri daerah itu. Gideon Purba terpilih menjadi Ketua Korpri Simalungun menggantikan ketua sebelumnya Drs Ismail Ginting yang memasuki masa pensiun. Usai pemilihan dilanjutkan dengan pelantikan yang ditandai dengan penyerahan pataka oleh Dewan Pengurus Korpri Sumut kepada Ketua Korpri Simalungun yang baru, Gideon Purba. (a29)

187 Unit RTLH Di DS Peroleh Bantuan Pembangunan/Rehabilitasi Pemprovsu LUBUKPAKAM (Waspada): 187 Unit Rumah Tidak Layak Huni (RTLH) milik warga kurang mampu di enam kecamatan Kab. Deliserdang akan dibangun/direhabilitasi bantuan Pemprovsu Tahun Angggaran 2012 melalui Dinas Penataan Ruang dan Pemukiman bekerjasama dengan Zeni Dam I/Bukit Barisan. Hal itu terungkap pada pelaksanan rembug warga dalam rangka persiapan pekerjaan fisik pembangunan/rehabilitasi RTLH wilayah Kab.Deliserdang, di Balairung Pemkab Deliserdang, di Lubukpakam, Jumat (19/10). Kegiatan dihadiri Plt Kepala UPTP Rumah Sewa Dinas Tarukim Sumut Dra. Berlinda Sahmawati MSi, Bupati Deliserdang Drs. H. Amri Tambunan diwakili Plt Sekdakab Drs. Agus Ginting MSi, Dandim 0204/DS Letkol Arh Wawik Dwinanto, Kadis Cipta Karya Ir H Abdul Haris Pane MM, unsur Muspika Kecamatan,Konsultan dan warga masyarakat penerima manfaat RTLH. Dra. Berlinda Sahmawati MSi menjelaskan, rembug warga dilaksanakan dalam rangka persiapan pekerjaan fisik pembangunan/rehabilitasi RTLH khususnya di Kab. Deliserdang yang mendapat bantuan sebanyak 187 orang masing-

masing di Kec. Percut Seituan 49 orang, Tanjungmorawa 4 orang, Lubukpakam 23 orang, Patumbak 5 orang, Pantai Labu 71 orang dan Kec. Beringin 35 orang. Pada pertemuan itu, warga penerima manfaat RTLH menerima penjelasan secara langsung dan dilakukan tanya jawab. Kemudian, tahap selanjutnya akan dilakukan verifikasi terhadap calon penerima bantuan seperti data kependudukan dan keabsahan kepemilikan tanah. Sedangkan pelaksanaannya direncanakan berlangsung akhir Oktober 2012. Dandim 0204/DS Letkol Arh Wawik Dwinanto menjelaskan, pembangunan dan rehabilitasi RTLH tersebut akan dilakukan cara arisan ataupun bergotongroyong bekerjasama dengan muspika, kepala desa, masyarakat dengan TNI melalui Zeni Dam I/Bukit Barisan. Bupati Deliserdang Drs. H. Amri Tambunan dalamsambutantertulisdisampaikanPltSekdakab Drs.AgusGintingmenyatakanteri-makasihkepada Pemprovsu dan Zeni Dam I/Bukit Barisan atas partisipasi yang diberikan bagi pembangunan dan rehabilitasi rumah tidak layak huni bagi warga kurang mampu di Deliserdang. (a06)

150 Kaum Ibu Dilatih Membuat Bulang-bulang BERASTAGI(Waspada): 150 Peserta kaum ibu dari berbagai desa di Kab. Karo mengikuti kegiatan pelatihan cara membuat bulangbulang dan tudung khas Karo, yang dilaksankan Dinas Pariwisata Kabupaten Karo selama tiga hari di aula hotel Sinabung Hills Berastagi. Pelatihan dimulai sejak Senin sampai Rabu (17/10) diharapkan dapat mengasah keterampilan kaum wanita di pedesaan terutama dalam mengolah tata busana tradisional khususnya membuat bulang-bulang dan tudung khas Karo, agar kaum ibu dapat melesatarikan budaya daerah, karena masyarakat Karo sebagian sudah lupa bagaimana cara yang benar membuat bulang-bulang dan tudung. Hal ini disampaikan Kadis Pariwisata Dinasti Sitepu melalui Kabid Budaya Teman Karokaro, SE kepada wartawan.

Diharapkan, dengan adanya pelatihan cara pembuatan bulang-bulang dan tudung khas Karo, ke depan kaum wanita di Tanah Karo bisa membuat sendiri tanpa harus pergi ke salon. Lukas Tarigan selaku instruktur mengatakan, masyarakat Karo sekarang hampir sebagian sudah tidak lagi memakai bulang-bulang dan tudung khas Karo secara benar. Bahkan kebanyakan harus pergi ke salon, sedangkan dalam memakai tata busana khas Karo kini sudah mulai tidak sesuai dengan aslinya. Camat Merdeka Kasman Sembiring yang menghadiri pelatihan di Hotel Sinabung Hill kepada Waspada mengatakan, sangat mendukung kegiatan ini, bahkan berharap agar peserta yang mengikuti pelatihan dapat melatih warga lainnya, termasuk generasi muda. (c10)

Kaligrafi, Seni Islam Bernilai Ekonomi Tinggi TEBINGTINGGI ( Waspada): Kaligrafi merupakan salah satu seni Islam yang bernilai ekonomi tinggi, jika kualitas serta pengelolaannya ditangani secara profesional. Bahkan, kaligrafi akan mampu menjadi salah satu ikon budaya bangsa Indonesai yang mayoritas muslim di hadapan dunia internasional. Upaya memperkenalkan kaligrafi sebagai produk ekonomi tinggi harus terus menerus dilakukan para pelaku seni kaligrafi dengan menggandeng pelaku ekonomi. Pesan itu disampaikan Wali Kota Tebingtinggi Ir.H.Umar Z Hasibuan, MM, saat membuka ‘Eksibisi Kaligrafi se Sumatera Utara’ dalam rangka kegiatan peringatan Hari Sumpah

Pemuda ke 84 tingkat Sumut, Kamis (18/10), di anjungan Sri Mersing, Lapangan Merdeka, Tebingtinggi. Ditambahkan, sebagai bagian dari ekonomi kreatif,parakaligrafertidakhanyadituntutmampu melahirkan karya seni bernilai tinggi dan dihargai secara ekonomis. Tapi harus juga mampu membangun relasi usaha yang mampu memasarkan produk seni itu hingga ke konsumen seni.“Sejalan dengan program OVOP (one product one village), Tebingtinggi siap menjadi basis utama kegiatan promosi dan pemasaran kaligrafi di Sumut,” ujar Wali Kota. Kegiatan eksibisi kaligrafi se Sumut itu, diikuti23kaligraferkotaTebingtinggiserta22kaligrafer dari berbagai kota yang ada di Sumut. (a09)

Keliling Indonesia Ingin Bertemu SBY USIANYA sudah tidak muda lagi. Namun, semangatnya terus saja bergelora. Helman Kamal Husein, 51, berjalan kaki keliling Indonesia hanya untuk bertemu Presiden Susilo Bambang Yudhoyono. Helman mengaku hanya tamat pendidikan Sekolah Luar Biasa (SLB) “Swadaya” di Semarang, Jawa Tengah, lulus pada 1982, namun dia mampu menulis dan membaca. “Harapan saya cuma ingin bertemu Pak SBY,” ujarnya kepada Waspada, saat singgah di Kantor Kejari Sidikalag Jumat (19/10). Dengan bermodalkan Rp200 ribu dan bendera merah putih, warga asal Surabaya, Jawa Timur ini memulai perjalanannya sejak 25 November 2010. Selama setahun 11 bulan, ia menginjakkan kaki di Kota Sidikalang dan telah mengelilingi 394 kabupaten dan kota di Pulau Jawa dan Sumatera. Selama melakukan perjalanan, ayah satu anak itu singgah di setiap kantor bupati, wali kota, DPRD, Polres, kejaksaan, pengadilan dan kantor lainya atau ke Dinas Pariwisata untuk meminta surat keterangan bahwa dia telah sampai di daerah tersebut. Berkas-berkas itu disusun dalam beberapa map dan disimpan di dalam tas hitam sebagai bukti ia telah melakukan perjalanan panjang, hanya untuk menemui pemimpin negara ini. Ia mengaku telah singgah ke istana negara, Jakarta, namun

gagal untuk bertemu presiden pada awal 2012. “Waktu itu saya tidak bisa bertemu presiden, karena presiden sedang sibuk,” katanya. Ia bertekad untuk meneruskan perjalanannya hingga ke Kalimantan. Perjalanan dari Kilometer Nol Indonesia ditandai pemberian sertifikat dari Wali Kota Sabang. Dia berencana kembali ke kampung halamanya di Kebraoan Karang Pilang Surabaya, kemudian bertekad meneruskan perjalanan ke Kalimantan dan Sulawesi.Dari niatnya itu, Helman berharap bisa bertemu SBY agar bisa meminta modal atau sponsor yang berniat membiayainya untuk membuka usaha di hari tuanya. Dalam melakukan perjalanan itu, ia mengandalkan sumbangan sukarela dari setiap warga yang melintas, bupat, wali kota, pejabat lainnya dan warga. Untuk makan, ia biasanya singgah ke warung makan dan untuk tidur selalu mencari penginapan murah. Bahkan, selama perjalanan itu, ia menghabiskan sepatu enam pasang dan mengalami enam kali sakit terserang demam karena nekat berjalan saat hujan. Ia mengaku lebih suka melintasi daerah kawasan hutan karena udaranya lebih sejuk, namun diakuinya juga sedikit takut karena sepi. “Saya cuma cemas pada binatang buas, karena sering bertemu ular di sekitar hutan,” ujarnya. Kartolo Munte

Waspada/Kartolo Munte

HELMAN Kamal Husein saat diwawancarai di Kantor Kejaksaan Negeri Sidikalang.

Ekonomi & Bisnis

WASPADA Senin, 22 Oktober 2012

Tinjauan Ekonomi

Jhon Tafbu Ritonga Pengamat Ekonomi

PilgubsuSumutDanRiau2013 Sabtu (13/10) saya terbang Ke Pakanbaru. Dari Bandara Sultan Syarif Kasim II ke Hotel kelihatan banyak baleho Bakal Calon Gubernur Riau 2013-2018. Seperti Gubsu Syamsul Arifin, rupanya tahun 2013 masa jabatan Rusli Zainal juga akan habis dan Provinsi Riau akan mengadakan Pilgub (pemilihan gubernur). Dipilih Riau jadi pembanding karena mengingat Gubernur pertamanya SM Amin Nasution (1958-1960) setelah sukses sebagai Gubsu (1948 dan 1953-1956), Gubernur keduanya Kaharuddin Nasution (1960-1966) setelah sukses di sana jadi Gubsu (1983-1988), dan karena Riau sekarang lebih hebat dari Sumatera Utara. Seperti yang saya saksikan sendiri (di Medan, Deliserdang, Sergai, Tebingtinggi, Tapanuli Selatan dan Langkat) sejak tiba hingga kembali ke Medan, di Riau pun ramai balon “menjual diri” dengan satu hajat, supaya jajak pendapat menghasilkan indikator ketenaran dan elektabilitas yang tinggi jika ikut Pilgub 2013. Supaya mendapat simpati pemilih. Di Sumatera Utara tak ada Cagub Independen. Balon dari partai sudah mengerucut dan mulai muncul nama Balon Wagub. Persamaannya, baik di Sumatera Utara maupun di Riau, akan banyak pemilih yang independen, alias golput. Banyak orang menjadi golput karena menganggapnya sebagai kebebasan. Tak ikut memilih itu merupakan hak asasi seperti juga bebas ikut mencoblos jika sudah terdaftar. Jika tidak terdaftar, pasti tidak boleh ikut mencoblos. Dengan kata lain, dalam sistem administrasi Indonesia menjadi golput itu lebih mudah daripada boleh mencoblos. Itu sebabnya bagi yang tidak lagi memerlukan bingkisan kampanye dan uang transpor mencoblos (serangan fajar) sangat ramai yang memilih berdiam diri di rumah pada hari Pilkada dan Pemilu. Banyak juga yang berlibur ke dalam dan luar negeri. Mereka umumnya sudah mengerti dan sangat faham. Belasan tahun reformasi menunjukkan bahwa hasil pemilihan legislatif dan eksekutif terasa amat kurang manfaatnya bagi rakyat banyak. Data resmi pemerintah (dari BPS) menunjukkan ketidakbermanfaatan eksistensi Gubsu bagi rakyat. Misalnya terlihat pada data ekonomi Sumatera Utara yang terus merosot dibanding Riau. Contoh mudah ialah jalan yang menjadi urusan Gubsu atau jalan provinsi yang ternyata semakin pendek. Dari tahun 1994 ke tahun 2010 berkurang 35 km, dari 2.788 km menjadi 2.753 km. Sedangkan panjang jalan Kabupaten/Kota bertambah 13.759 km, dari 15.058 km menjadi 28.817 km, dan kerja pemerintah pusat bertambah 1.287 km, dari 1.252 km jadi 2.539 km. Dalam hal pembangunan infrastruktur jalan peran Gubsu makin tak jelas manfaatnya. Berkenderaan di jalinsum perbatsan Sumut dan Aceh akan terasa kehadiran pemerintah di Aceh dan tak dirasakan peran Gubsu di jalinsum yang ada di Langkat. Saya teringat ejeken lima tahun lalu tentang kondisi jalinsum perbatasan Sumut dan Sumbar yg sudah diperbaiki masa Rudolf Pardede menjabat Gubsu. Tapi dilihat dari sisi rakyat, jumlah PAD

dalam APBD Sumut dari tahun ke tahun terus meningkat sebagai hasil pertambahan kenderaan dari 793.957 unit menjadi 4.100.000 lebih. Ironisnya daya serap atau kemampuan Pemprovsu menggunakan APBD cenderung makin menurun. Diberitakan sisa APBD 2011 Rp720 miliar karena kapasitas Gubernur makin menurun sedangkan PAD (setoran rakyat) terus tumbuh. Kegiatan yang makin sering di Pendopo USU ialah pameran. Perluasan Gedung Perpustakaan USU yang sudah dimulai Gubsu Rudolf Pardede sudah tiga tahun terbengkalai. Tiang-tiang betonnya merusak pemandangan yang dulu asri. Ketidakberfungsian itu diperkuat oleh fakta posisi ekonomi Sumatera Utara yang merosot tajam di pentas nasional. Sebelum krisis ekonomi (1998) yang mengawali reformasi, posisi ekonomi Sumatera Utara tercatat di atas Riau (1994). Tapi data 2011 menunjukkan posisi ke5 Sumatera Utara telah diambil alih oleh Riau. Karena Kalimantan Timur bertahan pada posisi ke-6 maka Sumatera Utara anjlok menjadi posisi ke-7. Kejatuhan posisi itu terasa ketika di Gedung DPD RI bersama beberapa orang Gubernur. Saat bincang informal di Ruang VIP indikasi terasa nyata. Sumut terkesan kurang dipandang oleh sesamanya. Mungkin juga dirasakan oleh Rudolf Pardede dan Parlindungan Purba yang menjadi host hari itu. Makin ketara ketika mendengar pidato pembukaan seminar oleh Ketua DPD RI dimana nama PLT Gubsu tak disebut-sebut sebagaimana Gubernur Kaltim dan Kalteng. Sumatera Utara dulu dipimpin oleh 17 orang Bupati/Walikota dan satu orang Gubernur dengan wibawa Kolonel, Brigjen dan Mayjen. Sekarang sudah 33 orang Bupati/ Walikota dengan seorang Gubernur ditambah 34 orangWakil Bupati,WakilWalikota danWakil Gubernur. Sejak Syamsul Arifin dalam penjara Wagubsu tidak lagi disebut-sebut karena sudah menjadi PLT. Posisi PLT itu mungkin yang membuat pejabat lain lalai menyebut dalam sambutannya sehingga saya merasakan Sumut mereka posisikan turun kelas. Penanggung jawab kemerosotan itu ialah pejabat yang selama ini dikayakan oleh rakyat Sumatera Utara dengan pajak, retribusi, PNBP dan pungutan lainnya. Mereka pilihan rakyat yang diberi fasilitas babu, sopir, ajudan, pengawal, sedan dan motor besar bersirine, pegawai, staf, Kepala SKPD, Kepala Biro, Asisten dan Sekretaris Daerah. Semua mendapat gaji ditambah berbagai tunjangan dan fasilitas lain seperti mobil mahal yang uangnya dari rakyat. Maka berita di surat kabar menyebut sebagian besar dari APBN dan APBD habis untuk belanja pegawai. Semuanya diambil dari keringat rakyat, kerja keras para saudagar dan profesional. Tahun depan Sumatera Utara bersama Riau akan Pilgub 2013-2018. Hendaknya Pilgubsu menghasilkan pemimpin yang mengembalikan supremasi Sumut dalam pentas ekonomi nasional. Bukan posisi terkorup mengalahkan Jakarta dan Aceh. Kuncinya sekarang ada di partai yang sedang memutuskan nama Calon Gubsu 2013-2018. Jika nanti partai memilih yang tidak berkapasitas, tidak amanah, dan mau menzalimi orang lain, pasti rakyat membayarnya lewat Pemilu 2014.

Waspada/Armin Nasution

PARA peserta kontes Indonesia Cyber Army serius mengikuti kompetisi yang digelar di Medan akhir pekan lalu.

Indonesia Butuh Banyak SDM Cyber Security MEDAN (Waspada): Kalangan industri di Indonesia, khususnya yang telah menggunakan sistem informasi, membutuhkan banyak sumber daya manusia (SDM) yang menguasai cyber security atau keamanan informasi. Sayangnya, kebutuhan tersebut belum diimbangi dengan ketersediaan SDM yang ada, kata seorang pejabat. Rico Rahmadi dari Direktorat Keamanan Informasi Kementerian Negara Komunikasi dan Informatika (Kominfo) mengatakan, perkembangan teknologi komunikasi, khususnya yang berkaitan dengan sistem dan jaringan informasi di Indonesia sangat pesat. “Banyak industri, seperti perbankan, yang sudah menggunakan sistem dan jaringan informasi. Untuk menjaga agar sistem tersebut tidak dibobol, maka harus ada SDM yang menguasai sistem keamanan informasi atau cyber security,” jelasnya kepada wartawan disela-sela Kompetisi tingkat nasional Indonesian Cyber Army 2012 yang berlangsung di STMIK Potensi Utama, akhir pekan lalu. Tingginya kebutuhan SDM cyber security ini didorong atas kenyataan bahwa tingkat kejahatan di dunia maya atau cyber crime di Indonesia sudah mencapai tahap memprihatinkan. “Cyber crime di Indonesia sudah pada tahap yang merugikan finansial. Misalnya saja, ada perusahaan yang sistem informasinya mendapat serangan dari hacker sehingga tidak berfungsi. Akibat matinya sistem, perusahaan mengalami kerugian hingga miliaran rupiah,” jelasnya. Begitu juga dengan perorangan yang menjadi korban penipuan online, tuturnya. Melihat kondisi tersebut, jelasnya, maka saat ini banyak perusahaan yang memiliki SDM khusus yang menangani keamanan informasi.

“Sayangnya pasokan SDM ini masih terbatas. Salah satu kendalanya adalah belum ada perguruan tinggi di Indonesia yang memiliki program studi tentang cyber security atau minimal memiliki mata kuliah. Umumnya hal ini dipelajari secara otodidak,” jelasnya. Rico berharap, melalui Kontes Indonesian Cyber Army 2012 yang diikuti 20 tim dengan 58 mahasiswa dari seluruh Indonesia, dapat menjadi langkah untuk mengembangkan pendidikan dibidang cyber security. Sementara Ketua STMIK Potensi Utama Rika Rosnelly menyambut baik kontes tingkat nasional tersebut. Kegiatan ini dapat menjadi ajang pengembangan potensi yang dimiliki peserta, khususnya dalam cyber security. “Kami berharap kompetisi ini dapat menjadi ajang pengembangan bakat mahasiswa dalam hal security jaringan. Sebab, kompetisi ini tidak hanya memenuhi unsur permainan, namun juga edukasi dalam bidang keamanan komputer,” tegasnya. Ketua Panitia Agus Setiawan mengatakan, kompetisi yang berlangsung 16-18 Oktober ini diharapkan mampu mendorong minat generasi muda untuk mempelajari jaringan keamanan (cyber security). “Tercatat peserta terjauh yang berpartisipasi berasal dari Kupang, Makassar, Manado dan Denpasar. Kompetisi yang diadakan adalah capture the flag dan investigation forensic games,” jelasnya. Salah seorang mahasiswa STMIK Potensi Utama Mhd Rendika Purnomo berharap perguruan tinggi menyediakan pendidikan cyber security yang saat ini sudah semakin dibutuhkan.(m06)

B5 Produk Asing Banjir, Waspadai Mutu Di Bawah Standar JAKARTA (Antara): Menteri Perdagangan Gita Wirjawan mengkhawatirkan produk asing akan membanjiri Indonesia karena tingginya konsumsi domestik yang secara akumulatif dalam 20 tahun mendatang nilainya mencapai 36 triliun dolar AS.

“Jika produsen lokal tidak mampu memenuhi permintaan domestik yang sangat besar, maka produk asing akan membanjiri Indonesia dan kita tidak akan menjadi tuan rumah di negara sendiri,” kata Gita saat menghadiri Temu Akbar Alumni Institut Teknologi Surabaya di Jakarta, Sabtu. Ia menjelaskan, konsumsi domestik yang tinggi, mencapai 60 persen dari total produk

domestik bruto (PDB), memang di satu sisi telah menyelamatkan ekonomi Indonesia dari dampak krisis global yang dimulai di Amerika Serikat pada 2008 dan Eropa pada 2011. Faktor itu membuat ekonomi Indonesia tetap tumbuh sekitar enam persen sementara Amerika Serikat kesulitan hanya untuk tumbuh dua persen. Namun di sisi lain, konsumsi domestik yang tinggi

justru membuat pasar Indonesia menjadi tujuan baru barangbarang dari negara yang sebelumnya bergantung pada pasar Amerika Serikat dan Eropa. “Data menunjukkan bahwa transportasi peti kemas ke Eropa berkurang 20 persen pada tahun lalu, ini menunjukkan benua yang sebelumnya menjadi tujuan ekspor itu kini tidak mampu membeli barang-barang dari negara lain,” kata Gita. Akibatnya, barang dari negara eksportir besar seperti China yang berpindah haluan menuju pasar-pasar baru yang tumbuh pesat seperti Indonesia. Total impor Indonesia pada 2011 lalu adalah 177,30 miliar dolar AS atau sekitar 18 persen dari PDB. Selain menyebabkan tingginya angka impor, komsumsi domestik yang sangat tinggi, menurut Gita, juga menyebabkan banyaknya barang-barang murah di bawah mutu standar yang masuk ke Indonesia.

“Sudah banyak produk impor yang melanggar standar nasional Indonesia (SNI), hal ini disebabkan karena masyarakat lebih menyukai barang murah tanpa memperhatikan mutu,” kata dia. Menurut Gita, kondisi itu harus segera disikapi dengan tepat karena jika dibiarkan, masyarakat Indonesia hanya bisa bangga menjadi pengekspor bahan mentah seperi batu bara atau kelapa sawit yang tidak mempunyai nilai tambah. Pemerintah dalam keterangan Gita sedang menyiapkan strategi hilirisasi untuk menciptakan produk-produk lokal yang dapat memenuhi sebagian besar konsumsi domestik. Dari sisi fiskal, strategi tersebut antara lain adalah insentif ‘tax holiday’ (membebaskan suatu perusahaan dari kewajiban membayar pajak dalam kurun waktu tertentu) kepada badan usaha manufaktur baru dengan investasi minimal satu triliun rupiah.

PAN Bantu Wirausaha Antara

PENGHARGAAN PRIMANIYARTA: Presiden Susilo Bambang Yudhoyono (kanan) menyerahkan penghargaan Primaniyarta 2012 kepada Direktur 0 Musim Mas Bahari Karim pada pembukaan Trade Expo Indonesia 2012 di Jakarta, akhir pekan lalu. Musim Mas dan Megasurya Mas (anak usaha Musim Mas) meraih dua penghargaan sekaligus masing-masing untuk Kategori Eksportir Berkinerja Baik dan Pelopor Pasar Baru. Nilai ekspor Musim Mas dan Megasurya terus meningkat bahkan Megasurya melakukan terobosan dengan mengekspor sabun ke Cuba, Korea Utara dan Myanmar yang merupakan bagian dari 132 negara tujuan ekspornya.

Kemlu Dorong RI - Afsel Optimalkan Kerjasama Potensi Ekonomi PANGKAL PINANG (Waspada): Di tengah krisis ekonomi dan melambatnya pertumbuhan ekonomi global, termasuk di negara-negara maju, Kementerian Luar Negeri (Kemlu) RI aktif memperkuat koordinasi dengan stakeholders Indonesia untuk meningkatkan kemitraan dengan negara-negara Afrika. Sejalan dengan penguatan orientasi diplomasi ekonomi, Indonesia menempatkan Afrika sebagai pasar non-tradisional yang penting sehingga memerlukan penanganan yang khusus. Ke m l u b e r k o m i t m e n menggalang, mendorong, dan memfasilitasi pelaku usaha nasional dengan menyediakan informasi faktual dan koordinasi penjajakan peluang bisnis di negara-negara Afrika, termasuk Afrika Selatan (Afsel). Hal tersebut terungkap dalam acara focus group discussion (FGD) bertema Mining and Local Economic Development: Benefiting People towardWelfare, berlangsung di hotel Aston Pangkal Pinang, Bangka Belitung, demikian menurut satu rilis yang disampaikan ke Waspada tentang forum yang diselenggarakan pada 15 Oktober lalu. Forum yang diselenggarakan atas prakarsa Direktorat Afrika ini dihadiri oleh Walikota Pangkal Pinang, Wakil Walikota Rustenburg-Afrika Selatan,

pengusaha Rustenburg, jajaran pejabat Pangkal Pinang, KADIN Pangkal Pinang, pejabat senior PT Timah, wakil KBRI di Pretoria, pelaku usaha di bidang pertanian, akademisi dan media massa. Forum yang secara resmi dibuka Direktur Afrika, Kemlu menghadirkan pembicara Drs. H. Zulkarnain Karim, MM, Walikota Pangkal Pinang; Mr. Tshepo Hope Maifala, Wakil Walikota Rustenburg, Afsel; dan Purwijayanto, Direktur Perencanaan dan Pengembangan Usaha PT Timah. Dalam sambutannya, Direktur Afrika Kemlu Drs. Lasro Simbolon, MA menegaskan Afrika Selatan merupakan negara mitra strategis Indonesia, sekaligus mitra dagang utama di kawasan Afrika. Sejumlah area kerja sama di berbagai bidang antar kedua negara terus mengalami peningkatan yang cukup signifikan. Total nilai perdagangan kedua negara tahun 2011 mencapai US$. 2.1 milyar, tercatat naik sebesar 23% dibanding tahun sebelumnya. Walikota Pangkal Pinang, Drs. H. Zulkarnain Karim, MM, mengapresiasi prakarsa Kemlu untuk menggelar forum ini dengan memilih kota Pangkal Pinang sebagai tempat penyelenggaraan acara dan tempat kunjungan lapangan delegasi Rustenburg. Menurutnya, salah

satu yang telah berhasil dari program ini adalah penerapan industri modern terpadu yang memadukan sektor perikanan, perkebunan, dan peternakan dengan sistem zero waste. Pangkal Pinang memiliki kesamaan dengan Rustenburg sebagai kota tambang, termasuk tantangan-tantangan di kedua kota ini seperti migrasi yang tinggi dan lingkungan hidup. Se m e n t a ra i t u , Wa k i l Walikota Rustenburg, Afrika Selatan Mr. Tshepo Hope Maifala, memuji keberhasilan Indonesia menjadi salah satu kekuatan baru ekonomi dunia. “Indonesia dan Afrika Selatan telah menandatangani sejumlah perjanjian kerja sama di berbagai bidang, dan oleh karena itu dia membawa serta pelaku bisnis setempat ke Pangkal Pinang. Lebih lanjut wakil kota Rustenburg menyampaikan harapan kunjungan ini membuahkan kerja sama yang kongkrit antar pelaku usaha kedua negara, misalnya pembuatan Letter of Intent antar kedua kota untuk mengembangkan sektorsektor ekonomi yang telah diidentifikasikan. Sementara itu, Direktur PT Timbang menggarisbawahi kesiapan perusahaan ini untuk go international termasuk kawasan Afrika. (m10)

MEDAN (Waspada): Partai Amanat Nasional (PAN) komit untuk meningkatkan kesejahteraan masyarakat khususnya generasi muda melalui pelatihan sekaligus modal kerja ke wirausaha muda. Hal ini dikatakan Ketua Umum DPP PAN Ir Hatta Radjasa melalui Ketua DPW PAN Sumut H Syah Afandin saat menyerahkan bantuan modal MAPAN (Maju Bersama PAN) kepada 25 wirausaha muda, Sabtu (20/10) di Hotel Putra Mandiri Jalan Gatot Subroto, Medan. Setiap wira usaha mendapat bantuan modal Rp 5 juta. Karena itu Syah Afandin yang juga merupakan bakal calon (Balon) Wakil Gubernur Sumatera Utara (Wagubsu) dari PAN berharap agar penerima bantuan memanfaatkannya sebaik mungkin. “Kalian merupakan orang yang beruntung karena tidak semua orang mendapat kesempatan seperti ini. Karena itu manfaatkanlah,” ujarnya. Menurut Syah Afandin yang biasa dipanggil Ondim, tidak ada yang tidak bisa di dunia ini asal kita punya kemauan dan niat yang baik. “Kalau kita punya keinginan dan niat baik, insyah Allah akan berhasil,” ujarnya. Karena itu ia berharap agar para penerima bantuan membuat program kerja dan inovasi agar usahanya berhasil. “Sebetulnya apa yang kalian buat ini hal biasa tapi kalau dikemas dengan baik akan menjadi luar biasa dan bisa berhasil. Kalau nantinya berhasil kita siap akan memberikan bantuan lanjutan apalagi jika saya diridhoi Allah dalam Pilgubsu nanti,” ujarnya sambil berharap doa dari seluruh yang hadir. Pada kesempatan itu Ondim juga menyarankan para penerima bantuan untuk membuat jaringan agar usahanya lebih bisa maju dan berkembang. Sebelumnya Ketua DPP PARRA Putra Batubara mengatakan, pemberian bantuan ini merupakan solusi PAN untuk menghasilkan para wirausaha-wirausaha muda. “Karena itu terapkan apa yang sudah diberi dalam latihan-latihan,” ujarnya. Sementara itu Ketua DPW PARRA Sumut Surkani mengatakan, 25 wira usaha muda yang menerima bantuan ini merupakan hasil seleksi dari sekitar 1000 orang yang mendaftar. Mereka ini lanjutnya, telah delapan kali mendapat latihan dan monitoring sehingga telah siap menjalankan usaha dengan bantuan modal yang diberikan. Para penerima bantuan sendiri mengucapkan terima kasih pada PAN melalui program MAPAN dalam membentuk wirausaha-wirausaha muda. Mereka berharap bantuan dalam bentuk konsultasi maupun monitoring dan lainnya tetap diberikan sampai mereka benarbenar mandiri menjadi wirausaha yang mampu bersaing. (m08)


100 Mobil berkonvoi dari Daihatsu SM Raja Menuju Kampung Ladang.

Pemprovsu Desak Legislatif Segera Rayakan Usia 105 Tahun Tetapkan UU Bagi Hasil Perkebunan Daihatsu Gelar Customer Gathering GUNUNGSITOLI ( Waspada): Pemerintah Provinsi Sumatera Utara berupaya mendesak lembaga legislatif untuk membuat regulasi agar pemerintah daerah (Pemda) dapat memperoleh bagi hasil dari sektor perkebunan. Karena, selama ini bagi hasil perkebunan hanya diperuntukkan bagi pemerintah pusat. Asisten II Bidang Ekonomi Pembangunan Sekdaprovsu R Sabrina mengatakan, bagi hasil tersebut bisa mencapai triliunan Rupiah. Seperti misalnya, Badan Usaha Milik Daerah Sumut PT Perkebunan Indonesia mampu memberikan pemasukan sampai Rp9,7 miliar per tahun. Padahal, terdapat puluhan perusahaan perkebunan, baik milik negara maupun swasta yang berada di Sumut. “Rencana undang-undang tentang bagi hasil perkebunan ini sudah dibahas DPR. Kami berharap segera ditetapkan menjadi undang-undang,” kata Hj Sabrina pada acara Workshop Kebanksentralan Wartawan Ekonomi dan Bisnis Sumatera Utara di Kota Gunungsitoli, Nias, yang dilaksanakan mulai Jumat hingga Minggu (19-21/ 10). Sabrina mengatakan, perkebunan tersebut antara lain meliputi perkebunan karet, kelapa sawit, kopi, kelapa, dan kakao.

Kelapa sawit luasnya 855.333,00 hektar dengan total produksi tandan buah segar sebesar 12.070.507,81 ton per tahun. Kopi di Sumut terdiri dari jenis arabika dan robusta. Luas lahan 19.649,16 hektar untuk kopi arabika dan 57.433,17 hektar untuk robusta. Produksi kopi arabika mencapai 19.137,31 ton per tahun. Sedangkan kakao memiliki lahan seluas 67.801,14 hektar dengan produksi 48.745,04 ton. Karet memiliki lahan seluas 449.182,70 hektar dengan total produksi 334.208,66 ton per tahun. Sementara itu, perkebunan kelapa memiliki luas lahan 132.744,80 hektar dengan total produksi 102.662,27 ton per tahun. “Saya yakin UU tersebut akan terbit. Saya melihat, Jatim berhasil memperjuangkan bagi hasil untuk tembakau dan rokok, mestinya Sumut juga bisa untuk perkebunan,” tandas Sabrina. Terapkan SRG Selain itu, Pemerintah Provinsi Sumut juga akan menerapkan Sistem Resi Gudang (SRG) untuk mengurangi potensi kerugian petani saat panen raya dan mengendalikan inflasi. “SRG ini akan sangat membantu petani untuk mendapatkan kepastian. Ini akan menjadi jaminan bagi hasil panen bagi

petani,” katanya. Dalam SRG, lanjutnya, petani dapat menyerahkan hasil panennya kepada Bulog untuk mendapatkan resi. Resi tersebut bisa digunakan petani untuk mendapatkan pinjaman untuk pembelian bibit atau keperluan keseharian. Sementara itu, Kepala Perwakilan BI Wilayah IX Sumut dan Aceh Nasser Atorf yang turut serta dalam workshop tersebut menjelaskan, pertumbuhan ekonomi Sumatera Utara mencapai 6,3 persen dan termasuk tinggi secara nasional. Sektor pendukung laju pertumbuhan ekonomi tersebut antara lain perkebunan kelapa sawit, karet, kakao dan lainnya. Sedangkan Kepala Divisi Ekonomi Moneter Kantor Perwakilan Bank IndonesiaWilayah IX Sumut-Aceh Mikael Budisatrio menambahkan, saat ini pemerintah sudah membangun gudang di Serdang Bedagai, Simalungun, dan Karo. Gudang-gudang tersebut dipersiapkan untuk menampung hasil panen petani. Selain itu, kata Mikael, pemerintah tengah membangun sistem perlindungan lain untuk petani berupa Perusahaan Penjamin Kredit Daerah (PPKD). “PPKD dapat memberikan pinjaman ke petani ketika tanaman-nya mulai tumbuh,” katanya. (m41)

MEDAN (Waspada) : Merayakan usia 105 tahun, Daihatsu gelar Customer Gathering - Bermain Bareng Sahabat Daihatsu yang dilaksanakan di Kampung Ladang, Tuntungan, Medan. “Benar dalam merayakan tahun special Daihatsu, kita menggelar Customer Gathering. Dimana dalam pencapaian 105 tahun dengan sebuah perjalanan panjang dan yang hanya bisa diraih oleh perusahaan besar juga menjalin keakraban dengan customer Daihatsu,” ujar Kepala Cabang Astra Daihatsu SM Raja, Edy Susanto didampingi Kacab Krakatau, Gusyandri, Kacab Tritura, Eric, dan Kacab Capella, Zainal di Medan, kemarin. Pada kegiatan tersebut, lanjutnya, diikuti 100 mobil yang terdiri dari empat anggota keluarga sehingga jumlah peserta fun games berkisar 400 peserta. “Pada kegiatan tersebut digelar outbond kids, fun games dewasa, lomba nyanyi dan bercerita, serta doorprize. “Dapat dikatakan kegiatan tersebut pantas dilaksanakan mengingat perjalanan panjang Daihatsu di Indonesia dimulai sejak tahun 1962 saat Daihatsu Midget yang lebih dikenal sebagai Bemo (becak motor) diperkenalkan untuk menjadi sarana angkutan umum mengantar dan melayani masyarakat Indonesia ke berbagai tujuan. Keberadaan Bemo yang masih dapat kita temui di beberapa tempat saat ini membuktikan kekuatan dan daya tahan produk Daihatsu yang sudah dikendarai selama 50 tahun terakhir ini,” ujarnya. Dengan demikian, lanjut Gusyandri, dalam merayakan 105 tahun usia Daihatsu, berbagai aktifitas telah dilaksanakan sepanjang tahun 2012 ini, di kota Medan sendiri seperti Media Gathering, UKM /Posyandu, Terios SevenWonder (Test Jalan Terios dari Jakarta ke Aceh melalui jalan darat dan sekaligus mempopulerkan wisata kuliner kopi luwak yang ada di pulau Sumatera), Xenia Gathering ( Bermain Bareng Sahabat Daihatsu). “Semua aktifitas terkait Perayaan 105 tahun Daihatsu dimaksudkan sebagai apresiasi bagi para pengguna Daihatsu dan masyarakat Indonesia pada umumnya, atas kepercayaan mereka pada produk Daihatsu,” lanjutnya. Acara ini juga di gelar, lanjutnya, sebagai rasa terima kasih Daihatsu kepada para Sahabat Daihatsu atas pencapaian juara 1 dalam pencapaian SSI Survei (survei kepuasan pelanggang dalam pembelian mobil baru) oleh JD POWER. Sekaligus untuk menandai metamorfosis Daihatsu menjadi “sahabat” bagi masyarakat Indonesia sesuai dengan tema Perayaan 105 Tahun “Daihatsu Sahabatku”. (m38)



Demokrat (Bisa) Hancur Jika KPK Mengulur Waktu


etua Umum Partai Demokrat Anas Urbaningrum dan Menpora Andi Mallarangeng kembali disebut-sebut sebagai otak dari korupsi proyek pembangunan Sports Center Hambalang. Menurut mantan bendahara umum Partai Demokrat Muhammad Nazaruddin dan tersangka kasus dugaan korupsi pada pembangunan Pusat Pelatihan Pendidikan dan Sekolah Olahraga Nasional (P3SON) di Bukit Sentul, Bogor, Deddy Kusdinar, Andi Mallarangeng selaku Menpora harus bertanggung jawab karena mengetahui pasti perubahan site plan proyek triliunan itu. Baik Anas maupun Andi dituding sebagai ‘’otak’’ yang membuat skenario tentang proyek pembangunan senilai Rp2,5 triliun itu. Tentu saja Anas dan Andi membantah, dan bantahan itu sudah diberitakan di media massa. Anas bahkan bersedia digantung jika terbukti menerima walau hanya sepeser. Begitu juga Andi tidak tahu menahu seputar perputaran uang terkait proyek di bawah departemennya. Sebenarnya, tidak hanya kasus AA (Anas dan Andi) saja yang membuat citra Partai Demokrat tercoreng sehingga mengakibatkan jatuhnya tingkat elektabilitas partai ke posisi keempat di bawah Golkar (18,1 persen), PDI-P (14,4 persen) dan Gerindra (12,5 persen) oleh satu lembaga survei. Tapi, sejumlah kasus korupsi lain yang juga melibatkan kader Demokrat ikut menambah rusak citra Demokrat. Sebagian sudah menjadi terdakwa dan sejumlah kader lagi dalam status saksi. Pamor Demokrat bisa separah sekarang ini juga disebabkan tidak konsistennya Bambang Yudhoyono (SBY) selaku Presiden dan Ketua Dewan Pembina Demokrat. Walau sudah ‘’berkoar-koar’’ akan berdiri paling depan dalam pemberantasan korupsi pada masa Pemilu dan Pilpres lalu, namun realisasinya jauh dari apa yang diharapkan. Kita yakin SBY menyadari harapan masyarakat yang begitu besar dalam hal pemberantasan korupsi. Namun prosedur harus ditempuh, termasuk di internal partai yang dilahirkan dan dibesarkannya (Demokrat). Walau banyak pihak mendesak Anas dan Andi segera dilengserkan, namun hukum belum menyentuh keduanya sehingga SBY tidak bisa bertindak tegas. Lagi pula tidak mudah mengganti posisi Anas sebagai Ketum DPP Demokrat. Sebab, dia terpilih dalam kongres. Jauh lebih mudah melengserkan Andi dari jabatannya Menpora karena langsung anak buahnya. Intisari Sayangnya itu pun tak dilakukan SBY. Kalau Wakil Ketua Komisi Pemberantasan (KPK) Busyro Muqoddas mengatakan Semakin banyak saja Korupsi Menteri Pemuda dan Olahraga Andi Mallakader Demokrat resah rangeng bisa saja jadi tersangka dalam kasus korupsi Hambalang. Hal itu bukan melihat perkembangan dugaan yang pertama kalinya disebutkan pimpinan partainya yang semakin KPK. Sebab, Ketua KPK Abraham Samad wartawan juga mengatakan bakal ada merosot di mata rakyat kepada kejutan dari kasus Hambalang. Publik langsung bereaksi ingin tahu dan selalu mengakitkannya dengan Andi dan Anas, apakah benar keduanya terlibat akan dijadikan tersangka atau bebas. Hemat kita, cukup berliku jalan untuk menjerat petinggi politik di negeri ini, apalagi dari partai yang berkuasa seperti Demokrat. Namun KPK tetap memainkan gayanya, seperti menikmati bubur panas. Dimulai dari pinggir lalu ke tengah pusaran buburnya. Tentu kita yakin kalau KPK punya keberanian menuntaskan kasus Hambalang dan juga kasus korupsi yang terkait dengan Kongres Partai Demokrat nan sarat dengan politik uang, tidak sulit untuk menuntaskannya. Tapi, selalu ada kemungkinan intervensi dari pihak-pihak yang berpengaruh di panggung politik dan kekuasaan di negeri ini. KPK pun seperti mengulur waktu sehingga kredibilitas dan popularitas Demokrat bisa hancur bila kasus AA semakin digantung oleh penyidik KPK. Justru itu, untuk meningkatkan status kasus Hambalang dan kasus-kasus megakorupsi lainnya dengan petinggi Demokrat sekelas Anas dan Andi sangat tidak mudah, walaupun di permukaan sepertinya Presiden SBY mempersilakan KPK melakukan pengusutan dan tidak ingin melakukan intervensi. Sepertinya, selama Presiden SBY masih menjadi orang nomor satu sepertinya Anas dan Andi sulit tersentuh hukum. KPK diprediksi baru akan memainkan peranan dan menunjukkan tajinya setelah pergantian atau suksesi pemerintahan 2014. Wajar saja kalau banyak tokoh dan kader Demokrat yang relatif bersih, seperti Ruhut Sitompul dkk mengharapkan Anas dan Andi segera mundur saja dari jabatannya saat ini sehingga kasus-kasus yang melibatkan keduanya tidak membuat pamor partai berlambang bintang mercy semakin terpuruk mengingat Pemilu 2014 semakin mendekat. Bisa dibayangkan jika KPK terus mengulur-ulur waktu sampai setahun ke depan sehingga kehancuran Demokrat akan semakin parah dan sulit diselamatkan lagi. Bisa dibayangkan pula kalau KPK sangat hati-hati karena takut implikasinya pada eksekutif dan legislatif. Rakyatlah yang akan mengadili mereka dalam Pemilu dan Pilpres 2014.+


Faks 061 4510025

Facebook Smswaspada

+6285763330204 WELCOME TO SUMATERA dg ciri khas nya jalan lintas yg compang camping,kolam tempat mancing tersedia di setiap ruas jln di pulau ini,manusia nomor satu pun di pulau ini sudah keasyikan nginap di hotel kelas pilu,ternyata rakyat tidak lapar hnya penghias tidur si kecil yg kian mengecil,kini perebutan kursi lowong di pulau ini telah bergaung dn para kandidat nya pun jarang di rumah asyik merayap mencari simpatik,tp siapa pun kelak yg di percaya mengurus sumatera ini itu janji jangan terlalu muluk muluk karena sulit utk mewujudkn nya lebih baik satu bukti dari pada seribu janji manis uh lubang bagai kolam,mari kita lihat ganti rugi lahan berujung bentrok tumbal nyawa melayang,penggusuran paksa tanpa kompromi sesuka hati meruntuhkn istana istana kecil rakyat lemah,itu hnya secuil ketidak adilan di negeri ini selain cerita pilu sang pemulung,tapi kita harus mencoba tetap bangga sebagai anak bangsa karena hnya itu yg tersisa dlm genggaman,utk bahagia lebih dari sekedar menelan beberapa butiran nasi jauh sudah dari mimpi yg singgah. +6285763330204 Dunia pendidikan di PEMKAB BATU BARA tercoreng atas ulah guru pns di SDN 014752 dgn ambisi dn dendam ingin menyingkirkn guru guru honor yg telah mengabdi bertahun tahun,para guru pns ini berupaya menyingkirkn kepala sekolah dn ingin mengangkat kepala sekolah baru dari kumpulan nya seakan mereka ingin menjadikn sekolah ini jadi yayasan, kepada bapak dinas pendidikan batu bara seharus nya bapak lebih jeli dan teliti menyikapi konflik internal yg trjadi di sekolah itu,ambisi dan dendam berkarat yg terpendam di hati guru pns itu bukan cermin seorang pendidik melainkan akn mengajar anak menjadi pendendam. +6285762103526 Uang parkir on the street, uang tip ato uang preman.? Yang pasti oknum dishub yang cair, nerima setoran dari jukir yang gak ngasi KARCIS sama masyarakat. +6287766217023 Kepada yth : Bapak kapoldasu, mohon dilakukan penahanan pidana pada pejabat pemda dan aparat dipolsek dikec. bandar kab. simalungun atas pemalsuan dokumeasih. +6283197931645 FORMELY Governor ‘ Ali Sadikin dengan Seni Kemeja yang disebut ; Kemeja Model ‘Ali Sadikin • To day Governor Joko Widodo berjaya dengan Seni Corak Kemeja yang disebut; Kemeja Kotak-kotak JokoWidodo • “Panjang Umur berkat Gusti ALLAH nggeeeh ?”# joum’at 26 Wage 1945 Saka * pelang gan tembakau tengku # +6285296915090 Islam tetaap tinggiii,Tuhaaaan berjanji.Walau dicaci dimaki,ALLAAAH LINDUNGiiii.Ingat2 wahe mandum2 syedara ulontuan d nanggroe..!Jumhur ulama spakat bahaupun mereka kadangkala beda mashab.Tp hr ini dnegara yg kebangkitannya dtakuti oleh kaum oreantalis,indonesia msh ragu tuk memakai produk dr ALLAH DAN RASULNYA yaitu QUR an wal HADIST.Mengapa2 oh mengapa menuhankan manusia smentara tuhan sluruh makhluk dan alam adalah ALLAH SWT.Mengapa ?.@l @mir @lghazi syihabuddin.2jantan api# +6285296805107 Karena di Indonesia masih sangat menyedihkan polisi saja sebagai penegak hukum dan begitu juga kejaksaan, dlam mnyelesaikan suatu kasus banyak sekali terjadi kecurangan,masih byak pelaksana2 yg tergiur dengan uang yg membuat ia skejap kaya,intinya pemerintah saja tidak percaya sepenuhya terhadap penegak hukum oleh karena itu pemerintah membentuk KPK, selaku untuk lebih meminimalisir uang2 rakyat yg shrusya ke rakyat tapi tdak ke rakyat,trima kasih.

WASPADA Senin 22 Oktober 2012

Perjumpaan Agama Dan Teknologi Oleh M Ridwan Lubis Selayaknya,dakwah yang harus memanfaatkan teknologi bukan teknologi yang memanfaatkan dakwah.


eradabanumatmanusiaditopang oleh perkembangan ilmu pengetahuan dan teknologi sebagai salah satu bagian dari tujuh aspek budaya yaitu bahasa, kepercayaan, seni, norma, nilai, teknologi, simbol. Kebutuhan terhadap teknologi adalah merupakan konsekuensi keinginan manusia untuk memperoleh kehidupan yang semakin nikmat, mudah dan nyaman. Akibatnya, lahirlah berbagai penemuan teknologi mulai dari yang sederhana sampai yang paling canggih. Teknologi sebagai sebuah prestasi dalam bidang teknis tetaplah berada pada posisi sebagai alat untuk mencapai tujuan. Sebaliknya, nilai yang terdalam dari kehidupan hanya diberikan oleh agama. Karena itu, agama adalah kebenaran absolut pedomanhidupyangditurunkanAllahkepada manusia agar mereka tidak tersesat dalam menjalaniseluruhkehidupan.Pemahaman keagamaanjugadapatmenjadipenghalang bagi perkembangan teknologi antara lain dengan munculnya sikap apologetic di dalam memahami perkembangan ilmu pengetahuan dan teknologi yaitu ketika orang melihat dalam teknologi terdapat nilai yang selalu bertentangan dengan kepentingan agama. HeidiACampbellmenulissebuahbuku berjudul When Religion Meets New Media yang diresensi dan kemudian diterjemahkan dengan judul Bagaimana Agama Memandang Teknologi. Ia menyebutkan bahwa negosiasi dan manifestasi keagamaanyangdidukungteknologiakanselalumenimbulkan pro dan kontra yang berkisar padapenentuanotoritas,identitasdanpraktik keagamaan. Penelitian tersebut adalah respon yang diberikan umatYahudi, Kristen dan Islam terhadap media baru yang dibatasi pada teknologi bergerak, digital, dan berjaringan seperti internet, computer dan telepon seluler. Ia menemukan empat jenis respons beragama terhadap media baru itu seperti penggunaan media internet untuk penyebaranagama,pemanfaatanteknologiuntuk menunjang praktik keagamaan. Selain dari itu adalah pesan-pesan kerohanian, doa harian dan alarm untuk mengingatkan saat berdoa. Respons lain adalah munculnya kekhawatiranberkompromidenganteknologi akibat dampak negatifnya. Di akhir resensi dikemukakan kesimpulan bahwa pertentangan yang terjadi sesungguhnya

bukan antara agama dengan teknologi tetapi arus budaya sekuler dengan keagamaan. Perkembangan teknologi dalam suatu kepastian sementara keberadaan budaya sekuler terserah pada pilihan masing-masing. Teknologi pada satu sisi menguntungkan bagi agama karena akan semakin memberikan kemudahan bagi umat beragama menjalankan ajaran agamanya. Sebagai contoh pengamalan ajaran Islam terkait cara untuk mengetahui arah kiblat, waktu shalat, perhitungan awal dan akhir bulan dalam rangka penentuan kegiatan keagamaan dan lain sebagainya. Kemudahan melaksanakan ibadah haji yang jaraknya demikian jauh tetapi dengan perkembanganteknologimakajarakyangjauh itu menjadi dekat. Demikian juga ketika melakukan komunikasi dengan perangkat teknologi begitu mudah dalam pelaksanaan ajaran merajut tali kasih sayang sesama manusia, tetapi juga tentunya teknologi dapat dipergunakan apa saja mencakup tujuan yang baik atau buruk. Perkembanganteknologimenawarkan kemudahan khususnya dalam tiga bidang yaitu transportasi, telekomunikasi dan turisme. Sarana transportasi akan memudahkan terjadinya mobilitas sosial. Mobilitas sosial menjadi bagian dari programpengembangandakwahsehingga dakwah yang semula hanya terpusat di daerahyangmudahdijangkauberdasarkan alasan transportasi kemudian perkembangannyamelesatjauhmasukkepelosokpelosok. Perkembangan missionary pada daerah yang dahulunya tertinggal sekarang telahberkembangtanpaadanyahambatan yang berarti. Demikian misalnya, perkembangan missionary Kristen di Tanah Papua dapat berkembang ke seluruh pelosok negeri karena jasa sarana transportasi. Daerah kepulauan Nias dahulunya identik dengan keterpencilanbagimerekayangmelakukan tugassuciyaitumenyebarkanajaranagama

bagi saudara-saudara kita yang belum menganut agama samawi. Dengan kemudahan transportasi, maka daerah terpencil dapat dijangkau oleh para muballigh maupun missionary dalam jangkauan waktu yang relatif singkat. Rintisan dakwah untuk menjangkau daerah terpencil di Sumatera Utara pada masa lalu adalah Yayasan Baitul Makmur yang dipimpin oleh Dr H.Gading Hakim. Dalam bidang telekomunikasi, pengaruh media baru teknologi terhadap wacana pengembangan keberagamaan adalah beragamnya program di media elektronik dalam menyebarkan informasi terhadap agama. Misalnya seperti fitur panduan shalat, masuk waktu, arah kiblat, doa-doa, pedoman mencari ayat Alquran, mencari Hadis dan lain sebagainya—merupakan contoh-contoh dari pengaruh teknologi media baru sebagai sumbangan untuk kemudahan pelaksanaan ajaran agama. Tetapi, harus pula diakui sejalan dengan teknologi sebagai perangkat bebas nilai maka teknologi juga dapat berakibat kerusakan mental masyarakat terutama di kalangan generasi muda. Apabila pertumbuhan telephone seluler di India menurut Kishore Mahbubani dalam bukunya Asia Hemisfer Baru—terjadi percepatan yang sangat fenomenal dalam bidang teknolgi komunikasi yang dampaknya membantu rakyat dalam pengembangan di bidang teknologi hasil-hasil pertanian. Tetapi yang terjadi pada sebagian masyarakat kita justru penggunaan handphone hanya bersifat konsumtif dan rekreatif sehingga penggunaannya terbatas bersifat konsumtif dan menjurus rekreatif semata. Kemudahan mengunduh gambargambar di internet membuat sebagian remaja terlena dalam perkembangan teknologi—akhirnya menjadi inspirasi timbulnya berbagai perilaku yang menjurus kepada pathologi sosial seperti perkelahian, perampokan, perkosaan dan lain sebagainya. Peranan televisi maupun media elektronik lainnya pada satu sisi membawa pengaruh positif bagi pengembangan wacana keberagamaan sebagaimana yang dapat disaksikan ketika bulan Ramadhan lalu—umat Islam disuguhi

siaran dakwah. Tetapi, tentunya juga harus disadari bahwa sekalikupun kuantitas tayangan Ramadhan begitu tinggi tetapi tidak selamanya membawa efek positif karena siaran itu banyak yang dikemas berlatarbelakang kepentingan komersial sementara dakwahnya hanya sekedar menopang motif komersialitas itu. Dalam kaitan itulah maka dapat disimpulkan bahwa wacana keberagamaan tidak dapat mengisolasi diri dari pengaruh teknologibaikcetakmaupunelektronik.Iaakan terus melakukan penetrasi ke dalam keluarga sebagai unit terkecil masyarakat. Persoalannya kemudian adalah tergantung dari seberapa kuat umat beragama melakukantigakebijakansekaligusyaituadaptasi, akomodasidanseleksiterhadapmediabaru teknologi. Selayaknya, karena itu dakwah yang harus memanfaatkanteknologibukan teknologi yang memanfaatkan dakwah. Adalah wajar manakala dakwah atau siaranagamayangmemanfaatkanteknologi karena teknologi tidak lebih dari sekedar alatsedangpesan-pesannilaibaikdanburuk berakar pada pernyataan ajaran agama. Karena itu, para pemuka agama maupun pemerintah hendaklah berusaha sekuat mungkinmelakukanrekayasaprogramagar nilaidakwahatauajarankeagamaanlainnya yang harus mengendalikan teknologi untuk menuju kepada terbentuknya masyarakat yang penuh makna (meaningfull society)— sebagai cikal bakal dari umat yang memiliki perilaku moderasi (ummatan wasathan) agar bisa menumbuhkan etos kesaksian (syuhada ‘ala al nas) sebagai pelaksanaan misi kemanusiaan di permukaan bumi. Turisme juga sebagai wujud dari masyarakat modern mendorong terjadinya mobilitassosialmenjangkaudaerah-daerah yang merupakan tujuan-tujuan wisata.Terjadinyamobilitassosialtentulahtidakberdiri sendiri tetapi sekaligus dengan ikutannya yaitu budaya maupun pola keberagamaan masyarakat pendatang bertemu dengan budaya dan keberagamaan penduduk setempat. Demikianlah terjadinya akulturasi budaya serta proses saling belajar dalam kegiatan keberagamaan secara global. Tetapi, proses penyiaran agama dalam kaitan global ini juga hendaklah didasari kewaspadaan—agar jangan sampai penyiaran agama tersebut dimaksudkan untuk mengekspor pola keberagamaan negara lain yang sifatnya menjurus kepada radikalisme dan fundamentalisme—yang isinya cenderung selalu menafikan pola tradisi keberagamaan masyarakat dan hanya mengakui kebenaran pola keberagamaan yang dibawanya. Penulis adalah Guru Besar UIN Syarif Hidayatullah Jakarta.

Meneguhkan Religiusitas Pelajar Oleh Torang Rambe ...wajah pendidikan kita tidak bisa jauh dari aspek religiusitas apalagi di tengah terpaan sekularisasi di segala bidang yang sangat membahayakan kaum pelajar.


ntuk kesekian kalinya wajah pendidikan Indonesia kembali menorehkan catatan buram seiring dengan kambuhnya penyakit klasik anarkisme kaum pelajar yang menelan korban nyawa. Sungguh miris memang, bangsa yang konon katanya sangat ramah dan lembut ini tapi dalam tampilannya seolah menjadi sebuah monster menakutkan. Tawuran, chaos, gengmotor, konvoi massal, narkoba dan perilaku liar lainnya dari sosok generasi penerus bangsa ini menjadi senandung duka cita pelajar kita. Sebenarnyabiladilihatlandasanfilosofis pendidikan, termasuk tujuan pendidikan nasional sangat luar biasa adalah sebuah garansibetapanegeriyang lohjinawegemah rifah inijauhdarisifatbarbardanbrutalisme. Gagasanpembentukanwatakdanperadaban yang mencerdaskan bangsa dalam kamus pendidikan adalah proyek besar bangsa ini sejak dulu hingga kini. Agaknya, tidaklah pantas negeri ini menjadi negara pecundang,meminjamistilahpakarsebagai calon negara gagal. Nauzu billahi min zalik. Lihatlah misalnya betapa gamblangnya tujuan pendidikan nasional menempatkan aspek ketuhanan menjadi urutan utama yakni mewujudkan manusia yang beriman danbertakwakepadaTuhanYangMahaEsa. Tapi nyatanya, sebagaimana dalam khazanah intelektual Sayyid Qutub seolah agama danTuhanterlempardarikehidupanmanusia. Evolusi religiusitas dan moralitas yang seharusnya menajadi jati diri para pelajar seolah tercerabut dengan derasnya alunan mesra arogansi, anggar jago dan isme-isme kelompok sektarian yang sangat berbahaya. Di sini dan kedisinian membangun karakter kaum pelajar adalah sebuah sikap yang perlu segera dilakukan. Pembentukan personalitas para pelajar yang tangguh dan berkeadabandengansegudangprestasihatta pembuat impian (the dream maker) yang mengantarkan bangsa ini menjadi sebuah kebanggaan, adalah cita-cita bersama. Waktu masih tersedia memang untuk terus menutup rapat catatan kelam perilaku pelajar indonesia tanpa tiada henti. Pelajar Berbasis Religius Eeksistesi kehidupan spritual keagamaan bagi kaum pelajar dengan religiusitas yang mumpuni adalah sesuatu yang tidak dapat ditawar lagi. Kiranya tepat apa yang dikatakan orang bijak bahwa jangan ada ruang yang kosong dalam setiap denyut kehidupan manusia dari agama dan kehidupan religius. Sentuhan batin semacam ini adalah sebuah desakan yang mesti diamalkan setiap orang secepat mungkin, bukan saja para kaum pelajar tentunya. Hampir seluruh pakar sosial keagamaan dariTimur dan Barat dalam penelitian mereka selalu saja sampai kepada kesimpulan bahwa faktor agama dengan religiusitasnya menjadi sangat vital, bukan hanya sebuah kebutuhantapiagamaakanmenjadisebuah nilai (value) yang akan mampu mengontrol

individu atau masyarakat. Agama sebagai petunjuk akan selalu setia memberikan kerangka acuan dalam berpikir, bertindak, berperilaku agar senantiasa sejalan keyakinan yang dianutnya. Secara jitu Mc.Quire, pakar psikologi keagamaan ternama menyebut bahwa sistem nilai yang berdasarkan agama dan religiusitas akan memberikan pedoman bagi individudanmasyarakatsebagaibentukkeabsahan dan pembenaran dalam kehidupan. Bila ditelisik akar masalah betapa murahnya amukmasadanamarahparapelajardewasa ini dalam banyak hal karena kaum pelajar telah kehilangan sistem nilai (baca : agama) yang seharusnya melekat dalam dirinya. Dalam proses pendidikan Islam inilah yang disebut dengan nilai-nilai yang terkandung padapengetahuanagamayangditanamkan pendidik kepada peserta didik (internalisation of values). Tidak ada institusi yang paling kredibel membentengi para pelajar dari penyimpangan sosial dan ketertiban moral selain agama. Kiranya sudah tepat kembali bila wajah pendidikan kita tidak bisa jauh dari aspek religiusitas apalagi di tengah terpaan sekularisasi di segala bidang yang sangat membahayakan kaum pelajar. Penyimpangan yang amat revolusioner dan sangat berbahaya sekali yang dilakukan umat manusia dewasa ini, termasuk kaum pelajar adalah menjauh dari Allah dan lari dari agama serta mendirikan bangunan kehidupan berdasarkan asas sekuler. Akibat yang ditimbulkannya adalah pengacaubalauan konsep manusiawi terhadap pengertian“manusia”. Sebab, dari satu sisi konsep ini berlandaskan asas penggambaran material-hewaniterhadapmanusia,sementara dari sisi lain berdasarkan pada prinsip “parsialisasi” manusia. Jadi, diagnosanya adalah kembali kepada Allah sedini mungkin dengan religiusitas yang anggun dan bersahaja. Kegaduhansosialyangdilakukankaum pelajar adalah pelajaran sangat mahal yang harusdibayardenganterusmelakukankerja keras terutama di kantong pendidikan yang intensitas dan bobot pendidikan agamanya sedikit berkuarang. Bila pelajar kembali disuguhi kedekatan dengan Tuhan yang diyakininya lalu ia tampil menjadi sosok yang religius akan menjadi sebuah pemandangan indah pada masa datang. Sebaliknya, bila mentalitas anak didik hanya berkutat kepada soal kecerdasan intelektual— tanpa diimbangi kecerdasan spritual dan emosional yang tangguh maka bangunan anak didik yang nota bene calon penerus bangsa akan mengalami kemunduran yang sangat berbahaya. Pentas PAI : Setetes Harapan Ditengahmaraknya perilakuyangtidak gentledilakukankaumpelajardanterpelajar di negeri ini, agaknya, tidak berlebihan bila mementum pentas Pendidikan Agama Islam (PAI) khususnya bagi sekolah umum yang digagas Kanwil Kementerian Agama

se-Sumatera Utara (Hari Kamis, 18 Oktober 2012 di Asrama Haji) sangat tepat. Bagaikan setetesembunditengahdahagakaumpelajar dengan sederet perilakunya yang menyimpang. Internalisasi pendidikan agama bagi kaum pelajar tidak bisa dihindari lagi sebagai basis mereka dalam menyambut estapet tanggungjawab kebangsaan pada masa akan datang. Pekan Keterampilan dan Seni PAI dengansegalaperlombaanyangdipertandingkanakan wawasandanpemahamankeagamaan dan moralitas kaum pelajar pada sekolah akan sangat menjadi penting artinya. Setidaknya, ada beberapa alasan mengapa pentas PAI tahun 2012 ini digulirkan: Pertama, sebagai ajang mendekatkan diri kepada sang Khalik.Tidak bisa dinyana lagi bahwa keterasingan manusia denganTuhan akan melahirkanmanusianestapa,hampa,panik dankegersanganspritualsangatakut.Sudah dapat dipastikanbahwapelajaryangkosong akan religiusitaslah yang sering muncul sebagai pembuat kegaduhan sosial (social destroyer) baik di lingkungannya, di sekolahnyadantempatdimanaiaberada.Pendidikan agama adalah warisan yang sesungguhnya mesti ditinggalkan kepada generasi dan sekaligus yang akan dibawanya pula di akhir hayatnya. Kedua,untukmeningkatkanmutupendidikan agama Islam secara komprehensif di sekolah. Harus diakui bahwa bobot dan desain kualitas pendidikan agama pada sekolah (umum), memang masih banyak yang harus disentuh apalagi “ruang” dan fasilitas yang diberikan masih belum seimbang sebagaimana dengan mata pelajaranyang lain. Ketiga, Penginternalisasian nilai-nilai agama. Ajang ini tentu akan kembali mempertegas bahwa dengan penguasaan dan penghayatan baik secara langsung atau tidak langsung terhadap agama akan menambah modal bagi pelajar betapa agama yang diyakininya telah mengantarkan dia pada posisi adikodarti yang tak bisa dielakkan. Keempat, peningkatan kreativitas dan motivasi.Miskinkreasiadalahambangyang akan melahirkan seseorang pada situasi yang tak seimbang karena ia akan terjebak pada rutinitas dan kebosanan. Motivasi adalah sebuah seni hidup yang mesti ada dalam diri setiap manusia karena ia adalah karunia yang amat mahal harganya. Dalam teori sejarah akan selalu ada sekelompok kecil individu kreatif pada hampir semua masyarakat yang bertindak sebagai pemimpin, pelopor, pembaharu dan penemu yang menciptakan gagasan baru, cara-cara baru dan teknologi baru. Kelima,keteladanandanpanutan.Salah satu yang hilang dari negeri ini akhir-akhir ini adalah keteladanan. Karena miskinnya bangsa ini dengan para manusia teladan boleh jadi pelajar juga kehilangan pegangan sehingga ia tidak bisa meniru idola yang ia teladani. Justru yang muncul adalah tata kelola penampilan sosok yang arogan dari para tokoh yang berseberangan dengan yang ada dalam imajinasinya. Negeri ini memang sedang membutuhkan para pemimpin idola dan teladan yang luar biasa. Inilah salah satu proyek besar Pentas PAI dihadirkan. Penutup Derasnya arus penyimpangan kaum

pelajar belakangan ini adalah patut dipikirkan oleh semua kalangan. Pelajar bukan saja sebagai potensi masa depan tapi ia juga sekaligus penyangga akan tegaknya sebuah bangsa. Bukankah Soekarno pernah secara lantangberkata“berikanakusepuluhpemudaakanakugoncangdunia”.Negeriinimembutuhkan sosok pemuda dan pelajar yang mampu menggoyang dan menggoncang dunia dengan segala kelebihan dan karyakaryanya yang dilandasi oleh rahmatTuhan. Negeri ini muak dan bosan menyaksikan pemuda dan pelajar yang hanya mampu mempertontonkanbudayaanarkisme,pandalismedansimbol-simbollainyangsemestinya tidak ada dalam kamus anak muda Indonesia. Kehidupan spritual dan kemesraan denganTuhan adalah modal dasar yang harus dimiliki oleh setiap orang, khusunya para pelajar sehingga mereka lebih terkontrol dimasa mudanya yang penuh dengan gejolak. Anak muda yang modern dan progresif tidakakanmalutampilmodisdenganatribut religiusitasnya. Kiranya, kaum pelajar harus dibekali dan membekali diri dengan senantiasa membangun kedekatan denganTuhan sehingga murka Tuhan dan munusia tidak menjadiakrabdalamdirikaumpelajar.Insya Allah. Penulis Adalah Kasi Mapenda Kemenag Deliserdang.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pem-baca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/ tidak diterbitkan di Media manapun. Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggung-jawab penulis.

SUDUT BATUAH * Penertiban terminal liar setengah hati - Masih ragu-ragu! * Banyak tokoh dijagokan dampingi Gus Irawan - Kayaknya sudah yakin kali, he...he...he * Kemiskinan terus melanda Indonesia - Terutama miskin akhlak


D Wak


WASPADA Senin 22 Oktober 2012

Wajib Belajar 12 Tahun

Salsabila Penderita Tumor Salsabila penderita Tumor Cerebellum dengan fluid level berukuran lebih kurang 6 x 5,8 cm didaerah mid cerebellum yang menekan ventricle 4 dan brain stem ke anterior juga menderita Hydrocephalus (kepala besar) sejak usia tiga tahun lalu kini telah mencapai 70 persen kesembuhan. Saya senantiasa mencari kesembuhan Salsabila 7 tahun, atau Sasa begitu dia disapa sehari-hari lahir di Medan 10 Januari 2005. Semua rumah sakit yang ada di Kota Medan sudah dibawanya Salsabila berobat dan sudah tujuh dokter yang menangani anaknya itu. Semua dokter mengatakan, penyakit Hydrocephalus belum ada obatnya kecuali dioperasi melalui selang di kepala. Jika dioperasi tidak menjamin kesembuhannya, kalaupun berhasil menjadi anak idiot. Alasannya ada Tumor Cerebellum di otaknya harus diangkat dan harus menjalani kemotraphy puluhan kali. Karena resikonya terlalu besar, Yuyun pun mengurungkan niatnya untuk mengoperasikan si Salsabila dan dibawa anaknya itu ke orang pinter namun hasilnya sama sekali tak ada kemajuan. Sementara penyakit bocah tersebut semakin hari, semakin mengkhawatirkan. Kepalanya terus bertambah besar, sehingga susah membuat dirinya untuk duduk dan jalan. Selain itu, Sasa juga sering menangis menahankan rasa sakitnya. Mungkin karena Allah kasihan dan hiba melihat Yuyun, ditunjukkan jalan kepadanya melalui seseorang yang dikenalnya. Orang tersebut menyarankan agar si Sasa dibawa berobat kesalah satu dokter Amerika yang ada di kota Medan. Saran dan anjuran tersebut tidak bisa disia-siakannya. Dalam dua minggu Salsabila sudah ada perubahan. Sudah bisa mengangkat kepala, duduk dan berdiri. Sekarang Sasa sudah empat bulan berobat dan kemajuannya sangat luar biasa. Kini dirinya sudah bisa bertitih jalan tanpa pegangan dan juga bisa bernyanyi. “Pengobatan yang dilakukan dokter Amerika itu sudah banyak disembuhkannya di antara penyakit Autis, Idiot, Kanker, Jantung, Kecing Manis, Gangguan Ginjal, Gangguan Liver dan penyakit lainnya,” jelas Yuyun yang didampingi Salsabila. Lebih lanjut dijelaskannya, pengobatan yang dilakukan dokter Amerika itu bukan kimia melainkan suplemen. Dalam kesempatan ini,Yuyun mengharapkan uluran tangan dari dermawan atau donator untuk meneruskan pengobatan si Salsabila. Karena biaya untuk kesembuhannya sangat mahal. Salsabila tinggal di Jalan Pelajar Gang Sadar No. 4 A Teladan Timur Medan atau dibelakang Toko Muslim Jaya. Hp. Yuyun Sri Rahayu 081263377915. Yuyun Sri Rahayu Orang Tua Salsabila

Mari Kita Sambut Kehadiran Sepultura Diprovinsi Sumut Horas...Horas....Horas...suatu hal yang menggembirakan kita bersama khususnya dikalangan Underground Metal pada umumnya, sebagaimana kita ketahui bersama, Sepultura akan mengguncang kota Medan nah ini merupakan suatu penghormatan dan patut di support tinggi. Saya mengharapkan kehadiran kita semua dan mari kita sambut kehadiran sepultura dikota kita tercinta ini, provinsi Sumut. Kepada seluruh panitia nantinya jangan sombong serta memberikan akses seluas luasnya kepada pemburu pemburu berita yang berskala internasional termasuk, TNI/Polri sedangkan kepada penonton jangan anarkis: “Jagalah nama baik daerah dimata internasional”. Wassalam Uli Surya A.R. Binjai Barat-Sumut


Gingging—Kebenaran Selain dengan akal pikiran, kebenaran itu juga didekati dengan rasa. Itu sebabnya, di samping atas pertimbangan alat bukti— kesaksian, hakim juga memutuskan perkara atas dasar keyakinannya—atas dasar “rasa” terhadap suatu kebenaran. Orang tua juga begitu. Ketika memutus perkara pertengkaran anak-anaknya, ia juga akan menggunakan rasa itu ketika memberi keputusan. Ketika si sulung bertahan dengan kesaksiannya, dan adiknya tak mau kalah dengan pendapatnya. Maka rasa akan kebenaran itu seketika akan muncul berkatakata. Kalau bukti itu bersifat wujud, maka rasa itu cuma bersemayam di dalam benak. Kalau bukti bersadar pada logika, maka rasa menyandarkan diri pada naluri, feeling atau hunch kata orang sana. Kalau bukti itu muncul di depan, maka rasa itu selalu jadi kesimpulan di belakang. Kalau bukti itu bisa direkayasa oleh siapa saja, tapi rasa ini tidak bisa. Dia cuma mungkin ditekan oleh pemiliknya sendiri, tanpa bisa dihilangkan. *** Dalam posisi ditekan, rasa itu akan menyublimasi di dalam benak. Dan, suatu ketika kelak dia akan muncul lagi. Ini adalah model sistematis yang berlaku universal. Ketika rasa kebenaran itu hendak muncul, maka logika yang ditawarkan ataupun kekuasaan yang hendak meredam tiba-tiba akan kehilangan efektivitasnya. Segala kekuatan yang dikerahkan, hanya akan semakin membuatnya semakin tangguh. Maka tak ada cara lain, beralihlah untuk berpihak padanya, sebelum engkau dilindasnya. Itulah sebabnya ketika KPK yang terlanjur dianggap sebagai pendekar korupsi, terlanjur didukung banyak pihak, maka setiap upaya melemahkan KPK, justru akan menemukan kenyataan sebaliknya. Apa yang disebut dengan “Semut Rangrang” KPK semakin meluas ke mana-mana dan siap untuk lebih luas lagi. Anda masih ingat toh ketika Bibit – Chandra hendak dibui. Maka pembelaan itu,

Oleh Drs Muhammad Rais, MPd, MSi Daerah yang telah berhasil dalam melaksanakan program wajib belajar sembilan tahun sangat masuk akal kalau kemudian mencanangkan program wajib belajar 12 tahun melalui peraturan daerah masing-masing.


unia pendidikan di Indonesia pada awal abad ke 21 menghadapi tiga tantangan besar.Tantangan pertama, sebagai akibat dari krisis ekonomi, dituntut mempertahankan hasil-hasil pembangunan pendidikan yang telah dicapai. Kedua, untuk mengantisispasi era global dunia pendidikan dituntut mempersiapkan sumber daya manusia yang kompeten agar mampu bersaing dalam pasar global. Ketiga, sejalan dengan diberlakukannya otonomi daerah, perlu dilakukan perubahan dan penyesuaian sistem pendidikan nasional sehingga dapat mewujudkan proses pendidikan yang lebih demokratis, memperhatikan keberagaman kebutuhan atau keadaan daerah dan peserta didik, serta mendorong peningkatan partisipasi masyarakat. Komitmen pemenuhan kebutuhan pendidikan sangat penting bagi kelangsungan pembangunan sumber daya manusia bangsa. Komitmen pemenuhan kebutuhan pendidikan bagi setiap warga negara tanpa terkecuali merupakan kewajiban negara. Salah satu upaya memenuhi kebutuhan pendidikan dilakukan melalui program wajib belajar 12 tahun. Program wajib belajar (Wajar) 12 sesungguhnya merupakan lanjutan dari program wajib belajar 9 tahun. Program wajib belajar 9 tahun dilaksanakan melalui jalursekolah maupun jalur luar sekolah. Program jalur sekolah meliputi program 6 tahun di SD dan program 3 tahun di SLTP. Pola-pola yang diterapkan di tingkat SD antara lain SD Reguler, SD Kecil, SD Pamong, SD Terpadu, Madrasah Ibtidaiyah, Pondok Pesantren, SDLB, dan Kelompok Belajar Paket A. Sedangkan pola untuk SLTP adalah SLTP Reguler, SLTP Kecil, SLTP Terbuka, SLTP Terpadu, Madrasah Tsanawiyah, MTs Terbuka, Pondok Pesantren, SLTPLB, SLB, dan Kelompok Belajar Paket B. Perubahan wajib belajar dari 9 tahun menjadi 12 tahun, awalnya sebatas dorongan yang hanya ditujukan bagi daerah-daerah tertentu yang telah mapan. Itu lebih supaya APBD terutama untuk pendidikan lebih fokus penggunaannya. Pemberlakuan wajib belajar semestinya diikuti kewajiban pemerintah menjamin setiap anak bisa bersekolah dengan menyediakan semua saran dan prasarana yang dibutuhkan. Pasalnya, sebagai konsekuensi logis kebijakan itu, negara

menanggung semua biaya yang dibutuhkan bagi siswa untuk mencapai standar minimal sekolah dalam masa wajib belajar. Sementara UU Sisdiknas tegas menyatakan kewajiban pemerintah menyediakan dana penyelenggaraan wajib belajar 9 tahun. Wajib Belajar 12 Tahun Demi membangun pendidikan di daerah-daerah maju, sangat diperlukan peran para bupati dan wali kota untuk memberikan prioritas utama alokasi anggaran daerah untuk pendidikan. Keberhasilan mengembangkan sumber daya manusia mesti menjadi ukuran sukses seorang bupati atau wali kota. Daerah yang telah berhasil dalam melaksanakan program wajib belajar sembilan tahun sangat masuk akal kalau kemudian mencanangkan program wajib belajar 12 tahun melalui peraturan daerah masing-masing. Pun demikian, daerah-daerah yang telah mencapai angka partisipasi kasar (APK) anak usia SMP di atas 90 persen sudah selayaknya memulai program wajib belajar 12 tahun. Konsistensi mengembangkan pendidikan nasional berdasarkan prioritas yang tidak bertentangan dengan UU Sisdiknas perlu terus dijaga. Karena ada dua tujuan yang harus dicapai dalam pendidikan yang sering tak searah satu sama lain, yakni kepentingan untuk mengejar mutu dan keinginan memeratakan pendidikan. Mutu pendidikan rata-rata memang harus ditingkatkan, tetapi pendidikanjuga harus mampu mendorong anak-anak dan sekolah tertentu untuk menjadi unggulan. Kepentingan untuk memeratakan pendidikan dan mengejar mutu pendidikan itu harus dibangun dalam sistem yang dikembangkan secara arif dan bijaksana. Sebagai bentuk kesinambungan dan konsekuensi logis dari program wajib belajar 9 tahun, Kementerian Pendidikan dan Kebudayaan (Kemendikbud) akan menyiapkan rintisan wajib belajar 12 tahun pada tahun 2013. Hal ini mempertimbangkan juga jumlah Angka Partisipasi Kasar (APK) yang diperkirakan akan mengalami peningkatan. Untuk saat ini jumlah APK SMA/SMK sebesar 70%. Jika APK peserta didik SMP diperkirakan naik 10% menjadi 80% maka terdapat tambahan sekitar 900 ribu peserta didik

tanpa komando terjadi di mana-mana. Bahkan buaya tidak berdaya memangsa cicak—lagian kok ya ada buaya yang doyan cicak. Kemudian lihatlah betapa gingging-nya para advokat itu menyampaikan kebenaran versi mereka. Saya kira apa yang disampaikan cukup logis, benar semua—menunjukkan betapa piawai orang-orang itu. Tapi ketika logika kebenaran itu berbenturan dengan rasa yang menyublimasi tersebut, maka semakin kuat pembelaan, cuma akan membuat lawan semakin besar. Itu juga mengapa ketika ada wartawan dipukuli sampai babak belur dan kameranya dirampas, tapi ada wartawan lain yang malah mem-video-kan dan menyebarluaskannya. Semakin kuat upaya membela perilaku kekerasan oknum TNI itu, semakin banyak orang yang bernada sinis. Semuanya “membabakbelurkan” pelaku tindak kekerasan itu. Simaklah pemberitaan yang meluas di media massa itu. Lihatlah komentar-komentar yang bejubel di jejaring sosial. Seseorang cukup menempelkan di dinding statusnya, foto pria berseragam mencekik pria lain yang menyandang kamera. Maka ratusan bahkan ribuan caci maki kemudian menyerbu habis-habisan. Kasihan deh. *** Kemenangan itu memang bisa didapat dengan cara gingging. Seberapa kuat engkau betekak bertegang urat, bisa mempengaruhi tingkat capaianmu pada apa yang engkau sebut kemenangan. Ketika kendaraanmu bersenggolan dengan kendaraan orang asing di jalanan, maka ilmu ginging ini bisa menentukan “kemenanganmu”. Untuk suatu jabatan, untuk menang perkara, untuk menonjol dalam komunitasmu, untuk kelihatan superior, kalau gingging, engkau bisa sampai ke sana. Nikmatilah kemenangan itu sedapatnya, rasakanlah ke-puasan itu sampai ke puncaknya. Karena ketika rasa kebenaran itu akan muncul, engkau akan tergerus tak bersisa.(Vol.356, 22/10/2012)

Kolom foliopini dapat juga diakses melalui

baru. Saat ini terdapat sekitar 7200 kecamatan di seluruh nusantara.Tapi, kecamatan- kecamatan tersebut belum teridentifikasi jumlah yang belum memiliki sekolah-sekolah setingkat SMA/ SMK. Untuk suksesnya program ini, paling tidak setiap kecamatan dapat memiliki masing-masing satu sekolah SMA/SMK yang layak untuk peserta didik pada tahun 2013. Karena itu, rintisan wajib belajar yang dipersiapkan akan diikuti dengan meningkatkan jumlah community college—ditujukan untuk peserta didik lulusan SMA/ SMK. Bagaimana Dengan Sumut ? Data dari Susenas tahun 2011 BPS Provinsi Sumatera Utara menunjukkan APK di Provinsi Sumatera Utara sebagai berikut : SD 104,56%, SMP 89,02% dan SMA/SMK 79,69%. APK dari sebaran di perkotaan dan pedesaan adalah, untuk perkotaan : SD 103, 16%, SMP 89,59% dan SMA/SMK 87, 16%, sedangkan untuk pedesaan : SD 105,83%, SMP 88,47% dan SMA/SMK 71,94%. Dari data tersebut jelaslah bahwa APK Provinsi Sumatera Utara untuk tingkat SMA/SMK melebihi APK secara nasional. Dengan demikian program wajib belajar 12 tahun sanga layak untuk dilaksanakan. Dengan pelaksanaan wajib belajar 12 tahun tersebut, maka apa yang

menjadi cita-cita Pemerintah Provinsi Sumatera Utara “agar rakyat tidak bodoh” dapat direalisasikan. Realisasi “agar rakyat tidak bodoh” ini lewat program wajib belajar 12 tahun yang nantinya akan menghadirkan SDM yang siap bersaing baik lokal maupun nasional. Dalam konteks kekitaan, Sumatera Utara, maka wajib belajar 12 tahun penting untuk segera dikawal pelaksanaannya agar hasilnya maksimal—karena berkaitan dengan berbagai tantangan masa depan. Beberapa studi juga menunjukkan bahwa proses demokrasi bisa berjalan dengan baik ketika didukung tingkat pendidikan masyarakatnya. Kemudian bahwa wajib belajar 12 tahun menjadi penting karena memiliki hubungan dengan Indeks Pembangunan Manusia (IPM). IPM sangat terkait erat daya saing suatu bangsa. Jadi, wajib belajar 12 tahun dapat digunakan sebagai penghantar untuk mencetak generasi masa depan yang lebih siap bekerja agar dari segi usia dan kompetensi siap.Yang penting, ke depan jangan ada anak lulusan SMP yang memilih untuk bekerja. Mereka harus melanjutkan sekolah, dan digodok agar lebih siap bekerja melalui pendidikan.Karena lamanya waktu pendidikan sangat terkait dengan pendapatan perkapita suatu negara. Penulis adalah Anggota Dewan Pendidikan Provinsi Sumatera Utara.

Menghentikan Tawuran Pelajar Oleh Honriani Nasution, ST

Dedi Sahputra


Aturan kapitalis demokrasi pulalah yang menyebabkan media informasi menayangkan tontotan yang tidak mendidik, menayangkan aksi kekerasan yang menjadi pembelajaran bagi anak-anak.


erita tentang tewasnya Alawy Yusianto Putra, siswa kelas X SMA N 6 Jakarta pada 24 September lalu telah menyita perhatian berbagai pihak. Kontan saja tragedi di dunia pendidikan tersebut mengundang orang untuk mendiskusikan apa sebenarnya yang terjadi dengan para pelajar dan dunia pendidikan saat ini. Salah satu stasiunTV swasta pun mengangkat tema ini dengan judul ‘Tawuran kok Jadi Budaya’. Dari tema saja sudah menggambarkan bahwa ada fenomena tawuran yang telah membudaya di kalangan pelajar. Wajar saja jika ada yang menilai tawuran itu sudah membudaya di kalangan pelajar, karena ternyata tawuran yang terjadi antar SMA Negeri 70 dengan SMA Negeri 6 Jakarta bukanlah kejadian pertama dan sepertinya juga tidak akan menjadi kejadian terakhir, dan akan menular ke daerah lain. Artinya akan muncul lagi tawuran antar pelajar setelah kejadian ini. Hal ini terbukti dengan adanya tawuran tanggal 3 Oktober 2012 antar SMA Negeri 8 dengan SMA Negeri 5 di Medan hanya diakibatkan oleh masalah rebutan pacar. Berbagai kalangan pun menyatakan pendapatnya tentang penyebab terjadinya tawuran antar pelajar, ada yang melihat dari perspektif psikologi, sehingga solusi yang ditawarkan juga dengan perspektif psikologi anak, yaitu cenderung memberikan kebebasan kepada anak, dan tidak baiknya orang tua memaksakan kehendak kepada anaknya, yang ujung-ujungnya sarat dengan nilainilai liberal. Menurut penulis kuranglah tepat jika melihat penyebab tawuran dan solusinya itu hanya dari perspektif psikologis karena hanya bersifat parsial/ individualis dan tidak mendasar. Penulis berpendapat bahwa penyebab tawuran itu tidak lain adalah diberlakukannya aturan kehidupan yang kapitalis demokrasi di tengah kancah kehidupan ini. Karena aturan kapitalis demokrasi inilah para orang tua – terutama ibu – tersibukkan mencari nafkah sebanyak-banyaknya. Karena dalam aturan kapitalis demokrasi seorang ibu tidaklah dipandang mandiri jika mengharapkan biaya hidupnya dari suaminya. Walaupun suaminya berpenghasilan lebih dari cukup, para ibu tetap

akan digiring agar masuk dunia kerja dengan alasan pemberdayaan perempuan. Dan ini termasuk salah satu program yang sangat gencar diupayakan oleh menteri pemberdayaan perempuan. Akhirnya para ibu yang terpengaruh dengan pemikiran ini akan berlomba-lomba masuk dunia kerja yang akan mengakibatkan para ibu melalaikan fungsi ibu, sebagai pendidik utama dan pertama bagi anak-anaknya yang akan memberikan efek fatal terhadap pendidikan anak. Akhirnya fungsi ibu dialihkan kepada pihak sekolah. Efek berikutnya adalah kurangnya perhatian dan kasih sayang dari seorang ibu kepada anak-anaknya. Ini menyebabkan para anak mencari perhatian di luar rumahnya. Maka tidak heran jika saat ini banyak remaja yang lebih suka berbagi cerita dengan teman facebook-nya daripada dengan ibunya, karena ibu tidak sempat lagi meluangkan waktu mendengar cerita pengalaman anaknya di luar rumah. Kalaupun mendengar sudah dalam kondisi tidak fit, karena ibu pulang ke rumah hanya untuk istirahat. Ibu lebih sering memberikan senyum manisnya kepada bosnya/kliennya dibandingkan kepada anaknya. Dalam benaknya senyum terhadap klien akan menghasilkan rupiah, senyum kepada anak toh tidak menghasilkan rupiah. Akhirnya para ibu bersifat materialis, the time is money sebuah semboyan yang melekat dalam benaknya! Aturan kapitalis demokrasi pulalah yang menyebabkan pihak sekolah tidak optimal mendidik anak-anak. Pihak sekolah lebih disibukkan mengelola keuangannya, memikirkan berbagai cara mendapatkan sumber pembiayaan sekolah dan memikirkan bagaimana caranya agar pemilik sekolah – jika swasta – mendapatkan keuntungan materi dari dunia pendidikan. Adapun sekolah negeri, setali tiga uang memikirkan bagaimana agar status sekolahnya menjadi sekolah favorit. Karena dengan semakin meningkat status sekolah bantuan dana pun akan banyak mengalir. Anehnya demi meningkatkan status sekolah pun menghalalkan segala cara! Ironisnya lagi pembiayaan sekolah dibebankan kepada anak murid dalam bentuk SPP – sekolah swasta- dan dibebankan kepada

rakyat – orang tua murid – melalui pajak untuk sekolah negeri. Anak murid sudah membayar SPP mahal, orang tua sudah membayar pajak mahal, tapi anak-anak tetap tidak mendapatkan pendidikan berkualitas dan tidak merasa aman di lingkungan sekolah—karena pihak sekolah tidak memasilitasi dengan satpam yang cukup dan capable. Aturan kapitalis demokrasi pulalah yang menyebabkan gap antara si kaya dan si miskin semakin tajam. Dengan alasan memedulikan pendidikan orangorang miskin, berbagai sekolah mengeluarkan kebijakan pembiayaan sekolah dengan subsidi silang. Artinya, pihak yang kaya dibebankan biaya sekolah yang mahal dan pihak yang miskin dibebankan biaya yang murah atau gratis. Jelas program ini semakin membuat si kaya merasa lebih hebat dari pada si miskin yang akhirnya menimbulkan sikap meremehkan si miskin di kalangan orang kaya—akan menyebabkan kecemburuan sosial semakin tinggi yang bisa menjadi pemicu tawuran antar pelajar. Aturan kapitalis demokrasi pulalah yang menyebabkan media informasi menayangkan tontotan yang bersifat tidak mendidik ke arah yang lebih baik, tontonan yang menayangkan aksi kekerasan yang cenderung menjadi pembelajaran bagi anak-anak. Walaupun dalam acara disebutkan harus dengan bimbingan orang tua, namun faktanya anak tetap menonton tanpa bimbingan orang tua. Demikian pula halnya dengan lingkungan di luar rumah sangat tidak kondusif untuk proses tumbuh kembangnya anak ke arah yang lebih baik. Bagaimana bisa dikatakan memiliki pengaruh yang baik, aktivitas judi bisa ditemukan hampir di setiap tempat, begitu juga dengan aktivitas-aktivitas yang mengarah kepada pornografi dan pornoaksi dengan mudahnya dapat terindra oleh anak didik. Bahkan ironisnya aktivitas kekerasan dan pornoaksi ini pun masuk ke dalam lingkungan sekolah dalam acara penerimaan siswa baru ataupun ospek dengan alasan untuk membangun mental calon pelajar/ mahasiswa. Awal September 2012, penulis mendapatkan sebuah cerita dari seorang mahasiswa yang sedang mengikuti Ospek di salah satu perguruan tinggi swasta. Di kampusnya Ospek penuh dengan kalimat-kalimat vulgar/ seronok dan aktivitas melakonkan hubungan suami istri. Mahasiswa tersebut cerita bahwa dia menangis menghadapi Ospek di kampusnya karena telinga dan matanya tidak sanggup

menghadapi acara yang penuh dengan nuansa pornografi. Ironisnya lagi, ketika si mahasiswa menceritakan tentang hal itu kepada orang tua dan minta agar dia tidak ikut Ospek, orang tua hanya menjawab, itu-kan sudah bagian dari program kampus. Jika kamu tidak ikut Ospek bisa-bisa nanti kamu dikeluarkan dari kampus tersebut, toh kita sudah membayar mahal untuk masuk ke kampus tersebut. Karena memang SPP di kampus itu mahal, maklum kampus swasta dan fakultas kedokteran! Ketika kita sadar bahwa kapitalis demokrasi yang menjadi penyebab utama membudayanya tawuran antar pelajar, lalu apa yang mesti kita lakukan agar anak-anak kita tidak ikut tawuran atau tidak menjadi korban tawuran? Mungkin mayoritas masyarakat akan mengatakan solusi yang tepat adalah agar para orang tua mendidik anaknya di rumah dengan baik dan optimal. Penulis cenderung tidak setuju dengan pendapat ini, karena pada faktanya masih ada orang tua yang mendidik anaknya di rumah dengan baik, tapi si anak tetap bisa ikut tawuran karena takut terhadap ancaman temannya yang mengajak tawuran. Atau jika dia bisa menolak ikut tawuran dia akan menjadi korban tawuran karena siswa yang mengajak tawuran merasa tersinggung dengan penolakannya. Artinya pendidikan yang baik di rumah jika tidak mendapat lingkungan yang kondusif maka tidak akan memberikan hasil yang optimal. Maka penulis lebih condong mengajak masyarakat – pembaca – untuk berjuang bersama mencampakkan sistem kapitalis demokrasi ini dan menggantinya dengan sistem Islam – khilafah Islamiyyah – yang akan menerapkan sistem pendidikan yang berasaskan Islam - murah/gratis, berkualitas dan sama rata, karena sistem pendidikan hanya akan terwujud jika ditopang sistem ekonomi Islam dan sistem pemerintahan Islam. Jelas sistem pendidikan Islam tidak bisa terwujud dengan sempurna dalam sistem kapitalis demokrasi. Akhirul kalam, memperjuangkan tegaknya khilafah adalah kewajiban bagi setiap Muslim, karena itu sebagai seorang Muslim sudah semestinya kita memperjuangkan tegaknya khilafah agar kita bisa masuk ke dalam Islam secara menyeluruh, selamat dunia dan akhirat. Wallahu a’lam. Penulis adalah Asisten Juru Bicara Muslimah Hizbut Tahrir Indonesia.

B8 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

A C : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window


Xenia, Terios Ready Stock. Pesan sekarang sebelum harga naik Hub. Hasibuan Astra 0812 6362 4634 PA K E T DA I H AT S U M U R A H Xenia DP 19 Jt-an Angs. 3 Jt-an Terios DP 22 Jt-an Angs. 5 Jt-an PU DP 9 Jt-an Angs. 2 Jt-an Full Disc, Data dijemput. Hubungi: ISHAK 0812 6510 5060


Khusus PNS Swasta dan wiraswasta juga bisa. Ready Stock, Xenia, Terios, Luxio, Gran Max PU & MB Sirion. Kredit Hingga 5 thn. Proses Cepat. Hub. PAIREN 0812 6305 0708

DAIHATSU BARU Xenia, Terios, Grand Max PU, Ayla. DP Ringan, Proses Cepat + Discon & Souvenir lainnya. Data dapat dijemput. Hub. LENNI 0813 7042 2217 # DAIHATSU BARU UTK PNS & UMUM # All New Xenia DP 27Jt, Angs. Rp. 3,5Jt (59 Bln). New Gran Max PU DP 8 Jt-an, Angs. Rp. 2,6 (97 bln) Proses Cepat, Data dijemput, Mobil diantar Hub. Arif Nasution Astra Daihatsu. 0812 6005 2465



“DAIHATSU PAKET MURAH” Gran Max Pick Up DP 7 Jt-an Angs. 2 Jt-an Gran Max Minibus DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 16 Jt-an Angs. 5 Jt-an Xenia M. Deluxe DP 21 Jt-an Angs. 4 Jt-an Terios TS Xtra DP 21 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061 77402067


Terios................Angs. 2.900.000 Xenia................Angs. 2.511.000 Gran Max......... Angs: 2.400.000 City Car “AYLA” Sudah Bisa Di Inden * Ready Stock, Proses Cepat* Promo Tambahan Hub. RIAN 0812 6383 691

100% BARU


Dapatkan Promo Menuju Akhir Tahun Semua Type Diskon, menarik, DP 15%. Atau Angs. 2 Jt-an Hub. 0811 6052 882. IRFAN

DAIHATSU Xenia 1.300cc Thn. 2005 XI BK Medan. W. Coklat muda met. Kondisi mobil siap pakai. Hrg. Nego. Mobil Simpanan jual cepat. HP. 0852 7650 6242


Jazz, CRV, Freed, City, Civic & Brio Accord. Proses Cepat. Hub. ROZAK 0823 620 32888 HONDA Civic Ferio ‘96. W. Biru tua I Thn. BK Mdn Asli, sangat Mls, Cat 95% M. Asli dalam M. Ori/Mulus. 83Jt. Nego. Hub. 0852 9777 9004


Thn. 2000 + Set Lengkap + Silver Kondisi Bodi + Mesin Mulus Terawat + Siap Pakai (Pemakai Wanita + RT + AC + Matic + TV + Dll. Harga Rp. 60 Jt (Nego) s/d Jadi Peminat Serius Hubungi Jln. Sei Asahan No. 74. HP. 0857 6306 9660 (Depan Gereja HKBP) Jam. 09.00WIB s/d 14.00 WIB. KIA Visto 2003, Silver. Jok kulit, AC, Tape, VR, CL, No. pilihan. Mulus luar dalam, Hub. 76808022

5 CM 6 CM

Rp. 65.000 Rp. 78.000

PROMO SUZUKI BARU Carry PU, New Mega Carry Extra, Ertiga, APV, langsung survey, data dijemput. Hub. 0853 5897 0889 (Freddy) TOYOTA Kijang Kapsul Solar LGX Th. ‘99 BK Mdn Lengkap, siap pakai. W. Coklat muda met. Hrg. Nego. Jual Cepat HP. Hub. 0811 652 506

TOYOTA Innova G Bensin, Thn. 2005. Biru, BK Mdn Rp. 143Jt. Hub. 0852 7538 3218 TOYOTA Kijang Krista Diesel Thn. 2003. Hitam, BK Mdn Rp. 145 Jt. Hub. 0813 6145 0444.


Avanza, Innova, Fortuner PURBA: 0813 9736 0333

TOYOTA PAKET AKHIR TAHUN READY: Avanza, Innova, Yaris, Fortuner, dll. Full Discount, Hub. DICKY. 0853 5939 7782 *TOYOTA BARU 2012*

(Dealer Resmi Toyota) 1. New Fortuner Bunga 0% Angs. 5.569.000 2. New Yaris...Angs. 2.900.000 3. New Rush...Angs. 3.304.000 4. All New Avanza...Angs. 2.800.000 5. Gran New Kijang Innova Angs. 3.304.000 Semua tipe Ready Stock. Terima Tukar Tambah. Info lebih lengkap Hub. 0852 7515 0363. Dapatkan Juga Promo Hadiah Spektakuler di bulan ini.


Ready Stock Avanza dan Veloz, Innova, Fortuner, Yaris, Hilux. Dapatkan penawaran menarik sampai Raya Haji, dan hadiah langsung. Discount Besar Hub. 0813 6121 1719 / 6878 3325 Bisa Tukar Tambah.






- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954


Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500

SOLUSI DANA CEPAT Max. 1 Hari Cair, Tanpa Usaha, Yang ditolak Bank. Jaminan. SHM SK. Camat, HGB Ruko Pabrik, BPKB Mobil, Spd. Mtr, Mobil Kredit. Pencairan hingga 500 Milyar. Hub. Bpk Roy 0813 7044 6633 - 0813 6229 0001

NISSAN PROMO OKTOBER Beli Evalia Grand Prize Mio. Promo lain untuk March, G. Livina. Hub. Aulia (0812 6027 255)

SUZUKI Sidekick Thn. ‘95 warna biru metalik. Mobil siap pakai, body kaleng2, Ban 4 Baru. Khusus yang nyari mobil cantik. (Mobil simpanan). Hub. 0813 7043 0799 SUZUKI Baleno Th. 95 Built-Up. W. Hitam, Body kaleng, mesin bagus, AC, PW, CL, Remot, MR, Son. Hrg. 53Jt damai. Hub. 0821 6463 7090

SUZUKI Escudo 1.600cc Th. 2004. BK Medan manual. Cat dan mesin mulus. W. Hitam met. Hrg. Nego Jual Cepat. HP. 0821 6021 0957


Carry PU, Ertiga, APV Arena LIWAN: 0852 6111 7724



- BUNGA TABUNGAN= 8%/Pa - BUNGA DEPOSITO = 8%/Pa - BUNGA DEPOSITO KHUSUS *) 1 Bln = 9% 6 Bln = 11% 3 Bln = 10% 12 Bln = 12%


Telp. (061) 844 6489, 882 6936, 847 5544, 795 4444, 736 8754, (0622) 430 780, (0623) 348 322, (0624) 573 7456

Rp. 91.000 Rp. 104.000


SEPEDA MOTOR YAMAHA Scorpio Thn. 2011 dijual. Warna hitam, mulus sekali, jarang dipakai. Mobil original. H. 19Jt. Hub. 0853 6010 8884 YAMAHA Vega R Thn. 2008 Dijual. Mulus, cantik, ibu2 yang pakai. Harga 4 Jt. Sisa Angsuran 340.000 x 10 Bulan. Hub. 0812 6053 1522



Telah tercecer/ hilang satu berkas Surat Tanah No. 17480/ A/I/24- Tanggal 11 Oktober 1973 A/n. Ds. R.M.G. Marbun, STh (Alm), Tanah terletak di Kampung Blok IX Tanjung Rejo Kecamatan Sunggal, tercecer sekitar Jl. Asahan Kota P. Siantar. Bagi yang menemukan mohon menghubungi Netty Marbun: 0812 6485 694 Jl. Kertas Koran No. 31 P. Siantar


MENJUALPECI TEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA




Usaha kecil, 6%/thn cair 20 s/d 40 hari kerja (Syarat & Ketentuan berlaku) Gunakan warnet/internet e-Proposal klik menu CSR untuk mendaftar


IFA Dahsyat mencari member Dapatkan komisi2, uang, sepeda motor, perjalanan ibadah, wisata, mobil, rumah, dll. Hub. Ibu Melawati 061 7947364, 0812 6548 425, 0819 6015 795, 0813 6229 7935


Telp.66482216 - 0813 7589 8757 Siap Ketempat



Ada Garansi



0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi

Ingin Promosikan Produk Anda


Media yang Tepat untuk Iklan Anda

KANTOR: GEDUNG GELORA PLAZA Lt. 1 Jl. SM. Raja No. 4 / 18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488



HP. 0813 7035 7291



Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Umroh Reguler 9 Hari 16, 20, 30 Januari Umroh Reguler 11 Hari 20 Januari Umroh Reguler 14 Hari 18, 25 Januari Umroh Plus Cairo / Istanbul

Bagi Jamaah luar kota menginap di Hotel Madani (Gratis) Pesawat via Singapore Menjual Tiket Domestik








Nomor: 02/PWS-Unham/X/2012 WISUDA SARJANA UNIVERSITAS AMIR HAMZAH Kepada seluruh Calon Wisudawan/ti untuk mengikuti WISUDA SARJANA UNHAM TAHUN 2012 yang akan dilaksanakan pada: Hari/ Tanggal : Sabtu/24 November 2012 Jam : 08.00 wib s/d selesai Tempat : Convention Hall - Hotel Danau Toba Internasional (HDTI) Jl. Imam Bonjol No. 17 Medan INFORMASI DAN PENDAFTARAN DI FAKULTAS MASINGMASING dengan ketentuan: Pendaftaran dimulai tanggal 8 Oktober 2012 dan ditutup tanggal 10 November 2012. Pengambilan Toga dan Undangan Wisuda 12 - 17 November 2012. Demikian untuk dimaklumi. Medan, 15 Oktober 2012 PANITIA WISUDA SARJANA UNHAM PERIODE TAHUN 2012

Manasik Haji & Umroh


Manasik setiap Hari - Sabtu : Pkl 14.00 s/d selesai - Minggu : Pkl 09.00 s/d selesai Tempat Manasik : Mesjid Agung Medan






UMROH 2013




Ada Garansi


Perkawinan, Sunatan, Kantor.




Door to Door Domestik & Int’l SRT-MOVING Telp. (061) 7711 8811 Jl. B. Katamso 557 Medan - Ritra Group



Rasa Indonesia Konsep Kaki Lima Untuk Wilayah: Aceh & Sumut 0813 9604 9377 0852 6247 6607



HP. 8219951




Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


Mari Bergabung Bersama





Apabila anda mencurigai sesuatu, silahkan hubungi kami di



IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat



11 CM Rp. 165.000 12 CM Rp. 180.000

HA TI-HA TI HATI-HA TI-HATI TIterhadap penipuan yang mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI membeli produk anda, dan HA HATI-HA TI-HATI TIapabila anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab

BPKB Spd. Motor Honda BK 6199 CQ A/n. T. Firmansyah Alamat Jl. Ismailiyah No. 138 Kec. M. Area Medan No. Rangka : MH1JB81167K042024 No. Mesin : JB81E-1042668


9 CM Rp. 126.000 10 CM Rp. 140.000



AYO MENYIMPAN UANG MITSUBISHI Kuda 2000 Super Exceed Bensin, Hitam silver, Alarm, Central Lock, DVD, Jok kulit. BPKB 1 nama, Mobil cantik bener. Kaleng2. Siap pakai. H. 80Jt. Nego. Hub. 0812 656 8818 / 7730 5875

7 CM 8 CM

Senin, 22 Oktober 2012


* * * * *

Umroh Reguler 9 Hr / 13 Hr Umroh Plus Mesir Umroh Plus Turkey Umroh Plus Aqsho Umroh Ramadhan Daftarkan segera ke: Kantor Pusat MULTAZAM Medan Jl. Titi Papan Gg. Pertahanan No. 10 Sei Sikambing Medan Telp. 061-4576116 / 061-4512319 HP. 0813 6137 2321

Klik di YouTube “Zulfikar Siregar Mimpi Bertemu Rasulullah” Subhanallah.... Semoga Bermanfaat


Metode pengobatan dengan cara ditotok dibagian syaraf dan kelemahannya dan diberikan Ramuan/ Jamu, 100% alami tidak ada efek samping bebas usia, bebas untuk semua agama, REAKSI DITEMPAT KHUSUS PRIA: - Panjang: 13, 15, 16, 18, 20 - Besar: 3, 4, 5, 6 - Impotensi - Kurang Keras/Ejakulasi dini - Tidak punya keturuan - Hernia KHUSUS WANITA: - Memperbesar payudara - Mempersepit vagina KONSULTASI UMUM: - Buka Aura - Pengasihan/penglarisan usaha - Masalah rumah tangga - Ingin dapat jodoh/pelet Alamat: Jl. SM. Raja depan Hotel GARUDA PLAZA samping Klinik BUNDA Gg. Keluarga No. 13C HP. 0812 6057 6444








TV, LCD, LED, PS, AC, KULKAS, M. CUCI, dll. Hub. 0812 6032 3040 / 0812 6032 3050



Oleh-oleh Khas Medan, Tanpa bahan pengawet !!, Mutu dan Kualitas dijamin, Siap antar ke tempat !! Hub. 0812 6080 3533/Henny Pin BB: 2A032E63 Alamat: Jl. Pipit 8 No. 303 P. Mandala Medan

Keterangan lebih lengkap silahkan hubungi:


T ELPON : 061 - 4576602 F AX : 061 - 4561347






Dasar, Junior, Senior, TOEFL, IELTS, Pers, Tuk ke luar negeri, dll, Group, Private/Gab. Pin bb: 26D6201C Hub. Mr. Jatin Singh (0852 7033 7088)

* Format: JPG - TIFF (Photoshop)


Menerima Siswa Baru, Instruktur Berpengalaman, Garansi Sampai Mahir, Ruang belajar Wi-Fi, Bonus Alat Kerja

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:


WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347

Hub. MB 1 Celullar Jl. Besar Delitua No. 1 (Depan Jl. Stasiun/Sekolah Istiqlal) Telp. (061) 703 2619HP. 0813 6113 9888


PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188


Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?


Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243




WASPADA Senin 22 Oktober 2012

07:00 Dahsyat 09:00 Sinema Pagi 11:00 INTENS 12:00 SEPUTAR INDONESIA 12:30 Sinema Siang 14:45 SILET 15.30 Olivia 16:30 SEPUTAR INDONESIA 17:00 Layar Drama Indonesia : Putri Bidadari 18:15 Layar Drama Indonesia : Yang Masih Di Bawah Umur 19:00 Layar Drama Indonesia : Separuh Aku 20:15 Layar Drama Indonesia : TUKANG BUBUR NAIK HAJI THE SERIES 22:30 Mega Sinema RCTI


07:00 SL Inbox 09:00 SL Liputan 6 Terkini 09:03 Halo Selebriti 10:00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 11:03 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:00 SL Liputan 6 Terkini 14:03 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:00 SL Liputan 6 Terkini 16:03 SL Eat Bulaga Indonesia 17:00 SL Liputan 6 Petang 17:30 Putih Abu-Abu 19:30 Ustad FotoCopy 22:30 SL Liputan 6 Terkini 22.33 Si Biang Kerok 23:33 FTV Utama

07:00 Disney Club : Handy Manny 07:30 Serial Pilihan 08:30 Serial Pilihan 1 10:00 Kisah Unggulan 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Diantara Kita 15:30 Lintas Petang 16:00 Aksi Didi Tikus 16:30 Animasi Spesial : Leon 17:00 Si Bolu 18:00 Tendangan Si Madun Season 2 19:00 Aladdin 20:00 Jagoan Silat 21:00 Raden Kian Santang 22:00 Dia Ayu 23:00 Intermezzo 00:00 Premier Highlights 00:30 Sidik 01:00 Lintas Malam 01:30 Sidik Kasus 02:00 Cerita Dinihari

07.3 0 Fenomania 08:00 Fresh & Fun 08:30 Friends 09:00 Seleb @ Seleb 10:00 Glory Jane 11:30 Topik Siang 12:00 Klik ! 13:00 Tom & Jerry 13:30 Little Krishna 14:00 Tom & Jerry 14:30 Chotta Bheem 15:00 Ghost Gang 15:30 Mr. Bean 16:30 Suka-Suka Nizam 17:30 Topik Petang 18:00 Pesbukers 19:30 Catatan Si Olga 20:30 Drama Korea : Boys Before Flowers 21:30 Mel’s Update 22:30 Black In News 23:00 World’s Most Amazing Videos

07:00 KISS Pagi 08:00 Sinema TV Pagi: 10:00 Sinema Tv Spesial: Jihan 12:00 Patroli 12:30 Drama Asia (Korea): 49 Days 14:00 Drama Asia (Korea): Thank You 15:00 KISS Sore 16:00 Fokus 16:30 Drama Asia: Can You Hear My Heart 18:00 Miniseri Spesial: Abay Anak Ajaib 19:00 Miniseri Spesial: Jalan Ke Surga 20:00 Sinetron Unggulan: Hikayat Ali Baba 22:00 Buaya Show 23:00 Mega Asia

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Metro Xin Wen 11.05 e Lifestyle 13.05 Zero to Hero 14.30 Metro Sore 15.30 Public Corner 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Prime Interview 21.05 Top Nine News 22.05 Economic Challenges 23.05 Metro Realitas 23.00 Metro Sports

B9 07:30 Ranking 1 08:30 Semangat Pagi 09:30 Fun Cooking 10:00 Bosan Jadi Pegawai 10:30 Insert Siang 11:30 Jelang Siang 12:00 Reportase Siang 12:30 Jika Aku Menjadi 13:15 Jail 14:00 Magic Comedy 14:30 Digital Clip 15:00 Sketsa 16:00 Show Imah 17:00 Reportase Sore 17:30 Inside 18:15 Comedy Project 19:15 Tahan Tawa 20:15 Canda Bule 20:45 Bioskop TransTV 22:45 Bioskop TransTV

06:30 Apa Kabar Indonesia Pagi 09:00 Keliling Indonesia 10:00 Coffe Break 12:00 Kabar Siang 13:00 Kabar Haji 13:30 Ruang Kita 14:30 Kabar Pasar Sore 15:00 ISM 16:00 Bumi Dan Manusia 17:00 Kabar Petang 19:00 Kabar Utama 20:00 Apa Kabar Indonesia Malam 21:00 Kabar Malam 22:00 Menyingkap Tabir 22:30 Kabar Arena 23:00 Kabar Hari Ini

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:00 Spongebob Squarepants 08:00 Avatar : The Legend Of Aang 08:30 Awas Ada Sule 09:30 Hot Spot 10:00 Dapoer Cobek 10:30 Obsesi 11:30 Buletin Indonesia Siang 12:00 Indonesia Bicara 13:00 Doo Bee Doo 14:00 Cagur On The Street 14:30 100% Ampuh 16:00 Fokus Selebriti 16:30 Oggy and The Cockroaches 17:00 Kartun 17:30 Kartun 18:00 Mantu-Mantu Morotin Mertua 19:00 Big Movies 21:30 Big Movies

James Bond-Skyfall Diberi Nilai Bintang 5 Seri teranyar James Bond, Skyfall banyak dipuji kritikus, beberapa bahkan menyebutnya sebagai film Bond terbaik sepanjang masa. Masih mengusung peran utama dibintangi Daniel Craig, film ke-23 ini disutradari pemenang Piala Oscar Sam Mendes. Ini adalah kali ketiga Craig memerankan agen rahasia 007. “Jelas ini adalah salah satu film terbaik Bond,” kata Geoffrey McNab dari The Independent seperti dikutip BBC. “Mendes berhasil kembali ke dasar,kejar-kejaran, adeganadegan berbahaya, perkelahian.

Pada saat yang sama Mendes berhasil menghidupkan kembali film ini, menambahkan karakterisasi ketimbang film dangkal yang biasa kita tonton,” tambah McNab. Bahkan Kate Muir dari The Times menyebut Skyfall sebagai sang jagoan film Inggris. “Sejak momen suara orkestra lagu Adele muncul, film ini sudah berhasil membuat penonton merinding, dan pasti langsung tahu film ini akan mengulang kejayaan klasik Bond,” tulis Muir. Baz Bamigboye dari The Daily Mail memberi film ini lima bintang penuh dan menyebut-

nya kombinasi fantastis 007 dan Bourne, Spooks, serta Home Alone. Robin Collin dari The Telegraphs tak ketinggalan memuji Mendes. “Dia tak takut membiarkan momen-momen dramatis muncul dan sinematografer Roger Deakins membuat potongan-potongan aksi liar nan ambisius, adegan-adegan paling indah yang pernah ada selama perjalanan 50 tahun Bond.” Dalam Skyfall Dame Judi Dench kembali memerankan M16 Direktur M, sementara Ralph Fiennes, Ben Whishaw dan

The Road Jalan Sepi Pembawa Petaka Sebuah misteri pembunuhan 20 tahun lalu meninggalkan kisah yang menyeramkan. Dan siapapun yang melewati jalanan berhantu itu, hidupnya akan berakhir tragis. The Road terdiri dari tiga bagian cerita. Chapter pertama (2008) diawali dengan adegan tiga remaja: Ella (Barbie Forteza), Janine (Lexy Fernandez) dan Brian (Derrick Monasterio) yang berkeliling kota dengan mengendarai mobil. Karena jalan raya ditutup, mereka terpaksa mengambil jalan tua. Perjalanan mereka menjadi pengalaman menakutkan dengan kehadiran sebuah mobil yang datang tiba-tiba, tanpa pengendara. Tak hanya itu, sosok perempuan dengan wajah tertutup plastik dan berdarah-darah, kerap muncul membuat suasana makin mencekam. Dua diantara mereka akhirnya ditemukan tewas ke-esokan harinya, dilanjutkan penyelidikan kepolisian pimpinan Luis (TJ. Trinidad). Ceritapun bergulir ke paruh kedua film ini (1998) saat kakak beradik Joy (Louise delos Reyes) dan Lara (Rhian Ramos) melalui jalan yang sama sepulang sekolah. Karena mobil rusak, merekapun meminta bantuan seorang pemuda (Alden Richards) yang belakangan justru menghabisi nyawa mereka. Paruh ketiga mengisahkan peristiwa tahun 1988 dimana seorang bocah mendapat perlakuan sadis dari ibunya sementara sang ayah gantung diri karena tak tahan menghadapi problema rumah tangga. Mampukah Luis memecahkan misteri itu? The Road adalah satu dari film horror yang ditayangkan dalam Asian Fear Fest melalui satu-satunya saluran televisi berbayar khusus film horror dan thriller Asia dan Hollywood: Thrill. The Road hari Sabtu, 20 Oktober, pukul 20:00 di saluran Thrill dapat diakses melalui Indovision (ch. 19); Okevision (ch. 8); Aora (ch, 221); Telkom Vision (ch. 610); CentrinTV (ch. 313) dan OrangeTV (ch. 162).(m19)

Naomie Harris bergabung menjadi sekutu Bond. Para kritikus pun memuji akting Javier Bardem yang memerankan karakter antagonis Silva. Menurut McNab, Bardem berhasil menjadi tokoh penjahat dengan kombinasi rasa getir dengan sifat keji Hannibal Lecter dalam film Silence of the Lambs. Caroline Jowett dari The Express menambahkan, “Dia bukan penjahat yang ingin mendominasi dunia seperti Ernst Blofeld, tapi dia selalu mengejutkan. Dia bisa membuat kita semua tertawa, hanya untuk

07:30 Selebrita Pagi 08:30 Ga Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Jejak Petualang 14:00 Dunia Binatang 14:30 Koki Pintar 15:00 Brownies 15:30 Tau Ga Sih 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Indonesiaku 17:30 Orang Pinggiran 18:00 Hitam Putih 19:15 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Jam Malam **m31/G

menunjukkan dia punya ancaman luar biasa.” Meskipun banyak kritikus memuji Skyfall, namun Xan Brooks dari The Guardian tak terlalu terkesan dengan film ini. Brooks hanya memberi tiga dari lima bintang. Dia memuji ketegangan yang berhasil dihadirkan pada setengah adegan film, namun menyebut keseluruhan Skyfall sebagai film yang sama tak menariknya dengan sepanjang 50 tahun Bond. Film ini disebut Brooks hanya membuka peluang penilaian sentimen, namun tetap kehilangan geregetnya.(ant)

Penyanyi Inggris Jadi Turis Luar Angkasa Rusia Penyanyi Inggris Sarah Brightman mengatakan bahwa dia sudah membeli kursi untuk terbang dengan pesawat luar angkasa Rusia dan mendeskripsikannya sebagai kesempatan untuk memenuhi keinginan masa kecil yang melampaui mimpi terliarnya. Brightman,52 terkenal lewat lagu I Lost My Heart to a Starship Trooper, akan terbang sampai 250 mil di atas bumi menuju International Space Station, menjadi turis luar angkasa pertama setelah pendiri Cirque du Soleil, Guy Laliberte melakukan perjalanan tahun 2009. “Saya lebih bersemangat dengan ini lebih dari semua yang pernah saya lakukan,” kata Brightman yang mengenakan gaun hitam dan sepatu berhak tinggi kepada wartawan di Moskow. “Dalam hampir seluruh hidup saya, saya merasakan keinginan luar biasa untuk melakukan perjalanan ke luar angkasa yang sekarang akan saya

mulai. Ini melampaui mimpi terliar saya,” katanya seperti dikutip Reuters. Konferensi pers pengumuman perjalanannya ke luar angkasa, diawali dengan iklan video album Dream Chaser akan dirilis bulan Januari. Video antara lain berisi lagu Angel juga menampilkan gambarnya semasa kecil dan momen-momen terkenal dalam sejarah pesawat ruang angkasa Soviet. Brightman, artis UNESCO untuk perdamaian, mengatakan bahwa dia melihat tayangan langkah pertama manusia di bulan tahun 1969 ketika berumur delapan tahun. Itu menginspirasi dia melakukan perjalanan ke luar angkasa. “Ini hal yang sangat menakjubkan. Untuk saya ini adalah titik balik,” katanya. Brightman tidak mau menyebutkan ongkos yang harus dia bayar untuk perjalanan luar angkasa difasilitasi perusahaan Amerika Serikat (AS), Space Adventures tersebut. Namun biayanya diperkirakan sekitar 35 juta dolar AS. Rusia mengenakan ongkos lebih dari 50 juta dolar AS per kursi kepada astronot NASA. Paket petualangan itu meliputi 12 hari di orbit. Brightman mengatakan dia akan menggunakan missinya untuk mempromosikan pendidikan ilmu pengetahuan bagi perempuan dan meningkatkan kepekaan terhadap lingkungan. Penyanyi membintangi film

musikal Phantom of the Opera, menyatakan antusiasmenya menghadapi perjalanan ke luar angkasanya dengan lantunan “I Lost my Heart to a Starship Trooper.” Dia sudah memesan perjalanan suborbital keVirgin Galactic dengan SpaceShipTwo. “Se-

bagai anak di era tahun 60-an, dengan semua roket dikirim serta manusia pertama di bulan adalah hal yang sangat besar artinya untuk anak-anak,” katanya kepada Reuters. “Ketika saya mengerti bahwa sangat mungkin untuk melakukan perjalanan bahkan pe-

Sarah Brightman/ nerbangan suborbital dalam hati saya berkata: ‘Baiklah, ini adalah hal yang selalu saya inginkan. Ini adalah mimpi saya!” Dia berhasil lulus tes sebelum penerbangan di pusat latihan Star City di Rusia yang berada diluar Moskow. (ant)

Nikita Willy Buktikan Tak Aji Mumpung GARA-gara sering mengusung sendiri lagu tema sinetron dibintanginya, Nikita Willy, kerap dicap mencoba aji mumpung. Yakni, memanfaatkan popularitas dunia seni peran guna mendulang sukses dalam merambah dunia nyanyi. Namun, seiring diluncurkan album perdana bertajuk Lebih Dari Indah (LDI), dara cantik berdarah Minang kelahiran Jakarta, 29 Juni 1994 ini,membuktikan keseriusannya menjadi penyanyi profesional. “Kalau sekedar aji mumpung, saya tak perlu butuh waktu dua tahunan untuk melansir album rekaman secara penuh. Nah, lewat perjuangan panjang dan berliku dengan melansir singel demi singel kebetulan mayoritas merupakan lagu tema sinetron saya bintangi, mental dan kepiawaian olah vokal saya benar-benar ditempa menjadi penyanyi profesional,” papar Nikita Willy kepada Waspada selepas peluncuran album per-dananya di KFC Kemang, Jakarta Selatan, baru-baru ini. Diakui artis serba-bisa peraih penghargaan Aktris Terbaik Panasonic Awards tahun 2010 dan 2011 yang memulai debut akting sejak usia enam tahun lewat Sinet-

ron Bulan Bintang dan sempat berakting memukau lewat film bioskop bertajuk Bestfriend, Married by Accident dan Tertipu Laris Manis ini, lantaran selama ini dunia seni peran merupakan prioritas utama karirnya, sempat pula mencuatkan kesan seolah-olah dirinya kurang serius berbasah-basah di dunia nyanyi. “Tapi, peluncuran album bertajuk LDI ini yang juga merupakan obesesi Nikita sejak lama otomatis membuktikan keseriusan saya melakoni profesi ganda secara beriringan dan profesional yakni di dunia akting dan tarik-suara,” tandas Nikita. Kekasih pesepakbola nasional berdarah Belanda- Diego Michiel ini, tampaknya tak mau aji mumpung apalagi main-main untuk menjadi profesional. Dalam menggarap singel andalan album LDI bertajuk Akibat Pernikahan Dini, Nikita bersama produser Glow Music- menggandeng komposer kondang Melly Goeslaw dan Anto Hoed. Sedangkan untuk menghimpun penikmat musik lebih luas – selain NikiLovers (penggemar fanatiknya), bekerjasama dengan KFC dan Music Factory Indonesia, Nikita pun sengaja mengusung ulang lagu Bohong milik Deddy Dhukun dan Dian Pramana Putra serta lagu legendaries Nonton Bioskop ciptaan Alm Bing Slamet yang Nikita Willy sukses dipopulerkan Benyamin Sueb. * (AgusT)



Warga Bireuen Tempati Gubuk Tak Layak Huni

Hendak Mencuri, Pemuda Dihajar Massa BIREUEN (Waspada) : Wajah seorang pemuda berinisial N, asal Peusangan, Bireuen, remuk dihajar masa karena dilihat berada di halaman rumah seorang warga Padang Kasab, Kec. Peulimbang, kabupaten setempat, Sabtu (20/10) menjelang subuh dan diduga hendak maling sepeda motor. Untung saja anggota Subsektort Peulimbang dan Polsek Jeunieb begitu mendapat informasi langsung ke lokasi sehingga nyawa korban dapat diselamatkan, lalu langsung dilarikan ke RSUD Dr Fauziah Bireuen. Keterangan yang dihimpun, warga Desa Padang Kasap selama beberapa bulan terakhir diresahkan dengan aksi maling pada malam hari di desanya sehingga dalam tiga bulan terakhir ini mereka melakukan penjagaan. Kapolres Bireuen Bireuen AKBP Yuri Karsono melalui Kapolsek Jeunieb Iptu PM Ketaren mengatakan, kasus tersebut sudah ditangani Polsek Jeunieb dan masih melakukan pengembagan. (cb02)

BIREUEN (Waspada) : Warga Kabupaten Bireuen yang berdomisili di sekitar kota dan desa-desa terpencil masih banyak tergolong kaum dhuafa kehidupannya di bawah garis kemiskinan. Para kaum dhuafa yang berdomisili di sekitar kota dengan mata pencaharian bervariasi, penarik becak, buruh, pemulung, tukang cuci, sedangkan kaum dhuafa di pedesaan umunya sebagai petani miskin, buruh tani dengan penghasilan belum memenuhi kebutuhan hidup yang layak. Tidak hanya kebutuhan biaya kebutuhan hidup tempat tinggalnya masih banyak yang menempati gubuk tak layak huni. Pengamatan Waspada di Desa Geulanggang Kulam, Kecamatan Kot Juang, Bireuen, Sabtu (20/10) di desa itu kedapatan sebanyak 10 kaum dhuafa masih menempati gubuk tak layak huni.

Rumah Janda Ludes Terbakar LHOKSUKON (Waspada): Satu rumah kontruksi kayu milik Aminah, 45, janda lima anak di Desa Reudeup, Kec. Lhoksukon, Aceh Utara, musnah terbakar, Sabtu (20/10) pukul 09:00. Tak ada korban jiwa, namun seisi rumah, termasuk satu unit sepedamotor, hangus dilalap api. Kerugian ditaksir puluhan juta rupiah. Sementara sumber api, diduga dari hubungan arus listrik.“Saatkejadian,rumahsedangkosong. Korbanbesertaanaknya tidak ada di rumah,” kata Jamal, 28, salah seorang saksi mata. Warga sekitar yang mengetahui insiden itu, kata Jamal, sempat berusaha memadamkan api dengan peralatan seadanya. Namun api sudah terlanjur membesar dan sulit dipadamkan. Camat Lhoksukon, Naikalias Sadakata, ketika dikonfirmasi wartawan membenarkan adanya musibah kebakaran itu. “Ya, memang ada. Kami secara pribadi juga sudah memberi bantuan untuk korban,” tandasnya. (b19)

Penjual Ganja Diburu BIREUEN (Waspada): Jajaran Satnarkoba Polres Bireuen memburu penjual 2 kg ganja kepada tersangka MH, 27, asal Aceh Utara, yang ditangkap di kawasan Cot Gapu, Kota Juang Bireuen, Jumat (19/10) saat hendak kabur yang telah dikantongi identitasnya. “Identitas penjual ganja sudah kami kantongi dan sekarang sedang kita buru serta telah memasukkan ke dalam daftar pencarian orang (DPO),” kata Kapolres Bireuen AKBPYuri Karsono SIK melalui Kasatnarkoba Iptu Indra Asrianto melalui Kanit Idik I, Brigadir Jauhari Ramli, Sabtu (20/10). (cb02)

Asnawi Mytsa Terpilih Sebagai Ketua KNPI Bireuen BIREUEN (Waspada): Asnawi Mytsa terpilih secara aklamasi sebagai Ketua KNPI Bireuen periode 2012-2015 dalam acara Musyawarah Daerah ke-3 yang dilangsungkan di aula Meuligoe Hotel Kamis (18/10). Ketua panitia, Khiril Anwar, Jumat (19/10), mengatakan, acara Musda KNPI yang dibuka Asisten Pemerintahan Murdani yang dihadiri sejumlah undangan lain, sebelumnya sempat muncul beberapa calon. Namun dalam pelaksanaan berlangsung secara aklamasi dan mempercayakan kepada Sekretaris Anshor Bireuen tersebut sebagai Ketua KNPI Bireuen priode mendatang. (cb02)

Petani Kemukiman Juli Barat Minta PATM Difungsikan JULI (Waspada) : Nasib petani sawah tujuh desa di Kemukiman Juli Barat, Kecamatan Juli Bireuen masih merana. Pasalnya, akibat proyek Pompa Air Tanpa Mesin (PATM) tidak berfungsi, seluas 450 hektare areal sawah sudah puluhan tahun petani tidak dapat turun ke sawah untuk melakukan musim tanam. Areal sawah produktif petani tujuh desa, Peuraden, Batee Raya, Alue Unoe, Pulo Lampoh, Pulo Lampoh, Seupeng Lampoh dan Desa Me Teungoh tidak memiliki pengairan untuk mengairi sawah mereka lantaran proyek PATM yang menelan dana Rp 2 miliar lebih airnya tidak menetes menjadi proyek sia-sia. Koordinator Irigasi Kabupaten Bireuen Tgk H Mustafa Umar berharap Pemkab Bireuen agar dapat mendatangkan tenaga teknis khusus untuk mengoperasikan PATM Juli. Camat Juli Zalkdi mengatakan, harapan petani Kemukiman Juli Barat akan disampaikan kepada bupati untuk ditindaklanjuti mendatangkan tenaga teknis khusus PATM. Asisten II Setdakan Bireuen Zualkifli mengatakan, proyek PATM Juli merupakan proyek APBA soal tidak berfungsinya akan dilaporkan ke Dinas Pengairan Provinsi Aceh. (b12)

Dewan Minta Dinkes Fogging Seluruh Aceh Timur IDI (Waspada): Menyusul meluasnya penyakit Demam Berdarah Dengue (DBD) di sejumlah kecamatan di wilayah Kabupaten Aceh Timur, DPRK setempat meminta Dinas Kesehatan di bawah Bidang Pengendalian Masalah Kesehatan (PMK) untuk melakukan fogging (pengasapan) ke 24 kecamatan, termasuk Simpang Jernih dan Lokop. “Kita sudah meminta Dinkes untuk melakukan fogging ke 24 kecamatan di seluruh Aceh Timur, karena anggaran untuk pengasapan sudah kita plot untuk tahun 2012,” kata Ketua Komisi D DPRK Aceh Timur, Abdul Hamid, Minggu (21/10). Kata dia, persoalan DBD tidak bisa dibiarkan berlarut tanpa pengananan yang serius, sebab penyakit DBD adalah penyakit yang menular secara langsung. Bahkan, kabarnya tahun 2012 penyakit yang dapat membawa kematian itu kini sudah tercatat 28 kasus. “Sementara tahun 2011 kasus DBD mencapai 34 kasus, jadi tak tertutup kemungkinana tahun ini akan meningkat dibanding tahun lalu,” ujar Abdul Hamid. Kepala Dinkes Aceh Timur Aiyub melalui Kabid PMK Zulfikry membenarkan adanya beberapa kasus DBD dalam sepekan terakhir di wilayah kerjanya, bahkan salah satunya sudah meninggal dunia akibat lambannya penanganan pihak medis. “Kita sudah melakukan fogging di beberapa lokasi, seperti Kecamatan Idi Tunong dan Idi Rayeuk,” katanya. (b24)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air

arai ilas dari gan, laju otor olan Paya hak ena kap

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


WASPADA Senin 22 Oktober 2012

M Yusuf Yakob, 47, salah seorang kaum dhuafa Desa Geulanggang Kulam yang ditemui mengatakan, di Gampong Geulanggang Kulam sekitar 10 kaum dhuafa termasuk diriunya masih menempati gubuk tak layak huni. Ayah lima anak yang sehari-hari berprofesi sebagai penarik beca selama selama 20 tahun lebih menempati gubuk tak layak huni yang dibangun di atas sebidang tanah berkuran 12 x 25 meter, pusaka orangtuanya. Menurut M Yusuf Yakob, sejak 2004 sudah mengajukan permohonan bantuan rumah dhuafa ke Pemkab setempat, namun habis tahun berganti tahun hingga saat ini belum ada realisasinya. “Kami sangat berharap agar Pemkab setempat memberikan perhatian terhadap bantuan rumah dhuafa, agar kami dapat menempati rumah layak huni,” pintanya. (b12)

PLN Gelar Operasi Pemutusan Meteran Waspada/Muhammad H Ishak

PROTES:Warga protes atas ketidakpedulian Pemkot Lhokseumawe terhadap jalan yang rusak di kawasan kota.Tampak satu unit mobil melintasi jalan rusak yang ditanami pohon pisang di Jalan Listrik,Gampong Tumpok Teungoh, Kecamatan Banda Sakti, Kota Lhokseumawe, Minggu (21/10).

6 Mobil Minyak Tanah Tujuan Banda Aceh Diamankan LHOKSEUMAWE (Waspada): Kepolisian Polres Lhokseumawe mengamankan enam mobil pick-up bermuatan minyak tanah illegal dari Sumatera Utara tujuan Banda Aceh. Penangkapan ini saat razia gabungan pihak Satuan Reskrim, Lantas dan Intel di Syamtalira Bayu, Aceh Utara, Minggu (21/10) dini hari.

Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kasat Reskrim AKP Supriadi mengatakan, penangkapan enam mobil pick-up jenis L300 dan jenis Grand Max ini saat melakukan razia rutin di depan Mapolres dan Syamtalira Bayu, Aceh Utara berdasarkan informasi yang diterimanya. “Memang saat itu kami sedang melakukan razia rutin. Ya kebetulan ada informasi tersebut, kami langsung siaga. Pertama kami tangkap dua mobil,

tak lama kemudian lewat lagi empat mobil dari arah timur. Saat kami periksa, ternyata ada drum berisi minyak tanah, sebagian dimasukkan ke dalam kotak fiber dan plastik,” ujar kasat. Saat diperiksa masing-masing sopir, tidak satupun memiliki dokumen resmi seperti izin niaga dan izin angkutan. Akhirnya, enam mobil, masingmasing sopir, kernet dan satu penumpang digiring ke Mapolres. (cmk)

PN Terima 32 Perkara Korupsi Aceh LHOKSEUMAWE (Waspada): Soedarmadji, Wakil Ketua Pengadilan TinggiWilayah Aceh di Lhokseumawe menyebutkan, dirinya mendapat tugas untuk melakukan pengawasan dalam tataran pelaksanaan perkara korupsi baik untuk PT maupun untuk PN. Sekarang ini perkara yang masuk ke PN telah mencapai

32 kasus, 29 kasus telah putus dan tiga kasus lain sedang berjalan. Kata Sudarmaji, hampir semua kasus yang telah diputuskan semuanya melakukan banding dan masuk ke Pengadilan Tinggi (PT). PT juga sudah sesuai SOP. Beberapa kasus korupsi itu seperti kasus pengaspalan di

Lhoksukon, pembangunan dermaga di Meulaboh, Aceh Barat dan kasus pengadaan sapi. Kata Sudarmaji, rata-rata yang terlibat dalam kasus korupsi itu unsur pemerintah sebagai terdakwa, begitupun ada juga kontraktor pelaksana yang melakukan kesalahan se-cara bersama-sama dengan pemerintah untuk konspirasi. (b18)

Terdakwa Kasus Korupsi Alkes RSUZA Menangis BANDA ACEH (Waspada): Kartini Hutapea, 58, terdakwa dalam kasus korupsi proyek pengadaan alat kesehatan Radiologi (MRI) di RSU Zainoel Abidin Banda Aceh menangis di ruang sidang Tipikor Banda Aceh, Kamis (18/10). Terdakwa yang juga Dirut PT KI itu tak mampu menahan air matanya ketika mendengarkan eksepsi yang menyentuh hatinya, yang dibacakan penasihat hukumnya Burhanuddin, atas dakwaan jaksa penuntut umum terhadap dirinya itu. Di ruang tahanan persisnya di belakang ruang sidang utama Tipikor, terdakwa sempat menjerit sehingga mengundang ke-

ingintahuan puluhan pengunjung dan petugas di sekitar itu. Sebelumnya, penasihat hukum terdakwa Burhanuddin dalam eksepsinya mempertanyakan sosok RM (Direktur PT KI) yang tidak dijadikan tersangka ataupun sebagai saksi ketika dilakukan penyidikan di Kejaksaan Agung. Padahal .RM ini adalah orang kepercayaan terdakwa dalam semua proses penawaran proyek pengadaan Alkes Radiologi (MRI 3 Tesla) di RSUZA Banda Aceh, yang dilakukan PT KI. Selain itu, penasihat hukum juga menilai dakwaan jaksa kabur (obscur libel), surat dakwaan tidak dibuat secara cer-

mat, lengkap dan jelas, identitas terdakwa tanggal lahirnya juga salah. Begitu juga, tidak diuraikan bagaimana cara perbuatan terdakwa dan hubungan penyertaannya dengan terdakwa Sur sehingga disebutnya perbuatan melawan hukum. Jaksa Penuntut Umum pada sidang sebelumnya mengatakan, kasus korupsi dalam pengadaan alat-alat radiologi MRI 3 Tesla di RSU Zainoel Abidin mengakibatkan kerugian negara sebesar Rp8 miliar lebih, sesuai audit dari BPKP. Untuk mendengarkan replik dari jaksa penuntut umum sidang ditunda, Selasa (23/10). (b02)

Kepala SKMN 2 Salang Hilang Di Laut SIMEULUE (Waspada): Kepala Sekolah Menengah Kejuruan Negeri (SMKN) 2 Salang Radian Ahmad dikabarkan hilang di laut lepas. Diduga dia tenggelam saat mandi di pantai pada acara rekreasi bersama siswa dan dewan guru dalam rangka perpisahan dengan dewan guru kontrak

SM3T. Hingga berita ini dikirim korban belum ditemukan. Berita tenggelamnya salah seorang tenaga pendidik di Ujung Pulau ini sudah kian merebak. Tak hanya di kampung bahkan didunia maya Facebook. Sebuah berita yang diunggah di status resmi milik Ikatan Pemuda Pelajar & Masyarakat

Simeulue (IPPELMAS) pada Sabtu (20/10) oleh pemilik Advokat Andry Rustyka dengan tegas menyatakan bahwa sang guru itu telah meninggal. Kejadian yang membuat panik warga di ujung Simeulue itu sejak siang. Korban tenggelam terbawa arus gelombang pantai Lhok Bahe, Kecamatan Salang. (cb08)

Indonesia Bukan Negara Miskin DR IRAWAN, salah seorang dosen di Universitas Padjajaran Bandung tiga hari lalu dipanggil pihak Sekolah Tinggi Agama Islam Negeri (STAIN) Malikussaleh Lhokseumawe sebagai tutor dalam seminar Pendidikan Agama Islam (PAI) yang dilaksanakan di aula SMK Negeri III Lhokseumawe. Pada kesempatan itu, Irawan sempat mengisahkan perjalanannya dari Bandung ke Aceh. Dari Bandung ke Kota Medan dia menggunakan jasa transportasi udara pesawat terbang, sedangkan dari Kota MedanAceh memanfaatkan jasa transportasi darat. Masuk ke Aceh, tentunya dia harus melewati Langkat. Mulai dari Langkat hingga Kota Lhokseumawe, dia melihat banyak rumah warga yang dibuat dari kayu. Rata-rata rumah-rumah tersebut banyak

yang sudah miring ke kiri dan kenan. Mungkin ini karena kemiskinan sehingga masyarakat tidak sanggup membangun rumah yang bagus. Miskin...tunggu dulu. Bagaimana mungkin penduduk Indonesia miskin, sementara semua kebutuhan hidup mereka diimpor. Coba bayangkan, sampai sekarang ini, penduduk Indonesia semuanya doyan makan mi instan, yang bahan bakunya terigu. Untuk memperoleh bahan baku tersebut, Pemerintah Indonesia harus impor dari India. Dulu masyarakat Indonesia tidak pernah kenal dengan air mineral kemasan. Sekarang air mineral kemasan sudah menjadi tren dan kebutuhan yang mutlak harus dipenuhi. Bukan hanya itu, ternyata Indonesia juga impor garam, impor beras dari Vietnam dan

Thailan, gawatnya lagi, Indonesia juga harus impor sapi untuk memenuhi kebutuhan makanan bergizi, impor susu dan bahkan Indonesia juga harus impor sayur-sayuran, impor gula, dan masih banyak kebutuhan lainnya yang harus diimpor. “Jadi siapa bilang Indonesia miskin. Semua kebutuhan Indonesia beli dari luar negeri. Jadi kalau ada yang bilang Indonesia miskin itu salah. Indonesia ini kaya raya,” kata Irawan. Kondisi tersebut telah membuat Indonesia lemah di mata dunia, karena semua kebutuhan bergantung pada luar negeri sehingga Amerika berani buat macam-macam untuk Indonesia. Amerika tidak berani macam-macam dengan Cina, Jepang dan bahkan mungkin dengan Malaysia. Maimun Asnawi

PANTONLABU (Waspada): Guna memperkecil angka tunggakan rekening listrik, PLN Area Lhokseumawe menggelar operasi pemutusan meteran listrik di wilayah kerja PLN rayon Pantonlabu, Aceh Utara, Sabtu (20/10). Manajer PLN Area Lhokseumawe, Ratnawati, dis ela pelepasan tim operasi di kantor PLN rayon Pantonlabu menjelaskan, operasi tersebut melibatkan 11 tim dari 11 rayon di wilayah kerja PLN Area Lhokseumawe. “Program ini digelar di seluruh Aceh, karena angka tunggakan rekening listrik sudah sangat mengkhawatirkan. Khusus di rayon Pantonlabu saja, nilai tunggakan mencapai Rp623 juta lebih,” kata Ratnawati. Ketua Forum Komunikasi Manajer Ranting (FKMR) PLN se-Aceh, Ridwan Adam menambahkan, target dalam operasi itu pelanggan

umum yang rekening listriknya menunggak di atas dua bulan. “Kalau tidak dilunasi, tim langsung melakukan pemutusan sementara dengan mencabut meteran. Jika setelah tahapan ini masih menunggak juga, jaringan akan dibongkar total dan ketika nanti dilunasi, meterannya langsung kita ganti dengan meteran sistem prabayar,” tutur Ridwan. Sementara Teuku Hasballah, Manajer PLN rayon Pantonlabu mengatakan, wilayah kerja PLN rayon Pantonlabu meliputi lima kecamatan di wilayah timur Aceh Utara, yakni Kec. Langkahan, Tanah Jambo Aye, Seunuddon, Baktiya dan Kec. Baktiya Barat. “Jumlah pelanggan umum yang rekening listriknya menunggak di atas dua bulan, 3.756 pelanggan. Sementara jumlah total tagihan Rp 623.186.360,” papar T Hasballah. (b19)

Polemik Di Saat Usul PAW Anggota DPRK BANDA ACEH (Waspada): Polemik pengurus PPRN kubu Amelia A Yani dengan PPRN Rauchin masih berlanjut. Khusus di Aceh, polemik makin meruncing ketika ada usulan pergantian antar waktu (PAW) Anggota DPRK Aceh Selatan. Masing- masing saling klaim memiliki legalitas dan dasar hukum yang kuat. Ketua Umum PPRN Aceh, Nazier A Ganie menegaskan, SK Menkumham No. M.HH17.AH.11.01tahun2011tanggal19Desember2011, tetap sah dengan ketua umum DPP PPRN H Rauchin. Sedangkan di Aceh diketuai Nazier A Ganie. Buktinya, kata Nazier, Sabtu (20/10) dalam verifikasi 46 parpol yang mendaftar ke KPU sebagai calon peserta pemilu 2014, satu di antaranya Partai Peduli Nasional (PPRN) kubu Rauchin. “SK Menkumham masih tetap berlaku dan KPU Pusat tetap berpedoman kepada SK Menkumham No M.HH-17.AH.11.01 Tahun 2011 tanggal 19 Desember 2011,” tegasnya. Soal kubu Amelia AYani yang mem-PTUNkan SK Menkumham No M.HH-17.AH.11.01 tahun 2011 tanggal 19 Desember 2011, Nazier mengakui bahwa gugatan itu dikabulkan, tapi PTUN menolak penundaan atas pelaksanaan SK Menkumham tersebut. Artinya, tegas Nazier, selama ada proses peradilan terhadap SK Menteri hukum dan HAM RI dimaksud, maka SK tersebut masih tetap berlaku. Kubu Rauchin telah melakukan upaya hukum banding tiga hari setelah ditetapkan keputusan PTUN No.43/G/2012/PTUN_Jkt, 24 Juli 2012. Dengan begitu, keputusan ini belum mempunyai kekuatan hukum tetap, kata Panitera PTUN Jakarta,Wahidin, 31 Juli 2012, seperti yang Waspada kutip kemarin.

Terkait dualisme kepemimpinan PPRN, seorang advokat senior di Banda Aceh, Mirdas Ismail menyebutkan, komposisi kepengurusan DPP PPRN yang sah periode 2011-2016, berdasarkan SK Menkumham No M.HH-17.AH. 11. 01 Tahun 2011 tanggal 19 Desember 2011 dan menjadi dasar hukum bagi peme-rintah untuk melakukan pembinaan politik bagi PPRN di bawah kepemimpinan Rauchim dan Joller Sitorus, selaku Ketua Umum dan Sekretaris UMUM DPP PPRM. DPW-PPRN Aceh (kubu Amelia AYani) yakni T Mashuri Raja Usin menegaskan, usulan PAW terhadap Sulaiman, anggota DPRK Aceh Selatan dari PPRN yang disampaikan Nazier A Gani, yang mengaku sebagai Ketua Umum DPW PPRN Aceh, sama sekali tidak berdasar dan tidak memiliki kekuatan hukum. Pasalnya, kata dia, berdasarkan SK DPP PPRN Nomor 075/A.1/DPP-PPRN/ SK/XII/2010 tertanggal 17 Desember 2010 tentang susunan pengurus DPW-PPRN Aceh yang ditandatangai Ketua Umum DPP-PPRN Amelia A Yani dan Sekjen Maludin Sitorus jelas-jelas nama Nazier A Gani tidak tercantum dalam komposisi pengurus, apalagi sebagai ketua umum DPWPPRN Aceh. Sebaliknya, Nazier A Gani, menegaskan, justru setelah keluarnya SK Menkumham No M.HH-17.AH.11.01 tahun 2012 tertanggal 19 Desember 2011, DPP PPRN kubu Amelia AYani sudah tidak sah, begitu juga perangkat di bawahnya seperti DPW PPRN Aceh lama juga tidak sah bila mengatasnamakan pengurus PPRN seperti T Mashuri Raja Usin, itu. “PPRN di Aceh yang memiliki legalitas adalah di bawah kepemimpinan saya,” tandas Nazier A Gani. (b01)

PANTONLABU (Waspada) : Pasokan air bersih PDAM Tirta Mon Pase, Aceh Utara, untuk pelanggan di Pantonlabu dan sekitarnya, mati lagi sejak Jumat (19/10). “Entah kapan normalnya pelayanan PDAM ini. Dari dulu bermasalah terus,” kata Rafar, 35, salah seorang pelanggan di Pantonlabu, pusat kecamatan Tanah Jambo Aye, Minggu (21/10). Keluhan serupa disampaikan Sri, 32, pelanggan Tirta Mon Pase di Meunasah Panton, desa tetangga Pantonlabu. Dia mengaku tinggal di rumah kontrakan dan air PDAM satu-satunya sumber air yang ia andalkan untuk kebutuhan sehari-hari.

“Suplai air untuk Meunasah Panton dihidupkan selang sehari sekali. Kalau mati selama tiga hari, otomatis stok air kami habis total. Jangankan keperluan lain, untuk buang air saja susah,” kata Sri. Kepala Kantor PDAM Pantonlabu, Syamsuddin, ketika dikonfirmasi menjelaskan, suplai air untuk kawasan itu terganggu karena kerusakan stop kran atau BallValve di Simpang Pante Breuh. “Stop kran itu sedang diganti. Jika semua berjalan lancar, besok (hari ini-red) suplai air sudah normal kembali,” kata Syamsuddin via telefon selular. (b19)

Air Tirta Mon Pase Tak Berfungsi

Pemkab Aceh Utara Beli 28 Mobil Baru LHOKSEUMAWE (Waspada): Pemkab Aceh Utara saat ini telah membeli mobil baru merek Avanza sejumlah 28 unit. 10 Di antaranya telah tiba dan digunakan anggota dewan. Padahal, kebupaten ini sedang mengalami seret keuangan pasca bobolnya kas daerah Rp220 miliar. Pantauan Waspada, Rabu (17/10) ada tiga unit mobil merek Avanza warna putih dan satu warna hitam plat warna putih diparkir di halaman Gedung DPRK Aceh Utara. Menurut sejumlah sumber, mobil ini baru beberapa hari kelihatan di gedung dewan. Kepala Bagian Umum dan Perlengkapan Sekda Aceh Utara, A Hamid saat dikonfirmasi mengatakan, pihaknya telah melakukan pengadaan 28 mobil baru merek Avanza dengan menggunakan dana APBK murni (sebelum perubahan) 2012. Bila ditotalkan dengan harga, sekitar Rp4,4 miliar.

Dari yang dipesankan melalui PT Dunia Barusa selaku distributor resmi sebanyak 28 unit, baru tiba dipakai pejabat dan dewan 10 unit. Selebihnya masih dalam proses pemberangkatan dari Jakarta ke Aceh Utara, dan kontrak pengadaan sampai November mendatang. “Pengadaan ini kita mengingat, mobil dinas di Aceh Utara sudah tua-tua, dan perlu pengadaan mobil dinas baru. Pengadaan terkahir kalau tidak salah saya pada 2011. Saya tidak ingat persisnya berapa,” ujar Hamid. “Aceh Utara sedang devisit anggaran senilai Rp36 miliar. Untuk menutupi ini, bupati meminjamkan ke Bank Aceh senilai Rp36 miliar,” ujar Bupati Aceh Utara, Muhammad Thaib pada kesempatan lain usai membuka Muzakarah Ulama Umara di Gedung Hasbi Assidiqi, Senin (15/10). (cmk)

Waspada/Mustafa Kamal

WARGA melihat mobil baru pengadaan Pemkab Aceh Utara tahun 2012. Dua dari 10 yang telah tiba ini diparkir di halaman gedung DPRK Aceh Utara, Kamis (18/10)


WASPADA Senin 22 Oktober 2012

Pemkab Aceh Besar Janji Bangun Sektor Perikanan

Parlementaria DPR Kota Banda Aceh Dewan Godok 11 Raqan Qanun Inisiatif Pemko Banda Aceh DPR Kota Banda Aceh menjelang akhir tahun 2012 ini sedang fokuskan energi untuk menggodok 11 Rancangan Qanun (Raqan) yang merupakan usulan atau inisiatif dari Pemko Banda Aceh. Pembahasan 11 Raqan Inisiatif Pemko Banda Aceh itu dimulai dari pemandangan umum kata akhir dari empat fraksi dewan, dalam sidang paripurna DPRK Banda Aceh, Rabu (17/10). 11 Raqan yang menjadi prioritas pembahasan pihak DPRK Banda Aceh yakni, Raqan Retribusi Pelayanan Persampahan/ Kebersihan, Raqan Retribusi Rumah Pemotongan Hewan, Raqan Retribusi Pemakaian Kekayaan Daerah, Raqan Retribusi Pasar Grosir dan atau Pertokoan, Raqan Penggantian Biaya Cetak KTP dan Akta Catatan Sipil. Raqan Izin Trayek, Raqan Retribusi Pengendalian Menara Telekomunikasi, Raqan Retribusi Izin Usaha Perikanan, Raqan Retribusi Palayanan Pasar dan Rancangan Qanun tentang Retribusi Penyediaan dan/atau Penyedotan Kakus. Fraksi Partai Demokrat dengan juru bicaranya Mardali berharap, setelah selesai dilakukan pembahasan nantinya Raqan tersebut telah lahir sebuah produk hukum, maka implementasinya qanun-qanun itu haruslah benar-benar dapat memberikan kontribusi yang baik dan nyata dalam berbagai sisi kehidupan, pembangunan dan masyarakat sehingga produk hukum yang dilahirkan dirasakan manfaatnya bagi warga masyarakat Kota Banda Aceh. Fraksi Partai Aceh dengan jurubicara Azhar Rhafsah meminta wali kota menyangkut dengan retribusi tower komunikasi, di mana sebelum diberikan izin pembangunan, yang harus diselesaikan terlebih dahulu adalah permasalahan dengan lingkungan di mana tower itu akan dibangun. “Ini perlu kami ingatkan, karena biasanya setelah tower dibangun menimbulkan masalah dengan masyarakat sekitarnya,” tutur Azhar. Fraksi PKS dengan juru bicaranya Mukminan berharap kepada Pemko agar Raqan tersebut benar-benar dibutuhkan dan mencerminkan keinginan mayoritas warga kota. Artinya, pembahasan Raqan itu harus dikaji secara mendalam bagaimana penerimaan masyarakat serta kemungkinan pelaksanaan qanun dimaksud di lapangan. Selain itu, fraksi PKS juga berharap Raqan tersebut dapat memberikan manfaat sekaligus kepastian hukum bagi masyarakat, terutama bagi dunia usaha yang pada akhirnya diharapkan dapat mendorong jalannya roda pemerintahan serta mempercepat roda pembangunan di Kota Banda Aceh. Sedangkan fraksi Persatuan Daulat Atjeh Independen (DA’I) dengan juru bicara Tgk Azhari menyarankan dalam proses penyusunan naskah akademik Raqan harus dipertimbangkan berbagai aspek dalam mengakomodir keinginan masyarakat dan pemerintah. Artinya, perlu dipertimbangkan aspek sosial budaya masyarakat dan spiritual sehingga tidak hanya mengejar PAD dari retribusi tersebut, tetapi juga dampak yang akan dirasakan masyarakat, sebagai contoh retribusi pengendalian menara telekomunikasi, bagaimana dengan aspek kesehatan terhadap paparan radiasi.

Pelabuhan Siti Ambia Siap Beroperasi SINGKIL (Waspada) : Kantor unit penyelenggara pelabuhan Kelas III Singkil mengoperasikan kembali Pelabuhan Siti Ambia Pulau Sarok pada akhir 2013 yang sebelumnya mengalami kerusakan akibat gempa, setelah Kementerian Perhubungan melalui Dirjen Perhubungan Laut membangun kembali sarana pelabuhan tersebut dengan biaya Rp100 miliar. Ka. Unit Penyelenggaraan Pelabuhan Kelas III Singkil Selamat Riadi, Sabtu (20/10) mengatakan, saat ini pembangunan fasilitas Pelabuhan Siti Ambia Singkil sudah berjalan 55 persen, dari jumlah anggaran sebesar Rp34.483.952.000 yang bersumber dari APBN sejak 2010. Dan untuk sisa pekerjaan 45 persen lagi pihaknya sudah mengusulkan kembali anggaran kepada Dirjen Perhubungan Laut Kementerian Perhubungan sebesar Rp41.827.000.000,anggaran tahun 2013. (cdin)

Dialog Pemuda Di Singkil SINGKIL (Waspada) : Wakil Bupati Aceh Singkil Dulmusrid membuka dialog pemuda yang diselenggarakan Forum Pemuda Pembela Bangsa (FP2B) dalam rangka Hari Sumpah Pemuda ke-84 Sabtu (20/10) di Hotel Anak Laut Singkil Utara diikuti puluhan pemuda dari berbagai organisasi dan OKP itu menghadirkan Dandim 0109/Singkil Letkol Inf Afson R.Sirat dan Mantan Ketua FKUB Ust. Kasman Cahniago sebagai narasumber. Dandim 0109/Singkil Letkol Inf Afson R.Sirat dalam materinya mengajak pemuda untuk senantiasa meningkatkan semangat Nasionalisme dan Kebangsaan serta tetap mencintai sejarah, Senada dengan itu Ust. Kasman Cahniago mengatakan, peran pemuda sangat menentukan. (cdin)

Ismail Kembali Pimpin Demokrat Aceh Tengah TAKENGEN (Waspada): Ismail kembali dipercayakan untuk memimpin Partai Demokrat, Kabupaten Aceh Tengah masa priode lima tahun ke depan dalam Muscab yang diselenggarakan, Sabtu (19/10) di Hotel Renggali Takengen, ketua Fraksi Demokrat DRPK Aceh Tengah ini dipilih secara aklamasi. Dari 17 suara yang menentukan pengurus partai bintang biru ini, 14 menyatakan tidak perlu dilakukan pemilihan, cukup ditetapkan Aman Nir, panggilan Ismail, kembali membawa biduk Demokrat yang sudah mendudukkan 4 kadernya di DPRK setempat. Terpilihnya Aman Nir secara aklamasi itu sudah terlihat, saat Ketua DPD Demokrat Aceh, Mawardi Nurdin menyampaikan sambutannya. “Nampaknya pemilihan kali ini akan berlangsung mulus tanpa ada kendala,” papar Mawardi. Aceh Tengah sudah membuktikan orang yang diusung Demokrat menang dalam pertarungan Pilkada, walau pelantikannya belum jelas kapan. Muhammad Tanwier, Pj Bupati Aceh Tengah dalam pelaksanaan Musda itu mengharapkan, partai yang solid dan besar kiranya dapat membawa perubahan dalam pembangunan di negeri dingin itu. (b32)

Khatib Idul Adha Diminta Serukan Peningkatan Ukhuwah BANDA ACEH (Waspada) : Bupati Pidie Jaya HM Gade Salam meminta para khatib shalat Idul Adha agar dalam khutbahnya menyampaikan seruan peningkatan ukhuwah Islamiyah. Hal ini dikatakan HM Gade Salam di Banda Aceh, Minggu (21/10) serangkaian dengan penyambutan Hari Raya Idul Adha 1433 H diperkirakan jatuh pada Jumat (26/10) mendatang. Gade Salam menyebutkan, bersamaan dengan Idul Adha, umat Islam berkemampuan hendaklah menyembelih hewan qurban. Selain juga Idul Adha dapat dijadikan momen untuk meningkatkan ketaqwaan dengan memperbanyak takbir dan tahmid. (b09)



WARGA Desa Le Mirah, Kecamatan Babahrot melansir bibit kelapa sawit dengan menyeberangi anak sungai berarus tajam akibat jembatan yang menghubungkan jalan menuju perkebunan rakyat tersebut putus setelah pengerokan arus di jalur milik perusahaan tambang biji besi PT JAM ke lokasi Pabrik Kelapa Sawit (PKS) yang diduga dikerjakan asal jadi. Foto direkam, Minggu (21/10).

Pendangkalan Akidah Kembali Marak BLANGPIDIE (Waspada) : Maraknya perkembangan sejumlah aliran maupun ajaran yang dinilai bertentangan dengan akidah Islam yang saat ini mulai kembali muncul di beberapa daerah di wilayah Aceh dinilai adanya infiltrasi dari pihak asing yang diduga ikut ‘bermain’ terhadap upaya pendangkalan akidah bagi masyarakat Aceh. Selain itu sejumlah temuan berupa penyimpangan ajaran yang didanai maupun disponsori oleh lembaga tertentu dianggap semakin mendasari

bahwa upaya asing untuk melakukan infiltrasi melalui jalur keagamaan dinilai sudah sangat mengkhawatirkan dan harus diwaspadai oleh semua elemen sehingga dapat diantisipasi sedini mungkin. Persoalan ‘infiltrasi’ asing terkait maraknya pendangkalan akidah di Aceh tersebut terkuak dalam acara pertemuan di pondok pesantren Misbahul Huda, Desa Persiapan Cot Seumantok, Babahrot, Aceh Barat Daya, Sabtu (20/10) diikuti Majelis Permusyawaratan Ulama (MPU) Abdya, Wakil Bupati Abdya Tgk Yusrizal Razali, Kasdim 0110 Abdya Mayor Arm Kusdi.YS,Wakapolres Tamlikan, Dinas Syariat Islam Abdya, serta sejumlah masyarakat dan beberapa pengikut ajaran Laduni yang telah

kembali ‘insyaf’. “Ada upaya dari pihak asing yang ingin mencoba melakukan infiltrasi dan melakukan upaya penjajahan secara modern, karena infiltrasi secara militer saat ini mungkin tidak lagi relevan sehingga upaya infiltrasi secara ideologi tentu menjadi jalan yang memungkinkan untuk mereka lakukan,” ungkap Kasdim Mayor Arm Kusdi YS. Wakapolres Kompol Tamlikan dan Plt Kadis Syariat Islam Abdya Amirman Adnan menuturkan, upaya pendangkalan akidah yang terjadi saat ini diharapkan harus menjadi perhatian serius dari semua pihak sehingga tidak sampai merusak sendisendi kehidupan berbangsa dan bernegara. (cb05)

KOTA JANTHO (Waspada): Pemkab Aceh Besar akan terus berupaya dan berkomitmen membangun sektor perikanan ke arah pengelolaan yang bertanggungjawab, berkelanjutan, serta berkeadilan. Di antaranya dengan menyiapkan, menyusun, dan mengembangkan sejumlah perangkat peraturan pelaksanaan yang akan segera dapat mengukur, mengatur, dan mengendalikan investasi di sektor tersebut agar memenuhi keberlanjutan lingkungan dan kriteria keberlanjutan sosial. Demikian dikatakan Bupati Aceh Besar Mukhlis Basyah dalam temu ramah dengan masyarakat nelayan dan pesisir di Pantai Lhok Mee, Kecamatan Mesjid Raya, Aceh Besar, Sabtu (20/10). Bupati Mukhlis Basyah berjanji akan mengembangkan secara bertahap Kawasan Konservasi Perairan Daerah (KKPD) Aceh Besar melalui penetapan zonasi, penyusunan tata kelembagaan, rencana pengelolaan kawasan dan aksi-aksi lapangan yang dijalankan secara kolaboratif oleh Pemkab Aceh Besar bersama Panglima Laot Lhok se-Aceh Besar dan mitra terkait lainnya. “Kami berkeyakinan, semua peserta yang hadir dalam kegiatan saweu lhok tersebut

memiliki pandangan, semangat, dan keinginan yang sama untuk menata, membangun, dan memulihkan kembali, serta mengelola sumber daya pesisir dan laut yang tersisa, yang masih dimiliki saat ini,” jelasnya. Bupati Mukhlis Basyah juga berjanji akan berupaya meningkatkan kesejahteraan seluruh masyarakat, terutama masyarakat nelayan dan pesisir di Kabupaten Aceh Besar dengan sebaikbaiknya, berkelanjutan, dan berkeadilan. Dalam dialog yang berlangsung tertib, Pawang Zakaria dan Pawang Zarkasyi mengharapkan Pemkab Aceh Besar senantiasa membantu, membina dan meningkatkan perekonomian serta harkat dan martabat masyarakat nelayan yang hidup di kawasan pesisir. Kadis Kelautan dan Perikanan Kabupaten Aceh Besar M Adil mengatakan, dialog dan diskusi langsung antara bupati dengan masyarakat nelayan, serta kegiatan Saweu Lhok dirangkaikan dengan kegiatan pemantauan kondisi terumbu karang dan peugleh pasie (pembersihan pantai-red) oleh para relawan unsur organisasi pegiat lingkungan, kelompok, dan komunitas pecinta alam, pelajar, mahasiswa, perwakilan masyarakat, pemerintah, serta TNI dan Polri. (b05)

Jasad Korban Pembunuhan Ditemukan Di Kebun Sawit SUBULUSSALAM (Waspada): Sepekan hilang, ditengarai dibawa orang tak dikenal, jasad Risma, 21, ditemukan dalam kondisi mengenaskan di area kebun sawit di Desa Suro Makmur, Kecamatan Suro, Aceh Singkil, Sabtu (20/10). Seperti berita media ini, Sabtu (13/10), Risma dikabarkan dibawa dua OTK dari salah satu lokasi di Desa Lae Mbersih Kecamatan Penanggalan, Jumat (12/10) malam bersama teman lelakinya, MI, 21, keduanya warga Simpang Kiri, Subulussalam ke dua tempat berbeda. Esoknya, M Ikhwan ditemukan menjadi korban penikaman. Sejak saat itu, pihak keluarga dan aparat kepolisian terus berusaha mencari Risma. Di lokasi penemuan mayat dipadati warga serta orang tua dan saudara-saudara korban yang histeris, tampak Kasat Reskrim Polres Aceh Singkil, AKP Ibrahim, Kapolsek Suro Ipda Asmadi, Kapolsek Penanggalan Iptu Budimansyah dan sejumlah personel Polres Aceh Singkil. Kapolres Aceh Singkil AKBP Bambang S

melalui Kasat Reskrim AKP Ibrahim di TKP belum berani memastikan kalau mayat yang ditemukan jasad Risma, korban penculikan pekan silam. “Korban yang ditemukan berjenis kelamin perempuan,” tandas Ibrahim. Penemuan mayat berawal dari laporan pemilik kebun, Nasjuddin kepada Polres Aceh Singkil. Pasalnya, Nasjuddin penasaran dengan bau yang mencurigkan di sekitar gubuknya yang dikunjungi sekali sepekan. Di bagian jurang kebun sawit miliknya, berjarak sekira 6 km dari Mapolsek Suro, Nasjuddin dan rekannya, Zulmi melihat mayat posisi telungkup di atas pohon melintang. Bagian kaki kiri terdapat gelang dan tak jauh dari sana terletak baju kaos bercak darah, mirip seperti yang dipakai korban saat meninggalkan rumah. Setelah turun dan melakukan oleh TKP, tim SAR Subulussalam mengevakuasi korban ke Puskesmas Penanggalan, lalu dibawa ke salah satu mushalla tak jauh dari rumah korban, selanjutnya dimakamkan di pemakaman Subulussalam Utara. (b28)

Guru Madrasah Berperan Tangkal Aliran Sesat BANDA ACEH (Waspada): Guru Madrasah dan Pendidikan Agama Islam memegang peranan penting di tengah kompleksitasnya persoalan akhir-akhir ini. Mereka diyakini mampu menangkal munculnya aliran sesat, tawuran dan degradasi moral di kalangan generasi muda. Hal itu disampaikan Rektor IAIN Ar-Raniry, Prof Dr Farid Wajdi Ibrahim, MA dalam sambutannya pada pembukaan Seminar Nasional Dual Mode System (DMS) FakultasTarbiyah IAIN Ar-Raniry Banda Aceh, Sabtu (20/10), di Auditorium Prof A Hasjmy. Rektor menambahkan, peran penting seperti itulah yang semestinya menjadikan para guru yang sekaligus berstatus sebagai mahasiswa Dual Mode System untuk meningkatkan kompetensi dan profe-

sionalisme. “Kita berharap, tenaga pendidik yang telah mengikuti seminar ini dapat menguasai minimal empat kompetensi, yaitu kompetensi pedagogic, profesional, kepribadian dan sosial, sebagaimana amanah UU No.14 tahun 2005 yang diuraikan dalam Permendiknas No.16 tahun 2007,” katanya. Menurut dia, program ini menuntut setiap guru yang mengajar di sekolah agar dapat melaksanakan tugasnya dengan profesional sesuai standar yang telah ditetapkan pemerintah. “DMS ini, program dari Direktorat Pendidikan Tinggi Islam, Kementerian Agama RI yang sudah berjalan sejak 2009 dan berakhir pada 2014,” papar Rektor. Pada kesempatan yang sama, Dekan Fakultas Tarbiyah Dr H Muhibbuthabry didam-

pingi Panitia Pelaksana Anton Widyanto menyampaikan, seminar itu adalah salah satu bentuk kontribusi nyata program Dual Mode System Fakultas Tarbiyah dalam memperingati Hari Jadi IAIN Ar-Raniry yang ke-49. “Di usianya yang sudah ke 49, IAIN Ar-Raniry diharapkan akan semakin maju sebagai research university, di mana salah satu indikatornya senantiasa concern dengan pengembangan intelektualitas, akademik dan penelitian,” ungkap Muhibbutthabry. Seminar itu diisi pakar Pendidikan Nasional tim Task Force Dual Mode System Kementerian Agama RI Prof Dr Aziz Fahrurrozi, Dekan FTK UIN Sultan Syarif Kasim Riau Dr Hj Helmiati dan Dekan Fakultas Tarbiyah IAIN Ar-Raniry Banda Aceh. (b07)

MPU Aceh Gelar Muzakarah Ekonomi Syariah BANDA ACEH (Waspada): Majelis Permusyawaratan Ulama (MPU) Aceh akan menggelar Muzakarah Ekonomi Syariah yang berlangsung, 23-24 Oktober di Banda Aceh. Ketua Panitia A Khalid, Sabtu (20/10) mengatakan, muzakarah dengan tema “Penguatan Ekonomi Syariah Menuju Masyarakat Aceh Yang Adil Dan SejahteraA” itu diikuti 85 peserta. Sedangkan tujuan muzakarah, kata Khalid, untuk membahas masalah aktual dan kontemporer seperti ekonomi Sya-

riah dalam rangka mencari solusi bagi permasalahan sosial keagamaan yang muncul di tengah-tengah masyarakat menjadi penting dilakukan. Adapun narasumbernya yaitu, Nazaruddin AW (Dekan Fakultas Syariah IAIN Ar-Raniry), dengan tema “Ekonomi Syariah (Filosofi dan Aplikasi di Aceh). Mahdi Muhammad (Pimpinan Bank Indonesia), dengan tema “Kebijakan Bank Indonesia dalam Pengembangan Ekonomi Syariah”.

Prof Dr H Muslim Ibrahim (Wakil Ketua MPU Aceh) dengan tema “Ekonomi Syariah dan Tantangan Modernitas (Perspektif Hukum Islam)”. Praktisi Ekonomi Syariah, Haizir Sulaiman (Bank Aceh Syariah) dengan “Konsep dan Pola Penerapan Ekonomi Syariah di Bank Aceh”. Dan dari Masyarakat Ekonomi Syariah Aceh Aminullah Usman dengan tema, “Peran dan Partisipasi Masyarakat Ekonomi Syariah (MES) Terhadap Penguatan Ekonomi Syariah di Aceh”. (b02)

Waspada/Khairul Boangmanalu

LOKASI penemuan mayat wanita diduga korban pembunuhan di kebun sawit Desa Suro Makmur, Kec. Suro, Aceh Singkil, Sabtu (20/10)

Puluhan Km Jalan Provinsi Di Pidie Rusak BANDA ACEH (Waspada) : Puluhan kilometer ruas jalan provinsi di Kabupaten Pidie kondisinya kini rusak parah. Kerusakan itu terjadi akibat kurang mendapat perawatan dari instansi terkait. Informasi diperoleh, Jumat (19/10) di Kantor Badan Perencanaan Pembangunan Daerah (Bappeda) Kabupaten Pidie, menyebutkan, ada sekira 48 kilometer ruas jalan provinsi dalam kondisi rusak karena kurang mendapat perawatan. “Panjang jalan yang mengalami kerusakan itu meliputi ruas Jalan Peukan Baro, Garot, Jabal Ghafur dan Teupin Raya, panjangnya 18 kilometer. Berikutnya Jalan Beureunuen-KeumalaTangse-Geumpang18kilometer,danJalanTibangBatee sepanjang 12 kilometer,” paparnya. Kepala Bappeda Pidie Maddan, melalui Sekretaris M Adam mengatakan, kerusakan badan jalan tersebut telah terjadi sejak lima tahun terakhir. Perbaikan yang dilakukan sangat terbatas. “Tidak bisa dilakukan seluruhnya akibat kucuran dana dari provinsi relatif sedikit. Dana yang dikucurkan untuk perbaikan jalan yang

menjadi tanggungjawab Pemerintah Provinsi Aceh di Pidie berkisar Rp1 hingga Rp4 miliar sehingga tidak bisa membiayai perbaikan,” katanya. Menurut dia, jumlah dana yang dikucurkan Pemerintah Aceh sangat sedikit sehingga tidak mampu mengcover semua jalan yang rusak. “Padahal idealnya dana yang dialokasikan Rp30 miliar per tahun,” kata Adam. Kadis Bina Marga dan Cipta Karya Pidie, Anwar Ishak menjelaskan, Pemkab Pidie bukan tidak mempedulikan keluhan masyarakat terhadap kerusakan ruas jalan provinsi di Pidie. Pasalnya, pembangunan dan perawatan jalan itu tanggungjawab Pemerintah Aceh. Namun, karena volume anggaran yang dikucurkan pihak provinsi sangat sedikit sehingga perawatan dan perbaikannya tidak bisa dilakukan secara menyeluruh. “Bagaimana kita bisa memperbaiki kerusakan jalan tersebut yang kini hampir semuanya rusak, sementara dana atau anggaran yang tersedia tidak mencukupi. Masyarakat juga harus memilah-milah, mana kewajiban provinsi dan kabupaten,” katanya. (b09)

Firasat Menjelang Maut SUASANA duka masih menyelimuti keluarga Rachmad Iqbal. Tak mudah bagi Rachmad Iqbal dan istrinya, Endang Er Suwanty melupakan kecelakaan yang telah merenggut jiwa Rizki Yolanda, 15, anak kedua mereka dari tiga bersaudara dan laki satu-satunya. Bahkan, sejak kejadian itu, Rachmad Iqbal sering jatuh pingsan bila mengingat dan membayangkan musibah yang menimpa putranya itu. Tak terkecuali Razali Saleh, sang kakek yang sangat dekat dengan almarhum. Saat kecelakaan itu terjadi, sang kakek bersama warga setempat berjibaku mengangkat tubuh mungil Rizki Yolanda dari himpitan mobil yang menabrak korban.

Endang Er Suwanty sendiri, hanya bisa meratapi ‘kepergian’ buah hatinya sambil istighfar dan menyebut nama Allah. “Kami tidak tahu kalau permintaan maaf kepada teman-teman sepermainan, termasuk temantemannya bermain bola, dua hari sebelum kecelakaan itu terjadi, sebagai pertanda kalau dia akan pergi untuk selama-lamanya,” kenang Endang Er Suwanty. Hal lain yang tidak biasa dilakukan korban adalah keinginannya disuapi nasi oleh sang kakek. Hari itu (Sabtu-red) sepulang dari sekolah, Kiki-panggilan akrab Rizki Yolanda, tidak mau makan jika tidak disuapi sang kakek. “Dia baru mau ma-

kan kalau disuapi kakeknya, bahkan dia sempat minta tambah makannya,” kata Endang. Ihwal permintaan maaf kepada teman-teman, juga diungkapkan Agustina, wali kelas III/ B SMP Negeri 7 Banda Aceh, tempat Kiki bersekolah. “Setelah kejadian, teman-teman sekelasnya bercerita kepada saya, waktu hari Sabtu dia sempat minta maaf kepada teman-temannya di sekolah. Almarhum bilang, dia pingin taubat, tidak mau lagi menggoda teman-temannya,” kata Agustina mengutip cerita anak didiknya. Menurut guru Matematika itu, prilaku aneh yang diperlihatkan Kiki sempat menimbulkan tanda tanya di benak te-

man-temannya sehingga beberapa teman sekolah Kiki menanyakan langsung hal itu kepada korban. Pertanyaan itu dijawab oleh Kiki, kalau dirinya sempat mengalami mimpi yang sangat mengerikan. “Namun, Kiki menolak menceritakan tentang mimpinya itu. Dia cuma bilang kalau mimpinya mengerikan sekali. Kiki juga bilang kalau dia mau pergi jauh, tapi tidak disebutkan kemana tujuannya. Keganjilan lain yang diperlihatkan Rizki Yolanda saat gotong royong di sekolahnya, Jumat (12/10). Kiki berulang kali menanyakan kepada wali kelasnya, Agustina, sampah mana lagi yang mau dibuang. “Gak

apa bu, biar saya aja yang angkat. Ibu tenang saja, saya masih sanggup,” ujar Agustina dengan mata berkaca-kaca. Di mata teman-teman dan guru serta orang tuanya, Kiki adalah anak yang baik, periang, penurut dan rajin shalat. “Pada malam Jumat, selepas halat Maghrib dia sering mengaji dan baca Yassin. Tapi, pada malam Jumat sebelum kecelakaan, Kiki tidak mengaji dengan alasan lelah sekali dan langsung tidur,” sambung Agustina mengutip cerita kakek korban. Seperti diberitakan, kecelakaan yang terjadi di lintasan Banda Aceh-Medan, tepatnya di Gampong Bukloh, Kecamatan Sukamakmur, Aceh Besar,

Senin (15/10) pagi, selain merenggut korban jiwa Rizki Yolanda dan Zulfahmi, juga merenggut korban jiwa Ernita dan Haya Zaira, istri dan anak Zulfahmi. Sedangkan putri bungsu Zulfahmi bernama Aura, mengalami shock berat sehingga saat menjalani perawatan di RSU dr. Zinoel Abidin, bocah berusia empat tahun itu tak sedetikpun mau dibaringkan di tempat tidur. “Tampaknya kecelakaan itu begitu mengguncang jiwa Aura sehingga dia shock berat,” kata seorang wanita yang ikut menjaga putri sulung Zulfahmi itu saat dalam perawatan di RSUZA. Iskandarsyah



Pemprov Diminta Benahi Jalan Provinsi Ke Singkil

Perkemahan Bhakti Satuan Karya Berakhir BANDA ACEH (Waspada): Pangdam Iskandar Muda Mayjen TNI Zahari Siregar menutup acara Perkemahan Bhakti Satuan Karya Pramuka Perdamaian Aceh jajaran Kodam Iskandar Muda di lapangan JapakehYon Raider 112 se-Propinsi Aceh, Aceh Besar, Minggu (21/10). “Saya yakin para peserta yang akan meninggalkan bumi perkemahan ini telah menjadi individu yang jauh lebih matang. saya berharap pengalaman selama di sini dapat dijadikan sebagai bekal dalam mengarungi kehidupan para peserta di masa mendatang yang masih sangat panjang,” ungkap Pangdam IM. Pangdam mengimbau kepada Pemerintah Aceh maupun kabupaten/kota agar sering melakukan kegiatan kepramukaan secara terpusat ini di mana kegiatan ini sangat positif sekali bagi mereka saya harapkan dari muspida untuk lebih aktif lagi memberikan satu kepedulian tentang antisipasi aktif kepada rakyatnya yang dalam hal ini diwakili oleh kepramukaannya. Hadir dalam acara penutupan perkemahan, Kapolda Aceh Irjen Pol Iskandar Hasan, Kasdam IM Brigjen TNI Iskandar M Sahil, para asisten dan Kabalakdam IM. (cb01)

SURO (Waspada): Untuk mendukung kesejahteraan rakyat di Pantai Selatan Aceh, Pemerintah Provinsi Aceh diminta benahi jalan provinsi ruas Subulussalam - Singkil. Demikian harapan masyarakat Aceh Singkil khususnya terkait pembenahan infrastruktur kepada pasangan Zaini Abdullah dan Muzakir Manaf, terkait kunjungan kerja Mualim, panggilan Wagub Aceh ke sana akhir pekan lalu. Aceh Singkil dan Subulussalam merupakan satu kawasan perkebunan kelapa sawit dan pengolahan minyak sawit, Cruide Palm oil (CPO) di pantai selatan Aceh yang perlu mendapat perhatian khusus pembenahan infrastruktur jalan karena volume dan intensitas kendaraan berbadan lebar atau truk angkutan besar yang kini dinilai tidak sebanding dengan kondisi jalan saat ini.

BPP2KB Langsa Bentuk Pusat Pelayanan Terpadu LANGSA (Waspada): Kepala Badan Pemberdayaan Perempuan & Keluarga Berencana (BPP2KB) Syahrizal menegaskan, saat ini BPP2KB telah membentuk suatu wadah pusat pelayanan terpadu pemberdayaan perempuan (P2TP2) untuk bersamasama mewujudkan keadilan dan kesejahtaraan bagi kaum perempuan. Hal itu diungkapkan Syahrizal kepada wartawan, Minggu (21/10). Menurutnya, tim ini dibentuk untuk menampung semua kasus anak dan kekerasan perempuan dalam rumah tangga, di mana kehadiran tim ini untuk melakukan mediasi terhadap kasus itu. Apalagi, sebagian kasus yang ditangani WH tentang anak-anak di bawah umur dan pelanggaran asusila wajib berkoordinir dengan BPP2KB. Dikatakan Syahrizal lagi, kehadiran P2TP2 untuk memudahkan perempuan dan anak untuk memperoleh pelayanan yang dibutuhkan dalam rangka pemberdayaan dan kesejahteraan. Di samping itu, juga mendukung perempuan dan anak untuk meningkatkan kemampuan, keterampilan, dan kemandirian, melayani konsultasi bagi pemecahan masalah perempuan dan anak. Yang selanjutnya memberikan rujukan persoalan perempuan dan anak ke berbagai sarana dan layanan lain yang dibutuhkan. (m43/b21)

Harga Kambing Naik 30 Persen KRUENG GEUKUEH (Waspada): Menjelang Hari Raya Qurban, harga kambing di Aceh Utara naik sekitar 30 persen. Seperti terjadi di pasar hewan di Dewantara, Aceh Utara, sebelumnya kambing qurban dijual Rp1,2 juta, kini menjadi Rp1,5 juta per ekor. “Permintaan kambing cukup tinggi, sehingga berpengaruh pada kenaikan harga, ditambah lagi bantuan kambing dari daerah laintidakada,sedangkanpersediaanlokalterbatas,”kataSambudiyah, pedagang hewan ternak di pasar tersebut, Minggu (21/10). Dikatakan, harga kambing layak kurban dilepas dengan harga antara Rp1,4-1,7 juta per ekor, sedangkan harga terendah Rp500 ribu per ekor, tetapi ukurannya masih kecil dan belum layak untuk kurban. Kendati, harga hewan ternak melonjak, tetapi minat pembeli teteap cukup tinggi. Buktinya, setiap hari pekan, di pasar hewan Dewantara ini mencapai 150 transaksi penjualan. (cmk)

Waspada/Mustafa Kamal

Polsek Langsa Barat Tangkap Pencuri Antar Provinsi LANGSA (Waspada): Dua tersangka pencuri antar provinsi berkedok sebagai pemungut barang bekas SZ, 17, warga Sungai Bilah, Pangkalanbrandan, Sumatera Utara bersama rekannya, FS, warga Brandan, buron, diamankan Polsek Langsa Barat saat melakukan pencurian di rumah M Daud, warga Lorong Utama Desa Sgriget, Langsa Barat, Sabtu (20/10). Kapolres Langsa AKBP Hariadi melalui Kapolsek Langsa Barat Iptu Budi Nasuha Waruwu, Minggu (21/10) mengatakan, kedua tersangka, FS dan SZ ini dari Brandan, berkedok mencari barang bekas meluncur ke Kota Langsa menggunakan becak bermotor menuju ke Lorong Utama Desa Sgriget. Sesampainya di sana FS masuk ke rumah M Daud yang malam itu sedang kosong. Sedangkan SZ menunggu di becak sambil melihat situasi. Kemudian tersangka FS masuk melalui jendela, membobol pintu menggunakan linggis dan mengambil satu unit handphone. (m43)

Waspada/Gito Rolies

PANGDAM Iskandar Muda Mayjen Zahari Siregar didampingi Kapolda Aceh Irjen Iskandar Hasan memberikan penghargaan kepada kontingen berprestasi, pada penutupan perkemahan pramuka Bhakti Satuan Karya, Minggu (21/10).

Faskab: Sejumlah Kecamatan Diindikasi Selewengkan Dana PNPM IDI TIMUR (Waspada): Fasilitator Kabupaten (Faskab) sedang mengumpulkan data terkait penyelewengan dana Program Nasional Pemberdayaan Masyarakat Mandiri Perdesaan (PNPMMPd) di sejumlah kecamatan. Jika terbukti, maka pihaknya siap memecat oknum pengurus program itu di tingkat kecamatan. “Kita sudah mengantongi beberapa kecamatan yang mencoba menyelewengkan dana program ini. Jika terbukti, maka kita akan usulkan pecat. Tapi uang diselewengkan juga harus dikembalikan,” kata Faskab PNPM-MPd Aceh Timur Zulfahmi, ketika mengisi Workshop Evaluasi dan Perencanaan Ruang Belajar Masyarakat (RBM) Kabupaten Aceh Timur 2012 di aula SKB Idi Timur, Sabtu (20/10). Menurut dia, dan PNPMMPd dan Bantuan Keuangan Peumakmu Gampong (BKPG) adalah diberikan pemerintah pusat dan pemerintah Aceh untuk meningkatkan taraf eko-

nomi masyarakat. Selain membangun gampong (desa—red), bantuan tersebut disalurkan dengan tujuan meningkatkan sumber daya manusia (SDA) ke arah yang lebih maju dan baik. “Jadi jika ada pihak yang menyelewengkan dana tersebut, maka sesuai mekanisme yang ada segera ditindak. Jadi mari kita bersama mengelola kegiatan sesuai Juklak dan Juknis,” papar Zulfahmi seraya me-

negaskan, sejumlah kecamatan yang diindikasi melakukan penyelewengan sedang dalam tahapan penyelesaian pengembalian uang. Ketua RBM Aceh Timur, Tgk Zulkifli M Thaib mengatakan, workshop tersebut diselenggarakan dengan tujuan untuk mengevaluasi kegiatan yang telah dilakukan dan merencanakan berbagai kegiatan yang menjadi prioritas utama. (b24)

Waspada/Muhammad H Ishak

FASKAB PNPM-MPd Aceh Timur Zulfahmi (kiri) ketika menyampaikan sambutan padaWorkchop Evaluasi dan Perencanaan RBM Aceh Timur di SKB Idi Timur, Sabtu (20/10).

IDI (Waspada): Panitia Khusus (Pansus) DPRK Aceh Timur siap menempuh jalur hukum baik pidana maupun perdata jika Bank Sulawesi Utara (Sulut) bersikeras tidak mengembalikan Rp6 miliar lebih jaminan asuransi Pemkab setempat. “Hasil pertemuan Tim Pansus dengan Bank Sulut Cabang Jakarta pada 15 Oktober lalu di Jakarta hingga sekarang belum ada titik terang, karena Bank Sulut menegaskan akan banding atas putusan Bupati Aceh Timur dan Pengadilan Negeri (PN) Idi berdasarkan surat resmi,” kata Muzakir, anggota Tim Pansus Jilid II dalam jumpa pers di Kantor DPRK Aceh Timur di Idi, Sabtu (20/10). Muzakir menduga, jika Bank Sulut tidak mengembalikan jaminan asuransi setelah Pemkab memutuskan kontrak pembangunan pusat Pemkab Aceh Timur di Idi dengan PT TGI, maka tidak tertutup kemungkinan diduga perusahaan asal Jakarta itu bermain mata dengan Bank Sulut ataupun dengan pihak asuransi.“Apapun alasannya, Bank Sulut harus mengembalikan Rp6 miliar jaminan asuransi Aceh Timur,” tegas Muzakir. Dalam jumpa pers itu hadir sejumlah politisi lain di antaranya Tgk Sulaiman Ismail, yang akrap disapa GM, Tajol Ula

selaku Ketua Pansus, Tgk Hasanuddin selaku Koordinator Pansus dan Abdul Hamid sebagai anggota Pansus. Tajol Ula menjelaskan bahwa jaminan asuransi Pemkab Aceh Timur di Bank Sulawesi Selatan (Sumsel) sebesar Rp14 miliar siap dikembalikan ke Pemkab Aceh Timur. Bahkan ketika Tim Pansus bertolak ke Jakarta awal pekan lalu, Bank Sumsel menerima dan membuat surat pernyataan tanda terima yang ditandatangani pihak Bank Sumsel yani Dahlan Kadir, selaku kuasa ukum dan Okma Riana selaku penyedia

legal. Dalam tanda terima bernomor 353/KAP/2.3/TTJ/B/2012 disepakati bahwa atas putusan PN Idi dan surat Bupati Aceh Timur pada angka 1, Bank Sumsel Babel melalui kuasa hukum akan segera menyampaikan kepada Direksi Bank Sumsel Babel untuk segera merealisasikan surat Bupati Aceh Timur pada kesempatan pertama. “Pansus ini akan berusaha agar seluruh jaminan asuransi Aceh Timur sebesar Rp20 miliar lebih kembali ke kas daerah Aceh Timur,” tutur Tgk Abdul Hamid, anggota Tim Pansus. (b24)

Waspada/Muhammad H Ishak

MUZAKIR saat menyampaikan hasil Pansus Jilid II DPRK Aceh Timur saat jumpa pers di kantor DPRK Aceh Timur di Idi, Sabtu (20/10).

MAA Dinilai Tak Proaktif


TERSANGKA pencuri antar provinsi, SZ, bersama barang bukti satu unit betor yang sudah hangus di halaman Polsek Langsa Barat, Minggu (21/10).

“Kita berharap Pemprov membenahi jalan untukmendukungperkebunansawitdanin-dustri minyak kelapa sawit,” papar Wartono, anggota DPRK Aceh Singkil yang juha Ketua DPC Partai Gerindra Aceh Singkil, belum lama ini. Ia mencontohkan, kerusakan jalan provinsi ruas Subulussalam - Singkil tepatnya di Kampung Bulusema, Kecamatan Suro, Aceh Singkil akibat banjir tahun 2010 lalu hingga kini belum diperbaiki. 50-an Meter pada dua titik jalan di sana aspalnya terkelupas akibat banjir, namun hingga kini belum diperbaiki. Selain jalan rusak itu, sejumlah jalan provinsi ruas Subulussalam - Singkil terlihat sempit dan tidak sebanding lagi dengan lalu - lintas kendaraan besar, terutama truk angkutan barang dan truk angkutan CPO ke sana. (b27)

Murid SD Langkahan Belajar Di Teras

Rp6 M Asuransi Di Bank Sulut Harus Dikembalikan PEDAGANG kambing kurban menunggu pembeli saat berjualan di Pasar Hewan Krueng Geukueh, Kecamatan Dewantara, Aceh Utara, Minggu (21/10)

WASPADA Senin 22 Oktober 2012

IDI ( Waspada): Terkait pelestarian adat budaya Aceh, Majelis Adat Aceh (MAA) dinilai tidak proaktif dalam melakukan berbagai langkah untuk menumbuhkembangkan adat dan budaya asli Aceh. “Oleh karenanya kita harap MAA lebih giat dalam melestarikan adat dan budaya Aceh khususnya di Kabupaten Aceh Timur,” kata Sekretaris Fraksi Partai Aceh DPRK Aceh Timur Fadhil Muhammad, Minggu (21/10) di Idi. Kata dia, upaya melestarikan adat dan budaya Aceh

dari ancaman globalisasi merupakan tanggungjawab lembaga MAA yang telah dibentuk Pemerintah Aceh sesuai UUPA. Untuk itu MAA Kabupaten Aceh Timur harus melaksanakan tugasnya semaksimal mungkin untuk pelestarian adat dan budaya Aceh. “Kita melihat dewasa ini adat istiadat yang ada di tanah rencong ini mulai mengalami kemunduran, jika dibandingkan Aceh tempo dulu. Jadi untuk pelestarian adat dan budaya Aceh dalam hal ini MAA sebagai lembaga yang harus berperan

maksimal,” ujar Fadhil. Ketua MAA Aceh Timur Tgk Lahmuddin melalui Kepala Bidang Pelestarian Adat dan Budaya Aceh MAA Aceh Timur, Ilyas Ismail menjelaskan, pihaknya mengakui selama ini MAA tidak bekerja maksimal, karena lembaga itu tidak memiliki anggaran sedikitpun untuk melakukan kegiatan pelestarian adat dan budaya. Dia mengharapkan, tahun 2013 Pemkab Aceh Timur dapat mengalokasikan anggaran yang lebih untuk berbagai sosialisasi dan pelestarian adat Aceh di Aceh Timur. (b24)

LANGKAHAN (Waspada): Sebanyak 37 murid kelas I dan V, SD Negeri 13 Langkahan di Desa non status Bidari, Kec. Langkahan, pedalaman Aceh Utara, terpaksa belajar di pustu tua lantaran kekurangan ruang belajar. “Khusus kelas satu, sebanyak 21 murid, belajar di teras. Mereka juga terpaksa belajar sambil lesehan di atas tikar lantaran tak ada bangku. Sedangkan murid kelas lain, duduk di bangku darurat,” kata Kepala SDN 13 Langkahan, Sukardi, Minggu (21/10). Sukardi menambahkan, total murid sekolah yang ia pimpin 107 orang. Mereka terbagi dalam lima rombongan belajar (rombel), mulai kelas I sampai kelas V. Namun ruang belajar permanen yang tersedia cuma tiga ruang. “Kami sudah mengusul pengadaan mobiler dan penambahan ruang kelas baru ke Disdikpora Aceh Utara, di Lhokseumawe. Tapi, sejauh

ini belum terkabul,” kata Sukardi via telepon. Sukardi juga menyebutkan, total guru di SDN 13 Langkahan, sembilan orang, termasuk dirinya. Namun delapan di antaranya masih berstatus bakti dan hanya kepala sekolah yang berstatus PNS. Kepala Desa non Status Bidari, Zainun S, kepada sejumlah wartawan, mengatakan, desa yang terpaut sekitar 45 kilometer arah selatan Lhoksukon itu terkesan dianaktirikan oleh Pemkab Aceh Utara. “Jalan saja belum memadai. Bahkan, sebagian anak-anak terpaksa naik perahu ketika pergi sekolah lantaran jalan penghubung antar dusun, rusak berat. Jalan itu putus akibat abrasi sejak lima tahun lalu dan kini sudah ditumbuhi semak belukar,” kata Zainun, di Desa non status Bidari, Sabtu (20/10). (b19)

Bubarkan Pesta Keyboard, Tim Gabungan WH Dihadang Warga LANGSA (Waspada) Tim gabungan Dinas Syariat Islam bersama Wiahatul Hisbah (WH) Kota Langsa bekerjasama dengan anggota Polisi Militer (PM) dan Satpol PP diserang warga saat akan melakukan pembubaran pesta musik keyboard di Gampong Alue Meureubo, Kecamatan Langsa Timur, Sabtu (20/10). Pantauan wartawan, sekira pukul 12:00 tim anti maksiat yang dipimpin Kadis Syariat Islam Ibrahim Latif mendapat informasi bahwa sedang berlangsung pesta keyboard syukuran personel TNI di Gampong Alue Meureubo dan melakukan pengecekan ke lokasi. Setelah melihat pertunjukan itu, personelWH dibantu Polisi Militer (PM) mencoba melakukan pembubaran hiburan keyboard tersebut karena diduga menjurus kepada perbuatan pornografi dan mabukmabukan. Tapi pembubaran itu justru mendapat perlawanan dari para penonton keyboard itu dengan melempari tim gabungan Satpol WH dan PM dengan botol minuman dan menghujani dengan batu. Tim gabungan yang sempat meminta bantuan Satpol-PP juga mendapat serangan yang mengejar dengan sepeda motor hingga di depan Pesantren Bustanul Ulum. Sementara Satpol PP yang mendapat serangan mendadak

mencoba menghindar dan langsung masuk ke kompleks Bustanul Ulum, sedangkan tim gabungan Satpol WH kembali ke kota karena salah seorang rekannya Edi Putra, A.Ma, 25, luka memar di kepala terkena lemparan batu dan dibawa ke RSUD Langsa. Begitu juga personel WH dan personel PM yang sempat mendapat luka lembab akibat serangan itu. Sedangkan personel Satpol PP yang terjebak di Pesantren Bustanul Ulum tak bisa keluar karena massa yang mengamuk sambil melemparkan batu masih berjaga-jaga di depan persantren. Mendapat tekanan itu, Dinas Syariat Islam meminta bantuan dari Polres Langsa untuk melakukan pengamanan. Akhirnya tepat pukul 01:30, personel Satpol PP dikeluarkan setelah mendapat penjagaan dari aparat kepolisian Polres Langsa. “Ketika hiburan keyboard telah kita bubarkan, kamilangsungdikepungdanlempardenganbotol miras, batu dan benda keras lainnya,” katanya. Sementara sebelumnya, tim anti maksiat juga telah menyisir jalan Lingkar PTPN I yang selama ini dijadikan lapak pacaran mengamankan empat pasangan di bawah umur. Sementara di Lapangan Merdeka, Lapangan Belakang dan kawasan Bambu Runcing, kawasan itu telah steril. (m43)

Permintaan Hewan Qurban Di Langsa Meningkat LANGSA (Waspada): Menjelang perayaan Hari Raya Idul Adha 1433 Hijriyah, permintaan hewan qurban di Kota Langsa meningkat tajam. Selain itu, harganya yang dipatok para penjual hewan qurban mengalami kenaikan bila dibandingkan hari-hari biasa., ,† Pantauan wartawan di salah satu tempat penjual hewan qurban, Marwan, Minggu (21/ 10) mengatakan, menjelang lebaran Idul Adha, permintaan hewan qurban mengalami peningkatan, baik itu lembu maupun kambing. Untuk kedua hewan ini, Marwan mengaku bisa menjual 5 - 6 ekor kambing maupun sapi (lembured). Sementara untuk kambing biri jika ada masyarakat yang ingin membelinya harus di pesan terlebih dahulu, karena harganya lebih

mahal bila dibandingkan kambing-kambing biasa. Untuk kambing yang dijual berasal dari luar Kota Langsa yakni Binjai Sumatera Utara, sedangkan untuk sapi kami hanya menyediakan dari Kota Langsa, karena jika dari luar daerah harganya lebih mahal., ,† Disebutkan, untuk harga jual kambing bervariasi mulai dari Rp1 juta hingga Rp 4.500.000 per ekor, begitupun juga dengan harga sapi dipatok berkisar Rp6 juta hingga Rp14 juta. Lanjutnya, masyarakat yang membeli hewan qurban ini datang dari berbagai daerah, dan Marwan mengaku, menjual hewan-hewan ternak ini bukan hanya menjelang Lebaran Idul Adha saja, akan tetapi setiap hari karena pada hari-hari biasa tak sedikit juga masyarakat yang membeli kambing untuk acara hakikah. (m43)

Warga Lamjame Pantau Lokasi Pelanggaran Syariat BANDA ACEH (Waspada): Ratusan warga Gampong Lamjame, Kecamatan Jaya Baru, Kota Banda Aceh, Sabtu, (20/10) meninjau dan memantau jembatan Lamjame yang disinyalir rawan terjadi pelanggaran Syariat Islam. Turut bersama warga,WakilWali Kota Banda Aceh Hj Illiza Saaduddi Djamal didampingi Sekdakota T Saifuddin TA dan sejumlah Kepala SKPD jajaran Pemko. Lokasi ini sering dimanfaatkan oleh pasangan mudamudi non muhrim di Kota Banda Aceh sebagai lokasi untuk memadu kasih. Sebelum turun ke lokasi, Illiza berkesempatan mengukuhkan Tim Amar Ma’ruf Nahi Mungkar (TANMAM) Gampong Lamjamee yang diketuai Keuchik Lamjamee Jufrizal. Tim ini beranggotakan Tuha Peut, Unsur Pemuda dan ibu-ibu dari Gampong Lamjamee sendiri. Pada kesempatan tersebut, Illiza meminta kepada para anggota tim yang dikukuhkan agar dapat mendedikasikan diri terhadap penegakan

Syariat Islam. Dan juga diharapkan mampu berfungsi sebagai Pageu Gampong yang mengawal Gampong Lamjamee dari praktik-praktik pelanggaran Syariat. “Kebanyakan dari mereka adalah pendatang yang memanfaat lokasi Gampong Lamjamee, Kalau kedapatan datangi dan tegur saja, Tugas dari TANMAM ini adalah memberikan nasihat dan bimbingan agar para pelanggar syariat ini sadar,” ujar Illiza. Selanjutnya, dia meminta kepada keuchik dan aparat gampong untuk menegur dan menindak siapa saja menyalahgunakan fungsi dari cafe, kos-kosan. Sekda pada kesempatan yang sama mengatakan, saat ini dari 90 gampong yang ada di Banda Aceh, sekitar 20 gampong masih sering terjadi pelanggaran syariat walaupun yang melakukan bukan masyarakat setempat. Sejauh ini sudah ada tiga gampong yang telah terbentuk tim amar ma’ruf nahi mungkar, antara lain Gampong Kuta Alam, Pango dan Lamjamee. (b02)

Masih Banyak Jalan Berlubang BLANGKEJEREN (Waspad) : Dua bulan lagi, Desember adalah batas terakhir realisasi fisik proyek Pemkab Gayo Lues untuk APBK murni 2012. Khusus untuk perbaikan jalan, progress yang dicapai masih hanya hitungan minim. Oleh karena itu, Mustafa dari kalangan LSM mendesak Pemkab untuk memperbaiki seluruh jalan rusak dan berlubang di Gayo Lues. Demikian dikatakannya, Minggu (21/10). Menurutnya, jalan berlubang adalah salah satu pemicu terjadinya kecelakaan. Warga beranggapan, seandainya saja badan jalan tidak rusak dan berlubang, mungkin beberapa peristiwa kecelakaan lalu lintas tersebut tidak akan

terjadi. Perlu diketahui, ratusan jalan di Gayo Lues dalam kondisi rusak. Banyak lubang di badan jalan. Lubang nyaris merata di sepanjang jalan Pengkala. Kerusakan ditengarai akibat maraknya kendaraan bermuatan berat melebihi tonase jalan. “Kita tadi sarankan agar jalan rusak ditambal dulu, semua jalan yang rusak dan berlubang,” kata Mustafa. Untuk dana menurut Mustafa, bisa menggunakan anggaran dana tanggap darurat yang disediakan Pemkab. Agar dapat melakukan perbai-kan secara menyeluruh walaupun bertahap. (cjs)

Waspada, Senin 22 Oktober 2012  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you