Issuu on Google+

Asrama TNI Terbakar ASRAMA perwira TNI Kodam Iskandar Muda di Banda Aceh terbakar, Minggu (19/6). Warga berupaya memadamkan api yang menghanguskan asrama tersebut. Kebakaran terjadi sekitar pukul 03:15 diduga akibat arus pendek itu. Lima bangunan dari kotruksi kayu musnah, namun tidak ada korban jiwa sedangkan kerugian diperkirakan ratusan juta rupiah.

WASPADA Demi Kebenaran Dan Keadilan

http://epaper.waspadamedan.com

SENIN, Wage, 20 Juni 2011/ 18 Rajab 1432 H

No: 23543 Tahun Ke-65

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-8, B1-8, C1-8)

Harga Eceran: Rp2.500,-

270 Gempa Susulan Guncang Taput Bangunan Rubuh Bertambah

Antara

TARUTUNG (Waspada): Gempa susulan yang menggoncang Luat Pahae Tapanuli Utara, sejak Sabtu (18/6) hingga Minggu (1/6), mengakibatkan bertambahnya jumlah bangunan hancur. Sedangkan gempa susulan tercatat 270 kali berkekuatan antara 0,5 hingga 5,1 Skala Richter (SR). “Frekuensi Gempa yang cukup tinggi dari hari sebelumnya disebabkan gempa susulan yang cukup besar yaitu 5,1 SR di tambah dengan rentanan gempa selanjutnya sampai Minggu pagi (19/6). ‘’Warga diminta tetap waspada, jangan panik, “ujar Ketua Tim Survei BMKG (Badan Meteorologi Klimatologi Dan Geofisika) Rifwar Kamin,Ssi kepada Waspada, Minggu (19/6) di Posko Utama Kantor Camat Pahae Jae – Sarulla Taput. Dia mengatakan, gempa susulan yang masih di rasakan masyarakat Pahae terjadi malam hari dengan kekuatan 5,1 SR dengan parameter gempa. Kejadian pukul 18 : 58, pusat gempa 1.78 LU 99.14 BT, kedalaman 10 km, kekuatan 5,1 SR. Lanjut ke hal A2 kol. 3

Waspada/Parlindungan Hutasoit

MASJID Raya Assallam Aekbotik, Kec Pahae Jae – Taput hancur akibat gempa susulan, Sabtu (18/6). Selain itu rumah penduduk yang rusak jumlahnya bertambah banyak.

Ruyati Dipancung Di Arab Saudi Kisah Kegigihan Ruyati Berakhir Di Ujung Pedang JAKARTA ( Waspada): Suasana duka menyelimuti kediaman almarhumah Ruyati binti Sutadi, 54, tenaga kerja wanita asal Indonesia, yang dihukum pancung oleh Pemerintah Arab Saudi. Di rumah sederhana bercat warna pink di Jalan Raya Sukatani Kampung Ceger RT 03 RW 02, Desa Sukadarma, Kec. Sukatani, Kab. Bekasi, penuh sanak keluarga dan warga sekitar yang bersimpati atas kasus yang menimpa Ruyati. Een Nuraeni, 35, anak pertama Ruyati, mengungkapkan dirinya pertama kali mendapat kabar ibunya telah dihukum pancung pada pukul 01.00 dinihari tadi, Minggu (19/6). “Migrant Care menelefon saya, kasih kabar ibu saya sudah meninggal,” ujar Een kepada wartawan, sembari terisak. Baru pagi hari tadi Kementerian Luar Negeri memberikan kabar serupa. Almarhumah sudah dimakamkan di Makkah setelah dieksekusi Sabtu. Kabar mendadak itu sangat disesalkan keluarga. Apalagi, kata Een, ibunya ternyata langsung di makamkan dan tidak dibawa pulang ke Tanah Air. “Keluarga mohon agar ibu bisa dipulangkan ke rumah dan akan dimakamkan di sini di pemakaman keluarga,” tambah Eeen.

Anak ketiga Ruyati, Iwan Setiawan, 25, menyesalkan tidak adanya pertanggungjawaban dari pihak perusahaan pengirim ibunya, PT DGU. Menurut dia, sejak Ruyati dipenjara pada 12 Januari 2010, perusahaan itu tidak pernah sekalipun memberi kabar tentang nasib ibunya. Selama ini, perkembangan kasus Ruyati, mereka terima secara rutin melalui telefon dari seorang TKW asal Lampung bernama Marni. “Dia itu TKW yang bekerja pada anak majikan ibu saya,” ujarnya. Sebelum berangkat ke Saudi terakhir kali, Agustus 2008, Ruyati sempat memalsukan KTP. “Umur ibu dibuat lebih muda 11 tahun, atas permintaan perusahaan. Supaya lancar dan tidak menemui kendala,” kata Iwan. Keluarga sempat berkeberatan Ruyati berangkat jadi TKW untuk ketiga kalinya. “Ibu juga sudah tua. Seharusnya istirahat saja di rumah, nggak usah kerja lagi di Saudi,” ucap Iwan. Menurut anak kedua Ruyati, Epi Kurniati, 27, ibunya memaksa pergi ke Saudi karena tidak ingin menyusahkan anakanaknya di masa tua nanti. “Kami sekeluarga sudah melarang dengan segala cara, tapi ibu tetap nekat,” katanya. Lanjut ke hal A2 kol. 3

Tabrakan Di Jalinsum

1 Tewas, 8 Luka-luka Dian

Eriq

Kasus Jeruk Makan Jeruk

Ijab Kabul Lancar KUALASIMPANG (Waspada): Kasus jeruk makan jeruk (perempuan menikahi perempuan,red) yang terjadi di Kab. Aceh Tamiang, Provinsi Aceh, semakin menghebohkan warga Bumi Muda Sedia. Seperti diwartakan Waspada, Sabtu (18/6), seorang remaja perempuan bernama Sri yang mengubah namanya menjadi Eriq, berhasil mempersunting bahkan menikahi Dian, 22, janda muda beranak dua, warga Desa Paya Bedi, Kec. Rantau, Kab. Aceh Tamiang. Lanjut ke hal A2 kol. 3

LENTERA

Pejabat Mengharap Kritikan Oleh: Syahruddin Siregar ADA pejabat yang tidak tahan dikritik. Begitu mendapat kritikan dia spontan seperti ‘kebakaran jenggot’, kasak-kusuk berusaha menutup-nutupi kritikan tersebut. Tetapi ada pula pejabat yang sengaja meminta dikritik jika memang dia menyimpang dari yang seharusnya. Adalah khalifah Umar bin Khattab r.a (581-November 644 M) yang tercatat dalam sejarah pemimpin Islam pada waktu pengangkatannya khawatir tidak ada pihak yang mau mengoreksi tindakannya demi menghormatinya.

LUBUKPAKAM (Waspada): Tabrakan beruntun di Jalinsum TanjungmorawaLubukpakam, Minggu (19/6) menewaskan Antoni,21, pengandara sepedamotor Yamaha Vixion BK 3348 SI, warga Gg. Keluarga, Dusun VIII, Desa Dalu XB, Tanjungmorawa, Deliserdang. Sumber dihimpun Waspada, sebelum insiden maut ini terjadi, korban yang mengendarai sepedamotor datang dari arah Medan menuju Lubukpakam. Setibanya di Jalinsum Km 21-22, Desa Tanjungbaru, Lanjut ke hal A2 kol. 5

JEDDAH (Antara): Seorang wanita Indonesia Ruyati binti Satubi, 54, Sabtu (19/6) dihukum pancung sampai mati karena membunuh seorang wanita Arab Saudi, kata Kementerian dalam Negeri Arab Saudi. Menurut penyalinan huruf dari bahasa Arab, wanita itu Raiaiti Beth Sabotti Sarona, terbukti bersalah membunuh wanita Saudi Khairiya binti Hamid Mijlid dengan menyerangnya berulangkali pada kepala dengan pemotong daging dan menikamnya di leher, kata kementerian itu dalam sebuah pernyataan yang diangkat oleh kantor berita resmi SPA. Kantor berita itu tidak menguraikan motif kejaha-

tan itu, ataupun mengungkapkan hubungan antara kedua wanita itu. Tapi beberapa pejabat Indonesia mengatakan bahwa sekitar 70 persen dari 1,2 juta warga Indoesia yang bekerja di Arab Saudi adalah staf domestik (rumahtangga). Pemancungan di provinsi Makkah di Saudi barat itu membuat jumlah eksekusi di kerajaan yang sangat konservatif itu tahun ini menjadi 28 orang, menurut hitungan AFP

berdasarkan pada laporanlaporan pejabat dan kelompok hak asasi manusia. Kelompok Amnesty International yang bermarkas di London pekan lalu minta pada Arab Saudi untuk berhenti melaksanakan hukuman mati, mengatakan telah ada peningkatan signifikan dalam jumlah eksekusi yang dilakukan pada enam tahun terakhir. Mereka menyatakan sedikitnya 27 orang telah dieksekusi di Arab Saudi pada 2011, “sama seperti jumlah semua orang yang dieksekusi pada sepanjang 2010. Limabelas orang dieksekusi pada Mei saja. Pada 2009, jumlah eksekusi mencapai 67, dibanding 102 pada 2008.

26 TKI Tunggu Giliran Pancung PADANG(Waspada): 26 TKI asal Indonesia terancam hukuman mati Di Arab Saudi . Mereka bakal menyusul seperti nasib Ruyati binti Satubi, 54, yang dieksekusi pancung oleh pemerintah Arab Saudi kemarin. “Kita tidak ingin peristiwa seperti yang terjadi pada Ruyati berulang pada 26 tenaga kerja yang saat ini tengah menunggu eksekusi,” ujar Menteri Hukum dan Hak Asasi Manusia Patrialis Akbar di Padang, Minggu (19/6). Patrialis mengakui, dalam kasus Ruyati, pemerintah merasa kecolongan karena tidak ada pemberitahuan resmi yang diberikan pemerintah setempat terkait eksekusi warga negara Indonesia di Arab Saudi. Patrialis mengaku, pihaknya hanya diberitahu Kedubes Arab Saudi di Jakarta, eksekusi Ruyati telah dilaksanakan. “Tidak ada pemberitahuan tertulis,” imbuhnya. (vvn)

Ransel Hitam Hebohkan Pengunjung Binjai Super Mall

Waspada/Hendrik Prayitno

DUA polisi Australia tengah memeriksa barang-barang di kamar apartemen Pemred Waspada dan rombongan di Oaks Harmony, Quay Street, Sydney, Minggu (19/6). Seorang penjahat bersenjata buronan polisi masuk dan bersembunyi ke kamar apartemen tersebut.

Polisi Australia Bekuk Mafia Narkoba Di Apartemen Pemred Waspada SYDNEY ( Waspada): Satuan Polisi Australia membekuk seorang penjahat bersenjata di kamar apartemen Pemimpin Redaksi (Pemred) Waspada H.Prabudi Said dan rombongannya di Oaks Harmony, Quay Street, Sydney, Minggu (19/6). Si penjahat diduga mafia narkoba yang melarikan diri dari kejaran polisi. Polisi bersenjata membuka pintu apartemen Waspada dengan kunci T, menemukan si penjahat bersembunyi di salah satu kamar dalam apartemen. Pada saat kejadian, seluruh penghuni kamar apartemen berlantai dua itu sedang keluar. Polisi yang memeriksa kamar setelah tertangkapnya si penjahat menemukan alat-alat narkoba

seperti jarum suntik, plastik kecil yang diduga tempat menyimpan bubuk narkoba tersembunyi di dalam sebuah tas hitam. Di dalamnya terdapat selebaran berbahasa Thai. Pelaku diduga adalah seorang berkewarganegaraan Thailand. H.Prabudi Said beserta rombongan yang kembali ke apartemen sekira pukul 18:00 waktu setempat mendapati pintu kamar apartemen dalam keadaan rusak dan kondisi ruangan yang berserakan. Polisi yang sudah tidak berada di tempat saat rombongan kembali telah meninggalkan secarik kertas berkop polisi

Daging Lembu “Belum Matang”

Lanjut ke hal A2 kol. 1

BINJAI (Waspada): Binjai Super Mall (BSM) sebagai pusat perbelanjaan terbesar di Kota Binjai di Jalan Soekarno-Hatta, Minggu (19/6), dilanda isu bom. Pasalnya, sebuah ransel warna hitam dan biru terletak di sudut tembok persis depan kios Pos Honda di lantai satu. Salah seorang Satpam menyebutkan, tidak diketahui siapa yang meletakkan ransel itu. Sudah dua jam lebih tidak ada yang mengambil.

Aparat Polres Binjai yang menerima informasi sudah siaga mengintai pemilik tas yang dicurigai itu, sebab di bagian atas tas berbentuk segi empat. Pukul 12:30, polisi meminta pengusaha BSM menginstruksikan seluruh pengunjung ke luar. Di saat itulah muncul teriakan heboh, dan pengunjung berlarian ke luar. Suara –suara meneriakkan ada bom.

Medan Utara Tak Layak Dipimpin Camat

Ada-ada Saja

MEDAN (Waspada): Warga sejumlah kelurahan di Kec. Medan Belawan mendesak pemerintah daerah dan pusat segera mewujudkan pemekaran wilayah Medan Utara, karena kondisi daerah itu dinilai sudah tidak layak lagi dipimpin camat. Hal tersebut terungkap dalam temu ramah antara Ketua Organisasi Daerah (Orda) Ikatan Cendikiawan Muslim Indonesia (ICMI) Medan Indra Sakti Harahap ST.MSi dengan warga Kec. Medan Belawan di Jalan Bawal, Pajak Baru, Kel. Belawan Bahagia, Medan Belawan, Rabu (15/6). Lanjut ke hal A2 kol. 1

Tanpa Dana Pemerintah

Guru Ngaji Dari Langkat Studi Banding Ke Jawa

Laporan Dedi Sahputra dari Sydney, Australia PASCA Australia mengeluarkan kebijakan memboikot ekspor lembu ke Indonesia, hubungan kedua negara jadi “hangat-hangat kuku”, kalau tidak mau dibilang memanas. Belum matangnya kedua negara jadi penyebabnya. Lanjut ke hal A2 kol. 2

Bakat Memimpin Eddy Syofian Sejak Sekolah MENJELANG pemilihan ulang Pilkada ulang kota Tebingtinggi, masyarakat di sana akan dihadapkan pada beberapa pilihan calon pemimpin. Sosok yang menonjol yang paling diharapkan membawa Tebingtinggi menjadi lebih maju dan berkembang adalah Drs H.Eddy Syofian, MAP (foto).

Lanjut ke hal A2 kol. 6

Ilustrasi/net

Lanjut ke hal A2 kol. 3

YANG namanya studi banding kerap dilakukan oleh kelompok kepentingan dari pemerintahan seperti Satuan Kerja Perangkat Daerah (SKPD) maupun anggota DPR (D) guna mengunjungi atau menemui obyek tertentu yang Lanjut ke hal A2 kol. 6

Lanjut ke hal A2 kol. 6

Pukul Murid, Kepala Guru Ditodong Pistol AKIBAT diduga menganiaya muridnya, seorang guru di Kuala Lumpur menjadi korban penodongan senjata api yang dilakukan oleh orangtua siswa. Harian Metro melaporkan, guru tersebut diduga memukul kepala salah seorang murid perempuan, yang kemudian mengadu kepada ayahnya. Karena tak senang dengan tindakan guru itu, orangtua siswa kemudian mendatangi sekolah dasar tempat anaknya belajar dan menodong guru itu dengan pistol yang ia bawa. Tersangka berusia 30an tahun itu, mendatangi kantin sekolah saat sang guru sedang sarapan dan langsung menyerangnya. Meski guru itu sempat meminta maaf, namun orangtua Lanjut ke hal A2 kol. 3

erampang Seramp ang Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu menerima laporan hasil studi banding dari Kyai Abdurrahman, Jumat (17/6).

- Itula, pigi nggak ngajak-ngajak - He...he...he...


Menag Berupaya ONH Tak Naik JEPARA (Antara): Menteri Agama Suryadharma Ali mengatakan pemerintah bersama DPR RI akan berupaya agar Ongkos Naik Haji (ONH) atau Biaya Penyelenggaraan Ibadah Haji (BPIH) tahun 2011 tidak mengalami kenaikan. “Hingga kini, BPIH memang masih dalam tahap pembahasan dengan Komisi VIII DPR. Tetapi, pemerintah bersama DPR akan berupaya agar BPIH tahun ini tidak naik,” ujarnya di Jepara, Jateng, Sabtu (18/6) malam.

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

http://epaper.waspadamedan.com

SENIN, Wage, 20 Juni 2011/18 Rajab 1432 H z No: 23543 * Tahun Ke-65

Terbit 24 Halaman (A1-8, B1-8, C1-8) z zHarga Eceran: Rp 2.500,-

Kasus Perempuan Nikahi Perempuan Di Aceh Tamiang

Izab Kabul Berjalan Lancar

Waspada/ist

Dian

KUALASIMPANG (Waspada): Kasus perempuan menikahi perempuan yang terjadi di Kab. Aceh Tamiang, Provinsi Aceh kian terkuak dan semakin menghebohkan warga Bumi Muda Sedia. Seperti diwartakan Waspada, Sabtu (18/6), seorang remaja perempuan bernama Sri yang mengubah namanya menjadi Eriq, berhasil mempersunting bahkan menikahi Dian, 22, janda muda beranak dua, warga Desa Paya Bedi, Kec. Rantau, Kab. Aceh Tamiang. Datok Penghulu Kampung (baca: Kepala Desa/Geuchik) Bukit Rata, Kec. Kejuruan Muda, Kab. Aceh Tamiang, Hermansyah yang disebut-sebut menerbitkan NA (Nota Akad) Eriq untuk menikahi Dian, ketika dikonfirmasi di Kantor Datok Penghulu, Sabtu (18/6), mengaku tak ingat lagi apakah dia pernah menandatangani NA untuk Eriq atau tidak. “Saya enggak ingat lagi, apa ada saya tandatangani NA untuk Eriq atau tidak. Saya memang enggak ingat lagi, sebab pertinggal

surat NA memang enggak ada arsipnya di kantor ini. Gitu juga data kependudukan atas nama Eriq, juga tidak ada arsipnya,” kilah Hermansyah. Hermansyah menyatakan dia belum lama menjadi Datok Penghulu Kampung Bukit Rata. Ketika serah terima jabatan memang tidak ada penyerahan arsip/dokumen oleh Datok Penghulu yang lama,sehingga tidak ada arsip. “Ketika saya menjadi Datok Penghulu, yang diserahkan hanya meja-meja ini, sedangkan bukti-bukti dokumen atau arsip data lainnya tidak ada. Makanya saya tidak tahu apakah Eriq itu warga Bukit Rata apa bukan, dan saya juga tidak ingat apakah ada saya tandatangani NA atas nama Eriq. Nanti hari Senin akan saya cek ke KUA Rantau tentang NA atas nama Eriq, siapa sebenarnya yang menerbitkan NA itu,” janji Hermansyah. Sedangkan Imam Dusun Mawar, Kampong Bukit Rata, Lanjut ke hal A2 kol 4

Waspada/ist

Eriq

Ruyati Dipancung Di Arab Saudi Pernyataan Arab Saudi MAKKAH (Waspada): Pemerintah Arab Saudi merilis pernyataan resmi bahwa seorang perempuan asal Indonesia bernama Ruyati binti Saboti Saruna telah dieksekusi mati di Makkah, Sabtu (18/6). Pekerja migran itu divonis bersalah karena membunuh warga Saudi, yang juga perempuan, bernama Khairiyah binti Hamed bin Ahmad Majlad, dengan pisau. Hal itu disampaikan Kementerian Dalam Negeri dan dipublikasikan oleh kantor berita Saudi Press Agency (SPA), Sabtu (18/6). “Kementerian menyatakan bahwa terpidana telah mengaku bersalah. Pengadilan Umum telah menjatuhkan vonis dan hukuman itu juga didukung oleh Pengadilan Kasasi dan Mahkamah Agung. Perintah Kerajaan telah dikeluarkan untuk pelaksanaan eksekusi itu,” demikian penjelasan pemerintah kepada SPA. Kementerian Dalam Negeri Saudi menegaskan bahwa Pemerintah Penjaga Dua Masjid Suci, Raja Abdullah Ibn Lanjut ke hal A2 kol 2

26 TKI Lagi Tunggu Eksekusi Mati JAKARTA (Waspada): TKI Ruyati binti Satubi, yang dihukum mati di Arab Saudi pada Sabtu (18/6), karena membunuh istri majikannya, Khoiriyah Omar Moh Omar Hilwani, kata Kepala Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia (BNP2TKI) Moh Jumhur Hidayat. “Dalam persidangan, Ruyati dengan gamblang mengakui membunuh setelah bertengkar karena keinginannya untuk pulang tidak dikabulkan,” kata Jumhur di Jakarta, Minggu (19/6). Ruyati, TKI asal Kampung

Ceger RT 03/01, Kecamatan Sukatani, Bekasi, Jawa Barat, menjalani hukuman mati dengan cara dipancung di Makkah, Arab Saudi, pada Sabtu (18/6). Jumhur mendapat laporan bahwa Ruyati yang dikirim un-

tuk bekerja di Arab Saudi oleh pelaksana penempatan TKI swasta (PPTKIS), PT Dasa Graha Utama, membunuh Khoiriyah pada 12 Januari 2010 dengan cara membacok beberapa kali kepala korban dengan parang dan menusuk leher korban dengan pisau dapur. Jumhur menduga Ruyati nekat membunuh majikannya karena selama ini kerap dianiaya. “Dalam persidangan Ruyati sempat mengaku sering dianiaya secara fisik, sehingga pada akhirnya dia melawan, yang berujung jatuhnya kor-

ban pada majikan perempuannya,” kata Jumhur. Perempuan berusia 54 tahun itu divonis mati dan dinyatakan terbukti melakukan pembunuhan pada 12 Januari 2010. Ruyati dituduh membunuh majikan dengan cara kejam, yakni menusukkan pedang berkali-kali ke tubuh korban. Di depan pengadilan, Ruyati mengakui perbuatannya. “Hukum di Saudi Arabia memang demikian adanya, bila seseorang membunuh maka pengadilan akan menjatuhkan Lanjut ke hal A2 kol 1

Pilkada Aceh Jadi Model Indonesia, Bahkan Dunia JAKARTA (Waspada): Pelaksanaan Pilkada Aceh pada November mendatang menjadi model Pilkada di Indonesia, bahkan dunia. Sebab hanya di Aceh ada partai politik lokal dan calon independen yang mengikuti Pemilu. “Calon independen dan partai lokal itu bukan hadiah dari Indonesia tapi hasil dari tawar-menawar dalam perjanjian Helsinki tahun 2005. Jika tanpa calon independen, delegasi GAM mundur dan perdamaian batal dilaksanakan,” sebut Deputi Bidang Koordinasi Politik Dalam Negeri Kemenko Polhukam, Mayjen TNI Amiruddin Usman dalam diskusi publik bertema Pemilukada dan Konsolidasi De-

mokrasi di Aceh, Sabtu (18/6) malam, di Hotel Grand Sahid, Jakarta. Amiruddin menyebutkan, untuk Pilkada Aceh mendatang, maka semua warga mesti mengawal agar pelaksanaan pemilihan berlangsung sukses. Untuk itu, kesiapan mental untuk patuh pada peraturan mesti dilaksanakan. “Mahkamah Konstitusi sudah menyatakan ada calon independen, maka di Aceh mesti dilaksanakan. Jika tidak, maka pemerintah bisa digugat,” sebut pria kelahiran Aceh Singkil itu. Pembicara lain, mantan Ketua Komisi Pemilihan Umum, Prof Dr Nazaruddin Lanjut ke hal A2 kol 7

Waspada/Parlindungan Hutasoit

MASJID Raya Assallam Aekbotik, Kec Pahae Jae – Taput hancur akibat gempa susulan, Sabtu (18/6) dan sejumlah rumah penduduk rusak.

270 Gempa Susulan Guncang Taput Hingga Hari Kelima Bangunan Hancur Dan Rubuh Bertambah

Waspada/Murizal Hamzah

DISKUSI politik tentang demokrasi di Aceh yang berlangsung di Hotel Sahid, Jakarta, Sabtu (18/6) malam, diadakan oleh Ikatan Mahasiswa Pascasarjana (IMPAS) Aceh Jakarta.Dari kanan ke kiri, moderator dosen Universitas Malikusaleh Aceh Utara, Kamaruddin Hasan dengan tiga pembicara anggota KPU, Dr. Abdul Aziz, staf Menkopolhukam Mayjen Amirudin Usman, dan mantan Ketua KPU Prof Nazaruddin Syamsuddin.

TARUTUNG (Waspada): Gempa susulan yang mengguncang Luat Pahae Tapanuli Utara, sejak Sabtu (18/6) hingga Minggu (1/6), mengakibatkan bertambahnya jumlah bangunan hancur. Sedangkan gempa susulan tercatat 270 kali berkekuatan antara 0,5

hingga 5,1 Skala Richter (SR). “Frekuensi Gempa yang cukup tinggi dari hari sebelumnya disebabkan gempa susulan yang cukup besar yaitu 5,1 SR di tambah dengan rentanan gempa selanjutnya sampai Minggu pagi (19/6). ‘’Warga diminta tetap was-

pada, jangan panik, “ujar Ketua Tim Survey BMKG (Badan Meteorologi Klimatologi Dan Geofisika) Rifwar Kamin,Ssi kepada Waspada, Minggu (19/ 6) di Posko Utama Kantor Camat Pahae Jae – Sarulla Tapanuli Utara (Taput). Dia mengatakan, gempa su-

sulan yang masih dirasakan masyarakat Pahae terjadi malam hari dengan kekuatan 5,1 SR dengan parameter gempa. Waktu kejadian pukul 18:58, pusat gempa 1.78 LU 99.14 BT, kedalaman 10 km, kekuatan 5,1 SR. Lanjut ke hal A2 kol 2

RUYATI, TKI yang dipancung di Arab Saudi.

Anak-anak Mohon Jenazah Ibunya Dipulangkan SUASANA duka menyelimuti kediaman almarhumah Ruyati binti Satubi ,54, tenaga kerja wanita asal Indonesia, yang dihukum pancung oleh Pemerintah Arab Saudi. Di rumah sederhana bercat warna pink di Jalan Raya Sukatani Kampung Ceger RT 03 RW 02, Desa Sukadarma, Kecamatan Sukatani, Kabupaten Bekasi, penuh sanak keluarga dan warga sekitar yang bersimpati atas kasus yang menimpa Ruyati itu. Een Nuraeni ,35, anak pertama Ruyati mengungkapkan, dirinya pertama kali mendapat kabar ibunya telah dihukum pancung pada Minggu (19/6) pukul 01:00 WIB dinihari. “Migrant Care menelefon saya, kasih kabar ibu saya sudah meninggal,” ujar Een sembari terisak. Baru pagi hari tadi (Minggu) Kementerian Luar Negeri memberikan serupa. Almarhumah sudah dimakamkan di Makkah setelah dieksekusi pada Sabtu (18/6). Kabar mendadak itu sangat disesalkan keluarga. Apalagi, kata Een, ibunya ternyata langsung dimakamkan dan tidak dibawa pulang ke Tanah Air. “Keluarga mohon agar ibu bisa dipulangkan ke rumah dan akan dimakamkan di sini di pemakaman keluarga,” tambah Eeen. Anak ketiga Ruyati, Iwan Setiawan ,27, menyesalkan tidak adanya pertanggungjawaban dari pihak perusahaan pengirim ibunya, PT DGU. Menurut dia, sejak Ruyati dipenjara pada 12 Januari 2010, perusahaan itu tidak pernah sekalipun memberi kabar tentang nasib ibunya. (vvn)

Pengaspalan Jalan Sibolga Barus Terkendala Akibat Pipa PDAM TAPTENG ( Waspada) : Pembangunan jalan Sibolga - Barus Tapanuli Tengah sepanjang 4 km dengan lebar 6 meter dengan dana APBN terkendala pipa PDAM Mual Nauli Tapteng yang di kedalaman 30 cm hingga 1 meter sehingga mengganggu pengaspalan. “Pipa air milik PDAM Mual Nauli ini benar-benar mengganggu pekerjaan kita, bukan kita tidak bisa mengerjakan,

Ada-ada Saja

Al Bayan

Pukul Murid, Kepala Guru Ditodong Pistol

Kebersihan Kucing Oleh: H. Ameer Hamzah KUCING adalah binatang kesayangan manusia. Banyak rumah orang Islam yang memelihara mahluk yang mirip harimau ini. Kucing binatang yang paling bersih. Binatang ini selalu membersihkan bulunya dengan jilatan lidahnya. Menurut para dokter badan kucing bersih secara keseluruhan. Liurnya bersih dan membersihkan. Aman bila dipegang oleh manusia. Rasulullah SAW membiarkan kucing minum dalam bejananya. Sisa air minum kucing masih digunakan Rasulullah untuk berwudhuk.(HR: Tarmizi). Binatang ini, jika membuang hajatnya dicari tanah yang lemah, debu atau

Lanjut ke hal A2 kol 2

Waspada/Riswan Rika

GEGANA Brimob sedang mengamankan tas yang dicurigai dan membawa ke mobil untuk diteliti.

Binjai Super Mall Dilanda Isu Bom Gegana Amankan Tas Hitam BINJAI (Waspada): Binjai Super Mall (BSM) sebagai Pusat Perbelanjaan terbesar di Kota Binjai di Jalan Soekarno-Hatta, Minggu (19/6) dilanda isu bom. Pasalnya, sebuah ransel warna hitam dan biru terletak di sudut tembok persis depan kios Pos Honda di lantai satu. Salah seorang petugas Satpam menyebutkan, tidak diketahui siapa yang meletakkan ransel itu, dan sudah dua jam lebih tidak ada yang mengambil. Lanjut ke hal A2 kol 7

Akibat diduga menganiaya muridnya, seorang guru di Kuala Lumpur menjadi korban penodongan senjata api yang dilakukan oleh orangtua siswa. Harian Metro melaporkan, guru tersebut diduga memukul kepala salah seorang murid perempuan, yang kemudian mengadu kepada ayahnya. Karena tak senang dengan tindakan guru itu, orangtua siswa kemudian mendatangi sekolah dasar tempat anaknya Lanjut ke hal A2 kol 7

vivanews

Net

Lembu.

Daging Lembu “Belum Matang” Laporan Dedi Sahputra dari Sydney, Australia PASCA Australia mengeluarkan kebijakan memboikot ekspor lembu ke Indonesia, hubungan kedua negara jadi “hangat-hangat kuku”, kalau tidak mau dibilang memanas. Belum matangnya kedua negara jadi penyebabnya. Angin dingin menerpa apa saja di Sydney siang itu. Tapi sebagai seorang Indonesia saya merasakan juga hawa panas hubungan kedua negara. Betapa tidak. Boikot itu dilakukan karena alasan Lanjut ke hal A2 kol 4

tapi kan sayang kalau pipa itu kita timbun dan akhirnya pecah sehingga mengakibatkan kualitas pekerjaan kita tidak bagus dan akhirnya yang rugikan juga masyarakat Tapanuli Tengah,”kata Pejabat Pembuat Komitmen 11 (Barus Cs) dari Kementerian Pekerjaan Umum Ir.Buyung Sitompul kepada Waspada di campnya, Parombunan, Kec Sibolga Selatan. Menurut Buyung, sudah berupaya bernegosiasi dengan PDAM Mual Nauli, Selasa (7/ 6) dan PDAM meminta bantuan agar pemborong membantu pendanaan pemindahan pipa, karena mereka tidak punya dana, dan itu disetujui pemborong tetapi diminta bantuan PDAM Mual Nauli agar menerjunkan tim teknisnya ke lapangan saat pemindahan pipa tersebut. Pertemuan itu ditindak lanjut, Rabu (8/6) baik pihak pemborong jalan maupun pihak PDAM Mual Nauli sepakat membuat undangan akan mengadakan pertemuan, Jumat (10/6) di Base Camp PT.Wasco di Barus. Lanjut ke hal A2 kol 2

Serampang - Pemerintah jangan lengah, 26 TKI lagi tunggu eksekusi... - He.... he....he....


Berita Utama

A2 Ruyati...

hukuman mati sampai keluarga korban memberi maaf untuk tidak dihukum mati. Kami sudah berusaha, tapi belum mampu menembus rigiditas sistem hukuman mati di Saudi Arabia,” jelas Jumhur. 26 TKI Tunggu Eksekusi Ruyati binti Satubi ,54, sepertinya bukan tenaga kerja asal Indonesia yang terakhir dieksekusi mati oleh pemerintah Arab Saudi. Sebanyak 26 orang tenaga kerja migrant Indonesia terancam bernasib sama seperti Ruyati. “Kita tidak ingin peristiwa seperti yang terjadi pada Ruyati berulang pada 26 tenaga kerja yang saat ini tengah menunggu eksekusi,” ujar Menteri Hukum dan Hak Asasi Manusia Patrialis Akbar di Padang, Minggu (19/6). Patrialis mengakui, dalam kasus Ruyati, pemerintah merasa kecolongan karena tidak ada pemberitahuan resmi yang diberikan pemerintah setempat terkait eksekusi warga negara Indonesia di Arab Saudi. Patrialis mengaku, pihaknya hanya diberi tahu Kedubes Arab Saudi di Jakarta bahwa eksekusi terhadap Ruyati telah dilaksanakan. “Tidak ada pemberitahuan tertulis,” imbuhnya. Walau begitu, pemerintah menyadari, pemerintah tidak bisa mencampuri hukum yang berlaku di Arab Saudi karena tidak ada kata maaf (takzir) dari pihak keluarga korban. Menurutnya, saat ini sedikitnya terdapat 316 warga negara Indonesia yang bekerja di Arab Saudi terbelit perkara hukum di sana. “Pemerintah setempat bersedia membebaskan 316 tenaga kerja kita yang bermasalah hukum di sana kecuali Ruyati, karena tidak mendapat takzir,” ungkapnya. Terkait 26 tenaga kerja Indonesia yang terancam hukuman mati, pemerintah berjanji akan segera melakukan lobilobi terhadap pemerintah Arab Saudi. Saat ini, pemerintah berniat mengembalikan jenasah Ruyati ke tanah air sesuai dengan keinginan keluarga. Meskipun hal ini tidak mudah, pemerintah akan berupaya untuk itu. Negosiasi terkait upaya pemulangan jenazah Ruyati akan dilakukan pemerintah dalam waktu dekat. Sesuai aturan hukum pemerintah Arab Saudi, terpidana yang telah dihukum pancung langsung dikuburkan di sana. Konsulat Jenderal Republik Indonesia (KJRI) di Jeddah, telah meminta akses seluasluasnya kepada Kementerian Luar Negeri Arab Saudi dan fasilitas pendampingan terhadap Ruyati melalui dua nota diplomatik. SBY Panggil Dubes RI Presiden Susilo Bambang Yudhoyono (SBY) menginstuksikan memanggil Duta Besar RI untuk Kerajaan Arab Saudi, Gatot Abdullah Mansyur Sirnagalih ke Jakarta untuk menjelaskan hukuman pancung atas Ruyati. “Dubes RI akan dipanggil ke Jakarta untuk menjelaskan-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. g4+, Rg6. 2. Me8+, Mf7. 3. MxM+, Rh6. 4. Mh5+mat.

TTS Topik

I T E R O M I I N O L L O O G I

Umum

U A S P E P O S I M B S E N

R O K A P A N K L I A T M S U D I B I U S N

I K R O N I S E R R V A S T O R J I U R M

O N D I K I T B A T A T O R O P A O N G T A N A N G A

I S I A M E R T R R I S B A G E A K A

I

1 6 4 8 2 5 3 7 9

2 5 9 3 7 1 4 6 8

U S E E R A U M P A N N G U R A B R A N G

Jawaban Sudoku: 8 1 6 9 3 7 2 4 5

5 9 2 6 8 4 7 3 1

7 4 3 1 5 2 9 8 6

9 2 8 7 1 3 6 5 4

4 3 1 5 6 9 8 2 7

6 7 5 2 4 8 1 9 3

mastikan bahwa SBY sudah memperoleh informasi mengenai hukuman pancung ini. “Untuk hal tersebut, pemerintah merasa sangat berduka dan terpukul, terutama kami sampaikan kepada keluarga atas kasus yang menimpa Ruyati itu,” ujarnya. Sebelumnya, Kementerian Luar Negeri RI mengecam pemancungan Ruyati ini. “Tanpa mengabaikan sistem hukum Arab Saudi, pemerintah mengecam pelaksanaan hukum tersebut karena dilakukan tanpa memperhatikan praktek internasional yang terkait perlindungan kekonsuleran,” kata Juru Bicara Kementerian Luar Negeri Michael Tene. Kemenlu menyatakan, walaupun pemerintah mengetahui bahwa Ruyati telah divonis bersalah, namun Arab Saudi tidak pernah memberitahukan kapan tanggal pasti vonis pancung dilakukan. (ant/vvn)

Pengaspalan...

mun tidak satupun dari PDAM Mual Nauli yang hadir,”kata Buyung. Menurutnya, hendaknya pihak PDAM Mual Nauli bisa tanggap dalam membantu percepatan pembangunan didaerah ini bukan menghalanghalangi karena dengan terbangun akses jalan itu sudah dapat dipastikan pendapatan asli daerah akan bertambah dan dapat membantu perekonomian masyarakat sekitar. Lebih lanjut dikatakannya, padahal sesuai UU RI No 38 Tahun 2004 penanaman pipa air bersih minimal kedalaman 1,5 meter dan pelanggaran tentang batas minimum pipa oleh PDAM Mual Nauli merupakan tindak pidana. Oleh sebab itu Buyung berharap agar pihak PDAM Mual Nauli Tapanuli Tengah bisa lebih arif. Sementara Direktur PDAM Mual Nauli Tapanuli tengah Ir.Joston Lubis beberapa kali akan dikonfirmasi, tidak berhasil ditemui di kantor nya.(a23)

“Anehnya surat undangan yang dibuat itu kita tanda tangani berdua yakni saya sebagai penanggungjawab proyek jalan itu dan Direktur PDAM Mual Nauli Ir.Joston Lubis dengan mengun-dang Kabag Teknik PDAM MUAL Nauli, Pelaksana Lapangan PDAM Barus-Batas Kota Sibolga, Konsultan Suvervisi, Kontraktor PT.Widya Sapta Colas/Wasco dan pengawas lapangan, na-

Pernyataan...

Abdulaziz Al Saud, berkomitmen untuk menegakkan keamanan, keadilan dan penerapan perintah Allah terhadap siapapun yang menyerang dan membunuh orang lain. “Pemerintah memperingatkan siapapun yang mencoba melakukan tindakan itu, baik laki-laki atau perempuan akan dihukum berdasarkan hukum agama,” demikian pernyataan pemerintah Saudi.(vvn/SPA)

270 Gempa...

“Gempa yang di rasakan di Sarulla IV-V MMI, merupakan gempa berkekuatan kecil antara 2,9 SR hingga 4,3 SR MI. Sehingga rumah yang mengalami kerusakan di akibatkan gempa utama 14 Juni 2011, telah bergeser dari pondasinya. ‘’Kami imbau warga yang memiliki rumah yang mengalami kerusakan parah agar tidur dalam tenda yang telah di sediakan di Posko. Itu untuk kenyaman dan keamanan,” imbuh Rifwar. Namun, masyarakat Luat Pahae sejak goncangan gempa kemarin masih merasa ketakutan luar biasa, atau trauma. Minggu (19/6) warga tampak di luar rumah dan di tendatenda darurat menjaga kemungkinan gempa susulan. Bahkan paginya ada goncangan gempa kecil menyebabkan warga berhamburan ke luar dan lari ke tempat yang lebih luas. “Kami sangat takut dengan gempa susulan tadi malam. Kami tidak mau tinggal dalam rumah dan terpaksa tidur di tenda – tenda bahkan banyak yang tidak tidur hingga pagi,”ujar Roy M Siregar dan M Simatupang. Masjid Hancur Akibat gempa susulan, Sabtu (18/6) dengan kekuatan 5,1 SR Masjid Raya Asslam Aek Botik Pahae Jae roboh, rata dengan tanah.Alat berat dikerahkan di lokasi membersihkan reruntuhan bangunan masjid. Jasa Sitompul kepada Waspada mengatakan, akibat gempa susulan lokasi Masjid Raya Assalam Aekbotik Desa Setia Kecamatan Pahae Jae terpaksa di ratakan dengan tanah, sebab seluruh bangunan sudah keropos akibat goncangan gempa. “Gempa itu sungguh me-

Kebersihan...

Jawaban TTS: S I S K A M L I N G

nya,” kata Juru Bicara Presiden, Julian Aldrin Pasha, saat dihubungi Minggu (19/6). Pemerintah, ujar Julian, telah meminta Kementerian Luar Negeri untuk berkoordinasi dengan Kedutaan Besar Republik Indonesia di Arab Saudi untuk menangani hal ini. “Pemerintah meminta KBRI untuk berkoordinasi dengan pihak Departemen Luar Negeri dan pihak Saudi Arabia untuk dapat menangani hal ini,” katanya. Pada dasarnya, kata Julian, pemerintah telah memberikan perhatian lebih kepada TKI maupun warga negara Indonesia di luar negeri yang sedang menghadapi kasus hukum. “Pemerintah dalam hal ini memberi perhatian lebih kepada TKI dan warga negara Indonesia di manapun berada yang terkait dengan kasus hukum,” kata Julian yang me-

3 8 7 4 9 6 5 1 2

tumpukan pasir lalu digali lobang, setelah mengeluarkan najisnya, dengan kukunya ditutup kembali. Siapa yang mengajarkan kucing begitu mencintai kebersihan? Siapa lagi kalau bukan ilham dari Allah SWT. Allah Maha Pencipta mahluk membekali kucing dengan otot yang melindungi kulitnya dari kuman. Lidah kucing dilengkapi dengan air liur yang mematikan bakteri-bakteri. Dalam lidahnya ada benjolanbenjolan kecil, fungsinya untuk membersihkan bulu-bulunya dari kotoran. Meski kucing aman dari penyakit, namun tidak baik juga bila anak-anak manusia memanjakan binatang ini, sebab bila terlalu dekat dengan manusia, jika terinjak atau terjepit ekornya, secara reflek kucing juga mengigit manusia. D i p e rk i r a k a n k u c i n g mengetahui bahasa manusia. Sebaliknya manusia tidak mengetahui bahasa kucing. Jika sebuah rumah tangga selalu cekcok antara suami isteri, kucing akan minggat dari rumah, ia pindah ke rumah yang lain. Begitu juga bila si kucing kelaparan, tuan rumah tidak

nakutkan warga Pahae,” katanya. Menurutnya, mesjid itu diratakan untuk membangun yang lebih kuat sehingga umat Muslim Pahae dapat menunaikan ibadahnya seperti shalat Jumat di hari-hari yang akan datang. Untuk sementara direncanakan akan didirikan tenda pengganti mesjid tersebut. Sementara, untuk membangun kembali masjid itu dibutuhkan dana berkisar Rp 1,5 miliar, ujar Jasa yang juga anggota DPRD Taput. Sedangkan Parlautan Gultom selaku Ketua Panitia Pembagunan Masjid Raya Assallam menjelaskan, masjid tersebut di bangun 1979 dan sudah berusia 35 tahun. Katanya, pihaknya akan mengupayakan pembagunan masjid tersebut lebih kuat dari bangunan sebelumnya, sehingga membutuhkan dana miliaran rupiah. Hasil pantauan Waspada di lapangan, warga yang bermukim di daerah tersebut masih trauma dengan goncangan-goncangan gempa kecil yang selalu menghantui mereka. Kondisi rumah warga, saat ini sudah semakin memprihatinkan, tidak tertutup kemungkinan jika goncangan masih berlanjut warga yang bermukim di Luat Pahae akan kehilangan rumah tempat tinggal mereka. Sementara, data dihimpun dari Kec Simangumban, Tapanuli Utara, akibat gempa susulan ada perubahan data dari sebelumnya, yaitu rumah warga 7 unit kategori rusak berat, rusak sedang 2, rusak ringan 34, gereja rusak ringan 1, rusak sedang 1, SMP rusak sedang 1, SMA rusak ringan 1, rumah dinas Puskesmas rusak ringan 1 dan jembatan rambin rusak ringan 1.(a21) memberi makan si kucing juga pindah. Jika kita pelihara kucing jangan sampai lupa diberi makan. Dalam hadits, orang yang mengurung kucing sampai mati kelaparan akan masuk neraka. Memelihara kucing ada manfaatnya. Selain nasi-nasi sisa di rumah menjadi makanannya, juga kucing dapat menangkap tikus. Tikus tidak berani berkeliaran di rumah. Kucing juga menjadi hiburan, sebab anak-anak kucing yang bergurau sesamanya mampu menampilkan berbagai atraksi dan adegan lucu, antara lain mirip olahraga pencak silat, judo, tinju, loncat indah, lari cepat, panjat dan sebagainya. Kucing itu sangat setia, terutama kepada anak-anaknya yang baru dilahirkan. Anakanaknya yang belum terbuka matanya dijaga dengan perawatan yang prima. Tubuh anaknya terus dijilat-jilat agar tidak kotor. Anak-anak kucing itu mendapat perlindungan dari induknya, memberi air susu setiap anaknya membutuhkan (kehausan). Anak-anak kecilnya disembunyikan. Biasanya di tempat-tempat yang aman, selain jangan dimakan “kucing jantan” juga jangan mengganggu manusia.

WASPADA Senin 20 Juni 2011

LPK Partai Golkar Sibolga Dilantik DPP Sambut Baik TOT Golkar Sibolga SIBOLGA (Waspada): Demi menyukseskan tahun 2011 sebagai tahun kaderisasi, DPD Partai Golkar Kota Sibolga telah mempersiapkan segala persiapan yang mapan, bahkan dituju sebagai narasumber yang nantinya akan ditugaskan untuk memberi keberhasilan dalam program kaderisasi yang rencananya akan diselenggarakan bulan juli mendatang, dan hal itu perlu dicermati bahwasanya bagi partai Golkar kader merupakan “akar dari pepohonan sepanjang akar itu kokoh dan kuat” untuk itu diharapkan para kader yang telah dilantik agar bekerja dengan baik dan bersungguhsungguh dalam melaksanakan tugasnya masing-masing. Demikian diungkapkan Sahlul Umur Situmeang selaku Ketua DPD II Partai Golkar Kota Sibolga, dalam sambutannya pada pelantikan LPK dan Training of Trainners DPD II Partai Golkar Sibolga tahun 2011, di Gedung Topas Hotel Wisata Indah Kota Sibolga, Sabtu (18/6) malam. Walikota Sibolga Drs HM Syarfi Hutauruk yang juga merupakan Dewan Pertimbangan DPD Partai Golkar Kota Sibolga dalam arahannya mengatakan, sejarah Partai Gol-

kar yang mempertahankan Negara Kesatuan Republik Indonesia(NKRI) berdasarkan pancasila, telah mampu membuktikan bahwa partai Golkar sejak berdiri sudah tumbuh dan menjelma di tengah-tengah masyarakat dan menjadi salah satu partai besar bahkan hingga saat ini masih diperhitungkan, untuk itu, kaderkader Golkar yang telah dilantik diharapkan agar selalu menjaga martabat dan harga diri partai serta membawa Partai Golkar menuju kearah lebih baik, khususnya para kaderisasi yang ada di Kota Sibolga. Ketua DPD Partai Golkar Sumatera Utara, diwakili Korda Sibolga dan Tapanuli Tengah, Jongker Tampubolon menegaskan, Partai Golkar saat ini merupakan salah satu Partai besar yang terpopuler, dengan demikian seluruh kaderisasi, pendukung dan simpatisan ditugaskan untuk memenangkan Partai Golkar pada pemilu 2014 dengan target 30 persen kursi di DPR RI, disamping itu juga menurut Jongker Tampubolon seluruh pengurus Partai Golkar harus mampu mengelola sekitar 40 juta Kader, kendati diakuinya hal itu merupakan tugas berat yang harus dilakukan, dan

Jongker Tampubolon yakin Partai Golkar di Kota Sibolga mampu mengemban tugas tersebut. Pada kesempatan itu, fungsionaris Partai Golkar Chairuman Harahap yang juga Ketua Komisi II DPR RI, menyebutkan Partai Golkar akan menjadi kuat Kokoh apabila setiap pengurus saling kerjasama dan pikul memikul dalam hal mengemban tugas. Chairuman juga menegaskan bahwa Partai Golkar Kota Sibolga merupakan salah satu kepengurusan yang solid di Indonesia, karena Partai Kota Sibolga tanggap akan instruksi baik itu instruksi dari DPD I Partai Golkar Sumatera Utara maupun menjalankan instruksi DPP Partai Golkar terlebihlebih khususnya mengenai kaderisasi dan konsolidasi sampai ke akar rumput. “Saya salut melihat Partai Golkar Kota Sibolga yang begitu tanggap dengan instruksi baik itu dari DPD I Partai Golkar Sumatera Utara maupun DPP Partai Golkar, khususnya mengenai kaderisasi dan konsolidasi sampai keakar rumput, terlebih-lebih saat ini Walikota Sibolga menjabat Dewan Pertimbangan Partai Golkar Kota Sibolga” tegasnya.(a23)

Izab Kabul...

“Entah Datok Penghulu yang sekarang yang menandatangani NA, entah Datok Penghulu Bukit Rata yang lama. Nanti hari Senin akan saya cek ke KUA Kec. Rantau tempat Eriq melangsungkan pernikahan bersama pasangannya itu,” janji Syamsul. Syamsul juga mengaku tidak tahu kalau Eriq itu adalah Sri. Ketika itu memang suara dan pembawaannya persis seperti laki-laki. “Saya baru tahu kalau Eriq itu perempuan setelah baca Waspada, yang disebut-sebut berdomisili di Desa Tanjung Karang. Tapi kenapa anak itu juga punya KTP Bukit Rata, kami benar-benar kecolongan dan tertipu. Tapi yang lebih tahu apakah Eriq itu lakilaki atau perempuan adalah Sucipto, karena Sucipto yang membawa Eriq menjumpai saya minta NA. Sucipto sekarang merantau ke Banda Aceh,” ujar Syamsul. Sedangkan Datok Penghulu Kampung Paya Bedi, Kec. Rantau, Azhari Rahmad ketika dikonfirmasi, juga menyatakan tidak ingat lagi tanggal berapa Eriq dan Dian menikah. “Ketika itu kalau enggak salah, saya sedang pergi ke Banda Aceh. Tapi saya enggak ingat lagi tanggalnya,” aku Azhari Rahmad seraya menambahkan, arsip NA atas nama Dian masih disimpannya. Kepala Lorong (Keplor) Dusun Inpres, Desa Paya Bedi, Abu Bakar ketika ditanya juga memberi jawaban sama. Abu

Bakar mengaku tak ingat tanggal berapa Eriq dan Dian menikah di KUA Rantau. “Saya memang hadir pada acara pernikahan di KUA Rantau,” ungkap Abu Bakar. Abu Bakar menerangkan, selain dia pada acara pernikahan itu juga hadir Nustami (orangtua Dian), Muzakir (Imam Desa Paya Bedi), Pak Manaf (Ka. KUA Kec. Rantau), Dian serta Eriq yang tanpa pendamping. “Eriq waktu itu sendirian tanpa ada teman atau saudara yang mendampingi. Acara izab qabul akad nikah berjalan lancar.” Sementara itu, menurut warga, Eriq selama ini memang selalu berjalan bersama Dian. “Kami sering melihat mereka berdua selalu bersama,” ungkap sejumlah warga Kota Kualasimpang. Sedangkan informasi lainnya menyebut, Dian sebelumnya sudah dua kali menikah dan pernikahannya dengan Eriq yang ternyata Sri itu, adalah pernikahan yang ketiga kali. “Dian sudah punya sepasang anak yang masih kecil,” tutur warga Desa Paya Bedi. Walau begitu, Waspada belum bisa memperoleh keterangan dari Dian maupun Eriq, karena mereka sedang tidak berada di rumahnya. Kasusnya, masih terus diusut Polres Aceh Tamiang. “Kami sedang mengusut kasus ini,” ungkap Waka Polres Aceh Tamiang, Kompol A. Azas Siagian.(b24)

Gary RM.Jusuf misalnya, dia menerima cacian dan makian orang-orang Australia gara-gara video tersebut. Mereka mengirimi setumpuk surat yang bernada tidak menyenangkan kepada Konsul RI di Sydney. ‘’Ada yang mengatakan tidak mau lagi datang ke Indonesia. Saya bilang silahkan saja kalau tidak mau datang karena itu hak mereka. Tapi sebaiknya masalah ini disikapi dengan bijak,’’ kata Gary. Bahkan pihak kedutaan RI juga mendapat teror berupa kiriman paket berisi kotoran lembu yang dikirim orang Australia. ‘’Pihak kedutaan juga dikirimi kotoran lembu karena peristiwa ini,’’ kata Gary. Gary menekankan, dari peristiwa ini menunjukkan bahwa sebetulnya kedua pihak sama-sama belum “matang” atau belum dewasa dalam bersikap. ‘’Sebagai sebuah negara, kelihatan kedua pihak belum dewasa. Yang satu sok menggurui, yang lain langsung emosional. Responsnya kalau perlu perangpun jadi. Kasus lembu ini menunjukkan belum matangnya kedua negara,’’ kata Gary. Gary mungkin benar. Lihat saja sikap pemerintah Australia, langsung main boikot. ‘’Harusnya-kan beritahukan dulu baik-baik. Ini sudah main boikot aja langsung,’’ katanya. Dari caranya memotong lembu, orang Australia mungkin menganggap orang Indonesia tidak beradab. Nah, orang Indonesia ketika menyikapi sikap yang kekanak-kanakkan ini tak kalah serunya. Prinsip “ente beli ana jual” langsung berlaku di sini. ‘’Malah ada yang bilang kalau perlu perang aja sama Australia,’’ kata Gary, mengingatkan bagaimana seharusnya hubungan bertetangga yang saling menguntungkan agar tetap harmonis. Faktanya, Australia juga punya ketergantungan pasar ekspor ke Indonesia. Di kawasan Northern Territory misalnya, ini adalah daerah produ-

sen lembu yang 80 persen lembunya diekspor ke Indonesia. ‘’Sekarang di sana, lembu-lembu itu tidak tahu mau dikemanakan. Apa mau dibunuhi saja,’’ kata Gary. Indonesia adalah negara yang membeli 60 persen dari lembu Australia yang diekspor. Sapi tersebut diekspor dari Pelabuhan Darwin di Northern Territory, dan Broome dan Wyndhan di Australia Barat. Berdasarkan data Meat & Livestock Australia, pada 2010, penjualan sapi ke Indonesia memberikan kontribusi sebesar 319 juta dolar Australia atau setara dengan USD342 juta. Pihak Kementerian Perda-

Syamsul ketika dikonfirmasi, membenarkan ada orang bernama Eriq datang bersama warga Dusun Mawar, Sucipto menemuinya. “Saya juga sudah lupa tanggal berapa kedua orang itu datang, minta tolong dibuatkan NA atas nama Eriq,” ungkap Syamsul. Menurut Syamsul, ketika itu Sucipto menyatakan Eriq tidak punya saudara dan famili di Aceh Tamiang. Eriq merantau dari Pekan Baru ke Aceh Tamiang dan sudah menjadi warga Desa Bukit Rata. “Tolonglah Pak Imam buatkan NA untuk Eriq yang mau menikah,” ucap Pak Imam Dusun Mawar, Syamsul menirukan permintaan Sucipto dan Eriq. Syamsul juga mengaku tak kenal Eriq, sebab yang membawanya Sucipto. “Saya tidak kenal dengan Eriq di mana rumahnya, tetapi Eriq punya KTP berdomisili di Desa Bukit Rata dan ada juga fotocopi Kartu Keluarga (KK). Saya sudah melihat data-datanya ketika itu, lalu saya katakan kalau mau buat NA harus menyerahkan fotocopi KTP 2 lembar dan fotocopi KK serta pasfoto warna 2x3 cm 6 lembar,” rinci Syamsul. Lalu, lanjut Syamsul, setelah semua persyaratan administrasi dilengkapi Eriq, selanjutnya sebagai Imam Dusun dia mengajukan NA atas nama Eriq untuk ditandatangani Datok Penghulu Kampung Bukit Rata.

Daging...

Indonesia tidak “hewani” memperlakukan lembu yang akan dipotong. Sebuah tayangan video yang beredar luas di internet menunjukkan proses pemotongan seekor lembu. Atas dasar ini pemerintah Australia yang mendapat tekanan dari Animals, sebuah Lembaga Swadaya Masyarakat (LSM) setempat, akhirnya memutuskan memboikot ekspor lembu ke Indonesia. Dalam video yang disajikan LSM Animals itu dikabarkan berlokasi di sebuah Rumah Potong Hewan (RPH) di Binjai tersebut terlihat seorang bertelanjang dada dan seorang lagi mengenakan jaket dan helm. Dengan bersusah payah mereka menjatuhkan hewan besar itu ke lantai keramik. Beberapa kali dilibas dan beberapa kali ditendang sebelum si lembu dipotong. Dalam narasinya, seorang perempuan yang bernama Lyn White dari LSM Animals mengatakan bahwa sulit sekali untuk tidak bersimpati kepada Brian (nama yang diberikannya untuk si lembu). Dia juga bertanya mengapa si lembu harus dikirim ke Indonesia untuk mendapat siksaan seperti itu. Maka pemerintah Australia pun akhirnya terprovokasi video yang katanya hasil investigasi pemotongan hewan di Indonesia tersebut. ‘’Kunjungan ini bisa sangat tidak tepat ataupun bisa jadi sangat tepat. Karena di tengah memanasnya hubungan antara Indonesia dengan Australia gara-gara kasus ekspor lembu,’’ kata Konsul Jenderal Indonesia di Sydney, Gary R.M. Jusuf ketika menerima Pemred Waspada dan rombongannya di gedung KJRI. Video pemotongan lembu di Binjai tersebut ternyata tidak saja menghentikan ekspor lembu dari Australia ke Indonesia. Tapi video tersebut juga telah menyebabkan berbagai perlakuan tidak manusiawi yang diterima orang Indonesia di Australia.

Waspada/Zulfan Nasution

FUNGSIONARIS DPP Partai Golkar yang juga Ketua Komisi II DPR RI Chairuman Harahap, SH.MH saat mengalungkan tanda peserta Training of Trainners (TOT) DPD II Partai Golkar Sibolga tahun 2011, di Gedung Topaz Hotel Wisata Indah Kota Sibolga.Sabtu (18/6) malam.

Pilkada...

Sjamsuddin, MA. Dia menyatakan, agar pelaksanaan Pilkada Aceh berlangsung damai, maka mesti membuang dendamdendam pada masa lalu. “Dendam bisa selesai jika kita mau memaafkan. Orang yang berjiwa besar yang mau memberi maaf ketika dia berkuasa,” sebut pria kelahiran Bireuen ini. Pembicara lainnya lagi yaitu DR Abdul Aziz, dari KPU Pusat, yang menjelaskan KPU akan mengawal KIP Aceh dalam pelaksanaan Pilkada nanti. Abdul menyatakan, Aceh punya modal untuk menghasilkan pelaksanaan demokrasi yang harmonis karena memiliki sejarah yang panjang serta modal Syariat Islam. “Jika ada anggota kami melanggar aturan dengan memihak kandidat tertentu, maka beritahu kami,” pintanya dalam diskusi yang dimoderatori Kamaruddin Hasan, dari Universitas Malikussaleh Lhokseumawe. Diskusi publik ini dilaksanakan setelah Sekda Provinsi Aceh, T. Setia Budi atas nama Gubernur Aceh Irwandi Yusuf melantik Pengurus Ikatan Mahasiswa Pascasarjana (IMPAS) Aceh-Jakarta, dengan Ketua Sayuti Abu Bakar dan Sekretaris Azwir Nazar. Diskusi diikuti kalangan mahasiswa asal Aceh, mahasiswa pascasarjana, aktivis, cendekiawan serta tokoh Aceh di Jakarta, termasuk anggota DPR RI asal Aceh, Muslim dan Azwar Abubakar.(cmh)

Binjai...

Aparat Polres Binjai juga sudah siaga mengintai pemilik tas yang dicurigai itu, sebab di bagian atas tas berbentuk segi empat. Pukul 12:30 polisi meminta pengusaha BSM menginstruksikan seluruh pengunjung ke luar. Di saat itulah muncul teriakan heboh, dan pengunjung berlarian ke luar. Suara –suara meneriakkan ada bom. Sedangkan karyawan dan pengunjung ingin melihat ransel itu diperintahkan menyingkir dan Polres Binjai langsung memasang garis polisi . “Kita tidak bisa main-main. Apalagi baru saja terjadi ledakan bom di Lubuk Linggau Sumatera Selatan,’’kata petugas yang ditemui saat mengevakuasi warga. Dia menyebutkan, Polri tidak berspekulasi terhadap benda yang mencurigakan. Setelah aparat Brimob Binjai memasuki lokasi, pengunjung diperintahkan lebih menjauh. Sekitar pukul 14:15, tim Gegana Brimob langsung memasuki areal dan mengamankan benda itu. Disaksikan Kapolres Binjai AKBP Rina Sari Ginting, dalam tempo 15 menit anggota Gegana sudah mengamankan ransel tersebut. Gegana selanjutnya memasukkan tas ke mobil . Menurut keterangan ransel itu akan diperiksa Mako di Brimob. Kapolres Binjai AKBP Dra Rina Ginting ketika dikonfirmasi Waspada i mengatakan, itu ransel bukan berisikan bom namun berisikan baju pria dan buku-buku.(a04/a05)

Pukul...

belajar dan menodong guru itu dengan pistol yang ia bawa. Tersangka berusia 30an tahun itu, mendatangi kantin sekolah saat sang guru sedang sarapan dan langsung menyerangnya. Meski guru itu sempat meminta maaf, namun orangtua siswa merasa tidak puas dan langsung menodongkan pistolnya ke kepala korban. Pejabat polisi Kuala Lumpur, Khairi Arasa membenarkan adanya insiden ini dan korban telah membuat laporan aduan. Khairi mengatakan, polisi kini tengah melakukan penyidikan atas kasus ini. Tindakan ini bukan yang pertama kali dilakukan oleh tersangka. Menurut laporan, ini pernah melakukan tindakan serupa saat menyerang guru lain dengan senapan shotgun sekira tiga bulan lalu. (st/rzl) gangan mengungkapkan bila dalam waktu dekat, larangan dari Australia tidak akan menyebabkan kelangkaan daging lembu di Indonesia mengingat ketersediaan lembu bakalan cukup dan saat ini dijajaki impor dari negara lain yang terbebas dari penyakit mulut dan kuku. Presiden Susilo Bambang Yudoyono bahkan telah menanggapi secara langsung kasus lembu Australia ini. SBY menyatakan pelarangan ekspor lembu Australia ke Indonesia ini dapat dijadikan momentum untuk mendorong peningkatan populasi sapi lokal dalam rangka swasembada daging sapi.

Tapi ini juga sifatnya belum pasti. Artinya belum tentu Indonesia akan mampu swasembada daging. Dan belum tentu pula negeri kita bisa mendapatkan produsen lembu yang bisa memasok kebutuhan nasional. Apalagi menjelang puasa dan lebaran tahun ini yang sebentar lagi menjelang. Dari sisi Australia juga jelas tidak menguntungkan. Mereka rugi karena kehilangan pasar lembu yang sangat potensial. Ternyata benar, hubungan yang tidak didasari kematangan itu tidak akan mengenakkan, sama tidak enaknya makan daging lembu belum matang.


A2

Berita Utama

Polisi Australia ... New South Wales, memberitahukan bahwa telah terjadi penggerebekan siang tadi (tepatnya pukul 14:30). ‘’Dalam surat tersebut disebutkan telah terjadi penggerebekan bersenjata dan polisi meminta penghuni apartemen untuk segera melapor kepada polisi kalau ada atau tidak ada barang-barang yang hilang sebagai upaya bersama memberantas kriminalitas di kota Sydney,’’ kata Erwin Siregar, salah satu peserta rombongan membaca surat polisi negara bagian New South Wales. Mendapati peristiwa tersebut, seluruh rombongan terkejut dan langsung menghubungi polisi. Dua polisi muda segera datang ke lokasi, kemudian memeriksa semua ruangan dan menanyai beberapa hal kepada rombongan tersebut. ‘’Hati-hati dalam memeriksa tas dan perlengkapan bapak ibu sekalian, mana tahu ada barang-barang si penjahat di dalamnya,’’ kata seorang polisi mengingatkan. Dari informasi polisi, diketahui si penjahat masuk ke dalam kamar apartemen melalui bal-

Medan Utara ... Hadir dalam pertemuan tersebut Ketua Organisasi Satuan (Orsat) ICMI Medan Belawan M Fathul Husni, Ketua Orsat Medan Marelan Bayhaki, dan mewakili Orsat ICMI Medan Deli Safrudin, tokoh masyarakat Medan Belawan H Adnan Ammar SAg serta tokoh masyarakat dan kaum ibu dari perwiritan setempat. Dalam pertemuan tersebut, tokoh masyarakat Kec. Medan Belawan H Adnan Ammar mengatakan wilayah Medan Utara yang luas harus dimekarkan dari Pemko Medan saat ini. Alasannya, lanjut warga Jalan Bangka Barat, Kel. Belawan II, Medan Belawan itu , disamping lambannya pembangunan di kawasan Medan Belawan, kondisi Medan Utara bila hanya dipimpin para camat membuat Muspika setempat kurang berjalan efektif. Akibatnya potensi besar daerah Medan Utara yang memiliki kawasan industri besar, pintu gerbang pelabuhan nasional dan penghasil produksi perikanan yang besar kurang berdampak bagi peningkatan kesejahteraan masyarakat. Sementara itu warga Kec. Medan Belawan lainnya mengatakan hal sama.Diantaranya Irwan,40, warga Jalan Belanak, Lingk. XVII, Kel. Belawan Bahagian meminta pihak-pihak lain agar tidak menghambat pemekaran Medan Utara. Jika dibandingkan dengan daerah lainnya di Medan, kondisi pembangunan di Medan Utara khususnya Medan Belawan jauh tertinggal, padahal potensi ekonominya sangat tinggi

kon yang pintunya tak terkunci. Si penjahat melarikan diri dari balkon apartemen yang bersebelahan saat digerebek dan melompat ke balkon apartemen Pemred Waspada. Dia bersembunyi di dalam apartemen Pemred Waspada selama sekitar satu jam sebelum polisi menyelinap masuk dari pintu masuk apartemen dengan kunci T. Penjahat tidak menduga polisi datang, kemudian menyerah saat polisi membekuknya dengan todongan senjata. Penjahat sempat memasukkan handphonenya ke dalam kopor salah satu rombongan, sementara batereinya di letakkan di dalam kopor rombongan yang lain. Polisi kemudian meminta Pemred Waspada dan rombongan untuk memeriksa dengan teliti semua isi kopor untuk memastikan tidak ada barang terlarang yang dimasukkannya untuk menghilangkan barang bukti. Pemred Waspada berada di apartemen tersebut sejak Kamis 16 Juni bersama 8 orang wartawan dan aktivis lingkungan hidup dari Medan untuk meninjau pabrik daur ulang dan peternakan lembu Australia. (m07) tetapi masyarakatnya lebih banyak hidup dibawah garis kemiskinan, sebutnya. Irwan yang merupakan nelayan dan sesekali menarik becak menyatakan setuju dilakukannya pemekaran. Hal sama dikatakan Uli,38, warga Jalan Bawal, Lingk. XIX, Kel. Belawan Bahagia, Medan Belawan. Menurutnya seluruh tokoh masyarakat di Medan Utara dan masyarakat harus menyatukan visi dan satu tujuan untuk pemekaran Medan Utara. Indra Sakti Harahap mengatakan sebagai Ketua Orda ICMI Medan, pihaknya telah menyampaikan sembilan rekomendasi yang dihasilkan dari pemikiran kaum intelektual yang tertuang dalam Rapat Kerja ICMI di Serdang Bedagai. Sembilan rekomendasi tersebut merupakan hasil pemikiran para pengurus dan dari orsat yang berada pada 21 kecamatan agar disampaikan kepada pemerintah daerah khususnya Pemko Medan dan DPRD Medan untuk mempercepat pembangunan daerah dan peningkatan kesejahteraan masyarakat. Diantara sembilan rekomendasi tersebut adalah percepatan pemekaran wilayah Medan Utara, penguatan ekonomi keluarga dengan pemberdayaan ekonomi keluarga untuk mengembangkan wirausaha dan lainnya. Segera terbitkan Perda tentang keberadaan masjid sebagai rumah ibadah umat Islam, sehingga seluruh masjid dilindungi oleh undang-undang dan otomatis tanahnya menjadi wakaf dan merupakan hal umat Islam.(m40)

Waspada/Sahrizal

KETUA Orda ICMI Medan Indra Sakti Harahap ST MSi (baju putih) didampingi pengurus Orsat Medan Belawan, Medan Marelan dan Medan Deli bersama masyarakat pesisir di Kecamatan Medan Belawan.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur:

Daging Lembu ...

1. g4+, Rg6. 2. Me8+, Mf7. 3. MxM+, Rh6. 4. Mh5+mat.

Jawaban TTS: TTS Topik

S I S K A M L I N G

I T E R O M I I N O L L O O G I

Umum

U A S P E P O S I M B S E N

R O K A P A N K L I A T M S U D I B I U S N

I K R O N I S E R R V A S T O R J I U R M

O N D I K I T B A T A T O R O P A O N G T A N A N G A

I S I A M E R T R R I S B A G E A K A

I

1 6 4 8 2 5 3 7 9

2 5 9 3 7 1 4 6 8

U S E E R A U M P A N N G U R A B R A N G

Jawaban Sudoku: 8 1 6 9 3 7 2 4 5

5 9 2 6 8 4 7 3 1

7 4 3 1 5 2 9 8 6

9 2 8 7 1 3 6 5 4

4 3 1 5 6 9 8 2 7

6 7 5 2 4 8 1 9 3

3 8 7 4 9 6 5 1 2

Angin dingin menerpa apa saja di Sydney siang itu. Tapi sebagai seorang Indonesia saya merasakan juga hawa panas hubungan kedua negara. Betapa tidak. Boikot itu dilakukan karena alasan Indonesia tidak “hewani” memperlakukan lembu yang akan dipotong. Sebuah tayangan video yang beredar luas di internet menunjukkan proses pemotongan seekor lembu. Atas dasar ini pemerintah Australia yang mendapat tekanan dari Animals, sebuah Lembaga Swadaya Masyarakat (LSM) setempat, akhirnya memutuskan memboikot ekspor lembu ke Indonesia. Dalam video yang disajikan LSM Animals itu dikabarkan berlokasi di sebuah Rumah Potong Hewan (RPH) di Binjai tersebut terlihat seorang bertelanjang dada dan seorang lagi mengenakan jaket dan helm. Dengan bersusah payah mereka menjatuhkan hewan besar itu ke lantai keramik. Beberapa kali dilibas dan beberapa kali ditendang sebelum si lembu dipotong. Dalam narasinya, seorang perempuan yang bernama Lyn White dari LSM Animals mengatakan bahwa sulit sekali untuk tidak bersimpati kepada Brian (nama yang diberikannya untuk si lembu). Dia juga bertanya mengapa si lembu harus dikirim ke Indonesia untuk mendapat siksaan seperti itu. Maka pemerintah Australia pun akhirnya terprovokasi video

270 Gempa ... “Gempa yang di rasakan di Sarulla IV-V MMI, merupakan gempa berkekuatan kecil antaar 2.,9 SR hingga 4,3 SR MI. Sehingga rumah yang mengalami kerusakan di akibatkan gempa utama 14 Juni 2011, telah bergeser dari pondasinya. ‘’Kami imbau warga yang memiliki rumah yang mengalami kerusakan parah agar tidur dalam tenda yang telah di sediakan di Posko. Itu untuk kenyaman dan keamanan,”imbuh Rifwar. Namun, masyarakat Luat Pahae sejak goncangan gempa kemarin masih merasa keta-

Kisah Kegigihan ... Ruyati binti Sutadi, 54, meninggalkan tujuh orang cucu dan tiga anak yang semuanya sudah berkeluarga. Dia sudah bercerai dengan suaminya, saat keberangkatan kedua ke Arab Saudi. “Saya sudah sakit-sakitan dan ingin dijaga istri. Tapi dia tetap nekat berangkat, akhirnya kami bercerai,” ungkap Ubedawi dengan suara terbata-bata menahan sedih. Pada keberangkatan pertama, Ruyati sempat bekerja di Madinahselamalimatahun,yang kedua enam tahun dan yang ketiga satu tahun empat bulan. “Pada keberangkatan pertama dia ingin menyekolahkan anaknya, Epi, di sekolah perawat. Sedangkan pada keberangkatan kedua dia ingin membelikan ang-

kutan luar biasa, atau trauma. Minggu (19/6) warga tampak di luar rumah dan di tenda-tenda darurat menjaga kemungkinan gempa susulan. Bahkan paginya ada goncangan gempa kecil menyebabkan warga berhamburan ke luar dan lari ke tempat yang lebih luas. Masjid Hancur Akibat gempa susulan, Sabtu (18/6) dengan kekuatan 5,1 SR Masjid Raya Asslam Aek Botik Pahae Jae roboh, rata dengan tanah.Alat berat dikerahkan di lokasi membersihkan reruntuhan bangunan masjid. Jasa Sitompul kepada Waspada mengatakan, akibat gempa susulan lokasi Masjid Raya kot untuk Iwan,” ungkap Een. Sebelum terjerat kasus hukum, selama sembilan bulan pertama bekerja di Mekah, Ruyati sempat mengirim uang sebanyak dua kali ke rumah, masing-masing sebesar Rp9 juta. Dari informasi yang diterima keluarga, sejak awal bekerja pada majikannya—namanya Heriya—Ruyati kerap disiksa. “Bahkan, waktu tiga bulan pertama kaki ibu saya patah. Tapi dia tidak dibawa ke rumah sakit dan hanya dirawat oleh anak majikannya yang juga seorang dokter,” tambah Een lagi. Berdasarkan kabar dari teman sesama TKW, kaki Ruyati patah akibat perlakuan sang majikan, Heriya. “Saya yakin ibu saya tidak bersalah. Dia hanya membela diri,” ucap Eeen sambil mengusap air matanya. (vvn)

Assalam Aekbotik Desa Setia Kec. Pahae Jae terpaksa di ratakan dengan tanah, sebab seluruh bangunan sudah keropos akibat goncangan gempa. Menurutnya, mesjid itu diratakan untuk membangun yang lebih kuat sehingga umat Muslim Pahae dapat menunaikan ibadahnya seperti shalat Jumat di hari-hari yang akan datang. Untuk sementara direncanakan akan didirikan tenda pengganti mesjid tersebut. Sementara, untuk membangun kembali masjid itu dibutuhkan dana berkisar Rp 1,5 miliar, ujar Jasa yang juga anggota DPRD Taput. (a21)

1 Tewas, 8 Luka-luka ... Tanjungmorawa stang sepedamotor Antoni bersenggolan dengan beca motor, hingga Antoni hilang keseimbangan, lalu menubruk truk tronton L 8142 DS, yang datang dari arah berlawanan. Selanjutnya truk tronton bertabrakan dengan Kijang Inova BG 2160 NK . Antoni tewas ditempat, sedangakan kernet truk, Binsar Aritonang, 29, warga Tanjungmorawa mengalami luka-luka serta 8 orang penumpang Kijang Inova mengalami luka lecet. Tubuh Antoni menempel di depan truk dan terjepit dengan batang pohon yang ditabrak truk tersebut, mengakibatkan tubuh Antoni mengalami luka dan patah dan tewas di tempat. (a07)

ka serah terima jabatan tidak ada penyerahan arsip oleh Datok Penghulu yang lama, sehingga tidak ada arsip. Sedangkan Imam Dusun Mawar, Kampong Bukit Rata, Syamsul ketika dikonfirmasi, membenarkan ada orang bernama Eriq datang bersama warga DusunMawar,Suciptomenemuinya. “Saya juga sudah lupa tanggalberapakeduaorangitudatang, minta tolong dibuatkan NA atas nama Eriq,” ungkap Syamsul. Menurut Syamsul, ketika itu Sucipto menyatakan Eriq tidak punya saudara dan famili di Aceh Tamiang. Eriq merantau dari Pekanbaru ke AcehTamiang dan sudah menjadi warga Desa Bukit Rata. “Tolonglah Pak Imam buatkan NA untuk Eriq yang mau menikah,”ucapPakImamDusun Mawar, Syamsul menirukan permintaan Sucipto dan Eriq. Syamsul juga mengaku tak kenal Eriq, sebab yang membawanya Sucipto. “Saya tidak kenal dengan Eriq di mana rumahnya, tetapi Eriq punya KTP berdomisili di Desa Bukit Rata dan ada juga fotocopi Kartu Keluarga (KK). Saya sudah melihat datadatanya ketika itu, lalu saya katakan kalau mau buat NA harus

menyerahkan fotocopi KTP 2 lembar dan fotocopi KK serta pasfoto warna 2x3 cm 6 lembar,” rinci Syamsul. Lalu, lanjut Syamsul, setelah semua persyaratan administrasi dilengkapi Eriq, selanjutnya sebagai Imam Dusun dia mengajukan NA atas nama Eriq untuk ditandatangani Datok Penghulu Kampung Bukit Rata. Syamsul juga mengaku tidak tahu kalau Eriq itu adalah Sri. Ketika itu memang suara dan pembawaannya persis seperti laki-laki. “Saya baru tahu kalau Eriq itu perempuan setelah baca Waspada, yang disebutsebut berdomisili di Desa Tanjung Karang,” ujar Syamsul. Sedangkan Datok Penghulu Kampung Paya Bedi, Kec. Rantau, Azhari Rahmad ketika dikonfirmasi, juga menyatakan tidak ingat lagi tanggal berapa Eriq dan Dian menikah. Kepala Lorong (Keplor) Dusun Inpres, Desa Paya Bedi, Abu Bakar menyebutkan acara ijab qabul akad nikah berjalan lancar. Kasusnya, masih terus diusut Polres Aceh Tamiang. “Kami sedang mengusut kasus ini,” ungkapWakaPolresAcehTamiang, Kompol A. Azas Siagian. (b24)

Putra daerah yang punya talenta kepemimpinan sejak masa sekolah ini telah pula membuktikan kepiawaiannya sebagai pemimpin dan komitmennya membangun Tebingtinggi ketika menjabat Pj.Walikota di kota Lemang ini. Salah satu karya momumental yang ditunjukkannya sejak masih duduk di bangku sekolah adalah berdirinya sebuah musholah di sekolah tempat di menuntut ilmu. ‘’Mushola ini berdiri berkat buah pikirnya,” ungkap Wakil Kepala Sekolah SMA Negeri I Tebingtinggi Trianda sembari menunjuk ke arah bangunan di salah satu sudut lingkungan sekolah tersebut. Ketika Eddy bersekolah di SMA Negeri I Tebingtinggi pada tahun 1980 s/d 1983 dia menjadi seorang Ketua OSIS. Baru saja dilantik Eddy lantas mengeluarkanideuntukpembangunanmushola di lingkungan sekolahnya.

Saat itu, meski telah menjadi sekolah favorit namun kalau mau ibadah shalat harus menggunakan salah satu ruang kelas. Pilihan lain adalah shalat di masjid yang lokasinya cukup jauh di luar kompleks sekolah. Mantan Wali Kelas II IPS 2 SMA Negeri ITebing Tinggi Rafa’i Purba juga menyatakan hal yang sama. Bahwa Eddy Sofyan adalah anak yang memiliki potensi besar dan bertalenta menjadi pemimpin. “Kita harus bangun mushola pak,’’ Rafa’i Purba mengenang ucapan Eddy pada waktu itu. Tapi dirinya belum mendapat gambaran dari mana uang untuk membangun mushola tersebut. Tapi Eddy dengan keyakinan, keuletan dan semangat yang besar akhirnya berhasil mewujudkan renananya membangun mushola sekolah. ‘’Ini luar biasa,’’ ungkap Rafa’i Purba. Eddy berhasil menggalang dukungan dan menhimpun bantuan dari berbagai pihak se-

hingga mushola berukuran 10 meter x 8 meter selesai dibangun. Hingga kini, mushola itu masih berdiri megah untuk memberi ruang bagi ribuan siswa/i SMA Negeri I Tebingtinggi melaksanakan beribadahibadah shalat, ataupun sekedar melepas kepenatan sehabis menimba ilmu pengetahuan di bangku sekolah. Pengalaman Eddy Syofian yang memiliki kepedulian terhadap pembangunan dan komitmennya terhadap perjuangan agama Islam sudah teruji. Eddy juga punya berbagai catatan yang menunjukkan kepedulian dan komitmennya itu. Harapan masyarakat Tebingtinggi untuk mendapatkan pemimpin yang bisa membawa kotaLemanginikearahyanglebih sejahtera, maju dan relijius sepertinya bukan sekedar harapan belaka. Sosok Eddy Syofian adalah orangyangpalingdiharapkandan palingmemungkinkanuntukmelakukan hal tersebut. (m07)

yang katanya hasil investigasi pemotongan hewan di Indonesia tersebut. ‘’Kunjungan ini bisa sangat tidak tepat ataupun bisa jadi sangat tepat. Karena di tengah memanasnya hubungan antara Indonesia dengan Australia gara-gara kasus ekspor lembu,’’ kata Konsul Jenderal Indonesia di Sydney, Gary R.M.Jusuf ketika menerima Pemred Waspada dan rombongannya di gedung KJRI. Video pemotongan lembu di Binjai tersebut ternyata tidak saja menghentikan ekspor lembu dari Australia ke Indonesia. Tapi video tersebut juga telah menyebabkan berbagai perlakuan tidak manusiawi yang diterima orang Indonesia di Australia. Gary RM.Jusuf misalnya, dia menerima cacian dan makian orang-orang Australia gara-gara video tersebut. Mereka mengirimi setumpuk surat yang bernada tidak menyenangkan kepada Konsul RI di Sydney. ‘’Ada yang mengatakan tidak mau lagi datang ke Indonesia. Saya bilang silahkan saja kalau tidak mau datang karena itu hak mereka. Tapi sebaiknya masalah ini disikapi dengan bijak,’’ kata Gary. Bahkan pihak kedutaan RI juga mendapat teror berupa kiriman paket berisi kotoran lembu yang dikirim orang Australia. ‘’Pihak kedutaan juga dikirimi kotoran lembu karena peristiwa ini,’’ kata Gary. Gary menekankan, dari peristiwa ini menunjukkan bahwa sebetulnya kedua pihak samasama belum “matang” atau be-

lum dewasa dalam bersikap. ‘’Sebagai sebuah negara, kelihatan kedua pihak belum dewasa.Yang satu sok menggurui, yang lain langsung emosional. Responsnya kalau perlu perangpun jadi. Kasus lembu ini menunjukkan belum matangnya kedua negara,’’ kata Gary. Gary mungkin benar. Lihat saja sikap pemerintah Australia, langsung main boikot. ‘’Harusnya-kan beritahukan dulu baikbaik. Ini sudah main boikot aja langsung,’’ katanya. Dari caranya memotong lembu, orang Australia mungkin menganggap orang Indonesia tidak beradab. Nah, orang Indonesia ketika menyikapi sikap yang kekanak-kanakkan ini tak kalah serunya. Prinsip “ente beli ana jual” langsung berlaku di sini. ‘’Malah ada yang bilang kalau perlu perang aja sama Australia,’’ kata Gary, mengingatkan bagaimana seharusnya hubungan bertetangga yang saling menguntungkan agar tetap harmonis. Faktanya, Australia juga punya ketergantungan pasar ekspor ke Indonesia. Di kawasan Northern Territory misalnya, ini adalah daerah produsen lembu yang 80 persen lembunya diekspor ke Indonesia. ‘’Sekarang di sana, lembu-lembu itu tidak tahu mau dikemanakan. Apa mau dibunuhi saja,’’ kata Gary. Indonesia adalah negara yang membeli 60 persen dari lembu Australia yang diekspor. Sapi tersebut diekspor dari Pelabuhan Darwin di Northern Territory, dan Broome dan

Wyndhan di Australia Barat. Berdasarkan data Meat & Livestock Australia, pada 2010, penjualan sapi ke Indonesia memberikan kontribusi sebesar 319 juta dolar Australia atau setara dengan USD342 juta. Pihak Kementerian Perdagangan mengungkapkan bila dalam waktu dekat, larangan dari Australia tidak akan menyebabkan kelangkaan daging lembu di Indonesia mengingat ketersediaan lembu bakalan cukup dan saat ini dijajaki impor dari negara lain yang terbebas dari penyakit mulut dan kuku. Presiden Susilo B.Yudoyono bahkan telah menanggapi secara langsung kasus lembu Australia ini. SBY menyatakan pelarangan ekspor lembu Australia ke Indonesia ini dapat dijadikan momentum untuk mendorong peningkatan populasi sapi lokal dalam rangka swasembada daging sapi. Tapi ini juga sifatnya belum pasti. Artinya belum tentu Indonesia akan mampu swasembada daging. Dan belum tentu pula negeri kita bisa mendapatkan produsen lembu yang bisa memasok kebutuhan nasional. Apalagi menjelang puasa dan lebaran tahun ini yang sebentar lagi menjelang. Dari sisi Australia juga jelas tidak menguntungkan. Mereka rugi karena kehilangan pasar lembu yang sangat potensial. Ternyata benar, hubungan yang tidak didasari kematangan itu tidak akan mengenakkan, sama tidak enaknya makan daging lembu belum matang.

Ijab Kabul ... Datok Penghulu Kampung (baca: Kepala Desa/Geuchik) Bukit Rata, Kec. Kejuruan Muda, Kab. Aceh Tamiang, Hermansyah yang disebut-sebut menerbitkan NA (Nota Akad) Eriq untuk menikahi Dian, ketika dikonfirmasi di Kantor Datok Penghulu, Sabtu (18/6), mengaku tak ingat lagi. Kata Hermansyah, belum lama dia menjadi Datok Penghulu Kampung Bukit Rata. Keti-

Ada-ada Saja ... siswa merasa tidak puas dan langsung menodongkan pistolnya ke kepala korban. Pejabat polisi Kuala Lumpur, Khairi Arasa membenarkan adanya insiden ini dan korban telah membuat laporan aduan. Khairi mengatakan, polisi kini tengah melakukan penyidikan atas kasus ini. Tindakan ini bukan yang pertama kali dilakukan oleh tersangka. Menurut laporan, ini pernah melakukan tindakan serupa saat menyerang guru lain dengan senapan shotgun sekira tiga bulan lalu. (st/rzl)

Bakat Memimpin ...

WASPADA Senin 20 Juni 2011

Kasus Pembakaran Kebun Karet, ICW Mengadu MEDAN (Waspada): Kasus pembakaran lahan kebun karet seluas satu hektare yang diduga atas suruhan oknum PNS Dinas Pemkab Tapteng, dan persoalannya sudah sampai ke polisi, belum ditanggapi. Hingga kini, pelakunya masih berkeliaran membuat warga trauma dan takut bekerja di kebun mereka. Menindaklanjuti kasus tersebut, ICW Tapanuli Tengah, atas instruksi pimpinan, mengirim pengaduan kembali ke Kapolda Sumut dan Kejatisu. ‘’ Berkas pengaduan akan diserahkan Ketua ICW Provinsi Sumatera Utara, David Sitorus,

SH hari ini (20/6),” kata Dohar Franklin Sianipar, Ketua Indonesia Coruption Warch (ICW) Tapanuli Tengah kepada wartawan di Medan, Minggu (19/6). Surat no: 05/KD-ICW/TT/ VI/2011 dan 06/KD-ICW/TT/ VI/2011 tertanggal 20 Juni 2011, ditujukan kepada Kapolda dan Kajatisu, agar kedua instansi dan lembaga hukum ini benar benar menindaklanjuti kasus di Tapanuli Tengah itu. “Demi hukum, Kapolda agar menginstruksikan jajarannya menangkap dan menahan para pelaku dan dalang pembakaran atas nama Dahyar Hu-

tagalung, yang telah ditetapkan sebagai tersangka oleh Mapolres Tapteng,” tegas Dohar, didampingi Baziduhu Halawa, Devisi Hukum dan Kriminal ICW Tapteng. Seperti dialami Helala, 40, dan isterinya Amiati Gea, 38, warga Kec. Badiri Tapanuli Tengah, pada 13 Mei 2011, dimana kebun karetnya seluas lebih kurang satu hektare dibakar dan dirusak buruh kebun diduga atas suruhan oknum PNS Dinas Pemkab Tapteng. Kendati telah ditetapkan sebagai tersangka, namun para tersangka tidak ditahan. (m21)

Ransel Hitam ... Sedangkan karyawan dan pengunjung ingin melihat ransel itu diperintahkan menyingkir dan Polres Binjai langsung memasang garis polisi . “Kita tidak bisa main-main. Apalagi baru saja terjadi ledakan bom di Lubuk Linggau Sumatera Selatan,’’kata petugas yang ditemui saat mengevakuasi warga. Disaksikan Kapolres Binjai AKBP Rina Sari Ginting, dalam tempo 15 menit anggota Gegana sudah mengamankan ransel tersebut. Gegana selanjutnya memasukkan tas ke mobil . Menurut keterangan ransel itu akan diperiksa Mako di Brimob.

Waspada/Riswan Rika

KARYAWAN Binjai Super Mall dan masyarakat berhamburan keluar dan menanti kebenaran isu bom di BSM. Kapolres Binjai AKBP Dra Rina Ginting ketika dikonfirmasi Waspada i mengatakan,

Guru Ngaji ... sudah disiapkan dan berlangsung dalam waktu relatif singkat. Intinya adalah untuk membandingkan kondisi obyek studi di tempat lain dengan kondisi yang ada di tempat sendiri. Umumnya dana untuk studi banding dikuras dari dana APBD maupun APBN yang membebani pemerintah. Tetapi kali ini dari Langkat terdengar kabar yang membuat perasaan haru bagi sejumlah tokoh agama dan pemuka masyarakat di daerah ini. H Ngogesa Sitepu yang akrab dengan panggilan Bang Tongat itu memberangkatkan 14 orang guru mengaji yang tergabung dalam Ikatan Guru Taman Pembacaan Al-Qur’an (IGTPQ) Kab.Langkat untuk melakukan studi banding meninjau beberapa pondok pesantren ke Pulau Jawa. ‘’ Ya, biaya perjalanan dan akomodasi kami seluruhnya ditanggung bantuan pribadi dari Bupati Langkat H Ngogesa Sitepu, ‘’ begitu kata Kyai Abdurahman selaku Ketua IGTPG Langkat didampingi Sekretarisnya T. Khazinatul Asrariah menjelaskan kepada Waspada, Minggu (18/6). Menurut Abdurahman , mereka melakukan studi banding keTaman Kanak-kanak (TK) di Madrasah Istiqlal yang berlokasi di lantai dasar Masjid Istiqlal di Jakarta. TK Istiqlal tersebut merupakan percontohan TK Islam se tanah air. Kami mempelajari metode baca dan tafsir Al-Qur’an 40 jam, Qiratul Qur’an dan Tahfizil Qur’an di Institut Ilmu Al Quran (IIQ), ujar Abdurrahman menjelaskan. Selain itu rombongan mengunjungi sejumlah Ponpes di Jawa Timur diantaranya Ponpes Madrasatul Tebu Ireng Jombang, Ponpes PPAI KH Hamin , Ponpes Al Islah Singosari di Malang, Ponpes Pasuruan , Masjid Agung Sunan Ampel dan Ponpes Mujihiddin Surabaya serta Depot Iqrak Jogyakarta. Buah tangan studi banding akan kami

LENTERA ... Dalam buku Islam dan Tata Negara (Ajaran, Sejarah, dan Pemikiran), H. Munawir Sjadzali, MA menguraikan pidato Umar begitu dilantik menjadi khalifah kedua (634-644 M), antara lain, katanya: “Sesungguhnya saya takut kalau (satu waktu) saya berbuat salah tetapi dari kalian tidak ada seorang pun menentangku karena hormat kalian kepadaku. Maka (permintaanku) kalau saya berbuat baik, bantulah saya, tetapi kalau saya berbuat jelek harap kalian perbaiki”. Ketika itu juga salah seorang hadirin berdiri dan berkata: Demi Allah wahai Amirul Mukminin, kalau kami melihat anda bengkok, maka akan kami luruskan kembali dengan pedang kami”. Satu riwayat menyebut, yang bersangkutan berucap berapi-api, dan mengacung-acungkan pedangnya. Di antara hadirin ada yang ketakutan bahwa Umar ra. akan marah menghadapi reaksi seorang laki-laki tersebut. Sifatnya selama ini sangat mudah marah jika tidak pas selahnya. Ternyata Umar ra. dengan tenang berucap, “Semoga Allah Swt menyayangi kalian, dan segala puji bagi Allah Swt. yang menciptakan di antara kalian ada orang yang berani mengoreksi Umar dengan pedangnya.” Di perjalanan pemerintahannya memang Umar ra. konsisten terhadap kesiapannya menghadapi kritikan. Seperti pernah diungkap pada kolom LENTERA ini berjudul Tangis Bayi Mengubah UU, salah satu contoh tindakan Umar

itu ransel bukan berisikan bom namun berisikan baju pria dan buku-buku.(a04/a05)

terapkan dalam mengelola pendidikan dari mulai tingkat RA (Raudhatul Athfal, setingkat TK), MDA (Madrasah Diniyah Awaliyah) dan Taman Pembacaan Al Quran (TPQ), kata Abdurahman yang juga pembina Ponpes An Nur Desa Selotong Kecamatan Secanggang yang mengelola RA,MDA dan TPQ dengan jumlah murid sekira 300-an anak-anak. Bupati Langkat H Ngogesa Sitepu ketika menerima kembalinya rombongan guru ngaji dari perjalanan studi banding bertempat di rumah dinas bupati di Stabat, Jumat (17/6) berharap agar pengalaman dan ilmu yang diperoleh kiranya dapat berbagi dengan rekan-rekan seprofesi lainnya, sehingga dunia pendidikan agama di daerah ini terus berkembang. Menurut bupati, keberadaan guru-guru pendidik bidang pengenalan dan pemahaman AlQur’an memberi arti sangat penting bagi bumi Langkat. Sebagai daerah religius masyarakat Langkat sepatutnya harus terus menerus memfokuskan perhatian terhadap hal-hal keagamaan, sebab dengan demikian memberi pengaruh yang signifikan bagi terbinanya akhlak generasi mendatang. Secara pribadi maupun sebagai umaro sudah sepatutnya kami mendekatkan diri kepada ulama sebagaimana guru-guru Qur’an yang sangat berperan dalam meningkatkan pembinaan anakanak sejak dini. Ngogesa meyakini dalam memimpin Langkat tidak terlepas dari rasa kebersamaan dan rasa memiliki . Karenanya kami sangat membutuhkan dukungan seluruh lapisan masyarakat dan do’a, sehingga amanah jabatan yang diemban tidak menimbulkan fitnah buat diri dan keluarga, begitu kata Bupati Ngogesa Sitepu seusai menerima cendera mata hasil studi banding berupa seperangkat CD yang berisi metode pembelajaran Al-Qur’an 40 Jam dan laporan tertulis kegiatan selama studi banding tersebut. (Ibnu Kasir) ra. Seorang ibu merepet (mengomel) saat menghentikan tangisan anaknya yang dia berhentikan menyusu. Repetan itu menyalahkan Umar ra bahwa anak menyusu tidak mendapat tunjangan. Kritikan ibu tersebut didengar Umar ra. pada malam hari dan esok harinya terbit UU yang mengatur setiap anak lahir mendapat tunjangan. Khalid Muhammad Khalid dalam buku Khulapaur Rasul yang diterjemahkan oleh Zaid Husein Alhamid juga mengungkap kisah Umar ra. mendengar kritikan melalui sinandung seorang isteri tentara terhadap dirinya. Seperti kebiasaannya, pada suatu malam Umar ra. berkeliling di kota Madinah, dia ingin tahu bagaimana kondisi rakyatnya. Di satu rumah terdengar sya’ir yang cukup menarik diperhatikan. Rupanya sinandung seorang isteri prajurit yang merindukan kepulangan suaminya. Besoknya, Umar ra. pergi ke rumah putrinya Hafsoh dan bertanya berapa lama seorang isteri tahan ditinggal suami. Hafsoh mengatakan, tidak lebih tiga bulan. Hari itu juga dia perintahkan seseorang memanggil tentara yang sudah lama meninggalkan isteri. Sejak itu tidak boleh lagi seorang tentara meninggalkan isteri lebih dari tiga bulan. Jadi, Umar ra. ingin dikritik tidak hanya sebatas mengaku di mulut saja tetapi memang isi kritikan itu ditindaklanjutinya sampai tuntas. Bukan seperti pejabat yang sering kita saksikan sekarang, menggelupur ketika mendapat kritik, lalu tindaklanjutnya nol?.Wallohu A’lam.


A3

Luar Negeri

WASPADA, Senin 20 Juni 2011

Inggris Desak Warganya Segera Tinggalkan Syria BEIRUT, Lebanon (AP): Kantor Kementerian Luar Negeri Inggris mendesak warganya di Syria agar segera meninggalkan negeri tersebut. London juga menganjurkan warganya agar tidak pergi ke Syria. Dalam satu pernyataan yang dimuat di website Kedutaanbesar Inggris di Syria, Kantor Kementerian Luar Negeri mengatakan warga Inggris harus meninggalkan Inggris ‘sekarang

juga dengan angkutan komersial, sementara misi ini masih tetap beroperasi.’ Katanya,merekayangdi-pilih untuk tetap tinggal di Syria harus menyadaribahwaitusangattidak

mungkin bahwa Kedutaanbesar Inggris di Damaskus akan mampu menyediakan layanan konsuler normal dalam hal terjadi‘ke buntuan ketertiban hukum lebih lanjut.’ Inggris, Prancis, Jerman dan Portugal juga mensponsori satu rancangan resolusi di Dewan Keamanan PBB untuk mengutuk Syria. Para aktivis HAM me-

ngatakan lebih dari 1.400 warga Syria tewas dalam pergolakan tiga bulan terhadap Presiden Bashar al Assad. Lebih jauh The Associated Press melaporkan tentara Syria telah memasuki desa yang dekat ke perbatasan dengan Turki, di tengah upaya yang terus dilakukan pemerintah untuk menumpas pemberontakan.

Ribuan warga Syria tiba di kawasan perbatasan dalam sepekan belakangan, melarikan diri daritindakanmiliterdiutara.Turki mengatakan sekitar 10.000 orang menyeberang ke wilayahnya namun banyak lagi yang berkemah di wilayah sebelah Syria. Para pegiat mengatakan paling tidak 19 orang ditembak mati dalam aksi-aksi protes

menentang Presiden Bashar alAssad hari Jumat. Media negara Syria melaporkan bahwa seorang polisi terbunuh dan banyak lainnya luka-luka. Syria melarang wartawan asing, termasuk dari BBC, untuk masukkenegaraitusehinggasulit mengukuhkan laporan-laporan secara independen dari sana. Warga lokal mengatakan

Libya: Serangan NATO Ke Tripoli Cuma Bunuh Sipil TRIPOLI, Libya (Antara/ Reuters):Para pejabat Libya mengatakan, sekitar tujuh warga sipil tewas dalam satu serangan udara pasukan Pakta Pertahanan Atlantik Utara (NATO) di Tripoli Timur Minggu (19/6) pagi. Para wartawan diajak oleh para pejabat pemerintah Libya ke suatu kawasan perumahan di kotamadya Arada Tripoli dan melihat satu tubuh ditarik keluar dari reruntuhan sebuah bangunan yang hancur.

KTT Perujukan Palestina Ditunda RAMALLAH, Tepi Barat (AP): Para pejabat Palestina mengatakan satu pertemuan tingkat tinggi antara para pemimpin kelompok Fatah dan gerakan Hamas telah ditunda. Pertemuan Selasa antara Presiden Palestina Mahmoud Abbas dan pemimpin Hamas Khaled Mashaal diharapkan untuk menunjuk PM bagi pemerintah perujukan. Namun kalangan pejabat dari kedua belah pihak mengakui Minggu (19/6) masih ada perbedaan mengenai siapa yang harus menjadi PM. Mereka mengatakan pertemuan itu telah ditunda. Keputusan itu merupakan satu kemunduran bagi perjanjian persatuan bulan lalu antara Hamas dan Fatah. Pada saat itu, mereka berjanji untuk mengakhiri pertikaian empat tahun yang menyebabkan Palestina dengan pemerintahan yang bersaingan di Tepi Barat dan Jalur Gaza. Para pejabat yang mengatakan tentang penundaan pertemuan itu tidak ingin jatidirinya disebutkan karena mereka merasa tidak berhak memberikan keterangan kepada media. (m10)

“Ada kesengajaan dan mereka sengaja menargetkan rumah-rumah penduduk sipil,” kata wakil menteri luar negeri Khaled Kaim kepada wartawan di lokasi itu. “Ini tanda lain dari kebrutalan Barat,” tegasnya. Bangunan itu tampak seolah-olah sedang dalam konstruksi dan sebagian besar kosong. Di rumah sakit setempat, para wartawan menyaksikan tiga mayat, termasuk anakanak, yang para pejabat pemerintah mengatakan mereka adalah orang-orang yang tewas da-

lam serangan udara itu. NATO sakit hati NATO marah dan sakit hati mendengar pemimpin Libya Moammar Khadafi — yang dalam pidatonya yang berapi-api mengatakan Sekutu tidak akan menang. Sekutu Barat mengutuk pidato tersebut. Wanita jurubicara NATO Oana Lungescu mengatakan di Brussels, Belgia, bahwa Khadafi dan pasukannya ‘secara sistematis dan brutal telah menyerang warga Libya.’ Dia mengatakan pasukan Khadafi bahkan

menggunakan masjid dan taman anak-anak sebagai perisai. Pengeboman berkepanjangan yang dilakukan NATO di Tripoli membuat Khadafi berang. “NATO akan kalah, mereka akan menarik diri dan kalah,” ujar Khadafi seperti dikutip The Associated Press, Sabtu. Suara tembakan terdengar di kota, dan terlihat pula para pendukung Khadafi turun ke jalan bersama anak anaknya. “Semua warga di Libya menginginkan Kolonel Khadafi,

bukan para pengkhianat itu,” ujar Rajab Hamman, pria berumur 51 yang merupakan pendukung Khadafi. Dokter di rumah sakit Misrata menyatakan, sembilan pemberontak dan wanita yang tinggal di dekat wilayah konflik tewas, 30 lainnya terluka. Serangan yang besar juga terjadi di kota Dafniya dan Zlitan. Untuk beberapa minggu,

para pemberontak terjebak di Misrata. Meski terus dihujani bom oleh pasukan pemberontak yang dibantu pasukan NATO, Khadafi bersikukuh tak akan turun dari jabatannya. Bahkan, dia sesumbar mengatakan bom nuklir pun tak akan membuatnya pergi. (ap/okz/m10)

tentara masuk ke kota Bdama, sekitar 2 km dari perbatasan Turki, Sabtu pagi, dengan

menembakkan senapan mesin dan membakar gedung-gedung yang mereka jumpai. (m10)


Luar Negeri

A4

WASPADA Senin 20 Juni 2011

Dalam Kaitan Sengketa Wilayah Di Laut China Selatan

Konferensi Tentang Persatuan Islam Dibuka Di London

Protes Anti-China Di Vietnam, Filipina Segera Kirim Kapal HANOI, Vietnam (AP): Ratusan warga Vietnam melancarkan protes mengecam China pada minggu ketiga Minggu (19/6) di tengah-tengah situasi yang terus memanas di seputar perairan yang diperebutkan di Laut China Selatan, di mana kedua negara barubaru ini mengadakan latihan militer. Sementara itu, panglima militer Filipina mengatakan Minggu (19/6) kapal angkatan laut negara itu tidak akan melewati batas zona ekonomi ekslusif 200 mil lautnya sementara kapal itu siap digelarkan dekat perairan Laut China Selatan yang disengketakan. Jend. Eduardo Oban mengatakan dia tetap optimistis bahwa sengketa perairan itu akan diselesikan secara damai dan menghindari kemungkinan konfrontasi militer. Sekitar 300 orang berkumpul di dekat Kedutaan China di ibukota Vietnam, Hanoi, dan berpawai di sepanjang jalan sambil meneriakkan ‘Hancurlah China’ dan menuntut agar negara tetangga di bagian utara itu tidak mencampuri wilayah Vietnam. Massa juga berkumpul di Ho Chi Minh City. “Kami akan berjuang membela negara kami jika dibutuhkan,” kata seorang pelajar Ngu-

yen Manh Ha (20). “Bukan hanya saya, tapi semua wargaVietnam bersedia mati untuk melindungi negara kami.” Protes jarang terjadi Vietnam dan biasanya cepat diatasi pasukan keamanan, tetapi Hanoi mengijinkan aksi demonstrasi tersebut terus berlanjut selama tiga minggu terakhir di tengah keamanan yang diperketat. Di satu titik terlihat massa melambaikan bendera Vietnam, berhenti di sebuah toko serba ada dan meneriakkan ‘Boikot Produk China!’. “Saya berada di sini hari ini untuk melindungi negara saya dari invasi China,” kata Nguyen Long, 82, yang juga terlibat dalam perang memperebutkan tanah perbatasan dengan China di tahun 1979. “Saya yakin orangorang di kedutaan itu mendengar apa yang kami teriakkan.” Hubungan antara kedua negara komunis itu berada pada

titik terendah setelah dua insiden terjadi bulan lalu yang melibatkan bentrokan antara kapal China dan Vietnam di Laut China Selatan. Vietnam menuduh kapal China menghalangi survei eksplorasi minyak di kawasan perairannya 200 mil lepas pantai yang diklaim sebagai zona ekonomi eksklusif. China mengatakanVietnam memasuki perairannya secara diam-diam dan membahayakan nelayan China. Vietnam mengadakan latihan AL di lepas pantainya Senin lalu. Pada Jumat, China mengumumkan negaranya juga mengadakan latihan tiga hari di Laut China Selatan, meski tidak menyebutkan tanggal pastinya. AS dan Vietnam mengeluarkan pernyataan bersama Jumat menyusul dialog pertahanan tahunan, di mana Washington

mengatakan, insiden ‘bermasalah’ ini menimbulkan kekhawatiran akan keamanan maritime. Filipina kirim kapal “Kita mengharapkan tidak akansampaipadakonfrontasimiliter itu,” kata Oban kepada wartawan ketika ditanya apakah dengan mengirim kapal Rajah Humabon ke perairan itu dapat menimbulkanbentrokansenjata.Dia mengatakan kapal itu akan beroperasi di dalam perbatasan maritimnya dan tidak akan memasuki perairan internasional. “Saya optimistik bahwa konflik-konflik yang mungkin terjadi di sana akan diselesaikan secara damai dan melalui saluran diplomatik, kendatipun yang dapat saya katakan adala kita juga harus memberlakukan hukum-hukum militer dalam zona 200 mil laut itu,” katanya.

Manila, Jumat mengatakan pihaknya akan menggelar Rajah Humabon ke Laut China Selatan sehari setelah China mengumumkan bahwa salah satu dari kapal patroli maritimnya juga menurut rencana akan melalui daerah itu.Kedua negara, serta Taiwan, Vietnam, Malaysia dan Brunei Darussalam mengklaim daerah-daerah yang kaya sumber alam di Laut China Selatan itu, terutama Kepulauan Spratly. China mengklaim seluruh Laut China Selatan sebagai tempat menangkap ikannya sejak lama tetapi Filipina menyatakan bahwa berdasarkan Konvensi PBB mengenai Hukum Laut yang menyatakan satu negara yang memiliki hak ekonomi ekslusif atas peraira-perairan yang berada dan 200 mil laut dari landas benuanya.

Rajah Humabon, kapal bekas fregat Angkatan Luat AS yang telah beroperasi selama Perang Dunia II, adalah salah satu dari kapal-kapal perang tertua di dunia. Kapal itu dioperasikan Angkatan Laut Filipina sejak tahun 1980.Ketegangan menyangkut daerah maritim itu dalam bulan-bulan belakangan ini meningkat setelah Filipina dan Vietnam menuduh China semakin agresif dalam mempertahankan klaimnya atas wilayah perairan itu. Filipina menuduh China bulan ini mengirim kapal-kapal angkatan laut untuk mengintimidasi negara-negara yang mengklaim wilayah sekitar kepulauan Spratly serta memasang tanda-tanda dan membangun pos-pos di daerah-daerah terdekat.(m23/m10)

India Bebaskan Tahanan Paling Tua, Berusia 108 LUCKNOW, India (Waspada): Pihak berwenang di India telah membebaskannarapidanapalingtua,BrijBihariPandey,yangberusia 108 tahun. Pandey dihukum karena kasus pembunuhan yang dilakukannya pada usia 84 tahun, demikian menurut para pejabat. Pandey, seorang bikshu Hindu, telah dibebaskan Jumat oleh satu pengadilan di negara bagian Uttar Pradesh, India Utara, atas dasar kemanusiaan setelah para pejabat penjara mendapat kesulitan untuk menyediakan perawatan medis secara regular kepada ‘para tahanan tertua dalam sejarah penjara India itu.’ “Kami mendapat kesulitan untuk merawat narapidana berusia 108 tahun itu. Kami ajukan permohonan bagi pembebasannya dan pengadilan menerima permohonan itu,” kata S.K. Sharma, pengawas Penjara Gorakhpur, 300 km dari ibukota negara bagian Lucknow, Sabtu (18/6). Dia mengatakan pembebasan itu atas dasar kemanusiaan. Pada saat usianya 84 tahun, Pandey bersama dengan 15 orang lainnya, kebanyakan dari mereka adalah keponakan dan anggota keluargnya, membunuh empat orang sehubungan dengan kasus warisan dari satu lembaga Hindu. Pada2009,diadidakwadandikirimkePenjaraGorakhpurnamun umurnya yang berada di atas seratus tahun dan kondisinya makin lemah yang menyebabkan dia harus sering dilarikan ke rumah sakit dan sebagian besar di tempat tidur. (bbc/ant/afp/m10)

Obama Tak Ingin Punya Anak Lagi WASHINGTON(Waspada):SaatpertamakalimemasukiGedung Putih, beredar spekulasi kalau Presiden AS Barack Obama dan ibunegaraMichelleObamaakanmemilikianaklagi.Halinimengingat mereka belum memiliki putra. Tetapi hal itu dibantah secara tegas oleh Obama dalam acara Good Morning America. “Saya pikir, menurut pandangan Michelle, ‘kami selesai’,” kata Obama, seperti dikutip dari Daily Mail. Saat ditanya mengenai rencananya untuk memiliki anak laki-laki, Obama justru mengatakan kalau tak berhak memutuskannya. Menurutnya, keputusan itu berada di tangan Michelle. “Anda sepertinya merasa keputusan itu berada di tangan saya, padahal tidak. Semua itu berada di tangan Michelle. Bukan saya yang membawa beban sepuluh pon di perut,” katanya. Presiden AS itu juga mengungkapkan bagaimana rumitnya sebagai orangtua yang memiliki dua gadis remaja. Dia pun melontarkan candaan, saat mewanti-wanti kedua putrinya untuk tidak bertindak penuh risiko. “Saya mengerti masa remaja itu sangat rumit. Saya juga menekankan pada mereka, kalau mereka harus dikelilingi pria bersenjata. Termasuk menjaga citra untuk pemilihan selanjutnya, artinya mereka tidak boleh berada satu mobil dengan pria yang memiliki bir,” kata Obama penuh canda. Dia juga mengungkapkan bagaimana sikapnya jika putrinya sudah memiliki kekasih. Obama berencana untuk ‘menginterogasinya’ di ruang Oval. “Saya mungkin akan mengundangnya ke ruang Oval, menanyakan IPK-nya, lalu mencari tahu masa depan karirnya. Malia, Sasha, jika kalian menonton ini, saya hanya bercanda,” katanya sambil tersenyum.(vvn)

Gema Internasional

Reuters

PARA pengguna jalan dihentikan oleh para pemrotes dalam satu protes anti-China di Hanoi, Vietnam, Minggu (19/6). Ratusan

warga Vietnam melakukan protes di depan Kedutaanbesar China untuk ketiga harinya Minggu setelah Beijing mengirimkan satu patroli maritim paling besarnya ke wilayah perairan yang dipertikaikan di Laut China Selatan.

Pengebom Bunuhdiri Serang Konvoi Jerman di Afghanistan KUNDUZ, Afghanistan (AP): Seorang pengebom bunuhdiri menyerang konvoi militer Jerman di utara Afghanistan Minggu (19/6), tiga warga sipil tewas dan menyebabkan sedikitnya satu kenderaan lapis baja terbalik, begitu menurut keterangan pejabat dan saksi mata. Jubir Taliban Zaibullah Mujahid mengaku bertanggungjawab atas serangan itu. Pengebom itu meledakkan kenderaannya sebelum pukul 10:00 pagi waktu setempat di satu jalan sibuk di pinggiran kota Kunduz, dekat bandara. Seorang wartawan AP di tempat kejadian melihat sedikitnya satu kenderaan lapis baja terbalik dan apa yang terlihat seperti mobil warga sipil yang hancur dalam ledakan itu. Tiga warga sipil tewas dan

11 lainnya cedera dalam serangan itu, kata Kementrian Dalam Negeri dalam satu pernyataan. Tidak ada tentara NATO yang tewas atau cedera, menurut jubir pasukan koalisi, May. Tim James. Serangan itu terjadi setelah berlangsung kekerasan terhadap pasukan Afghanistan dan keamanan NATO. Sabtu, beberapa penyerang bunuhdiri menyerang kantor polisi di ibukota, menewaskan sembilan orang termasuk lima warga sipil sebelum mereka akhirnya bisa dilumpuhkan. Delapan tentara NATO tewas di Afghanistan pada hari yang sama. Empat tewas dalam pertempuran di bagian selatan dan timur, sementara empat lainnya tewas akibat kecelakaan kenderaan di bagian selatan

Obama Tunduk Pada AIPAC DALAM pidatonya di depan konferensi Asosiasi Amerika-Israel AIPAC, tiga hari setelah memberikan pernyataan yang pro-Israel di Departemen Luar Negeri AS tentang kebijakan pemerintahannya di Timur Tengah, Presiden AS Barack Obama tunduk pada keinginan AIPAC. Semakin jelas bagi dunia internasional bahwa Obama perlu berbicara di depan kelompok organisasi Yahudi Amerika mengingat dalam waktu satu tahun ke depan, tahun 2012 AS akan melaksanakan pesta demokrasi yaitu pemilihan presiden AS. Obama menganggap betapa pentingnya memperoleh dukungan suara dan dana dari warga Yahudi Amerika. Menghadapi situasi tak menentu di Timur Tengah dan khususnya penyelesaian perdamaian antara Palestina dengan Israel, Obama merasa perlu ‘mendekati’ AIPAC sebagai satu pressure group yang paling kuat berperan di bidang politik dan ekonomi Amerika Serikat. Oleh karena itulah, untuk persiapan Obama ikut pemilihan presiden AS tahun depan maka dia perlu melakukan kebijakan luar negeri. Solusi ‘dua negara’ (Palestina dan Israel) tidak menemukan titik penyelesaian. PM Israel Benyamin Netanyahu terang-terangan menentang solusi dua ne-

gara yang ditawarkan oleh Presiden Obama. Netanyahu lebih memilih one-state solution dengan power sharing. Di sisi lain, kejutan datang dari Palestina. Faksi Fatah yang sedang memimpin pemerintahan Otoritas Palestina melakukan rekonsiliasi dengan faksi Hamas yang saat ini menguasai Jalur Gaza.Kedua faksi bersepakat akan mendeklarasikan Palestina sebagai negara bebas dan independen pada bulan September yang akan datang. Penentangan terhadap rencana deklarasi Palestina muncul dengan keras dari Israel dan AS, yang tidak bisa menerima kehadiran Hamas dalam pemerintahan Palestina karena faksi itu dianggap sebagai organisasi teroris. Rekonsiliasi ini mendapat respons dari AIPAC yang menekan Obama agar ‘tunduk membela’ kepentingan Israel. Obama mengucapkan: I and my administration have made the security of Israel a priority. It is why we have increased cooperation between our militaries to unprecedented levels. Jelas tipis tercapai perdamaian di Palestina dan itu artinya darah bangsa Palestina akan mengalir deras untuk memperjuangkan hak kemerdekaan mereka. Nah, bagi Obama tinggal menagih janji AIPAC untuk mendukung-

nya dalam pemilihan presiden AS tahun 2012. Kalau memang Obama tunduk pada keinginan AIPAC (artinya juga terhadap Netanyahu), pernyataan Obama merupakan tekanan politik yang memalukan dan hanya mengindahkan kepentingan Israel dan mengenyampingkan penderitaan rakyat Palestina atas kekejaman Israel, hidup dalam pendudukan, blokade, kam pengungsi dan menjadi orang-orang terlantar di negeri mereka sendiri. Obama mengenyampingkan setiap persoalan yang berkaitan dengan okupasi atau menggunakan kekerasan tanpa memandang hukum terhadap penduduk Palestina yang tak berdaya sebagaimana penyerangan massal dua tahun lalu ke Gaza. Israel menganggap serangan yang dilakukannya adalah hak untuk mempertahankan diri dari serangan kelompok teroris. Jadi, sungguh mengherankan bahwa seorang presiden AS mencoba menyenangkan warga AIPAC, suatu tindakan dan cara merendahkan diri. Kembali pada komentarnya yang negatif, Obama meniru Netanyahu, menyalahkan langkah-langkah rekonsiliasi dan persatuan yang diambil oleh Otoritas Palestina dan faksi Hamas. Obama beranggapan

bahwa kesepakatan Fatah dengan Hamas akan memunculkan kesulitan besar menuju perdamaian. Sebenarnya, jika Obama berpikir lebih dalam dan tidak emosional dan dipertimbangkan dengan baik, kesepakatan seyogyanya dihargai sebagai suatu langkah besar menuju terciptanya suatu perdamaian. Jadi, tak sepatah pun kata diucapkan oleh Obama di konperensi AIPAC mengenai isu-isu pemukiman, Jerusalem, atau pengungsi Palestina. Tak satu pun juga ucapannya mengenai siksaan yang diterima oleh bangsa Palestina, dan tak ada satu pun rencana untuk berbicara dengan bangsa Palestina. Setelah pidato Obama di AIPAC, respons muncul dari para pemimpin Palestina yang menyimpulkan tidak ada lagi kemungkinan untuk melihatWashington memberikan bimbingan dalam mencapai perdamaian, keadilan, yang dapat mendukung resolusi konflik. Memang, untuk menerima kerangka perdamaianWashington dipandang dari sudut sikap Obama-Netanyahu, akan memunculkan bayangan gelap inkompetensi dan ilegetimasi jalan diplomasi Palestina di masa-masa yang akan datang. (Kosky)

Afghanistan. 4 Pengawal truk NATO tewas Dua serangan bom jalanan Sabtu menewaskan empat pengawal keamanan mengawal iring-iringan pasokan bahan bakar bagi salah satu pangkalan NATO di timur Afghanistan, demikian menurut seorang kepala polisi. Ledakan di provinsi Ghazni terjadi di satu jalan besar yang menuju ke satu pangkalan yang digunakan pasukan Polandia yang ditempatkan di kawasan itu sebagai bagian dari misi NATO, kata penjabat kepala polisi provinsi Mohammed Hussain. Bom-bom itu diledakkan dalam selisih waktu dua satu sama lainnya ketika iring-iringan mobil tangki tersebut melintas, yang menewaskan 4 pekerja Afghanistan yang bekerja sebagai pengaman para kontraktor yang dibayar untuk mengawal iringiringan kendaraan tersebutg, kata Hussain. Juga terjadi di Ghazni, NATO mengatakan Sabtu pasukannya telah menewaskan ‘sejumlah’ pemberontak dalam tembak menembak satu hari sehari sebelumnya, menyita sejumlah granat berpeluncur roket, senapan AK-47 dan jaket tahan peluru. Pertempuran di Ghazni itu terjadi di tengah tekanan oleh Taliban sebagai bagian dari ofensif musim seminya di Afghanistan. Pemberontak menggunakan bom jalanan, serangan bunuhdiri dan taktik lainnya

dalam usaha untuk membalas kekalahan mereka dalam peningkatan serangan malam hari oleh NATO. Sementara itu Sabtu, para pejabat mengatakan para pemberontak menculik seorang anggota dewan provinsi Logar dan tiga anggota keluarganya di kota Jalalabad, di timur Afghanistan. Anggota dewan provinsi itu, Abdulkhaliq Khairkhowa sedang melakukan perjalanan di jalanraya utama dekat Jalalabad Jumat malam untuk menghadiri satu upacara pemakaman hari berikutnya, kata Dr. Abduwali Wakil, ketua dewan provinsi Logar. Seorang pria berhasil bersembunyi di bawah tempat duduk mobil dan kendaraan itu ditinggalkan begitu saja oleh para penculik, kata Wakil. Pria tersebut kemudian mengikuti para penculik ke Pegunungan Torghar, satu daerah yang dikuasai Taliban, sebelum dia kembali untuk memberitahu pihak berwenang, tambahWakil. Serangan masih terus dilancarkan terhadap pasukan keamanan meski Presiden Afghanistatn Hamid Karzai menegaskan pembicaraan damai telah dimulai antara AS, pemerintah Afghanistan dan Taliban. Laporan tentang pembicaraan itu telah menjadi berita dalam beberapa bulan terakhir, namun pernyataan Karzai yang dikeluarkan Sabtu untuk pertama kalinya menyebutkan keterlibatan AS. (m23/m10)

LONDON,Inggris(Antara/IRNA-0ANA):Konferensiinternasional tentang Persatuan Islam kelima dimulai di London. Konferensi itu diadakan setiap tahun di ibukota Inggris sejak lima tahun lalu oleh sebuah organisasi bernama ‘Forum Persatuan Islam’ (IUF). Tema konferensi yang berlangsung selama empat hari itu adalah ‘Perlunya perubahan untuk membangunkan ummah’. Sejumlah pembicara, pada hari pertama konferensi, menyebut Revolusi Islam Iran sebagai ‘pemberontakan Agustus di bawah pimpinan almarhum Imam Khomeini’ akan mampu mengguncang dunia barat dan Zionis, serta mengatakan bahwa efeknya dapat dilihat di negara-negara Islam . Ulama Islam dari negara-negara Islam berpartisipasi dalam konferensi tersebut dan banyak dari mereka yang menyampaikan pidato.Hojatoleslam Muhsin Araki, di antara pendiri IUF, dengan mengacu pada kehilangan kemegahan ummat Muslim dan kelambanan mereka di bidang ilmiah, ekonomi dan sosial pada abad terakhir, mengatakan bahwa manifestasi yang paling mengerikan dari kelemahan tersebut adalah kehadiran rezim Zionis di wilayah Palestina. Dia mengatakan, satu-satunya solusi untuk semua masalah dunia Islam adalah melaksanakan ajaran al Quran. Araki mengkritik gangguan militer Amerika Serikat dan Pakta Pertahanan Atlantik Utara (NATO) dalam pemberontakan orangorang Muslim di negara-negara kawasan Arab dan menambahkan bahwa kekuatan asing tidak berhak untuk memaksakan apapun dari pemerintah untuk masyarakat kawasan, dan itu adalah hak masyarakat untuk memilih jenis pemerintah mereka sendiri. Pembicara lain dalam konferensi tersebut juga menggarisbawahi perlunya persatuan Islam, terutama dalam situasi yang sensitif seperti saat ini.

Debu Gunung Berapi Itu, Setelah Berkeliling Dunia, Kembali Ke Chile SANTIAGO, Chile (Waspada): Debu dari satu gunung berapi Chile yang meletus hampir dua minggu lalu telah berkeliling dunia dan kembali lagi ke negara asalnya. Kembalinya debu gunung berapi itu — yang telah mengganggu penerbangan di Argentina, , Brazil, Uruguay, Australia dan Selandia Baru dalam perjalanannya keliling dunia — Jumat (atau Sabtu 18/6 WIB) telah memaksa para pejabat Chile untuk membatalkan penerbangan domestik untuk pertama kalinya sejak meletusnya gunung Cordon Caulle 4 Juni lalu. Perusahaan penerbangan LAN membatalkan penerbangannya ke beberapa kota di Puerto Montt, Coyhaique dan Punta Arenas di selatan negara Amerika Selatan tersebut. Sementara debu dari Cordon Caulle telah menimbulkan malapetaka dengan perjalanan udara luar negeri, telah menyebabkan penerbangan internal Chile sebagian besar belum dapat terbang sampai Jumat. “Ujung dari awan yang telah berkeliling dunia itu lebih atau kurang sudah berada di depan Coyhaique,” kata Kepala Kantor Penerbangan Sipil Pablo Ortega. Coyhaique berada 800 km di selatan dari gunung berapi tersebut. Pihak berwenang Chile telah mengevakuasi 3.500 orang yang tinggal di dekat gunung berapi tersebut setelah mulai terdengar letusan namun sebagian telah kembali. Gobernur Provinsi Ranco Eduardo Holck mengatakan gunung berapi itgu mengeluarkan debu yang baik yang menyebar di atas lembah sungai Nilahue. Pemerintah masih tetap memberlakukan siaga merah bagi komunitas di dekat Cordon Caulle. Dinas Pertambangan dan Geologi Nasional Chile memperingatkan bahwa kegiatan gunung berapi dapat saja terjadi lagi ‘dengan beberapa episode yang serupa atau lebih besar lagi intensitasnya. Kamis, pemerintah provinsi Beuquen di Argentina menyatakan bantuan ekonomi darurat ke beberapa kota di mana debu yang jatuh dari gunung berapi Chile itu membahayakan ternak dan para wisatawan tidak ada yang datang. (bbc/m10)

Kolonel Irak Ditembak Mati BAGHDAD, Irak (Antara/AFP): Seorang kolonel militer Irak tewas ditembak di ibukota Irak, Baghdad, Sabtu (18/6) malam oleh orang-orang bersenjata dengan pistol berperedam suara, kata seorang pejabat Kementerian Dalam Negeri. “Kol. Taher Ibrahim Ahmed, yang bekerja di kementerian pertahanan, ditembak hingga tewas saat dia berada di dalam mobilnya di Jalan Palestina”, di timur ibukota, kata pejabat itu. Meskipun belum ada klaim dari pihak-pihak yang bertanggungjawab, kelompok jaringan Al Qaida mengatakan pihaknya berada di balik banyak serangan semacam itu yang ditujukan kepada para perwira senior militer dan para pejabat. Sementara itu di Baquba, Irak, beberapa hari sebelumnya, puluhan pemberontak bersenjata menyerang perkantoran pemerintah provinsi di Irak tengah, kata seorang wartawan AFP dan perwira keamanan, yang menggambarkan serangan bergaya sama dengan serbuan dua bulan lalu.

Reuters

PARA pengunjukrasa yang membawa spanduk berbaris menuju ke gedung Parlemen Spanyol di Madrid, Spanyol, Minggu (19/ 6). Satu pekan setelah pembersihan kemp para pemrotes di lapangan Puerta del Sol, Madrid, ribuan demonstran kembali turun ke jalan untuk memprotes krisis politikm perbankan dan ekonomi di Eropa.


Sport

WASPADA Senin 20 Juni 2011

A5

Swiss Sempurna, Denmark Tragis KOPENHAGEN (Waspada): Hasil sempurna dibukukan Swiss dalam tiga laga Grup A Piala Eropa U-21 di Denmark. Sebaliknya, tuan rumah Denmark bernasib tragis akibat dipecundangi Islandia 1-3 pada pertandingan terakhirnya di

Aalborg, Minggu (19/6) dinihari WIB. Swiss lolos ke semifinal dengan tanpa kemasukan satu gol pun dari tiga partai, sedangkan Denmark tersingkir kendati memiliki nilai dan koleksi gol sama dengan Belarus dan Islandia. Setelah menggasak Denmark 1-0 dan Islandia 2-0, Swiss masih mengganas dengan

menggunduli Belarus 3-0 di NRGi Park, Aarhus. The Nati sudah membuka keunggulannya saat laga baru berjalan enam menit via titik putih, karena Innocent Emeghara dijegal OlegVeretilo di kotak terlarang. Striker Admir Mehmedi yang bertindak sebagai eksekutor, sukses mengecoh kiper Aleksandr Gutor. Belarus berusaha bangkit, tetapi tak satu pun dari sejumlah peluang Pavel Nekhaychik, Stanislav Dragun dan Aleksandr Perepechko, yang berhasil menemui target. Jelang turun minum justru Swiss yang memantapkan keunggulannya. Kelengahan benteng Belarus dimaksimalkan Mehmedi menit 43. Menit 68 Sergei Matveychik mendapat kartu kuning kedua karena melakukan pelanggaran terhadap Xherdan Shaqiri. Swiss pun memanfaatkan kelebihan pemainnya dengan menyarangkan gol ketiga melalui tembakan Frank Feltscher pada injurytime. Meski kalah, Belarus tetap melaju sebagai runner-up Grup A berdasarkan hasil head-tohead, setelah secara mengejutkan Denmark dipermalukan Islandia 1-3 di Aalborg. Dinamit Muda sebenarnya hanya membutuhkan hasil imbang untuk lolos ke empat besar. Tetapi tiga perubahan komposisi pemain di sektor tengah yang dilakukan Islandia,

membuat tim tuan rumah kehilangan arah. Aaron Gunnarsson kembali main usai menjalani sanksi akumulasi kartu. Johann Gund-

Klasemen Akhir Grup A AP

ANAK-ANAK Swiss memenangkan tiga laga penyisihannya di Grup A Piala Eropa U-21.

Swiss Belarus Islandia Denmark

3 3 3 3

3 1 1 1

0 0 0 0

0 2 2 2

6-0 3-5 3-5 3-5

9 3 3 3

Mexico Memang Matang Tembus Semifinal Jumpa Honduras NEW JERSEY, AS (Waspada): Gol babak kedua dari Aldo De Nigris dan Javier ‘Chicharito’ Hernandez menuntaskan kebangkitan Mexico dengan mengatasi Guatemala 2-1 pada perempatfinal Piala Emas 2011. Hasil duel di New Meadowlands Stadium, East Rutherford, New Jersey, Minggu (19/6) pagi WIB tersebut, sudah cukup bagi Tim Sombrero untuk melaju ke semifinal. Pelatih Mexico Jose Manuel de la Torre pun mengklaim, pasukannya memang matang dan tangguh. “Tim kami sangat kuat di lini tengah. Mereka tahu mesti menang melawan semua kesulitan,” tuturnya. Pemain pengganti De Nigris yang masuk pada awal babak kedua, menyamakan kedudukan bagi sang juara bertahan menit 48, setelah serbuan Carlos Ruiz menit kelima membuat Guatemala unggul terlebih dulu. Chicharito kemudian mencetak gol penentu kemenangan menit 65, sehingga Sombrero maju ke semifinal untuk bertemu Honduras, yang menang 4-2 lewat drama adu penalti melawan Kosta Rika. “Kami tahu ini duel sulit dengan lawan yang sulit pula. Gol di menit awal itu terjadi karena situasi di lapangan sedikit rumit

dan ketat. Tetapi kami tahu akan kembali ke performa kami, ternyata kami menang,” tambah De la Torre Kendati tersingkir, arsitek Guatemala Ever Hugo Almeida mengaku tetap bangga dengan timnya. “Saya kira kita harus jujur, kami tidak memiliki level yang sama seperti tim Mexico,” ucapnya. Mexico yang memenangkan ketiga laganya di babak penyisihan, selanjutnya jumpa Honduras pada semifinal di Houston, Rabu (22/6). Sukses Honduras dalam drama adu penalti di New Meadowlands Stadium yang dipadati 78.807 penonton, ditentukan kecemerlangan kiper Noel Valladares, yang menyelamatkan dua tendangan pemain Kosta Rika, Celso Borges dan Alvaro Saborio. Jerry Bengtson lebih dahulu memberi Honduras keunggulan 1-0 menit 49. Dennis Marshall kemudian menyamakan kedudukan menjadi 1-1 menit 56. Valladares memastikan hasil reguler tetap 1-1 menit 76 dengan melakukan diving untuk menghentikan laju bola hasil tendangan penalti Saborio. Dalam adu penalti, Carlo Costly,Victor Bernardez,Wilson

STRIKER Mexico Aldo De Nigris (kiri) dijatuhkan bek Guatemala Gustavo Cabrera di New Meadowlands Stadium, East Rutherford, New Jersey, AS, Minggu (19/6) pagi WIB. -AP-

Palacios dan Bengtson, semua berhasil sebagai eksekutor Honduras. Semifinal lainnya akan mempertemukan pemenang perempatfinal antara Amerika

Serikat kontra Jamaika dan Panama melawan El Salvador. Juara Piala Emas akan mendapat satu tiket ke Piala Konfederasi FIFA 2013. (m15/ant/afp/rtr)

Kejutan Prancis, Kongo Piala Dunia U-17 MONTERREY, Mexico (Waspada): Prancis dan Kongo membuat kejutan besar pada partai perdana babak penyisihan Piala Dunia U-17 di Mexico, Minggu (19/6) pagi WIB. Mengawali laga Grup B di Estadio Universitario, Monterrey, Prancis membantai Argentina 3-0 melalui gol yang tercipta sepanjang babak pertama. Kecepatan, umpan-umpan kilat, serta organisasi permainan tim Ayam Jantan Muda, tak mampu diimbangi anak-anak Tango. Lenny Nangis mengirimkan umpan silang yang dituntaskan dengan sempurna oleh Yassine Benzia menit 35. Nangis kembali terlibat pada gol kedua yang dicetak Sebastien Haller. Benzia menciptakan gol keduanya sebelum turun minum. Argentina tak mampu membalas hingga laga berakhir. Di Grup A, juara Eropa Be-

landa dibekuk Kongo 0-1, kendati anak-anak remaja Kincir Angin mendominasi awal duel dengan berlama-lama menguasai bola. Tonny Trindade de Vilhena mampu memanfaatkan umpan Anass Achahbar menjadi gol, tetapi dianulir karena sang striker terperangkap off-side. Kongo hanya meraih peluang melalui tendangan jarak jauh Bel Epako. Tetapi wakil Afrika itu malah mengejutkan Meneer Muda dengan membobol gawang Boy de Jong menit 53 melalui serangan balik kilat dari Justalain Kounkou. Korut, Jepang Sebelumnya di Grup A, tuan rumah Meksiko mengalahkan juara Asia Korea Utara 3-1 di Estadio Morelos. Sombrero sempat tersentak saat Korut mencetak gol cepat menit ketiga melalui Jo Kwang. Menit 37 Mexico membalas lewat tendangan voli Carlos

fifa

PENYERANG Prancis Sebastien Haller merayakan golnya ke gawang Argentina di Monterrey, Mexico. Fierro. Bakak kedua Mexico mendominasi dan kartu merah kiper Cha Jong Hun karena melanggar Marco Bueno melempangkan kemenangan tuan rumah. Menit 68 Jong Kwang Sok menyundul masuk umpan silang Giovani Casillas ke gawang sendiri. Gol pamungkas Mexico tercipta menit 87 ketika Casillas dengan cepat menyambut bola muntah sepakan Fierro, yang ditepis kiper pengganti An Kang

Chol. Beda dengan tetangganya Korut, Jepang berhasil memupuk peluang melaju ke babak gugur dari Grup B, setelah menang 1-0 atas wakil Karibia, Jamaika. Pemain pengganti Masaya Matsumoto yang menjadi bintang kemenangan Samurai Biru dengan golnya menit 61. Jepang selanjutnya menjajal Prancis pada Selasa (21/6), sedangkan Jamaika menantang Argentina. (m15/goal/fifa)

mundsson pulih dari cedera dan Birkir Bjarnason buat kali pertama terpilih sebagai starter. Islandia mendominasi permainan dan Kolbeinn Sigthors-

son membuka keunggulan menit 58, memanfaatkan umpan silang Bjarnason. Berselang dua menit, tandukan Bjarnason menyambut

umpan Sigurdsson menggandakan keunggulan tim tamu. Bashkim Kadrii sempat memperkecil ketertinggalan Denmark menit 81. Tetapi ten-

dangan melengkung Hjorthur Valgardsson dari luar kotak penalti pada injury-time berhasil memulihkan kemenangan Islandia. (m15/goal/fifa)


Sport

A6

WASPADA Senin 20 Juni 2011

Bartoli Juara Turnamen Eastbourne WIMBLEDON, Inggris (Waspada): Tahun ini, Maria Sharapova (foto) memasang target di Wimbledon. Dengan tegas, petenis cantik asal Rusia itu menyatakan siap menggondol trofi keduanya dari turnamen All England Club. “Jika saya melakukannya lagi, maka itu akan menjadi pencapaian terbaik selama karier,” ujar Sharapova, Minggu (19/6). Sebelumnya, Sharapova memang sudah pernah meraih kemenangan di Wimbledon. Ketika itu, Masha masih berusia 17 tahun dan merebut titel grand slam pertama pada 2004 sebelum dua tahun kemudian sukses mengangkat trofi di AS Terbuka dan Australia Terbuka. Mengenai performanya yang tak kunjung mencapai puncak semenjak pulih dari cedera panjang pada 2008 silam, Sharapova menganggap sebagai hal yang lumrah. Pemilik tinggi 188 cm sadar ini dirinya harus menata ulang semua untuk bisa kembali level teratas. “Saya seperti menata ulang semua. Ketika baru kembali, pada dasarnya saya juga harus memulai dari titik nol. Saya dipaksa berjuang dan berkompetisi dengan petenis papan atas era sekarang. Sungguh sebuah proses yang panjang,” tuntasnya. Sejak operasi bahu pada akhir 2008, Sharapova mengalami masa sulit. Bahkan petenis berusia 24 tahun itu berada di titik terburuk dalam karier tenisnya dengan merosot hingga peringkat 126 dunia. Perlahan tapi pasti, ikon iklan Nike ini mulai menemukan permainan terbaiknya. Berbekal kemenangan di Roma Masters, Sharapova semakin percaya diri menjalani Wimbledon 2011 yang akan dimulai Senin (20/6) ini. (m33/ap)

AP

LONDON ( Waspada): Petenis Prancis, Marion Bartoli (foto), sukses memenangi Turnamen WTA Eastbourne International di London, Minggu (19/ 6). Ini adalah kemenangan pertama Bartoli di atas lapangan rumput. Pada final tersebut, Bartoli mengalahkan petenis Republik Ceko, Petra Kvitova. Bartoli yang berada di peringkat sembilan dunia menang 6-1, 4-6, 7-5 atas Kvitova. Di awal permainan, Bartoli tampil dengan rasa percaya diri yang tinggi. Di sini, petenis Prancis itu menyapu bersih lima game terakhir set pertama. Namun di set kedua Bartoli kalah tipis sebelum akhirnya menang lewat pertarungan ketat di set penentu. Walau kalah, Kvitova merasa tak terlalu kecewa. “Ini adalah pemanasan yang

Sukses Ganda Tontowi/Liliyana SINGAPURA (Waspada): Ganda campuran Indonesia, Tontowi Ahmad/Liliyana Natsir, menyempurnakan penampilan impresif mereka di ajang Singapura Terbuka Super Series. Di final turnamen berhadiah 200 ribu dolar AS itu, Minggu (19/6), unggulan keempat ini menang 21-14, 27-25 atas pasangan Taiwan, Chen Hung Ling/Cheng Wen Hsing. Dengan demikian, ganda campuran terbaik Indonesia ini mencatat hatrik gelar di musim 2011, setelah India Terbuka Superseries dan Malaysia Terbuka Grand Prix Gold. Total, pasangan yang “disatukan” pada Oktober 2010 itu sudah mengoleksi lima gelar. Sepanjang tampil di Singapura, Tontowi/Liliyana tampil prima. Bukan cuma menyingkirkan sejumlah pemain top, termasuk unggulan utama dari China, mereka juga tak pernah kehilangan game. Peringkat lima dunia ini selalu menang straight set, termasuk ketika mengalahkan unggulan utama, Zhang Nan/Zhao Yunlei, di semifinal. Tontowi/Liliyana tampaknya akan menutup pertandingan ketika unggul 20-19, tetapi ganda Taiwan itu berhasil menyamakan kedudukan 25-25. Dua kali pengembalian yang gagal dari lawan pun memastikan Tontowi/Liliyana meraih gelar ketiga

tahun ini. “Pada game kedua, kami agak tegang dan terbawa pola permainan lawan. Setelah kami bisa menyamakan angka, kami yakin menang,” kata Liliyana yang diamini Tontowi di mana keduanyakini kian yakin menghadapi Indonesia Terbuka Super Series Premier pekan depan. Keberhasilan Tontowi/Liliyana tersebut menjadi satusatunya kesuksesan bagi bulutangkis Indonesia. Pasalnya, ganda putra Alvent Yulianto/ Hendra Aprida Gunawan hanya mampu menempati runner-up untuk kedua kalinya secara beruntun akibat kalah dari Fu Haifeng/Cai Yun (China) 17-21, 13-21. Gelar ganda putri diraih pasangan China Tian Qing/ Zhao Yunlei yang mengalahkan Ha Jung Eun/Kim Min Jung (Korea) 21-13, 21-16. Tunggal putra dijuarai Chen Jin tanpa bertanding karena Lin Dan terpaksa mundur akibat cedera. Tunggal putri sendiri tetap didominasi Negeri Tirai Bambu setelah Wang Xin menyisihkan Tine Baun (Denmark) 21-19, 21-17. (m33/ant)

Presiden akan diikuti 28 negara dan SEA Games hanya 11 negara. Karena itu, target dua medali emas paling realistis,” tutur Setya. Senada itu, Manajer Pelatnas Tinju yang juga Ketua Panitia Piala Presiden, Serta Ginting, lebih optimis. Dia memperkirakan Indonesia dapat meraih lima medali emas. “Saya pikir kita dapat merebut tiga medali emas dari tim putra dan dua emas dari tim Putri,” kata Ginting. Indonesia akan menampilkan tiga tim, yakni Garuda, Rajawali, dan Elang. Tim Garuda diperkuat delapan petinju putra dan enam putri. Di bagian putra, ada Denny Hitarihun (49 kg), Julio Bria (52 kg), Rafli Langi (56 kg), Matias Mandiangan (60 kg), Vinky Montolalu (64 kg), Taufan Paransa (69 kg), Alex Tatontos (75 kg), dan Nazarudin (81 kg). Pada bagian putri terdapat Selly Wanimbo (48 kg), Irene Sasihiang (51 kg), Marsadeva (54 kg), Welmi Pariyama (57 kg), Magdalena Kambayong (60 kg), Siti Aisyah (64 kg). Tim Rajawali putra diperkuat Bogi Andriano (49 kg), Hofni Sangelorang (52 kg), Dadan Amanda (56 kg), Ralin Lumongi 60 kg), Afdan Bahtila (64 kg), Daniel Pasaribu (69 kg), Toar Sompotan (75 kg), dan Kristanto (81 kg). Tim Rajawali putri dihuni Rumiris Simarmata (48 kg), Beatrix Sugoro (51 kig), Norberta Tajun (54 kg), Ni Luh Yeni WD

Tenis Eksekutif Korem 022/PT P E M ATA N G S I A N TA R (Waspada): Korem 022/PT mengadakan pertandingan tenis eksekutif memperingati HUT Kodam I/BB dan HUT Korem 022/PT di lapangan tenis indoor PT STTC, Kota Pematangsiantar, Sabtu (18/6). “Pertandingan eksekutif ini merupakan rangkaian akhir dari kegiatan HUT Kodam I/ BB dan HUT Korem 022/PT tahun ini sebelum syukuran dilaksanakan Senin (20/6) ini bersamaan dengan HUT Kodam I/BB,” sebut Danrem 022/PT Kolonel Karsiyanto melalui Kapenrem 022/PT Mayor Caj Drs Prinaldi (foto), Minggu (19/6). Menurut Prinaldi, pertandingan eksekutif itu diikuti Uspida Kabupaten Simalungun dan Kota Pematangsiantar, Imigrasi, Bridgestone, PTPN IV Bah Jambi, Perkebunan Sipef, Bank Mandiri, Bank BRI, Telkom, Per-

Waspada/ist

pajakan, Taspen, Rindam I/BB, dan Korem 022/PT. “Dengan ini, tentu akan terbina hubungan baik Korem 022/PT dengan berbagai pihak,” papar Kapenrem. Pemenang pertandingan itu sendiri diraih Wadan Denhub Mayor Chb R Hutagalung (nilai 44). Runner-up ditempati Brig Pol Syawaludin Nasution (Polres Simalungun/39) diikuti Pakumrem 022/PT Mayor Chk Bambang Permadi (38) dan Danrem 022/PT Kol Inf Karsiyanto (36). (a30)

nal dan Kvitova mengungguli petenis Slovakia Daniela Hantuchova 7-6, 4-2. Sempat tertunda hujan, Hantuchova akhirnya memutuskan mundur karena cedera sesaat hujan reda. (m33/ap)

Rifat Kibarkan Merah Putih JAKARTA (Waspada): Bendera Merah Putih berkibar di arena reli Asia Pasific Rally Championship APRC 2011 setelah Rifat Sungkar dan Scott Beckwith (navigator) naik podium usai meraih prestasi ganda, yaitu posisi kedua Pacific Cup dan memimpin posisi 1. Pada Rallye de Nouvelle Caledonie yang merupakan putaran ketiga Asia Pasific Rally Championship APRC, Minggu (19/6), Rifat/Scott yang membela tim Pertamina Cusco Racing menyajikan penampilan terbaiknya. Sesuai rilis yang diterima Waspada, Rifat dan Scott memacu kendaraan Mitsubishi Lancer Evolution X pada leg kedua untuk menyelesaikan enam Special Stage (SS) yang dilewatinya dengan gemilang. “Alhamdulillah, saya bahagia sekali karena akhirnya bisa naik podium dan mendapat sambutan luar biasa dari penonton. Lebih membanggakan lagi karena kami mampu mengibarkan bendera Merah Putih,” kata Rifat. Manajer Tim Pertamina Cusco Racing dari Indonesia, Haris Gondo Kusumo, menyatakan perjuangan Rifat dan Scott memang luar biasa. Dikatakan, keberhasilan Rifat ini memang sudah diprediksi sebelumnya oleh berbagai media di New Caedonia maupun negara lainnya, termasuk Prancis. (yuslan)

Kroser Asing Masih Tangguh SURABAYA (Waspada): Pengalaman berharga banyak dipetik kroser nasional seiring berakhirnya perhelatan Surya 12 Motoriders Powercross Championship 2011 di Sirkuit Barata, Ngagel-Surabaya, Sabtu (18/6) malam. Ajang itu sendiri menghadirkan juara internasional di kelas SE (Special Engine) 125 cc Kim Askhenazi (Australia) yang mengemas total 225 poin dan Aris Setyo sebagai juara nasional dengan raihan nilai 114. Aris pun meraih gelar nasional dengan mengatasi tekanan dari rivalnya, Alexander Wiguna (109/NTB), dan Farhan Hendro (DKI) yang berada di tempat ketiga dengan 83 poin. Hal tersebut, lanjut Aris, didapat dari obrolannya dengan kroser-kroser asing, seperti Askhenazi, Jack Ridley (Australia) maupun Matev Irt (Slovenia). Askhenazi harus puas berada di posisi kedua di bawah Jack Ridley yang membela tim Dumasari Bostar Bonaharto dari Sumatera Utara. Posisi ketiga kroser Prancis, Vincent Berthome. (yuslan)

Reuters

GELAR kedua Super Series direbut Tontowi Ahmad/ Liliyana Natsir dengan menjuarai Singapura Terbuka, Minggu (19/6).

Menpora Minta Petinju Indonesia Maksimal JAKARTA (Waspada): Menteri Pemuda dan Olahraga (Menpora) Andi Alfian Mallarangeng meminta petinju Indonesia tampil maksimal. Juga memetik pengalaman pada turnamen tinju amatir Piala Presiden XXI di Jakarta, 2-9 Juli mendatang. Imbauan itu disampaikan Menpora kepada petinju Indonesia saat Soft Opening Turnamen Tinju Piala Presiden di Stadion Tenis Tertutup Gelora Bung Karno, Senayan, Jakarta, Minggu (19/6). “Saya berharap petinju dapat memetik pengalaman berharga pada Piala Presiden nanti. Hasil dapat dijadikan bahan evaluasi agar dapat merebut medali emas pada SEA Games nanti. Sebab SEA Games lalu di Laos kita belum meraih medali emas. Semoga SEA Games mendatang saat kita menjadi tuan rumah, petinju Indonesia merebut medali emas,” ujar Menpora. Tantangan Menpora itu mendapat sambutan meriah dan tepuk tangan petinju. Sementara itu, Ketua Umum Pengurus Pusat Persatuan Tinju Amatir Indonesia (PP Pertina), Setya Novanto, menyatakan keyakinannya jika petinju dapat tampil maksimal di Piala Presiden. “Saya perkirakan setidaknya dua medali emas bakal dapat kita raih. Kita tahu bahwa Piala

Reuters

baik untuk Wimbledon. Saya akan menuju Wimbledon dengan perasaan yang enak,” kata Kvitova sportif. Sebelumnya, Bartoli mengalahkan Samantha Stosur (Australia) 6-3, 6-1 di semifi-

(57 kg), Dolince Sanadi (60 kg), dan Kasih Pasaribu (64 kg). Tim Elang putra diwakili Musa Cahyadi (49 kg), Zakaria Pasaribu (51 kg), Atris Neolaka (56 kg), Arenaldo Moniaga (60 kg), Denny Hutasoit (64 kg), Lodwik Batlayeri (69 kg), Ruben Sitompul (75 kg), dan Willys Riripory (81 kg). Sementara Tina Penturi (48 kg), Nurmala Dewi (51 kg),Veronica Nicholas (54 kg), Jeane Maleyong (57 kg), Arie Marsiana (60 kg), dan Fransisca Wahyu (64 kg) akan memperkuat tim Elang putri. (yuslan)

7 Daerah Ikuti Voli Pantai LTES 2011 Dibuka Sekdakab Samosir MEDAN (Waspada): Sekdakab Samosir Ir Hatorangan Simarmata membuka kejuaraan voli pantai Lake Toba Eco Sport (LTES) 2011 di Pantai Pasir Putih, Parbaba, Samosir, Minggu (19/6). Voli pantai merupakan satu dari lima cabang olahraga yang digelar dalam rangka memeriahkan pesta tahunan di objek wisata kebanggaan Sumatera Utara tersebut. Empat cabor lainnya adalah tinju, dragon boat, binaraga dan drumband. Hatorangan Simarmata mengharapkan, para peserta

voli pantai LTES 2011 dapat memanfaatkan Pantai Pasir Putih Parbaba untuk meningkatkan prestasi, supaya bisa membawa nama harum Sumut di tingkat nasional. Didampingi Kadis Parhub Samosir Subandrio Parhusip, Kadis Kesehatan Manigor Simbolon, Kadis Kehutanan Y Hutauruk, Kadis Sostekpora W Simbolon dan Humas G Naibaho, Sekdakab meminta semua peserta supaya bertanding secara sportif. Pembukaan voli pantai di Parbaba turut dihadiri Ketua

Pengprov PBVSI Sumut Ir Akbar Ali, didampingi Elfian selaku Kabid Binpres. Juga Kabid Pemberdayaan Olahraga Dispora Sumut Drs Darwis Siregar dan Sekretaris Panitia LTES 2011 Drs Mazrinal Nasution MAP. Darwis Siregar mengatakan, cabang voli pantai yang berlangsung 19-21 Juni, diikuti tujuh daerah tingkat II, yaitu Medan, Deliserdang, Siantar, Simalungun, Samosir, Tanjungbalai, dan Labuhanbatu Selatan. “Melalui pertandingan voli pantai, LTES 2011 diharapkan dapat meningkatkan kunjungan

wisatawan ke Kabupaten Samosir,” harap Darwis. Ketua PBVSI Sumut Ir Akbar Ali menuturkan, kejuaraan voli pantai LTES 2011 dibagi dua kategori, yakni senior dan junior putra maupun putri. “Voli pantai akan dikembangkan dan dibina secara serius di Sumatera Utara, sebab saat ini levelnya sudah menjadi cabang olahraga prestasi dan bergengsi,” tekad Akbar Ali. Ditambahkannya, selama ini pembinaan voli pantai Sumut memang kurang serius, sehingga keberadaan atletnya terkesan

dadakan. “Mereka tidak berlatih secara serius dan fokus, karena kebanyakan berasal dari atlet voli indoor. Mereka hanya bermain voli pantai ketika menghadapi kejuaraan saja,” timpal Elfian. Menurut Kabid Binpres PBVSI Sumut tersebut, potensi atlet voli pantai Sumut sebenarnya sangat menjanjikan. “Tetapi itu memang perlu pembinaan serius. Kejuaraannya juga sangat minim, ini yang nantinya akan kita tingkatkan,” tambah Elfian. (m15)


Sport

A7 Porwil Batam Kurang Semarak

WASPADA Senin 20 Juni 2011

Senin Ini Dibuka Resmi

Waspada/Dedi Riono

DELAPAN pemain terbaik City Selection Medan diabadikan bersama usai melakoni duel dengan tim All Star LA Lights Streetball 2010, Minggu (19/6) malam.

Dominasi Universal Ballers LA Lights Streetball 2011 Open Run Medan MEDAN (Waspada): Universal Ballers meraih sukses ganda di ajang LA Lights Streetball 2011 Open Run Medan. Selain juara, tim yang diperkuat mantan pemain All Star LA Light Streetball 2010, Lana ‘Money Man’, itu juga meloloskan dua pemainnya dalam daftar delapan pemain terbaik City Selection Medan, yakni Moebaraq Siregar ‘Baraq’ dan Andrew ‘Wewe’. Universal Ballers sendiri memastikan gelar juara dengan menaklukkan Gue Banget 149 pada final di Lapangan Udara TNI AU Polonia Medan, Minggu (19/6) malam. Disaksikan ratusan penonton, Universal sempat mendapatkan perlawanan ketat hingga babak kedua. Namun berkat Lana ‘Money Man’, perlahan tapi pasti, Universal pun sukses mengakhiri laga dengan kemenangan sekaigus berhak atas hadiah

uang tunai Rp10 juta. Keberhasilan Universal meraih sukses ganda seperti telah diprediksi sebelumnya. Tekad dan ambisi mengulang sukses runner-up grandfinal 2010 lalu memacu semangat mereka. Ada pun enam pemain lainnya yang masuk dalam daftar delapan pemain terbaik City Selection Medan adalah Djakat Pramudia ‘D One Handler’ (D’Vasto Dima), Ari Prihandono ‘Lil’ Mask’ (D’Vasto Dima), Suwandi ‘New Shine’ (D’Vasto Dima), Ferry Steaventinus (Aku Cinta Mama 1), Davin (Gue Banget), dan Ananda (Ballstar Medan 1). Kedelapan pemain selanjutnya bergabung dalam satu tim menghadapi grandfinal di Jakarta, September mendatang. “Hasil City Selection Medan ini didapat dari pemantauan dewan juri. Para juri itu adalah Danny ‘D Rockz’, Ali Budimansyah, Raoul ‘Ebos’ Hadinoto,

Dede Rahman, dan Dwui ‘Iboy’ Eriano,” ujar National Promotion PT Djarum Indonesia, Mario CS Panjaitan. Mario juga memberikan apresiasi kepada tim D’Vasto Dima yang sukses meloloskan tiga pemainnya sekaligus dalam skuad pemain terbaik. Penghargaan lainnya adalah Rookie Terbaik yang diraih Sudyanto ‘Hanger’ (Ballstar Medan 2), MVP direbut Rahmad ‘Invisible’ (Ice Cream A), dan gelar Top Dunk of the Game dimenangkan Suwandi ‘New Shine’ (D’Vasto Dima). Usai final, penonton disuguhkan laga eksebisi antara All Star LA Light Streetball 2010 versus tim City Selection Medan. Pada pertandingan seru itu, All Star unggul 57-40. Setelah Kota Medan, penyelenggaraan kompetisi LA Lights Streetball 2011 selanjutnya menuju Palembang pada 25-26 Juni nanti. (m42)

BATAM, Kepri (Waspada): Satu hari menjelang pembukaan Pekan Olahraga Wilayah (Porwil) se-Sumatera 2011 di Batam, Kepulauan Riau, tampak kurang semarak dengan minimnya spanduk dan umbul-umbul di “kota dollar” itu. Masyarakat setempat pun banyak yang tidak mengetahui akan dilaksanakannya Porwil yang merupakan event bergengsi olahraga lima tahunan yang sekaligus ajang kualifikasi Pekan Olahraga Nasional (PON). Menurut rencana, Porwil akan dibuka Gubernur Kepri HM Sani di Stadion Tumenggung, Senin (20/6) ini pukul 15.00 dimeriahkan tarian adat Negeri Lancang Kuning tersebut. Ketua Kontingen Sumut, Muhyan Tambuse, didampingi Wakil Ketua Panusunan Pasaribu menyebutkan, defile kontingen yang berkekuatan 126 atlet dan pelatih pada pembukaan ini akan berada di urutan kedelapan. Nantinya, atlet Sumut akan mengenakan pakaian

Waspada/Setia Budi Siregar

TIM atletik Sumut foto bersama sebelum melaksanakan latihan di Stadion Tumenggung, Minggu (19/6). adat Karo yang dipakai dua atlet pencak silat, Dani Pradana dan Dinda Ayu Permata Sari. Sekretaris PB Porwil 2011, Amri, Minggu (19/6), mengakui pelaksanaan Porwil Sumatera 2011 di Batam yang diikuti 1098 atlet dan ofisial dari sembilan provinsi (Riau tidak ikut karena tuan rumah PON) memang kurang semarak, karena keterbatasan dana dan sarana. Untuk event berskala nasional yang merupakan babak kualifikasi PON ini, PB Porwil 2011

Jalan Santai YPHM, ITMI Medan MEDAN (Waspada): Ribuan pelajar Yayasan Perguruan Harapan Mandiri (YPHM) Medan, Jl Brigjen Katamso dan mahasiswa ITMI Medan mengikuti olahraga jalan santai dalam rangka menyambut HUT Kota Medan ke-421, Minggu (19/6). Peserta jalan santai dilepas Kadis Pendidikan Kota Medan, Drs Hasan Basri MM, di pelataran sekolah itu. Selanjutnya, peserta menempuh rute perjalanan dari depan gedung Harapan Mandiri (Jl Brigjen Katamso) hingga Simpang Sei Mati dan kembali ke sekolah. Selain pelajar dan mahasiswa, Ketua YPHM Wiryanto, Dandenpom I/5 Medan Mayor CPM Hendra Yuspidar, anggota TNI, dan masyarakat sekitar ikut jalan santai tersebut. Pada kesempatan itu, Hasan Basri memberi apresiasi kepada Yayasan Perguruan Harapan Mandiri dan ITMI Medan yang telah berpartisipasi menyambut HUT Kota Medan. Koordinator Kesiswaan dan Ketua Panpel, Hendri, mengatakan olahraga jalan santai merupakan kegiatan rutin Per-

guruan Harapan Mandiri, yakni dua kali dalam setahun. (m42)

Problem Catur Putih melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2.

imbang 1-1. Generasi unggul lebih dahulu lewat gol Josua di menit 31 sebelum akhinya Mabar Putra menyamakan skor melalui gol Rahmat Kurniawan tiga menit berselang. Dalam adu penalti, Mabar Putra sukses mencetak empat gol masing-masing dari Trisna Pramana, Rahmat Kurniawan, Angga AS, dan Nurmin Syahputra. Sedangkan Generasi Medan hanya mampu mengemas dua gol. Selanjutnya, Bintang 12 dan Generasi akan bertemu di semifinal pada Jumat (24/6) mendatang. Semifinal lainnya mempertemukan SSB Tunas Muda Labura kontra Surya Putra Sampali pada waktu bersamaan. (m42)

TTS TOPIK

“Semula kita menggelar pertandingan atletik untuk nomor lari di Pulau Pinang, tetapi lintasan di sana belum selesai di bangun. Kita terpaksa memilih Johor, karena biaya lebih efisien dari daerah lain di Sumatera,” ungkapnya. Amri menambahkan, enam cabang olahraga yang dipertandingkan di Porwil Sumatera 2011 ini merupakan kualifikasi PON 2012 di Riau, termasuk cabang atletik untuk nomor lari lintasan. (m18)

Piala PSBI Jakarta

Semifinal Piala Specs U-15 menit. Dalam adu penalti, Aditia, Bayu Kurniawan, Krisna, Chandra, dan Arjun sukses membobol gawang Patriot yang dikawal Muhajir. Sebaliknya Patriot hanya mampu mencetak tiga gol lewat M Sartam, M Yusuf, dan M Fadil setelah tendangan Fauzan ditepis kiper Bintang 12, Agus. Sementara itu, Mabar Putra juga harus meraih tiket semifinal lewat drama penalti setelah dalam waktu normal bermain

nyisihan. Cabang catur digelar di Hotel Grand Majesty (20-26 Juni) dan bola basket dimainkan di Sports Hall Tumenggung (2026 Juni). Sementara empat cabang lainnya dipertandingkan mulai Selasa (21/6) besok. Cabang atletik digelar di Stadion Tumenggung Abd Jamal dan Johor (21-26 Juni), bulutangkis di GOR Banda Baru (2126 Juni), sepaktakraw di GOR Sekolah Harapan Utama (2225 Juni), dan pencak silat di Kepri Mall (21-25 Juni).

Rantauprapat FC Optimis Bertahan

Bintang 12, Mabar Putra Menyusul MEDAN (Waspada): SSB Bintang 12 dan Mabar Putra Medan menyusul ke semifinal turnamen antar SSB Piala Specs U-15, setelah sama-sama memenangi drama adu penalti di Stadion Kebun Bunga Medan, Minggu (19/6). Bintang 12 memastikan tiket semifinal setelah menang adu penalti atas SSB Patriot Pantonlabu (Aceh Timur) 5-3. Drama penalti dilakukan setelah kedua tim bermain imbang tanpa gol selama waktu normal 2x35

hanya diberi anggaran sebesar Rp4 miliar. Begitu juga dengan sarana dan prasarana, diakui belum layak. Dari awal, kata Amri, Porwil 2011 ini direncanakan digelar di Pulau Dompak, Pulau Pinang. Namun, adanya persoalan hukum yang menyangkut mantan Gubernur Kepri, Porwil terpaksa dipindahkan ke Batam. Catur, Basket Lebih Awal Sebelum pembukaan, cabang catur dan bola basket telah menjalani pertandingan pe-

Wapada/Hasriwal AS

WAKIL Bupati Labuhanbatu dan tim Rantauprapat FC foto bersama setelah memastikan diri lolos ke semifinal Piala PSBI Jakarta di Stadion Veledrome Rawamangun, Jakarta, Sabtu (18/6).

JAKARTA (Waspada): Rantauprapat FC optimis mempertahankan gelar Piala PSBI (Punguan Simbolan Boruna Indonesia-Persatuan Simbolon dan Boruna se Indonesia) untuk kedua kalinya. “Permainan tim semakin matang dan kompak, apalagi semangat dan motivasi pemain kian tinggi. Belum lagi segenap pemain dan ofisial mendapat suntikan motivasi dari warga Labuhanbatu, termasuk Wakil Bupati Labuhanbatu,” kata Manajer Tim Rantauprapat FC,

UMUM Mendatar

1. Kepanjangan dari singkatan populer sikon (dua kata, tulis tanpa spasi). 8. Setuju; Tidak kontra. 9. Buku acuan untuk melihat arti atau terjemahan kata dsb. 11. Susunan; Tata susun; Teknik menyusun karangan agar diperoleh cerita yang indah dan selaras; Integrasi warna untuk mencapai kesatuan yang harmonis. 12. Perdagangan dengan saling bertukar barang. 13. Singkatan minimum. 14. Gedung yang dilengkapi alat-alat untuk keperluan pengamatan dan penelitian ilmiah tentang bintang dsb. 15. Sakit (Inggris). 16. Berhenti (Inggris). 19. Jatuh; Hilang. 21. Tari tradisional dengan penari utama wanita, dilengkapi dengan selendang yang dikalungkan di leher. 23. Gelar bangsawan di Jawa diantara gelar raden dan raden mas. 24. Nama bandara di kota Kuala Lumpur, Malaysia (singkatan). 26. Kota besar di Turki selain Istanbul. 28. Nama pahlawan, jenderal besar. 29. Obat untuk membuat orang kehilangan rasa kesadarannya.

30. Galak; Ganas.

Menurun

1. Singkatan populer Sistem Keamanan Lingkungan. 2. Peristilahan (tentang kata-kata); Ilmu mengenai batasan atau definisi istilah. 3. Bagian dari kelompok atau bagian dari keseluruhan; Tulisan yang biasa terlihat di atas contoh mata uang baru. 4. Singkatan gelar insinyur. 5. Sekolah musik. 6. Kepala negara yang mempunyai kekuasaan mutlak, diperoleh dengan cara yang tidak demokratis. 7. Sama kedua belah bagiannya; Setangkup. 10. Sembarang; Tombak yang ujungnya bercabang tiga untuk menangkap ikan. (Di koran Waspada, tetap pakai he he he). 17. Perbuatan terlarang menurut adat atau nasihat diet dari dokter. 18. Besar hati; Bangga; Berani dalam bahasa minang. 20. Ruang tempat makan minum (di kantor, sekolah dsb). 22. Cahaya. 23. Ikan besar. 24. Konferensi Meja Bundar. 25. Masalah yang dikedepankan. 27. Anak Baru Gede.

Wilson Siagian, di Jakarta, Sabtu (18/6) malam. Jamuan makan malam tersebut digelar usai Rantauprapat FC mengalahkan Armed FC 41 pada semifinal yang digelar di Stadion Veledrome Rawamangun, Jakarta Timur. Di final, Rantauprapat FC nantinya akan berhadapan dengan tuan rumah Muara Tapanuli Utara dalam ulangan final tahun lalu. “Target kita tidak hanya menjuarai turnamen tahun ini, tetapi juga tahun depan. Tar-

get kita adalah tiga kali berturutturut, sehingga piala bergilir ini bisa menetap bersama kami,” kata pelatih Rantauprapat FC, Lion Simatupang. Atas prestasi tersebut, Wabup Labuhanbatu Suhari Pane menyambut baik semangat dan target Rantauprapat FC. Suhari mengakui terkesima sekaligus bangga dengan prestasi dan semangat putra daerah di Jakarta. Final akan dilangsungkan pada Sabtu (25/6) di Stadion Gelanggang Olahraga Bojonegoro, Kuningan, Jakarta. (j02)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan hari ini: sangat mudah (*), bisa diselesaikan dalam waktu tak sampai empat menit. Jawabannya lihat di halaman A2 kolom 1.

9

6 9 6 3 8 7 4 2 3

7 9 2 3 7 5 3 9 5 6 4

4 6 3 3 7 7 1 2 6 9 8 8 5 2 9 7 3 2

6

9 8 3 2 7 5 1 4 7 ve209


Sport

A8

SMK Mulia Juara Futsal WEB MEDAN (Waspada): Tim futsal SMK Mulia Medan menjuarai turnamen antar-pelajar Kota Medan memperebutkan trofi bergilirWartawan Ekonomi & Bisnis (WEB) Sumut di Lapangan Terminal Futsal Medan, Minggu (19/6). Gelar juara SMK Mulia diraih setelah menaklukkan SMA Ar Rahman Medan 2-0 di final. Dua gol tim binaan Drs HAE Siregar itu disumbangkan Zulfikar Lubis dan Yusrizal Muzaki masingmasing di menit 15 dan 25. “Ini gelar juara yang sangat kita syukuri, terlebih lawan memberi perlawanan ketat sepanjang laga. Tapi anak-anak mampu mengontrol penampilan sehingga tidak terpancing dengan permainan lawan,” ujar pelatih SMK Mulia, Syahrial. Pada perebutan posisi ketiga, SMAN 1 Medan mengalahkan SMAN 3 Medan 4-3. Kemenangan SMAN 1 tidak diraih dengan mudah, terlebih mereka harus tertinggal 0-2 di babak pertama sebelum akhirnya mencetak empat gol di babak kedua. Sebagai juara, SMK Mulia berhak atas piala bergilir WEB dan piala tetap Bank IndoneAP

Schumi Yakin Podium BERLIN (Waspada): Berkaca dari performa apik Michael Schumacher (foto) di GP Kanada, kubu Mercedes optimistis mampu merebut podium pada GP Valencia, Minggu (26/6) nanti. Schumacher berhasil finish keempat di GP Kanada. Pembalap asal Jerman itu bahkan sempat berada di urutan kedua ketika balapan berlangsung. Terkait hal itu, Schumi optimistis mampu merebut podium di seri balap yang digelar di SirkuitValencia tersebut. “Valencia merupakan salah satu dari balapan yang tak biasa di kalendar musim ini dengan sirkuit jalan raya yang menurut saya sangat atraktif, baik untuk pembalap dan fans,” ungkapnya, Minggu (19/6). “Saya menikmati balapan tahun lalu di sini. Cukup mengejutkan karena sirkuit jalan raya karakternya cukup cepat dan mengalir. Jadi saya sangat menantikan balapan nanti,” sambung legenda hidup F1 ini. “Tentu saja kami berharap bisa menghadirkan pertunjukan yang bagus, tampil dengan kuat, dan menjalani akhir pekan penuh semangat, sebelum melakoni balapan ‘kandang’ di Inggris dan Jerman,” tuntasnya. (m33/auto)

Renault Pakai DRS Baru ENSTONE, Inggris (Waspada): Renault memasang target masuk ke jajaran tiga besar pada balapan di GPValencia akhir pekan nanti. Mereka cukup percaya diri karena kini telah melakukan update pada DRS. Dalam dua balapan terakhir, Renault memang tampil kurang menyakinkan karena maksimal hanya menembus posisi kesembilan. Menghadapi GP Eropa nanti, mereka tetap mengusung optimisme tinggi. “Trek di sana cocok dengan kami. Paling tidak kami akan berjuang merebut posisi di garis depan saat kualifikasi,” kata Ketua Tim, Eric Boullier, Minggu (19/6). “Kami butuh podium untuk bisa mensejajarkan diri dengan tim elit. Itulah prioritas kami saat ini,” tuntas Boullier. (m33/auto)

Waspada/Dedi Riono

TIM futsal SMK Mulia binaan HAE Siregar diabadikan bersama ofisial dan panitia usai menjuarai turnamen antar-pelajar memperebutkan piala bergilir WEB 2011, Minggu (19/6). sia plus dana pembinaan Rp2 juta. SMA Ar_Rahman mendapat dana pembinaan Rp1 juta

serta masing-masing Rp700 ribu dan Rp500 ribu bagi juara III dan IV. (m42)

WASPADA Senin, 20 Juni 2011


Medan Metropolitan Interpelasi Gatot Ditentukan Hari Ini

B1

WASPADA Senin 20 Juni 2011

MEDAN (Waspada): Hak interpelasi yang diwacanakan anggota DPRD Sumut dari berbagai fraksi akan ditentukan hari ini, Senin (20/6), melalui rapat pimpinan dengan pimpinan fraksifraksi. Diperkirakan rapat membahas usulan para anggota dewan untuk menggunakan hak interpelasinya terhadap Plt Gubsu Gatot Pujonugroho akan alot. Karena pada rapat yang sama Kamis pekan lalu, seorangWakil Ketua DPRD Chaidir Ritonga mengatakan, interpelasi merupakan jalan terakhir yang akan ditempuh dewan. Diberitakan sebelumnya, sejumlah anggota dewan mendesak pimpinan dewan untuk melakukan hak interpelasinya terhadap Plt Gubsu. Para anggota dewan dari sembilan fraksi menilai Gatot Pujonugroho telah berlaku sewenang-wenang dalam mengangkat 110 pejabat eselon III di lingkungan Pemprovsu. Hanya anggota dewan dari Fraksi PKS yang tidak meminta interpelasi. Kemarin, Ketua Fraksi Gerindra Bulan Bintang Reformasi Yan Syahrin kepada wartawan mengaku secara resmi telah mengajukan surat ke pimpinan

dewan. Isinya, mendesak untuk menggunakan hak interpelasi terhadap Plt Gubsu. Dia berharap fraksi-fraksi lain juga melakukan hal yang sama. Diakui Yan Syahrin, mengangkat pejabat eselon memang wewenang kepala daerah. Namun harus mengacu PP No.10 tahun 2000 tentang Pengangkatan Pegawai Negeri Sipil dalam jabatan struktural. Tidak seperti yang dilakukan Plt Gubsu sekarang ini. Kesannya sangat semena-mena dengan mengabaikan etika dan Baperjakat. Dia berharap pelaksanaan hak interpelasi itu dapat diputuskan pada rapat pimpinan dewan dengan pimpinan fraksifraksi, karena hampir seluruh fraksi sudah menyetujuinya. ’’Yang saya dengar, Fraksi PAN, PDI Perjuangan, Demokrat, PPRN, PPP, Golkar dan PDS, juga akan melayangkan surat ke pimpinan dewan untuk mengajukan hak interpelasi,’’ katanya. Pendapat senada juga di-

117 Siswa SMK Farmasi YPFSU Dilantik MEDAN (Waspada): Sebanyak 117 siswa SMK Yayasan Pendidikan Farmasi Sumatera Utara (YPFSU) dilantik dan diambil sumpahnya pada acara pelantikan di Hotel Danau Toba Medan, Sabtu (18/6). Pelantikan berlangsung meriah dan lancar. Adapun siswa yang meraih ranking I, yakni Nabila Maharani, ranking II yakni Laili Syafitri, dan ranking III, yakni Irna D.S. Sianipar. Dalam sambutannya, Kepala SDM Dinkes Sumut Jauhari meminta agar anak-anak yang sudah dilantik atau diwisuda tidak cepat puas diri, karena apa yang dihasilkan saat ini adalah awal atau permulaan. Jika pun terpaksa bekerja, lanjut Jauhari, jangan bekerja ditempat yang tidak sesuai dengan profesi kita, hal-hal yang tidak baik jangan diikuti. “Jika pun terpaksa bekerja, modal awal kita bukan wajah cantik dan ketampanan, tetapi kepribadian yaitu akhlak dan senyuman. Dengan senyuman, seseorang yang dilayani merasa nyaman dan senang,” katanya. Kasi Kurikulum SMK Dinas Pendidikan Sumut Zulhanif mengatakan, apa yang diraih saat ini merupakan dasar ke perguruan tinggi, kerja dan wirausaha. “Saya minta agar menjaga citra dan nama baik sekolah,” katanya. Dia juga menerangkan tentang karakter siswa yang menurun, akibatnya siswa tidak mampu memposisikan dirinya sebagai siswa. “Untuk ibu dan bapak guru, saya minta setiap mata pelajaran, untuk menanamkan sikap-sikap karakter kepada siswa,” jelasnya sembari mengatakan, guru harus memperbaiki diri, baru bisa memperbaiki siswa. Sedangkan Dewan Pembina dan Pengawas YPFSU Panangian Siregar meminta agar para siswa untuk berlaku jujur dalam menjalani kehidupan, sebab, kejujuran modal awal membangun bangsa dan negara. (h02)

Waspada/Mursal AI

SEJUMLAH siswa SMK Famasi YPFSU menunggu dilantik dan diambil sumpah di Hotel Danau Toba, Sabtu (18/6).

sampaikan Ketua Fraksi Partai Amanat Nasional (FPAN) Parluhutan Siregar. Kepada Waspada dia mengatakan wajar bila dewan menggunakan hak interpelasinya kepada Plt Gubsu untuk masalah ini. FPAN, kata Parluhutan Siregar, memandang usulan interpelasi yang dilakukan anggota dewan adalah hal yang biasa-biasa saja, yakni untuk mempertanyakan prosedur dari pengangkatan 110 pejabat eselon III tersebut. Dugaan sementara anggota dewan, kata Parluhutan Siregar, pengangkatan para pejabat eselon III tersebut tidak sesuai dengan prosedur yang benar. Sebab, ada pejabat yang baru satu bulan diangkat, sekarang dicopot lagi. ’’Apa benar penilaian kinerja bisa dilakukan satu bulan?’’ katanya.

Parluhutan juga menginformasikan suasana kerja di lingkungan Pemprovsu saat ini yang menurutnya sangat tidak nyaman. Dualisme kepemimpinan masih terasa dengan status Gubsu Syamsul Arifin masih non aktif, sementara wewenang Plt Gubsu sangat terbatas. Sementara itu, F-PDS Marasal Hutasoit secara terpisah kemarin juga mengatakan mayoritas fraksi di legislatif sudah mendukung segera digulirkan hak interpelasi kepada Plt Gubsu. Apalagi Marasal yang juga anggota Komisi A melihat dalam pengangkatan pejabat eselon III, Baperjakat tidak berani memberikan saran maupun masukan kepada Plt Gubsu. Interpelas lemah Pengamat politik dan otonomi daerah dari USU Ridwan Rangkuti mengatakan,

interpelasi DPRDSU terhadap Plt Gubsu tidak jelas substansinya. Untuk itu secara politik dapat dikatakan lemah dan tidak maksimal. Lemahnya hak interpelasi itu mengacu kepada UU No 32 tahun 2004 tentang Pemerintahan Daerah, dimana legislatif bagian dari eksekutif sehingga sulit melakukan pengawasan yang ekstra seperti yang dilakukan DPR terhadap presiden. Berbeda pada saat pemberlakuan UU No 22/1999, banyak kepala daerah diberhentikan oleh DPRD melalui hak yang dimiliki legislatif. Ridwan pesimis hak interpelasi dapat menggoyang Gatot, karena secara politik dan peraturan tidak mendukung legislatif maksimal menjalankan hak interpelasi tersebut. (m12/ m22/m13)

Evaluasi Perwal Kepling MEDAN (Waspada): Komisi A DPRD Medan merekomendasikan Pemko untuk mengevaluasi Peraturan Walikota (Perwal) No.5 tahun 2010. Mereka juga minta Camat Medan Maimun untuk menganulir pemberhentian 22 Kepling yang berusia di atas 60 tahun. Rekomendasi itu dikeluarkan Komisi A dalam rapat dengar pendapat dengan Camat Medan Maimun Said Reza, di gedung dewan, kemarin, rapat dilaksanakan setelah dewan menerima keluhan 22 Kepling yang merasa diberhentikan semena-mena. Rapat dengar pendapat dipimpin Ketua Komisi A DPRD Medan Irhamsyah. Selain camat Medan Maimun, hadir juga Lurah Sukaraja Siswoyo dan Lurah Jati Mismi Zein. Personel Komisi A yang hadir Surianda Lubis, Burhanuddin Sitepu, Aripay Tambunan, Damai Yona Nainggolan, Porman Naibaho, Abdul Rani, Parlindungan

Sianipar, dan Janlie. Camat Medan Maimun Said Reza membantah disebutkan memberhentikan 22 Kepling secara semena-mena. Katanya, pemberhentian itu merupakan amanat Perwal No.5 tahun 2010 tentang pengangkatan Kepling di Kota Medan. Salah satu isinya adalah pembatasan usia Kepling sampai 60 tahun. Disebutkan Reza, terhitung 31 Maret 2011, seluruh SK Kepling di Kecamatan Medan Maimun berakhir. Sesuai ketentuan, setiap dua tahun sekali SK Kepling diperbaharui. Mereka yang dinilai masih cakap dan mampu bekerja baik, masih dipercaya memegang jabatan itu dengan penerbitan SK baru. Terhadap ke 22 dan 66 orang Kepling di kecamatan itu, sambung Reza, tidak lagi diperpanjang surat tugasnya karena terkena peraturan yang ada dalam Perwal. Usia mereka sudah di atas 60 tahun. Dalam proses penggantian

para Kepling, ujar Reza, tidak dilakukan sembarangan. Camat menetapkan syarat harus ada rekomendasi dari lurah yang didasari atas usulan dari Kepling yang digantikan. “Karena itu, beberapa dari kepling itu digantikan anaknya sendiri,” katanya. Namun anggota dewan tetap memandang kalau pemberhentian itu tidak manusiawi. Anggota dewan Burhanuddin Sitepu menganggap camat menggunakan Perwal itu sebagai alat kesewenang-wenangan. Dia juga menilai bahwa Perwal itu bentuk keegoisan Pemko Medan. Sementara itu, anggota Komisi A lainnya Aripay Tambunan meminta camat tidak mengukur kinerja Kepling dari umurnya. Usia 65 tahun sekalipun bila dia merupakan tokoh masyarakat dan bekerja baik, harusnya tetap dipertahankan untuk menjaga kenyamanan di lingkungan. (m12)

Pemprovsu–JICA Kurangi Gas Rumah Kaca MEDAN (Waspada): Pemprovsu melalui Badan Perencana Pembangunan Daerah (Beppeda) bersama tim ahli dari Japan International Cooperation Agency (JICA) akan menyusun sebuah rekomendasi untuk upaya pengurangan gas rumah kaca (GRK) atau CO2, yang telah menyebabkan peningkatan suhu global. Rekomendasi yang ditargetkan rampung tahun 2012 nanti diharapkan menjadi panduan bagi seluruh provinsi di tanah air dalam upaya penyusunan Rencana Aksi Daerah (RAD) mitigasi dan adaptasi perubahan iklim (climate change), khususnya terhadap sektor usaha perkebunan sawit, karet dan industri pengolahan sampah atau limbah domestik. Menurut Ketua Bappeda Sumut Riadil Akhir Lubis dalam workshop on RAD GRK di Hotel Arya Duta Medan, Senin (13/

6), proyek dengan dana hibah Jepang itu merupakan bagian dari upaya Pemerintah RI yang secara internasional berkomitmen menurunkan GRK sebesar 26% menjelang 2020 dengan upaya sendiri dan sebesar 41% apabila mendapat bantuan negara lain. “Rekomendasi yang dihasilkan nantinya juga bertujuan untuk mengurangi dampak bencana alam dan berbagai penyakit,” kata Riadil. Dijelaskannya, rekomendasi yang mendapat asistensi tim ahli JICA itu nantinya tidak hanya menjadi panduan dalam upaya pengurangan GRK di tanah air, tetapi juga bisa dijadikan argumen untuk mengubah regulasi atau membuat regulasi baruyangimplementasinyalebih berwawasan lingkungan hidup. Dalam workshop yang dihadiri Mr Osamu Isada (Deputy Team Leader of JICA Expert Team), DR Ir Zahari Zein (USU),

Dr KazuhitoYamada (JICA Expert for Climate Change Policy and NAMA & MRV), Mr Riga Anggarendra (Project Assistant of JICA Team), Dr Mariko Fujimori (JICA) Expert for Climate Change Policy and Adaptation Measure) itu, Riadil mengatakan, Provinsi Sumatera Utara juga ditetapkan sebagai lokasi pilot proyek pengembangan kapasitas strategi perubahan iklim di Indonesia. Riadil merincikan, dipilihnya Sumut sebagai salah satu provinsi untuk proyek ini, karena kontribusi 135 Pabrik Kelapa Sawit (PKS) yang memproduksi 5.207.161 ton Crude Palm Oil (CPO)telahmenghasilkan190juta gas metan (CH4). Selainitukontribusidari1.500 industri yang ada tidak hanya menghasilkan GRK tetapi juga memunculkanpotensiterjadinya hujan asam.“Indikasi ini terdapat di sekitar lokasi kawasan Industri Mabar (KIM),” ujarnya. (m28)

Menelusuri Aktivitas Masinis (3-Habis) MELAKONI profesi sebagai masinis selama 21 tahun membuat Sugito, 52, hidup tenang. Bukan karena gaji yang lumayan, tetapi tanggung jawab nyawa penumpang di tangannya benar-benar dijalankan dengan penuh kenikmatan. “Semua profesi punya kendala dan masalah, tapi tergantung bagaimana kita menanggapi dan menjalankannya,” ungkap Sugito, 52, masinis KA Ekonomi kepada Waspada, Senin lalu, ketika seharian mengikuti perjalanan KA itu dari Medan ke Tebing Tinggi. Tujuh jam perjalanan paling jauh Medan menuju Rantau Parapat atau dua jam dari Tebing Tinggi menuju Medan atau kemana pun itu rute yang telah ditentukan akan dia jalankan dengan semangat. “Saya sudah sangat menyatu dan menikmati profesi ini sejak tahun 1990, siang atau malam atau tengah malam juga harus saya kerjakan dengan konsentrasi,” ujarnya. Dia mencintai profesinya bukan hanya karena gaji yang terbilang lumayan, tapi syukur yang sangat besar karena Tuhan memberinya pekerjaan di saat dia membutuhkannya. Sementara dulu saingan waktu zaman dia mendaftar juga banyak. Terlebih untuk sekarang ini semakin banyak peminat pegawai

PT Kereta Api dengan dilihatnya berjubel lamaran yang masuk kemarin ketika PT KA menerima lowongan sebanyak enam ribuan pelamar, sedangkan yang diterima hanya seratusan saja. “Alhamdulillah sekarang saya sudah golongan tiga a (IIIared) mendapatkan gaji pokok sebesar Rp3,9 juta dan uang premi atau uang jalan rata-rata Rp1,3 juta per bulan,” ungkapnya. Sementara Buchori, 20, pegawai magang KA yang baru masuk akhir tahun 2009 menuturkan, dia pun punya keinginan untuk menjadi masinis, namun sesuatu yang telah diraih masinis golongan IIIa seperti Sugito tidaklah mudah diraih dengan dadakan atau kilat. Pasalnya, harus melewati beberapa tahapan dan proses untuk menjadi seseorang yang berpengalaman dan mapan di bidang KA. “Untuk menjadi masinis, seseorang harus melewati beberapa tahapan mulai dari pendidikan fungsional masinis, pembekalan di Dipo atau bengkel lokomotif, ikut jalan-jalan mengenal lintas jalan, kemudian jadi asisten masinis hingga akhirnya pantas jadi masinis setelah melewati proses sesuai masa kerja selama 4 tahun, golongan IIa dulu baru IIIa,” tuturnya. Sementara itu, U. Silaban, bagian tata usaha yang berkan-

tor di Stasiun KA Tebing Tinggi mengungkapkan gaji masinis tidak berhenti pada gaji pokok dan uang jalan saja, tetapi masih ada tunjangan masinis Rp275 ribu perbulan dan tunjangan risiko Rp720 perbulan. Mereka diberi uang jerih payah berbeda dengan pegawai tata usaha seperti dia, hanya mendapat gaji Rp3,9 juta perbulan tanpa uang

jalan dan tunjangan. “Tapi saya sangat memuji profesi masinis. Jadi, layaklah dilayani bak tuan raja, ada mes ruang istirahat lengkap dengan akomodasi makan minum gratis. Jika mau ambil uang jalan tinggal bilang dan saya langsung berikan jam berapa pun itu,” ungkapnya. Tapi apa yang masinis dapatkan patut dikutip pelajaran

MASINIS KA Ekonomi Sugito.

bahwa tidak ada yang tanpa proses untuk mendapatkan sesuatu, janganlah melihat masinis dari apa yang dikerjakannya tinggal mengendalikan kemudi dan duduk manis di depan, tapi lihatlah tanggung jawabnya yang memikul ratusan nyawa di pundaknya ketika mengemudi KA. * Silfa Humairah

Waspada/Hamdani

Waspada/Hang Tuah J Said

KETUA STIK-P Medan, Hj Ida Tumengkol Bcomm MHum (kanan), menyerahkan cenderamata kepada Kabiro Metro TV Biro Medan-Aceh,Yuda Panjaitan, dalam acara Workshop Jurnalistik di aula kampus tersebut, Jl SM Raja Medan, Sabtu (18/6).

Dunia Televisi Itu Tidak Mudah Workshop Jurnalistik Di STIK-P MEDAN (Waspada): Televisi itu sebenarnya tidak indah dan tidak gampang seperti yang dipikirkan banyak orang selama ini karena masyarakat hanya melihat hasil sempurna di televisi, tapi di belakangnya perlu kerja keras tim untuk menampilkan gambar tersebut. Demikian disampaikan Yuda Panjaitan dalam ceramahnya dalam “Workshop Jurnalistik, Learning TV Broadcast” yang digelar Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan di aula kampus tersebut, Jl SM Raja, Sabtu (18/6). “Media televisi merupakan media yang kompleks. Tidak seperti radio atau media cetak, pemirsa harus bergulat dengan gambar yang bergerak cepat dan suara sebagai tambahan bagi informasi faktual yang disampaikan,” tambah Kabiro Metro TV Biro Medan-Aceh di hadapan peserta. Yuda menambahkan sangat penting bagi jurnalis televisi menghindari pembebanan yang lebih berat melalui bahasa rumit atau voice over yang terlalu banyak. Selama sehari penuh, mahasiswa dibekali materi pelatihan yang disampaikan narasumber seperti Yuda, Adli Hakim (Reporter Metro TV), Usrizal P (Cameraman Metro TV), dan Putri Bakri (dosen Broadcasting di STIK-P). Pada kesempatan itu, Adli menjelaskan cara dan tugas menjadi reporter televisi mulai dari mengumpulkan data di lapangan, wawancara hingga harus mampu menulis naskah berita. “Seorang reporter TV itu harus mampu

mengamati langsung sebuah peristiwa, menentukan sasaran observasi, peka terhadap keadaan, faktual/objektif, detail, dan yang terpenting dapat mendeskripsikan suatu peristiwa bukan menafsirkannya,” ujar Adli. Sementara itu, Usrizal menerangkan teknik mengambil gambar seperti Low Angle, Eye Level, dan High Angle sekaligus menjelaskan tugas cameraman yang harus bertanggung jawab menjaga kamera dalam peliputan. Sebelumnya, Putri Bakrie menerangkan TV Broadcast, jenis media massa beserta fungsinya, pembuatan dan jenis naskah berita televisi. Dikatakan, seorang reporter harus berdedikasi tinggi, tidak mementingkan liputannya saja, tapi juga peduli dengan sisi kemanusiaan. “Contohnya saja ketika meliput sebuah daerah yang terkena bencana alam, maka reporter juga turut membantu korban tidak hanya melakukan peliputan saja,” pungkas mantan reporter Metro TV itu. Dalam kegiatan itu, peserta pun merasakan menjadi presenter televisi dengan menyampaikan naskah berita yang disiapkan panitia. Panitia juga mengumumkan peserta terbaik yang diraih Rahmat Ilahi Siregar dari Pesantren Ar-Raudhatul Hasanah. Penutupan kegiatan workshop tersebut ditandai penyerahan cenderamata dari Ketua STIK-P Hj Ida Tumengkol BComm MHum didampingi Puket III Austin Antariksa SSos kepada ketiga narasumber yang diterima Yuda Panjaitan. (m33/arianda)

Peduli Terhadap Peran Veteran MEDAN (Waspada): Pemerintah Provinsi Sumatera Utara (Pemprovsu) menyatakan komit memperhatikan veteran di Sumut. Hal ini tidak terlepas dari peran besar para veteran dalam perjuangan kemerdekaan di masa lalu. PLt Gubsu Gatot Pujonugroho menyatakan hal ini saat menerima audiensi Legiun Veteran Republik Indonesia (LVRI) Sumut, di Lantai 9 Kantor Gubsu, Jalan Diponegoro Medan, Selasa (14/6). “Komitmen perhatikan Waspada/Amir Syarifuddin veteran tersebut akan terus PLT Gubsu Gatot Pujonugroho menerima audiensi pengurus menjadi fokus kami untuk terus mendorong kontribusi LVRI Sumut. para veteran di masa sekarang ini, tentunya veteran sesuai dengan semangat membangun kontribusi terbesar telah ditujukkan saat Sumut lebih baik di masa kemerdekaan saat ini. Wakil Ketua I LVRI Sumut, M Rizan pada perjuangan kemerdekaan dulu,” kata Gatot. Dalam kesempatan tersebut, Gatot juga kesempatan tersebut mengungkapkan meminta agar para veteran terus mengingatkan dukungan veteran terhadap kepemimpinan dirinya dan Pemprovsu dalam setiap kinerja yang Gatot yang juga anak dari seorang veteran. dilaksanakan dalam mengemban amanah Dalam audiensi tersebut hadir juga pengurus masyarakat Sumut saat ini. Hal ini, katanya, akan LVRI Sumut lainnya seperti Ketua LVRI Sumut menjadi masukan yang sangat berarti jika sean- Rhinokusyanto, H Trisno Marjunet, Bucharfi dainya motivasi itu terus menerus diberikan para AS dan Muhammad TWH.(m28)

Tim Pemekaran Medan Utara Saling Klaim BELAWAN (Waspada): Tim Pemrakarsa Pemekaran Medan Utara saling klaim pada posisi yang benar. Misalnya, Awaluddin alias Awel, satu dari tiga orang yang dikeluarkan dari Tim 17 Pemerakarsa Pemekaran Medan Utara, kemarin, menegaskan sikap yang dikeluarkan sejumlah inisiator Tim 17 di Siombak, Kelurahan Paya Pasir, Kecamatan Medan Marelan, Selasa (15/6), termasuk mengeluarkan dirinya dari Tim 17, kata Awel, tidak sesuai prosedur karena dilakukan tanpa surat undangan dari ketua tim Pemrakarsa Pemekaran Medan Utara. “Rotasinya saat ini saya ketua. Namun undangan untuk mengambil sikap itu tidak ada saya keluarkan. Jadi, sikap itu merupakan sikap pribadi yang bukan merupakan sikap Tim 17,” jelasnya. Awel menyayangkan sikap teman-teman-

nya yang terlalu gegabah melakukan pertemuan dengan wartawan mengenai peryataan sikap tersebut. “Alangkah lebih dewasa jika sikap itu diucapkan dalam rapat pleno Tim 17 agar seluruh tim tahu,” tambahnya. Dia mengakui, tugas yang diemban dirinya bersama delapan temannya yang merupakan Pokja Tim 9 adalah mencari, menyaring dan mengangkat calon ketua Panitia Pemekaran Medan Utara. Sebelumnya, akibat dinilai bekerja tidak sesuai prosedur dalam mengambil keputusan menentukan ketua panitia pemekaran Medan Utara, sejumlah inisiator tim Pemrakarsa Pemrakarsa Medan Utara mengeluarkan tiga orang anggotanya dari tim, yakni Awaluddin, Johan Arifin AA dan Zulkifli Syahdan. (h03)


Medan Metropolitan

B2

WASPADA Senin 20 Juni 2011

Pendaftar Kecewa PSB SMAN 1 Ditutup MEDAN (Waspada): Ketidaktransparan SMAN 1 Medan dan sekolah lain soal pendaftaran dan penutupan penerimaan siswa baru, membuat masyarakat kecewa dan pupus harapan mendaftarkan anaknya ke sekolah yang dimaksud. Seperti yang dirasakan Susi, warga Pasar VIII Tembung yang terkejut mendengar pendaftaran siswa baru di SMAN 1 telah ditutup sebulan lalu, sementara SKHUN anaknya dari bangku SMP baru saja keluar. Hal yang sama juga diungkapkan Febria, 14, siswa yang baru menamatkan MTsN 2 Medan. Menurutnya, sejak Mei yang lalu telah mendengar pe-

nutupan penerimaan siswa baru di SMAN 1 dari teman-temannya yang ditolak ketika mengajukan pendaftaran. “Keinginan saya untuk masuk ke SMAN 1 pupus sudah, padahal SKHUN belum keluar. Aneh juga sih pendaftar yang mendaftarkan diri menggunakan apa, jika SKHUN saja belum keluar, memang beberapa sekolah sudah mengeluarkan

Seminar Meraih Peluang Di STINDO MEDAN (Waspada): Dalam seminar bertajuk “Kiat Sukses Mencari Peluang” yang diselenggarakan kelompok mahasiswa STIE Indonesia ( STINDO ), minggu lalu, menyimpulkan agar seseorang berhasil dalam hidupnya harus berani menghadapi tantangan dan berani tampil beda. Kesimpulan itu disampaikan moderator seminar Ny.Lily pada seminar sehari yang mengadirkan pembicara dari praktisi marketing dan entrepreneurship Asri Liu, Ketua Badan Kehormatan DPRD Medan Janlie dan konsultan artis penyanyi nasional Hansen Teo, bertempat di aula Kampus Stindo Jalan Perbaungan Medan. Pembicara pertama, Asri Liu menyampaikan seseorang harus menyadari apa yang ditabur itulah yang dituai, tetap berani dalam menghadapi tantangan, iklas dan bersyukur saat mengerjakan visinya. Asri Liu yang dikenal sebagai seorang praktisi dunia marketing, menilai untuk dapat menjadi pribadi yang luar biasa, seseorang itu harus mempunyai nilai yang disebutnya dengan RESULTS ( Relation, Excellence, Stewardship, Unity, Loyalty,Teachability dan Spirit). Hansen Teo turut memaparkan beberapa kisah hidupnya yang dinilai cukup membentuk keberadaannya hari ini. Sementara Ketua Badan Kehormatan DPRD Medan Janlie yang tampil sebagai narasumber terakhir, turut membawa suasana seminar tersebut menjadi lebih hangat dan bersemangat. (m22)

Reuni SMPPN 24 Ke Pantai Cermin MEDAN (Waspada): Ikatan Silaturahmi Ajang Temu Kangen (ISATK) SMPPN 24 Medan akan mengadakan pertemuan alumni yang diadakan di Pantai Cermin, Sabtu (2/7) mendatang. Sampai saat ini yang terdaftar sebagai anggota sebanyak 180 orang. Mulai dari alumni 1978 sampai dengan 1985. Hal itu disampaikan Syahrizal Lubis dan Sekretaris ISATK Asih Subiantoro di Medan, Jumat (17/6). Pertemuan ISATK dibentuk tahun 2009 dan dilakukan setiap 6 bulan sekali untuk menyambung kembali tali silaturahmi yang sempat terputus dan semakin mengukuhkan para anggotanya menjadi suatu ikatan persaudaraan SMPPN 24 yang kompak dan solid. Bagi teman-teman alumni yang berminat silakan mendaftar ke Abdul Hamid (08126531966), Taufik Hakim (08126307503), Ismanto Ismail (081396714031), dan Khairul Ilham (081263888038) dan Eko (085261356). (csf)

Usut Dana Hibah MEDAN (Waspada): Lembaga Swadaya Masyarakat Komisi Peduli Keadilan (LSM KPK) Sumut mendesak Kejatisu untuk mengusut dugaan penyelewengan dana hibah di salah satu Perguruan Tinggi Swasta (PTS) dan dana hibah Dikti, yang melibatkan oknum-oknum pejabat di Kopertis Wilayah I. ”Saya minta Kejatisu untuk mengusut tuntas dugaan korupsi dana hibah itu, yang jumlahnya mencapai miliaran rupiah,” kata ketua Komisi itu, Ferdinand Ghodang, kepada wartawan saat ditemui di Bandara Polonia Medan, Minggu (12/6). Menurut Ghodang, dugaan korupsi itu dilakukan dengan rapi bekerjasama dengan PTS dan pihak yayasan perguruan yang bersangkutan. Bahkan, dari informasi yang diperoleh dugaan korupsi dana hibah 2010 itu sudah berlangsung lama dan terorganisir. Sebelumnya, pihak Kejatisu telah beberapa kali memanggil untuk penyelidikan pejabat terkait oknum di Kopertis Wilayah 1, namun sampai saat ini mandek. (m32)

SKHUN. Jadi, mereka punya kesempatan itu sedangkan kami tidak,” ungkapnya kepada Waspada, kemarin. Disesalkan lagi, tidak ada sosialisasi ke publik kalau SMAN 1 menerapkan kebijakan tersebut. Menurutnya, tidak mungkin pemerintah mendiskriminasikan anak bangsa yang ingin mengenyam pendidikan yang berkualitas. Dan, pendidikan berkualitas bukan hanya untuk anak pejabat dan orang-orang yang berduit tetapi dapat dinikmati semua masyarakat. Sementara itu, salah seorang pimpinan di sebuah SMKN negeri di Medan mengungkapkan penutupan pendaftaran lebih dulu di SMAN 1 dan lainnya, meski Rintisan Sekolah Bertaraf Internasional (RSBI), dianggap diskriminasi dan seperti terlalu melebihkan SMAN 1 dibandingkan sekolah lainnya. Padahal seharusnya semua sekolah negeri disamakan. “Sehingga sekolah seperti kami ini hanya menerima siswa sisa saja yang tidak masuk ke sana,” ungkapnya, Kamis (16/6).

Dia menambahkan sekolah yang telah menutup pendaftaran bukan hanya SMAN 1 Medan saja, tapi SMKN 1 Percut Seituan juga telah menutup pendaftaran penerimaan siswa baru kemarin, Sehingga semua siswa berprestasi sudah mereka kantongi, penyeleksian siswa telah mereka lakukan. Sementara di SMK 2 baru akan membuka pendaftaran 22 Juni. “Padahal kami juga berkeinginan membuka pendaftaran lebih awal seperti mereka. Tapi SMK 2 dihalang-halangi,” ungkapnya. Menanggapi hal itu, Kepala Sekolah RSBI SMAN 1 Medan Rebekka Girsang menyebutkan pelaksanaan Penerimaan Siswa Baru (PSB) di sekolahnya sesuai dengan mekanisme dan peraturan yang berlaku. Bahkan dari ketentuan sekolahnya harus memberikan beasiswa atau belajar secara gratis kepada peserta didik kurang mampu juga telah dilakukan. Rebekka beralasan pelaksanaan PSB yang lebih cepat dari penerbitan SKHUN SMP sesuai

dengan Undang-Undang dan peraturan termasuk SK Walikota Medan No /360.K/2010 tanggal 26 Maret 2010 tentang Prosedur Penerimaan Peserta Didik Baru (PPDB) sebagai RSBI. Bahkan Rebekka mengaku PSB untuk tahun ajaran 2011/ 2012 melalui mekanisme yang dilalui oleh pendaftar seperti seleksi administratif meliputi nilai rapor SMP/MTs Kelas VII s.d IX (semester 1 s.d 5) untuk mata pelajaran Bahasa Indonesia, Bahasa Inggris, Matematika, IPA, IPS masing-masing mempunyai nilai rata-rata minimal 7,50, fotokopi rapor semester 1 s.d 5 yang dilegalisir oleh Kepala Sekolah sebanyak 1 set dan menunjukkan rapor asli seperti surat keterangan telah mengikuti UN dan US SMP/ MTs TP. 2010/2011 dll. Bahkan menurutnya, dalam pelaksanaan RSBI, pihaknya memberikan kuota bagi masyarakat miskin namun dia tidak merinci berapa banyak siswa miskin yang ditampung dan mendapat dana bantuan pembelajaran secara gratis. (csf/m37)

Pemko Tak Mundur Bersihkan Ternak Babi Sebelum Ramadhan Sudah Tuntas MEDAN (Waspada): Pemko Medan tidak akan mundur untuk membersihkan ternak babi di Kota Medan. Kepala Dinas Pertanian dan Kelautan Pemko Medan Wahid, kemarin, mengatakan, penertiban ternak kaki empat tersebut akan dilakukan di tiga kecamatan, yakni Medan Labuhan, Belawan dan Denai setelah 1 Juli 2011 Alasan penertiban setelah 1 Juli karena saat ini Pemko fokus pada peringatan HUT Kota Medan ke-421 yang jatuh pada 1 Juli ini. Tidak mungkin konsentrasi itu terpecah dan HUT Kota Medan diwarnai dengan hal-hal yang tidak diinginkan. Selain itu, Walikota Medan Rahudman Harahap juga sudah menargetkan sebelum puasa ternak kaki empat ini sudah kosong. “Ada waktu tiga minggu untuk melakukan persiapan penertiban. Jadi, ini akan kami manfaatkan. Kalau sekarang

semua pihak konsentrasi pada persiapan HUT Kota Medan,” katanya. Menurut Wahid, pihaknya tidak akan mundur dan siap menghadapi risiko yang terjadi. Mereka tidak mau lagi gagal untuk kesekian kalinya. Sebab, bila gagal tentunya persiapan waktu tiga minggu akan percuma. “Mana mau kami mundur lagi. Kami sudah siap menghadapi risikonya. Makanya semua disiapkan dengan matang,” bebernya. Namun,Wahid tidak menjelaskan secara rinci apakah penertiban ini serentak dilakukan atau per kecamatan. Dia hanya mengatakan, penertiban akan dilakukan di tiga kecamatan itu. Sebab, di tiga kecamatan itu populasi ternak kaki empat masih banyak. “Konsentrasinya di tiga kecamatan itu. Tekhnisnya kami siapkan dululah. Intinya kami sudah siap melakukan pengosongan,” pungkasnya. Secara terpisah, Kepala

Satuan Polisi Pamong Praja (Satpol PP) Kota Medan Kriswan mengharapkan Dinas Pertanian dan Kelautan benar-benar melakukan sosialisasi penertiban ternak kaki empat di tiga kecamatan (Belawan, Labuhan, Denai). Diharapkan semua peternak menerima bantuan biaya transportasi untuk pemindahan ternak. Dengan begitu tidak ada alasan untuk tidak mengetahui adanya rencana pengosongan atau penertiban ternak kaki empat. Walaupun peternak tidak mau bersedia pindah tidak bisa mengelak lagi, sebab sudah ada pemberitahuan dan terkait perda. “Selama ini mereka bertahan dengan memanfaatkan celah sedikit pun. Salah satunya tidak ada sosialisasi dilakukan dan tidak ada bantuan transportasi. Kalau sudah dilakukan tidak ada alasan lagi, kami pun tinggal angkat yang tetap bertahan,” ucapnya. (m50)

Hermes Palace Fogging Lingkungan Warga MEDAN (Waspada): Mengantisipasi wabah penyakit demam berdarah dengue (DBD), sebagian lorong dan rumah warga di Jalan Karya Pembangunan, Kelurahan Medan Polonia, persisnya Gang E, A dan D dilakukan pengasapan (fogging). “Ini merupakan bentuk kepedulian terhadap masyarakat, khususnya yang berdiam disekitar kita,” sebut HRD Hermes Place Medan, Edison Sianturi didampingi Executive House Keeper Ramlida dan Chief Security Supratman disela-sela kegiatan itu, Jumat (17/6) pagi. Dijelaskannya, sebelum dilakukan pengasapan, lebih dulu berkoordinasi dengan pihak kelurahan yang menyambut baik pengasapantersebut.“Fogging dilakukanmerupakansalahsatubentuk kepedulian perusahaan kepada masyarakat sekitar. Ini kali pertama dan direncanakan dilakukan berkelanjutan,” terang Edison. Ke depannya, kepedulian dalam bentuk lain akan dilanjutkan dan diupayakan sesuai kebutuhan masyarakat. “Intinya apa yang bisadiberikankepadamasyarakatsekitarakandilakukan,danberharap koordinasi dengan warga tetap bisa berjalan baik,” harapnya. Selain itu, pihaknya juga telah memberi peluang atau lapangan pekerjaan. Terbukti banyak tenaga kerja berasal dari masyarakat sekitar yang bekerja di perusahaan itu. Tentunya ini juga memberi dampak positif bagi peningkatan perekonomian. Seorang warga, Darma menyambut positif adanya pengasapan, karena berdampak positif dan mencegah wabah penyakit DBD. (m27)

Waspada/gito ap

DUA PETUGAS melakukan fogging di Jalan Kar ya Pembangunan, Jumat (17/6), sebagai bentuk kepedulian Hermes Palace terhadap warga sekitar guna mengantisipasi DBD.

Waspada/Ist

DARI KIRI: Head Stakeholder Asian Agri Group Freddy Widjaya, Kababinkum Poldasu Kombes Pol John Hendri, Praktisi Pers H War Djamil, SH, Pembantu Rektor III M Arifin SH MHum, Dekan Fakultas Hukum UMSU, Ketua PWI Cabang Sumut Muhammad Syahrir dan Kepala Pusham Unimed Majda El Muhtaj diabadikan seusai penyerahan penghargaan pada penandatanganan MoU di bidang akademik dirangkai Diskusi Publik “Hak Jawab, Undang-Undang Pers dan Kode Etik Jurnalistik” di Aula Kampus UMSU, Medan, Selasa (14/6).

PWI- UMSU Jalin Kerjasama Akademik MEDAN (Waspada): Persatuan Wartawan Indonesia Cabang Sumatera Utara (PWI Sumut) dan Fakultas Hukum Universitas Muhammadiyah Sumatera Utara (UMSU) menandatangani naskah kerjasama (memorandum of understanding-MoU) di bidang akademik. Acara diawali kegiatan Diskusi Publik Hak Jawab, Undang-Undang Pers dan Kode Etik Jurnalistik atas dukungan Asian Agri Group. Penandatanganan naskah kerjasama dilakukan Dekan Fakultas Hukum UMSU FaridWajdi dan Ketua PWI Cabang Sumut Muhammad Syahrir disaksikan Rektor UMSU diwakili Pembantu Rektor III M Arifin, Kapolda Sumut diwakili Kababinkum Kombes Pol John Hendri, unsur Pengurus PWI Cabang Sumut serta manajemen Asian Agri Group diwakili Head Stakeholder Freddy Widjaya dan Humas Lidia Veronika di Aula Kampus UMSU Jalan Mukhtar Basri Medan, Selasa (14/6).

Butir-butir MoU yang disepakati antara lain mencakup kerjasama di bidang pendidikan, jurnalisme dan informasi berdasarkan kepakaran yang ada dari kedua belah pihak. Pembantu Rektor III M Arifin Dekan Fakultas Hukum UMSU maupun Ketua PWI Cabang Sumut Muhammad Syahrir dalam sambutannya menyampaikan ucapan syukur kepada Yang Maha Kuasa atas terjalinnya kerjasama tersebut. Dan secara khusus menyampaikan ter imakasih atas dukungan Asian Agri Group yang mengawali kerjasama dengan menggelar kegiatan diskusi publik. Sementara Head Stakeholder Asian Agri Group Freddy Widjaya menyambut positif kerjasama yang terjalin. Hak jawab Praktisi Pers War Djamil, salah seorang pembicara dalam diskusi menegaskan, UU No.40 Tahun 1999 tentang Pers maupun Kode Etik Jurnalistik (KEJ) yang ditetapkan berdasarkan

SK Dewan Pers memberi ruang kepada seseorang atau kelompok orang untuk memberikan tanggapan atau sanggahan terhadap pemberitaan yang disebut Hak Jawab. Namun idealnya, menurut War Djamil, ketika Hak Jawab telah disahuti media massa semestinya tidak lagi disertai melakukan gugatan pencemaran nama baik ke pengadilan atas dasar KUHP. Di lain sisi, Kepala Pusat Studi Hak Asasi Manusia (Pusham) Universitas Negeri Medan Majda El Muhtaj yang juga tampil sebagai pembicara mengupas tentang jurnalisme berbasis HAM. Menurutnya, ada empat langkah yang perlu dilakukan antara lain dibutuhkan komitmen yang teruji dari penegak hukum untuk tunduk pada mekanisme penyelesaian berbasis HAM jurnalis. Selain itu, perlunya penguatan kelembagaan pers dan insan pers dalam memperkuat profesi jurnalis berbasis HAM. (m08)

Waspada/Surya Efendi

ANGKOT MENUMPUK: Sejumlah angkutan kota (angkot) ngetem dan menumpuk di inti kota, salah satunya di depan Medan Plaza Jalan Iskandar Muda Medan, Kamis (16/6). Keberadaan angkot-angkot ini membuat lalu lintas macat di lokasi tersebut. Sudah selayaknya Pemko Medan menerapkan angkutan massal dan mengalihkan operasional angkot ke pinggiran kota.

Mukerwil PPP, 70 Persen Politik Eksternal MEDAN (Waspada): Hasil Musyawarah Kerja Wilayah I DPW PPP Sumut yang berlangsung 3 hari yakni, Jumat (17/6) – Minggu (19/6), di Asrama Haji Medan, menghasilkan 70 persen sikap politik eksternal dan tiga 30 persen sikap politik internal. Hal ini dikarenakan PPP Sumut ingin langsung melayani umat dan mengambil posisi yang tegas untuk umat. Sikap poltik eksternal yang dihasilkan yakni, PPP Sumut meminta Pemrovsu untuk tetap komitmen dalam menjalankan programprogram kerakyatan dan pemerataan pembangunan. PPP Sumut juga meminta Pemprovsu untuk melaksanakan program-program yang diarahkan pada penguatan pembangunan pedesaan dan kawasan pesisir. “Kalau pedesaan dan kawasan pesisir itu menjadi sangat pesat, maka muara akhirnya adalah kota. Maksudnya, memperkuat desa, sama dengan memperkuat kota, karena jika desa dan pesisir pesat akan memberikan dampak langsung bagi pertumbuhan kota. Untuk itu, konsep pembangunan yang konkrit harus bertumpu di desa dan pesisir seperti akses pendidikan, kesehatan dan infrastuktur.” Hal ini diungkapkan Ketua DPW PPP Sumut Fadly Nurzal didampingi Sekretaris Yulizar Parlagutan Lubis bersama pengurus lainnya saat temu pers di Asrama Haji Medan, Minggu (19/6) siang. Fadly menuturkan, dari hasil Mukerwil ini

juga DPW PPP Sumut juga menolak berbagai bentuk politik pragmatis dan bentuk politik yang transaksional, karena dapat merusak tatanan demokrasi. DPW PPP Sumut juga meminta kepada Mendiknas untuk meninjau ulang UN yang menjadi syarat kelulusan siswa. Menurut Fadly, agar tidak terjadi bentuk kemunafikan dalam ranah pendidikan dan melahirkan siswa-siswa dari hasil kemunafikan tersebut, maka UN harus ditinjau ulang. “Cukup UN sebagai alat ukur, tetapi bukan syarat kelulusan. PPP Sumut juga memberikan apresiasi kepada ibu Siami Surabaya yang memperjuangkan kejujuran dalam penyelenggaraan UN,” kata Fadly. Sedangkan sikap politik internal PPP Sumut antara lain, PPP Sumut tetap komit dan solid untuk mendukung Surya Darma Ali (SDA) agar terpilih kembali menjadi Ketua Umum PPP pada muktamar nanti. “PPP juga mendorong dan mencalonkan kader-kader terbaik PPP sebagai Gubernur Sumut periode 2013 -2018 nanti, DPW akan menyiapkan survey kepada masyarakat terhadap kader-kader PPP nanti, awal 2012 sudah bias dilihat siapa kader tersebut,” kata Fadly. Dalam kesempatan tersebut, PPP Sumut juga berharap Syamsul Arifin bebas dari jeratan hukum. “Pada inkrach nanti, kita inginnya Pak Syamsul keluarnya bersih dan kembali memimpin Sumut ini,” tegas Fadly. (h02)

Pertemuan Tokoh Agama Dengan Panglima TNI-Kapolri

FUI Sesalkan Perobohan Masjid Al-Ikhlas Tak Disinggung MEDAN (Waspada): Pengurus Forum Umat Islam (FUI) Sumatera Utara menyesali pertemuan antara warga Medan dan tokoh agama/ masyarakat dan pemuda dengan Kapolri dan Panglima TNI di Medan Kamis malam lalu. Pasalnya, pertemuan itu tidak sedikit pun menyinggung masalah perobohan Masjid AlIkhlas, padahal isu tersebut adalah masalah nasional dan menyangkut kondusifitas di Sumatera Utara. “Terus terang, saya menyesali sikap perwakilan tokoh agama Islam yang hadir dalam acara tersebut tidak menyampaikan permasalahan perobohan Masjid Al-Ikhlas kepada Kapolri atau Panglima TNI. Seharusnya, kasus Masjid Al-Ikhlas disampaikan kepada Panglima TNI karena menyangkut domainnya TNI,” tegas ustadz Indra Suheiri kepada Waspada, Jumat (17/6). Menurut ustadz Indra Suheiri, meskipun pihaknya dari kalangan Ormas Islam yang tidak diundang, namun seharusnya dua perwakilan Ormas Islam yang diundang dalam pertemuan tersebut bisa menyampaikan masalah perobohan Masjid Al-Ikhlas kepada Panglima TNI dan tidak hanya bersikap mendengar ceramah seremonial, apalagi hanya mendengar kata sambutan dari petinggi TNI-Polri bahwa situasi di Sumut kondusif. “Seharusnya perwakilan Ormas Islam yang diundang itu tidak hanya mendengar kondusifitas antara umat beragama dengan pemerintah

di Sumatera Utara. Tokoh agama Islam yang hadir seharusnya bersuara, melaporkan situasi pasca perobohan Masjid Al-Ikhlas,” tegas Indra Suheiri lagi. Selain itu, tambah Indra Suheiri, tidak adanya sesi tanya jawab atau interaksi dalam pertemuan tersebut diduga sebagai upaya untuk menghindari agar masalah perobohan Masjid Al-Ikhlas tidak sampai didengar oleh petinggi TNI. “Padahal, banyak permasalahan di Medan dan Sumatera Utara khususnya yang harus dilaporkan kepada kedua petinggi itu selama mereka berada di Medan ini sekaligus memberikan berbagai solusinya,” ujarnya. Sementara itu, terkait penurunan spanduk milik Forum Umat Islam yang dipasang di pinggir Jalan Adi Sucipto depan restoran Avia Bandara Polonia Medan, Kamis (16/6) sekira pukul 09.00 buru-buru diturunkan oleh aparat berpakaian preman menjelang kedatangan Kapolri di Bandara Polonia Medan, Indra Suheiri juga menyesali tindakan tersebut. Padahal, tambah Indra Suheiri, spanduk tersebut isinya mengucapkan selamat datang kepada Kapolri di Kota Medan. Namun, sekira pukul 09.00, sejumlah petugas berpakaian preman tiba-tiba saja menurunkan spanduk tersebut tanpa alasan yang jelas. Setelah spanduk diturunkan, beberapa orang yang berasal dari salah satu Ormas Islam tersebut bergegas meninggalkan lokasi depan bandara tersebut. (h04)

131 Dokter FK UISU Dilantik Sementara itu, Dekan FK UISU dr Rahmat MEDAN ( Waspada): Kepala Dinas Pendidikan Sumut Syaiful Syafri mengajak mengatakan, jumlah dokter yang dilantik 131 lulusan dokter untuk senantiasa meningkatkan orang dan lulusan FK saat ini mencapai 2.900 wawasan dengan membaca buku dan sumber alumni. Dokter harus mempersiapkan diri bahan bacaan lainnya yang bermanfaat bagi sebagai pelayan kesehatan primer karena setiap para dokter muda, serta melakukan penelitian dokter melalui sistem asuransi bertanggung jawab atas sekian ribu jiwa. “Semakin sehat dan pengabdian kepada masyarakat. “Selain itu, para dokter juga dituntut masyarakat berarti semakin sedikit orang yang melakukan penelitian terhadap berbagai sakit dalam tanggung jawabnya,” tegasnya. Pada acara tersebut, Herdi Gunarta S.Ked, penyakit, sehingga diharapkan dokter muda memiliki kompetensi. Selama ini dokter sangat putra kedua dari Kadisdiksu Syaiful Syafri berjarang melakukan penelitian yang bersumber hasil memperoleh gelar kesarjanaan di bidang dari alam, udara, makanan dan sumber kedokteran pada Fakultas Kedokteran UISU penyakit lainnya,” kata Syaiful Syafri dalam acara Al-Munawwarah Jalan SM Raja Medan. (m41) Pelantikan Dokter lulusan Fakultas Kedokteran (FK) Universitas Islam Sumatera Utara (UISU) di Hotel JW Marriot Medan, Rabu (15/6). Pelantikan tersebut dilakukan oleh Dekan FK UISU dr. Rahmat Lubis didampingi Pembantu Dekan I Prof. dr. Gusbakti dan turut dihadiri Kadis Kesehatan Sumut diwakili dr. W Minandi, Kadis Kesehatan Binjai dr. Gusnadi, Persatuan Orang Tua Mahasiswa (POMA) FK UISU dr. Mahim Siregar MARS, Pangdam I BB diwakili Mayor TNI Suharto, Kapoldasu diwakili AKBP Waspada/Ist Zahara dan Sugiarto dari KADISDIKSU Syaiful Syafri dan istri berfoto bersama dengan BNN Provinsi Sumut. putra keduanya, Rabu (15/6).


WASPADA Senin 20 Juni 2011

Medan Metropolitan

B3

Polisi Tangkap Pecandu Dan Pengedar SS Saat Gelar Razia Kendaraan Bermotor MEDAN (Waspada): Razia kendaraan bermotor yang digelar Polsek Medan Timur, tidak hanya menjaring para pengendara sepedamotor dan mobil yang tidak memiliki kelengkapan suratsurat. Namun, saat menggelar razia di kawasan Jln. Cemara, Sabtu (18/6) malam sekira pukul 23:00, petugas Polsek Medan Timur berhasil menangkap pecandu dan pengedar sabu-sabu (SS). Informasi yang diperoleh Waspada di lapangan, Minggu (19/6), penangkapan itu bermula ketika petugas Polsek Medan Timur dipimpin Kompol Patar Silalahi dibantu AKP Nimrot Aprwin Simanjuntak menggelar razia rutin di ka-

wasan Jln. Cemara. Saat itu, polisi mengamankan sejumlah sepedamotor karena pengendaranya tidak bisa memperlihatkan Surat Tanda Nomor Kendaran (STNK). Pada saat bersamaan, tersangka ESN, 35, warga Komplek

Perumahan Veteran, Desa Medan Estate, yang mengendarai sepedamotor melintas di Jln. Cemara. Melihat sejumlah polisi sedang menggelar razia, tersangka ESN berbalik arah dan berusaha melarikan diri. Namun berkat kesigapan petugas Reskrim Polsek Medan Timur, tersangka ESN berhasil ditangkap. Ketika hendak digeledah, tersangka ESN mencoba menelan plastik berwana putih. Namun polisi berhasil menggagalkannya dan menyita bungkusan plastik kecil berisi sabusabu. Saat diinterogasi, tersangka ESN mengaku membeli

Waspada/Andi Aria Tirtayasa

KANIT Reskrim Polsek Medan Timur AKP Nimrot Aprwin Simanjuntak (kiri) sedang menyaksikan proses pemeriksaan tersangka pecandu dan pengedar SS, Minggu (19/6) sore.

narkoba tersebut dari tersangka RSS, 30, warga Jln. Jalur Hijau Desa Medan Estate, Kecamatan Percut Seituan. Kemudian polisi melakukan pengembangan dan menyuruh tersangka ESN menghubungi tersangka RSS selaku pengedar sabu-sabu tersebut. Begitu mendengar adanya pelanggan baru yang ingin membeli sabusabu, tersangka RSS menyuruh ESN datang ke Jln. Pasar V samping kampus Unimed. Setibanya di lokasi yang telah dijanjikan, polisi melihat tersangka RSS sedang berdiri di pinggir jalan. Tanpa buang waktu, polisi langsung menangkap RSS berikut barang bukti tiga paket kecil sabu-sabu. Saat ditanya wartawan di Mapolsek Medan Timur, Minggu (19/6) sore, tersangka ESN mengaku narkoba tersebut dibeli dari tersangka RSS seharga Rp 250 ribu dan untuk digunakan sendiri. “Kalau sudah pakai SS, pikiran jadi tenang dan tidak ngantuk saat kerja malam,” ujar tersangka ESN yang mengaku bekerja sebagai sekuriti di salah satu komplek perumahan swasta Jln.Pancing. Sementara itu, Kanit Reskrim Polsek Medan Timur AKP Nimrot Aprwin Simanjuntak menjelaskan, kedua tersangka masih menjalani pemeriksaan. Dalam kasus ini, polisi masih memburu seorang bandar SS yang identitasnya sudah diketahui. “Dari kedua tersangka, polisi menyita empat paket kecil SS sebagai barang bukti. Sedangkan seorang bandarnya masih diburon,” ujar AKP Nimrot Aprwin Simanjuntak. (h04)

Penjahat Curi Uang Dan HP Milik Jaksa Berpura-pura Mengusuk Kaki MEDAN (Waspada): Aksi kejahatan dengan modus berpura-pura mengusuk kusuk kaki, terjadi di Medan. Dalam kasus tersebut, seorang jaksa yang bertugas di Aceh mengalami ker ugian uang dan handphone. Sumber Waspada di Polsek Medan Baru mengatakan, Minggu (19/6), korban Rustam Efendi Simarmata, SH, 29, penduduk DesaLancangGaram,Kecamatan Banda Sakti, Kota Lhokseumawe kehilangan uang tunai Rp3 juta dan handphone. Peristiwa itu terjadi pada

Sabtu (18/6). Saat itu, korban menumpang angkutan kota (angkot) trayek 64 dari Jln. Gatot Subroto menuju rumah keluarganya di Jln. Sisingamangaraja, Medan. Setelah korban masuk ke dalam angkot dan baru berjalan 10 meter, tiba-tiba seorang pria masuk ke dalam angkot dan duduk berhadapan dengan korban. Setelah itu, tiga wanita lainnya masuk ke dalam angkot tersebut dan duduk berjajar di sebelah kanan korban. Selanjutnya, pria yang duduk berhadapan dengan kor-

ban menawarkan kusuk gratis di lapangan Merdeka. Berdalih sebagaipromosi,priatidakdikenal itu mempraktikkannya dengan cara mengusuk kaki korban. Setelah dikusuk, pria itu menyarankan korban agar datang ke tempat praktiknya di lapangan Merdeka sembari menyerahkan selembar kertas fotokopi gambar monyet dan bertulisan Klinik Pengobatan Herbalis. Kemudian, pria itu turun dari angkot disusul tiga wanita lainnya yang duduk di sebelah kanan korban. Setelah angkot tersebut melanjutkan perjala-

nannya, korban baru menyadari bahwa uang dan hanphone di saku celananya sudah tidak ada lagi. Kapolsek Medan Baru AKP Dony Alexander, SH, SIK mengatakan, pihaknya sudah menurunkan personel ke lapangan dan mengumpulkan informasi dari sopir angkot guna mengidentifikasi ciri-ciri pelaku. Dalam kasus itu, kata Dony, penyidik sudah mengambil keterangan korban dan sejumlah saksi. Saat ini, pelaku kejahatan dengan modus mengusuk kaki tersebut masih diburon. (m36)

Perpustakaan Keliling Kewalahan Layani Anak Sekolah BUKU adalah jendela dunia. Masih ingat dengan istilah itu? Dengan buku maka akan membuka cakrawala berpikir. Selain itu, dengan membaca buku akan meningkatkan derajat seseorang. Sebab setiap buku yang dibaca mengandung sejuta ilmu pengetahuan. Perpustakaan merupakan salah satu sarana untuk mendapatkan bahan bacaan yang gampang. Termasuk pula Perpustakaan Daerah Sumatera Utara. Tidak dipungkiri keberadaan Perpustakaan Daerah tidak dapat dijangkau oleh masyarakat yang tinggal di pinggiran kota. Maka dari itu dicanangkanlah perpustakaan keliling. Perpustakaan keliling bukanlah barang baru. Sebab sejak tahun 1990 perpustakaan keliling sudah digalakkan untuk menjangkau masyarakat yang membutuhkan bahan bacaan di daerah pinggiran. Sasarannya terutama adalah anak sekolah. Bagian Pelayanan Badan Arsip dan Perpustakaan Daerah

Sumut (BAPERASDA) Eli Suhaeriyah mengungkapan, saat ini untuk melayani kebutuhan perpustakaan keliling terdapat lima unit mobil perpustakaan yang dioperasikan. Empat unit mobil perpustakaan keliling itu antara lain Granmax dua unit dan Kijang Hailux dua unit. Empat unit mobil perpustakaan keliling memiliki titik tujuan yang berbeda, yakni ada yang tujuannya hanya 8 titik dan ada yang 16 titik. Setiap titik tujuan tempat yang harus dikunjungi setiap mobil harus dua tempat. Misalnya, di titik tujuannya di Kecamatan Medan Selayang maka tempat yang harus dikunjungi harus dua tempat. Menurut Eli, layanan perpustakaan keliling totalnya dioperasikan di 16 titik, jika sehari terdapat 16 titik bila dikali dua tempat yang dikunjungi maka akan terdapat 32 lokasi yang dikunjungi per harinya. Mobil perpustakaan keliling beroperasi dari pagi hingga siang hari

pukul 12.45 setiap hari. Biasanya kecamatan yang dikunjungi antara lain Kecamatan Medan Selayang, Kecamatan Percut Sei Tuan, Medan Helvetia, Medan Perjuangan, Medan Belawan, Medan Deli, Medan Johor, Medan Amplas, Medan Denai, dan sebagainya. Satu mobil perpustakaan keliling memiliki 1500 hingga 2.000 eksemplar buku dan terdapat satu pustakawan yang akan melayani masyarakat. Sistem peminjaman buku sama halnya seperti biasa, harus terdaftar terlebih dahulu sebagai anggota. Anggota perpustakaan boleh meminjam buku maksimal 2 eksemplar. “Tujuan perpustakaan keliling untuk memberikan layanan informasi kepada masyarakat yang tidak dapat menjangkau perpustakaan ini, mempermudah mereka yang kesulitan datang ke perpus,” jelas Eli. Sementara itu menurut Januaran H, 43, selama lima tahun menjadi sopir perpusta-

kaan keliling banyak pengalaman yang dihadapinya. Kalau di jalan ia harus menghadapi kemacetan sehingga terlambat datang ke sekolah-sekolah. Menurutnya, antusias masyarakat terhadap perpustakaan keliling begitu besar, terutama anak-anak. “Biasanya yang mengunjungi perpustakaan keliling kebanyakan anak-anak. Kadang saya dengan pustakawan kewalahan melayaninya, sampai ratusan,” ungkap Januaran. Begitu pula yang dikatakan Eli, anak-anak cukup antusias membaca dari perpustakaan keliling ini. Namun antusias itu masih terkendala dengan jumlah perpustakaan yang tak sebanding. Rencananya tahun ini BAPERASDASU menambah satu unit mobil perpustakaan keliling lagi, tapi masih menunggu persetujuan DPR. Melihat antusias anak-anak yang berkunjung ke perpustakaan keliling apakah ini pertanda budaya baca di Kota Medan mulai meningkat? (cag)

Waspada/Ismanto Ismail

TERSANGKA CMIUP alias Pardede, 21, memperagakan cara menikam korban Hendri pedagang sate Padang yang diperankan Wenpi Ambon dalam rekonstruksi yang berlangsung di Jln. Buku, Gg. Johar, Kelurahan Sei Putih Barat, Kecamatan Medan Petisah, Jumat (17/6).

Polisi Rekonstruksi Kasus Pembunuhan Pedagang Sate MEDAN (Waspada): Tersangka CMIUP alias Pardede, 21, berdalih terpaksa menghujamkan senjata tajam sebanyak satu liang ke punggung kiri Hendri, 32. Namun, luka tusukan itu menyebabkan pedagang sate ini tewas karena terlalu banyak mengeluarkan darah. “Aku terpaksa menikamnya karena korban mengambil batu setelah wajahnya ditinju temanku LT alias Tampubolon (buron) penduduk Lorong Gereja. Pisau itu aku ambil dari gerobak sate milik korban,” kata tersangka Pardede, kepada Waspada, Jumat (17/6), menjelang pelaksanaan rekonstruksi kasus pembunuhan pedagang sate Padang yang digelar Polsek Medan Baru di Jln. Buku, Gg. Johar, Kelurahan Sei Putih Barat, Kecamatan Medan Petisah. Rekonstruksi tersebut dipim-pin Kapolsek Medan Baru AKP Dony Alexander, SH,

SIK dibantu Waka Polsek AKP Tris Lesmana Zeviansyah, SH, SIK, MH; Kanit Reskrim Iptu Andik Eko Siswanto, SH; PanitI Iptu Akta Wijaya, SH; Panit-II Iptu Alexander Putra, SH dan Kanit Sabhara AKP B. Lumbanraja, SH. Selain itu, turut disaksikan pengacara PH Prodeo Yen Zarmon, SH, Jaksa Penuntut Umum ( JPU) Pardamuan Siburian, SH dan ratusan warga setempat. Dalam rekonstruksi tersebut tersangka Pardede penduduk Jln. Notes, Kelurahan Sei Putih Barat, Kecamatan Medan Petisah memperagakan 27 adegan. Sementara, korban diperankan We m p i A m b o n p e g a w a i honorer Polsek Medan Baru dan LT alias Tampubolon diperankan petugas juru periksa Polsek Medan Baru Bripka Parmunangan Hutabarat, SH. Kasus pembunuhan itu terjadi pada 21 Mei 2011 pukul

22:00 di Jln. Buku, Gg. Johar simpang Lor ong G ereja, Kelurahan Sei Putih Barat, Kecamatan Medan Petisah. Awalnya, tersangka Pardede dan LT membeli sate Padang. Saat itu, keduanya hanya menyerahkan uang Rp2 ribu dan ditolak oleh korban. Sebab, harga sate tersebut Rp5 ribu per porsi. Akibatnya, kedua tersangka terlibat pertengkaran dengan korban. Tiba-tiba, tersangka LT memukul wajah korban. Kemudian, tersangka Pardede mengambil pisau dari gerobak sate dan menikam korban hingga tewas. Dua hari kemudian, tersangka Pardede berhasil ditangkap dari tempat persembunyiannya di Kutacane. Sedangkan tersangka LT masih diburon. Kapolsek Medan Baru AKP Dony Alexander, SH, SIK mengatakan, tersangka Pardede dijerat pasal 338 subsider pasal

351 ayat (3) KUHPidana. “Dalam kasus itu, polisi sudah melakukan pemeriksaan terhadap sejumlah saksi dan menyita barang bukti berupa pisau milik korban yang digunakan tersangka,” jelas Dony usai menyaksikan jalannya rekonstruksi tersebut. Sementara itu, Suhardi, 45, salah seorang anggota keluarga korban, penduduk Jln. Batu Tulis Medan yang menyaksikan jalannya rekonstruksi mengatakan, tindakan tersangka cukup kejam. “Kenapa tersangka tega membunuh korban. Pihak keluarga mengharapkan tersangka mendapat hukuman berat,” jelasnya. Menurut Suhardi, korban merantau ke Kota Medan guna mengadu nasib. Karena belum mendapat pekerjaan, korban berdagang sate Padang dan sudah berlangsung selama beberapa pekan. (m36)

Tiga Tersangka Korupsi Migor Gagal Ditahan MEDAN (Waspada): Tiga tersangka kasus dugaan korupsi penyaluran minyak goreng (migor) di Kabupaten Batubara gagal dijebloskan dalam tahanan Poldasu. “Belum dilakukan penahanan karena ada tersangka yang sakit. Kemudian, ada yang menjalani proses sidang di Langkat. Ada juga tersangka yang keterangannya masih dibutuhkan,” ujar Kasubbid Pengolahan Informasi dan Data (PID) Bidang Humas Poldasu AKBP MP Nainggolan didampingi Kasat Tipikor AKBP Verdi Kalele ditanya wartawan, Jumat (17/6).

Menurutnya, ketiga tersangka, Ketua Tim Pelaksana Syaiful Margolang disebutkan menderita hipertensi dan jantung. Pimpinan KSR Bina Sejahtera Yadi Suprayogi menjalani persidangan di Pengadilan Negeri Stabat, Kabupaten Langkat dalam kasus yang sama dan Eddy Wijaya alias Abeng keterangannya masih dibutuhkan. Mengenai tersangka Abeng, tidak dijelaskan secara rinci keterangan apa lagi yang dibutuhkan untuk menjebloskannya ke dalam sel tahanan. Soal ini, Kasat Tipikor Verdi Kalele hanya mengatakan, keterangan Abeng

masih dibutuhkan untuk melengkapi berkas. “Dia belum ditahan karena selama menjalani pemeriksaan dinilai kooperatif,” kata Verdi ditanya lagi alasan tidak ditahannya Abeng. Sebelumnya dalam kasus tersebut, penyidik menetapkan lima orang sebagai tersangka. Dua diantaranya telah ditahan, yaitu, mantan Kepala Dinas Perdagangan Industri dan Koperasi Pemkab Batubara Mangandar Marpaung dan rekanan proyek migor Direktur UD Sahabat Sejati Sumardi. Dijelaskan, pada 2008 Disperindag Sumut mendapat

Polisi Tangkap Pengguna Sabu-sabu MEDAN (Waspada): Petugas Sat Narkoba Polresta Medan menangkap seorang pengguna sabu-sabu dalam penggerebekan di kediamannya, Jumat (17/ 6). Selain mengamankan tersangka, polisi menyita barang bukti berupa 5 gram sabu-sabu. Informasi yang diperoleh Waspada di lapangan, Sabtu (18/6), tersangka Awie, 39, warga Jln. Gatot Subroto Medan merupakan target operasi (TO) Polresta Medan dalam kasus narkoba. Bahkan tersangka dise-

but-sebut sebagai bandar narkoba di Kota Medan. Sebab, tersangka pernah ditangkap dalam kasus yang sama, beberapa waktu lalu. Tersangka berhasil ditangkap berkat informasi dari masyarakat. Kemudian, polisi melakukan penyelidikan. Setelah mengetahui tersangka berada di rumahnya, polisi dibantu kepala lingkungan (Kepling) setempat melakukan penggerebekan. Saat ditangkap, tersangka

Awie sedang menggunakan narkoba jenis sabu-sabu. Namun tersangka membantah tuduhan sebagai pengedar sabu-sabu. ”Saya hanya pengguna, bukan pengedar,” ujarnya. Kapolresta Medan Kombes Pol. Tagam Sinaga, SH, MH melalui Kasat Narkoba Kompol Amri Siahaan, SIK, SH ketika dikonfirmasi wartawan, Jumat (17/6), membenarkan adanya penangkapan terhadap tersangka Awie. (m39)

DIPA senilai Rp29 miliar untuk kegiatan migor kepada masyarakat. Berdasarkan keputusan Gubsu mencantumkan jumlah alokasi migor untuk 28 kabupaten/kota termasuk Batubara melalui Disperindag dengan mendapatkan subsidi Rp582.762.913.03 untuk penggantian subsidi penyaluran sebanyak 233.105.165212 liter. Berdasarkan surat perintah pencairan dana (SP2D) Kantor Pelayanan Perbendaharaan Negara Medan, bahwa dana subsidi migor yang dicairkan untuk pergantian subsidi di Batubara sebesar Rp981.525.000 dengan ketentuan migor harus disalurkan ke masyarakat sebanyak 392.610 liter. Tetapi faktanya, pencairan dana subsidi dilakukan sebelum penyaluran migor dilaksanakan. Subsidi migor yang disalurkan pelaku usaha hanya Rp134.030.000, yakni 53.612 liter. Ketika dilakukan audit oleh BPKP ditemukan kerugian negara atas kegiatan penyaluran subsidi migor di Batubara sebesar Rp847.495.000. Atas penyelewengan itu, para tersangka akan dijerat pasal 2 ayat 1 sub pasal 3 sub pasal 11 UU RI No. 31 tahun 1999 tentang tindak pidana korupsi.(m27)


Opini

B4 TAJUK RENCANA

Hukuman Mati Koruptor Sudah Saatnya Diterapkan

A

pa bedanya koruptor dengan teroris? Biasanya koruptor hidup senang (kaya-raya) sementara teroris hidupnya sederhana, idealis, memegang prinsip, malah cenderung miskin. Tapi, beda lebih mencolok ada pada dampak dan bahayanya. Meski keduanya sama-sama berbahaya, namun bahaya koruptor lebih besar ketimbang teroris karena menghambat pembangunan, dan memiskinan rakyat. Tak pelak lagi, bangsa Indonesia yang memiliki kekayaan alam melimpah hidup rakyatnya banyak yang miskin. Data dari BLT atau bantuan langsung tunai dua tahun lalu menunjukkan ada 19 juta lebih keluarga miskin. Nah, kalau dikalikan tiga saja, karena rata-rata rumah tangga (suami-istri dengan dua anak), maka jumlah orang miskin mencapai 76 juta jiwa. Itu yang terdata, belum lagi mereka yang tak terdata. Masih untung pemerintah tidak menaikkan harga BBM. Jika BBM naik maka semakin meluaslah kemiskinan di negeri ini. Sekalipun faktanya koruptor itu lebih berbahaya bagi masyarakat, bangsa, dan negara, namun hukuman buat pelaku korupsi demikian ringannya. Belakangan ini, terkait kasus suap Deputi Gubernur Senior BI Miranda Goeltom para pelaku tak sampai 2 tahun dihukum. Sangat ringan sehingga dipastikan tidak akan menakutkan! Beda dengan kasus teroris. Vonis Amir Jamaah Ansharut Tauhid KH Abu Bakar Ba’asyir dijatuhi hukuman 15 tahun penjara. Memprihatinkan memang melihat rendahnya hukuman bagi para koruptor di Indonesia, sehingga wajar-wajar saja kalau kasus korupsi semakin meningkat. Dan sebagai perbandingan lagi, Abdullah Sunata, terdakwa teroris pelatihan militer di Aceh divonis 10 tahun penjara. Mantan anggota Brimob Sofyan Tsauri divonis 10 tahun. Ia terbukti menjual senjata api kepada teroris jaringan Aceh. Sementara Syarifudin Zuhri yang menyembunyikan Noordin M Top diganjar 8 tahun penjara. Pelaku bom Bali lalu divonis mati dan sudah menjalani eksekusi. Sebelumnya, Mahkamah Agung mengeluarkan data tentang hukuman bagi koruptor selama 2010. Dari banyaknya koruptor yang divonis, mayoritas hanya divonis 1 hingga 2 tahun saja. Sebanyak 442 kasus korupsi sudah diputus. 90,27 Persen koruptor divonis bersalah, dan tercatat 269 perkara atau 60,68 persen yang terdakwanya divonis antara 1 hingga 2 tahun saja. Bahkan, MA juga memvonis Intisari kasus korupsi dengan vonis di bawah 1 tahun jumlahnya 28 perkara atau 6,33 persen. Tercatat ada 43 perkara atau 9,73 KPK harus diperkuat, persen perkara korupsi yang terdakwanya UUTipikor dilengkapi de- dibebaskan. Di daerah-daerah banyak korupsi tidak terjangkau hukum ngan pasal hukuman ma- pelaku karena dapat mengatur oknum aparat ti bagi pelaku korupsi ba- penegak hukum dengan kekuatan uangnya. Hemat kita, vonis rendah terhadap tu para koruptor tiarap pelaku korupsi menunjukkan tidak ada keseriusan dari pemerintah dan aparat penegak hukum dalam upaya pemberantasan korupsi, termasuk oleh KPK sendiri. KPK lebih senang menunjukkan keberhasilannya menangkap pelaku korupsi, tidak memberi tanggapan dengan hukuman rendah, apalagi melakukan upaya pencegahan. Upaya memasukkan pasal hukuman mati dalam UU Tipikor belum juga terwujud. Kalau Ketua Front Pembela Islam (FPI) Habib Rizieq setuju koruptor diperlakukan sama dengan teroris, sebenarnya hal itu sudah banyak diterima di banyak negara sehingga penegak hukum di Indonesia bisa menerapkannya. Apalagi pengurus MUI bahkan Ketua MK dan Menkum HAM pun sependapat hukuman koruptor harus diperberat, boleh disamakan dengan teroris karena dampak negatifnya luar biasa besar. Dalam syariat Islam hukuman terhadap pencuri saja potong tangan, padahal nilai barang yang dicurinya mungkin kecil tak sampai Rp1 juta. Sehingga hukuman bagi para koruptor yang ‘’menilep’’ uang rakyat bermiliaran rupiah harusnya jauh lebih berat, di mana hukuman mati sangat pas dijatuhkan kepada para koruptor. Dan kalau hukuman mati diterapkan dengan tegas, pastilah para koruptor ketakutan, sehingga afek jeranya membuat para pejabat takut berkorupsi ria saat mendapatkan jabatan dan amanah sebagai pejabat pemerintahan di pusat, provinsi, maupun kabupaten-kota. Sepertinya hukuman bagi pelaku korupsi saat ini baru ‘’setengah hati’’. Hal itu bisa dilihat dari sulitnya menangkap basah pelaku, kecuali buktinya lengkap atau kecekal KPK dengan sadap rekamannya. Prosesnya berbelit, dan hukumannya sangat rendah. Dan yang membuat miris masyarakat. Saat ditangkap,diproses, maupun setelah vonis pengadilan mereka dapat perlakuan istimewa. Masih bisa ketawa-ketawa, berpakaian necis, dapat fasilitas, dapat remisi dll sehingga tidak terasa sudah bebas kembali ke masyarakat dengan tetap kaya-raya dari hasil korupsinya. Dengan hukuman demikian rendah pastilah menyulitkan dalam memberantas tikus-tikus korupsi, apalagi di lapangan terlihat jelas bagaimana para koruptor dan keluarga koruptor masih bisa menikmati kekayaannya. Sehingga bagaimana mungkin bisa membuat efek jera jika upaya memberantas korupsi baru sekadar ‘’show’’ dan ‘’main-main’’, sekadar ‘’lips service’’ atau ‘’setengah hati’’ saja. Pantas kalau bangsa ini gagal dan akan semakin parah di masa mendatang jika tidak dilakukan reformasi terkait hukumannya yang ringan bagi pelaku korupsi. Harusnya Indonesia mengikuti proses hukum di Cina atau nengara lain yang menerapkan hukuman berat, misalnya hukuman tembak mati, hukum gantung terhadap pelaku korupsi tanpa pilih kasih. Di Cina, komitmen itu datang dari pimpinan tertingginya sehingga sudah 3000 koruptor dihukum mati (berat) dilihat oleh para pejabat lain dan rakyatnya. Kalau Cina kini menjadi bangsa yang maju maka Indonesia pun bisa lebih maju dari Cina jika berani memberlakukan hukuman mati bagi koruptor.+

APA KOMENTAR ANDA SMS 08974718101

Faks 061 4510025

Facebook smswaspada

082160876636 Masih adakah yang bisa diharapkan, sehingga negeri ini dapat melangkah lebih maju. Yang terpampang di hadapan kita hanyalah perilaku korupsi yang sungguhsungguh sangat memalukan. Perilaku korup sudah merambah ke segala sendi kehidupan. Uang negara terus digerogoti. SBY yang katanya menghunus pedang untuk memberantas korupsi, seperti tak berdaya. Ada lagikah yang bisa diharap? 06176582233 Tolonglah traffic light di Kota Medan benar-benar difungsikan. Kalau listrik padam, seharusnya ada genset khususnya di kawasan rawan macet. Soalnya, kalau lampu pengatur lalulintas tidak berfungsi, hampir bisa dipastikan jalanan akan macet. Sangat menderita lho Pak terjebak di tengah kemacetan dalam cuaca yang sangat panas begini. 02160821339 Kabarnya masuk sekolah bertaraf internasional harus membayar puluhan juta rupiah. Kasihan dong anak-anak kurang mampu yang sebenarnya memiliki kecerdasan, tapi tak bisa masuk ke sekolah berkualitas seperti itu karena dilahirkan dari keluarga miskin. Nasib, nasib. 081369029219 Hayo, Ketua DPRD Langkat didemo ratusan kepala desa. Tentu saja Kepala Desa tersinggung disebut kepala dosa. Makanya, tidak saja kita harus menjaga hati, juga harus menjaga mulut. Ingat, mulutmu harimau kamu. 06175420468 Aku sedih Ustadz Abu Bakar Ba’asyir divonis 15 tahun. Kuasa hukum memang banding, karena hakim dinilai tidak mempertimbangkan keterangan saksi kunci, Khairul Ghazali. +6285658074220 Pilkada ulang 28 Juni mendatang, mudahan berlaku adil, semoga janji para calon KDH, ditepati, kami para pendidik, tolong jangan dipersulit adm, agar mutu mengajar dapat meningkat, jangan sikit2 uang. Ingat janji.

WASPADA Senin 20 Juni 2011

Sisi Buruk Otda: Robohnya Sekolah Dasar Oleh Effan Zulfiqar Harahap Buruknya nasib pendidikan dasar di daerah adalah cerminan ketidakperdulian pemda terhadap pembangunan pendidikan dasar

H

arian Waspada dua kali menurunkan berita menyangkut buruknya nasib Sekolah Dasar Negeri di Padanglawas Utara (Waspada 19 dan 23 Mei 2011). Sedih membaca berita tersebut bagaimana mungkin Sekolah Dasar (SD) yang dibangun sejak zaman orde baru (orba) belum pernah tersentuh oleh nikmatnya zaman otonomi daerah (otda). Bagaimana mungkin sekolah yang mestinya memberikan suasana nyaman dan gembira bagi anak-anak untuk belajar, justru sebaliknya berada dalam suasana ketidak nyamanan. Dengan kondisi SD yang hampir roboh, atap yang bocor, dinding lapuk dan berlobang di sana sini. Kalau hari panas murid-murid yang belajar sudah pasti akan merasa gerah luar biasa. Bila hujan turun ruangan kelas akan kebanjiran karena atap yang bocor. Loteng dan asbes yang sudah lapuk berpotensi menimpa murid-murid pada saat belajar dan lantai yang bolong-bolong suatu saat akan menyebabkan mereka terjatuh. Cat dinding yang sudah kusam dan berlumut jelas sangat tidak higienis bagi mereka. Kursi yang kakinya hampir patah dan meja yang lebih jelek lagi dari meja penjual daging di pasar bukan tempat yang baik untuk menulis dan membaca. Seperti itulah gambaran kondisi SD di negeri ini setelah otda. Bukannya lebih baik, justru lebih buruk kondisinya bila dibadingkan masa orde baru. Dengan otda sejatinya kondisi bangunan SD akan lebih baik karena sepenuhnya kewenangan bidang pendidikan telah diberikan kepada daerah untuk mengelolanya lebih baik lagi dibandingkan zaman orba. Kenyataannya sangat bertolak belakang. Pemerintah daerah (pemda) sepertinya tidak begitu menganggap terlalu penting untuk memperbaiki kondisi SD

yang sudah hampir roboh. 10 tahun otda berjalan, ternyata nasib SD makin terpuruk apalagi SD yang dikelola swasta mungkin sebagian akan jauh lebih buruk lagi nasibnya. Kalau boleh dikatakan kondisi sekolah yang ada jauh lebih bagus dari kandang ayam atau kambing. Belum lagi permasalahan jumlah guru kelas yang tidak sebanding dengan jumlah kelas dan ditambah lagi dengan kepala sekolah yang jarang hadir. Sangat-sangat tidak layak rasanya kondisi sekolah seperti itu diharapkan dapat melahirkan orang-orang yang berkualitas. Padahal SD merupakan investasi jang-ka panjang yang akan menentukan kualitas SDM yang ada di daerah dan di negeri ini. Di negeri ini memang aneh, seharusnya lebih diprioritaskan bagaimana membangun SD yang lebih baik bukan PTnya. Karena bagaimanapun bila dasarnya tidak bagus, otomatis ke atasnya juga akan tetap buruk. Kalau dikatakan tidak ada anggaran untuk memperbaiki gedung SD yang sudah tidak layak tersebut tidak benar. Anggaran untuk pendidikan, terutama pendidikan dasar sangat besar dikucurkan pemerintah pusat tiap tahunnya melalui DAK/DAU. Masalahnya begitu sampai di daerah lebih banyak yang dikorup. Demikian juga yang berasal dari APBD yang menurut UUD 45 perubahan Pasal 31 negara harus memprioritaskan anggaran sekurang-kurangnya 20% dari APBN dan APBD. Pertanyaan nya kemana anggaran pendidikan yang 20% digunakan pemda? Faktanya, kasus-kasus korupsi yang melibatkan aparat pemda banyak terkait dengan penyalahgunaan anggaran pendidikan dengan cara melakukan mark up atau anggaran-anggaran fiktif yang terkait dengan penggunaan dana BOS atau DAK/DAU yang dianggarkan untuk pendidikan, ter-

masuk dana-dana pendidikan yang bersumber dari APBD. Bahwa UU 32 Tahun 2004 secara jelas dan tegas menyebutkan pelayanan dasar minimal yakni bidang pendidikan menjadi urusan wajib dan tanggung jawab pemda untuk melaksanakannya dengan sebaik-baiknya dan menganggarkan pembiayaannya di APBD. Demikian juga dalam Pasal 30 UU No 20 tahun 2003 Sistem Pendidikan Nasional tegas disebutkan bagaimana tanggungjawab pemerintah pusat, pemerintah provinsi dan pemerintah kabupaten/kota dan pengelolaan pendidikan. Sesungguhnya tidaklah benar bila disebutkan bahwa anggaran untuk pendidikan di daerah sangat kurang yang menyebabkan tidak bisa dilakukan perbaikan terhadap bangunan SD yang sudah hampir roboh. Alasan tersebut sangat klasik rasanya yang menyebabkan lambatnya kemajuan pendididkan di negeri ini yang sebenarnya semuanya bermuara dari tidak bermutunya pendidikan dasar kita. Pendidikan dasar sebagaimana disebut dalam UU No. 20Tahun 2003 adalah merupakan jenjang pendidikan yang melandasijenjangpendidikanmenengah, yang terdiri dari SD dan Madrasah Ibtidaiyah atau bentuk lain yang sederajad serta sekolah menengah pertama (SMP) dan madrasah tsanawiyah (MTs). Buruknya nasib pendidikan dasar di daerah adalah cerminan ketidakperdulian pemda terhadap pembangunan pendidikan dasar. Keperdulian hanya ditujukan pada saat peringatan Hari Pendidikan Nasional. Lihat bagaimana hebatnya semangat memperingatinya, termasuk slogan dan wacana-wacana yang disampaikan oleh pejabat di daerah menyangkut komitmen untuk membangun pendidikan di daerah. Termasuk pada saat mencalon jadi kepala daerah. Selesai terpilih yang lebih dipentingkan adalah membeli mobil dinas yang harganya setara dengan biaya untuk merehap dua bangunan SDN yang hampir roboh. Kini yang diharapkan adalah adanya ketegasan dan kemauan kuat dari aparat pemerintah di daerah (baca kepala daerah

dan DPRD) untuk melaksanakan semua keputusanpolitikmenyangkutpendidikan dan pembiyaaannya sebagaimana yang tertuang dalam undang-undang. Tanpa adanya ketegasan dan kemauan kuat akan selamanyanasibpendidikandasarmenjadi prioritas terakhir di daerah. Bahasa sederhananya selama pemda masih tidak fokus dan punya perencanaan yang baik dalam pelaksanaan pembangunanpendidikantingkatdasar,terutama dalam penyedian sarana dan prasarana yang minimal saja. Maka selama itulah nasib pendidikan dasar di daerah akan menderita di tengah-tengah euforio otda dan semangat rame-rame untuk korupsi berjamaah pejabat daerah. Benar apa yang pernah ditulis tokoh pendidikan kita Winarno Surakhmad di Harian Kompas edisi 15 Maret 2004, katanya: “Dengan anggaran terbatas saja korupsi di sektor pendidikan sulit dicegah, apalagi kalau anggaran melimpah”. Artinya dengan anggaran yang melimpah seperti sekarang ini bukannya nasib pendidikan makin baik, justru makin buruk karena habis dikorup di daerah. Sedangkan anggaran yang sedikit saja tidak lepas dari sasaran untuk dikorupsi. Sudah seharusnya semua pihak yang perduli terhadap masa depan bangsa ini di daerah berpaling untuk secepatnya memperbaiki bangunan SD yang hampir roboh sebelum anak-anak masa depan bangsa tersebut mati tertimpa oleh bangunan yang sudah lapuk. Bahwa kita sepakat dan mengakui pendidikan dasar (terutama SD) merupakan investasi jangka panjang yang harus dijaga kualitas dan keberlanjutannya. Sejatinya tujuan dari pendidikan dasar adalah mengajarkan kecakapan dasar, seperti membaca, menulis dan berhitung yangmerupakanpenunjangutamapengajaranpadajenjangpendidikanselanjutnya. Pertanyaannya apakah anak-anak bisa fokus belajar membaca, menulis dan berhitung dengan baik di tengah-tengah bangunan SD mereka yang minim sarana dan prasana dan hampir roboh? Penulis adalah Wakil Rektor I Universitas Muhammadiyah Tapanuli Selatan.Tulisan ini adalah pendapat pribadi dan tidak mewakili lembaga

Mengapa Kita Tidak Pernah Siap Berdemokrasi? Oleh Ir. B. Ricson Simarmata, MS. EE Dalam alam demokrasi, yang paling utama dibentuk adalah mau menerima kekalahan dengan tulus, menghargai orang lain, taat pada aturan yang sudah baku...

A

lex Ferguson mengatakan dengan tulus bahwa dia tidak malu kalah dengan team terbaik dunia sekelas Barcelona, mereka unggul dalam segala hal dari MU, mereka memang pantas untuk menang. Ungkapan itu sangat jujur, natural, dan menerima kenyataan dengan tidak terpaksa. Saat bersamaan, pemilihan ketua umum PSSI penuh dengan kekacauan dan berakhir rusuh, semua memaksakan kehendaknya dan merasa paling benar dan tidak ada yang mau mengalah. Dua hal bertolak belakang kalau kita menggunakan ukuran kacamata demokrasi. Alex Ferguson sangat siap menerima ajarandemokrasidengantulusdannatural. Tidak mempersoalkanmengapateamnya kalahdanmaumenerimakenyataandemi menyelamtkan sepkabola universal yang menjujung tinggi arti sportivitas. Sementara para peserta PSSI yang selalu ngotot memaksakan kehendaknya tidak pernah berpikirjangkapanjangtentangartisebuah masa depan yang lebih baik. Inilah sikap mental yang tidak siap berdemokrasi. Ketika kehendak dipaksakan berarti sudah mengeliminir nilai demokrasi itu sendiri. Sekali lagi, mengapa kita tidak siap berdemokrasi ketika dunia memuji kita sebagai negara demokrasi terbesar ketiga di dunia? Akankah pujian Obama mengatakan Indonesia punya masa depan yang begitu cerah kalau kita masih mempertahankankarakterkitasepertiini?Demokrasi pada sisi lain yang saya pahami adalah persoalan aturan dan bagaimana menghargai orang lain. Sistem politik sebuah negarayangmenerapkandemokrasibiasa punya pengharapan yang lebih baik daripada negara otoriter. Dalam alam demokrasi, yang paling utama dibentuk adalah mau menerima kekalahan dengan tulus, menghargai orang lain, taat pada aturan yang sudah baku dan ditetapkan bersama. Berangkat dari prinsip seperti inilah, wajar bangsa Amerika Serikat sampai pada finish demokrasi yang substansial. Para politisi di Amerika Serikat sangat menghargai konstituen pemilihnya. Mereka menyadari sepenuhnya, mereka duduk menjadi senator, pejabat publik karena rakyat menginginkan perubahan yang lebih baik. Pada fase ini senator dan politisi di negara Amerika sudah menghargai konstituen masing-masing. Mereka menyadari sepenuhnya bahwa mereka tidak akan pernah duduk tanpa dukungan dari masyarakat. Untuk itu berbuat yang terbaik kepada rakyat tentu menjadi pilihan yang paling utama. Beda dengan politisi di negara kita yang selalu mengatakan siap berdemokrasi,tetapitidakpernahmenghargai konstituen pemilihnya. Aspirasi masyarakat hanya menajdi wacana tanpa ada upaya konkrit bagaimana menjawab persoalan masyarakat. Sangat menarik memang mencermati apa yang dikatakan oleh Boni Hargens yang sedang S3 di Jerman. Dulu

pada masa Yunani kuno, politik adalah tempat para manusia yang berilmu dan bermoral. Yang duduk di politik adalah harus punya ilmu pengetahuan dan moral yang tinggi. Karena yang dibicarakan di sana adalah kepentingan umum (public good) yang sangat besar. Maka segala perangkat aturan yang dibuat sangat ditaati bersama. Tidak ada ruang untuk melanggar aturan. Kalau kita lihat demokrasi yang kita terapkan, memang sangat wajar kita tidak siap berdemokrasi. Janganlah dulu saling menyalahkan. Ketika demokrasi bicara masalah aturan dan saling menghargai orang lain, tidak terlalu sulit menemukan fakta di lapangan tentang kurangnya kita taat pada aturan dan menghargai orang lain. Di setiap lampu merah Kota Medan, sekalipun sudah ada tulisan sangat besar berhenti di belakang garis, hampir semua kendaraan,baikelitedanbiasa-biasaselalu melewati garis tersebut. Bahkan sang penerobos lampu merah sangat mudah kita temukan. Inilah potret sebuah bangsa yang tidak siap berdemokrasi. Sampel lampu merah dan lalu lintas ini masih satu sampel. Padahal taat kepada rambu lalu lintas adalah persoalan aturan dan bagaimana menghargai orang lain. Di sini saja kita sudah tidak siap berdemokrasi, padahal masih sangat sederhana. Konon lagi dalam praktik berbangsa dan bernegara yang baik. Di negara secara formal banyak sumber daya yang dikelola. Salah satunya adalah uang dan bentuk fasilitas yang lain. Inilah yang menajdi sumber persoalan. Padahal dalam mengelola sumber daya negara butuh aturan dan regulasi yang baik. Jika kita tidak sanggup menghargai hak orang lain dengan melihat bahwa uang dan sumber daya negara adalah untuk kebaikan bersama, inilah yang menjadi akar persoalan makanya muncul perilaku korupsi. Korupsi adalah bentuk ketidakmampuan kita menghormati apa yang menjadi hak-hak rakyat. Korupsi adalah bentuk ketidaktaatan kita pada aturan yang baik. Mengingat dalam kultur masyarakat kita selalu mencari jalan pintas dan di luar aturan, maka seringkali terjadi pelanggaran terhadap berbagai aturan main. Bangsa yang tidak taat pada aturan main selalu jatuh dalam konflik bersaudara. Bagaimana supaya siap berdemokrasi? Tentu tidak ada rumusan baku seperti dalam rumus Matematika atau Fisika. Tetapi jawabnya memang sangat sederhana. Dua prasyarat mutlak dalam berdemokrasi, taat pada aturan dan menghargai orang lain. Ketika saya menjadi seorang pejabat publik, program pembangunan tidak saya jalankan untuk rakyat, maka saya sudah tidak menghargai apa yang menjadi hak orang lain dan saya sudah melanggar aturan. Munculnya berbagai konflik politik di tingkat lokal dan nasional adalah buah dari ketidaksiapan kita mengahrgai orang

laindantidaktaatpadaaturanmain.Budaya mundur di negeri Jepang oleh pejabatnya adalah bentuk menghargai orang lain. Dia secara tidak langsung mempersilakan orang lain yang lebih mampu untuk memimpin. Dari sini dapat kita lihat bersama, bahwa demokrasi membutuhkan rumusan yang sangat sederhana, menghargai orang lain. Wajarlah demokrasi di negara –negara maju menjadiinstrumenutamamencapai tujuan negara. Jika mereka tidak mampu menghargai orang lain dan taat kepada aturan, maka ke depan mereka tidak akan dipilih lagi menajdi politisi atau pejabat publik. Sangat kontras di negara kita, dari masyarakat yang secara kualifikasi pendidikannya sudah tinggi pun sangat sulit mengahrgai hak orang lain dan taat pada aturan. Bukan pemandangan yang asing bagi kita, bahwa mobil pejabat selalu didahulukan jika lewat. Sekalipun ada aturan semua sama di depan hukum dan pemerintahan. Ternyata itu tidak jalan, hanya sebatas lips service semata. Ketikademokrasimenjadipilihanbagi sebuah bangsa, dibutuhkan sikap menghargai orang lain dan taat pada aturan. Selanjutnya dalam lakon politiknya, segala perilaku politiknya perlu diarahkan untuk membangunrakyatdanmemberikannilai yang baik kepada masyarakat. Inilah sebuah contoh yang sangat sederhana, bahwa demokrasi itu sebenarnya tidak rumit, hanyamasalahmenghargaioranglaindan taat pada aturan yang sudah keputusna bersama pula. Kapankah kita siap berdemokrasi? Penulis adalah Mantan Rektor UHN Medan/ Saat Ini Ketua STMIK IBBI Medan

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP dll). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Izin reklame tumpang tindih - Inilah enaknya di Medan, he...he...he * PLN targetkan 105 ribu sambungan baru - Tak padam saja sudah syukur! * Bupati Sergai: Aspek moralitas penting - Ya iyalah pak!

oel

D Wak


Opini

WASPADA Senin 20 Juni 2011

B5

AS Kembali Ke Emas Dan Perak Klarifikasi PDAM Tirtanadi Sehubungan dengan pemberitaan SKH Waspada 15 Juni 2011 halaman B-5 kolom 5-7 judul “Distribusi PDAM Macet Tiga Kali Sehari,” berikut ini kami sampaikan beberapa hal yang harus diluruskan terhadap isi pemberitaan tersebut sebagai berikut: 1. Pendistribusian air di Kota Berastagi berjalan lancar dan tidak benar terjadi kemacetan pendistribusian air tiga kali dalam sehari seperti yang diberitakan Harian Waspada. 2. PDAM Tirtanadi Cabang Berastagi dalam melayani pelanggan tidak diskriminatif dan memperlakukan semua pelanggan sama sesuai dengan ketentuan yang berlaku di PDAM Tirtanadi. Jadi, tidak benar kalau PDAM TIrtanadi lebnih mengutamakan pelanaggan hotel di Gunung Sinabung dan Gunung Sibayak. 3. Pendistribusian air di Jalan Perwira saat ini memang belum dapat dilayani selama 24 jam karena ada beberapa jeda waktu yang diperlukan untuk mengisi Reservoir Gundaling yang mensupply wilayah Jalan Perwira dan Jalan Kolam. 4. Sampai saat ini wilayah Jalan Lau Gendak belum termasuk daerah pelayanan PDAM Tirtanadi Cabang Berastagi, jadi PDAM Tirtanadi tidak bertanggungjawab terhadap pendistribusian air diwilayah tersebut. 5. Kepala Cabang PDAM Tirtanadi di Kota Berastagi sejak 01 April 2011 dijabat oleh M Kasim Sebayang, S.Kom bukan oleh M Nuh Siregar, SE. Demikian disampaikan, kami harapkan agar klarifikasi ini dapat diterbitkan di SKH Waspada agar tidak terjadi kesalahpahaman. Atas perhatiannya diucapkan terimakasih. Ir Amrun Kepala Divisi Public Relations

Kesenjangan Pendidikan Untuk menjadi siswa di Rintisan Sekolah Bertaraf Internasional (RSBI), mungkin hanya mimpi bagi orang miskin. Siapa sih yang tidak ingin mesuk ke sekolah berkualitas tinggi? Di RSBI, proses pembelajarannya menerapkan teknologi, menggunakan dua bahasa, dengan sarana dan prasarana yang terus ditingkatkan. Tapi, bagi yang bukan berasal dari keluarga berkantong tebal, tak usahlah berharap terlalu banyak. Harian Waspada Jumat (17/6) di rubriik Medan Metropolitan halaman B1 membeberkan, untuk masuk ke sekolah RBSI harus mengeluarkan biaya mencapai jutaan rupiah hingga puluhan juta rupiah. Padahal, banyak siswa dari keluarga kurang mampu, tapi sebenarnya memiliki kecerdasan luar biasa. Tentunya mereka tidak akan mungkin masuk ke sekolah RSBI karena biayanya begitu tinggi. Kalau memang begini adanya, tidakkah sekolah bertaraf internasional hanya menyebarkan kesenjangan pendidikan? Kepala Dinas Pendidikan Sumatera Utara Syaiful Bahri menyebutkan, RSBI bukan semata-mata untuk orang berada saja. Namun diakuinya, untuk mendukung peningkatan kualitas di sekolah tersebut, perlu adanya partisipasi masyarakat seperti dunia usaha serta orangtua siswa. Dikatakannya, semua orang baik yang mampu atau tidak mampu, bisa masuk ke sekolah RSBI. Tentunya dengan cara bersaing. Anak yang tidak mampu, kata dia, bisa masuk, karena pemerintah telah menyiapkan dana Bantuan Operasional Manajemen Mutu (BOMM) dan bantuan beasiswa miskin. Itulah memang teorinya. Tapi, benarkah teori ini sesuai dengan kenyataan? Benarkah anak dari keluarga kurang mampu bisa masuk ke sekolah RSBI? Dari mana pula mereka bisa menyediakan uang jutaan atau puluhan juta rupiah sebagai uang masuk, seperti dibeberkan Waspada. Rosna Stabat

Dedi Sahputra

Foliopini

dedisahputra@yahoo.com

Sydney Joke Gerimis kecil disertai angin dingin cukup membuat sebagian besar rombongan mengkerut kedinginan. Maka pilihan langsung tertuju pada sebuah cafe tidak jauh dari pintu keluar Sydney International Airport. Teh dan kopi panas menghangatkan tubuh. Dengan cekatan pelayan bule itu menuangkan air hangat ke dalam sebuah gelas bertutup. Dia membiarkan beberapa saat daun teh yang dicelupkan itu larut dan mengendap. Dengan segera kamipun menarik gelas itu untuk segera beranjak. ‘’Guys.., I need that tea cup,’’ kata pelayan itu menahan senyum. Rupanya gelas teh itu masih harus dipindahkan ke dalam gelas campuran aluminium dan kertas itu baru bisa dibawa beranjak. Diiringi tatapan bule-bule itu, kamipun berlalu sambil menahan geli. Ini adalah joke pertama sejak rombongan kami menginjakkan kaki di kota Sydney itu. *** Minibus bermuatan maksimal 15 orang itu melaju kencang membelah kota Sydney. Ada Pemred Waspada H.Prabudi Said, ada aktifis lingkungan Dewi Budiati, ada pejabat pemerintah dan ada para wartawan. Suasana di luar sana cukup dingin, tapi di dalam minibus itu terasa hangat dengan joke-joke dari para penumpangnya. Ketika mobil itu mundur misalnya. Ini mengispirasi Dewi Budiati untuk mengeluarkan joke-nya. Ceritanya di Jakarta, seorang pemilik mobil yang asal Medan akan memarkirkan kendaraanya. Baru saja mobilnya masuk ke areal parkir, datanglah mendekat seorang juru parkir yang asal Solo yang baru seminggu lalu sampai di ibukota. ‘’Trus, trus, trus..,’ kata si tukang parkir yang belum pengalaman itu. ‘’Masih bisa lagi? Jauh kali udah kurasa,’’ tanya si supir. ‘’Masih jauh mas, trus, trus, trus…,’’ si juru parkir mengulangi aba-abanya. Tiba-tiba dari arah bekang terdengar suara gedubrak. Buru-buru si supir turun sambil melihat ke bamper mobilnya. Ternyata bagian belakang mobilnya itu penyok karena menabrak sebuah tiang batas parkir. ‘’Kau bilang trus, trus. Tapi kok nabrak…

Dasar taek,’’ kata orang Medan ini memaki kasar. ‘’Bukan.., Bukan taek mas tapi tunggul,’’ jawab tukang parkir dengan tetap kalem. Seisi minibus itu tertawa. Tak mau kalah, si pejabat pemerintahpun berseru, ‘’Di sini ngantrinya tertib ya. Gak ada yang nyelonong. Kalau kita di kampung sudah pakai nomor urut pun masih ada yang nyelonong,’’ katanya. Diapun mulai mengisahkan: Suatu ketika seorang nenek dari kampung dibawa anaknya untuk mengobati sakitnya di Medan. Singkat cerita sampailah mereka di ruang praktek seorang dokter ternama. Saking ternamanya, tiap malam orang mengantri untuk berobat kepadanya. Si nenek pun harus menunggu. 10 menit, 20 menit, setengah jam, sampai menjelang satu jam si nenekpun mulai tak sabar. ‘’Bah yang lamanya,’’ katanya dalam bahasa daerah. ‘’Sabar ya bu,’’ jawab di anak juga dalam bahasa kampungnya. Cukup sudah, batas kesabaran si nenek sudah habis. Diapun beranjak dari tempat duduknya menuju meja resepsionis tanpa bisa dicegah sang anak. ’’Kok lama kali, dokter macam apa ini?’’ teriaknya kepada gadis penerima tamu. ‘’Ibu nomor urut berapa?’’ tanya si gadis sambil tersenyum. ‘’Bah, untuk apa nomor urut-ku,’’ tanyanya. ‘’Untuk masuk ke dalam ruang dokter bu. Kalau tidak ada tidak bisa masuk,’’ jawab di gadis. ‘’Aku ini sudah tua, untuk apa lagi kau minta nomor urut-ku,’’ katanya seraya berlalu. ‘’Ayo pulang kita. Masak dimintanya numur urut orang tua seperti aku ini,’’ kata si nenek diiringi tatapan heran anaknya. Dia tahu, dalam bahasa daerahnya, urut berarti bokong. *** Banyak sekali cerita konyol yang tidak bisa diceritakan satu per satu. Semuanya kemudian dikisahkan dengan berderai tawa. Begitulah berbagai hal yang konyol, pada saatnya akan menjadi cerita yang gembira.(Vol.236, 20/6/ 2011)

Kolom foliopini dapat juga diakses melalui http://epaper.waspadamedan.com

Oleh Emil W. Aulia Tak hanya Utah dan Virginia, ”gerakan” kembali ke koin emas dan perak terus merambah ke sekujur daratan AS

W

ajah sistem ekonomi Amerika Serikat (AS) masa depan sepertinya akan berubah. Sejumlah kalangan di Negeri Paman Sam itu gencar mengusulkan penggunaan koin emas dan perak sebagai alat transaksi. Negara Bagian Utah menjadi pelopornya. Belum lama ini, sejumlah wakil rakyat di sana menyusun rancangan undang-undang terkait hal tersebut. RUU itu telah lolos hingga ke tingkat Kongres melalui pemungutan suara. Jika RUU itu nanti disahkan maka koin emas dan koin perak akan menjadi alat tukar alternatif bagi rakyat Utah selain uang kertas dolar. Utah tak sendiri. Keinginan memakai koin emas dan perak juga berkumandang dari Negara Bagian Virginia. Disarikan dari berbagai sumber, Virginia malah lebih awal mengajukan proposal serupa. Medio Januari lalu, delegasi Partai Republik Virginia, Bob Marshall meminta Majelis Umum mempertimbangkan pencetakan dan penggunaan koin emas dan perak sebagai alat transaksi alternatif bagi warganya. Tak hanya Utah dan Virginia, ”gerakan” kembali ke koin emas dan perak terus merambah ke sekujur daratan AS. Dilaporkan, selusin negara bagian mulai melirik koin emas dan perak untuk alat transaksi. Ide ini bertumbuh di Idaho, South Carolina, New Hampshire, Tennesse, Indiana, Iowa, Oklahoma, Vermont, Georgia, Missouri dan Washington. Nilai Tukar Dolar Keinginan memakai koin emas

dan perak sebagai alat transaksi muncul setelah mencermati krisis ekonomi yang melanda AS beberapa dekade terakhir. Realitas itu membuka pikiran sebagian rakyat AS meneliti ulang sistem moneter yang mereka pakai pasca-kebijakan Presiden Nixon (1971) yang melepaskan keterikatan pencetakan uang kertas dolar AS dari baku emas dan perak. Dalam ekonomi, ini dikenal dengan sebutan fiat money –dolar dicetak dan diedarkan tanpa sandaran emas dan perak. Dolar diterima sebagai alat tukar (mata uang) karena dipaksakan penggunaannya oleh mekanisme politik hukum negara (legal tender). Seiring penerapannya, sistem itu menunjukkan kelemahan. Hari ke hari, grafik kurs dolar AS cenderung merosot. Dolar labil dan rentan gejolak. Lainnya, soal inflasi. Uang kertas cetakan The Federal Reserve itu terus kehilangan daya belinya dari masa ke masa. Ini membuat sebagian warga AS ketar-ketir. Maklum, uang yang mereka simpan tidak lagi aman sebagai medium pelindung harta. Inflasi telah merampok secara tersembunyi hasil kerja keras mereka yang ditabung dalam wujud dolar AS. Semua kekhawatiran itu juga terangkum dalam pertimbangan pengajuan RUU tersebut. Di situ disebutkan pandangan sejumlah ahli yang memprediksi akan terjadi krisis yang disebut dengan ”kehancuran mata uang akibat hiper-inflasi di masa depan”. Ini sekaligus sinyal bahwa dolar, cepat atau lambat, akan menunjukkan wujud aslinya sebagai selembar kertas biasa, tak berbeda dengan kertas lainnya.

Menggunakan koin emas dan perak dipercaya mampu mengatasi dampak buruk fiat money. Disebabkan terbuat dari logam mulia, koin emas dan perak memiliki sejumlah keunggulan dibanding uang kertas. Koin dwi-logam itu bernilai karena bahannya. Bukan seperti uang kertas yang bernilai karena dibubuhkan cetakan angka di atasnya. Grafik juga menunjukkan ketahanan emas dan perak terhadap inflasi. Nilainya stabil bahkan terus menguat. Emas dan perak mampu menjaga daya beli. Beda dengan uang kertas yang nilainya mudah diguncang gejolak, rentan inflasi bahkan manipulasi. Koin Dinar Dan Dirham Aspirasi sejumlah warga AS untuk keluar dari dampak fiat money, beralih ke koin emas dan perak, bukan solusi baru. Umat Islam, jauh-jauh hari sudah memiliki tuntunan lengkap perihal bagaimana tatanan keuangan dijalankan. Dalam Islam, uang mesti terbuat dari emas dan perak. Dalam terminologi Islam, dikenal sebutan dinar dan dirham. Dinar adalah koin terbuat dari emas seberat 4,25 gram (22 karat). Dirham, koin perak murni seberat 2,9 gram. Keduanya digunakan sejak masa kedatangan Rasululah Saw hingga Kekhalifahan Usmani (1921). Selama 1400 tahun, dinar dan dirham digunakan untuk alat menunaikan zakat, sedekah, mahar, tabungan hingga transaksi perniagaan. Allah SWT menciptakan emas dan perak. Dia punya rencana dibalik kuasa penciptaan itu. Menurut al-Ghazali, koin emas dan perak adalah alat transaksi yang memberi keadilan. ”Allah menciptakan dinar (emas) dan dirham (perak) sebagai ’hakim penengah’ di antara seluruh harta sehingga dengan keduanya harta bisa diukur.” Sistem uang kertas yang kini mendominasi dunia sejatinya bermasalah.

Mantan Dirut Bank Muamalat A. Riawan Amin menyebut sistem itu sebagai salah satu pilar keuangan setan (satanic finance) yang menjadi tonggak tegaknya sistem riba moderen. Uang kertas sesungguhnya tidak memiliki nilai selain wujudnya sebagai kertas. Jika uang kertas dirusak atau dibakar maka seketika tidak akan berharga. Bandingkan dengan koin dinar emas dan dirham perak yang sekalipun dibakar atau dirusak, ia senantiasa bernilai karena dari jenisnya memang sudah bernilai. Sistem uang kertas juga menjadi alat kolonialisme moderen. Sistem ini menjadi instrumen penaklukan sebuah negara tanpa perlu pengerahan kekuatan militer. Sebuah negara yang nilai mata uangnya kuat bisa menundukkan negara lain dengan beberapa trik permainan moneter hingga membuat nilai mata uangnya terjungkal. Bila krisis moneter terjadi maka krisis lainnya di berbagai bidang kehidupan gampang tersulut. Kini AS mulai melangkah memilih koin emas dan perak sebagai sistem moneter alternatif. Bagaimana dengan umat Islam Indonesia? Kita tak perlu berkiblat jauh-jauh ke AS. Sudah 10 tahun, dinar dan dirham beredar di Nusantara dan digunakan dalam berbagai aktifitas muamalat sehari-hari, utamanya untuk pembayaran zakat, sedekah, simpanan haji, tabungan pendidikan, mahar dan alat barter sukarela. Koin dinar dan dirham telah hadir sebagai salah satu jalan keluar dari sistem ekonomi ribawi masa kini beserta dampak buruknya. Di atas segalanya, kehadiran kembali dinar dan dirham adalah menjadi jalan awal bagi umat Islam untuk menaati larangan Allah dan Rasul-Nya yang mengharamkan praktik riba. Penulis anggota Masyarakat Ekonomi Syariah (MES) Sumut

Otoriter Dalam Kesantunan Komunikasi Politik Oleh Hari Murti Tindakan-tindakan mereka relatif tak banyak berbeda dengan otoriter yang selalu ingin menang sendiri memaksakan ide-idenya sebagai kebenaran yang absolut

S

antun, dari rasa bahasa kita sehari-hari, nilai maknanya terasa lebih tinggi dibanding sopan. Jika sopan dan santun bersatu dilekatkan pada sebuah karakter komunikasi, maka lengkaplah sudah kepribadian seorang individu sebagai insan yang bijaksana, yaitu “lebih bijak untuk sisi/orang yang sana”, bukan “bijak untuk sisi sini”. Dalam politik, sikap santun mungkin memang karakter pribadi seorang politisi sehari-hari tanpa ada kaitannya dengan profesinya sebagai politisi. Sebagian politisi lainnya memilih sikap santun dalam komunikasinya sebab melihat gaya seperti ini seperti magnet bagi simpati dan dukungan. Pada dimensi yang lain, perkembangan sebuah teori selalu melewati tahapan yang disebut tesis, kemudian muncul antitesis sebagai reaksi negatif atas tesis, lalu keduanya bersatu menjadi sintesis. Pada tahap sintesis inilah sebuah teori bukan hanya praktis, juga cukup efisien. Jika dihubungkan dengan gaya komunikasi politik para elite negeri kita sekarang, maka ketika mereka memaksakan kehendaknya dengan bahasa politik yang begitu diplomatis santun, maka sintesis dari teori komunikasi itu telah muncul. Inilah masa komunikasi politik yang saya sebut sebagai masa kesantunan yang otoriter, yaitu sebuah otoriterianisme dengan menggunakan kesopanansantunan sebagai mekanismenya. Orang terbuai, terlena, dan otoritarianisme itu terasa tak ada karena dibungkus dengan kata-kata yang aduhai lemah lembutnya. Saya sangat berusaha membuat judul yang lebih santun lagi dibanding Otoriter Dalam Kesantunan Komunikasi Politik untuk menggambarkan keadaan komunikasi politik sekarang ini, tapi saya tak berhasil karena kita semua menyaksikan mereka yang di atas sana itu hanya empati dengan perasaan rakyat secara komunikasi oral saja. Tindakan-tindakan mereka relatif tak banyak berbeda dengan otoriter yang selalu ingin menang sendiri memaksakan ide-idenya sebagai kebenaran yang absolut. Rakyat hanya diberi pengertian-pengertian dengan bahasa yang eufemistis retoris bahwa apa yang menjadi pertentangan antara pemimpin-pemimpinnya dengan rakyat tentang sebuah topik hanya disebabkan ketidaktahuan rakyat, bukan akibat pemimpinnya yang tidak aspiratif terhadap rakyat. Lihatlah otoriter yang santuan itu. Rakyat protes ada kolam renang di gedung DPR, namun beberapa anggotanya dengan lugas, retoris, dan santun mengatakan kolam untuk penyimpanan air untuk mengantisipasi kebakaran. Dan, di tengah aspirasi keprihatinan rakyat, pembangunan gedung itu pun tampaknya akan terus berjalan seolah menunjukkan ketidakpedulian. Ada yang kena protes karena mengeluarkan pernyataan tak berempati dengan korban bencana, ia malah mengatakan maksud hatinya bukan se-

perti itu. Ya ... ampun, mana ada orang lain bisa tahu isi hati orang kecuali Tuhan dan orang itu sendiri. Tapi ketika kata hati diucapkan ketika memberi klarifikasi, semua menjadi terasa rasional, logis, menyintuh, dan baik-baik saja. Setiap hari, kita melihat sebagian petinggi negeri ini begitu cakap dalam menglarifikasi berbagai hal dengan bahasa yang santun, tetapi tetap bersebarangan dengan rakyat. Ada juga yang selalu memilih sikapnya sendiri sebagai kebenaran dan segera mengatakan bahwa mereka bukan antikritik ketika rakyat mulai gerah dengan kengototannya yang lembut itu. Di sisi lain, ada pula rakyat yang begitu menutup hati ada pemimpinnya dengan bahasa-bahasa sederhana, namun dramatis. Inilah zaman komunikasi santun yang otoriter itu. Dulu, otoritarianisme itu sudah cukup tertutupi dengan kemampuan retorika dalam orasi, tanpa kesantunan yang begitu aduhai lembut nian. Pada Perang Dunia II, kita mengenal diktator seperti Hitler atau Mussolini yang begitu mahir dengan suara yang meledak dan kadang sangat keras. AS bahkan mendirikan sebuah lembaga kajian komunikasi sebagai reaksi kekaguman dan ketakutan pada kemampuan orasi orang-orang seperti Hitler itu. Hitler sangat berpengaruh dan “berhasil” membawa negaranya ke jurang kehancuran dengan kemampuan komunikasi politik yang otoriter, namun retoris yang dimilikinya itu. Pasca-Perang Dunia II, retorika dan propaganda konvensional seperti Hitler mulai tak laku. Mereka para komunikator politik kemudian menyintesiskan metode komunikasi yang instruktif dan kuersif (tesis) dengan persuasif (antitesis) menjadi sebuah metode konvergensif yang menantang ilmu komunikasi untuk memberinya konfirmasi ilmiah. Inilah gaya komunikasi politik para elite kita sekarang, sebuah sintesis dari metode sebelum-sebelumnya. Tapi, fenomena komunikasi ini lebih dulu lahir praktiknya dibanding teorinya sehingga saya tak punya istilah ilmiah umum kecuali menyebutnya sebagai komunikasi politik yang santun, tetapi otoriter. Atas fenomena komunikasi politik sekarang ini, saya merasa sangat nyaman mengutip salah satu syair lagu Ebiet G. Ade untuk menggambarkannya. “Kegaduhan ini begitu sepi”, katanya. Ya memang, kegaduhan politik kita akibat pemimpin-pemimpinnya yang tidak aspiratif begitu sangat tenang di permukaan seolah tak ada masalah dalam demokrasi kita ini. Padahal, di tingkat yang lebih dasar, kita melihat rakyat dan pemimpin-pemimpinnya mulai saling bersikap otoriter dengan bahasa yang lembut. Ada yang membawa kerbau ke lokasi demontrasi, ada yang selalu menyebutnyebut rakyat-rakyat, ada yang menjadi tersangka kasus mafia pajak yang sambil meneteskan air mata malah meminta menjadi staf ahli. Ketika de-

ngan rasio kita berpikir maling harus ditangkap maling juga, permintaan itu masuk menjadi bahasa politik yang sopan walaupun tidak santun. Alamiah Ilmu itu bersifat aplikatif. Agar seseorang bisa mencapai tujuannya, maka ia harus mengaplikasikan ilmu dan meninggalkan cara-cara tradisionalnya. Dalam kita berkomunikasi, kita sering terjebak dalam tradisi dan sesekali juga melaksanakan teori ilmiahnya. Artinya, sikap alamiah dalam berkomunikasi terkadang harus ditinggalkan ? Tidak! Ia harus dikombinasikan dengan komunikasi yang ilmiah. Dengan begitu, komunikasi politik menjadi berenergi. Pemimpin itu memang mengatur dalam komunikasinya, kalau perlu dengan sedikit memaksa jika diperlukan. Nah, di sinilah komunikasi yang alamiah dan ilmiah itu harus bersatu untuk memunculkan energi sehingga rakyat bisa membedakan mana pemimpin yang mengatur dan mana yang otoriter. Pemimpin yang mengatur memberi klarifikasi yang sederhana dan membumi dalam konfirmasinya ketika mendapat penolakan. Pemimpin yang otoriter menjawab dengan menambahi nuansa keotoriterannya dalam komunikasi. Sedangkan pemimpin yang santun dalam keotoriterannya sulit dipahami komunikasinya. Maka, dibutuhkan karakter alamiah dan setara dengan kemampuan komunikasi rakyat dari pemimpin da-

lam berkomunikasi. Tidak perlu sepenuhnya menjadi seperti apa yang ada dalam buku atau terlalu bersikap antiilmiah karena sikap itu tidak alamiah juga. Lakukan saja komunikasi politik dengan apa adanya karena itu justru akan membuat komunikasi politik seorang pemimpin mencapai tujuannya, yaitu perobahan pengetahuan, sikap, dan tindakan rakyat. Komunikasi politik yang santun saja, tetapi tidak aspiratif dengan rakyat, menjadi seperti apa yang dikatakan Ebiet G. Ade, “Kegaduhan ini begitu sepi”. Minim sekali titik temu antara rakyat dengan pemimpinnya dalam kesantunan komunikasi. Lalu, untuk apa semua itu. Lihatlah, aspirasi rakyat tidak neko-neko, sekedar ingin menggunakan dana negara untuk yang lebih penting dibanding membangun gedung DPR. Bukankah yang kita lihat sekarang ini adalah aspirasi rakyat tentang wakilnya harus kalah oleh kesantunan argumentasi mereka yang mendukung pembangunan gedung ? Maka, sebaiknyalah mendengarkan aspirasi rakyat dalam komunikasi politik. Santun perlu, sopan apalagi. Namun, jangan sampai kesantunan itu hanya sekedar santun, tanpa mau sinkron dengan rakyat dalam tindakan. Lama-lama, kesantunan yang semu akan dianggap rakyat sebagai semiotik semata. Penulis adalah pemerhati komunikasi politik. Alumnus STIK “Pembangunan” Medan


B6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 320i Limited Edition Ungu met Th. 95, Ex Dokter. A/n. Sendiri, Sgt mewah dan mulus, Full Sound System. Hrg. 62Jt. Nego. Hub. 0812 64777088 DAIHATSU Feroza ‘93 Dijual, Biru Exclusive MT 85%, Ban Serap 100% AC dingin, PS, CL, Body kaleng dan mulus Serius hub. 0852.7630.2013, TP

DAIHATSU PROMO DAHSIAT Beli Xenia dapat terios. Xenia angs 2,885/bln Hub. DIKA 0852 7074 7744 / 061.77443877

DAIHATSU Espass Pick Up Thn. 2004, Warna hitam. Harga Rp. 38,5 Juta/ nego. Hub. 0813 7070 1176 PROMO ASTRA DAIHATSU Undian Hadiah 1 Milyar/Bln

Xenia Sporty DP 14 Jt-an, Terios DP 18 Jt-an Hub. IQBAL. 0813 61007 907 (data dijempuat)

DAIHATSU BARU PAKET MURAH Xenia Li......DP 12 Jt-an.......Angs. 3 Jt-an Terios..........DP 18 Jt-an.......Angs. 3 Jt-an Luxio...........DP 8 Jt-an........Angs. 3 Jt-an Pick Up.......DP 7 Jt-an.........Angs. 2 Jt-an Hub. PT. CAPELLA MEDAN (JOSUA) 0812 6311 0820

PAKET DAIHATSU MURAH

Gran Max Pick Up DP 8 Jt-an Angs. 2 Jt-an Xenia 10 Deluxe DP 12 Jt-an Angs. 3 Jt-an Terios TS Xtra DP 16 Jt-an Angs. 4 Jt-an Luxio D DP 6 Jt’an Angs. 3 Jt-an Sirion Type D DP 8 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 63154132 - 061.77402067 ISUZU Panther Grand Deluxe Blue Grey Met th. 95. Sudah model Th. tinggi, sgt mulus, VR, BR, PS, PW, CL, AC, Sound System, Hrg. 60 Jt Nego. Hub. 061-6967 9753

KIA

Mobil

NEW PRIDE (READY STOCK)

PROSES CEPAT, BONUS BB TORCH / ONYX TERIMA TUKAR TAMBAH HUB. MELI 0852 7830 5777 / 061.9138 3575

KIA Travello Thn. 2010, Silver, BK Medan asli, pakai Dari Baru, Over Kredit DP 68 Jt/Nego. Angsuran 26x6.045.000. Hub. 0813 6215 1688

MITSUBISHI 100% BARU

T120PU DP 13 Jt-an Ang. 3 Jt-an 1300PU DP 30 Jt-an Ang. 3,6 Jt-an Colt Diesel Hub. 0813.9799.0818

DEALER RESMI SUZUKI MOBIL

Carry PU 1.5 FD Rp. 8 Jt-an ..Angs. 2.489.000,APV Rp. 12Jt-an ...........Angs. 3.705.000,New Karimun Rp. 9 Jt-an..Angs. 3.302.000,Splash GL RP. 13 Jt-an ...Angs. 3.744.000,Swift ST DP 16 Jt-an ...Angs. 4.354.000,SX4 DP 19 Jt-an ........Angs. 5.357.000,Hub. 0812 654 0809 / 77722121

TOYOTA Kijang LGX Thn 2003, Warna Silver, BK Medan asli 1 nama dari baru Hub. 0853.7309.2254 *TOYOTA BARU*

Pesan sekarang & Dapatkan hadiahnya Ready: Avanza, Innova, Fortuner, Yaris, Cash & Kredit. Hub. 0812 6048 1001 TOYOTA Kijang Capsul LGX Diesel A/n. Sendiri. BK Medan Th. 2002. Biru mika, sgt mulus orisinil, mesin sehat, terawat, Full sound system. Pake TV. Harga 135 Jt Nego. Hub. 0821 6811 9355 TOYOTA Kijang Commando NCH Short, 5 pintu, 6 Speed Th. 91. Sgt mulus luar dalam, VR, BR, CL, Rmt, RTP, AC Dingin. Hrg. 48 Jt. Nego. Hub. 061-77700712

7 CM 8 CM

Rp. 91.000 Rp. 104.000

BURSA BUTUH DANA DANA EXPRESS SHM, SK Camat 1 Hari Clear Tanpa usaha 0813 6229 0001 0812 6095 5531 (Henrik) BUTUH DANA CEPAT

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633

BURSA

PELUMAS

TOYOTA Kijang Krista 1,8 Bensin Thn. 97, BK Mdn, W. Biru silver, Komplit. AC DB, Tape, VR, BR, CL, PS, PW, Jok asli Mulus. Original. body kaleng BU. Hub. HP. 0812 60212106 Mdn

MOBIL DICARI OVER KREDIT HONDA JAZZ/ CRV/ INNOVA/ FORTUNER/ AVANZA CASH PUN OK !!! H. IPUL: 0812.6038.5555 / TELP/ SMS BURSA BUTUH DANA BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

Mulai 18 Jt-an atau Angsuran 2 Jt-an

Fasilitas Member Astra World

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms TI-HA TI untuk membeli produk anda, dan HA HATI-HA TI-HATI apabila anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu,

BURSA

BUSANA & ASESORIS

Kijang Inova 2009, BK Mdn, Cat mulus, Lengkap TV + DVD AMP3 Satu tangan Hub. (061) 7788.5384

TOYOTA Kijang Super 1.8 1995. AC DB, CL, PS, VR, BR, Tape, CD, DB Sedan, Abu2 metalic. Mulus/body kaleng. Jarang pakai. BK Panjang. Bln. 12. HP. 0852 6120 0454 / 0813 96315 789. 65 Jt Nego.

11 CM Rp. 165.000 12 CM Rp. 180.000

061-4576602. Terimakasih

DIJUAL CEPAT

TOYOTA Kijang Commando NCH 1,5cc Short 6 Speed Th. 86. Lampu Gril Grand, Wrn Hitam met, VR, BR, RTP. Hrg. 33 Jt. Nego Abis. Hub. 0812 6063 7823

9 CM Rp. 126.000 10 CM Rp. 140.000

silahkan hubungi kami di

TOYOTA Avanza Th. 2006. Type G. BK Medan Cat dan mesin mulus, siap pakai Jual Cepat. Hub. HP. 0811 652506. Jl. Suluh No. 19 D Mdn.

DP

* Syarat dan Ketentuan Berlaku

Rp. 65.000 Rp. 78.000

SUZUKI Katana 89. W. Hitam, BK Mdn/ Panjang. VR, Tape DVD, AC Baru, 31 Jt/ Nego. 0813 9789 9288 / 0852 7002 7313

KESEMPATAN MENANG BESAR

DP Mulai 25 Jt-an atau Angsuran 3 Jt-an

5 CM 6 CM

SUZUKI Katana Model Tinggi Ban Besar Th. 95. Hitam met Orisinal. Semuanya sehat, Full S. System. Hrg. 50 Jt. Nego. Hub. 0821 6811 9388

WASIR/ AMBEIEN

PECI MAHKOTA

Garansi 10 Hari Sembuh Tanpa Operasi Hubungi Spesialist Wasir

SERVICE/ASESORIS MOBIL

PIJAT & LULUR

‘MULIA JAYA’ POWER STEERING

BERSEDIA DIPANGGIL HUB. 0813.7739.9508

Jl. Brigjend. Katamso No. 683C Medan ( ± 50m dari Simpang Pelangi) HP. 0852.9751.4253 - 0812.6050.0881

BURSA

- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954

BURSA

MENJUAL PECI TEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan

MBAK ALIN

TERAPI VITALITAS PRIA

H.G.A. FACHRUDIN

Jadikan Pria Jadi Idaman Para Wanita

Jl. Setia/ Gaperta Ujung No. 2 T. Gusta

“H. MOHD. RAWAL” Ciri2 Ambeyen: Disekeliling Dubur Ada Benjolan Seperti Daging Tumbuh/Jerawat, Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur Seperti Luka, Solusinya Datang dan Berobatlah ke

“H. MHD. RAWAL” PUSAT:

Jl. Prof. H.M. Yamin S.H No. 251 A Simpang Pahlawan Tel.(061) 4563067 Cabang I

Jl. Bunga Harum (Benteng) No. 26 Suka Jadi Telp. 0761-45368 -HP. 0812 6568 700 Pekan Baru Telp. (0761) 45368 HP. 0812.656.8700 Cabang II: Komp. Perhub. Laut Jl. Baruna II/II Telp. 0765 36906 HP. 0852 6201 0594, 0812 60311 695 Dumai

SPECIALIST MATA TANPA OPERASI Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll

Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan sampai tuntas, Insya Allah

Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar web: ffaridar aridar awal.com aridara

FAX.4561347 HARGA BELUM TERMASUK PPN 10%

AMANAH UMROH PAKET RAMADHAN

UMROH AWAL, PERTENGAHAN DAN FULL RAMADHAN UMROH RAMADHAN 9 HARI UMROH RAMADHAN 14 HARI UMROH FULL RAMADHAN 30 HARI UMROH REGULER 9 HARI TGL 11 JULI 2011 UMROH REGULER 14 HARI TGL 13 JULI 2011

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

PAKET HAJI PLUS NON KLOTER 2011

Langsung Berangkat ! Tidak Perlu Ngantri ! JADWAL KEBERANGKATAN UMROH 1, 15, 20 JULI/ 3, 10, 17, 24 AGUSTUS

PAKET HAJI Haji Plus

FASILITAS PENGINAPAN HOTEL BERBINTANG PENERBANGAN VIA SINGAPORE KHUSUS BAGI JEMAAH DARI LUAR KOTA NGINAP DI HOTEL MADANI GRATIS

CALL CENTER: (021) 9862000 0878 8200 0020

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222 - 0821.6655.1222

KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

Dengan H. TEJA SAEFUL

Cucu Asli Mak Erot Bersama

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

A. AMARUDIN

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG : 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6057.6444

SANGGAR SUPRANATURAL ILMU HIKMAH & KEBATINAN OLEH: MASTER GENDAM

USTADZ AGENG PANGESTU

FORUM KOMUNIKASI DAN PENYEMBUHAN ALTERNATIF INDONESIA IZIN DEPKES. 448/15830 - IZIN KEJATI No. B270/DSP5.08 1. Gendam Asmaradhana (Solusi Kilat) Problem asmra dan rumah tangga 2. Gendam pedotshih (pemutus hubungan asmara dan perselingkuhan PIL dan WIL) 3. Puter Giling (menarik/ memanggil orang yang minggat, kabur) Insya Allah, Suami, Istri atau Pacar dalam waktu singkat akan kembali dengan cepat 4. Asmara Gay/ Lesby/ Hypersex 5. Susuk aura, pemikat, pemanis, pengasihan, kecantikan dan ketampanan 6. Penglarisan dagang, kedai, rumah makan/ restoran GARANSI jual beli tanah dgn cepat TUNAS 7. Penyembuhan segala macam penyakit medis - non medis (kutukan, keturunan, bawaan dan guna-guna) 8. Keluhan khusus pria (ejakulasi dini dan impotensi) 9. Pengobatan/ penyembuhan alternatif bisa jarak jauh

BUKA TIAP HARI DARI PUKUL 08.00 Wib s/d 23.00 WIB Kantor: Jl. Puri (±300meter dari RM. Famili Jl. Sisingamangaraja) No. 57F Medan Telp. (061) 7678.1087/ 0813.6246.7777 - 0813.7040.5888

14 Hr Rp. 17 Jt 11 Hr RP. 15 Jt 14 Hr Rp. 18 Jt RP. 22 Jt

KLINIK TRAPI ALAT VITAL MAK HJ. ICOT Ditangani langsung

Hub: (061) 7365429 - 7362887

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

US.8.000 US.7.500 US.7.300

H. UST. YUSUF/ H. ABIDIN

Dpt Diperoleh di Sumatera - Aceh

BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna

HARGA (USD)

Al - Anshor Starap

Starap

WASIRI Wasiri berani menjamin kesembuhan tuntas ambeien/wasir anda. Sangat berkhasiat dan cepat menghilangkan ambeien. Wasir yang menonjol maupun yang tumbuh di dalam. Redakan rasa sakit, perih dan menghentikan pendarahan waktu buang air besar, mencegah infeksi dan panas dalam serta melancarkan buang air besar.

MADINAH

Starap

UMROH RAMADHAN FULL RAMADHAN

Office: Gedung Gelora Plaza Lt. 1 Jl. SM. Raja No. 4/ 18 Medan Telp. (061) 732.6981 / 0813.7503.1889 - 0852.6213.3488

(Untuk Ambeien)

MAKKAH Grand Shafa

PROMO UMROH

A. Ust OTONG

BUSANA & ASESORIS SPECIALIST AMBEYENT TANPA OPERASI PUTUS SAMPAI KE AKAR2NYA DIJAMIN TDK SEMBUH UANG KEMBALI GARANSI

Senin, 20 Juni 2011

BALAI PENGOBATAN TRADISIONAL

ALAT VITAL

DITANGANI OLEH AHLINYA: M. SUHERDI

DARI PELABUHAN RATU SUKABUMI JABAR

Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat

MENANGANI KELUHAN: MENAMBAH UKURAN

-

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

MINI & EFEKTIF IKLANKAN PRODUK ANDA


Agenda

WASPADA Senin 20 Juni 2011

Deteksi Orbitkan Meggie

Kue Ulang Tahun Momo Geisha Momo, penyanyi grup musik Geisha dibikin kejutan oleh fansnyadiMedan.Diatakmenyangka para penggemarnya sudah m e n y i a p k a n k u e Ul a n g Tahunnya ke-25 di Garuda Plaza HotelMedanSabtu(18/6)malam. Para fans-nya yang disebut My Geisha, secara diam-diam sudah menantinya di lobi Garuda Plaza Hotel tempat dia menginap bersama grupnya serta bandbandlainyapengisi pentas Pound diantaranya J Rocks, Sma*sh dan The Changcuters. Sekitar pukul 22.30 Momo

turun dari kamar hotelnya langsung menuju Coffee shop. Belum lama duduk santai, dia sudah repot melayani penggemarnyamintafotobarengserta memintanya menuju area lobi yang memang sudah menunggu My Geisha dengan kue Ultahnya. Momo melihat iringan fans membawa kue Ulang Tahun bertuliskan angka 25 menjadi terharu serta terperanjat.“Terima kasih...terimakasihMyGeishaku”, tuturnya sembari tak bisa menyembunyikan perasaan harunya.

DiiringitepuktanganparaMy Geisha, Momo kemudian meniup lilin diiringi foto bersama dengan para fansnya. Dia juga menyatakan bangga sekali melihat antusias para penggemarnya sambil menanyakan apakah mereka tadi melihatnya di panggung. Momo memang tidak bisa berlama-lama meladeni para penggemarnya, karena makin lama makin banyak saja yang mengerubuninya. Akhirnya para kru membawanya keluar hotel.(m12)

Waspada/t.junaidi Momo Geisha bersama My Geisha usai meniup lilin Ulang Tahunnya ke-25 di Lobi Garuda Plaza Hotel Medan Sabtu (18/6) JUAL RUMAH PERMANEN U/ 12x22, 4 Kamar Tidur, 3 Kamar Mandi, 1 Ruang tamu di JL. Budi Luhur Gg. Aneka No. 106C H u b . 0 8 1 3 . 7 0 6 3 . 0 6 7 7 - ( 0 6 1 ) 3010.6317 dengan H. Safi’i, SH (Junaidi. S)

RUMAH DAN TANAH LUAS

Jl. Bambu No. 51 Dekat Brayan Center, SHM, LT. 624, COCOK UNTUK DEVELOPER, Bisa bangun 7 unit Rumah, Harga 450.000/meter (nego) Hub. 0852.9700.1251

TANAH TANAH & BANGUNAN DIJUAL

Luas 580m & 702meter, Sertifikat di Jl. Balam Sei Sikambing B Medan (dekat Ringroad Jl. Gagak Hitam) Peminat hub. Amri 0811.647.434

2 BIDANG TANAH DIJUAL

MINI & EFEKTIF IKLANKAN PRODUK ANDA

BURSA

PENDIDIKAN

RENANG

Belajar s/d MAHIR, TIKET Kolam Gratis selama latihan Hub. TEDI HP. 0852.6086.7851

LOWONGAN PENGAJAR B. INGGRIS

Syarat: * Mahasiswa/ D3/ S1 B. Inggris * Berpengalaman dikursus/ disekolah min. 1 tahun * Menguasai Conversation dengan baik Lamaran diantar langsung ke:

GEMILANG EDUCATION CENTRE

TERAKREDITASI BAN PT dan DEPKES RI

: Jl. Aksara 130 Telp. (061) 735.6625 (depan Ramayana Aksara Medan) P. SIANTAR : Jl. A. Yani 10 Telp. (0622) 703.0999 (samping Radio BOSS FM)

Jl. Pancing/ Willem Iskandar 116 Telp. (061) 662.1202 - 662.1201 MEDAN

Informasi Pembaca Bursa Property

AKBID WIDYA HUSADA IZIN DIKNAS No. 249/D/O/2002 IZIN DEPKES No. HK.03.2.4.1.2203

MENERIMA MAHASISWI BARU ANGKATAN X T.A. 2011/ 2012

Bagi tamatan SMA/ SMK/ ALIYAH/ SPK

Testing Gel I: 7 Juli 2011

Informasi lengkap: 1. Dr.dr.H. Wirsal Hasan, MPH, HP. 0812.639.88388 2. dr.Hj. Sundari Syarif HP. 0811.618.011

MEDAN

BURSA

PROPERTY

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

RUMAH DIJUAL

L. Tanah 14x25m, Bangunan 8x12m, SK Camat, 3 Km Tidur, 2 Km Mandi, Dibangun Thn 2008, Lokasi Jl. Utomo No. 92 Desa Bakaran Batu Kec. Batang Kuis, lewat Tembung Hub. 0813.6171.5656

RUMAH DIJUAL

LT. 148m² (8x18,5m), LB. 120m² di Komp. Permata Hijau No. 5 Mulirejo Sunggal/ Sunggal, SHM Harga 250 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

RUMAH 2 LT DIJUAL

MAGISTER (S2) ILMU PETERNAKAN FAKULTAS PERTANIAN UNIVERSITAS SUMATERA UTARA

MENERIMA MAHASISWA/I BARU T.A.2011/2012 Syarat Pendaftaran : * Sarjana (S1) dari berbagai disiplin Ilmu, yaitu; Peternakan, Pertanian, Biologi serta bidang ilmu yang relevan; * Mengisi Formulir Pendaftaran dan kesediaan mengikuti seleksi; * Melampirkan Fotocopy Ijazah dan Transkrip yang dilegalisir * Pas photo 3x4, 4x6 masing-masing 4 lembar. PENDAFTARAN :

Tgl 1 Juni s/d 22 Agustus 2011 Lokasi : Gedung DH Penny Fakultas Pertanian USU Jl. Prof. A. Sofyan No.3 Jam Kerja 09.00 – 16.00 WIB Info lebih lanjut hub :

Hendra Syahputra, SE/081362374336 email : peternakan-s2@usu.ac.id webside : http://peternakan-s2.usu.ac.id

POLITEKNIK NEGERI MEDAN Bekerjasama Dengan PT. PLN (Persero)

Menyelenggarakan Pendidikan Diploma III Program Studi Teknik Listrik untuk menjadi Calon Karyawan PT. PLN (Persero) Persyaratan peserta P e s e r t a p ro g r a m h a r u s m e m e n u h i persyaratan sebagai berikut: 1. Warga negara Indonesia lulus SMK jurusan Listrik atau SMA/ MA sederajat bidang IPA 2. Tahun kelahiran 1991 atau sesudahnya untuk penerimaan Angkatan II (Kedua) tahun Akademik 2011/ 2012 3. Belum menikah dan sanggup tidak menikah selama pendidikan 4. Tidak memiliki ketunaan yang menggangu kelancaran program studi dan pekerjaan 5. Berbadan sehat dan tidak buta warna 6. Bebas narkoba, dinyatakan dengan melampirkan surat pernyataan bermaterai dari yang bersangkutan 7. Melampirkan surat keterangan berkelakuan baik/ keterangan dari POLRI (dapat dilengkapi setelah lulus ujian tertulis) 8. Lulus ujian masuk/ seleksi penerimaan 9. Bersedia ditempatkan diseluruh Unit PLN yang ada Indonesia, dengan melampirkan surat pernyataan bermaterai Jadwal Pelaksanaan: Pembelian Formulir: 17 - 22 Juni 2011 Pengembalian Formulir: 17 - 23 Juni 2011 Ujian tertulis: 25 Juni 2011 Pengumuman Hasil Ujian Tertulis: 28 Juni 2011 Registrasi: 30 Juni - 1 Juli 2011 Tes kesehatan, Psikotes dan Wawancara: 3 Juli - 2 Agustus 2011 oleh PT. PLN*) Pengumuman Hasil Akhir: 4 Agustus 2011*)

Informasi:

Politeknik Negeri Medan

Jl. Almamater No. 1 Kampus USU, Medan 20155 Telp. (061) 821.1235 Ext. 111 *) jadwal ditentukan oleh PT. PLN

LT. 393m² (12x30m), 5 Kmr Tidur, Jl .Bukit si Guntang Kel. Glugur Darat II Kec. Medan Timur, SHM, Harga 1M/ nego Hub. 0813.7021.5212 - 0819.643.206

RUKO 2 LT DIJUAL

RUMAH 228 JT/ NEGO

Luas 10x23m, SERTIFIKAT, 3 K. Tidur, K. Mandi, Dapur, R. Makan, R. Tamu, Keramik, Garasi, Listrik, PAM Jl. Srikandi Gg. Terusan No. 10 Kec. Medan Denai, H. Lukman 0813.7050.0890 - (061) 735.2345

DIJUAL RUKO 2 LT

LT. 80m² (4x20m) di Jl. Kangkung Kel. Petisah Hulu Kec. Medan Baru, SHM Harga Rp. 550 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

DIJUAL RUKO 2 TKT

LT. 85m² (4,15x20,5m), LB. 4x18m di Jl. T. Amir Hamzah No. 10A, SHM Harga 650 jt/nego Hub. 0813.7021.5212 - 0819.643.206

DIJUAL RUMAH LT. 311m² (10,35x30,4m), LB. 119m² Jl. Garu VI No. 28 Kel. Harjosari I Kec. Medan Johor, SHM Harga RP. 450 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

DIJUAL RUMAH KIOS

LT. 390m², LB. 160m², Lokasi di Jl. Sei Batang Hari Sudut/ Jl. Sei Ular Baru No. 71 Kel. Babura Sunggal Kec. Medan Sunggal/ SHM Harga RP. 800 Jt/nego

Hub. 0813.7021.5212 - 0819.643.206

RUMAH 1,5 LT DIJUAL

LT. 159m² (10x16m), LB. 150m² Jl. Pertiwi No. 4 Kel. Binjai Kec. Medan Denai, Harga Rp. 350 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

RUKO 2 LT DIJUAL

LT. 92m² di Jl. Sentosa Baru No. 23 C Kel. Sei Kera Hilir-II Kec. Medan Timur/ SHM, RP. 450 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

TANAH DIJUAL

LT. 774m² di Jl. Pelajar Gg. Pribadi Kel. Teladan Timur Kec. Medan Kota/ SAPHDGR Harga Rp. 350 Jt Hub. 0813.7021.5212 - 0819.643.206

TANAH DIJUAL

LT. 148,29m² Lokasi di Kel. Desa Lubuk Pakam Kab. Deli Serdang/ SAPGR Harga 80 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

TANAH DIJUAL

LT. 8.816m² di Jl. T. Amir Hamzah Desa Perdamaian Kec. Binjai Kab. Langkat/ SHM Harga Rp. 500 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

2 BIDANG TANAH DIJUAL LT. 3.723m² dan 2.921m² lokasi di Desa Jonggir Leto Kec. Panai Kab. Simalungun, SHM Harga Rp. 900 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

38 BIDANG TANAH DIJUAL

LT. ±239.902m² Lokasi Desa Sukasari Kec. Jati Luhur, Kab. Purwakarta Prov. Jawa Barat, SHM Harga Rp. 1M/ Nego Hub. 0813.7021.5212 - 0819.643.206

2 BIDANG TANAH DIJUAL

LT. 556m² dan 994m², Lokasi JL. Talun Sungkit Kel. Tiga Raja Kec. Girang Sipamngan Bolon, Kab. Dati II Simalungun, SHP Harga 150 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

TANAH DIJUAL

RUMAH DIJUAL

RUMAH DIJUAL

LT. ±1.176m² di JL. Bandar LabuhanDusun V Desa Bandar Kec. Tanjung Morawa Kab.Deli Serdang/SHM Harga Rp. 325 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

LT. 124m² Jl. Utama Link. VII Kel. Kotamaksum IV, Kec. Medan Area, SHM Harga Rp. 550 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

LT. 395m², LB. 200m² Lokasi Jl. ELang No. 7 Medan, SHM Harga Rp. 650 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

DIJUAL

RUMAH DIJUAL

DIjual Rumah 2 pintu, Uk. 8x18m Jl. Veteran Gg. Swadaya Psr. 7 Helvetia Hub. HP. 0821.6514.6797

Jl. Mesjid Baiturrahman Gg. Swadaya No. 20 Binjai, Luas 220m², Kamar 3, Kamar Mandi 3, Ruang Tamu 1, Ruang keluarga 1, Dapur 1

RUMAH DIJUAL MURAH

RUMAH DIJUAL MURAH

Jl. STM/ Jl. Suka Aman No. 15 A LT. 148m², 3 KT, 1 KM Harga 280 Jt/nego Hub. 0812.6352.5310 - 0812.6300.6778

LT. 1.183m² dan 3.225m², Lokasi di Kompleks Petrum PT. TOzai 1 lama Kel. Setia Negara d/h Kel. Bah Kapul Kec. Siantar Martoba Pematang Siantar, SHGB Harga 425 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

LT. 21.009m² (Rp. 65.000/meter) Nego di Jl. Limau Mungkur Gg. Sederhana Desa Bangun Rejo Dusun VII Kec. Tanjung Morawa Kab. Deli Serdang/SPPATDGR Hub. 0813.7021.5212 - 0819.643.206

LT. 1.930m² di Jl. SM. Raja Km. 6,5 Medan sebelah Stasiun SIpirok Ekspress/ SHM Harga Rp. 6M/ Nego Hub. 0813.7021.5212 - 0819.643.206

Hub. Pay 0819.7888.000

Jl. Kapten Sumarsono Gg. Residence No. 177/A & 177 (depan Pengadilan Agama), SHM, Tingkat 3, LT. 135m², P: 15, L: 9, Harga nego HP. 0812.6059.3875

B7

TANAH DIJUAL

DIJUAL MURAH (B.U)

1. Tanah 15x50 = 750m² SHM Jl. Kasuari Medan, LOKASI STRATEGIS COCOK UNTUK RUMAH, KANTOR BANK, SWALAYAN, HOTEL, KLINIK, BENGKEL, RUKO DLL HARGA HANYA Rp. 3 Jt/m² 2. RUKO 3 TINGKAT LB. 6X16M, LT. 6X24M, SHM Jl. H.M. Yamin, Medan, LOKASI STRATEGIS (NEGO) 3. TANAH SHM 5300M² Jl. Lintas Tebing Tinggi - MEDAN SANGAT STRATEGIS (PAGAR 2M KELILING) COCOK UNTUK GUDANG, PROPERTY, RUKO, RESTORAN, DLL, HARGA HANYA Rp. 500.000/M² 4. LADANG SAWIT SHM + Akte Camat Seluas 34 Ha di Pinggir Jalan Lintas, Hasil dijamin sudah 20 Ton/ bulan, Umur tanam 4-5 tahun Bibit Marihat - Kondisi tanaman sangat baik, Hanya Rp. 3,5 Milyar 5. RUMAH DI KOTA TEBING TINGGI + SHM Lokasi strategis, LT. 180m², LB. 90m², Hanya Rp. 295 Jt 6. Tanah strategis di Kota Tebing Tinggi + SHM COCOK BUAT RUMAH, Seluas 800m² HUBUNGI: 0821.6814.9800 / 0812.621.6442

Deteksi Records kini menaungi artis pendatang baru mulai mengorbitkan penyanyi perdananya di tahun 2011 ini seorang penyanyi solo asal Pulau Bangka- Meggie untuk para pecinta musik di Indonesia. Meggie atau akrab disapa Memey lahir di Jakarta 24 Maret 1990. Sosoknya yang cantik ini mempunyai karakter berbeda dengan solois lainnya di Indonesia, range vokalnya khas serta penampilannya merupakan kelebihan yang hendak diperkenalkan kepada para pencita musik di Indonesia. Di single perdananya ini,

Meggie hadir dengan kemasan format single mengusung lagu karya Deddy Ramon berjudul Suka-Suka. Lagu bergenre pop masih mengangkat tema jatuh cinta ini menjadi peluru pertama diluncurkan Deteksi Records dengan harapan dapat menembus pasar di industri musik Indonesia. Di sela-sela konser Pound di Lapangan Brimob Medan Sabtu (18/6) yang dia juga turut tampil membawakan tiga lagu serta menjadi bintang tamu di penampilanJRocks,Meggiemenyatakan senang mendapat kesempatan, selain mempelajari sesuatu yang barudidunianyanyiyangmema-

ng menjadi impiannya sejak kecil. Kesempatan diberikan pihak label, tidak disia-siakannya untuk belajar dan terus mengasah kemampuannya.SemangatMeggie cukup beralasan, karena selain didukung tim managemen dan para musisi yang terlibat pun memberikan kontribusi penuh. Hal ini dapat dilihat dari pembuatan komposisi aransemen lagu yang sangat simple. Sebagai pendatang baru, Meggie bersyukur semua telah dipersiapkan serta terlaksana dengan baik. Dia berharap single perdananya dapat diterima diblantikamusikIndonesia.(m19)

TANAH DIJUAL

LT. 1.349m², Lokasi di Dusun VIII Desa Medan Krio Kec. Medan Sunggal Kab. Deli Serdang/ SPMHAT Harga Rp. 40 Jt/nego Hub. 0813.7021.5212 - 0819.643.206

BURSA

LOWONGAN DIBUTUHKAN: Gadis/ Janda Kristen untuk bekerja di rumah orang kristen, Gaji 700 Rb/ bln bersih Hub. Bapak Jovli 0812.6553.5559 Medan

DICARI TUKANG JAHIT BAJU WANITA

Trampil/ Berpengalaman, Wanita Hub HP. 0813.6166.6888 DIBUTUHKAN SEGERA

Tenaga kerja wanita usia 17 - 40 thn dengan posisi sebagai: BABY SITTER, PRWT JOMPO, PRWT PRIBADI, PRT, Syarat: FC. Ijazah, KTP, KK, Gaji bersih 700 Rb s/d 1.300 Rb/ bln + U. Cuti + Bonus + THR, Makan, Asrama, Dijemput loket gratis HUB: YYS. MAREL MANDIRI Jl. Cengkeh Raya No. 18C Medan HP. 0813.6199.9211 - 0813.9664.5507

TUKANG PANGKAS

Dibutuhkan 10 Orang, Disiplin, Rapi, Pengalaman (diutamakan dari T. Tinggi, Kisaran, R. Prapat, Siantar, Stabat) Hub. 0852.7562.0202

DIBUTUHKAN

Mendesak !! Sekolah Baru membutuhkan Guru TK min lls SMA, kreatif & suka dunia anak Hub Jl. Karya Wisata No. 23A Johor Tp. 786.1690 Medan

LOWONGAN KERJA

Dibutuhkan tenaga kerja P/W usia (17-35 thn) untuk posisi dlm kantor “Cab Medan”, syarat: - Pendidikan min SMU/ sederajat - Bawa berkas surat lamaran lengkap + Guntingan iklan ini untuk proses interview Penghasilan: RP. 1.800.000/ bln HUB. IBU NURHALIMAH/ BPK ROY HP. 0812.6388.5458 - 0878.6950.5625 Alamat kantor: Jl. Brigjen. Hamid No. 8B (±10m dari jembatan kanal arah Delitua Medan

BURSA

AC

ELEKTRONIK

PROMOSI SHARP

PLASMA CLUSTER + INVARTEL

- PANASONIC - LG - MITSUBISHI - TCL - DAIKIN - DAST SEWA - GREE AC FLOOR - SAMSUNG STANDING - CHANGHONG - MIDEA 5 Pk & 3 Pk BONUS GRATIS PEMASANGAN

Hub.

TOK O SUPER ELECTR ONIC OKO ELECTRONIC

Jln. Sutomo No. 139C (Simp. Gandhi) Tel. 061-7343415 - 7360741 - 77982281

INT ALASI - PEMASANGAN - REPERASI - AC - KULKAS INTALASI

BURSA

PHOTO COPY

BURSA

ALAT MUSIK

DIJUAL

Alat Musik Keyboard SX KN2400, KN2600 & KN7000 Kondisi 95% (2nd). Mulus seperti baru. Hub. 0821 6621 1302 / 0878 6932 2762

BURSA

KONSTRUKSI

WC 0812 60444275 WC JL. SETIA BUDI

TERCECER

Jl. Brayan Medan

8442246 WC 08126427 1725

Tumpat Sedot

Telp.:

ADI

Ada Garansi

WC 0813 6147 0812 Setia Budi SERVICE

AC AC

ELEKTRONIK RAHMADANI TEKNIK

Service - Reparasi - Spare Parts Isi Freon - Jual/Beli - Bkr Pasang AC- KULKAS - MSN CUCI

061-7500 4891 - 0813 6149 7921 REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757- 085371491338 Siap Ketempat

BURSA

MATERIAL

TERCECER

BPKB Mobil Daihatsu BK 8818 CB a/n. USIYANTO. Alamat: Dsn II No. 69 DS. Buntu Badimbar Tjg. Morawa. No. Rangka: MHKSPRDCF 7K000506. No. Mesin 9605765. Tercecer Jl. S. Parman -Jl. Pemuda Medan.

BURSA

KOMPUTER

Harian

WASPADA

TERCECER

Asli Surat Akta Tanah Hibah No. 8 Tgl. 30 Maret 09, Akte Notaris FIFI RIZANI, SH a/n. T. ARINDA dan Akte Camat No. 592.2/91/STM/1993, Luas 10.000 M2, terletak di Desa Talun Kenas Dusun V STM Hilir Kab. Deli Serdang. Tercecer disekitar Jl. SM. Raja

BURSA

TRAVEL/WISATA

BURSA

PELUANG BISNIS

PELUANG USAHA

Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA

Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866

Harian

WASPADA BURSA

PERABOT

TUMPAT/ SAL. AIR

Bergaransi/ Setia Luhur 160 F

CV. HYDRO UTAMA

Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410

1 BPKB Toyota Kijang BK 1425 AY. Nama Usman SE, MSi. Tercecer di Jl. Garu IV No. 148 Lk. IV Kec. Harjosari Medan. No. Rangka MHFIIUF81Y0005159 No. Mesin: IRZ-7005151. Thn. Buatan: 1998

Hub. TUMPAT / SEDOT WC/GRANSI

845.8996 0812.631.6631

3. M e n y e d i a k a n S p a r e P a r t & Perlengkapan Depot Air Minum 4. Menyediakan RO Rumah Tangga

Surat pernyataan melepaskan Hak Atas Tanah, an. Dra. Dahyuni Azda Nomor: 593.83/672/MDN/2000 Tanggal: 25 Nopember 2000 Tercecer di Jl. Pelajar Tanggal 5 Mei 2011 Hubungi 0812.644.4448

LOWONGAN KERJA

Jl. Brigjen. Katamso No. 474 Kel. Kampung Baru Telp. (061) 7796.2261 HP. 0812.6387.9999

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Dokumen Berisi Surat Izin Perawat asli a/n: MINAR ULI NAINGGOLAN, CD, pada tanggal 12 Juni 2011, Bagi yang menemukan akan diberi hadiah sepantasnya, Hub. 061-4571217 TERCECER

Posisi: 1. Operator Komputer SMK s/d D1 Wanita 2. ADM (Administrasi/ Akuntansi): D3 s/d S1 Wanita 3. Tenaga Ahli (Sarjana Teknik Sipil): S1 s/d S2 Pria

PT. AGUNG LAISMANA PRIBADI

Rp. 14 Jt s/d 38 Jt

2. Air Pegunungan 6700 s/d 7000 Liter Rp. 230.000 / Tangki

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

BURSA

DICARI

LAMARAN DIANTAR LANGSUNG KE:

PELUANG BISNIS

1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & RO

SPRING BED DIJUAL MURAH

TELAH TERCECER

Dicari 10 orang Salesman/ Girl untuk memasarkan buku-buku Refrensi dari luar dan dalam negeri Income bisa 10 Juta/ bulan. Pendidikan SLTA Uang transport Rp. 500.000/ bulan Diutamakan yang punya kendaraan sendiri Wawancara/ Seleksi hari Rabu dan Kamis Tgl. 22-23, jam 11.00-12.00 Wib Yang berminat bawa CV ke: PT. LENTERA ABADI Jl. Sei Tuan No. 3 Medan

Lamaran diterima paling lama tanggal 20 Juni s/d 24 Juni 2011

KRISNA WATER

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

HILANG/TERCECER

NB: Bagi pelamar yg baru tamat SMA, Ijazah bisa menyusul

Syarat-syarat: 1. Memiliki kendaraan sendiri dan SIM 2. Kreatif dan berpenampilan menarik 3. Tinggi min. 165cm, Berat badan ideal

MODEL TERBARU

HARGA TERMURAH

Training Center Ingin Trading Futures : Forex, (42 Currency), Index, Commoditi, Metals, Cfd Stock US, CFD Indices, CFD Financial Gold, Silver. Currency terbaru USDSGD (Singapura Dolar) !! Spread Mulai dari 2 Point, Tanpa Biaya (Swap Dan Cash Komisi)

Telah Hadir Di MasterForex Meta Trader

Kami memiliki Solusi Trading yang Nyaman dan menghasilkan minimal 100 pips / hari. Metode CHAOS TRADING Biaya Training Rp 18.500.000,-

MasterForex Sumatera Training Center Mandiri Building Lt.6, Jl. Imam Bonjol No. 16D Medan 20112 Sumatera Utara – Indonesia Tel. +62-61-3000 33 00 Fax. +62-61-3000 33 84 www.medan.masterforex.org e-mail : medan@masterforex.org

TOKO JEPARA TOP MENJUAL PERABOT JATI JEPARA ASLI KUALITAS EXPORT DAN HARGA EKONOMIS, JUGA MENERIMA PESANAN SERTA GANTI KAIN KURSI SHOWROOM: Jl. Gunung Krakatau No. D-9 Telp. (061) 664.2303 Sebaris Pizza Hut Medan WORKSHOP: Jl. Perwira II No. 230 Flexi: 7653.3509 Medan

NB: KREDIT DIDUKUNG OLEH: ADIRA FINANCE DAN SPEKTRA

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

MINI & EFEKTIF IKLANKAN PRODUK ANDA


Ekonomi & Bisnis

B8

Inspirasi Bisnis

WASPADA Senin 20 Juni 2011

Pengamat & Praktisi Manajemen

Cahyo Pramono

Radius 3 Km SELALU melihat ke langit, bisa membuat kita tersandung. Mungkin begitu jika kita selalu memperhatikan hal-hal yang jauh dan luas tanpa menyadari keadaan sekeliling kita. Demikian juga dengan pemasaran bisnis kita. Untuk produk-produk yang dibutuhkan banyak orang dalam frekuensi yang sering. Mungkin perlu ada semacam kesadaran pemasaran di lingkungan kita berada. Yang saya maksud adalah bahwa warga masyarakat disekililing kita sebenarnya adalah pasar yang potensial untuk kita jadikan sasaran. Kadangkala, atas nama keinginan bisnis yang besar, kita lupa bahwa kita sudah tidak memperhatikan sasaran yang lebih dekat dan terjangkau di tangan kita. Mereka-mereka yang tinggal di sekitar lokasi bisnis kita adalah calon pembeli, calon pelanggan. Dengan melakukan pemasaran ke masyarakat sekitar, kita akan mendapatkan banyak hal positif. Yang pertama; anggaran pemasaran pasti jauh lebih hemat. Tidak perlu distribusi yang memakan biaya karena jauh. Kita tidak perlu menciptakan “pengganti” diri untuk menjadi dekat dengan mereka yang jauh. Yang kedua; strategi komunikasi pemasarannya bisa disederhanakan dan disesuaikan dengan keadaan sekitar kita dengan tepat. Karena itu lingkungan kita, jelas kita bisa dengan mudah mempelajari dan mengamati kebiasaan-kebiasaan yang mereka lakukan. Yang ketiga; pengeluaran pemasaran akan lebih sesuai dengan hasil yang kita harapkan. Radius 3 KM. Jika anda memiliki peta kota atau daerah tempat gerai anda berdiri, buatlah titik dengan jarak 3 KM dari posisi usaha anda itu. Lalu buat lingkaran megitari lokasi anda dari titik 3 KM itu. Dan itulah sebenarnya daerah 3 KM yang penting untuk anda jadikan sasaran. Perbesarlah tampilan peta tersebut, sehingga anda bisa melihatnya dengan lebih detail semua bagian dalam lingkaran anda. Dari posisi tersebut anda bisa melihat potensi-potensi apa saja yang ada. Mulai dari jumlah rumah, kondisi perumahan, jumlah pertokoan, jumlah perkantoran dan semua potensi lainnya. Selanjutnya pelajari, apakah mereka yang ada di dalam lingkaran itu sudah menjadi pelanggan anda. Kategorikan mereka kedalam 3 bagian utama. Yang pertama; mereka yang sudah anda hubungi dan sudah menjadi pelanggan anda. Yang kedua; mereka yang sudah anda hubungi tetapi belum menjadi pelanggan anda dan yang ketiga adalah mereka yang belum anda hubungi dan belum menjadi pelanggan anda. Buat daftarnya..! Daftar itulah yang bisa dijadikan acuan kerja pemasaran anda. Jangan salah sangka! Banyak dari kita merasa bahwa pasti tetangga kita di radius itu sudah menjadi pelanggan kita, padahal bisa jadi mereka tidak pernah tahu tentang bisnis kita. Manusia hari ini sangat penuh dengan pesan-pesan di dalam pikirannya. Bahkan cenderung berlebihan sehingga mereka tidak lagi mau menerima pesan-pesan baru. Seperti sering saya ingatkan, banyak dari kita sudah tidak lagi mau atau memiliki kesempatan untuk membaca poster dan spanduk-spanduk di pinggir jalan. Kita sudah tidak lagi

tertarik dengan iklan. Kita bahkan tidak pernah membaca tulisan dikemasan makanan yang kita pegang. Kita tidak lagi pernah membaca tulisan yang ada di bungkus rokok yang tiap hari kita pegang. Media komunikasi sangat banyak, dari koran, tv, radio, internet dan promosi luar ruangan. Untuk membaca semua pesan dari koran terbitan jakarta yang bisa sampai 30-an halaman, dengan cara baca cepat, kita membutuhkan sedikitnya 32 jam –bahkan hari kita pun tak cukup untuk itu—. Bahkan kita tidak pernah lagi membaca semua tulisan dalam brosur-brosur promosi yang pernah kita terima. Apalagi menyimpanya. Begitu juga dengan tetangga kita yang juga sibuk dan penuh kegiatan. Artinya, walaupun sudah lama bisnis anda, jangan merasa bahwa mereka yang menjadi tetangga anda paham dan tahu bisnis anda. Karena selain kesibukan mereka, bisa jadi para tetangga itu sebenarnya orang-orang yang silih berganti tinggal dan pergi. Artinya; segeralah buat daftarnya, dan segera lakukan sesuatu untuk menjadikan mereka pelanggan anda. Klik Data yang anda dapat dari peta itu adalah awal yang baik untuk bisa mendapatkan data tamahan berupa jumlah penduduk, bentuk rupa profesi atau bisnis mereka, jumlah pesaing, kondisi pesaing dan binis lain yang bisa kerjasama dengan anda dan bukan pesaing. Setelah itu siapkan strategi dengan tahapan perkenalan, mengundang, mencoba, kolaborasi dan jualan. Tahapan perkenalan adalah tahapan yang perlu sekali dilakukan. Tentu saja terasa sedikit aneh kalau kita berkenalan lagi kepada tetangga yang sudah sekian waktu berdekatan tapi tidak kenal. Untuk tahap ini, cobalah buat re-louncing –peluncuran ulang—. Buatlah sesuatu sebagai alasan untuk memperkenalkan lagi produk atau outlet anda. Bisa saja anda membuat paket khusus untuk tetangga dekat dengan judul yang sama. Lalu mungkin dengan pemberian diskon dan hadiah-hadiah tertentu. Komunikasikan dengan para tetangga itu dengan media promosi yang sederhana dan tepat. Kunjungi mereka bersama tim anda. Mungkin dengan membagikan brosur dan diikuti dengan presentasi penjualan. Undang mereka untuk hadir dan melihat bisnis anda. Jika produk anda memungkinkan untuk diberikan sebagai contoh, mungkin anda bisa membagikannya kepada mereka dengan gratis untuk menarik perhatian mereka. Untuk mereka mungkin anda bisa memberikan layanan pesan antar. Toh jaraknya tidak jauh, bisa cepat sampai dan relatif mudah. Untuk mereka yang sama-sama berbisnis tetapi bukan pesaing, selain secara pribadi mereka bisa menjadi pelanggan anda, secara lembaga mereka juga bisa dijadikan partner. Bisa saling numpang brosur, brosur anda ada di tokonya dan brosurnya ada di toko anda. Ini penting, karena mereka juga memiliki pelanggan yang bisa jadi belum pernah menjadi pelanggan anda. Jika hubungan semakin bagus, anda bisa saling memancing pelanggan dengan memberikan hadiah atau diskon kepada pelanggan mereka. Misalnya, pelanggan toko roti tetangga anda yang berbelanja lebih dari 200 ribu akan mendapat kupon diskon 35% untuk berbelanja di tempat anda. Selamat mencoba. Konsultasi & Pelatihan; tj@cahyopramono.com

Diversifikasi Konsumsi Pangan Terganjal Harga Gandum MEDAN (Waspada) : Belum terbiasanya masyarakat mengubah pola makan menyebabkan diversifikasi konsumsi pangan terganjal dan harga gandum terus meningkat. Pada tahun ini Indonesia mengimpor sebanyak 5 juta ton. Dengan besarnya kebutuhan gandum sebagai bahan dasar pembuatan roti maupun mi instan membuat negara mengeluarkan dana sebesar Rp7triliun. Besarnya anggaran tersebut berbagai kebijakanpun dikeluarkan. Prof Posman Sibuea, anggota Dewan Ketahanan Pangan Kota Medan menyatakan kebijakan stabilisasi harga sudah diluncurkan sebagai senjata pamungkas untuk meredam gejolak harga, hasilnya tidak optimal. “Jika pemerintah menekan harga terigu lewat penurunan bea masuk, jelas upaya ini tidak memberi ruang untuk memulai gerakan diversifikasi konsumsi pangan. Muaranya pengembangan produk pangan berbasis

umbi-umbian, jagung, sagu, dan pisang akan selalu terganjal,” ujarnya kepada wartawan, di Medan, Minggu (19/6). Sulitnya mengubah kebiasaan makan sebagian besar masyarakat, lanjutnya, untuk kembali ke bahan pangan lokal, membuat roti dan mi instan mengkristal menjadi makanan untuk sarapan pagi. “Padahal, sejak dulu Indonesia dikenal memiliki beragam makanan lokal roti dan mi instan memang bukan produk Indonesia.”

Kepala Badan Ketahanan Pangan (BKP) Kota Medan, Eka RYanti Danil menyatakan untuk mengatasi krisis pangan saat ini, pemerintah menyusun program diversifikasi konsumsi pangan. Langkah ini dilakukan untuk mengantisipasi makin mahalnya harga tepung terigu dan beras dimasa mendatang. Ketergantungan yang kian besar terhadap produk olahan terigu, lanjutnya, telah mencederai ketahanan pangan sebab potensi pangan berbasis sumber daya lokal menjadi terabaikan. Pemerintah harus aktif mendorong perubahan pola makan pokok dari roti dan mi instan ke komoditi terdiversifikasi yang disesuaikan dengan potensi sumber daya lokal. “Untuk itu masyarakat tidak bisa lagi diajak makan sagu, pisang, jagung dan ubi dalam bentuk produk olahan tradisionalnya. Arah pengembangannya harus diletakkan pada arah selera konsumen dan keinginan pasar,” ujarnya. Dengan begitu, terangnya

kembali, bahan makanan lokal tersebut perlu diolah menjadi bentuk produk pangan baru yang bisa dinikmati dengan gaya hidup gaul dan cosmopolitan. Pemahaman yang lebih biak tetang gaya hidup masyarakat akan memandu dalam menentukan prioritas diversifikasi konsumsi pangan. Prof Posman menegaskan untuk mengurangi ganjalan diversifikasi pangan ini perlu upaya peningkatan SDM. “Hingga kni, kualitas SDM di industri pangan sebagian besar adalah tamatan SLTA ke bawah dan hanya sekitar 2,66 persen yang menyandang gelar sarjana. “Ditinjau dari segi lokasi pabrik, jumlah SDM yang berkualifikasi sarjana di industri pangan cenderung menurun jika lokasi industri tersebut semakin jauh dari Jakarta. Terlebilebih lagi jika lokasi industri itu di luar Jawa. Tercatat sektiar 57 persen industri pangan di luar Jawa belum memiliki tenaga sarjana teknologi pangan,” lanjutnya kembali. (m38)

Bisnis Masa Depan Penuh Tantangan MEDAN (Waspada): Pasca krisis keuangan terburuk, 2009, bisnis masa depan masih akan dihadang berbagai tantangan. Ada banyak masalah baru, tetapi sekaligus membuka celah atau peluang untuk bisa bertahan dan bahkan berkembang. Demikian gambaran yang

mengemuka pada RUPS TobaPulp 2011 di Medan, Jumat (17/ 6). Gambaran masa depan bisnis itu tercermin dalam laporan Direksi TobaPulp (PT Toba Pulp Lestari,Tbk) disampaikan secara bergantian oleh Firman Purba, Anwar Lawden dan Juanda Panjaitan di hadapan para pe-

Udang Galah Makin Langka Di Batubara LABUHANRUKU ( Waspada) : Pendapatan penjala atau pemancing udang galah di sepanjang sungai Limalaras Kp.Benteng dan sungai Rawadolik-sungai Bagali Dahariselebar, Talawi, Batubara berkurang karena hasil tangkapan udang semakin langka Sahrul salah seorang pengumpul udang galah di Labuhanruku, Minggu (19/6) mengatakan, dalam tiga bulan terakhir udang galah makin hilang di sungai Labuhanruku dan Rawadolik Biasanya dia bisa mengumpul 2 sampai 4 kilo udang galah per hari hasil tangkapan dan dijualnya dengan harga bervariasi. Jenis udang jarahan (sedang) Rp 40 - 50 ribu per kg

dan jenis jeranggah (besar) Rp60 -70 ribu per kg ‘’Kalau sekarang udang galah makin langka, setengah kilo pun payah,’’ujar Sahrul. Harga udang jarahan saat ini naik biasa Rp50 ribu jadi Rp 60 ribu dan jeranggah jadi Rp80 ribu per kg Udang terkumpul dijual kepada agen di Tanjungtiram untuk ekspor, kalau sedikit dijual di rumah makan terdekat. Berkurangnya udang galah diduga karena air sungai tercemar limbah dari hulu (Simalungun). Tidak seperti tahun enam atau tujuh puluhan jenis udang bersepit dua ini mudah di pancing atau dijala pakai umpan kelapa busuk di sungai Labuhanruku. (a12)

serta RUPS (rapat umum pemegang saham) yakni para pemegang saham dan kuasanya, serta dihadiri para anggota Dewan Komisaris (Roli Arifin, Drs Sabam Leo Batubara, Lundu Panjaitan, SH.MA) dan juga Dewan Direksi (SC Paruthi, Juanda Panjaitan, SE, Ir Firman Purba, Anwar Lawden SH). Juga hadir notaris Gunawati, SH. RUPS dan RUPS Luar Biasa diadakan untuk mengesahkan laporan tahunan 2010 serta mereposisi dua anggota Direksi, dipimpin Komisaris Utama Roli Arifin. TobaPulp, industri pulp satu-satunya di Sumatera Utara dan berbasis di Desa Sosorladang, Kecamatan Parmaksian, KabupatenTobasamosir, adalah produsen pulp dengan kapasitas mesin 240 ribu ton per tahun. Bahan bakunya berupa ekaliptus (eucalyptus sp) yang dihasilkan dari HTI (hutan tanaman industri) yang tidak lain dari “perkebunan kayu.” Lokasi HTI-nya tersebar di beberapa kabupaten di kawasan Toba. Perusahaan ini mempekerjakan 938 orang, 85 persen di antaranya putra-putri lokal, ditambah sekitar 6.000 orang warga setempat yang bekerja pada 276 perusahaan mitra-usaha.

Masalah terpenting masa depan ialah meningkatnya terus harga BBM (bahan bakar minyak) sebagai dampak ketidakseimbangan kenaikan permintaan dunia dengan pasokan tersedia. Distribusi BBM pun menjadi tidak menentu akibat pergolakan politik di negaranegara penghasil utama minyak bumi, Timur Tengah. Ketidakpastian selalu mengakibatkan fluktuasi harga. Kenaikan harga BBM berdampak pada harga bahan baku, dan pada gilirannya memengaruhi harga pokok dan harga jual produksi. Untuk bisa bertahan dalam suasana penuh tantangan itu, manajemen perusahaan mesti mencari kiatkiat baru untuk meningkatkan efisiensi agar produk tetap bisa bersaing di pasar global. “Kita mesti bisa mencari celah untuk bisa bertahan di tengah-tengah kesulitan dan persaingan yang makin keras. Apabila pemulihan ekonomi global bisa berkesinambungan, maka peluang untuk menghasilkan lebih banyak produksi tetap terbuka. Kita memang tidak sendirian. Semua pemain bisnis global menghadapi situasi ini,” kata Komisaris Utama TobaPulp, Roli Arifin, usai RUPS. (rel/m14)

PILIH UDANG

Waspada/Iwan Has

Pasaran udang di Kec Tanjungtiram, Talawi, Kab Batubara saat ini mencapai Rp 75.000 untuk jenis udang Kelong dan udang Swallow Rp 35.000 per kg. Terlihat salah seorang nelayan sedang memilih udang hasil tangkapan dari laut untuk dijual kepada pedagang di pelataran TPI Pangkalan Desa Masjid Lama, Kecamatan Talawi, Kabupaten Batubara, Minggu (19/6).

71 Persen UMK Tidak Pernah Pinjam Modal Ke Bank BANDUNG (Waspada): Bank yang berniat masuk ke Usaha Mikro dan Kecil (UMK) harus berani mengambil risiko karena ranah tersebut tidak memiliki catatan keuangan dan jaminan usaha. Hal tersebut menjadikan perbankan UMK-able. “Tantangan bagi perbankan adalah karakteristik UMK tidak memiliki badan hukum, catatan keuangan yang memadai dan jaminan,” ujar Deputy Presiden

Director BTPN, Djemi Suhendra saat Media Workshop di Hotel Hilton, Bandung, Sabtu (18/6). Djemi menjelaskan, hasil penelitian Bank Tabungan Pen-

siunan Nasional (BTPN) di dua pasar tradisional di Kota Medan dan Yogyakarta mengungkapkan, sebanyak 71 persen UMK tidak pernah melakukan pinjaman modal pada bank. “Ada anggapan usaha mikro kecil tidak bankable. Pihak UMK juga beranggapan bank itu bukan buat rakyat,” ujarnya. Menurutnya, dalam hal ini pemerintah harus merancang undang-undang atau peraturan mendorong untuk pengembangan microbanking. Saat ini

UMK merupakan kelompok usaha memiliki jumlah paling besar. Kriteria usaha yang termasuk dalam Usaha Mikro Kecil dan Menengah telah diatur dalam Undang-Undang Nomor 20 Tahun 2008. Di situ disebutkan pengertian dan kriteria UMKM. salah satunya berdasarkan besar jumlah aset yakni untuk usaha mikro maksimal Rp50 juta dan untuk usaha kecil maksimal Rp500 juta. (okz)

Investasi Emas, Pilih Batangan! JAKARTA (Waspada): Selain menjadi perhiasan, sekarang ini emas sering kali dijadikan investasi oleh sebagian masyarakat di seluruh dunia lantaran memberikan imbal hasil yang lebih dibanding jika hanya menabung di bank saja. Gold Investment Advisor Endy junaedy Kurniawan menuturkan imbal hasil tabungan tidak pernah melewati inflasi sehingga boleh dibilang tahun demi tahun daya beli masyarakat turun. Padahal tadinya niat

untuk menabung supaya bisa digunakan ditahun tertentu ternyata imbal hasilnya tidak sampai. “Artinya menabung, jatuhnya rugi. Nah oleh sebab itu lebih baik investasi emas karena naiknya lebih dari inflasi. Ketika kita akan menggunakannya, misalnya untuk tujuan pendidikan dan sebagainya bisa kita jual dan nilainya jauh lebih tinggi dibandingkan biaya yang diperlukan,” ungkap Endy kala ditemui dalam acara acara

Indonesia Finansial Expo & Forum (IIEF) 2011 di Jakarta Convention Center (JCC), Sabtu, (18/6). Selain itu Endy menuturkan jika ingin berinvestasi dalam bentuk emas lebih baik berinvestasi dalam bentuk emas batangan. Hal ini dikarekan jika kita berinvestasi emas dalam bentuk perhiasan emas itu hanya sebagai trend mode atau fashion saja. Ketika keluar model baru maka perhiasan lama akan dijual, jadi investasinya

tidak dalam jangka panjang di mana sebaiknya investasi dalam bentuk emas itu sebaiknya untuk investasi dalam jangka waktu menengah hingga jangka waktu panjang. Sementara itu, pada masa sekarang ini masyarakat di Indonesia sudah memiliki kesadaran cukup tinggi untuk berinvestasi dalam hal lain secara daripada menabung dibank. “Jadi orang makin sadar menabung tidak memberikan imbal hasil cukup,” pungkasnya.(okz)

Tuntaskan Daftar Tunggu, PLN Gelar Go Grass 2 TEBINGTINGGI ( Waspada): Guna menghabiskan daftar tunggu yang tidak tersambung jaringan listrik PLN, PT. Persero PLN Ranting Tebingtinggi melaksanakan Go Grass (gerakan sehari sejuta sambungan) tahap 2 terhadap lebih kurang 100 pelanggan baru di Kota Tebingtinggi dalam sehari, Jumat (17/6) dengan pemakaian KWH meter pra bayar. “Kami harapkan kepada para pelanggan PLN Ranting Tebingtinggi yang baru agar segera menghubungi pihak PLN sekaligus dapat menambah daya secara gratis diprogramkan pemerintah hingga 30 Juni 2011,” ucap Kepala PLN Ranting Tebingtinggi Anggiat Purba kepada Waspada di sela-sela pelaksanaan Go Gress 2, Jumat (17/6). Pelaksaan progam pemerintah pusat diawali di komplek perumahan PNS Jalan Gunung Lauser BP 7, Kelurahan Tanjung Marulak Hilir, Tebingtinggi ditandai dengan penyerahan berita acara kepada konsumen pengguna listrik pra bayar. Saat itu, petugas lapangan dibagi dalam 10 tim untuk pemasangan 100 calon pelanggan pemakai listrik pra bayar (LPB) dalam sehari di Kota Tebingtinggi. Anggiat Purba,SE didampingi menajer PLN Cabang Pematangsiantar diwakili Ramses Sihite dan Rukino serta sejumlah petugas lapangan mengatakan apabila ada pelanggan kekurangan daya di rumahnya segera menghubungi PLN untuk menambah daya gratis dari 450 ke 1.300-2200 atau dari 900 ke 1300-2200. Akan tetapi, katanya, apalagi dikemudian hari masih ditemukan pelanggan membuka MCB (kotak sekering) tanpa sepengetahuan petugas, PLN akan memberikan sanksi. Sementara itu, staf PLN Cabang Pematangsiantar Ramses Sihite dan Rukino menambahkan, keuntungan LPB ini konsumen lebih mudah mengoptimalkan konsumsi listrik (hemat listrik) . Konsumen tidak perlu berurusan dengan pencatat meter tiap bulan dan tidak perlu terikat dengan jadwal pemba-

yaran listrik bulanan karena persediaan KWH dapat ditambah berapa saja dan kapan saja sesuai kebutuhan dan keinginan pelanggan. Sistemnya seperti pengisian pulsa, minimal sebesar Rp 20 ribu, katanya. Binjai Over Target Manajer PLN Cabang Binjai Ir Pintor Rumapea minta masyarakat yang ingin memasang aliran listrik menghindari calo. Program Gerakan Sehari Sejuta Sambungan ( Grass) kedua dilakukan secara nasional Jumat( 17/6) salah satunya menghindari praktik kecurangan oleh calo untuk penyambungan baru yang merugikan. Ir Pintor Rumapea didampingi Asisten Manajer APP Alamsyah Siregar, Asmen Teknik Simamora dan Humas Safwan menegaskan, PLN saat ini memberikan kemudahan dan ketegasan terhadap pelanggan. Seperti peningkatan daya dari 450 atau 900 ke 1300 dan 2.200 secara gratis. Gress merupakan memprogram menghabiskan daftar tunggu, target PLN Cabang Binjai ditetapkan 7.692 pelanggan, bisa over target terealisasi 12.214 pelanggan .Tersebar di 14 unit rayon dan ranting. Pencapai pelanggan baru sampai over target di rayon Binjai Kota 1.092, Binjai Barat 9.781, Binjai Timur 1.996, ranting Stabat 1.271, ranting Kuala 1.303 pelanggan, ranting Gebang 387, Ranting P.Susu 570, P.Brandan 311, Tanjungpura 1.193, ranting Brastagi 543, Kabanjahe 468, Sidikalang sebanyak 1.062, Tiga Binanga 611 dan Pakpak Barat 436 pelanggan. Nyalakan 940 Pelanggan Sementara PT PLN Cabang Padangsidimpuan menyalakan secara serentak sebanyak 940 pelanggan yang masuk dalam program Gerakan Sehari Sejuta Sambungan, Jumat (17/6). Manajer PT PLN Cabang Padangsidimpuan, Ir Sudirman ST ketika melakukan pemasangan meteran listrik terhadap rumah pelanggan di Batunadua, Kecamatan Padangsidimpuan Batunadua, mengatakan program ini merupakan langkah strategis PT PLN untuk

meningkatkan kualitas pelayanan penyambungan baru terutama dalam hal mengatasi daftar tunggu permintaan sambungan listrik yang sudah mengurai panjang selama ini disebabkan oleh berbagai kendala, seperti terbatasnya pasokan daya listrik. Realisasi penyambungan GRASS tahap II Januari-Juni

2011 totalnya yakni 6.641 sambungan meliputi Panyabungan totalnya 1.041, Kotanopan totalnya 391, Sibuhuan totalnya 1.011, Sipirok totalnya 239, Gunung Tua totalnya 1.018, Natal totalnya 767 dan Rayon Padangsidimpuan totalnya 1.234, dimana khusus untuk Juni ini sambungan baru sebanyak 940. (a11/a04/c13)

Sumut Bisa Belajar Pada Bali Soal Kepemilikan Asing MEDAN (Waspada) : Propinsi Sumatera Utara bisa mengambil hikmah dan belajar banyak dari kemampuan propinsi Bali mengembangkan potensi bisnis properti, termasuk kemampuan untuk membuka ruang bagi pihak asing dalam kepemilikan properti. Keterbukaan sikap pemerintah propinsi, kabupaten dan kota, serta masyarakat Bali secara keseluruhan terhadap kepemilikan asing dalam properti, justru membuat ekonomi pulau Dewata itu serasa tidak pernah rehat. “Kami yakin Sumatera Utara pun sejatinya bisa belajar banyak dan mengambil hikmah dari potensi ekonomi yang didapat Bali dari keterbukaan sikap terhadap kepemilikan asing dalam properti setempat. Kami telah melihat sendiri, betapa welcomenya pemda dan masyarakat Bali terhadap pihak asing yang hendak memiliki rumah atau penginapan di daerah mereka,” ujar Ketua DPD Realestate Indonesia Sumatera Utara (REI Sumut), TomiWistan, di Medan, kemarin. Didampingi sejumlah pengurus REI Sumut lainnya seperti Hali Dermawan, M Fajri, dan lainnya, Tomi menyebutkan beberapa waktu lalu mereka melakukan studi banding ke DPD REI Bali dan melihat potensi properti setempat. Saat berkunjung ke sebuah kawasan di Bali yang bakal dikembangkan pihak Bakrie Lands, Hotels, and Resorts, pihaknya mendapati fakta kalau masyarakat

setempat menyambut baik setiap orang atau wisatawan asing yang memilih lama tinggal di Bali. Dia mencontohkan, kawasan danau Toba dikelilingi oleh beberapa kabupaten dan Bukit Lawang, Kabupaten Langkat di Sumatera Utara adalah salahsatu daerah yang pantas dikembangkan propinsi Sumatera Utara menjadi daerah terfavorit dan layak ditinggali lebih lama bagi turis asing dan domestik. “Para turis pasti akan memilih untuk menginap lebih banyak di kawasan Danau Toba jika mereka memiliki properti sendiri. Kalau mereka ada lebih lama, fakta menunjukan geliat ekonomi masyarakat sekitar terus bergerak naik. arena itu, kami berharap rancangan undang-undang kepemilikan properti oleh pihak asing bakal disahkan oleh pemerintah dan DPR-RI dalam waktu dekat ini,” katanya. Sebab, ujar dia, RUU kepemilikan asing di properti saat ini dirancang sedemikian menariknya. Kata dia, jika sebelumnya hanya dirancang dengan skema kepemilikan selama 25 tahun, lalu bisa diperpanjang untuk masa 20 tahun, dan kemudian diperpanjang lagi selama 25 tahun ke depan, maka kini dalam RUU tersebut skema kepemilikan asing dirancang menjadi 70 tahun sekaligus. “Kami berharap DPR-RI dan pemerintah pusat melihat potensi pengembangan ekonomi dengan adanya kepemilikan asing di properti kita,” tegas Tomi Wistan. (m38)


Sumatera Utara

WASPADA Senin 20 Juni 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:28 12:41 12:26 12:32 12:32 12:29 12:25 12:21 12:28 12:27

‘Ashar 15:55 16:08 15:52 15:58 15:57 15:54 15:51 15:46 15:53 15:53

Magrib 18:38 18:55 18:36 18:45 18:44 18:35 18:34 18:30 18:37 18:39

‘Isya

Imsak

Shubuh Syuruq

Kota

19:53 20:10 19:51 19:59 19:58 19:49 19:48 19:44 19:51 19:53

04:43 04:53 04:42 04:46 04:47 04:50 04:43 04:39 04:45 04:43

04:53 05:03 04:52 04:56 04:57 05:00 04:53 04:49 04:55 04:53

L.Seumawe 12:30 L. Pakam 12:24 Sei Rampah12:23 Meulaboh 12:34 P.Sidimpuan 12:22 P. Siantar 12:23 Balige 12:23 R. Prapat 12:20 Sabang 12:38 Pandan 12:24

06:15 06:25 06:14 06:18 06:18 06:20 06:14 06:10 06:16 06:14

Zhuhur ‘Ashar 15:56 15:49 15:48 16:00 15:47 15:48 15:48 15:45 16:03 15:49

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:43 18:34 18:33 18:45 18:29 18:32 18:31 18:27 18:51 18:31

19:58 19:48 19:47 20:00 19:42 19:46 19:45 19:41 20:06 19:45

04:45 04:41 04:40 04:51 04:43 04:41 04:42 04:40 04:50 04:44

04:55 04:51 04:50 05:01 04:53 04:51 04:52 04:50 05:00 04:54

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:24 12:25 12:35 12:28 12:25 12:32 12:20 12:30 12:23 12:22

18:31 18:34 18:48 18:36 18:35 18:43 18:29 18:40 18:31 18:32

19:45 19:48 20:02 19:50 19:49 19:53 19:43 19:54 19:44 19:46

04:44 04:44 04:49 04:48 04:42 04:47 04:38 04:48 04:43 04:40

04:54 04:54 04:59 04:58 04:52 04:57 04:48 04:58 04:53 04:50

Panyabungan 12:21 Teluk Dalam12:28 Salak 12:26 Limapuluh 12:21 Parapat 12:23 GunungTua 12:20 Sibuhuan 12:20 Lhoksukon 12:30 D.Sanggul 12:24 Kotapinang 12:19 AekKanopan 12:20

06:16 06:12 06:11 06:22 06:14 06:12 06:13 06:10 06:22 06:15

15:49 15:51 16:01 15:53 15:51 15:57 15:46 15:56 15:49 15:48

06:15 06:15 06:20 06:18 06:13 06:18 06:09 06:19 06:14 06:11

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Jalan Binjai–Bahorok Butuh Perbaikan

PERBAUNGAN (Waspada) : Muspika Kec. Perbaungan menggelar sosialisasi kebijakan pengelolaan persampahan untuk menuju Kota Kecil Adipura di aula kantor Cabang Dinas (KCD) Pendidikan Nasional Perbaungan, Kamis (16/6). Hadir dalam kegiatan itu Asisten II Sergai Amrullah Damanik, Plt Kakan AMDAL Sergai Aladin Berutu, Kadis Tarukim H Herman Sitorus, Kabid Perlindungan Konsumen Dinas Perindagsar Darwis Rambe, Camat Perbaungan Akmal, serta tokoh masyarakat, pemuda, agama serta sejumlah peserta sosialisasi. Selaku nara sumber dari Balai Lingkungan Hidup (BLH) Sumut Freddy Saragih, Fairia Adlyka dan Sriani Ginting. Camat Perbaungan Akmal mengatakan, sebagai kepala pemerintahandikecamataninisangatbanggaatasterpilihnyaPerbaungan sebagai nominasi dalam program menuju Kota Kecil Adipura Plt Kakan Amdal Sergai M Aladin Berutu mengatakan, Pemkab Sergai sangat mendukung program kerja yang akan disosialisasikan pada hari ini, karena ini menunjang kinerja Kantor AMDAL dalam bidang lingkungan hidup untuk pengelolaan persampahan di kecamatan ini.(c03)

LVRI Harus Proaktif Dukung Pembangunan DS LUBUKPAKAM (Waspada) : Musyawarah Cabang (Muscab) IX LegiunVeteran RI (LVRI) Kabupaten Deliserdang dibuka Ketua DPD LVRI Sumut diwakili Kol (Purn) H M Rizan di Balairung Pemkab Deliserdang di Lubuk Pakam, Senin (13/6). Muscab dihadiri Wabup H Zainuddin Mars, Dan Dim 0204/ DS Letkol Arh Wawik Dwinanto, Dan Brigif 7/RR Letkol Inf Safaruddin,unsurMuspida,KakanMinvetcadDamI/13Deliserdang Mayor U Saragih, Kaban Kesbang Drs H Edy Azwar, Kadis Infokom Drs Neken Ketaren serta undangan lainya. Ketua DPD LVRI Sumut melalui Kol (Pur) H M Rizan mengharapkan, ke depan LVRI harus dapat lebih proaktif mendukung program percepatan pembangunan daerah berintegrasi dengan rakyat yang merupakan tugas dan fungsinya seperti diraihnya Piala Adipura untuk kategori Kota Lubuk Pakam dengan nilai tertinggi dari Presiden merupakan hasil dari kerjasama yang baik di daerah ini termasuk peran serta dari LVRI. Wabup Deliserdang H Zainuddin Mars mengatakan upaya untuk mewariskan nilai-nilai semangat perjuangan para pahlawan dahulu harus terus kita lakukan terutama bagi kita para pemegang amanah rakyat. Dan Dim 0204/DS Letkol ArhWawik Dwinanto mengharapkan pelaksanaan Muscab LVRI harus benar-benar mengacu pada thema yang dipilih yaitu“LVRI mengajak seluruh bangsa Indonesia untuk kembali ke jati diri bangsa sebagai insan Pancasila yang tidak mengenal menyerah. Ketua DPC LVRI Deliserdang H Amaluddin menjelaskan, Muscab IX LVRI Deliserdang diikuti pengurus ranting kecamatan ditambah peserta peninjau dari PIVERI dan PPM berjumlah 120 orang. (a06)

FKPAE Dukung Kapolres Binjai Berantas Judi BINJAI(Waspada):ForumKomunikasiPemukaAntarEtnis(FKPAE) Kota Binjai mendukung sikap Kapolres Binjai AKBP Rina Sari Ginting yang bertindak tegas dalam memberantas berbagai bentuk judi di daerah ini. FKPAE berada di barisan terdepan bersama Kapolres memberantas judi yang meresahkan masyarakat Kota Binjai. Tokoh masyarakat dari 15 etnis di Binjai yang tergabung dalam FKPAE, memberikan apresiasi yang tinggi kepada Kapolres Binjai yang bertindak tegas, tanpa pandang bulu, dalam memberantas perjudian di daerah ini. Hal itu diungkapkan Ketua FKPAE Kota Binjai Dr HT Murad El Fuad, Rabu (15/6).(a05)

Sepedamotor Laga Kambing, Seorang Tewas PANTAICERMIN (Waspada) : Adiputra alias Adi, 20, warga Dusun I, Desa Ara Payung, Kec. Pantai Cermin, Kab. Serdang Bedagai tewas setelah kecelakaan lalu lintas di Jalan Pantai CerminArapayung, Rabu (15/6) sekitar pukul 21:00. Menurut keterangan, Kamis (16/6), Adi mengendarai sepedamotor Suzuki Smash tanpa plat. Ia datang dari arah Kota Pantai Cermin menuju Desa Ara Payung, setibanya di TKP muncul sepedamotor Honda Grand BK 3113 MA yang dikendarai Bopa Elinza Chaniago, 22, warga Gang Sere, Desa Pantai Cermin Kanan, Pantai Cermin. SaatituposisikendaraanAditerlalumengambilbahujalansebelah kanan, sehingga terjadi tabrakan. Keduanya terpental, Adi dilarikan ke Puskesmas terdekat, tetapi nyawanya tidak dapat diselamatkan. Sedangkan, Bopa dilarikan ke RSU Melati Perbaungan dan masih menjalaniperawatan intensif.KasatLantasPolresSergaiAKPGunadi SB ketika dikonfirmasi, Kamis (16/6) membenarkan. (a08)

Tidak Ada Hubungan Asuransi Bumi Asih Dengan Anggota DPRD Sergai PT Asuransi Bumi Asih menekankan tidak ada hubungan bisnis dengan anggota dewan DPRD Sergai. Sehingga tidak ada alasan bagi perusahaan tersebut untuk memberikan klaim terhadap anggota dewan tersebut. Demikian disampaikan Branch Manager Asuransi Jiwa Bumi Asih Jaya Esrin Tarigan, SE. MM di Waspada, Sabtu (18/6). “Kami tidak ada hubungan apapun dengan anggota DPRD Sergai, apalagi menyangkut nasabah di anggota DPRD Sergai yang berkaitan dengan asuransi seperti pemberitaan Harian Waspada yang terbit, Sabtu (18/6) yang menyatakan kesal dana asuransi tak cair, anggota DPRD Sergai mengamuk,” katanya. Demikian untuk dimaklumi. (red)

Zhuhur ‘Ashar 15:46 15:53 15:51 15:47 15:49 15:46 15:45 15:55 15:49 15:44 15:46

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:26 18:33 18:34 18:31 18:32 18:27 18:26 18:42 18:32 18:26 18:29

19:40 19:46 19:48 19:45 19:46 19:41 19:40 19:57 19:46 19:40 19:42

04:43 04:50 04:45 04:39 04:42 04:41 04:42 04:44 04:44 04:39 04:39

04:53 05:00 04:55 04:49 04:52 04:51 04:52 04:54 04:54 04:49 04:49

06:13 06:21 06:15 06:10 06:13 06:12 06:12 06:16 06:14 06:09 06:10

Tak Mau Diajak Garap Lahan PTPN II, Kelompok Preman Serang Warga

STABAT (Waspada): Ruas jalan provinsi dari Kota Binjai menuju Bahorok, Kab. Langkat rusak dan berlubang. Pantauan Waspada, Kamis (16/6), mulai kawasan Lincun Binjai telah terlihat kupak-kapik. Sebagian telah ditimbun dengan batu dan sebagian lain masih rusak. Di kawasan itu debu yang beterbangan sangat menggangu pengguna jalan. Selain itu ruas jalan di kawasan Salapian juga rusak parah. Terdapat beberapa titik tebing jalan yang menanti abrasi parah akibat tekanan air. Pantauan lainnya, jalan di sepanjang kawasan PT London Sumatera Turangi menuju Bahorok juga rusak parah berlubang. Masih terdapat sekitar dua kilometer ruas jalan yang rusak di sana. Pagar besi pengaman jalan juga banyak yang patah. Kondisi demikian membutuhkan perhatian serius untuk menghindari terjun bebas kendaraan ke sungai jika kecelakaan lalulintas terjadi. Jalan rusak juga terlihat di pangkal Jembatan Sei Wampu di Kec. Bahorok. Ruas jalan semakin rusak parah jika air hujan berharihari tergenang di lubang. Sebelumnya abrasi berkepanjangan juga terlihat di Desa Namu Embelin, Kec. Kuala Kab. Langkat yang mengancam putusnya badan jalan. (a03)

Muspika Perbaungan Sosialisasi Pengelolaan Sampah

C1

Ketua FPKS DPRDSU Minta Kapoldasu Berantas Premanisme Di Binjai

JALAN Binjai – Bahorok di kawasan Lincun rusak parah sebagian telah ditimbun batu, Kamis (16/6).

Waspada/Abdul Hakim

Pelaksana Bandara Kualanamu ‘Kecilkan’ Pemkab Deliserdang LUBUKPAKAM (Waspada): Buntut jalan LubukpakamPantai Labu hingga Minggu (19/6) rusak parah, salah satu anggota dewan menilai pelaksana pembangunan Bandara Kualanamu telah mengecilkan Pemkab Deliserdang. Berbicara lewat telefon selular, kemarin kepada Waspada, Drs H Syarifuddin Rosha menyebutkan, alasannya karena pelaksana pembangunan Bandara Kualanamu sama sekali mengabaikan Surat Keputusan (SK) Menteri Perhubungan (Menhub) No KM 0508. Isinya, sebut mantan sekretaris Pemuda Pancasila Deliserdang ini, pembangunan bandara dan kedua pelaksana wajib bertanggung jawab terhadap kerusakanlingkungan.“Jikapelaksana mengabaikankeduapoininimaka keberadaannya akan ditinjau kembali,” tegasnya. “Empat tahun yang lalu surat keputusan (SK) Menteri Perhu-

bungan (Menhub) ini sudah merebak, kini saya melihat seperti terabaikan.Lihatsajakondisijalan Lubukpakam –Pantai Labu saat ini kian parah bila disiram berlumpur sebaliknya jika tidak berdebu,” tegas Drs H Syarifuddin Rosha Soal kerusakan jalan ini Waspada mencoba meminta keterangan dari Firdaus, Humas AngkasapuraCabangIIMedan.“Maaf saya lagi ada kegiatan keluarga mengingat hari libur. Coba tanya soal ini langsung ke pelaksana di Kualanamu,” ujarnya singkat lewat ponsel kemarin pagi. Namun Syarifuddin sesuai janjikepadaharianiniakhirpekan lalu, masalah yang membelit dalampembangunanbandaraKualanamu ini cukup dilematis dan menggambarkan kesewenangan pemerintahan.“Parahnyahingga kini sertifikat tanah bandara belum jelas, sehingga jelas merugikan pemerintah setempat. Jika ini jelas kan sudah ada ketentuan masuk kas daerah, yakni Biaya Perolehan Hak atas Tanah dan Bangunan (BPHTB),” sebut sekretaris Komisi C DPRD Deliserdang ini.

Malah, belum lama ini pihaknya mempertanyakan soal Izin Mendirikan Bangunan (IMB) bandara tersebut, yang hingga kini belum tercatat. “Hingga kini masih proses ke Mahkamah Agung. Surat sudah Komisi C layangkan ke Mahkamah Agung, namunharusmelewatipimpinan kami,” jelasnya yang menyarankan Waspada konfirmasi ke pimpinan dewan. Sayang saat dihubungi lewat ponsel, pimpinan dewan belum bisa menjawab. Langgar UU No 32 Soal Otonomi Daerah “Saya tegaskan semua masalahyangmembelitinimerupakan pelanggaran terhadap undangundang nomor 32 soal otonomi daerah. Ancamannya bisa 10 tahun penjara. Lagi-lagi dalam hal ini hukum begitu tumpul,” kembali Syarifuddin mereferensikan. Contoh lain, tambah Syarifuddin, adalah masalah teranyar yakni pengorekan pasir yang jelas ilegaldilakukandidalambandara. “Saya sudah berulangkali mendesak pihak Cipta Karya dan Pertambangan serta Satpol PP untuk menghentikan kegiatan itu. Na-

mun apa lacur, hingga kini pekerjaanilegaliniterusberlanjut,”sesalnya. Begitu pun, Syarifuddin tidak menampik dampak positif dari pembangunan yang menghabiskan dana triliunan, terhadap masyarakat setempat. “Meski sempat terkatung-katung infrastruktur di dalam sudah bisa dikatakan melewati angka 50 persen,” ungkapnya. Hanya, Syarifuddin ingin pembangunantersebuttetapberjalan pada aturan yang sudah ditetapkan.“InikanNegarahukum. Aturan soal pengelolaan sumberdaya alam dan manusia jangan terabaikan lah. Kunci pembangunaninilancarcukupmudahyakni saling menghargai, mana yang hak mana yang kewajiban. Saya yakin jika semua pihak menjalankan ini, praktis akan menjadi contoh bagi mega proyek lain yang ada di tanah air. Hargailah masalah yang kecil karena sebenarnya dia bisa menjadi masalah yang besar,” tamsil Syarifuddin yang kembali meminta kearifan semua pihak menyikapi hal ini. (m16)

Pasangan KB Lestari Dari Langkat Wakili Sumut Ke Harganas STABAT (Waspada): Kabupaten Langkat terus mengukir prestasi dan kali ini melalui Badan Keluarga Berencana dan Pemberdayaan Perempuan, bumi Langkat berseri terpilih mewakili Propinsi Sumatera Utara ke Tingkat Nasional sebagai pasangan KB Lestari Teladan 10 Tahun. ‘’Jagakesehatankembangkan wawasan selama mengikuti masa orientasi dan puncak acara nantinya,”pesan Bupati Langkat H Ngogesa Sitepu yang juga didampingi Ketua DPRD H Rudi Hartono Bangun ketika menerimapasanganKBLestariTeladan 10 Tahun atas nama Bambang dan istrinya Susi Handayani di rumah dinas bupati di Stabat, Selasa (14/6). Bupati juga menyatakan rasa terima kasih atas kemampuan pasangan tersebut sehingga terpilih mewakili Sumut ke Tingkat Nasional, sembari berharap da-

pat mengenalkan Langkat saat beradadikarantinamaupunpuncak acara Hari Keluarga Nasional (Harganas) di Lembang Bandung Barat, Provinsi Jawa Barat pada akhir Juni nanti. Sebelumnya Kaban KB dan PP Darwan Hasrimy melaporkan keikutsertaan Langkat atas terpilihnya pasangan Bambang dan Susi Handayani mewakili ProvsupadakegiatanHariKeluarga Nasional di Jawa Barat. Keberhasilan pasangan ini setelah mengikuti seleksi masingmasing di Tingkat Kecamatan, Kabupaten dan Provinsi. Untuk dimaklumi bahwa pasangan KB Lestari ini sebagai peserta KB Kon-dom dan KB IUD mulai tahun 1998. Pasangan yang dikaruniai 2 orang anak beralamat di Lingkungan IV, Sidosari Luar, Keluarahan Tanjung Selamat Kecamatan PadangTualang.SuamidariSusiHan-

BINJAI (Waspada):Tiga orang menderita luka berat-ringan ketika sekawanan preman menyerang warga Dusun Tembis, Kel. Tanah Merah, Kec. Binjai Selatan, Jumat(17/6) sore. Peristiwa itu dipicu karena keinginan kawanan preman yang mengajak warga menggarap lahan PTPN II, ditolak.Ketiga orang tersebut, kini dirawat di RSU Artamedica dan Rumah Sakit Djoelham Binjai. Ketiga korban masing masing Bage Ginting ,70, mengalami luka beratdankinimasihdalamkeadaankomaakibatbacokanyangdilakukan oleh sekelopok preman. Sepi Sembiring ,60, dan Conto Sembiring juga mengalami luka bacok, kesemuanya warga Dusun Tembis. Kapolres Bnjai AKBP Dra Rina Sari Ginting ketika dikonfirmasi Waspada melalui Kasat Reskrim AKP Roni Bonic, SiK membenarkan kasus itu.Pihaknya sedang menyelidiki pelaku pembacokan. Informasi dihimpun Waspada di lapangan dan di kepolisian dan Kepala Dusun Tembis Rusli Sembiring dan warga Sehat Tarigan, sebelumnya warga dusun setempat mengerjakan lahan PTPN II Kebun Sei Semayang. Hal ini sudah dilakukan warga beberapa tahun dan tidak ada kendala dari pihak perkebunan. Sehari sebelum kejadian, sekelompok pemuda datang ke Dusun Tembis, dan mengajak untuk menggarap lahan PTPN II yang lokasinya tidak jauh dari kediaman mereka. Namun hal itu ditolak wargaTembis. Tetapi pada Jumat sore, kelompok preman mengamuk, merusak rumah warga serta menyerang warga. Polres Binjai yang mendapat pengaduan langsung menurukan puluhan anggotanya ke lokasi kejadian dan mengamankan Dusun Tembis. Melihat polisi dating, kelompok preman tersebut kabur dengan sepeda motor. Kasus itu mendapat perhatian Ketua Fraksi PKS DPRD Sumut Hidayatullah,SE. Dalam siaran persnya yang diterima malam tadi, Hidayat meminta Kapoldasu membasmi preman di Kota Binjai yang selama ini membuat resah warga di sana. (a05/m14)

KA Tubruk Panther Di T.Tinggi, Sopir Selamat TEBINGTINGGI (Waspada): Ali, 37, sopir mobil Panther B 8560 JWselamatdarimarabahayasetelahmobilyangdikemudikannyaditubruk Kereta Api (KA) penumpang di perlintasan KA tanpa pintu nengnong dan tanpa penjaga di Ling. II, Kel. Lalang, Kec. RambutanTebingtinggi, tepatnya di Jalan Gunung Simeru, SimpangTakari menuju Desa Paya Lombang, Kab. Serdang Bedagai, Jumat (17/6) siang Menurut informasi, Ali,37, yang mengendarai mobil seorang diri datang dari arah Desa Paya Lombang menuju Kota Tebingtinggi. Saat melintas di perlintasan tanpa pintu nengnong, datang kereta apipenumpangdariarahMedanmenujuTebingtinggihinggatubrukan tak terhindarkan. Mobil yang dikemudikan Ali sempat terpental beberapa meter keluar dari rel perlintasan KA. Bagian belakang mobil rinsek, namun Ali sales racun rumput ini selamat tanpa mengalami luka-luka. Menurut warga sekitar, sebelum tabrakan, mereka telah berteriak memberitahukan pengemudi mobil bahwa kereta api akan melintas, namun karena seluruh kaca mobil tertutup rapat, sang sopir tidak mendengarkan teriakan warga. “Kamiberteriakmengingatkansopiritu,namuntidakdidengarnya,” ucap Musi warga di sana. Sementara Ali, warga Perbaungan, Sergai mengaku tidak mengetahuikalaukeretaapiakanlewatkarenatidakadapintunengnong di sana. Kasus ini ditangani Satlantas Polres Tebingtinggi. Akibat kejadian itu, pemilik mobil rugi puluhan juta rupiah.(a11)

Seorang Pemburu Babi Tewas Tersengat Listrik BESITANG (Waspada): Satu dari enam orang pemburu babi tewas tersengat arus listrik tegangan menengah (TM) di pedalaman Dusun Sekundur Nauli, Desa Bukitselamat, Kec. Besitang. Korban, Pahanatan Doloksaribu, 22, warga Lingkungan V Kampungsawah, Kel. Bukitkubu, Kec. Besitang, Jumat (17/6) tewas ditempat kejadian setelah pohon kayu yang ditebangnya tersentuh jaringan kabel PT PLN. Salahseorangtemanberburukorbanbegitumelihatkejadiantragis ini segera memberitahukannya kepada teman-teman mereka. Dalam kondisi sudah tak bernyawa, korban dievakuasi ke rumah duka. Kematianpriayangberstatusmasihlajangitutakhanyamembawa duka mendalam bagi keluarganya, tapi juga bagi teman-temannya sesama pemburu hewan liar yang menjadi musuh petani.(a02)

DPRD Sidoarjo, Belajar PAD Ke Binjai

Waspada /Ibnu Kasir

BUPATI Langkat H Ngoegsa Sitepu dan Ketua DPRD Langkat Rudi Hartono Bangun menyampaikan ucapan selamat kepada pasangan KB Lestari Bambang dan istrinya Susi Handayani yang mewakili Propinsi Sumatera Utara ke Tingkat Nasional saat beraudiensi di rumah dinas bupati di Stabat, Selasa (14/6). dayaniberstatussebagaikaryawan

di PTPN II Sawit Seberang. (a01)

BINJAI (Waspada): DPRD Sidoarjo,Jawa Timur melakukan studi banding ke Binjai tentang penggalian Pendapatan Asli Daerah( PAD). Enam fraksi DPRD Sidoarjo dipimpin Ketua Mundir Dusi Ilmawan berkeinginan memperoleh sumber PAD,agar dapat dimanfaatkan di Sidoarjo. Menurut staf Humas Pemko Binjai Hendrik Kamis( 16/6), DPRDSidoarjo ingin memperoleh masalah izin gangguan, perdagangan,industri,peternakan, pengolahan sarang burung walet, pemanfaatan air bawah tanah serta IMB. Menurut pimpinan rombongan, sistem pendapatan asli daerah di Binjai akan dijadikan referensi. Mana yang potensil bisa dimanfaatkan di Sidoarjo untuk menggali sumber PAD. Diakui penduduk Sidoarjo lebih kurang dua juta, sangat diperlukan belajar ke Binjai. Hasil studi banding ini akan dievaluasi tim. Mana bermanfaat dan belum dipraktikkan di Sidoarjo, kita akan menggali sistem yang ada di kota Binjai. (a04)

Pemkab Sergai-Kejari Sei Rampah Tandatangani Kesepakatan Bersama SEIRAMPAH (Waspada) : Dalam upaya penyelesaian masalah-masalahhukumdanmemberikan perlindungan kepentingan umum serta menjaga dan mengamankan aset-aset negara, untuk pertama kalinya Pemkab Serdang Bedagai menandatanganikesepakatanbersamadengan Kejaksaan Negeri Sei Rampah yang dituangkan dalam bentuk piagam kerjasama dalam bidang penanganan perkara Perdata dan Tata Usaha Negara. Kesepakatan itu meliputi, pemberian bantuan hukum dalam penyelesaian sengketa hukum, pertimbangan hukum dan tindakan hukum. Naskah kesepakatan tersebut ditandatangani Bupati Sergai HT Erry Nuradi bersamaKejariSeiRampahErwin Harahap di Ruang Rapat Wakil Bupati Kantor Bupat Sergai di Sei Rampah, Rabu, (15/6). Penandatanganan penanganan perkara Perdata danTata UsahaNegaratersebutjugadisak-

sikan Sekdakab Sergai H Haris Fadillah, Staf Ahli Bupati Bidang Hukum dan Politik Hotman Hutajulu, Inspektur Sergai H Gustian,Kadis Disdik Sergai Rifai Bakri Tanjung, Kabag Hukum Jufri Eddy, Kabag Humas Indah Dwi Kumala serta Para Kepala Seksi Jajaran Kejari Sei Rampah. Bupati Sergai Erry Nuradi menyatakan penandatangan piagamkerjasamainimerupakan suatu langkah yang baik untuk itu diharapkan kepada pihak terkait dapat memahami dan menjalankan kesepakatan ini dengan kesadaran yang tinggi dan penuh rasa tanggung jawab sesuai dengan peraturan perundang-undangan yang berlaku. Sehingga dapat terus terjalin kerjasama yang baik dan berkesinambungan, karena roda penyelenggaran pemerintahan ini tidak dapat berdiri sendiri tanpa dukungan dari berbagai unsur baik itu dari legislatif dan yudikatif dalam hal ini Kejari Sei Rampah.

Lebih lanjut Bupati mengharapkan melalui kesepakatan bersama ini, untuk ke depannya penanganan masalah dan sengketa hukum Perdata dan Tata Usaha Negara,dapatdiselesaikandengan cepat dan berjalan lancar. Kejari Sei Rampah Erwin Harahap mengemukakan, penandatangani kerjasama ini sebagai tugas dan program kerja Kejaksaan dalam memberikan pelayanan dan bantuan hukum (pengacara negara) dibidang Perdata dan Tata Usaha Negara kepada instansi-instansi pemerintah, BUMN dan BUMD. Sesuai dengan Keppres No.55 Tahun 1991 Pasal 25 Jo Pasal 21 bahwa KejaksaanRImempunyaitugasyang meliputi enam bidang, di antaranya bidang Perdata dan TUN yang intinya bidang ini mempunyai tugas dan wewenang melakukan penegakan hukum, bantuan hukum, pertimbangan hukum dan pelayanan hukum. (a08)

Waspada/Eddi Gultom

BUPATI Sergai HT Erry Nuradi bersama Kajari Sei Rampah Erwin Harahap saling menyerahkan nota piagam kerjasama penanganan perkara Perdata dan Tata Usaha Negara antara Pemkab Sergai dan Kejaksaan Negeri Sei Rampah, Rabu (15/6).


Sumatera Utara

C2 Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, Rizaldi Anwar, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Rama dhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

30 Petani Dan Nelayan DS Ikut Penas XIII Di Kaltim LUBUKPAKAM (Waspada) : 30 Petani dan nelayan di Deliserdang akan mengikuti Pekan Nasional Kontak Tani dan Nelayan (Penas KTN) XIII/2011 di Tenggarong, Kab. Kutai Kartanegara, Kalimantan Timur, 18-23 Juni 2011. Petani-nelayan itu berasal dari bidang pertanian 19 orang, perikanan 5 orang, ketahanan pangan 3 orang dan bidang kehutanan 3 orang merupakan kelompok tani andalan (KTA) yang akan mengikuti berbagai lomba ketangkasan dan keterampilan sesuai bidangnya. “Kita harapkan peserta Deliserdang yang tergabung dengan kontingen Sumut memanfaatkan forum Penas XIII/2011 dengan sebaik-baiknya melalui pertemuan, diskusi, pameran, studi banding, peragaan dan tukar menukar informasi dan teknologi dengan peserta lainnya,” kata Kabid Pertanian Dinas Pertanian Deliserdang H Maimuddin Nasution, Selasa (14/6). Menurutnya, tujuan KTA Deliserdang mengikuti Penas XIII/2011 untuk meningkatkanmotivasidangairahpetani-nelayandanmasyarakat pelaku agribisnis dalam pembangunan sistem usaha agribisnis yang berdaya saing, berkerakyatan dan berkelanjutan melalui kemitraan yang saling menguntungkan sekaligus menumbuhkan minat generasi muda pada pertanian, perikanan dan kehutanan. Disebutkannya, pada Penas KTN, bidang pertanian Deliserdang akanmenampilkanpemanfaatan teknologinonorganiksepertipestisida nabatidenganmemanfaatkankotoranternak.Kemudianuntuklomba pengembangantanamanmelaluitehnispencangkokandanstek,demikian juga bidang perikanan, kehutanan dan tanaman pangan. Diperkirakan 30 ribu peserta dari seluruh Indonesia menghadiri perhelatanlimatahunanyangakandibukaPresidenRISusiloBambang Yudhoyono. Selain peserta dalam negeri,Penas KTN XIII/2011 juga diikuti puluhan peserta petani luar negeri di antaranya Jepang, Vietnam,b Malaysia, Thailand, dan Filipina. (a06)

Senin 20 Juni 2011

Majelis Talim Nurhasanah Akan Dirikan TPA Gratis Se-Kab Labusel

WASPADA

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: H.T. Dony Paridi. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan).

WASPADA

Waspada/ Hasanuddin Harahap

Hj Hasnah Wildan Aswan Tanjung saat memberikan arahan di hadapan pengurus dan anggota Majelis Ta’lim se Kec. Torgamba, Jumat (17/6).

Pengolahan Minyak Mentah Ilegal Mulai Marak Di Langkat STABAT (Waspada): Gudang pengolahan minyak mentah (kondensat) secara ilegal mulai marak di Kab. Langkat. Di Kec. Wampu dan Hinai terdapat tiga gudang pengolahan minyak, satu di antaranya telah terbakar 9 Juni 2011. Namun pemiliknya belum diproses secara hukum meski terang-terangan mengolah minyak tanpa izin. Selain itu lokasi penyulingan minyakilegaljugabanyakterdapat di kawasan Bulutelang dan Bukit Tua Kec. Padangtualang. Tidak hanya eksplorasi minyak secara ilegal, kegiatan disana juga berlanjuthinggapengolahanminyak mentah menjadi BBM. Menurut Arfan, salah seorang warga Padangtualang, Ka-

mis (16/6), maraknya ekplorasi yang dilakukan kelompok masyarakathinggapengolahanminyak mentah menjadi BBM, meresahkan masyarakat. Pasalnya hasil penyulingan itu kini terduga telah bebasdijualdipasaran,sementara mutu minyak diyakini warga Padangtualang kurang baik. Kades Bulutelang Kec. Padangtualang Zulham S yang ditemuidisela-selaunjukrasadiDPRD Langkat, Kamis, membenarkan banyaknya kegiatan penyulingan minyak meskipun dia tidak dapat memastikan kegiatan itu ilegal atau legal. ‘’Kita tidak memiliki hak untuk menertibkannya,’’ ujar kades seraya menghindar pergi. Secara terpisah dikatakan pengurus GP Alwashliyah Kab.

Langkat, Hasan Basri, meminta aparat yang terlibat dalam pengawasanmaupunpenertibanuntuk menindak tegas pertambangan ilegal tersebut. ‘’Jika tidak ditanggapi secara serius, tidak tertutup kemungkinan akan banyak beredar di pasaran BBM dengan kualitas rendah karena penyulingannya tidak ditangani sesuai prosedur,’’ katanya. Menyangkut adanya dua gudang pengolahan minyak mentahilegaldiKec.Wampu,Kapolsek Stabat AKP Risya Mustario ketika dikonfirmasi Kamis (16/6) mengatakan, aktifitas pengolahan di gudang yang dimaksud sudah tidak ada. ‘’Kemarin mau kita grebek, tetapi gudang telah terbakar,’’ sebut Kapolsek. (a03)

40 Persen Perusahaan Di DS Tak Miliki Dokumen UKP-UPL LUBUKPAKAM (Waspada): Dari 700 lebih perusahaan yang beroperasi di Deliserdang, sekira 40 persen di antaranya tidak memiliki dokumen UKL/UPL dan DPLH (upaya pengelolaan lingkungan/upaya pemantau lingkungan dan dokumen pengelolaan lingkungan hidup (DPLH). Sedangkan bersadarkan UU nomor 32/2009 tentang perlindungan dan pengelolaan lingkungan hidup ditegaskan setiap perusahaan industri di wajibkan memiliki dokumen UKL/UPL. Terhadappengusaha/pemilik perusahaan sudah dilakukan pemanggilan dan telah dilakukan pendataan perusahaan untuk melengkapidokumenUKL/UPLnya. Tapi masih banyak yang belum lengkap. “Jika sampai batas waktu yang ditentukan (Oktober 2011), perusahaan-perusahaantersebut belum juga memiliki, maka akan dilaporkan ke pihak berwajib,’’

tegasKepalaBadanPengendalian Dampak Lingkungan Daerah Deliserdang H Susmono, Senin (13/6). H Susmono menjelaskan, perusahaan industri yang wajib memiliki dokumen pengelola lingkunganhidupadaduakriteria. Kriteriapertamabagiindustriyang belum beroperasi wajib memiliki dokumen UKL/UPL dan kriteria kedua bagi industri yang sudah beroperasi wajib memiliki dokumen DPLH. Itu sebabnya, penyusun dokumen AMDAL wajib memiliki sertifikat kompetensi penyusun dokumen Amdal karena merupakan persyaratan untuk penerbitan izin lingkungan. Selain itu, ada pengaturan diamanatkan dalam UU nomor 32/2009 yang menyebutkan dikenakannya sanksi pidana dan perdata terkait pelanggaran bidang AMDAL. Selain itu bagi orang yang melakukanusaha/kegiatantanpa

memilikiizinlingkunganmaupun yangmenyusundokumenAmdal tanpa memiliki sertifikat kompetensi, serta pejabat yang memberikan izin lingkungan tanpa dilengkapi dengan dokumen AMDAL atau UKL-UPL dapat dikenakan sanksi pidana dan perdata terkait pelanggaran bidang Amdal. Karenanya sesuai yang diamanatkan UU, seluruh perusahaan yang wajib UKL-UPL, wajib memiliki dokumen. Sedangkan bagi perusahaan yang baru berdiri harus terlebih dahulumengurusizinlingkungan hidup. Bagi perusahaan yang tidak wajib UKL-UPL,diwajibkan memiliki surat pernyataan sanggupmenjagalingkungandiketahui Bapedalda. Karenanya bagi pengusaha yang belum memiliki izin sesuai dengan ketentuan diimbau untuk segera mengurus izinnya. (a06)

Workshop Peningkatan Kualitas Pembelajaran BTL 2 Di SMPN 1 Labuhandeli LABUHANDELI (Waspada): 77 Guru SMP Negeri 1 Labuhandeli, Kab. Deliserdang mengikuti workshop peningkatan kwalitas pembelajaran Batter Teaching and Learning 2 (BTL 2) bekerjasama dengan Decentralizen Basic Eduaction 3 (DBE) USAID UNICEF Provinsi Sumatera Utara, pekan lalu. Workshop dibuka Kadis Dikpora Kab. Deliserdang Hj Sya‘adahLubis,SPd. MAPdidampingi Kepala SMPN 1 Labuhandeli Drs Misran Sihaloho, MSi, yang turut dihadiri Camat Kec. Labuhandeli Dedi Maswardi, SH. MAp, Kacabdis Dikpora Kec. Labuhandeli, unsur Pengurus Komite SMPN 1 Labuhandeli Drs Budiman Saragih, Koordinator DBE 3 USAID UNICEF Provsu Anwar Suhut Situmorang, SE dan 8 orang Distrik Fasilitator DBE 3 (8 Orang). Kadisdikpora Deliserdang Hj Sya’adah Lubis, SPd dalam sambutannya mengatakan, pada tahun ini Kab. Deliserdang terpilih sebagai nominator 13 kabupaten/kota di seluruh Indonesia yang akan dipilih menjadi nominator terbaik, Kabupaten Layak Anak/Kabupaten Ramah Anak (KLA/KRA). Untuk itu seluruh aparat Dinas Pendidikan di seluruh Kab. Deli Serdang agar turut mendukung kegiatan-kegitan KLA/KRA, agar Deli Serdang bisa menjadi yang terbaik. Dijelaskannya, berbicara tentang peningkatn mutu guru, pemerintah sudah sangat banyak mengaspirasikeinginanguru,tapi kemudian adakah perubahan yang bisa kita lakukan dengan perhatian pemerintah yang begitu besar dimaksud, tentu gurulah yang paling bisa menjawabnya, maka kegiatan workshop BTL 2 di SMPN 1 Labuhandeli bekerjasama dengan Decentralizen Basic Eduaction 3 (DBE) USAID UNICEF Provsu sangat tepat dilakukan untuk menyahuti

Waspada/Ist

KADIS Dikpora Kab. Deliserdang Hj Sya‘adah Lubis, SPd. MAP (empat dari kiri) didampingi Kepala SMPN 1 Labuhandeli Drs Misran Sihaloho, Msi ketika membuka workshop Workshop Peningkatan Kualitas Pembelajaran BTL 2 Di SMPN 1 Labuhandeli, belum lama ini. perhatian pemerintah tersebut. ’‘Pembenahahn dan penataan sekolah harus terus dilakukan,denganmemanfaatkanseluruh stakeholder yang ada, pengecatan, penataan taman. Tapi tak bolehdilupakanpenciptaanpembelajaran yang lebih bermakna seperti penerapan pembelajaran Paikem (pembelajaran aktif, informatif, komunikatif, enjoyfull learning dan menyenangkan),‘‘ katanya. Camat Labuhandeli Dedi Maswardi, SH. MAP menginginkan agar sekolah dapat mengembangkan bakat dan minat anak sesuai kemampuannya, menerapkan pola pendidikan berkarakter, meskipun menurut beliau pendidikan dengan karir politik tidak berbanding lurus dengan pendidikan yang kita peroleh. ’‘Untuk menjadi Presiden, Gubernur, Bupati, DPR hanya cukup tamat SMA, sedangkan karirstrukturalsangatmenghargai pendidikan. Dari DBE3 Deliserdang Anwar Suhut Situmorang SE, hanya berharap agar kerjasama seperti inmi bisa terus dilakukan dengan berbagai sekolah

di Deliserdang,’‘ katanya. Kepala SMPN 1 Labuhandeli Drs Misran Sihaloho, MSi mengatakan, pelaksanaan worshop ini untuk mempersiapkan pola pembelajaran yang baru bagi guruSMPN1Labuhandelimenghadapi Tahun Pelajaran 20112012, dimana SMPN 1 Labuhandeli tahun ini meluluskan siswasebanyak257siswa(100persen lulus), SMPTerbuka Labuhandeli sebanyak33siswadanPadaTahun Pelajaran 2011-2012 akan menerima siswa reguler 7 x 38 ( 266 orang), siswa Persiapan Kelas RSBI 1 x 32 Siswa (32 Orang) dan juga akan menerima siswa SMP Terbuka 80 orang. Dikatakan Kepala Sekolah SMP Berprestasi tahun 2011 yang meraih juara II dan sedang mengikuti Program S-3 Manajemen Pendidikan di Universitas Negeri Medan ini berharap,Tahun Pelajaran 2011-2012 SMPN 1 Labuhandeli bisa diprogramkan menjadi salah satu sekolah SMP Rintisan Sekolah Berstandar Internasional (RSBI) di Kab. Deliserdang yang sampai saat ini belum ada. (m43)

KOTAPINANG (Waspada): Program kerja Majelis Ta’lim Nurhasanah akan mendirikan Taman Pendidikan Alquran (TPA) secara gratis seKabupaten Labuhanbatu Selatan (Labusel). Kemudian anggota Majelis Taklim Nurhasanah membuat Serikat Tolong Menolong (STM) serta mengadakan pertemuan sekali sebulan guna membahas program organisasi itu.. Hal ini dikatakan Pembina MajelisTa’lim Nurhasanah Kab.Labusel, Hj HasnahWildan Aswan Tanjung di sela pelantikan Majelis Taklim Nurhasanah Kecamatan Torgamba, Jumat ( 17/7) di halaman kantor CamatTorgamba Jl. Lintas Sumatera-Riau di Cikampak. Menurutnya, Majelis Ta’lim ini dibentuk bertujuan untuk mempererat hubungan silaturahmi antara satu sama lain. “Semua anggota Majelis Ta’lim Nurhasanah jangan membeda-bedakan dengan MajelisTa’lim yang lain, bagi saya adalah sama. Anggota Majelis Ta’lim Nurhasanah boleh memasuki MajelisTa’lim lain,tidakdilarangsepanjangibu-ibupunyawaktu, karena saya melihat dua bulan sudah majelis ini dibentuk, ada semacam pengkotak-kotakan, ini tak boleh ya bu,” tegas Pembina Majelis Ta’lim Nurhasanah. Dia mengatakan ada 47,3 persen warga di Kab.Labusel dari kaum perempuan, Hj HasnahWildan Aswan Tanjung mengimbaukaumibumengawasianaknyadalammenonton TV dan bermain internet hingga larut malam,

karena dikhawatirkan mengganggu jam tidur anak sekolah. Menurut Pembina Majelis ini, ada 674 orang pengurusMajelisTa’limNurhasanahseKecamatan Torgamba sudah dilantik, di antaranya ada 145 orang adalah bilal mayit sampai ke tingkat desa se Kec. Torgamba. Bilal mayit ini adalah ibu-ibu yang siap mengorbankan waktu, ini meru-pakan suatu pekerjaan sosial. Kepengurusan Majelis Ta’lim di Kecamatan Torgamba merupakan jumlah yang terbanyak disbanding dari Kecamatan lain. “ Khusus kepada pakTomi Harahap dan ibu Hj.Uswathun Hasanah Tomi Harahap saya menyampaikan apresiasi dan ucapan terima kasih” kata Pembina Majelis Ta’lim Kab.Labusel itu. Bupati Labusel dalam sambutannya berpesan jangan nanti karena urusanMajelisTa’limsehingga urusan rumah tangga terkendala. Mari kita kawal anak anak kita kemudian saat suami keluar rumah dengan sepedamotor agar diingatkan agar menggunakan helm, katanya. Pengurus MajlisTa’lim Kec.Torgamba dilantik terdiri Ketua Umum Hj Nursaniah Sagala, Sekretaris Umum Juliana Beby, Bendahara Umum Marthalina Sembiring sedangkan Pembina untuk Kecamatan Torgamba Hj. Uswathun Hasanah Tomi Harahap, serta ratusan pengurus dari Majelis Ta’lim setiap Desa di KecamatanTorgamba. (a19)

Hutan Mangrove Lubuk Jaya Tanjungpura Beralih Fungsi STABAT(Waspada): Di kawasan Lubuk Jaya, Kecamatan Tanjungpura, Kabupaten Langkat banyak ditemukan kawasan hutan mangrove beralih fungsi menjadi perkebunan kelapa sawit. Hasil penelusuran bersama anggota DPRD Langkat dari Fraksi PKS, Maruf Ritonga, di sana masihadaempatalatberatyangsedangmembabat lahan mangrove untuk dijadikan perkebunan kelapa sawit di lahan seluas 300 hektare. Wakil rakyatitutidakdapatberbuatbanyakmenyaksikan hal demikian karena diduga pengalihfungsian itu dibackingi oknum-oknum tertentu. Dia meminta Pemkab Langkat menindak tegas aksi perambahan agar kawasan hutan mangrove di Tanjungpura tidak binasa ditangan oknum-oknum yang hanya mencari keuntungan. Lebih lanjut dikatakan Maruf Ritonga, pengalihfungsian kawasan hutan bakau bukan hanya terjadi di Lubuk Jaya Tanjungpura, tetapi juga diDesaKaryaMajuTanjungpura.‘’Anehnyahingga

kini tidak ada upaya pencegahan darurat yang dilakukanpetugasberwenang,’’kesalMaruf,Kamis (16/6). Menyikapi masalah itu Kadis Hutbun Kab. Langkat SupandiTarigan belum berhasil dimintai konfirmasinya karena tidak berada di kantornya, Kamis (16/6). Dihubungi via handpone juga tidak berhasil. Sementara Kabag Humas Pemkab Langkat Syahrizal juga belum berhasil menghubungi Kadis Hutbun hingga belum ada penjelasan mengenai ada tidaknya tindakan ataupun sanksi menyangkut alih fungsi kawasan hutan itu. Secara terpisah Camat Tanjungpura Nuriansyah menuturkan, untuk aktifitas penanaman kelapa sawit dari pembukaan kawasan hutan mangrove sebagaimana dimaksud hingga kini pengelolanya belum ada melapor.‘’Sampai sekarang mereka belum melapor, kita belum tahu apakahmerambahkawasanhutanataumenanam di lahan pribadi,’’ katanya Kamis (16/6) sore. (a03)

Asian Agri Group Sukseskan Peringatan Hari Lingkungan Hidup 2011 MEDAN (Waspada): Asian Agri bersama membutuhkan bantuan dari perusahaan yang TanotoFoundationikutmensukseskanperingatan beroperasi di daerah itu untuk membantu Hari Lingkungan Hidup Sedunia 2011 yang digelar menjaga dan meles-tarikan lingkungan termasuk PemerintahKotaKabupatenLabuhanbatu,Sumamembantu masya-rakat. tera Utara di PT. Supra Matra AbadI Asian Agri Menurutnya, meski Labuhanbatu dikenal group di Kebun Aek Nabara, Asian Agri, Rabu memiliki areal tanaman sawit dan komoditas (15/6)kemarin,denganmenyumbang1100pohon dari beberapa perusahaan perkebunan nusantara buah-buahan. maupun swasta, namun hasilnya tidak dinikmati Acara yang berlangsung sukses dan meriah pemerintah daerah itu. “Karena sesuai undangdihadiri oleh Bupati LabuhanbatuTigor P. Siregar, undang, hasil dari perkebunan seluruhnya untuk Kapolres,PN.Labuhanbatu,DandimLabuhanbatu pemerintah pusat.” serta unsur Muspida, tokoh agama, masyarakat Dia juga menjelaskan, 98 persen Anggaran dan pemuda. Pendapatan Belanja Daerah (APBD) habis untuk Head Stake Holder Asian Agri , FreddyWidjabiaya atau gaji pegawai yang mencapai 6.000ya, mengatakan, sumbangan 1.100 pohon proan orang. “Saya berharap agar perusahaan memduktif itu merupakan salah satu wujud nyata kepebantu masyarakat dan lingkungan sekitar kebun dulian perusahaan Asian Agri (AA) group dalam dan bahkan daerah lain seperti pantai dan saya menjaga lingkungan. Kepedulian lingkungan, dukung kalau perusahaan melakukan secara delanjutnya, bukan hanya dilakukan pada kegiatan ngan cara sendiri. Saya siapkan data kalau memertertentu seperti pada peringatan Hari Lingkungan lukannya,” kata Tigor. Hidup Sedunia 2011 yang digelar di Labuhanbatu, Bantuan bibit buah-buahan sebanyak 1.100 tetapi juga dalam setiap kesempatan. pohon dari Asian Agri yang akan ditanam di berba“Sebagai perusahaan yang bergerak di perkegai lokasi dan 500 pohon yang sebelumnya sudah bunan kelapa sawit dan produk turunannya yang dibagikan di daerah lain pada kesempaan yang juga merupakan usaha berkesinambungan, maberbeda, sangat mendukung program pemerinnajemen memang merasakan pentingnya mentahsecaranasionalyangmenargetkanpenanaman jaga lingkungan. Asian Agri komit menjaga dan satu miliar pohon dalam kaitan hari Lingkungan membantu segala upaya yang dilakukan semua Hidup. (h02) kalangan khususnya pemerintah untuk menjaga/melindungi dan melestarikan lingkungan,” kata Freddy. Dia menegaskan, kesadaran menjaga ling-kungan hidupseharusnyaditanamkan sejak dini seperti para siswa sekolah yang akan menjadi penerus bangsa. “Sehingga menjaga dan merawat lingkungan sudah tertanam sejak dini,” ujarnya. Asian Agri juga menyerahkan menyerahkan Waspada/Mursal AI 530 buku yang berwawasan BUPATI Labuhanbatu Tigor P. Siregar menanam pohon disaksikan lingkungan. Bupati Labuhan Batu, Head Stake Holder Asian Agri , Freddy Widjaya, di Lapangan PT. Tigor Panusunan Siregar, me- Supra Matra AbadI Asian Agri group di Kebun Aek Nabara, Asian ngatakan, pihaknya memang Agri, Rabu (15/6), kemarin.

Aksi Penipuan Via Telepon, Belasan Juta Raib T.TINGGI (Waspada) : Asman Ompusunggu, 62, warga Kampung Barisan Sidikalang, Desa Gelam Sei Sarimah, Kec. Bandar Khalifah, Kab. Sergai menjadi korban penipuan dengan modus mentransfer Rp16 juta dengan 4 kali pengiriman. Pensiunan PNS itu mengadukan kasus penipuan yang dialaminya ke MapolresTebingtinggi, Kamis (16/6) didampingi kedua anaknya Besni Lionita Ompusunggu, 32, dan Ferdando Ompusunggu, 30, yang dikabarkan penelefon gelap mendapat musibah. Dalam laporannya korban menyebutkan, saat kejadian, Selasa (14/6) Asman dan istrinya Tiarmin Raja Gukguk menerima telefon dari seseorang yang tidak mereka kenal. Dalam pembicaraan telefon, orang itu mengabari, anaknya Ferdando Ompusunggu yang sedang bekerja di Siborong-Borong mendapat musibah. Ferdando dikabarkannya telah membunuh seseorang, akibatnya dia dimassa warga kampung hingga kritis, karena mengalami luka berat di bagian kepalanya. “Anak bapak yang bernama Ferdando Ompusunggu di Siborong-Borong-Tapteng lagi mendapatmasalah,permasalahannyaadalahanakbapak membunuh orang, lalu dipukuli warga. Sekarang anak bapak kami tolong dengan membawanya ke Rumah Sakit di Padangsidimpuan. Karena kondisinya kritis banyak membutuhkan darah. Kami mohon bapak mengirimkan uang untuk keselamatananakbapak,”ucapkorbanmenirukan

ucapan si penelepon. Mendengar kabar itu, Asman dan istrinya terkejut, lalu menangis sambil meminta tolong kepada si penelefon agar nyawa anaknya segera ditolong. Saat itulah penelepon gelap tersebut meminta korban mentransfer uang Rp2 juta melalui Bank Mandiri atas nama Heriyah untuk biaya ongkosnya. Korban hari itu juga mengirimkan uang sesuai dengan permintaan si penelefon. Setelah uang dikirim, Asman kembali dihubungi kembali meminta transfer uang dengan alasannya tertangkap polisi sebagai pelaku pembunuhan. “Penelepon meminta dikirim uang Rp10 juta,” tutur Asman menirukan penelefon gelap itu. Mendengar uang Rp10 juta, Asman tidak mampu menyanggupinya, tetapi mengupayakan permintaan si penelefon. “Uang kami hanya ada Rp 8 juta, si peneloponpun menerimanya dengan mengatakan, “Kalau begitu tida apalah pak, Rp 8 juta itupun jadi, tetapi bapak langsung transfer ke BRI atas nama Jansen Sihite,” sebut Asman lagi. Namun keesokan harinya, Rabu (15/6) si penelefon misterius itu kembali menghubungi Asman dan kembali meminta transferkan uang Rp1 juta dengan alasannya untuk biaya perobatan di Puskesmas Padangsidimpuan. Kasus penipuan tersebut kini dalam penyelidikan petugas di Mapolres Tebingtinggi. (a11)


Sumatera Utara

WASPADA Senin 20 Juni 2011

Jalan Teluknibung Mulai Dibenahi

Kantor Adpel TBA Direhab Setelah 30 Tahun TANJUNGBALAI (Waspada) : Administratur Pelabuhan Tanjungbalai-Asahan melakukan rehab bangunan kantor setelah sejak didirikan 30 tahun lalu belum pernah dilakukan perbaikan. “Kita ingin memberikan pelayanan prima kepada para pengguna jasa baik secara langsung maupun tidak langsung seperti perusahaan pelayaran, agen pelayaran serta masyarakat umum,” kata Kepala Adpel Tanjungbalai-Asahan Arosokhi Nazara melalui Humas M Sihotang kepada Waspada, Kamis (16/6). Dikatakan Sihotang, kepala kantor beberapa waktu lalu mengajukan permohonan ke kantor pusat di Jakarta untuk mendapatkan bantuan dana rehabilitasi gedung kantor mengingat bangunan lama itu tidak layak dipergunakan lagi. “Kalau hujan turun sebentar saja, airnya pasti menggenangi seluruh ruangan dan dikhawatirkan dapat merusak inventaris kantor dan dokumen,” terang Sihotang. Dijelaskan, anggaran itu telah diterima pada tahun 2011 Rp949.527.000 dan pembangunannya juga telah dimulai dengan mengganti hampir 90 persen bangunan dan dikerjakan CV Sei Dua Raya. “Semua prosedur telah kita laksanakan mulai dari proses tender, pengerjaan kegiatan, sampai rampung nantinya sesuai Kepres No.54 Tahun 2010,” tutur Sihotang. Seorang agen pelayaran H M Zein Kamal dikonfirmasi Waspada mengaku prihatin dengan kondisi kantor Adpel yang selama ini selalu tergenang air saat hujan sehingga menghambat dan menyulitkan para agen maupun masyarakat dalam pengurusan surat-surat pelayaran. “Kami berharap, dengan direhabnya kantor baru, para petugas Adpel dapat meningkatkan sumber daya manusia serta profesionalitas dalam bekerja dan terpenting memberikan pelayanan yang lebih baik dari sebelumnya,” harap Kamal. (a32)

Bangunan Kantor BPBD Batubara Memprihatinkan TANJUNGTIRAM (Waspada): Bangunan Kantor Badan Penanggulangan Bencana Daerah (BPBD) Kab.Batubara di Desa Bagandalam Tanjungtiram kondisi nya memprihatinkan. Saat inibangunannyasudah‘kupak-kapik’aliasrusaksebelumditempati “Sayang botul bangunannyo udah salosai tapi tak ditompati.Alhasil rusak disobabkan dindingnyo papan kelapo dilapis traplek (triplek) diusak anak-anak tu “ ujar warga dekat kantor, Minggu (19/6) Tidak jelas alasan bangunan kantor BPBD yang sudah siap itu tidak ditempati dibiarkan rusak dicoret-co ret seperti jendela, dinding, kunci pintu Karena tak diawasi bangunan APBD Batubara 2010 dengan pagu Rp800 juta itu berubah fungsi jadi tempat kencan, ngisap ganja,miras pada malam hari Bangunan kantor pakai tangga itu dibagian atas dijadikan perkantoran, di bawahnya seperti lapangan Karena tak ditempati dinding dari papan kelapa kemudian dilapisi triplek dihiasi coretcoret ditulis dengan arang, kapur, berpecahan, jendela bercopotan. Sampai saat ini personil BPBD masih menumpang di Balai Pertemuan disamping kantor Camat Tanjungtiram .Dalam anggaran APBD Batubara 2011 dialokasikan dana penambahan ruang kantor BPBD (DAU) 1 paket de ngan dana Rp.299.788.500. (a12)

Wisuda PAUD Al Amin T.Tiram T.TIRAM (Waspada):Wisuda 24 siswa PAUD/Kober Al Amin Dusun II Desa Sukamaju, Tanjungtiram, Batubara berlangsung meriah, Sabtu (18/6) Ka.UPTTanjungtiram diwakili Jamhur mengatakan, peranan PAUD cukup membantu pendidikan awal bagi anak-anak sekitar desa. Serta diharapkan kerjasama baik pengelola PAUD dengan warga setempat Pimpinan PAUD Dra Ismawani menjelaskan, wisuda angkatan II sebagai langkah awal bagi wisudawan ke jenjang pendidi kan lebih tinggi. Menyampaikan terima kasih kepada pemerintah desa, para guru, masyarakat yang telah ikut membantu PAUD dipimpinnya. Acara wisuda menampilkan hiburan dari siswa seperti tari persembahan menabuh drum band, tari nyanyi serta membaca doa. (a12)

Tiga Sindikat Curanmor Antar Provinsi Babakbelur Di Babalan P.BRANDAN (Waspada): Tiga kawanan spesialis pencurian sepedamotor babak belur dihajar warga saat aksinya dipergoki korban dan spontan diteriaki maling di Desa Telukmeku, Kec. Babalan. Tersangka, Sa, 25, Sw, 25, dan Is, 22, ketiganya warga Dusun PantaiBuaya,DesaBukitmas,Kec.Besitang,Jumat(17/6)diamankan Polsek P.Brandan untuk mejalani proses hukum. Menurut keterangan, saat itu ketiga tersangka diduga hendak menyatroni sepeda motorYamaha Jupiter BK 3307 IP milik Suciati, 45, yang lagi parkir di pinggiran Jalan Dusun III, Desa Telukmeku, Kec. Babalan. Melihat aksi tersangka korban spontan meneriakan maling. Teriakan ibu rumah tangga itu menjadi perhatian warga di dusun itu. Para warga melakukan pengejaran dan berhasil membekuk ketiga pelaku. Kapolsek, AKP HM. Kosim Sihombing dikonfirmasi mengatakan, Sa, salah satu dari tersangka sudah empat kali terlibat dalam kasus curanmor di wilayah hukum P.Brandan juga termasuk di daerah Besitang. Menurut pengakuan tersangka, kata Sihombing, seluruh sepeda motor hasil curian tersebut telah ia jual kepada penampung gelap (penadah) ke daerah Lokop, Aceh Tamiang. “Kasus sedang kita kembangkan,” ujarnya. Dengan tertangkapnya, Sa dan dua rekannya, sejumlah warga yang pernah menjadi korban kehilangan sepeda motor berharap kepada polisi dapat membongkar jaringan sindikat curanmor yang lainnya.(a02)

Waspada/Rasudin Sihotang

KONDISI Jalan Besar Teluknibung sebelum ditertibkan terlihat kumuh dan kerap menimbulkan kemacetan. Foto direkam Kamis (5/4).

Pengerukan Pasir Kuala Tanjungtiram Mencurigakan LIMAPULUH(Waspada) : Rencana pengerukan pasir di Kuala Tanjungtiram oleh pengusaha dari Singapura, menurut DirekturEksekutifBatubaraHijau A Sahuri yang berbicara akhir pekan lalu, sangat mencurigakan. Modusbantuanuntukmengeruk Kuala Tanjungtiram dinilai pembodohan bagi rakyat Batubara. Menurutnya informasi yang diterima melalui pemberitaan diketahui, Singapura terus mengumpulkan pasir laut guna kepentingan reklamasi di negara itu yang terus memperbesar wilayahnya menjadi 70 kilometer persegi pada tahun 2030. Pengambilan pasir laut juga sangat membahayakan kelestarian lingkungan, karena merusak ekosistem, habitat sumber daya laut dan turunnyamukapulauyangsecara berangsur bisa berdampak pada tenggelamnya pulau. Batubara Hijau juga mempertanyakankemanahasilpenge-

rukan yang dikabarkan bekerja diatas lahan tiga hektar, kalau memang hasil pengerukannya untuk mereklamasi pantai – pantai kritis yang ada di Kabupaten Batubara seperti Pantai Kuala Sipari menurutnya sah – sah saja. Ataupun jika pengusaha Singapuraitumendirikanpabrikbahan jadi dari pasir kuarsa yang dikabarkanbanyakdipantaiBatubara dan hasil pengerukan itu yang notabene pasir maka itu juga sangat baik. Tapibilahasilpengerukannya itudibawakeSingapuraitusangat mencurigakan, sebab menurut informasiyangditerimanyaharga pasir laut mencapai 35 dolar Singapura per kubik. “ Kalau hasil pengerukan itu dibawa ke Singapura itu nyata-nyata pembodohan bagi rakyat Batubara, dalih pembangunan untuk memperlancar Kuala Tanjungtiram itu hanya modus untuk mempermudah kepentingan tertentu.

Untuk itu kita minta Pemkab Batubara dan pengusaha jujur kepada rakyat jangan setelah terjadi pengerukan terjadi penyesalan berkepanjangan,” kata Sahuri. Ia mengimbau rakyat Batubara jangan silau dengan itikad orang yang seolah-olah baik untuk Batubara, tapi sebenarnya mereka hanya memikirkan kepentingannya sendiri. Kabar tentang hancurnya ekosistem akibat pengerukan pasir di Riau kepulauan dan Batam diketahui telah mengakibatkan pulau tenggelam. Menurutnya pemerintah telahmengeluarkanlaranganekspor pasir laut melalui Peraturan Menteri Nomor 02/M-DAG/ PER/1/2007 tentang larangan ekspor pasir, tanah dan Top Soil, larangan itu bertujuan memudahkan pemerintah mengontrol dan melakukan rehabilitasi lingkungan pesisir dan laut.(c05)

Nasib Nelayan Kecil Batubara Memprihatinkan T.TIRAM (Waspada) : Faktor minimsaranadanprasaranapatroli sebagaialasanaparatdiPelabuhan Tanjungtiram,KabupatenBatubara sehinggatidakefektifmenjalankan pengawasan, adalah dinilai klasik dan mengada-ada. ‘’Ini alasan klasik dan mengada-ada. Karena minim sarana prasarana seperti kapal patroli sehingga tidak efektif menjalankan pengawasan. Padahal merupakan bagian dari tupoksi yang harusdilakukansebagaimanabebantanggungjawab,’’tukasZulnas salah seorang tokoh pemuda di Tanjungtiram kepada Waspada, Rabu (15/6) terkait lemahnya penindakan terhadap pelangga-

ran di laut. Pengoperasian pukat harimau/trawldansejenisnyasampai kepada masalah zona penangkapan nelayan dan pungli yang hingga kini masih menjadi kemelut di kalangan nelayan kecil yang bertangkahan di Kuala Batubara meliputi Kec Tanjungtiram, Talawi, Gambus Laut/ Perupuk, Kec Lima Puluh, dan Pagurawan Kec Medang Deras. Dia mengaku mengkonfirmasi langsung aparat berkompeten di pelabuhan dan mengatakan salah satu faktor mereka karena minim dan tidak lanyaknya kondisi sarana patroli. Akibatnya nasib nelayan

berskala kecil semakin terpuruk dan tertindas karena menjadi sasaran pungli baik berkedok ‘melapor’. ‘’Sudah kehidupan mereka Senin Kamis karena minimnya tangkapan di pungli lagi,’’katanya prihatin. Minimnyatangkapannelayan akibat keganasan pukat trawl dan sejenisnya melakukan penangkapan di zona nelayan kecil. Begitu juga bertindak sangat mudah,tanpaoperasikelautaparat bisa melakukan, karena boatboat penangkapan ikan ilegal itu keluarmasukmelewatipelabuhan dan bertambat di seputaran gudang.(a13)

DPRDSU Temukan Hutan Jadi Kebun Sawit Di Asahan MEDAN (Waspada): Tim reses DPRD Sumut dari daerah pemilihan (Dapil) VI merekomendasikanbeberapahalkepada Pemprovsu.Salahsatunyaadalah alihfungsikawasanhutanmenjadi perkebunan kelapa sawit. Lokasinya di Desa Tempurung, KecamatanSeiSepayangTimur,Kabupaten Asahan. Ketua Tim Reses Dapil IV, Mustofawiyah Sitompul, mengatakan itu kepada wartawan di gedung DPRD Sumut, Jumat (17/ 6). Rekomendasi atas temuan di lapangan itu telah pula disampaikan dalam rapat paripurna dewan, untuk diteruskan ke Pemprovsu untuk ditindaklanjuti oleh Satuan Kerja Perangkat Daerah (SKPD) terkait. Mustofawiyah Sitompul, menyebutkan, Pemprovsu belum juga merespon rekomendasi yang disampaikan dewan tentang masalah ini. Pada reses tahun2010,masalahinijugasudah disampaikan dewan.‚’’Saat reses I tahun 2011 ini, hal yang sama juga kita sampaikan kepada Pemprovsu,’’ katanya. Dijelaskannya bahwa rekomendasi khusus itu merupakan

aspirasi masyarakat yang dihimpun anggota dewan dari Dapil Sumut IV yang meliputi Kabupaten Asahan, Kabupaten Batubara dan Kota Tanjung Balai. KataMustofawiyah,ada1.000 hektare kawasan hutan di sana yang dialihfungsikan. 250 hektare di antaranya sudah menjadi perkebunan sawit dan sudah berproduksi. Sisanya masih dalam tahappengolahanuntukdijadikan perkebunan sawit. Kondisi serupa juga terjadi di Desa Bagan Asahan dan beberapa desa lain di KecamatanTanjungbalai, Kabupaten Asahan. Sedikitnya 150 hektare lahan kawasan hutan dialihfungsikan menjadi perkebunan sawit. Berdasarkan SK Menteri Kehutanan No. 44/2005, keduanya berada dalam kawasan jalur hijau hutan bakau. KomisiADPRDSumutbersama dengan masyarakat, sebelumnyasudahberulangkalimembahas, bahkan mengadukan masalah ini ke Kepala Dinas Kehutanan Perkebunan Kabupaten Asahan dan Kapolres Asahan. Namun hasilnya adalah praktik tangkap lepas dan pem-

biaran.

PT MMNA Selain itu, Tim reses IV DPRD Sumut juga menyoroti keberadaanPTMultiMasNabatiAsahan (MMNA) di Kecamatan Sei Suka, Kabupaten Batubara. Dalam operasionalnya menimbulkan permasalahan bagi masyarakat sekitar. Dari temuan di lapangan dan keluhan masyarakat, disebutkan bahwa waterpam yang dibangun perusahaan tidak hanya untuk kebutuhanpabrik,tetapijugauntuk penjualanairbersihkekapalkapal yang bongkar muat atau sandar di pelabuhan perusahaan itu. Pipa-pipa distribusi waterpam itu justru dibangun di badan irigasi yang selama ini digunakan untuk pengairan sawah masyarakat.Selainitu,jugaterjadipencemaranairlautakibataktivitaspencucian kapal yang sandar di dermaga perusahaan. Anggota dewan dari Dapil IV Sumut, berharap rekomendasirekomendasi tersebut menjadi perhatian pihak terkait agar tidak terjadi hal-hal yang tidak diinginkan dengan masyarakat di sana. (m12)

Dua Pemuda Tewas Terseret Arus Deras Sei Pelawi Langkat Waspada/Rasudin Sihotang

SEJUMLAH warga Kota Tanjungbalai memilih mencari pepohonan rindang di tepian Sungai Asahan sekedar duduk bersantai saat panas Matahari siang menyengat melanda daerah itu. Selain menikmati hawa sungai nan sejuk serta pemandangan indah hilir mudik sampan nelayan, para pencari kesejukan itu juga disuguhkan minuman khas air kelapa muda yang disediakan pedagang keliling. Foto direkam Minggu (19/6) saat panas terik pukul 13:00.

C3

P.BRANDAN (Waspada): Dua pemuda tewas terseret arus air saat mandi-mandi di Sungai Pelawi, dan satu mayat korban ditemukan, Sabtu (18/6 sedangkan seorang lagi, Minggu (9/6). Kedua korban Hepi, 25, wargaSimpangtiga,Sei.Bilah,Kec. Sei Lepan dan rekannya, Rudi, 21, warga Jalan Pendawa Pasarpipa, Desa Pelawi Selatan Kec Babalan. Menurut keterangan, kedua korban bersama rekannya, Sabtu siang itu mandi-mandi di Sungai

Pelawi dan mereka melompat dari atas jembatan. Saat itu, Hepi, bergantung di besi kolong jembatan. Tanpa disangka, kedua tangan pemuda yang lagi mencengkram besi, terlepas. Akibatnya, korban jatuh tercebur ke sungai yang berarus deras. Begitu melihat tubuh korban tenggelam, rekan-rekannya berupaya melakukan pencarian, namun tidak berhasil menemukannya. Warga pun turut melakukan

pencarian, dan akhirnya mayat pemuda itu ditemukan terapung di bawah jembatan kereta api. Upaya pencarian berlanjut atas seorang korban lagi yang belum ditemukan. Warga dibantu personil Natalyon Infantri (Yonif)-8 MarinirTangkahan Lagan melakukan penyisiran dengan perahu karet. Lalu, Minggu menjelang siang, mayat Rudi berhasil ditemukan. Kapolsek P. Brandan, AKP HM.Kosim Sihombing dikonfirmasi membenarkan.(a02)

TANJUNGBALAI (Waspada) : Jalan Besar Teluk-nibung (Yos Sudarso) yang berfungsi sebagai jalan utama transportasi pengangkutan barang dan jasa dari dan menuju pelabuhan Teluknibung mulai dibenahi. Ruas jalan yang biasa menjadi langganan kemacetan akibat banyaknya pedagang kaki lima yang menggelar dagangan kini mulai lancar. Sementara, pemandangan kumuh dengan tenda plastik berwarna-warni serta aroma tidak sedap bersumber dari air bekas ikan yang menusuk hidung saat melintas berangsur hilang, Minggu (19/6). Kemudian, saluran air pembuangan yang diatasnya berdiri kios-kios penjual ikan mulai dibongkar serta sampah-sampah yang memenuhi drainase dikeluarkan.“Alhamdulillah, sekarang udah lancar, tinggal lagi sampah bekas dari parit itu harus segera dipindahkan, kalau tidak, bisa menyebabkan kemacetan,” ujar Linda, 21, warga Kel. Seimerbau, Kec. Teluknibung. Hal senada juga diucapkan Umawi, 56, warga

Kel. Perjuangan, Kec.Teluknibung, yang kesehariaannya bekerja sebagai juru parkir di pelabuhan penumpang. Dikatakan, dirinya memberikan apresiasi kepada pemerintah kota dimana penertiban pedagang ikan itu merupakan bagian program Walikota Thamrin Munthe dalam menciptakan kota yang indah dan asri. Padahal tambah Umawi, beberapaWalikota telah menjabat di Kota Kerang itu sejak puluhan tahun lalu, namun belum pernah ada yang mampu memindahkan para pedagang kaki lima itu. “Walikota sebelumnya juga pernah menertibkan pedagang disana, akan tetapi mereka kembali lagi ke tempat semula dan terkesan dibiarkan. Tapi saya yakin, PakThamrin memiliki komitmen tentang hal ini,” terang Umawi. Sebelumnya, Satuan Polisi Pamong Praja KotaTanjungbalai dibantu unsur Muspika KecamatanTeluknibung melakukan penertiban puluhanpedagangkakilimadiJalanYosSudarsokarena menjadi penyebab utama kemacetan lalu lintas. Para penjual ikan segar itu kemudian di relokasi ke pasar Perjuangan tidak jauh dari lokasi. (a32)

Kadis PU Tanjungbalai ‘Ambil Alih’ Wewenang Walikota TANJUNGBALAI (Waspada) : Kadis Pekerjaan Umum KotaTanjungbalai Abdul Aziz, dinilai telah mengambil alih tugas dan wewenangWalikota dalam pengangkatan Pokja Unit Layanan Pengadaan (ULP) di instansi itu. Pengangkatan Pokja ULP ditetapkan melalui SK Kadis PU, padahal berdasarkan pasal 14 ayat 2 Perpres No 54 tahun 2010 tentang Pengadaan Barang/Jasa Pemerintah, ULP pada satuan kerja perangkat daerah dibentuk oleh Walikota. “ Pengangkatan Pokja ULP yang ditetapkan denganSKKepalaDinasPUtidaksah,dantindakan kepala SKPD itu telah melampaui batas kewenangannya,” kata Sekretaris Komisi C DPRD Kota Tanjungbalai Hakim Tjoa Kian Lie kepadaWaspada Minggu (19/6). Hakim menambahkan, pada pasal 130 Perpres no 54 tahun 2010 bagi SKPD yang belum dibentuk Unit Layanan Pengadaannya (ULP) , maka kepala SKPD menetapkan Pejabat/Panitia Pengadaan untuk melaksanakan Pengadaan Barang/Jasa. Sementara, Kadis PUTanjungbalai malah menantang Perpres No.54 Tahun 2010 dengan menerbitkan SK Pengangkatan Pokja

ULP. “ Seharusnya bukan membentuk Pokja ULP untuk melaksanakan pengadaan barang/ jasa di SKPD Dinas PU,” jelas Hakim. Oleh sebab itu, Hakim menilai, Pokja ULP padaDinasPUTanjungbalaitidakmemilikilegalitas hukum. “ Bertentangan dengan Perpres,”tukas Hakim. Hakim mendesakWalikota selaku penanggungjawab kebijakan pemerintahan di Kota Tanjungbalai untuk melakukan evaluasi terhadap persoalan tersebut, termasuk keabsahan pelaksanaan tender yang telah dilaksanakan. Dan, Hakim meminta agar Walikota membatalkan SK pengangkatan Pokja ULP Dinas PU karena bertentangan dengan Perpres No 54 tahun 2010 tentang Pengadaan Barang/Jasa Pemerintah. “ Kita tidak mengharapkan kegiatan pembangunan tahun 2011, khususnya dinas PU, akan menuai permasalahan hukum. Jika tidak ada evaluasiolehwalikota,danapabilaterjadipersoalan hukum makaWalikota yang harus bertanggungjawab,” pungkas Hakim. Sementara, Kadis PU Tanjungbalai dicoba dikonfirmasi melalui saluran telefon belum berhasil. (a14)

Lalai Menyuling BBM Tempat Pencucian Mobil Terbakar RANTAUPRAPAT (Waspada) :Sebuah tempat usahapencucianmobil ludesterbakardanmenghanguskan satu unit mobil Suzuki Katana BK 1413 DB, Sabtu (18/6) di Jalan Ahmad Dahlan Simpang Jalan Gatot Subrot Rantauprapat. Kebakaran itu diduga dipicu dari api rokok saat hendak menyuling/memindahkan BBM bensin dari sebuah mobil ke jerigen. Informasi yang diperoleh Waspada, disebutkan seorang anak pemilik tempat pencucian mobilituhendakakanmenyuling/memindahkan BBM bensin dari tangki mobil ke dalam jerigen sambil mengisap rokok. Tanpa disadarinya api mulai menjalar dari bawah kolong mobil dan membakar mobil dan lainnya. Kebakaran itu mengejutkan orang-orang yang berada di lokasi. Tidak ada korban jiwa dalam peristiwa itu. Peristiwa kebakaran yang terjadi di siang bolong itu, menjadi perhatian warga yang kebetulan melintas di jalan itu. Api berhasil dijinakkan dan tidak sempat meluas kemana-mana setelah mobil pemadam kebakaran tiba. Terlihat juga, disekeliling lokasi doorsmerr dan tempat usaha

servis radiator itu turut terbakar dan telah dipasang garis polisi. KabanKesbangLinmasLabuhanbatuHasnul Basri saat dihubungi wartawan, tidak dapat memberikan informasi banyak tentang kebakaran itu, namun hanya membenarkan saja ada peristiwaitu.Saatditanyatentanginformasikebakaran, Hasnul hanya menjawab, “ Hanya bengkel yang terbakar, dan datanya sama polisi,” ucapnya. Kapolres Labuhanbatu AKBP HirbakWahyu Setiawan SH SIK melalui Kasat Reskrim AKP Tito Hutauruk membenarkan. Tito menyebutkan, peristiwa kebakaran yang terjadi sekira pukul 12:30 itu meludeskan tempat usaha doorsmerr milik B Siburian, 68, warga JalanDurianRantauprapat,sertamenghanguskan 1 unit mobil Katana BK 1413 DB, mesin pompa, mesin dompeng, tabung gas elpiji ukuran 12 Kg dan 3 Kg. Sedangkan sumber api, diduga dari bawah kolong mobil tersebut, saat Ucok Siburian anak dari B Siburian itu merokok sambil menyulingn BBM bensin dari dalam tangki mobil ke jerigen. kerugian ditaksir mencapai Rp 150 juta. (a17)

Tak Layani Korban Laka, Puskesmas Siduadua Nyaris Diamuk Massa AEKKANOPAN (Waspada) : Keluarga korban kecelakaan lalulintas di Dusun Palia Desa Gunungmelayu Kecamatan Kualuhselatan Labura mengamuk dan menjerit-jerit karena Nurdin Sianipar tidak dilayani saat berada di Puskesmas Siduadua Kecamatan Kualuhselatan, Sabtu (18/6). Walau berada di puskesmas sekira 15 menit, namuntidaksatupunpetugasmedisatauperawat yang bertugas di sana menggubris korban. Karena kondisi korban yang dibawa dengan truk tidak dipedulikan petugas medis yang ada di sana , keluarga korban mengamuk dan menjerit-jerit. Salah seorang putra korban bernama Her memasuki ruang per ruang untuk meminta tolong agar ayahnya mendapatkan penanganan medis. Melihat situasi seperti itu, sejumlah warga yang berada di sekitar puskesmas langsung datang. Mengetahui korban lakalantas tidak dipedulikan, masyarakat jadi ikut emosi dan hampirsajadiantaramerekaadayangmelempari puskesmas itu. Namun karena dihalangi sebagian warga, keinginan untuk melempari puskesmas berhasil dicegah. Kendati massa sudah mengamuk, petugas tetap tidak acuh. Bahkan ironisnya, ada warga yang melihat Kepala Puskesmas Siduadua dr

Maimunah berjalan menuju ke belakang. Sementara itu, sebagian perawat ada yang asyik bermain tenis meja di belakang puskesmas. Salah seorang warga bahkan sempat menyemprotdokteryangmenjadiKepalaPuskesmas. “Apa takut tak dibayar maka kamu tak mau melayani? Kalau memang kamu tidak mau melayani bilang,” kata warga yang marah atas tindakan yang dialami warga yang membutuhkan pertolongan di fasilitas milik pemerintah itu. Khawatir dengan kondisi Nurdin Sianipar, keluarganya kemudian membawa pria itu ke RSUD Labuhanbatu Utara di Aekkanopan untuk mendapatkanpenangananmedis.Namunkarena kondisinya yang cukup parah, oleh petugas medis di RSUD itu, Nurdin dirujuk ke salah satu RS di Medan. Kepala Puskesmas Siduadua dr Maimunah yang dikonfirmasi Waspada di puskesmas itu mengatakan meminta maaf atas kejadian itu. “Saya minta maaflah pak. Mungkin lagi apes,” katanya ringan saat ditanya tentang kejadian yangmenimpawargayangmembutuhkanpertolongan medis di institusi yang dipimpinnya. Ia juga mengatakan, pada saat kejadian dirinya sedang berada di kamar mandi rumahnya yang berada satu kompleks dengan puskesmas itu. Dikatakannya, cukuplah sekali saja kejadian seperti ini. (c08)

Lingkungan Hidup Tanggung Jawab Bersama RANTAUPRAPAT (Waspada): Penyelamatan lingkungan hidup tanggung jawab bersama, oleh sebab itu harus mulai dari sekarang dilaksanakan dari yang kecil seperti membuang sampah pada tempatnya. Demikian dikatakan Bupati Labuhanbatu Dr H Tigor Panusunan Siregar, SpPD membacakan sambutan Menteri Lingkungan Hidup Gusti Muhammad Hatta, pada peringatan Lingkungan Hidup Sedunia di Lapangan Bola Kaki PT SMA Aek Nabara, Kecamatan Bilah Hulu, Rabu (15/6). Peringatan Hari Lingkungan Hidup 2011 sesuai dengan Tahun Hutan Internasional 2011 yang dideklarasikan Perserikatan Bangsa-Bangsa (PBB). Kesesuaian tema ini merupakan pengakuan, hutan memberikan kontribusi penting bagi pembangunan berkelanjutan, pemberantasan kemiskinan, dan pencapaian tujuan MDGs (Millennium Development Goals). Berkaitan dengan itu, Menteri KLH menga-

takan, rehabilitasi hutan masih terus ditingkatkan dan melibatkan semua komponen bangsa. Konversi lahan harus melihat aspek tata ruang melalui kajian lingkungan hidup strategis. KetuapanitiaHariLingkunganHidupSedunia 2011 L.Batu Lidya B Purba, SKM dalam laporannya mengatakan, peringatan hari lingkungan hidupseduniauntukmengingatkansemuapihak hutan mempunyai peranann penting dalam menyeimbangkan kehidupan semua makhluk hidup di bumi. Peringatan di L.Batu ini bertema forest nature at your service, artinya hutan penyangga kehidupan. Tema ini diangkat sesuai petunjuk dari Kementerian Negara Lingkungan Hidup dengan mengingatpentingnyamenjagakelestarianhutan. Pada kesempatan itu dilaksanakan pameran produksi bahan daur ulang bahan bekas, daur ulang sampah barang perusak lingkungan, dan pembagian hadiah dalam rangka peringatan lingkungan hidup. (a18)


Sumatera Utara

C4

WASPADA Senin 20 Juni 2011

Akses Jalan Kecamatan Di Madina Buruk

Waspada/Sarmin Harahap

SALAH satu ruas jalan di Kecamatan Puncak Sorik Marapi, tepatnya di Desa Hutabaringin Julu, Selasa (15/6) kondisi jalannya buruk, memprihatinkan dan luput dari perhatian Pemkab Madina.

Soal Masjid Nurul Hidayah Dibahas Developer Tak Hadir PERCUTSEI TUAN (Waspada) : Pejabat Muspika Percut Sei Tuan, Kab. Deliserdang beserta elemen Forum Umat Islam (FUI) Sumut,FrontPembelaIslam(FPI) sertaBadanKemakmuranMasjid (BKM) Nurul Hidayah, Desa Medan Estate, PS Tuan kembali membahasperihalkelangsungan masjid itu ke depan, Kamis (16/ 6). Pertemuan dipimpin Camat Percut Sei Tuan Darwin Zein didampingi unsur Koramil PSTuan dan Polsekta Percut dan dihadiri perwakilan Kantor Kementerian Agama Deliserdang Ismail serta sejumlah elemen/unsur Ormas Islam Sumut, Deliserdang dan Kec. Percut SeiTuan dan seyogianya juga hadir pihak Universitas Amir Hamzah. Pertemuan sekaligus pembahasan itu dilaksanakan aula kantor Camat Percut Sei Tuan. Namun, semua yang hadir termasuk Muspika menyayangkan ketidakhadiran pihak developer Pancing Bisnis/MMTC. ‘’Kami sudah dua kali mengundang MMTC selaku developer, namun tidak pernah hadir,’’ tegas camat. Pernyataanitudidukungoleh kalangan undangan yang hadir dan sudah pernah mengikuti beberapa pertemuan sebelumnya terkait kelanjutan Masjid Nurul Hidayah di Desa Medan Estate yang tetap dipertahankan umat Islam.Sementara, kondisinya kini sudah dipagari seng oleh developer yang menyatakan lahan masjid adalah milik mereka. Dalam pertemuan itu, Ketua II FUI Sumut Affan Lubis menyatakan tegas, tidak ada masjid yang tidak wakaf, yakni tanah maupun bangunannya. Sesuai Fatwa MUI Pusat 1983 tidak sah masjid jika tidak wakaf. Kemudian, MUI Pusat juga mendukung MUI Sumut/Medan yang menyatakan

masjid tidak boleh dipindahkan. Sofyan dari BKM Nurul Hidayah mengemukakan, BKM Nurul Hidayah tetap memfungsikan masjid tersebut. Kemudian, berdasarkan informasi peta MMTC, lokasi Masjid Nuru Hidayah berwarna hijau yang artinya pertapakannya bukan milik MMTC. Lalu, diungkap kembali Risalah Juli 2007 yang menyatakan tidak akan pernah ada penggusuran dan pemindahan Masjid Nurul Hidayah. Hal itu diperkuat dengan pernyataan FUI Deliserdang Rabualam Syahputra. Dia menyatakan tegas, sikap umat Islam sudah jelas, yakni masjid tidak boleh dipindahkan. Kemudian oleh Drg. Alisyahbana, dikemukakan pertanyaan dan pernyataan, apakah masalah paling urgen sehingga Masjid NurulHidayah hendak dipindah-

kan? Apakah masjid itu mengganggu? Sebelumnya,rencanapemindahan Masjid Nurul Hidayah ke areal/komplek Kampus UniversitasAmirHamzahdandibangun developer. Berjarak sekitar 500 meter dari lokasi sekarang. CamatPercutSeituanDarwin Zein dalam paparannya, mengemukakan, selaku pihak pemerintah senantiasa berada di tengahdantidakberpihak.Namun, sekaligus tidak menginginkan munculnya konflik serta gesekan berkaitan dengan Masjid Nurul Hidayah tersebut. ‘’Muspika sudah melayangkan undangan kepada developer seminggu lalu, namun kita sangat kecewa mereka tidak hadir,’’ tegas Darwin. Dia menambahkan, perihal terselenggaranya pertemuan berikut atau mendatang, masih

dimungkinkan. Namun, semua elemenyangdiundangmestihadir. Sementara dari FPI Deliserdang mengemukakan, Masjid Nurul Hidayah tidak boleh dibongkar apalagi dipindahkan. Melainkandenganterbangunnya kawasan Jalan Pancing, Desa Medan Estate justru semakin kita bangun megah Masjid Nurul Hidayah. H Hamdani Harahap, dari Lembaga Advokasi Umat Islam (LADUI) MUI Sumut tetap meminta Pemkab Deliserdang membongkar pagar seng yang melingkupi Masjid Nurul Hidayah. “Sekiranya Pemkab Deliserdang sudah terlanjur memberikan IMB pagar seng di sekitar Masjid Nurul Hidayah tersebut, kami berharap hal itu ditinjau kembali untuk dibatalkan,”katanya. (m34)

Akses jalan menuju sejumlah kecamatan di Kabupaten Mandailing Natal terlihat buruk. Selain sulit dilalui karena banyaknya lubang besar di badan jalan, juga karena tidak ada perawatan memadai sehingga ilalang di kiri kanan bahu jalan menutupi setengah badan jalan. Kondisi jalur transportasi ini tidaksajamemperlambatsirkulasi pemasaran hasil bumi masyarakat di kecamatan.Tapi kini berkembang ke arah ancaman keselamatan jiwa pengendara akibat badan jalan menyempit. Pantauan Waspada di lapangan, kondisi jalan seperti itu (buruk) banyak terlihat di Kecamatan Panyabungan misalnya, jalan jurusan Desa Sopo Batu, Aek Mata dan Aek Banir. Di Kecamatan Panyabungan Utarameliputijalanjurusan Desa Adian Jior - Hutabargot, Gunung Barani, Gunung Manaon, Rumbio, Soposorik, Kampung Baru, Kelurahan Mompang, dan Tanjung Mompang. Kecamatan Naga Juang meliputi jalan menuju Desa Humbang I dan II,Tarutung Panjang. Kecamatan Panyabungan Timur meliputi jalan menuju Desa Gunung Baringin, Pagur, Sirangkap, Hutatua, dan Banjar

Lancat. Kecamatan Panyabungan Barat meliputi jalan menuju Desa Tarutung, Barbaran, Longat, Hutatonga,danRunding.Kecamatan Puncak Sorik Marapi meliputi jalan meunju Desa Maga Dolok, Maga Lombang, Hutabaringin, Hutabaringin Julu, Sibanggor dan Hutanamale. Kecamatan Tambangan melipuji jalan menuju Desa Aek Marian, Muaramais, Pastap Jae, Pastap Julu, Angin Barat, Tambangan, Tambangan Pasoman, dan desa lainnya. Kecamatan Muarasipongi meliputi jalan menuju Desa Sibinail, Ranjobatu. Kecamatan Batang Natal meliputi jalan menuju Desa Hadangkahan, Salebaru, Aek Guo, Aek Manggis. KecamatanNaga Juang meliputi jalan menujuDesaSimau,BanjarPaku, jurusanjalansimpangBalimbingBanjar Paku. Akses jalan yang tergolong parah sejak Madina sebelum dan sesudah dimekarkan banyak dijumpai di kawasan Kecamatan Batahan, Sinunukan, Natal, dan Kecamatan Muara Batang Gadis. Di kawasan itu hingga kini masih banyak desa yang terisolir akibat jalur transportasi yang hampir lumpuh.

Karena itu ke depan diharapkan, program pembangunan fisik dari dana APBD, APBN, BDB dan sumber dana lainnya haru lebih terarah dan mengacu pada kepentingan untuk memulihkan dan meningkatkan perekonomian masyarakat. Dengan demikian, kendala transportasi bisa diatasi karena jalan merupakan salah satu kunci utama supaya pergerakan ekonomi dari sektor pedesaan bisa

terpacu maksimal. Untuk itu pihak eksekutif maupun legislatif jangan hanya mensahkan program pembangunanAPBD yang sarat “pesanan”. Semua pihak harus sadar, bukti salah satu daerah dikatakan maju bukan karena bisa menata kawasan ibu kota dengan megah. Tapi dilihat dari faktor dan banyaknya manfaat pembangunan bagi masyarakat di pedesaan. Sarmin Harahap

PAUD Diharapkan Langkah Awal Pembangunan SDM Bangsa T. TINGGI (Waspada) : Pendidikan Anak Usia Dini (PAUD) diharapkan bisa menjadi langkah awal pembangunan sumber daya manusia yang berkualitas bagi masa depan bangsa. Atas dasar itu, peranan pengeloa serta tutor yang terlibat didalamnya, tidak bisa diabaikan. Sudah seharusnya, perhatian pemerintah terhadap PAUD dimanfaatkan bagi sebesar-besarnya kemajuan PAUD di masa mendatang. Pesan itu disampaikan PlhWalikota Tebingtinggi diwakili Asisten Umum Agussalim Purba, Selasa (14/6), saat melepas ribuan siswa PAUD se Kota Tebingtinggi, di Gedung Asber Nasution. Terlihat hadir Kadis Pendidikan H Pardamean Siregar, MAP dan jajarannya serta Kakan Kemenag H Hasful Huznain. Ribuan warga dari berbagai kelurahan hadir di tempat itu. Sebanyak 55 PAUD terlibat dalam kegiatan, dengan melepas 1.214 siswa. Kadis PendidikanTebingtinggi H Pardamean Siregar melaporkan jumlah siswa PAUD keseluruhannya mencapai 2.251 anak dari 59 lembaga PAUD. (a09)


WASPADA Senin 20 Juni 2011

Sumatera Utara

C5

Mantan Pangulu Yang Dibakar Preman Kampung Akhirnya Tewas

Waspada/Arlius Tumangger

BANGUNAN bersejarah yang terletak di Kota Salak, Kecamatan Salak, Kabupaten Pakpak Bharat persisnya di depan Rumah Dinas (rudin) Bupati dalam waktu dekat ini akan dirobohkan rata dengan tanah. Berdasarkan sejumlah informasi mengatakan, di lokasi bangunan, Pemkab rencananya akan dibangun air mancur dan taman untuk keindahan Kota Salak. Sementara, sebelumnya, pada masa jaman penjajahan Belanda bangunan yang keseluruhannya hampir terbuat dari kayu itu telah dijadikan sebagai kantor pemerintahan dan pernah ditempati Sekretaris Camat (masa pemerintahan Kabupaten Dairi) serta sejak dimekarkan hingga tahun anggaran (TA) 2010, oleh Sekda Pakpak Bharat Gandi Wartha Manik juga mendiaminya dan menempati bangunan itu.Foto direkam, Sabtu (18/6).

Cabuli Anak SD Dihajar Warga PEMATANGSIANTAR (Waspada): Seorang pria, Bam, 49, warga Jalan Rakutta Sembiring, Gang Rahayu Atas, Kelurahan Nagapita, Kecamatan Siantar Martoba, Kota Pematangsiantar diduga mencabuli seorang pelajar SD hingga dihajar warga. Keterangan dihimpun dan pengaduan di Polres Pematangsiantar, Sabtu (18/6) dari keluarga korban KP, 9, warga jalan yang sama dengan Bam menyebutkan korban diduga dicabuli Bam di komplek SDN di Jalan Rakutta Smbiring, Gang Rahayu Atas, Kelurahan Nagapita, Kecamatan Siantar Martoba, Pematangsiantar, Kamis (16/6) pukul 11:00. Perbuatan cabul itu terungkap ketika tante korban mendapat informasi dan menyuruh bibi korban agar korban jangan lewat dari rumah Bam, Sabtu (18/6) pagi, karena korban sudah pernah dicabuli Bam di komplek SDN dengan cara menciumi bibir dan meremas-remas tubuh korban sesudah diberikan uang Rp 1.000. Kapolres Pematangsiantar AKBP Alberd TB Sianipar, SIK, MH saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu dan Kasat Reskrim AKP Azharuddin menyebutkan pengaduan keluarga korban KP masih dalam penyelidikan termasuk informasi tentang perbuatan cabul yang diduga dilakukan Bam terhadap putrinya.(a30)

PNS P. Siantar Diminta Tingkatkan Kedisiplinan, Kebersihan Dan Etos Kerja PEMATANGSIANTAR (Waspada): Walikota Pematangsiantar meminta agar PNS di lingkungan Pemko meningkatkan kedisiplinan, kebersihan dan etos kerja serta memberikan pelayanan prima kepada masyarakat. Walikota Hulman Sitorus, SE menyampaikan itu saat memimpin apel gabungan Korpri di halaman Balaikota Pematangsiantar, Jumat (17/6), dimana apel gabungan setiap tanggal tujuhbelasan itu sudah menjadi tradisi di lingkungan Pemko. Turut hadir pada apel gabungan itu Wakil Walikota Drs. Koni Ismail Siregar, para asisten, staf ahli serta para kepala dinas, badan, kantor serta bagian di lingkungan Pemko serta mitra dari TNI seperti Kodim 0207/Simalungun.(a30)

Tingkatkan Layanan, TPDK Sibolga Selatan Diresmikan SIBOLGA (Waspada) : Untuk meningkatkan pelayanan publik tentang sistem administrasi kependudukan, Walikota Sibolga Drs HM Syarfi Hutauruk kembali meresmikan Tempat Perekaman Data Kependudukan (TPDK) di Kecamatan Sibolga Selatan jalan SM Raja, Jumat (17/6) di Sibolga. Walikota SIbolga Drs HM Syarfi Hutauruk dalam sambutannya, TPDK dibentuk untuk melayani masyarakat kota Sibolga mengurus KartuTanda Penduduk (KTP), Kartu Keluarga (KK) dan Akta Kelahiran secara gratis sebagaimana program kerja yang dicanangkan oleh pemerintah kota Sibolga dibawah kepemimpinan Drs HM Syarfi Hutauruk dan Marudut Situmorang, AP.MSP selaku Walikota dan Wakil Walikota Sibolga. “Dikesempatan ini, kami mengajak segenap masyarakat di negeri berbilang kaum ini untuk turut berpartisipasi menyukseskan program kerja Pemko Sibolga, salah satunya adalah pelayanan publik tentang pengelolaansistimadministrasikependudukan,khususnyapenertiban KTP, KK serta Akte Kelahiran gratis tersebut,” pungkas walikota. Sebelumnya, Kadis Kependudukan dan Catatan Sipil kota Sibolga, Drs H Ahmad Sulhan Sitompul MAP melaporkan, peresmian TPDK guna meningkatkan kualitas pelayanan kepada masyarakat dalam memeroleh dokumen kependudukan, baik KK dan KTP, sekaligus untuk tertib administrasi kependudukan dengan pelayanan yang cepat, tepat dan efisien, maka diseluruh kecamatan di kota Sibolga sudah berdiri TPDK. Dikesempatanitu,WalikotaSibolgaDrsHMSyarfiHutauruk,Ketua DPRD Sibolga Syahlul Umur Situmeang, Kasdim 0211/TT,Wakapolres SibolgaKotaKompolArbainPanggabean,SH.MHdansejumlahanggota dewan meninjau ruangan TPDK, serta menyerahkan sejumlah KTP kepada masyarakat saat itu sedang mengurus KTP. (a24)

Berastagi Ramai Dikunjugi Wisata BERASTAGI (Waspada) : Kota wisata Berastagi, KabupatenTanah Karo, Minggu (16/6) ramai dikunjungi wisatawan domestik, dari berbagai daerah Sumatera Utara. Dampaknya para pedagang yang terdapat di jantung kota kubis sibuk meladeni para wisatawan yang menikmati hari libur di daerah dua gunung aktif Sinabung dan Sibayak. Kesibukan pedagang terlihat di jantung kota Berastagi, terutama di sederetan Pasar Buah, Taman Mejuah - juah, Bukit Kubuh, dan Puncak Hill (Gundaling) yang sibuk meladeni para wisatawan yang sekedar melepaskan lelah, dengan menikmati jagung bakar, rebus dan es tebuh sambil menikmati udara sejuk dengan menikmati berkuda tunggang dan sado. “Alhamdulilah, pengunjung ramai kembali membuat para pedagang senang, karena dengan ramainya wisatawan sejumlah para pedangang meraup untung berlebih dari hari biasanya,” terang bibi Lisna kepada Waspada, Minggu (18/6) siang di sederetanTaman Mejuah - Juah yang selalu menyediakan jagung bakar, rebus dan es tebuh dan berharap kepada cuaca agar tidak hujan. (c19)

Panitia Musyawarah PWI Perwakilan T.Tinggi Terbentuk TEBINGTINGGI (Waspada) : Panitia Musyawarah Persatuan Wartawan Indonesia Perwakilan kotaTebingtinggi terbentuk melalui rapat yang digelar, Rabu (15/6). Pembentukan kepanitiaan itu, sehubungan dengan habisnya masa kepengurusan PWI sebelumnya serta instruksi dari PWI Cabang Sumut. Ketua PWI Perwakilan KotaTebingtinggi AH Kartono mengatakan, pembentukan kepanitiaan itu, menyahuti amanah organisasi serta melanjutkan estafet kepengurusan PWI. AH Kartono berharap kepanitiaan yang ditunjuk akan melaksanakan amanah yang dipercayakan dan kegiatan itu nantinya berlangsung sukses. Ditambahkan, musyawarah PWI kota Tebingtinggi rencananya akan dilaksanakan di luar kota, dalam rangka menumbuhkan hubungan silaturrahmi di antara sesama anggota PWI perwakilan Kota Tebingtinggi.“Kita rencanakan pelaksanaan musyawarah pada 23-24 Juli 2011,” ujar Kartono. (a09)

Pelatihan Jurnalistik PC PMII Tapsel

Mahasiswa Harus Kuasai Informasi P.SIDIMPUAN (Waspada): Sebagai generasi intelektual yang berperan besar dalam menentukannasibbangsakedepan,mahasiswa harus mampu menguasai informasi dan bisa memahami pentingnya jurnalistik. Karena itu HarianWaspada, khususnyaWaspada Perwakilan Tapanuli, bersedia membimbing mahasiswa untuk mengenal tugas-tugas kewartawanan melaluipengenalandasar-dasarjurnalistik. Wartawan Waspada, Sukri Falah Harahap, menyampaikan itu saat menjadi pemateri dalam Pelatihan Jurnalistik PC PergerakanMahasiswaIslamIndonesia (PMII) Padangsidimpuan-Tapanuli Selatan yang diselenggarakan PK PMII Jalan Mobil (JAMIL) Tapsel di Padangmatinggi, Sabtu (18/6). Pada pelatihan yang diikuti sekitar 50 kader PMII itu, Sukri Falah memaparkan materi dasar jurnalistik.Kemudian, dilanjutkan dengan tahap tanya jawab antara pemateri dan peserta pelatihan. Sukri juga memaparkan sejarah jurnalistik, perihal media, wartawandanpekerjaannya,cara mencari dan meramu data menjadi berita, hingga diterbitkan/ disiarkan ke publik. “Di Indonesia, keberadaan wartawan diakui dan dilindungi UU No.40 tahun 1999 tentang Pers. Kemudian dalam bekerja, wartawan harus patuh dan tidak boleh melenceng dari kode etik jurnalistik,” terangnya. Usai mendapat penjelasan tentang jurnalistik, peserta pelatihan mulai melancarkan‘serangan’ bertubi-tubi kepada pemateri. Kemudian pertanyaan tentang kenapa sekarang sangat mudah menjadi wartawan, sehinggasiapapunbebasuntukme-

miliki kartu pers. Selain itu ada juga pertanyaan kenapa wartawan dalam pemberitaannya sering memihak. Menjawab itu, Sukri Falah yang pernah menimba ilmu jurnalistik di Lembaga Pers DR Soetomo Jakarta menjelaskan, wartawan memperoleh berita dari apa saja yang didengar, dilihat, dan dirasakannya. “Wartawanbekerjasiangmalamdanharuspekaterhadaplingkungan sekitar.Tiap hari pasti ada kejadian yang didengar, dilihat, dan dirasakan.Tentu di antaranya ada yang pantas dijadikan berita, begitulah jalannya kenapa setiap hari ada sajaberitayangdiperoleh dan dibuat wartawan,” jelasnya. Kenapa sekarang sangat mudah menjadi wartawan. Sukri Falahmenyebutuntukmenjadiwartawan yang benar-benar menjalankan tugas jurnalistik atau profesionaldalambertugassangatlah sulit. “Sekarang banyak sekali orangyangmengakudirinyawartawan hanya dengan modal mengantongi kartu pers, tapi tidak pernah melakukan tugas-tugas jurnalistik atau biasa diistilahkan

dengan wartawan gadungan. Ini akibat kebebasan pers di negara kita yang sudah begitu kebablasan,” sebutnya. Mengenai tindakan apa yang dilakukan agar wartawan gadungan tidak merusak citra baik wartawan. Sukri mengembalikannya kepada masyarakat, termasuk mahasiswa. “Dengan munculnya perbedaan nyata antara wartawan profesional dengan gadungan, maka masyarakatataunarasumberbisa membedakan dan menentukan manayangsebenarnyawartawan, dengankatalainbiarkanalamyang menyeleksi,” terangnya. Pada Pelatihan Jurnalistik PC PMII itu, panitia yang diketuai Khairul Saleh dan Sekretaris Kurnia Sandy juga menghadirkan Borneo Dongoran dari salah satu media cetak Tabagsel sebagai pemateri Kode Etik Jurnalistik. Turut hadir Ketua Umum PC PMII Padangsidimpuan-Tapsel, Kobol Nasution, Sekretaris Umum Dedy Kurniawan, Ketua Pengurus Komisariat (PK) PMII JamilTapsel Muhammad Akhyar Rangkuti, dan Sekretaris Muhammad Syamsuddin Hasibuan.(c13/a27)

Waspada/Ahmad Cerem Meha

WARTAWAn Waspada Sukri Falah Harahap (kanan ujung) menyampaikan materi Dasar Dasar Jurnalistik pada Pelatihan Jurnalistik PC PMII P.Sidimpuan-Tapsel, Sabtu (18/6).

Pembangunan 9.000 Ha Kebun Plasma PTPN IV Bagi 4.500 KK Terkendala Izin MEDAN (Waspada): Upaya PTPN IV membangun perkebunan kelapa sawit untuk rakyat seluas lebih kurang 9.000 Ha di Mandailing Natal mengalami kendala. Padahal, jika areal perkebunan itu terwujud yang untung tidak hanya PTPN tapi juga Pemkab dan warga sekitar kebun ikut merasakan kemakmuran. Ekspansi PTPN IV di Madina untuk mengembangkan Perkebunan Pola Inti dan Plasma dengan Program Pemerintah di Bidang Revitalisasi Perkebunan. SelakuBadanUsahaMilikNegara ditugasi membangun perkebunan kelapa sawit untuk rakyat seluas lebihkurang9.000Ha. MewakiliseluruhpetaniplasmaPemkabmenetapkanperwakilanpara petani melalui 4 KUD, masingmasing KUD Setia Abadi (2.400 Ha) di Desa Batu Sondat, KUD Pasar Baru (3.200 Ha) di Desa Batahan, KUD Maju Bersama (1.400 Ha) di Desa Natal dan KUD BangkoJaya(2.000Ha),yangdiperuntukkan bagi 4.500 KK petani plasma. HumasPTPNIVSyahrulSiregar menjelaskan pada awal keberadaan PTPN IV di Mandailing Natal perusahaan-perkebunan yang beroperasi masih relatif kecil dan penggarap lahan pun belum menjadi masalah utama, akan tetapi akhir-akhir ini permasalahan tanah sangat mencuat ke permukaan khususnya di Kec. Batahan dan Kecamatan Ranto Baek. Hal ini berakibat terhambatnya penyelesaian pembangunan kebun Inti dan plasma milik PTPN IV. Munculnya permasalahan

inidipicumaraknyapenggarapan dan tumpang tindih izin lokasi yang diterbitkan oleh Pemkab dan diperparah lagi munculnya surat keterangan ganti rugi diterbitkan Kepala Desa di dalam izin lokasi yang diduga berlaku surut. Sebagaimana terjadi saat ini di desa Batahan, terjadi kasus tumpang tindih izin lokasi dengan lahan kebun kelapa sawit milik PT. Palmaris Raya. KUD Pasar Baru Batahan dengan target 3.200 Ha untuk 1.600 KK sebelumnya telahmemperolehizinlokasimelalui Pemkab No : 525.25/154/k/2007 tanggal30Maret2007. Namunsaat pembukaanlahandilakukanoleh mitrakerjaPTPNIVseluas600Ha, pihakPTPalmarismengklaimlahan tersebutberadadidalamizinlokasi mereka. Pengakuan lisan 3 orang KepalaDesa(DesaPasarBatahan, Desa Sari Kenanga dan Desa Kuala Batahan) pada 1 Juni 2011 di DPRD Mandailing Natal menyatakan bahwa lokasi PT. Palmaris Raya seharusnya di Kuala Batahan atau Desa Batahan III yangjaraknyadariizinlokasiKUD Pasar Baru Batahan binaan PTPN IV berjarak ± 2 km. Hal ini diperkuat dengan surat penjelasan Kepala Desa Batahan III oleh Camat Batahan tanggal 11 Mei 2011 yang menjelaskan Desa Batahan III yang sebelumnya berada dalam binaan Departemen Transmigrasi dengan sebutan UPTSP3 Batahan atau UPT Batahan SP3 berdasarkan Perda Kabupaten Mandailing Natal No : 08 tahun 2008 Desa UPTSP3 Batahan atau UPT Batahan SP3 ditetapkanmenjadiDesaDefinitif

yang dirubah nemanya menjadi Desa Batahan III. Sesuai dengan peta izin Lokasi No : 525.25/489/ k/2007 lokasi lahan PT. Palmaris Raya dicantumkan di Desa Batahan III. Dengan demikian letak lokasi PT. Palmaris Raya seharusnya tidak tumpang tindih denganizinlokasiKUDPasarBaru Batahan binaan PTPN IV, namun di lapangan PT. Palmaris Raya berusaha dan membangun perkebunan di atas Izin Lokasi KUD Pasar Baru Batahan sehingga terjadi tumpang tindih untuk mendudukkan lokasi yang sebenarnya. Kabag Hukum dan Pertanahan PTPN IVWahid Rambey sangat menyayangkan hal tersebut. Polres Madina terlihat sangat cepat memproses pengaduan PT. Palmaris, sedangkan pengaduan PTPN IV juga kepada Polres Madina atas kasus yang sama sudah setahun belum ada tindak lanjutnya. Karena itu, Wahid Rambey berharap kiranya pihak yang berkompeten dalam hal ini Pemkab Madina mendudukkan permasalahan yang sebenarnya dengan berpedoman kepada : 1. Izin Lokasi KUD Pasar Baru dikeluarkan 30 Maret 2007 dengan lokasi Batahan. 2. Izin Lokasi PT. Palmaris Raya dikeluarkan 7 Agustus 2007 dengan perkataan lain terlebih dahulu Izin Lokasi KUD Pasar Baru Batahan diterbitkan. 3.Dari segi lokasi, kedua Izin lokasi tersebut juga berbeda yaitu : Lokasi Izin Lokasi KUD Pasar Baru Batahan berada di Desa Batahan. Sedangkan lokasi izin lokasi PT. PalmarisRayaseharusnyadiDesa Batahan III.(m03)

PEMATANGSIANTAR (Waspada): Sesudah mendapat perawatan selama seminggu, mantan pangulu (kepala desa), korban Jannen Siahaan, 53,wargaNagoriTigabolon,KecamatanSidamanik, Kabupaten Simalungun yang diduga dibakar preman kampung, akhirnya tewas saat menjalani perawatan di RSU Tiara, Kota Pematangsiantar, Sabtu (18/6) pagi. Korban akhirnya meninggal akibat luka bakar yang dialaminya mencapai 90 persen, karena hanya bagian kelaminnya yang tidak terbakar. Sedang bagianwajah,kepaladantubuhnyalainnyamengalami luka bakar yang sangat parah. Keluarga yang selama ini mengharapkan kesembuhan korban yang tidak sadarkan diri sejak mengalami luka bakar pada Sabtu (11/6) malam dan sudah mulai sadar sejak Minggu (12/6) akhirnya membawa jenazah korban kembali ke Nagori Tigabolon. Pihak RSUTiara melalui Dr. Ardi yang merawat korban kepada wartawan menyebutkan korban akhirnya meninggal akibat luka bakar yang dialaminya sudah mencapai 90 persen terutama bagian wajah dan seluruh rambutnya terbakar. Berkaitan dengan meninggalnya korban, para tersangka pelaku yang diduga membakar korban terdiri OS, 26, WS, 23, alias Batu, JM, 26, dan JS, 26, semuanya warga Tiga Bolon, Kecamatan Sidamanik, Simalungun yang selama ini diproses dan ditahan di Polsek Sidamanik, dipindahkan ke Ma-

polres Simalungun di Kelurahan Pematang Raya, Kecamatan Raya pada hari yang sama sesudah didapat informasi, korban sudah meninggal. Kapolres Simalungun AKBP M. Agus Fajar H, SIK saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak, Kasat Reskrim AKP Nasrun Pasaribu, SIK dan Kapolsek Sidamanik AKP Delami Saleh membenarkan empat tersangkapelakusudahdipindahkankeMapolres Simalungun guna mencegah hal-hal yang tidak diinginkan, apalagi Mapolsek Sidamanik cukup dekat dengan kediaman korban. “Empat tersangka pelaku sudah dibawa ke Mapolres Simalungun, termasuk berkasnya sudah turut dilimpahkan pihak Polsek Sidamanik ke Polres Simalungun,” sebut Sulaiman dan menambahkan empat tersangka diduga melakukan tindak pidana yang mendatangkan bahaya bagai keamanan umum dan menyebabkan bahaya bahaya maut dan orang mati dengan ancaman hukuman seumur hidup atau maksimal 20 tahun penjara sesuai Pasal 187 KUH Pidana,” terang Sulaiman. Seperti diberitakan, tersangka pelaku OS, WS,JMdanJSdidugamembakarmantanpangulu bersama bus Sinar Mutiara yang ditumpangi satu rombongan yang baru pulang dari pesta di Samosir di jalan umum PematangsiantarSidamanik, Nagori Tiga Bolon, Kecamatan Sidamanik pada Sabtu (11/6) pukul 22:00. (a30)

Wakil Ketua DPRD Simalungun Kecam PT Sipef SIMALUNGUN (Waspada):Wakil Ketua DPRD Simalungun,Julius Silalahi, mengecam tindakan pihak perkebunan PT Sipef Bukit Maradja, Kec. Gunung Malela, Simalungun yang tidak mengindahkan kesepakatan yang telah ditetapkan untuk tidak melakukan penggalian lubang isolasi dan melakukan pelarangan penggembalaan ternak di areal kebun. Menurut Julius, perusahaan yang bergerak dalam komoditi perkebunan kelapa sawit itu sudah tidak mendukung upaya mensejahterakan dan dinilai telah mengabaikan kepentingan masyarakat terutama yang bermukim di sekitar areal perkebunan dimaksud. Padahal, sebelumnya sudah ada kesepakatan antara pihak PT Sipef dengan masyarakat, termasuk dengan pihak DPRD dan Pemkab Simalungun. Dimana dalam kesepakatan, PT Sipef agar menghentikan penggalian lubang isolasi dan tetap memberikan kesempatan bagi warga untuk menggembalakan ternak sapinya di areal kebun. “ Kita sudah berulang kali menerima keluhan masyarakat di sekitar areal pekebunan melalui pangulu (kepdes) setempat. Hingga kini pihak PT Sipef masih terus melakukan penggalian dan tetap melarang ternak warga, padahal sudah ada kesepakatan antara PT Sipef dengan warga yang dilakukan di komisi II DPRD Simalungun beberapa waktu lalu, namun hal itu tidak diindahkan,” tegas politisi Partai Demokrat kepadaWaspada, kemarin. Menurutnya lagi, sesungguhnya DPRD dan Pemkab Simalungun sangat mendukung kehadiran investor. Diharapkan dengan kehadiran investor dapat memberikan kontribusi terutama bagi peningkatan kesejahteraan masyarakat. Apalagi sesuai dengan persyaratan untuk mendapatkan atau memperpanjang HGU (Hak Guna Usaha) bagi perkebunan ada persyaratan khusus yang harus diperhatikan. Diantaranya kehadiran investor diharapkan tidak merusak lingkungan. Kemudian keberadaan investor juga harus membawa manfaat atau kontribusi bagi masyarakat yang ada di sekitar perkebunan atau perusahaan yang bersangkutan. “ Perusahaan yang baik adalah perusahaan

yang mematuhi ketentuan-ketentuan yang ada dan kehadirannya membawa manfaat baik bagi perusahaan itu sendiri serta bagi masyarakat, terutama warga yang tinggal di sekitar areal perkebunan,” cetus Julius. Terkait dengan ternak warga, Julius berharap ada win-win solution. Dia berharap, pihak perusahaan tidak langsung mematahkan dengan melarang warga mengembalakan ternak di areal kebun.Halinidemimenyelamatkanternakwarga yang jumlahnya mencapai ribuan ekor yang tersebardidelapannagori(desa)yangmengelilingi areal perkebunan PT Sipef. “ Kita berharap PT Sipef membuat wilayahwilayah khusus bagi warga untuk mengembalakan ternaknya,” ujar Julius, seraya juga mengharapkan warga dapat mematuhi ketentuan yang dibuat oleh PT Sipef, sehingga ternak warga tidak merusak tanaman perkebunan. Di tempat terpisah, Pangulu Nagori (kades) Syahkuda Bayu, Suyatno mengatakan, PT Sipef telah melanggar kesepakatan untuk tidak melakukan penggalian lubang isolasi dan melarang ternak warga. Menurutnya, sebelumnya delegasi warga dan pangulu di sekitar perkebunan PT Sipef di Kec. Gunung Malela, menyampaikan protes tertulis kepada DPRD dan Pemkab Simalungun terkait larangan pengembalaan ternak serta penggalian jalan perbatasan antara nagori dengan perkebunan. Lebihlanjutdijelaskan,selamapuluhantahun sebelumnyawargabebasmengembalakanternak di sekitar areal perkebunan. Namun beberapa bulan terakhir ini, pihak PT Sipef membuat larangan keras dengan alasan ternak warga merusak tanaman kelapa sawit. “ Alasan PT Sipef tidaklah benar. Ternak warga hanya memakan rumput, bukan kelapa sawit,” terang Suyatno. Sementara, pihak PT Sipef menyebutkan penggalian lubang diperbatasan areal perkebunan dengan pemukiman warga serta larangan pengembalaan ternak di areal perkebunan merupakan kebijakan perusahaan. Hal ini dilakukan demi menekan angka kerugian yang dialami perusahaan akibat pencurian dan perusakan tanaman yang disebabkan ternak warga.(a29)

Laporan Produksi TPL 2010 Menurun MEDAN (Waspada): Produksi TobaPulp 2010 mengalami penurunan dari 210.607 ton (2009) menjadi 175.989 ton karena faktor perawatan tahunan dan recovery boiler. Demikian gambaran yang mengemuka pada RUPS TobaPulp 2011 di Medan, Jumat (17/6). Gambaran masa depan bisnis itu tercermin dalam laporan Direksi TobaPulp (PT Toba Pulp Lestari,Tbk) yang disampaikan secara bergantian oleh Firman Purba, Anwar Lawden dan Juanda Panjaitan di hadapan para peserta RUPS (rapat umum pemegang saham) yakni para pemegang saham dan kuasanya, serta dihadiri para anggota Dewan Komisaris (Roli Arifin, Drs Sabam Leo Batubara, Lundu Panjaitan, SH.MA) dan juga Dewan Direksi (SC Paruthi, Juanda Panjaitan, SE, Ir Firman Purba, Anwar Lawden SH). Juga hadir notaris Gunawati, SH. RUPS dan RUPS Luar Biasa diadakan untuk mengesahkan laporan tahunan 2010 serta mereposisi dua anggota Direksi, dipimpin Komisaris Utama Roli Arifin. Namun sejalan dengan pemulihan ekonomi global pasca krisis finansial 2009, nilai penjualan naik dari AS $ 78,8 juta menjadi AS $ 98,2 juta. Pada posisi itu perusahaan meraih laba bersih “sangat sederhana” sebesar AS $ 0,4 juta, tetapi “lumayanmenggembirakan”dibandingkandengan rugi bersih AS $ 5,5 juta tahun 2009. Selama 2010TobaPulp kembali membuktikan komitmen kuatnya di bidang pengelolaan lingkungan hidup. Ini tercermin dari perolehan pringkat hijau (green) PROPER (program peringkat kinerja perusahaan) untuk ketiga kalinya secara berturut-turut dari Kementerian Lingkungan Hidup. Maknanya, perusahaan mampu mencapai tingkat pengelolaan lingkungan lebih tinggi dari yang dipersyaratkan. Kemudian ada perolehan kembali sertifikat ISO 14001:2004 (sistem menajemenlingkungan) hasilsurveillanceperiodik dari organisasi sertifikasi internasional untuk operasional pabrik dan juga HTI. Selain itu, lagi-lagi perusahaan juga mendapatkan kembali sertifikasi ISO 9001:2008 (sistem manajemen mutu) dan juga sertifikat PHPL (pengelolaan hutan produksi lestari) dari Departemen Kehutanan yang mengizinkan perusahaan melaksanakan dengan persetujuan sendiri program pemanenan. Juga ada sertifikat Kesehatan dan Keselamatan Kerja OHSAS 18001:2007 untuk

kebijakan-kebijakan dalam menjamin karyawan bekerja dalam lingkungan yang aman dan sehat. Di bidang tanggung jawab sosial (CSR – corporate social responsibility) TobaPulp konsisten mengalokasikan 1% hasil penjualan bersih (net sales) untuk membiayai program pemberdayaan masyarakat (CD – community development) terutama di sekitar areal kerja. Besaran dana CD 2010 ialah USD954.816,17 atau 1% dari hasil penjualan setelah dikurangi biaya penjualan (sales expences). Dengan kurs akhir tahun Rp8.991 per dolar, maka nilai CD 2010 dalam mata uang rupiah menjadi Rp8,58 miliar, lebih tinggi dari nilai CD 2009 sebesar Rp7,1 miliar. Dengan demikian nilai CD TobaPulp 2003 – 2010 mencapai Rp66,48 miliar dengan pemanfaatannya antara lain meliputi: pembangunan prasarana (jalan, air bersih), sarana (pertanian, peternakan,peralatansekolah,lapanganolahraga, pasar) , usaha rumah tangga (kerajinan enceng gondok, pandai besi, budidaya lebah madu, tenunantradisional)sertaaktivitassosial(bantuan sarana ibadah, pengobatan massal, bantuan untuk korban bencana). Selain itu perusahaan tetap committed mengembangkan kemitraan-usaha dengan sedikitnya 276 pengusaha lokal yang mempekerjakan sekitar 6.000 orang. Mereka menangani pekerjaan-pekerjaan seperti: sipil, angkutan bahan baku dan barang penolong, pemanenan, penyiapan lahan penanaman, penanaman, pemupukan dan pemeliharaan. Nilai transaksi 2010 mencapai Rp267,5 miliar. Reposisi RUPS tahunanTobaPulp dilanjutkan dengan RUPS Luar Biasa untuk mengangkat dua anggota Direksi baru, yakni Riduan Sibuea,45, sarjana sains komputer Universitas Sisingamangaraja XII (US XII) Medan kelahiran Meulaboh, Aceh Barat, dan terakhir menjabat staf senior HubunganPemerintahan(governmentrelations) di Medan, serta Tjhi Min Sin,49, sarjana elektro Universitas Dharma Agung (UDA) Medan yang selama ini menangani sistem kelistrikan pabrik di Parmaksian. Keduanya menggantikan Firman Purba yang kini fokus menangani rencana pengembangan kebun, sertaWilim yang sudah pindah ke industri pulp dan kertas lebih besar di Riau, RAPP. (rel/m14)


Aceh

WASPADA Senin 20 Juni 2011

C7

Jembatan Alue Udeung Kritis BIREUEN (Waspada): Jembatan beton yang berada di Desa Alue Udeung, Kec. Peusangan, Bireuen kriris. Pasalnya abautmen retak dan jalan di kawasan itu telah amblas, sehingga dapat dipastikan bila tidak segera diantisipasi maka jembatan itu amlas ke sunagi. Keterangan warga jembatan yang dilintasi sejumlah warga dari beberapa desa kawasan itu, terancam amblas karena jalan ujung jembatan telah amblas “Aboutmen sudah retak-retak, tembok pendukung lainnya, juga sudah tumbang ke alur, akibat tanah disekitarnya longsor, tergerus derasnya aliran air berasal dari perbukitan,” kata Muhammad dan Deka warga setempat, Minggu (19/6). Menurut keduanya, kondisi jembatan dan jalan benar-benar memprihatinkan dan mendesak untuk diperbaiki, sebelum jembatan itu amblas ke sungai. “Kami khawatir apabila tidak segera ditangani, bukan jembatan saja terancam ambruk, tapi jalur utama itu juga putus total, kalo boleh ini harus segera diatasi,”

kata Mustafa dan Khalil. Sementara itu, dari ujung jalan aspal dikawasan Desa Blang Dalam hingga tembus ke simpang Cot Ijue, melintasi Desa Blang Geulanggang, Tanoh Mirah, Blang Rambong Kec. Peusangan sebagian besar badan jalan selain berbatu, jalan dasarnya sudah pernah diaspal itu kondisinya rusak parah sebab dipenuhi lubang. Sedangkan di kawasan Blang Rambong, jebolnya gorong-gorong jembatan, sejauh ini belum diperbaiki. Mengindari hal-hal tidak diinginkan, warga memasang tanda pakai kayu. “Sisi jembatan kecil di tikungan Dusun Gle Putoh sudah amblas dan gorong-gorong ditengah jalan Dusun Beuringen dekat SDN, tersumbat dan terpaksa digali warga. Kami harap, dapat diperbaiki. Kami juga berharap, di kanan-kiri jalan aspal dapat dibangun saluran sehingga aliran air lebih lancar, badan jalan juga tidak cepat rusak,” harap warga.(amh)

Langgar HGU, Izin PT LB Minta Ditinjau Ulang SUBULUSSALAM (Waspada): Dinilai melanggar Hak Guna Usaha (HGU) dengan merambah/merusak kawasan di luar HGU yang ada, izin HGU PT Laot Bangko (LB) di Babah Luhung Kec. Simpang Kiri, Subulussalam diminta tinjau ulang. Permintaan itu disampaikan Ketua LSM Wanagreen Subulussalam, Suparta melalui pres relisnya kepada Waspada belum lama ini. Dikatakan, melalui peta Geographic Information System (GIS) versi Disbunhut Kota Subulussalam Suparta memperoleh informasi kalau PT LB telah melakukan perambahan di luar batas izin yang telah ada sekira 200 hektar. Karenanya Suparta berharap Pemko Subulussalam segera melakukan evaluasi. “Tolong dievaluasi kembali kawasan perkebunan kelapa sawit di Babah Luhung, tepatnya di afdeling IV,” tulisnya menilai, perusahaan ini telah melakukan perambahan untuk kepentingan pribadi tanpa berniat melestarikan

hutan di kawasan perbatasan perkebunan. Subangun Berutu, Kahumas PT LB kepada Waspada, Rabu (15/6) di Jontor mengatakan kalau penilaian itu tidak masuk akal. Alasannya, lokasi yang dipersoalkan, Afdeling IV (bukan III) sebelah timur berbatas dengan hutan bebas berstatus Areal Peruntukan Lain (APL). Lalu, sekira tiga tahun silam keluar izin kepada PT Gunung Pudung, menyusul sebelumnya kepada PT Matras Kec. Sultan Daulat semasa Aceh Singkil. Sementara sebelah timur dengan pemukiman penduduk Kec. Simpang Kiri dan Sultan Daulat, sebelah utara Kec. Sultan Daulat dan selatan Transmigrasi SKPC Kec. Penanggalan. “Tak benar PT Laot Bangko melakukan perambahan di luar HGU,” jelas Subangun menambahkan, dari luas 6.800 ha lokasi PT LB di 9 afdeling, baru 4 yang dibuka, yakni afdeling 1, 2, 3 dan 7. (b33)

Perusahaan Asing Rambah Hutan Aceh Timur LANGSA (Waspada): PT.Padang Palma Permai (PPP), anak perusahaan SIME DARBY, perusahaan BUMN dari Malaysia, ditenggarai merambah ratusan hektar hutan di kawasan Kec. Peureulak, Kab. Aceh Timur. Ratusan hektar hutan tersebut kini telah ditanami kelapa sawit yang diklaim sebagai area perkebunan milik perusahaan itu. Ketua LSM FAKTA, Rabono Wiranata mengatakan, berdasarkan data dan peta dari Badan Pertanahan Nasional (BPN) Aceh Timur, kawasan hutan yang dirambah PT. PPP mencapai 400 hektar terletak di Desa Cek Mbun, Kec. Peureulak, Kab. Aceh Timur. “Kawasan hutan yang dirambah tersebut merupakan hutan produksi terbatas,” ungkap Rabono seraya mengatakan, berdasar peta dari BPN Aceh Timur, kawasan hutan yang dirambah PT.PPP berada pada titik-titik kordinat; X; 367 430 - Y; 516 100 menuju pada kordinat ; X; 360 417 - Y; 519 668. dan merupakan kawasan Hutan Produksi Terbatas (HPT). Rabono menjelaskan perambahan hutan yang dilakukan PT.PPP ini terungkap saat LSM FAKTA melakukan monitoring konflik satwa liar Gajah dan Harimau di kawasan hutan tersebut. “Ternyata lokasi hutan itu sudah menjadi area perkebunan kelapa sawit yang diklaim sebagai milik PT.PPP,” ungkap Rabono.

Ketua LSM PERMASTEK, Ibnu Hajar kepada wartawan mengungkapkan data dari Dinas Kehutanan dan Perkebunan Aceh Timur, menjelaskan untuk kawasan hutan di kabupaten Aceh Timur, PT.Padang Palma Permai hanya memiliki 5.000 hektar HGU yaitu di Blang Simpo/Paya Meuligo, Kec. Peureulak. 5.000 hektar HGU tersebut tertuang dalam dua SK Mendagri yaitu masing-masing HGU 3000 hektar, nomor dan tanggal surat keputusan SK.36/HGU/DA/79 , 14 Nop 1979 dan tanggal berakhirnya hak 31 Desember 2009 dan HGU 2000 hektar, nomor dan tanggal surat keputusan SK/61/HGU/DA/87, 03 Desember 1987 dan tanggal berakhir 2022. “Untuk area perkebunan sawit di Desa Cek Mbun- Peureulak yang luasnya hampir 400 hektar PT.PPP tidak memilki surat izin apapun,” ungkap Ibnu Hajar. Kepala Dinas Kehutanan dan Perkebunan Aceh Timur, Ir.Syaifuddin mengakui tidak mengetahui adanya perambahan hutan dan konvensi kawasan hutan menjadi perkebunan kelapa sawit. Dengan adanya laporan dari LSM ini maka Dinas Kehutanan dan Perkebunan Aceh Timur akan segera mengusut kasus ini. “ Hingga saat ini belum ada laporan, sekarang akan kita tindaklanjuti kasus ini,” ucap Syaifuddin. (b22)

Polres Singkil Didesak Tuntaskan Kasus Perusak Hutan KEL BANDA ACEH (Waspada): LSM Wanagreen, Subulussalam mendesak Polres Aceh Singkil menuntaskan proses hukum terhadap tersangka perusak sekira 89 hektar hutan kawasan ekosistem lauser (KEL) di Kec. Runding, yang dijadikan lahan kelapa sawit milik pribadi menggunakan alat berat. Desakan itu disampaikan Suparta, Ketua LSM Wanagreen Subulussalam, Sabtu (18/ 6), melalui surat elektronik tentang proses hukum terhadap tersangka Sd, 61, warga Subulussalam, Kec. Simpang Kiri yang kasusnya terkesan dipetieskan polisi. LSM Wanagreen juga mendukung Mabes Polri harus menindak tegas bahkan menebas semua pelaku perambah hutan. Kalau ternyata hutan lindung dirambah secara illegal, menurutnya, pelaku tidak hanya melanggar peraturan tapi juga merusak ekosistem kehutanan. Pengusaha ternama asal Subulussalam itu dilaporkan membuka lahan untuk areal perkebunan kelapa sawit seluas 200 ha, di wilayah Kec. Runding, namun 89 ha dari lahan tersebut diduga kuat masuk KEL.

Polres setempat akan memasukkan nama Sd dalam daftar pencarian orang (DPO) karena mengabaikan dua kali panggilan. Kapolres Aceh Singkil AKBP Hemi Kwarta, Minggu (30/5) menyebutkan, jika hingga hingga batas waktu ditetapkan (Senin 31/ 5-red) tidak juga memenuhi panggilan penyidik maka akan dimasukkan DPO. Penegasan Kapolres memaksa tersangka Sd datang ke Mapolres Kampung Baru, Singkil Utara, dua hari kemudian didampingi keluarganya. Namun pasca kedatangan tersangka ternyata tidak berkelanjutan. Informasi lain menuding Polres mempetieskan kasus tersebut. Kapolda Aceh Irjen Pol Fajar Prihantoro saat kunjungan kerja ke Aceh Singkil awal Agustus 2010, mengatakan, illegal logging atau perambahan hutan dampaknya akan dirasakan anak- cucu, seperti banjir, longsor, fenomena alam lain yang tidak bersahabat karena kondisi alam yang rusak. “Tidak ada main-main dengan kayu termasuk anggota polisi. Ini harus diproses, “ janjinya.(b30)

Waspada/tarmizi ripan

TERSANGKA kasus illegal logging berinisial Sd (pakai batik)warga Subulussalam terlihat akrab dengan perwira menengah Polda Aceh. Terlihat Sd diapit Dua Pamen pada jamuan makan, saat kunjungan Kapolda Irjen Pol Fajar Prihantoro ke Mapolres Kampung Baru, Singkil Utara, belum lama ini

Waspada/Abdul Mukthi Hasan

WARGA melihat kondisi jembatan di Desa Alue Udeung, Kec. Peusangan terancam amblas.

33 KK Korban Longsor Langkahan Dipermainkan Dinas BMCK Aceh LANGKAHAN, Aceh Utara (Waspada): 33 Kepala Keluarga (KK) korban longsor di Dusun Cemara, Gampong non status Bidadari, Kec. Langkahan, Aceh Utara kepada Waspada mengaku dipermainkan pihak Dinas Bina Marga dan Cipta Karya (BMCK) Provinsi Aceh. Pasalnya, bantuan rumah layak huni yang dijanjikan hingga kini belum dibangun, sementara barak pengungsian yang ditempati terancam ambruk.

Selain warga, rasa kecewa juga membaluti Amiruddin Hamzah, Camat Langkahan. “Mereka telah menghuni barak sejak tahun 2008, namun hingga tahun 2011, rumah layak huni yang dijanjikan belum juga dibangun. Kini, barak mulai miring, jika ambruk akan menimbulkan masalah baru,” kata Amir Hamzah. Untuk memperjuangkan rumah layak huni, Amir Hamzah mengaku telah bolak-balik

ke BMCK Aceh, dan hingga kini belum membuahkan hasil. Terakhir diketahui, BMCK Aceh juga belum mengusulkan kebutuhan dana tersebut pada anggaran tahun 2011. Karena itu, camat dan masyarakat mengaku telah dipermainkan BMCK. Salah seorang Kabid di BMCK Aceh mengatakan, anggaran untuk rumah layak huni untuk korban lonsur di Langkahan Aceh Utara baru akan diusulkan pada anggaran tahun 2012.

Bupati Minta Bides Rajin Kunjungi Masyarakat MEUREUDU (Waspada) : Bupati Pidie Jaya, Drs. H. M. Gade Salam, meminta bidan desa (Bides) di daerahnya rajin mengunjungi masyarakat dan tinggal bersama mereka di desa sebagai upaya mengoptimalkan dan mendekatkan pelayanan kesehatan kepada penduduk. “Saya berharap Bides tidak hanya menunggu pasien di Puskesmas atau Pos Kesehatan desa. Tapi rajinlah mengunjungi masyarakat apalagi letak rumah warga di pedalaman terpencarpencar, “katanya kepada Waspada, Jumat (17/6). Bupati yang dikenal sangat rajin turun ke desa (turdes) dan

rajin mengunjungi rakyatnya menyatakan hal tersebut menanggapi Waspada, menyangkut hingga kini masih ada diantara bidan desa itu yang masih enggan tinggal bersama masyarakat di desa tempat tugasnya. Hal itu pula yang sering menjadi sorotan anggota DPRK setempat pada hampir setiap ada pertemuan dengan eksekutif. Apa yang menjadi sorotan masyarakat dan anggota Dewan Perwakilan Rakyat Kabupaten (DPRK) Pidie Jaya, memang diakuiH. M. Gade Salam. Tapi ke depan, Bupati mengharapkan janji pengabdian kepada masyarakat harus direalisasikan.

“Jika barak pengungsi itu ambruk, maka akan menimbulkan bencana baru terhadap para korban, dan, itu tinggal menunggu waktu. Padahal lahan untuk pertapakan rumah baru sudah ada, tinggal menunggu keseriusan Dinas BMCK Provinsi Aceh merealisasikan pembangunan rumah,” kata Amiruddin. Irwan Firdaus,35, Minggu (19/6) menyebutkan, bangunan barak itu sudah miring karena

dinding dan tiangnya keropos. “Mungkin hanya mampu bertahan tiga bulan lagi, setelah itu roboh,” kata Irwan Firdaus. Menurut Irwan, beberapa waktu lalu. Irwandi Yusuf, Gubernur Aceh pernah berkunjung ke lokasi kejadian pada akhir 2008. Di hadapan masyarakat dan Muspida Aceh Utara, gubernur menjanjikan akan membangun tempat tinggal baru layakhuniuntukparakorban,apa lagi lahan telah tersedia.(cmun)

Dewan Dakwah Khawatir Waduk Pusong Jadi Sarang Maksiat

“Artinya, janji siap mengabdi kepada masyarakat itu tidak sekedar diucapkan tapi di implementasikan di lapangan,“katanya menambahkan. Gade Salam mengatakan, Pemkab Pidie Jaya terus berupaya mewujudkan pemerataan pemberian pelayanan kesehatan kepada masyarakat. Salah satunya melalui program Peningkatan Status Rumah Sakit Umum Meureudu dan penambahan infrastruktur kesehatan hingga ke pedesaan. “Program ini bertujuan agar masyarakat memperoleh pelayanan kesehatan yang sempurna, “kata bupati.(b21)

LHOKSEUMAWE (Waspada): Dewan Dakwah Kota Lhokseumawe mengkhawatirkan waduk (reservoir) di teluk Pusong menjadi sarang maksiat disebabkan tidak ada pengelolaan dan pengawasan dari pemerintah. Sejumlah pengunjung yang kebanyakan datang malam hari adalah pasangan-pasangan yang tidak jelas, yang sejak lama membuat risih pemuka agama. “Beberapa pemuka masyarakat juga pernah menyinggungnyinggung masalah ini, tapi tak ada tanggapan,” kata Sekretaris Dewan Dakwah Lhokseumawe, Zarkasyi kepada Waspada, Minggu (19/6). Waduk untuk menanggulangi banjir dan memperindah kota itu sudah berubah menjadi ajang rekreasi yang sangat diminati masyarakat, terutama karena jalannya bagus, timbunan batu alamnya tinggi dan menciptakan kolam raksasa di pinggir laut dengan lokasi sangat luas. Karena itu Dewan Dakwah mendesak Pemko Lhokseumawe menertibkan tempat rekreasi itu secara baik dan layak. Menertibkan tidak harus menutupnya, tapi perlu pengawasan dan pengelolaan dengan baik, sehingga tempat itu memberi manfaat lain bagi pemerintah, dan tidak menjadi sarang maksiat.(b12)

Penembakan Tagore, Siapa Yang Rekayasa? KELUARGA Abubakar Bintang jadi incaran peluru. Sebelumnya Muhclis Gayo, SH (Kadis Pemuda dan Olah Raga Aceh Tengah) yang bersimbah darah disambar poyektil, ketika aparat kepolisian di Bireuen baku tembak dengan pelaku penculikan. Kini giliran Tagore, saudara sedarah Muchlis yang menjadi buah bibir. Penembakan Bupati Bener Meriah di mobil pribadinya, awal Juni 2011, memunculkan isu beragam. Ada yang menuding Tagore sengaja merekayasa, namun bagi yang yakin itu bukan rekayasa, justru menganalisa motif kejadian. Rekayasa Siapa? Pelaku penembakan dari jarak dekat, menurut keterangan Tagore senjata pelaku jenis laras panjang. Namun walau disiram peluru tajam, Tagore dan supirnya tidak terluka. Sebuah keajaiban? Sementara mobilnya berlubang ditembus timah panas. Untuk membuktikan keterangan Tagore, Kapolres Bener Meriah langsung mengamankan mobil CR BL 1Y. Anehnya ketika polisi memeriksa mobil tersebut, dari lubang bekas tembakan tidak ditemukan proyektil peluru. Di lapangan satu selongsong peluru pun tidak ditemukan. Bukan hanya polisi yang mencari selongsong, warga juga membantu membersihkan TKP, namun sarung timah panas itu tidak ada. Luar biasa. Ada apa ini? Tagore yang dituding merekayasa kejadian itu, kepadaWaspada menyebutkan, “Mereka yang memberikan penilaian ini rekayasa, tidak percaya kepada kekuatan Allah. Bila Tuhan berkehendak tidak ada manusia yang mampu menghalangi. Saya yakin dengan kekuatan Allah, semoga kasus ini cepat terungkap,” sebut Tagore yang tidak terima disebut memberi keterangan palsu. Untuk membuktikan benar atau tidak keterangan Tagore, Kapolres AKBP Drs Hari Apriyono mereka ulang kejadian. Kapolres juga menyiapkan beberapa jenis senjata dan meletuskannya, agar warga sekitar yang mendengar letusan pada malam kejadian memberi keterangan jenis senjata mana yang menyalak saat kejadian. Dari keterangan warga, Kapolres untuk sementara menyimpulkan, suara senjata yang dipergunakan saat kejadian jenis glock (senjata laras pendek), bukan senjata laras panjang seperti keterangan Tagore. Artinya senjata glock itu hanya ada di kalangan tertentu tingkat komandan. Kalau di Bener Meriah hanya ada di tangan AKBP Drs Hari Apriyono. Sampai disini masih berkembang rumor, kejadian itu rekayasa Tagore dan sang bupati berpeluang terjerat memberi keterangan palsu. Opini publik terbelah antara rekayasa Tagore dan bukan rekayasa. Walau Tagore sendiri berani bersumpah atas kejadian itu. Demikian dengan Gempar, supirnya juga sempat dibawa ke orang pintar untuk mengembalikan semangatnya. Namun, isu rekayasa terus menggelinding. Ahirnya tim Puslabfor dari Medan turun ke Bener Meriah selama 2 hari, dengan membawa sejumlah peralatan canggih. Hasilnya mengejutkan. Proyektil yang tidak berhasil ditemui tim yang diturunkan Kapolres Bener Meriah, ternyata berhasil ditemukan. Dashboard dan chasis mobil Tagore, dibongkar ulang. Jenis peluru yang didapat tim forensik, kaliber 7,62 x 39 mm. Proyektil ini mengindikasi jenis senjata api laras panjang. Menurut Kapolres Bener Meriah

Waspada/ Khairul Akhyar

BUPATI Tagore memberi keterangan usai kejadian. Kaca depan mobilnya berlubang ditembus peluru. AKBP Drs Hari Apriyono, senapan yang digunakan semiotomatis atau otomatis. Bisa jadi jenis SKS buatan Cina, atau proyektil itu bisa digunakan untuk senjata laras panjang model SLR 95 buatan Bulgaria. Keterangan Kapolres ini ‘menghilangkan’ penilaian AKBP Hari Apriyono sebelumnya, yang menyebutkan jenis senjata glock laras pendek. Jenis senjata dari proyektil itu tidak dipergunakan kesatuan militer di Indonesia, baik TNI maupun Polri. Senjata tersebut lebih banyak dipergunakan oleh militer dari luar NKRI. Hasil temuan tim forensik dari Medan menunjukkan bukti, mobil yang ditumpangi Tagore benar dihujani peluru senjata laras panjang. Masihkah disebut ini rekayasa Tagore? Benar atau tidak ini rekayasa Tagore, ada tim dari institusi negara ini yang membuktikannya. Puslabfor Medan sudah menemukan proyektil peluru. Berhasil mengidentifikasi jenis senjata. Sebuah langkah yang bagus. Bila ini bukan rekayasa Tagore, lantas apa motif penembakan? Mengapa paska kejadian aparat kepolisian tidak melakukan sweeping. Tidak menutup jalur larinya tersangka? Bersambung. Bahtiar Gayo


Aceh

C6

WASPADA Senin 20 Juni 2011

Ombak Landa Perairan Aceh Nelayan Diminta Hati-hati

Polisi Bekuk Bandar Dan Pengedar Ganja SIMPANG MULIENG, Aceh Utara (Waspada): Aparat Kepolisian Sektor Syamtalira Aron—Simpang Mulieng, Aceh Utara membekuk tersangka bandar dan seorang tersangka pengedar daun ganja kering, di dua tempat terpisah, Sabtu (18/6) petang. Tersangka bandar berinisial IA, warga Desa Blang Reuma, Kec. Meurah Mulia, Aceh Utara. Sedangkan pengedar, IJ, warga Tanjoeng Krueng Pase, Kec. Syamtalira Aron. Keduanya kini mendekam di sel Mapolsek Syamtalira Aron. Diamankan 3 ons plus 10 amplop daun ganja kering, sebagai barang bukti. Kapolres Aceh Utara AKBP Farid Bachtiar Effendi melalui Kapolsek Syamtalira Aron, AKP Yusuf Hariadi, Minggu (19/6) menjelaskan, IJ dibekuk berdasarkan informasi masyarakat. Dalam pengembangan kasus, diketahui ganja itu diperoleh IJ dari bandar IA. Sekitar dua jam kemudian IA berhasil ditangkap. “Kasus ini masih kita dalami dan kembangkan sesuai prosedur,” jelas Kapolsek.(cmus)

Warga Beunyot Kritis Tabrakan BIREUEN (Waspada): Eli Diana pengendara sepedamotor Supra X asal Desa Buenyot, Kec. Juli, Bireuen, Minggu (19/6) sekira pukul 08:00 kritis dan tak sadarkan diri, setelah sepedamotornya menghantam dump-truk di lintas Bireuen-Takengon Km 9,7 Teupin Mane, Juli, dan harus segera dilarikan ke RSUD dr Fauziah, Bireuen. Keterangan diperoleh, kecelakaan itu terjadi saat dua kendaraan melaju dari arah yang sama, namun naas setiba di lokasi sepedamotor menghantam truk dari belakang. Kapolres Bireuen, AKBP HR Dadik Junaedi, SH, melalui Kanit Laka, Aiptu Mahdi yang dikonfirmasi membenarkan kejadian itu. Katanya, beberapa saat setelah kejadian sejumlah anggota Satlantas bersama anggota Polsek Juli turun ke lokasi. Kedua kendaraan diamankan ke Pos Lantas Simpang Empat.(amh)

Masyarakat Buka Sekolah Agama Bendung Aliran Sesat TANAH PASIR, Aceh Utara (Waspada): Sejumlah tokoh masyarakat Kec. Tanah Pasir, Aceh Utara membuka sekolah agama untuk membendung aliran sesat. Para tenaga pengajar di lembaga pendidikan ini, selain dari guru sekolah umum juga dari dayah salafi (pesantren-red). Imum Mukim Tanah Pasir, Tgk Rusli kepada Waspada, Sabtu (18/6) menjelaskan, selama ini di kecamatan itu belum ada satu pun sekolah agama. “Kita telah bermusyawarah agar dibangun Madrasah Tsanawiyah di Tanah Pasir,” jelasnya. Setelah dilakukan koordinasi dengan Kantor Departemen Agama (Depag) Aceh Utara, akhirnya diputuskan untuk membuka madrasah yang setingkat dengan SMP. Lokasi sementara, menggunakan bekas sekolah SD di Gampong Kumbang. Tgk Rusli menjelaskan, dasar lahirnya MTs di Tanah Pasir juga menjawab keresahan warga terhadap aliran sesat yang menghantui anak-anak mereka. “Untuk itu kami mengangkat beberapa teungku dayah, untuk menjadi guru,” tambah dia. Di antaranya Tgk Muktaruddin dari Dayah Paloh Gadeng dan Tgk Bustami dari Dayah Cot Trueng. Sementara Tgk.Syukri yang juga tokoh warga Tanah Pasir mengharapkan, meski madrasah itu masih berstatus swasta, pendidikan agama dan umum harus berkualitas.(b17)

Waspada/Muhammad H. Ishak

KONDISI Pelabuhan Pendaratan Ikan (PPI) Kuala Idi Rayeuk, Aceh Timur, Minggu (19/6) dalam kondisi sepi dari aktifitas nelayan menyusul ombak besar dan angin kencang yang melanda perairan Selat Malaka dalam tiga hari terakhir.

Generasi Aceh Diambang Kehancuran IDI CUT, Aceh Timur (Waspada): Kondisi sosial masyarakat sudah terbawa dengan perkembangan zaman dan era globalisasi. Keadaan tersebut kembali diperparah dengan ketidaktegasan Pemerintah Aceh disaat adanya aliran sesat berkembang, sehingga disimpulkan generasi Aceh pada abad ke 21 diambang kehancuran.

“Jika generasi kita sudah hancur dengan tidak peduli agama Islam yang

beraliran ahlussunnah wal jama’ah, maka tunggulah masanya Islam akan ‘angkat kaki’ dari Aceh sebagaimana terjadi di Spanyol masa lampau,” kata Tgk. Muhammad Nasir dari Dayah Paloh Gadeng, Aceh Utara, saat menyampaikan Dakwah Islamiyah Dalam Rangka Menyambut Isra’ Mi’raj Rasulullah SAW di Balai Pengajian Raudhatul Muta’alimin Matang Geuto Idi Cut, Aceh Timur, Sabtu (18/6) malam. Menurut dia, secara kasat mata generasi penerus Aceh masa depan banyak yang sudah kehilangan kendali. Selain tidak peduli agama yang mulai diinjakinjak pihak luar, pemuda dan pemudi sudah jarang yang menuntut ilmu pengetahuan agama di dayah-dayah yang

Tim Pengawas RS Fakinah Laporkan Direktur Ke Polda BANDA ACEH (Waspada): Tim pengawas Yayasan Teuku Fakinah melaporkan Direktur RS Fakinah Dr M. Saleh Suratno dan Akper T. Fakinah ke Polda Aceh, karena tidak dapat menunjukkan laporan pertanggungjawaban keuangan selama masa jabatannya. Padahal, kata Ketua Tim Pengawas M. Sidiq Fahmi, Jumat (17/6), tim pengawas telah memberi kelonggaran waktu tetapi tidak diindahkan. Menurutnya, tim pengawas telah melengkapi bukti pemindahan bunga deposito Akper Fakinah dan RS ke rekening pribadi dan dokumen lainnya. “Bukti itu telah kami serahkan kepada penyidik Polda Aceh,” katanya. Pihak yayasan berharap penegak hukum secepatnya menyelesaikan kasus tersebut, apabila tidak segera diungkap maka akan menghambat operasional kegiatan rumah sakit. Sebelumnya, terkait pemberhentian Direktur Rumah Sakit Tgk Fakinah yang juga Direktur Akademi Perawat Tgk Fakinah (APTF) tertanggal 4 April 2011, dinilai kuasa hukum Dr HM Saleh Suratno, J. Kamal Farza, SH tidak punya dasar yang jelas, karena dua yayasan yang mengeluarkan surat pemberhentian direktur ini tidak memiliki alas hak yang sah.(gto)

Pencairan Dana Ke Dinas Di Pemkab Bireuen Tersendat BIREUEN (Waspada): Sejumlah Satuan Kerja Perangkat Kabupaten (SKPD) di lingkungan Pemerintah Kabuopaten Bireuen mengaku pelaksanaan kegiatan belum dapat berjalan maksimal. Pasalnya, dana untuk kebutuhan tersebut hingga kini masih tersendat pencairannya kendati APBK sudah disahkan sekira dua bulan lalu. “Apalagi ada dinas yang sudah berhutang untuk berbagai kebutuhan,” ucap sumber Waspada, Jumat (17/6) di Bireuen. Kalangan PNS di sana juga mengaku tidak tahu penyebab hingga dana untuk kebutuhan berbagai kebutuhan itu tidak lancar. “Sepertinya ada yang tidak beres dengan keuangan Bireuen,” ucap sumber yang minta namanya tidak dipublikasikan. Dia menyebutkan, pada tahun anggaran sebelumnya, pencairan dana dari Dinas Pengelolaan Keuangan dan Kekayaan Daerah (DPKKD) Bireuen tidak terkendala, kendati sisa Dana Alokasi Umum (DAU) lebih kecil. Kepala DPKKD Bireuen, M. Yusuf, SH kepada wartawan menyebutkan, membantah tersendatnya pencairan dana dimaksud. Dia menjelasakan, setiap dinas yang sudah mengajukan pencairan dana telah diproses dan sudah dibayarkan. Menurutnya, setiap usulan pencairan dana yang masuk ke BPKKD disortir lagi, dan kegiatan yang dianggap mendesak akan diprioritaskan pencairan dananya. (cb03)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 146 Jakarta/Medan

15:45

GA 147 Medan/Jakarta

16:20

Y6 537 Medan

19:15

Y6 538 Medan

07:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

AK 305 Kuala Lumpur *

12:20

AK 306 Kuala Lumpur*

12:45

FY 3401 Penang **

14:10

FY3400 Penang **

14:30

Batavia Air Lion Air

Sriwijaya Air Air Asia Fire Fly

* Setiap Senin, Rabu , Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

Waspada/Muhammad H. Ishak

RATUSAN pengunjung serius mendengarkan Dakwah Isra’ Mi’raj Rasulullah SAW di Balai Pengajian Raudhatul Muta’alimin, Desa Matang Geutoe, Idi Cut, Aceh Timur, Sabtu (18/6) malam.

dipimpin para ulama kharismatik. Akibatnya, disaat ilmu pengetahuan didapatkan dari sekolah umum, maka saat itulah kelalaian mengelilingi generasi. Tak hanya pengaruh narkoba dan terlibat dalam pergaulan bebas yang melanda pelajar SMP dan SMA sederajat di Aceh, lanjut Tgk. Muhammad Nasir, kini tidak sedikit para mahasiswa dan mahasiswi yang sudah menganut aliran sesat seperti muncul di Banda Aceh barubaru ini. “Kondisi tersebut terjadi tok karena orangtua dan dan lingkungan sebelumnya tidak mempagarinya dengan keimanan dan aqidah yang benar, sehingga pengaruh luar cepat meresap ke dalam tubuhnya,” jelasnya. Untuk itu, kata dia, diharapkan seluruh masyarakat Aceh untuk mempagari anak-anaknya sebagai generasi penerus bangsa dari pengaruh luar, sehingga Aceh ke depan memiliki calon-calon pemimpin yang bebas narkoba dan jauh dari pergaulan bebas serta tidak pernah terjerumus dalam aliran sesat sebagaimana aliran Millata Abraham sempat mewabah di Banda Aceh dan beberapa kabupaten/kota lainnya di Aceh. Sebelumnya, Pimpinan Balai Pengajian Raudhatul Muta’alimin, Tgk. Abdul Manan, S.Pd.I dalam sambutannta mengatakan, kegiatan keagamaan tersebut terlaksana berkat kekompokan dan ketusan pemudan dan pemudi—khususnya Matang Geutoeh—sehingga terlaksana kegiatan tersebut. Dakwah Islamiyah tersebut turut dihadiri unsur Muspika Darul Aman, aparatur desa dalam beberapa gampong di sekitar Desa Matang Geutoe, alim ulama, tokoh adat dan tokoh massyarakat serta seribuan masyarakat yang berdomisili di Kecamatan Darul Aman.(cmad)

Balon Bupati/Wabup Aceh Timur Bermunculan IDI, Aceh Timur (Waspada): Diamdiam, nama-nama Bakal Calon (Balon) Bupati dan Wakil Bupati Aceh Timur bermunculan. Hal itu ditandai dengan adanya sejumlah kandidat Cabub/ Cawabub telah membuat Surat Keterangan Catatan Kepolisian (SKCK) di Mapolres Aceh Timur. Informasi yang diperoleh, 8 kandidat Balon Bupati/Wakil Bupati di Kab. Aceh Timur telah mengambil SKCK dari Mapolres. “Hasil sementara sudah 8 kandidat mengambil SKCK,” ujar Kapolres Aceh Timur, AKBP Drs Ridwan Usman, Minggu (19/6). AKBP Ridwan Usman menyebutkan, ke delapan kandidat yakni Drs. Abdullah asal Kec. Peureulak Kota, Zainuddin asal Kec. Julok, M. Nasir asal Kec. Peureulak, Sofyan Adami, SH, asal Kec. Idi Rayeuk, Fakhrurazi asal Kec. Madat, Zulkifli Mahmud asal Kec. Banda Alam, dan Masthur,

SH, kandidat asal Kec. Peureulak Kota serta Abdussalam, SE, asal Kec. Nurussalam— Bagok. Dengan diambilnya SKCK sebagai Calon Bupati/Wabup Aceh Timur, masyarakat kini mulai membincangkan potensi yang dimiliki kandidat. Meski mayoritas disebut-sebut bakal mendaftar melalui jalur Independen, tetapi sejumlah nama lainnya seperti kandidat dari Partai Aceh (PA) dan kandidat dari Partai Koalisi juga mulai diperbincangkan. “Rakyat sudah mengetahui siapa yang layak untuk menjadi pemimpin di Aceh Timur,” ujar Ilyas Ismail, tokoh masyarakat Aceh Timur. Serahkan DP4 dan DAK2 Sementara Ketua Komisi Independen Pemilihan (KIP) Aceh Timur, Iskandar A. Gani, SH kepada Waspada mengatakan, Pemkab Aceh Timur telah melakukan penandatanganan Berita Acara Serah Terima Daftar Penduduk Potensial Pemilih

Pemilu (DP4) dan Data Agregat Kependudukan per-Kecamatan (DAK2) untuk Pemilukada Aceh Timur 2011. Penandatanganan berita acara oleh Bupati Aceh Timur, Muslim Hasballah, dengan Ketua KIP Aceh Timur dilakukan, Kamis (16/6) di Aula Serbaguna Banda Aceh. Penyerahan DP4 dan DAK2 Pemkab Aceh Timur, dilakukan berdasarkan surat keputusan Bupati Aceh Timur, No: 270/68/368/2011 Tanggal 15 Juni 2011, tentang penetapan jumlah penduduk Aceh Timur untuk Pemilihan Umum Kepala Daerah Bupati danWakil Bupati 2011. “Bagi yang mencalonkan sebagai Cabup dari perseorangan dengan pertimbangan penduduk syarat dukungan mencapai 3% dari jumlah DAK2. Selanjutnya KIP akan menggelar rapat pleno tentang pengeluaran Surat Keputusan tentang jumlah dukungan KTP bagi calon persorangan.(cmad)

IDI, Aceh Timur (Waspada): Menyusul cuaca buruk sejak tiga hari terakhir, ombak besar disertai angin kencang kini mulai melanda sebagian besar wilayah perairan timur Provinsi Aceh, sehingga berpotensi menimbulkan kecelakaan laut terutama bagi kapal-kapal nelayan tradisional. Menurut sumber Waspada di Pelabuhan Pendaran Ikan (PPI) di Kuala Idi, Kabupaten Aceh Timur, Minggu (19/6) menyebutkan, tinggi gelombang di perairan timur Aceh dan Sumatera Utara hingga sepekan terakhir ini diperkirakan berkisar antara 3-5 meter. Sementara tinggi gelombang di atas normal disertai kecenderungan cuaca buruk diperkirakan juga terjadi di sekitar perairan Selat Malaka hingga ke beberapa kabupaten/Kota lainnya di Aceh, seperti Kota Lhokseumawe dan Pidie. Selain di wilayah itu, cuaca ekstrim dan gelombang laut dengan ketinggian hingga mencapai lima meter juga terjadi perairan lain seperti perairan Belawan dan Natuna serta di perairan Kepulauan Riau. “Sudah tiga hari stok ikan habis, karena kapal (boat—red) tidak bisa melaut, sebab tinggi ombak mencapai 5 meter,” ujar Hamdani, tokoh nelayan di Kuala Idi, Minggu (19/5). Ketua LSM Lembaga Advokasi Buruh dan Nelayan Aceh (LABNA), Zainuddin Salam kepada Waspada menyebutkan hal sama. Dia menambahkan, sejak beberapa hari terakhir banyak kapal ikan nelayan tidak melaut disebabkan ombak cukup tinggi yang berpotensi menimbulkan kecelakaan laut. Penurunan aktifitas nelayan Aceh Timur dan sekitarnya untuk melaut, lanjut dia, turut berdampak terhadap volume hasil tangkapan ikan nelayan dan harga ikan di Aceh yang sejak sebulan terakhir cenderung naik hingga 30 persen dari harga normal. “Harga ikan gembung kuring, misalnya, kini masih bertahan di kisaran Rp25. 000 per kilogram (kg) atau naik sekitar Rp5000 per kg,” katanya. Pengamatan Waspada, kondisi Pelabuhan Pendaratan Ikan (PPI) Kuala Idi Rayeuk, Aceh Timur, dalam kondisi sepi dari aktifitas nelayan. Padahalbiasanyatidakkurangdariseribuanwargatumpahkesanadengan berbagai keperluan, termasuk masyarakat memilih membeli ikan ke Kuala Idi, karena dianggap lebih murah dan ikannya masih bagus. Kapolres Aceh Timur, AKBP Drs Ridwan Usman melalui KBO Satuan Pol Air, Aiptu Zainir saat diminta keterangan membenarkan kondisi cuaca di Selat Malaka kembali berubah. “Ya benar, setelah beberapa pekan normal kini Selat Malaka kembali berombak dan anginya berhembus kencang,” katanya. (cmad)

Direktur CV Garuda Aceh Mandiri Mengamuk Di Kanto PU LHOKSEUMAWE (Waspada): Polisi terpaksa mengamankan Direktur CV Garuda Aceh Mandiri, Muhammad Zubir,30, karena mengamuk dan merusak pintu Dinas Pekerjaan Umum (PU) Kota Lhokseumawe, Kamis (16/6). Mantan kombatan itu mengaku emosi setelah membaca pengumuman pemenang lelang proyek yang ditempelkan di dinding dinas tersebut. Informasi dihimpun Waspada menyebutkan, setelah melihat pengumuman lelang proyek peningkatan Jalan Kumbang-Paya Bili bahwa calon pemenangnya adalah CV Yed’s Co Brothers, dan CV Ikhlas That, serta CV Kawan Karya sebagai calon pemenang cadangan I dan II, Zubir langsung masuk ke ruangan Dinas PU untuk mencari kepala dan sekretaris Unit Layanan Pengadaan (ULP) pengadaan/ jasa, Tri Hariadi dan Furqan. Karena tidak berhasil ditemukan, Zubir meninju filling cabinet di ruangan tengah Dinas PU. Bahkan, saat keluar dari ruangan tersebut, dia menendang pintu hingga rusak. Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kasat Reskrim AKP Galih Indra Giri saat dihubungi, menyebutkan, sejauh ini pihaknya masih memeriksa Zubir. Hasil pemeriksaan sementara, kasus tersebut menjurus ke pelanggaran pasal 406 KUHPidana tentang pengrusakan. Ditanya apakah tersangka ditahan atau tidak, Galih menyatakan hal itu akan diputuskan oleh penyidik usai melakukan pemeriksaan. Direktur CV Garuda Aceh Mandiri M Zubir di Mapolres Lhokseumawe, kemarin siang, mengakui meninju filling cabinet dan menendang pintu Dinas PU hingga rusak. Hal itu dilakukannya, karena emosi setelah membaca pengumuman pemenang proyek peningkatan Jalan Kumbang-Paya Bili. Emosinya semakin memuncak, kata Zubir, sebab ia tidak menemukan Tri Hariadi dan Furqan selaku kepala dan sekretaris ULP pengadaan barang/jasa untuk mempertanyakan penetapan pemenang lelang yang dinilai janggal. “Perusahaan yang dimenangkan oleh panitia lelang adalah perusahaan yang jaminan penawarannya, seperti yang diminta pada dokumen data lelang halaman 58, tidak ada nomor dokumen dan tanggal. Padahal nomor dan tanggal itu sifatnya mengikat. Salah mencantukan nomor saja bisa gugur, apalagi tidak ada nomor sama sekali. Maka saya keberatan dengan hasil pengumuman lelang proyek itu,” katanya.(b17)

Pos Pemadam Kebakaran Madat Kurang Sosialisasi MADAT, Aceh Timur (Waspada): Keberadaan pos pemadam kebakaran untuk wilayah barat Aceh Timur di Madat, Kecamatan Madat, dinilai kurang sosialisasi. Banyak warga tidak tahu nomor kontak pos itu. Bahkan ada keuchik yang belum tahu kalau di Madat ada Pos Pemadam kebakaran. “Ini harus menjadi bahan evaluasi pejabat dinas terkait, supaya keberadaan pos itu benar-benar bermanfaat bagi masyarakat banyak, khususnya di Kec. Madat, Pantee Bidari dan Simpang Ulim,”kata Sulaiman Hamzah alias Apaleman, anggota DPRK Aceh Timur asal Madat, di Madat, Jumat (17/6). Menurut politisi Partai Aceh ini, sebagai lembaga pelayan publik, sudah selayaknya nomor kontak Pos Pemadam Kebakaran disebar ke semua desa agar diketahui seluruh masyarakat. Minimal nomor kontak mareka tersimpan di perangkat telefon keuchik. Dengan demikian, ketika terjadi kebakaran bisa cepat dihubungi dan peluang keberhasilan memadamkan api juga semakin besar. (cmus)

Polisi Amankan Simpatisan Pemukul Tim Sukses Calon Bupati BLANGPIDIE (Waspada) : Arifin, 40, asal desa Kuta Tinggi, Kecamatan Blangpidie, Aceh Barat Daya (Abdya) yang juga tim sukses Calon Bupati Akmal Ibrahim sejak Rabu (15/6) ‘diamankan’ pihak kepolisian. Arifin diamankan oleh Polsekta Blangpidie karena melakukan pemukulan terhadap Sabirin, 39, salah seorang relawan Ir.M.Fakhruddin Muhdi yang juga Calon Bupati Abdya lainnya yang diusung oleh Partai Demokrat dan Partai Matahari Bangsa (PMB). Aksi pemukulan terhadap Sabirin oleh Arifin pada Minggu (12/ 6) malam sekitar pukul 19.30 itu sempat membuat situasi politik menjadi memanas. Pasalnya, kedua pihak merupakan warga sekampung serta memiliki kemungkinan munculnya ‘perang’ antar pendukung dari kedua pihak.

Terhadap kondisi tersebut pihak kepolisian langsung melakukan reaksi cepat untuk mengantisipasi terjadinya permasalahan yang lebih besar. Seperti diungkapkan Kapolres Abdya melalui Kapolsek Blangpidie Iptu Marzuki,SH kepada Waspada Jum’at (17/6), bahwa simpatisan dari kubu ‘lanjutkan’ tersebut langsung diamankan oleh pihak kepolisian dalam ranga mengantisipasi munculnya beragam gejolak serta pertikaian yang dinilai dapat memicu kerawanan. Selain itu pihak kepolisian seperti dituturkan Kapolsek Blangpidie akan tetap bertindak tegas terhadap pelaku tindak pidana demi penegakan hukum tanpa pandang bulu, namun demikian kepada seluruh elemen masyarakat tetap diminta agar saling menghargai dan menghormati serta bersama-sama menjaga ketertiban di lingkungan

masing-masing. “Memang benar Arifin (pelaku) sudah kita amankan pada hari Rabu kemarin. Kita tetap konsisten melakukan penegakan hukum tanpa pandang bulu, namun demikian kepada kedua pihak baik pelaku maupun korban tetap kita harapkan untuk mengedepankan tali silaturahmi dan persaudaraan,” ujar Iptu Marzuki,SH, Kapolsek Blangpidie. Terhadap kejadian tersebut Ir.M.Fakhruddin Muhdi yang menghubungi Waspada Jum’at (17/6) meminta kepada pendukungnya yang menjadi korban pemukulan itu supaya tidak dendam dan dapat memaafkan si pelaku. Menurutnya kejadian itu dapat dijadikan sebagai sebuah bahan interopeksi agar semua pihak tidak mudah terpancing kearah perpecahan. (sdp)

Waspada/Maimun Asnawi

RUMAH M. Ridwan, 25, di Gampong Meunasah Mee Matang Panyang, Tanah Pasir,Aceh Utara,Minggu (19/6) sekitar pukul 10:30 ludes terbakar.

Satu Rumah Terbakar TANAH PASIR, Aceh Utara (Waspada): Satu rumah di Gampong Meunasah Mee Matang Panyang, Kec. Tanah Pasir, Aceh Utara, Minggu (19/6) pukul 10:30 terbakar. Tidak ada korban jiwa, namun kerugian mencapai puluhan juta rupiah. Khairunnisa, 28, warga Meunasah Mee Matang Panyang mengatakan, pukul 10:30 melihat asap hitam mengepul ke udara, sekitar 250 m dari rumahnya. Rumah yang ludes terbakar itu milik M. Ridwan, 25, berkontruksi kayu. Saat peristiwa terjadi, Ridwan bersama isteri dan anaknya sedang ke tempat saudaranya di Idi, Aceh Timur. Makanya, tidak ada harta benda yang berhasil diselamatkan. Beberapa warga mengatakan, sempat mendengar ledakan dari rumah korban. Warga menduga, itu suara kompor gas. Tak lama kemudian kobaran api membakar seluruh rumah. Setelah rumah ludes baru datang mobil pemadam, namun sudah terlambat.(cmun)


Aceh

C8

WASPADA Senin 20 Juni 2011

Jalan Sawang Rusak Akibat Angkutan Galian C

Revolusi Belajar Sukses Untuk Siswa SMP

SAWANG, Aceh Utara (Waspada): Jalan utama Kec. Sawang, Aceh Utara dua tahun setelah selesai dibangun, kini kondisi sebagian badan jalan terkelupas di sisi kiri. Ini akibat truk pengangkut galian C dari beberapa tempat saat pulang menuju ke Krueng Mane berisi muatan. Menurut informasi aktivitas galian C ini tidak memiliki izin. Warga Cot Geulumpang, Desa Jurong, Kamis (16/6 mengatakan, di desanya terdapat satu penambangan galian C ilegal, selama ini sangat meresahkan warga. Lokasinya sangat dekat dengan irigasi. Apabila terus berlanjut, saluran irigasi yang mengairi puluhan hektar sawah yang merupakan mata pencaharian utama masyarakat teramcam rusak.(b03)

LANGSA (Waspada): Para siswa kelas dua pada Sekolah Menengah Pertama (SMP) Negeri-I Kota Langsa mengikuti seminar pendidikan sehari tentang revolusi belajar sukses, Kamis (16/6). Acara digelar untuk menghadapi UN tahun mendatang dan persiapan megikuti seleksi masuk sekolah faforit. Pelaksana seminar dipelopori Ganesha Operational (GO) Langsa. Kepala Ganesha Operation Sumut-Aceh, Ir. Jamso Haryono Pangaribuan usai seminar di SMPN-I Langsa mengatakan, tujuan seminar untuk memberi pemahaman dengan pola belajar penggunaan otak kiri dan otak kanan. “Selama ini dalam proses belajar masih banyak siswa atau pelajar yang menggunakan otak kiri, namun kita berupaya agar siswa mampu menggunakan kedua fungsi otak tersebut sehingga lebih cepat menangkap materi yang diberikan guru, serta nantinya tidak kewalahan saat menjawab soal ujian,” sebutnya.(b22)

Pengelolaan Dana Restribusi Terminal Bireuen Kurang Jelas

Gajah Liar Teror Buket Linteung LANGKAHAN, Aceh Utara (Waspada): Tiga ekor gajah liar dilaporkan mengamuk di kawasan perkebunan Desa Buket Linteung, pedalaman Langkahan, Kab. Aceh Utara. Belasan Ha tanaman dilaporkan hancur diobrak-abrik, sementara petani takut ke kebun karena khawatir berhadapan langsung dengan hewan berbadan bongsor itu. “Kawanan gajah tersebut masuk kampung tiga hari lalu dan sampai sekarang masih bertahan di kawasan perkebunan warga. Mareka menebar teror dengan meraung-raung sembari mematahkan batang pohon yang agak tinggi, termasuk pinang,”kataYusuf, 50, warga Buket Linteung kepada Waspada, Jumat (17/6) petang. Yusuf menambahkan, dalam tiga hari terakhir, setidaknya sudah 15 Ha kebun warga dirusak kawanan gajah. Sasaran utamanya kebun kepala sawit, pinang, dan kebun pisang. “Kami sudah kewalahan menghadapi situasi ini. Pemerintah harus segera turun tangan. Jangan sampai ekonomi petani di sini lumpuh total karena terus-terusan takut ke kebun,” harapnya.(cmus)

15 Mendakam Ke Pulau Jawa ACEH UTARA (Waspada): Sedikitnya 15 Menteri dalam Kampung (Mendakam) nama lain untuk geusyik (kepala desa) melaksanakan studi banding ke Pulau Jawa. Kunjungan tersebut didampingi dua Mukim dan Camat Dewantara. Dana keberangkatan para geusyik sepenuhnya oleh PT. Pupuk Iskandar Muda (PIM). Ketua Asosiasi Geusyik Dewantara, Sofyan Hanafiah kepada wartawan, Kamis (16/6) mengatakan,. PT PIM menyanggupi dan menanggung seluruh biaya yang dibutuhkan selama kegiatan studi banding para geusyik dan mukim di beberapa kabupaten di pulau Jawa. Namun Sofyan belum dapat menjelaskan daerah mana yang akan dikunjungi. Sekretaris Perusahaan (Sekper) PT PIM, Sakban Daud yang dihubungi membenarkan, semua Kades dan Mukim serta Camat Dewantara akan melakukan studi banding ke pulau Jawa dibiayai PT PIM. “Menajemen PIM menyetujui studi banding para Kades Dewantara sebagai rasa kepedulian terhadap lingkungan. PIM menaruh perhatian besar terhadap semua kegiatan pedesaan lingkungan,” katanya. (cmun)

Antisipasi Membludaknya Pendaftar MEULABOH (Waspada): Kepala Dinas Pendidikan (Diknas) Aceh Barat Bismi, S.Pd mengatakan, seluruh siswa lulusan Sekolah Menengah Pertama atau sederajat tahun 2011 akan tertampung di seluruh bangku SMA. “Setiap tahun tidak ada permasalahan dengan daya tampung siswa tamatan SMP karena semua tertampung di SMA yang ada di Aceh Barat,” kata Bismi, Kamis (16/6). Bismi mengatakan setiap tahun total tamatan siswi SMP/ MTs yang mampu di tampung sejumlah SMA di Aceh Barat mencapai 3.296 orang siswa. Sementara jumlah lulusan siswi menengah pertama rata-rata 3.128 orang. “Memang ada sejumlah wali murid dari luar kota seperti Nagan Raya yang cenderung menyekolahkan anak mereka di sini, tapi jumlahnya masih tertampung,” kata Bismi. Sementara Ketua Komisi D DPRK Aceh Barat membidangi pendidikan, Zaenal Abidin, S.Si menekankan perlunya ketegasan dinas terkait menyangkut penerimaan siswa baru. Hal ini untuk menekan membludaknya jumlah pendaftar di sekolah tertentu.(cak)

Terkikis, Jalan Meunasah Hampir Putus SAWANG, Aceh Utara (Waspada): Sejak tiga tahun terakhir akibat terkisis air hujan, jalan menuju meunasah Gampong Meunasah Pulo, Kec. Sawang, Aceh Utara hampir putus. Sementara pagar meunasah di atas tebing, tinggal 50 cm dari 2 meter sebelumnya dengan bibir tebing. Geuchik Gampong Maunasah Pulo, Bukhari Makam, Rabu (15/6) mengatakan, kedua situasi dan kondisi ini pihaknya sudah mengajukan permohonan ke dinas terkait. Kendati demikian, jawaban pihak dinas tidak menampakkan respon positif. Gampong Meunasah Pulo mempunyai jumlah penduduk sekitar 485 jiwa lebih. Kondisi ini sangat mengharapkan penanganan secara khusus masalah ini. “Kalau swadaya masyarakat tidak mungkin ini dapat ditangani, karena butuh biaya dalam jumlah besar, kami taksir mencapai Rp350 juta,” ujar Bukhari.(b03)

Dispora Serahkan 30 Kambing Pemberdayaan Masyarakat BANDA ACEH (Waspada): Peserta program Sarjana Penggerak Pembangunan di Pedesaan (SP3) melalui Dinas Pemuda dan Olahraga (Dispora) Aceh, menyerahkan bantuan berupa 30 ekor kambing kepada masyarakat di lima desa dalam wilayah Kec. Lhoknga, Aceh Besar. Desa-desa yang mendapat bantuan masing-masing Desa Lampaya, Nusa, Lam Girek, Naga Umbang dan Meunasah Lambaro. Setiap desa mendapat enam ekor selanjutnya diserahkan kepada dua kelompok peternak. Kepala Bidang (Kabid) Kepemudaan Dispora Aceh, Drs. H. Bustamam, MSi, di Meunasah Desa Naga Umbang mengatakan, kambing ini bantuan spontanitas para peserta SP3 dalam rangka pemberdayaan masyarakat di tempat mereka bertugas. Sementara seorang peserta SP3, Trisna Hadi, menyebutkan, dana pembelian kambing ini berasal dari dana peralatan kerja yang tidak digunakan. “Dari pada dananya mubazir, maka kita secara spontan membuat program pemberdayaan masyarakat ini,” jelasnya.(b07)

Waspada/Zafrullah

KABID Kepemudaan Dispora Aceh, Drs. H. Bustama, MSI (tiga dari kanan) menyerahkan berkas kontrak perjanjian kepada penerima bantuan dari Desa Meunasah Lambaro, disaksikan Geuchik, Jamaluddin (paling kanan).

Waspada/Muhammad H. Ishak

KAPOLRES Aceh Timur, AKBP Drs Ridwan Usman (kiri) menyaksikan Sertijab Waka Polres Aceh Timur dari Kompol Didik Santoso, S.Ik, SH kepada Kompol Dony Wahyudi, S.Ik, Sabtu (18/6), di halaman Mapolres.

Polri Siap Gandeng TNI TO Senjata Api Illegal IDI, Aceh Timur (Waspada): Aksi perampokan menggunakan senjata api (senpi) illegal berbagai jenis, menjadi Target Operasi (TO) dan prioritas Polri. Bahkan dalam mengungkap kasus yang meresahkan masyarakat itu, Polri siap menggandeng TNI. Demikian ditegaskan Kapolres Aceh Timur, AKBP Drs Ridwan Usman usai Serahterima Jabatan (Sertijab) Wakapolres Aceh Timur dari Kompol Didik Santoso, S.Ik, SH kepada Kompol Dony Wahyudi, S.Ik, Sabtu (18/6) di halaman Mapol-

res. Kompol Didik mendapat jabatan baru di Reskrimsus Polda Aceh, sementara Kompol Dony sebelumnya Wakapolres Naga Raya. Kapolres menambahkan, sejumlah kasus bersenjata api belum ditutup, bahkan hingga kini masih dilakukan pengembangan dan penyelidikan mendalam. “Seperti kasus penculikan penderes getah di Ranto Peureulak yang terjadi barubaru ini dan beberapa kasus lainnya di wilayah barat dan wilayah timur. Intinya kita terus mengejar pelaku aksi kejahatan, karena tugas Polri adalah memberi rasa aman kepada masyarakat,”jelasAKBPRidwanUsman. Karenanya Kapolres Ridwan Usman minta pelaku kejahatan

di Aceh Timur menyerahkan diri sebelum polisi mengambil tindakan. Sebab, meski mengelabui dan melarikan diri ke luar Aceh Timur, identitas lengkap dan alamatnya telah dikantongi polisi. “Sebelum polisi mengambil tindakan lebih bagus menyerah, karena bisa jadi hukuman atas perbuatannya lebih ringan dari pada diambil paksa,” tegas Kapolres Ridwan Usman. Selain itu, tambah perwira asal Montasik ini, siapa pun yang memiliki senpi dari berbagai jenis tanpa izin instansi terkait, harus segera diserahkan ke polisi. “Senpi illegal haram disimpan dan digunakan serta dibawa oleh masyarakat. Karena penggunaan senpi diatur oleh Undang-Undang,” sebut Kapol-

res Ridwan Usman seraya menandaskan, jika mengetahui ada senpi illegal yang disimpan seseorang, segera lapor ke polisi dan identitas sumber akan dirahasiakan. Kapolres kembali mengingatkan, menjelang Pemilukada di Aceh yang sudah diambang pintu, diharapkan semua pihak ikut menyukseskan dengan menjaga keamanan dan kedamaian. Pasalnya, damai itu indah dan mahal. “Untuk itu mari sama-sama kita jaga kedamaian sebagaimana diamanahkan MoU Helsinki antara Pemerintah RI-GAM pada 2005.“Kandidat yang akan bertarung kita harap sama-sama menjaga dan memelihara kedamaian,” ulang Ridwan Usman.(cmad)

PPP Kukuhkan Balon Walikota Dan Wakil Walikota Langsa LANGSA (Waspada): Partai Persatuan Pembangunan (PPP) Kota Langsa, secara resmi melakukan pengukuhan terhadap pasangan H. Jauhari Amin – H RazaliYusuf sebagai bakal calon (balon)Walikota/WakilWalikota Langsa yang akan diusung dalam Pemilukada mendatang. Pengukuhan diadakan di Stroom Café itu, Sabtu (18/6), dihadiri unsur pimpinan Pengurus Pusat dan Pengurus Wilayah PPP Provinsi Aceh, serta seratusan kader Partai Persatuan Pembangunan (PPP) Kota Langsa. Ketua DPC Partai Persatuan Pembangunan (PPP) Kota Langsa Letkol (Purn) Alibasyah Tanjung mengatakan, sebelum melakukan pengukuhan, terlebih dahulu melalui berbagai tahapan mekanisme partai. Bahkan dalam penjaringan bakal calon yang dibuka oleh DPC PPP Langsa beberapa wak-

tu lalu, lima pasangan balon walikota/wakil walikota Langsa telah mendaftarkan diri. Setelah melalui fit and propertest yang komprehensif, akhirnya DPC PPP menetapkan tiga pasang balon sesuai urutan nilai tertinggi untuk diusulkan ke DPW PPP Provinsi Aceh dan DPP PPP. “Karena pasangan H Jauhari Amin – Razali Yusuf memperoleh nilai tertinggi dibandingkan pasangan lainnya ketika dilakukan fit and propertest, maka dengan demikian DPP PPP akhirnya menetapkan pasangan ini sebagai pasangan resmi yang akan diusung oleh DPC PPPP Langsa sebagai balon walikota/wakil walikota Langsa pada Pemilukada mendatang,” ujar Alibasyah Tanjung. DPP PPP menginstruksikan kepada DPC PPP untuk memproses pencalonan ke Komisi Independen Pemilihan (KIP) sesuai aturan perundang-un-

dangan. Kepada seluruh jajaran DPC PPP Langsa, DPP PPP meminta untuk tetap menjaga

kekompakan dan bersatu untuk memenangkan balon yang diusung oleh partai.(b22)

Waspada/Ibnu Sa’dan

UNSUR Pimpinan Partai Persatuan Pembangunan Pusat dan Provinsi Aceh, ketika mengukuhkan pasangan H. Jauhari Amin – H Razali Yusuf sebagai balon walikota/wakil walikota Langsa diusung DPC PPP Kota Langsa dalam Pemilukada mendatang.

Suplai Air Irigasi Langkahan Macet 19 Ribu Ha Sawah Terancam Merekah PANTONLABU, Aceh Utara (Waspada): Suplai air Daerah Irigasi (DI) Langkahan dilaporkan macet sejak sepakan terakhir. Akibatnya 19 ribu hektar lebih sawah di kawasan perbatasan Aceh Timur- Aceh Utara terancam merekah. Ribuan petani terpaksa menunda menabur benih lantaran sawah mareka belum teraliri air. “Sesuai kesepakatan petani dan dinas pengairan, seharusnya air sudah sampai ke sawah sejak sebulan lalu. Tapi fakta sekarang, air dalam saluran sangat

sedikit. Bahkan di beberapa titik, belum ada sama sekali,”kata Razali Meudeuhak, salah seorang petani yang juga mantan Keuchik Tanjoeng Minjei, Tanah Jambo Aye, via telefon, Minggu (19/6). Razali menambahkan, khusus di Desa Tanjong Minjei Tanah Jambo Aye, para petani sawah sudah bersiap-siap menabur benih. Namun karena sawah masih kering, tahapan itu terpaksa ditunda hingga batas waktu yang belum bisa dipastikan. “Harapan kami, Dinas Pengairan segera menanggu-

langi masalah ini. Jangan sampai musimtanamgadukaliinibenarbenar gagal,” harapnya. Sementara Kepala Dinas Pengairan Ranting Tanah Jambo Aye, Fahmi, melalui Koordinator Operasional dan Pemeliharan Jaringan, Hasan Basri alias Pak Bob, saat dikonfirmasi secara terpisah, membenarkan suplai air DI Langkahan saat ini tengah macet. Hal itu disebabkan debit air sungai Arakundo menciut, sehingga suplai air yang masuk ke bendungan tidak maksimal. “Sebelumnya, kondisi ini

juga sempat diperparah dengan banyaknya tumpukan sampah serta sedimen di sekitar kanal utama dekat bendungan. Tapi kendala itu sudah kita atasi. Jumat 16 Juni lalu kita bersama masyarakat dari Perkumpulan Petani Pemakai air (P3A) atau Kejruen Blang, sudah bergotongroyong membersihkan sampah itu. Biasanya, dua atau tiga hari setelah pembersihan, suplai air akan kembali lancar meski debit air sungai belum memadai,”tandas Pak Bob. (cmus/b10)

Satgassos Garuk Belasan Gepeng BANDA ACEH (Waspada): Belasan gelandangan dan pengemis (Gepeng) digaruk Satuan Tugas Sosial (Satgassos) dari Dinas Sosial dan Tenaga Kerja (Dissosnaker) Kota Banda Aceh, Jumat (17/6) malam hingga Sabtu (18/6) dinihari, dari sejumlah kawasan di pusat kota dan pusat jajanan. Petugas Satgassos mendatangi pasar Aceh, Rex Peunayong, Neusu, Merduati, Seutui dan pasar swalayan, mendapati gelandangan dan pengemis berkeliaran, lalu menangkap dan menaikkan mereka ke dalam mobil petugas. Dari razia malam itu, petugas Satgassos Disnaker menja-

ring 16 gepeng, di antaranya 14 dewasa dan dua balita, terdiri dari wanita dan laki-laki. Setelah diberi arahan, para gepeng dipulangkan ke kampung halaman malam itu juga. Kepala Dissosnaker Kota Banda Aceh, Drs Purnama Karya, Sabtu (18/6) mengatakan, razia Gepeng ini rutin dilakukan dan waktunya tidak ditentukan. “Razia gepeng kita lakukan untuk meningkatkan rasa nyaman bagi warga yang menikmati makanan di warung, restoran dan café, sehingga tidak ada gepeng yang meminta-minta,” ujarnya. Razia ini, menurut Purnama, juga dalam mendukung kunjungan wisata Visit Banda

Aceh Year 2011. “Kita berharap ke depan tidak banyak lagi gepeng berkeliaran di warung dan restoran. Karena menganggu konsumen,” ujarnya. Purnama mengungkapkan, razia juga dilakukan karena banyak pengaduan masyarakat, sebab dinilai meresahkan. “Kita minta pemilik toko, warung, restoran dan café tidak memberi izin masuk para gepeng untuk meminta-minta,” jelasnya. Menurutnya para gepeng ini umumnya berasal dari Aceh Utara. Selama melakukan aktivitas di Banda Aceh, mereka menyewa tempat menginap di sebuah toko kawasan Goheng, Seutui. “Gepeng yang ditangkap

malam itu diberi pengarahan bahwa meminta-minta itu tidak baik. Setelah itu, kita bawa ke terminal dan kita belikan tiket untuk pulang ke kampung di Aceh Utara.” Dissosnaker tetap memiliki program melakukan pembinaan dan membantu kaum duafa, Gepeng di Banda Aceh. Bagi masyarakat dapat membantu warga miskin, duafa dan gepeng di gampong masingmasing, atau melalui lembaga zakat dan lembaga sosial. “Masyarakat kita imbau agar tidak memberi bantuan kepada gepeng di jalanan, perempatan jalan, restoran, café dan warung,” kata Drs. Purnama Karya.(b07)

BIREUEN (Waspada): Pengelolaan dana restribusi terminal Bireuen kurang jelas penggunaannnya, sehingga kondisi terminal selain kacau juga rusak parah dan sehingga mobil penumpang enggan singgah di terminal. Sementara Kepala Dishubparkominfo, Ibrahim Ahmad menyebut, yang mengatakan tidak jelas itu adalah orang yang tidak mengerti persoalan atau asal bicara, karena masalah uang semua dilaporkan kepada atasannya. Informasi yang diperoleh, Rabu (15/6), uang restribusi yang dikutip dari mobil penumpang di terminal maupun di luar terminal selama ini terkesan kurang jelas angkanya dan kurang jelas kemana diperuntukkan. Kecuali itu, sejumlah kalangan di Bireuen juga menyoroti masalah areal parkir di Kota Bireuen yang masih belum tertib alias amburadul, sehingga masalah parkir saja tak mampu diurus. Bahkan tim terpadu pernah ikut menertibkan areal parkir di beberapa lokasi yang semrawut termasuk bongkar muat barang di kota. “Padahal tronton dilarang membongkar barang di wilayah Kota, karena sudah ada lokasi khusus, itu juga tidak jelas,” katanya. Sementara Kadishub, Bireuen Ibrahim Ahmad yang ditemui di ruang kerajanya mengatakan, kalau ada yang menyebut kurang jelas itu dari sudut mana. Uang untuk pengelolaan terminal tidak ada, selama ini uang hasil restribusi dikelola dan yang ditargetkan PAD terlalu tinggi, sehingga tidak tercapai, walau dibanding priode sebelumnya ada peningkatann,” kilahnya. (amh)

Kejari Idi Komit Berangus Korupsi IDI, Aceh Timur (Waspada): Kepala Seksi Intel (Kasi Intel) Kejaksaan Negeri Idi, Muhammad Iqbal bersama jajarannya, Rabu (8/6) petang, bersilaturrahmi ke kantor KumpulanWartawan Aceh Timur (KuWAT), Jalan Medan - Banda Aceh, Tanoeh Anoe, Idi Rayeuk, Aceh Timur. Kedatangan rombongan Abdi Adhyaksa itu disambut Ketua KuWAT, Iskandar Usman Alfarlaky, didampingi Sektarisnya Ilyas Ismail serta pengurus dan anggota KuWAT. Mereka membahas banyak hal yang menyangkut dengan kinerja Kejari Idi, termasuk masalah penanganan kasus korupsi di Aceh Timur. “Kita komit memberangus semua kasus dugaan korupsi di Aceh Timur. Namun komitmen ini tentu terasa sulit kita jalankan jika tidak didukung semua elemen, termasuk pers. Itu sebabnya, partisipasi rekan wartawan di AcehTimur, khususnya yang bernaung di KuWAT, sangat kita harapkan. Minimal kita saling tukar informasi terkait dugaan atau indikasi korupsi,” kata Muhammad Iqbal. Pada kesempatan sama, Muhammad Iqbal juga mengabarkan, dalam waktu dekat pihaknya berencana membuat pos pengaduan masyarakat di sejumlah tempat yang dianggap cocok serta strategis. Langkah ini dilakukan agar keluhan masyarakat, terutama yang menyangkut penegakan hukum, tertampung semua serta bisa ditindaklanjuti sebagaimana mestinya. Di pihak lain, Ketua KuWAT Iskandar Usman Alfarlaky, menyatakan, mendukung penuh langkah Kejari Idi. “Kita siap bekerjasama sekaligus berpartisipasi aktif membantu Kejari. Bahkan, selama ini pun, kita intens memantau serta memberitakan berbagai indikasi korupsi di Aceh Timur. Ini wujud kontrol sosial serta tanggungjawab kami, sebagaimana diamanahkan Undang-Undang Nomor 40 tahun 1999 tentang Pers,” tandas Iskandar.(cmus)

Pelabuhan Dan Industri Aceh Utara Dukung MP3EI LHOKSUKON, Aceh Utara (Waspada): Pelabuhan Umum Krueng Geukuh dan beberapa industri di Aceh Utara, pendukung Program Masterplan Percepatan dan Perluasan Pembangunan Ekonomi Indonesia (MP3EI). Sekitar Rp1,25 triliun dana pembangunan Pelabuhan Umum Krueng Geukueh, Aceh Utara dialokasikan melalui program MP3EI. Program pemerintah pusat yang mempersiapkan dana Rp20 triliun untuk Aceh, juga disalurkan pada sektor pertanian, terutama perkebunan karet dan kepala sawit. “Pemerintah menyetujui Aceh masuk dalam program MP3EI,” kata Wakil Gubernur Aceh, Muhammad Nazar dalam pertemuannya dengan sekitar 500 tokoh masyarakat yang terdir dari para ulama, imum mukim, geusyik, pemuka adat dan para pemuda di Lhoksukon. Di Aceh Utara, tambah Nazar, dikebangkan pertanian, karet dan kepala sawit. Untuk mendukung program ini, seluruh industri yang menjadi penyanggah sektor pertanian harus dihidupkan kembali. Di antaranya, pabrik pupuk dan kilang PT. Arun yang menyediakan gas alam untuk bahan baku pupuk.(b17)

TNI Latih Ranger Pemantau Hutan Leuser BANDA ACEH (Waspada): TNI Kodam Iskandar Muda melatih sedikitnya 60 orang staf pemantau hutan (Eco Ranger) Kawasan Ekosistem Lauser (KEL) di Rindam Mata Ie Aceh Besar, untuk meniongkatkan kemampuan dalam menjaga hutan di Aceh dari pengrusakan. Penyerahan personil Ranger langsung dilakukan oleh Kepala Dinas Bapedalda Aceh Ir. Husaini Syamaun, di Rindam Iskandar Muda Mata ie. Para peserta akan mengikuti fase pelatihan bela negara untuk menjadi kader pemantau kawasan ekosistem Leuser, pelatihan ini dilaksanakan selama satu bulan terhitung dari hari Kamis (9/6). Berdasarkan pengamatan bapedalda kerusakan dan ancaman terhadap kelestarian KEL terus berlangsung, sehingga BPKEL wilayah Aceh berkewajiban untuk melakukan monitoroing dan perlindungan secara intensif terhadap kawasan paru-paru duani tersebut. “Dari dasar itulah, pemerintah Aceh merekrut pemudapemuda disekitar KEL pada 13 kabupaten/kota di Aceh untuk memantau hutan dan dilatih oleh TNI, karena kemampuan bela negara dan kedisiplinan sangat dibutuhkan bagi para staf Ranger dalam mengemban tugas dilapangan,”kata Kepala Dinas Bapedalda Aceh Ir. Husaini Syamaun usai penyerahan, Kamis (9/6). Ia mengatakan, staf pemantau hutan (Ranger) merupakan salah satu unit kerja di Badan Pengelola Kawasan Ekosistem Leuser (BPKEL) wilayah Aceh yang berfungsi untuk melakukan patroli pengamanan dan perlindungan terhadap satwa dan habitatnya yang ada didalam kawasan ekosistem leuser.(gto)

Waspada/Gito rolies

KEPALA Dinas Bapedalda Aceh Ir. Husaini Syamaun sedang memberikan pengarahan kepada 60 staf Ranger di Aula Rindam Mata ie Aceh Besar.


Waspada, Senin 20 Juni 2011