Issuu on Google+

Medan 24-32 C

Berastagi 19-30 C

R. Prapat 24-320C

Parapat 19-29 0C

P. Siantar 18-270C

Sibolga 22-29 C





Hujan guntur

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Senin

BMKG Polonia

SENIN, Pahing, 20 Desember 2010/14 Muharram 1432 H

No: 23362 Tahun Ke-64

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-8, B1-8, C1-8)

Harga Eceran: Rp2.500,-

Gonzales Super Star

CHRISTIAN Gonzales meluapkan kegembiraannya usai mencetak gol (foto kanan) pada pertandingan semifinal leg kedua AFF Suzuki Cup di stadion utama Gelora Bung Karno, Jakarta, Minggu (19/12). Gonzales (tengah) berusaha melewati hadangan dua pemain Filipina Robert James Dazo Gier (kiri) dan Mark Anthony Gocon (kanan). Antara


JAKARTA (Waspada): Indonesia mengatasi Filipina 1-0 pada partai semifinal leg kedua AFF Suzuki Cup 2010 di Stadion Utama Gelora Bung Karno Jakarta, Minggu (19/12).

Kapoldasu Minta Penyidik Tangani Korupsi Seperti KPK

Gol tunggal kemenangan Garuda Merah Putih kembali dicetak Cristian ‘El Loco’ Gonzales menit 43. Itu merupakan sumbangan nyata striker naturalisasi asal Uruguay, yang juga menjadi pahlawan kemenangan saat menang 1-0 pada leg pertama di GBK, Rabu lalu. Berkat sang Super Star, Indonesia lolos ke final agregat 2-0 untuk berjumpa lagi dengan Malaysia pada partai puncak. Sebelumnya Malaysia telah dibantai pasukan Alfred Riedl 5-1 pada pertandingan perta-

MEDAN (Waspada): Penanganan kasus-kasus korupsi idealnya seperti dilakukan Komisi Pemberantasan Korupsi (KPK). Dimulai dengan penelitian, penyelidikan, penyidikan, kemudian penuntutan. Kapolda Sumut Irjen Pol. Oegroseno mengatakan itu menjawab wartawan, Minggu (19/12), terkait penanganan kasus-kasus korupsi oleh penyidik Satuan III/Tindak Pidana Korupsi (Tipikor) Polda Sumut selama 2010 yang ter-

ma babak penyisihan Grup A. Indonesia tiga kali menembus final pada 2000, 2002 dan 2004. Malaysia yang sudah lebih dulu melaju dengan menyingkirkan Vietnam, terakhir melangkah ke final pada 1996 dan dikalahkan Thailand 0-1. Gonzales selain jadi pahlawan kemenangan Merah Putih juga berpeluang menjadi top skor AFF Cup. Memiliki skill di atas rata-rata, Gonzales dikenal sangat oportunis memanfaatkan peluang sekecil apapun. Lanjut ke hal A2 kol. 5

Lagi, 67 Gajah Ngamuk Waspada, Minggu (19/12) mengatakan, amukan gajah dalam skala besar kembali terjadi diwilayah kerjanya. Berdasarkan laporan yang diterima dari masyarakat, kawanan gajah yang terbagi dalam 4 kelompok besar kembali merubuhkan 4 unit rumah di kawasan Singah Mulo, Dusun Ketibung, Desa Ketibung Musara. Selain merubuhkan dan memakan isi rumah seperti gabah di karung, aksi gangguan gajah tersebut juga ikut mengobrak-abrik lahan pertanian penduduk, seperti tanaman palawija, padi, coklat, Lanjut ke hal A2 kol. 6

Polisi Harus Tegas Terhadap Anggotanya Yang Korupsi Waspada/Surya Efendi

NONTON BARENG: Ratusan warga bersama pendukung fanatik PSMS Medan menyaksikan pertandingan semifinal leg kedua antara Indonesia melawan Filipina, Minggu (19/12) malam. Mereka menyaksikan nonton bareng di pinggir jalan simpang empat Jl. Brigjend Katamso dan Jl. Pemuda dekat kantor Waspada Medan.

SMeCK Holigan Konvoi Rayakan Kemenangan MEDAN (Waspada): Ratusan SMeCK Holigan melakukan konvoi keliling Kota Medan merayakan kemenangan tim nasional Indonesia setelah menundukkan Filipina di semifinal Piala AFF dengan skor 1-0 dan memastikan diri melaju ke babak Final. Dalam aksi konvoi dengan start Jalan Brigjen Katamso Medan tersebut, ratusan SMeCK Holigan mengendarai sepeda motor dan satu unit mobil pick up menuju Lapangan

Hargamu Di Depan Tuhan

Lanjut ke hal A2 kol. 6

Merdeka Medan dan kemudian berputar-putar Kota Medan. Selain bernyanyi meluapkan kegembiraan diiringi dentuman drum band, mereka juga mengibarkan bendera merah putih dan bendera SMeCK Holigan. “Kompoi ini untuk merayakan kemenangan Indonesia melawan Filipina di semi final Piala AFF 2010 dengan Lanjut ke hal A2 kol. 1

JAKARTA (Waspada): Pegawai di lingkungan Kepolisian Republik Indonesia segera menikmati tunjangan kinerja atau remunerasi. Sesuai dengan Peraturan Presiden Nomor 73 Tahun 2010, pemerintah telah memutuskan pemberian remunerasi bagi pegawai di lingkungan Korps Bhayangkara tersebut. Anggota Komisi Kepolisian Nasional (Kompolnas) Ronny Lihawa mengatakan, dengan remunerasi itu, Polri tak boleh memberikan toleransi kepada anggotanya yang masih melakukan praktek menyimpang,

Sintua GKPS P. Tongah Tewas Dibunuh

LENTERA Oleh: Prof Dr Syahrin Harahap, MA HAMPIR tidak perlu dipertanyakan; apakah seorang manusia dimuliakan atau tidak oleh Allah, sebab Allah sendiri yang menyatakan bahwa Dia memuliakan anak manusia. (Walaqad karramnâ banÎ âdam Q.S.17/al-Isrâ: 70). Juga tidak perlu dipertanyakan; apakah Allah menyayangi manusia sebab Allah sendiri adalah Tuhan Yang Maha Pengasih lagi Maha Penyayang.( arrahmân arrahim). Namun, manusia yang dimuliakan dan disayangi Allah itu ternyata lebih sering mencari penghormatan dan kasih sayang dari manusia. Banyak orang menundukkan kepala kepadanya saat dia mendatangi atau berpapasan dengan

Lanjut ke hal A2 kol. 3

Dapat Tunjangan Kinerja

Rumah Dan Perkebunan Porak-poranda LOKOP, Aceh Timur (Waspada): Tidak kurang dari 67 ekor gajah liar kembali mengamuk di sejumlah desa dalam wilayah Lokop, Kecamatan Serbajadi, Kab. Aceh Timur, Provinsi Aceh. Akibatnya, beberapa rumah hancur. Selain itu, lebih dari 10 hektar areal perkebunan dan perkebunan lenyap diamuk satwa liar tersebut yang telah bersarang disana lebih sepekan. Puluhan Kepala Keluarga (KK) yang sebelumnya mengungsi ke desa tetangga, kini terpaksa kembali mengungsi ke rumah famili. Geuchik Ketibung Musara, Bukhari Muslim MH, kepada

kesan jalan di tempat. Karena itu, Kapolda meminta penyidik Tipikor dalam menanggani kasus korupsi meniru konsep KPK. “Kalau saya maunya seperti dilakukan KPK,” ujar Oegroseno. Dia menjelaskan, sebelum melakukan penyidikan harus dilakukan penyelidikan dan penelitian. Kemudian, diperdalam oleh penyidik. “Jika penyidikan sudah cukup kuat, jangan mundur lagi,” tandasnya.

Waspada/Muhammad H. Ishak

SETIAP hari ribuan pelamar CPNS memadati halaman Setdakab Aceh Timur di Idi. Foto diambil pekan lalu.

CPNS Aceh Timur Membludak, Pendaftaran Ditutup Mendadak IDI RAYEUK, Aceh Timur (Waspada): Pendaftaran CPNS (Calon Pegawai Negeri Sipil) Formasi Umum Tahun 2010 di Kab. Aceh Timur, Provinsi Aceh ditutup mendadak sebelum jadwal penutupan berakhir, Senin (20/12). Lanjut ke hal A2 kol. 2

P E M ATA N G S I A N TA R (Waspada): Seorang pria, sintua gereja GKPS Joniardin Purba, 48, warga Pangkalan Tongah, Nagori Bangun Pane, Kec. Dolok Pardamean, Kab. Simalungun ditemukan tewas dengan tubuh berlumuran darah dari bekas luka tusukan benda tajam di bagian perut dua liang dan ketiak kiri satu liang di Pangkalan Tonga, Minggu (19/12) pukul 02:00 dinihari. Keterangan dihimpun menyebutkan, korban diduga dibunuh warganya sendiri MM. Belum jelas diketahui motif pembunuhan itu, namun menurut keterangan sementara yang diperoleh menyebutkan, hanya masalah Lanjut ke hal A2 kol. 2

Waspada/ME Ginting

RIBUAN umat Islam larut dalam dzikir dan doa di Lapangan Merdeka Medan, Minggu (19/12).

Ribuan Umat Islam Zikir Dan Doa Sambut 1 Muharram MEDAN (Waspada): Ribuan umat Islam dari berbagai penjuru Kota Medan dan daerah lainnya larut dalam zikir dan doa di Lapangan Merdeka Medan dalam rangka memperingati Tahun Baru Islam 1 Muharram 1432 Hijriyah, Minggu (19/12). Lanjut ke hal A2 kol. 3

terutama korupsi. “Polri harus lebih tegas, tidak boleh memberikan toleransi kepada anggotanya yang masih melakukan praktek pungutan liar maupun korupsi,” kata Ronny saat dihubungi Minggu (19/12). Menurut Ronny, sebenarnya tak ada hubungan langsung antara pemberian remunerasi dengan pengurangan perilaku korupsi di sebuah lembaga. “Coba saja, lembaga yang sudah menerapkan remunerasi juga masih banyak melakukan korupsi,” kata dia. Ronny sendiri menilai, pengertian remunerasi di lingkungan Polri ini sebagai langkah wajar dari pemerintah. “Ini hanya salah satu bentuk upaya dari pemerintah untuk meningkatkan kesejahteraan anggota polisi dan pegawai di lingkungan Kepolisian.” Kompolnas sendiri, lanjut Ronny, akan berupaya meningkatkan pengawasan terhadap lembaga Kepolisian. Selain itu, kata dia, Kompolnas meminta masyarakat semakin meningkatkan control kepada Kepolisian.

Lanjut ke hal A2 kol. 1

erampang Seramp ang - Gol jaleh Gonzales - He...he...he...

Medan 24-32 C

P.Sidimpuan 19-30 C

R.Prapat 24-32 0C

Penyabungan 19-29 0C

Berastagi 18-27 0C Berawan


Sibolga 22-29 0C Hujan guntur

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca 0

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

SENIN, Pahing, 20 Desember 2010/14 Muharram 1432 H  z No: 23362 * Tahun Ke-64

Terbit 24 Halaman (A1-8, B1-8. C1-8)  z Harga Eceran: Rp 2.500,-


Terdakwa SS Tertangkap Lagi Ketika Pesta SS TAKENGEN ( Waspada): Yus, 38, penduduk Dusun Sara Rasa, Kampung Keramat Mupakat, Kecamatan Bebesen, Aceh Tengah, terdakwa kasus sabu-sabu (SS) tertangkap lagi oleh petugas Polres Aceh Tengah saat sedang pesta sabu. Saat digerebek di kediamannya, ditemukan barang bukti 17 paket sabu dan 1,5 ons ganja kering siap edar. Se-

dangkan status tersangka sudah menjadi terdakwa di Pengadilan Negeri Takengen juga dalam kasus sabu, namun belum berketetapan hukum. Kapolres Aceh Tengah, AKBP Edwin Rahmat Adikusumo, didampingi Kasat Narkoba, kepada Waspada, Minggu (19/12) membenarkan pihaknya menangkap tersangka. Lanjut ke hal A2 kol 2

67 Gajah Ngamuk Hancurkan Rumah Dan Perkebunan L O K O P, A c e h T i m u r (Waspada): Tidak kurang dari 67 ekor gajah liar kembali mengamuk di sejumlah desa dalam wilayah Lokop, Kecamatan Serbajadi, Kab. Aceh Timur, Provinsi Aceh. Akibatnya, beberapa rumah hancur. Selain itu, lebih dari 10 hektar areal perkebunan dan perkebunan lenyap diamuk satwa liar tersebut yang telah bersarang disana lebih sepekan. Puluhan Kepala Ke-

luarga (KK) yang sebelumnya mengungsi ke desa tetangga, kini terpaksa kembali mengungsi ke rumah famili. Geuchik Ketibung Musara, Bukhari Muslim MH, kepada Waspada, Minggu (19/12) mengatakan, amukan gajah dalam skala besar kembali terjadi diwilayah kerjanya. Berdasarkan laporan yang diterima dari masyarakat, Lanjut ke hal A2 kol 2

Hargamu Di Depan Tuhan


SELEBRASI EL LOCO. Pahlawan sukses Indonesia Cristian ‘El Loco’ Gonzales (kiri) berlari merayakan golnya ke gawang Filipina dengan rekannya Firman Utina di Stadion Utama Gelora Bung Karno Senayan, Jakarta, Minggu (19/12) malam. JAKARTA (Waspada): Indonesia mengatasi Filipina 1-0 pada nasi babak pertama serta beberapa kali mencoba meneror partai semifinal leg kedua AFF Suzuki Cup 2010 di Stadion gawang tamu melalui duet baru El Loco dan Yongki. Utama Gelora Bung Karno Jakarta, Minggu (19/12). Menit 10 tercipta peluang lewat kaki El Loco yang Gol tunggal kemenangan Garuda Merah Putih kembali mendapat umpan terobosan, namun masih mampu dicetak Cristian ‘El Loco’ Gonzales menit 43. Itu merupakan diamankan kiper Filipina Neil Leonard Dula. sumbangan nyata striker naturalisasi asal Uruguay, yang Berselang sepuluh menit, suami Eva Siregar itu mendapat juga menjadi pahlawan kemenangan saat menang 1-0 pada umpan matang dari tengah, namun tandukannya masih leg pertama di GBK, Rabu lalu. terlalu lemah. Demikian juga saat terjadi kemelut di gawang Berkat El Loco, Indonesia lolos ke final dengan agregat Filipina menit 21. 2-0 untuk berjumpa lagi dengan Malaysia pada partai puncak. Menit 33, satu peluang kembali dibangun Indonesia lewat Sebelumnya Malaysia telah dibantai pasukan Alfred Riedl kaki M Nasuha dan dilanjutkan Oktovianus Maniani, namun 5-1 pada pertandingan pertama babak penyisihan Grup A. masih melebar ke atas gawang Filipina. Termasuk tenIndonesia tiga kali menembus final pada 2000, 2002 dangan M Ridwan yang mendapat umpan dari Firman Utina dan 2004. Malaysia yang sudah lebih dulu melaju dengan menit 38. menyingkirkan Vietnam, Baru menit 43 Indoneterakhir melangkah ke final sia membuka keunggulanpada 1996 dan dikalahkan nya melalui tendangan jaThailand 0-1. rak jauh dari El Loco. Skor Melawan Filipina tadi 1-0 bertahan hingga bumalam, Riedl mengubah baran, kendati kedua tim JAKARTA (Waspada): Puluhan ribu penonton memasedikit formasi dengan terus saling menekan di hadati Gelora Bung Karno dalam pertandingan semifinal memasukkan striker Yongki dapan lebih 80 ribu penonleg kedua Piala ASEAN Football Federation antara IndoAriwibowo dan mencaton yang memadati GBOK. nesia - Filipina, Minggu (19/12). dangkan Irfan Bachdim. Kemenangan itu diNamun membludaknya penonton yang memadati Filipina besutan pelatih Sisambut suka cita penduGelora Bung Karno tidak disertai dengan profesionalitas mon Alexander McMenekung Indonesia, sebagian panitia penyelenggara pertandingan. Masih banyak pemy tetap pada formasi di antaranya terus menenonton yang tidak mendapat tempat duduk, padahal meyang sama seperti pada leg riakkan “Hidup El Loco...”. reka memegang tiket. pertama. Lanjut ke hal A2 kol 3 Lanjut ke hal A2 kol 4 Indonesia mendomi-

Tiket Kacau, Penonton VIP Terpaksa Berdiri

Pelamar CPNS Membludak, Pendaftaran Ditutup Mendadak IDI RAYEUK, Aceh Timur (Waspada): Pendaftaran CPNS (Calon Pegawai Negeri Sipil) Formasi Umum Tahun 2010 di Kab. Aceh Timur, Provinsi Aceh ditutup mendadak sebelum jadwal penutupan berakhir, Senin (20/12). Penutupan dilakukan

Pemkab menyusul membludaknya pelamar dari sejumlah kabupaten/kota di Aceh, untuk merebut 227 formasi. Pelamar tidak hanya dari luar Aceh Timur, seperti Aceh Utara, Kota Lhokseumawe dan beberapa kabupaten/kota lainnya, namun juga dari

Sumatera Utara. “Setelah kami lihat pelamar mencapai 10.300 lebih, akhirnya setelah berkoordinasi kami menyatakan pendaftaran ditutup, Jumat (17/12)— lebih cepat 3 hari—sebelum jadwal yang ditetapkan sebelumnya, Senin (20/12),” ung-

kap Kepala Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Kab. Aceh Timur, Bustami, SH kepada Waspada, Minggu (19/12). Menurut Bustami, alasan lain yakni tidak mampunya Lanjut ke hal A2 kol 4

Oleh: Prof Dr Syahrin Harahap, MA

Kapoldasu Harapkan Senjata Api Tidak Miliki Izin Diserahkan MEDAN (Antara): Kapolda Sumatera Utara (Kapoldasu) Irjen Pol Oegroseno mengharapkan seluruh pemilik senjata api yang tidak memiliki izin untuk mengembalikannya kepada pihak kepolisian. “Bagi yang menyerahkan secara baik-baik, tidak akan dilakukan pendekatan hukum,” kata Oegroseno usai dialog tentang “Jurnalisme Konflik” di Lapangan Tembak Perbakin

Medan, Minggu (19/12). Pihak kepolisian memperkirakan masih ada senjata api yang tidak berizin masih beredar di Sumatera Utara (Sumut). Sedangkan untuk senjata api berizin, pihak kepolisian dapat melakukan pemantauan penggunaannya karena datanya tersimpan di Lanjut ke hal A2 kol 3

KPK Bergerak Cepat Selidiki Dugaan Suap Di MK JAKARTA (Waspada): Kasus dugaan korupsi yang disebut-sebut menyeret beberapa nama Hakim Mahkamah Konstitusi (MK) akan segera dibuktikan Komisi Pemberantasan Korupsi (KPK). Menurut Wakil Ketua KPK Haryono Umar tidak akan ada pemisahan dalam proses penyelidikan dugaan korupsi di tubuh MK, baik yang dilaporkan tim investigasi dugaan suap di MK yang dipimpin oleh Refly Harun maupun laporan dari Ketua MK Mahfud MD dan sejumlah hakim konstitusi. “Ya keseluruhan laporan akan kami proses,” katanya

saat dihubungi Minggu (19/ 12). Haryono menjelaskan, baru beberapa hari lalu KPK menaikan perkara dugaan suap di MK ke tahap penyelidikan. Hal ini didasarkan pada informasi yang diperoleh dari Direktorat Pengaduan Masyarakat (Dumas). Namun, Haryono enggan merinci informasi apa saja yang sudah didapat oleh Dumas karena masih dalam proses penyelidikan. “Ini masih dalam proses penyelidikan kita tidak boleh menyebutkan,” kilahnya. Lanjut ke hal A2 kol 1

Sintua GKPS Tewas Korban Pembunuhan

HAMPIR tidak perlu dipertanyakan; apakah seorang manusia dimuliakan atau tidak oleh Allah, sebab Allah sendiri yang menyatakan bahwa Dia memuliakan anak manusia. (Walaqad karramnâ banÎ âdam Q.S.17/al-Isrâ’: 70 ). Juga tidak perlu dipertanyakan; apakah Allah menyayangi manusia sebab Allah sendiri adalah Tuhan Yang Maha Pengasih lagi Maha Penyayang. (arrahmân arrahâm). Namun, manusia yang dimuliakan dan disayangi Allah itu ternyata lebih sering mencari penghormatan dan kasih sayang dari manusia. Banyak orang menundukkan kepala kepadanya saat dia mendatangi atau berpapasan dengan orang lain; pintu kenderaannya dibukakan, tasnya diangkatkan, sepatunya pun dibuka dan

Lanjut ke hal A2 kol 2

Waspada/Muhammad H. Ishak

MEMBLUDAK: Setiap hari ribuan pelamar CPNS memadati halaman Setdakab Aceh Timur di Idi. Lebih 10.300 pelamar tercatat menjadi peserta ujian tes. Foto diambil pekan lalu.

P E M ATA N G S I A N TA R ( Waspada): Seorang pria, sintua gereja GKPS Joniardin Purba, 48, warga Pangkalan Tongah, Nagori Bangun Pane, Kecamatan Dolok Pardamean, Kabupaten Simalungun ditemukan tewas dengan tubuh berlumuran darah dari bekas luka tusukan benda tajam di bagian perut dua liang dan ketiak kiri satu liang di Pangkalan Tonga, Minggu (19/12) pukul 02:00 dinihari. Keterangan dihimpun menyebutkan, korban diduga dibunuh warganya sendiri MM. Belum jelas diketahui motif pembunuhan itu, namun menurut keterangan sementara yang diperoleh menyebutkan, hanya masalah sepele yang kemudian saat

bertemu di tempat kejadian, terjadi pertengkaran antara korban dengan MM dan berakhir dengan pembunuhan. Pihak Polsek Dolok Pardamean yang menerima informasi tentang pembunuhan itu mendatangi lokasi kejadian dan melakukan penyelidikan Lanjut ke hal A2 kol 1

Serampang - Bonus bakal mengalir .... - He.... he....he....

Berita Utama


WASPADA Senin 20 Desember 2010

Dapat Tunjangan Kinerja Polisi Harus Tegas Terhadap

Irigasi Batang Ilung Rusak, Musim Tanam Di Paluta Terancam Gagal

JAKARTA (Waspada): Pegawai di lingkungan Kepolisian Republik Indonesia segera menikmati tunjangan kinerja atau remunerasi. Sesuai dengan Peraturan Presiden Nomor 73 Tahun 2010, pemerintah telah memutuskan pemberian remunerasi bagi pegawai di lingkungan Korps Bhayangkara tersebut. Anggota Komisi Kepolisian Nasional (Kompolnas) Ronny Lihawa mengatakan, dengan remunerasi itu, Polri tak boleh memberikan toleransi kepada anggotanya yang masih melakukan praktek menyimpang, terutama korupsi. “Polri harus lebih tegas, tidak boleh memberikan toleransi kepada anggotanya yang masih melakukan praktek pungutan liar maupun korupsi,” kata Ronny saat dihubungi Minggu (19/12). Menurut Ronny, sebenarnya tak ada hubungan langsung antara pemberian remunerasi dengan pengurangan perilaku korupsi di sebuah lembaga. “Coba saja, lembaga yang sudah menerapkan remunerasi juga masih banyak melakukan korupsi,” kata dia.

GUNUNGTUA (Waspada): Saluran irigasi Batang Ilung rusak, akibatnya 2.500 hektare lahan persawahan di Kec. Padangbolak dan Portibi, Kabupaten Padanglawas Utara, terancam musim tanamnya. “Akibat banyaknya saluran irigasi yang bocor dan mendangkalnya irigasi Batang Ilung membuat petani waswas,” ujar Ketua Komisi II DPRD Padanglawas Utara, Gu s m a n Ef f e n d i Sire g a r kepada Waspada, Mingu, (19/ 12) di Gunungtua. Kondisi irigasi yang kini mengalami pendangkalan akibat mengendapnya tanah dan saluran pengairan irigasi yang jebol di banyak titik, menjadi pemicu utama tidak tersalurnya air ke persawahan. Menurut Gusman, persawahan mulai dari Padang Bolak hingga ke Portibi musim

Anggotanya Yang Korupsi

Ronny sendiri menilai, pengertian remunerasi di lingkungan Polri ini sebagai langkah wajar dari pemerintah. “Ini hanya salah satu bentuk upaya dari pemerintah untuk meningkatkan kesejahteraan anggota polisi dan pegawai di lingkungan Kepolisian.” Kompolnas sendiri, lanjut Ronny, akan berupaya meningkatkan pengawasan terhadap lembaga Kepolisian. Selain itu, kata dia, Kompolnas meminta masyarakat semakin meningkatkan control kepada Kepolisian. “Masyarakat jangan takuttakut lagi melaporkan penyimpangan yang mereka temukan. Kami siap membantu untuk membangun lembaga Kepolisian yang bersih,” Ronny menambahkan. Remunerasi itu akan diberikan awal 2011 mendatang. Tunjangan itu diberikan dalam 18 kelas jabatan sesuai dengan kepangkatan. Namun, hingga kini, Polri belum menentukan kepangkatan apa saja yang akan berada dalam kelah-kelas jabatan tersebut. (vivanews)

Anas: Bocoran WikiLeaks Bukan Momok Menakutkan JAKARTA (Waspada): Partai Demokrat (PD) menilai bocoran dokumen diplomat mengenai Indonesia yang disampaikan situs WikiLeaks tidak perlu dianggap sebagai momok yang menakutkan. Pasalnya informasi yang disampaikan oleh diplomat Amerika Serikat itu hanya merupakan persepsi pribadi dari mereka. “Kan itu belum tentu yang senyatanya, karena itu persepsi kan,” kata Ketua Umum Partai Demokrat Anas Urbaningrum di Warung Tegal Sunda

Kelapa, Jakarta, Minggu (19/12). Menurut Anas, pemerintah sebetulnya tinggal memberikan klarifikasi jika informasi yang disampaikan Wiki Leaks dalam situsnya mengandung informasi tidak benar dan tidak mengenakan. Anas menganggap fenomena bocoran informasi melalui WikiLeaks ini harus ditinjau sebagai sebuah pesan moral politik. Pesan itu menunjukkan bahwa tidak ada kebijakan politik yang bisa disembunyikan dari masyarakat. (vivanews)

KPK Bergerak ....

Bupati Bengkulu Dirwan Mahmud, enggan berkomentar banyak terkait hal ini. “Semuanya saya serahkan kepada ketua MK (Mahfud MD). Saya rasa itu langkah institusi untuk melaporkan dugaan korupsi, hakim tidak baik (berkomentar),” katanya Minggu (19/12). Dia juga mengaku belum tahu, apakah perkara yang dinaikkan ke tahap penyelidikan itu kasus yang menyeret namanya atau bukan. Hanya saja, dia berjanji akan mengikuti langkah-langkah hukum yang diambil oleh Ketua MK. “Saya juga tidak tahu mekanisme di KPK seperti apa,” jelasnya. (okz)

Ditanya soal kapan pemeriksaan akan dilakukan, Haryono enggan menjelaskan. Kendati demikian dia berjanji proses penyelidikan untuk membuktikan ada atau tidak dugaan korupsi ditubuh MK akan secepat mungkin dilakukan. “Tidak ada jangka waktu. Pokoknya prosesnya akan sampai selesai,” katanya. Sementara Hakim Konstitusi M Arsyad Sanusi yang disebut-sebut menerima sejumlah uang dari mantan calon

Sintua GKPS ....

serta mengamankan MM yang diduga tersangka pelaku pembunuhan itu. Sedang mayat korban dibawa ke RSUD Dr Djasamen Saragih Kota Pematangsiantar guna keperluan visum. Kapolres Simalungun AKBP Marzuki saat dikonfirmasi melalui Kasubbag Humas Iptu Sulaiman Simanjuntak, Kasat Reskrim AKP Nasrun Pasaribu menyebutkan, kasus dugaan pembunuhan itu masih dalam penyelidikan pihak Polsek Dolok Pardamean bekerjasama dengan Sat Reskrim Polres. (a14)

Tiket Kacau ....

Hidup El Loco ....

Tu r u t m e n d a m p i n g i P re s i d e n Yu d h oy o n o d i antaranya Mennegpora Andi Ma la ra ng e ng d a n Ke tua Umum PSSI Nurdin Halid. Juga sejumlah tokoh nasional antara lain Ketua DPR RI Marzuki Alie, Ketua DPD

Beberapa penonton mengaku memegang tiket VIP di tribun barat. Tapi karena tempat duduk sudah dipadati penonton lain, mereka kemudian diarahkan panitia ke tribun media. Di antara penonton yang tidak kebagian tiket terlihat pula sejumlah artis. Mereka antara lain Julia Perez yang datang bersama pasangannya Gaston Castano, Manohara, dan Cici Paramida. Tapi tidak semuanya yang diarahkan ke tribun media mer upakan pengunjung dengan tiket. Salah seorang pengunjung bahkan mengaku datang bersama rombongan menteri. “S a y a b e r s a m a r o m bongan menteri. Tapi itu juga ada keluarga menteri. Kalau mereka memegang tiket VIP,” kata pengunjung yang tidak mau disebut namanya itu. (vivanews)

Presiden Susilo Bambang Yudhoyono juga sumringah dengan sukses skuad Riedl. Presiden duduk di ruang VVIP Stadion Utama GBK dengan mengenakan kemeja berwarna merah-putih.

Kapoldasu ....

“Sampaikan informasinya, akan kita amankan semua,” kata Kapolda. Mantan Kepala Divisi Profesi dan Pengamanan (Propam) Polri itu menyatakan, kemungkinan adanya kelompok garis keras yang memiliki senjata masih ada, meski kelompok terkeras telah dilumpuhkan di kawasan Dolok Masihul, Kabupaten Serdang Bedagai. “Kalau ada lagi kelompok yang menggunakan senjata api, penegakan hukum akan terus dilakukan,” katanya. Tak Ada Laporan Punculikan Kapolsu juga mengatakan, pihak kepolisian di Sumatera Utara belum pernah menerima laporan dari masyarakat

yang menjadi korban tindak penculikan anak, meski isu kejahatan itu telah menyebar. “Sampai sekarang belum ada yang melapor,” kata Irjen Pol Oegroseno. Kapolda mengatakan, isu penculikan anak tersebut tergolong teror yang disebarkan pihak-pihak yang tidak bertanggung jawab untuk menimbulkan keresahan masyarakat. Namun pihaknya cukup kesulitan untuk melacak penyebar isu yang meresahkan tersebut karena murahnya penggunaan telekomunikasi saat ini. Mungkin saja, kata Kapolda, pelaku yang tidak bertanggung jawab langsung membuang kartu telefon genggam

Direktorat Intelijen Polda Sumut. Untuk mencegah terjadinya hal-hal yang tidak diinginkan atau praktik penyelahgunaan, pihak kepolisian mengharapkan senjata api yang tidak memiliki izin tersebut diserahkan. Pihak kepolisian di Sumut tidak akan menindak pihakpihak yang menyerahkan senjata api tanpa izin tersebut secara baik-baik. Namun meski imbauan itu disampaikan, pihak kepolisian juga mengharapkan partisipasi masyarakat untuk menyampaikan informasi jika mengetahui keberadaan atau penggunaan senjata api oleh pihak-pihak tertentu.

Pelamar CPNS ....

1. ......, 0-0-0+.

ingat Allah maka Allah akan mengingatmu.(Q.S. 2/alBaqarah: 152). Jika kamu menolong Allah maka Dia akan menolongmu.(Q.S. 43/Muhammad:7). Itulah sebabnya kita diminta untuk selalu berdoa dan menyampaikan harapan agar posisioning diri kita berada tempat yang layak di hadapan Tuhan dan di hadapan manusia. Allahummaj ‘alnÎ syukûra,waj’alnÎ syabûra,waj’alnÎ fÎ ainÎ shagÎra wafÎ a’yuninnâsi kabÎro (Ya Allah, jadikanlah aku manusia yang bersyukur, manusia yang bersabar, jadikanlah aku didalam pandanganku kecil, namun agung di depan pandangan orang lain. Wa allahu a’lam bi al-shawab. ****

daerah menambah anggaran untuk proses test CPNS, di mana target sebelumnya hanya 7.500 hingga 10.000 pelamar. “Proses tes sudah diakhir tahun, jadi untuk penambahan anggaran mustahil, lebih-lebih APBK-P sudah diparipurnakan,” sebutnya. Bustami merinci, anggaran sebelumnya yang diprogramkan untuk mencetak soal tes Rp150.000.000. “Jika pelamar lebih 10.000 orang, maka segala sesuatu lainnya, baik soal dan pengawas ujian, akan terhutang. Sehingga kami putuskan untuk menutup pendaftaran lebih cepat,” ujar Bustami. Dia menyebutkan, meski rekap akhir secara rinci ma-

sing-masing formasi yang dibuka belum selesai, tetapi pihaknya secara umum melihat, pelamar yang mendominasi formasi tahun ini yakni, formasi tenaga pendidikan dan tenaga kesehatan. “Guru dan kesehatan paling banyak pelamar,” imbuhnya. Mengenai bagaimana jika masih ada pelamar yang berdatangan—Senin hari ini—ke Pendopo Idi, Bustami menegaskan, surat edaran telah ditempel di lokasi pendaftaran di Sekretariat Daerah Pemkab Aceh Timur di Idi, di mana pendaftaran ditutup lebih cepat. “Berhubung pelamar melebihi target dan anggaran yang terbatas, dan soal tes juga harus dibeli di Banda Aceh, maka pendaftara ditutup,” jelasnya. (cmad)

2. Ke2, BxK+.

67 Gajah Ngamuk ....

yakni milik Hasbi, 35, dan milik Mukim Bunin, Muhammad Piyah. Selain rumah dan isinya, 4 hektar areal perkebunan ikut lenyap. “Puluhan gajah masih bersarang di kawasan itu, bahkan amukannya terus terjadi tanpa pandang siang dan malam,” katanya. Ekses dari mengganasnya puluhan gajah di sana, lanjut Geuchik Bukhari, pihaknya telah meminta warga yang berdekatan dengan pemukiman yang telah menjadi sarang gajah, untuk mengungsi dan menginap di tempat yang lebih aman, baik di meunasah maupun di rumah familinya. “Masyarakat kita sangat

khawatir dengan aksi gajah di pedalaman Aceh Timur, bahkan warga terus berjaga-jaga malam hari menggunakan obor dan meriam bambu,” kata Bukhari seraya meminta instansi terkait turun ke lapangan mengusir satwa liar yang kian mengganas di pemukiman penduduk itu. Sementara Kepala Dinas Kehutanan dan Perkebunan Aceh Timur, Saifuddin, SE, M.AP, kepada Waspada, Minggu (19/12), juga membenarkan aksi gajah kian merajalela di wilayah pedalaman kabupaten setempat. Namun mengingat anggaran terbatas, pihaknya tak mampu berbuat ba-

nyak mengatasi amukan gajah, kecuali hanya sebatas melaporkannya ke Dinas Kehutanan dan Perkebunan Aceh di Banda Aceh. Selain itu pihaknya juga melaporkan setiap perkembangan di Aceh Timur—terkait amukan gajah—ke Balai Konservasi Sumber Daya Alam (BKSDA) di Banda Aceh. “Gajahnya ngamuk karena habitatnya diganggu, karena itu kita minta masyarakat yang selama ini telah masuk ke habitat gajah dengan berbagai aksi, segera ke luar mencari tempat lain yang jauh dari sarang binatang berbelalai itu,” pinta Saifuddin.(cmad)

Tersangka SS ....

Kanit Tipikor Polres Aceh Tengah, sudah membuat laporan ke Polres dan mengirim surat ke Mahkamah Agung serta Komisi Yudisial, tentang dugaan adanya mafia peradilan di PN Takengen. Salah satu point yang dilaporkan Zega, adalah persidangan terdakwa Yus dalam kasus narkoba sebelumnya, yang dialihkan penahanannya oleh hakim bahkan dibebaskan berkeliaran. Akhirnya, Yus yang di’bebaskan’ majelis hakim Pengadilan Negeri Takengen itu

sebelum divonis, kembali ditangkap polisi dalam kasus yang sama. Polisi kembali menemukan barang bukti sabu seberat 10 gram dan ganja kering 1,5 ons dari tersangka. Selain kasus Yus tersebut, ada lima kasus lainnya yang dilaporkan Zega tentang dugaan mafia di PN Takengen. Zega membeberkan adanya permainan uang dalam menangani perkara di PN Takengen. Sedangkan Humas PN Takengen, T. Sarapi, SH. MH, ketika dikonfirmasi Waspada

seputar adanya laporan Zega, mengelak untuk memberi keterangan dan menyarankan agar menemui langsung ketua pengadilan. Tapi Moch. Ali, SH. MH, ketika Waspada mintai keterangan justru menyerahkannya kepada Hakim Ade Satriawan, SH untuk memberi penjelasan soal isi surat Zega, di mana hakim ini pun membantah keterangan Zega. Namun dia tidak menjelaskan secara rinci bantahannya terhadap laporan Kasmudin Zega itu. (b18)

Jawaban Problem Catur:

3. Rc1, Bc2+. 4. Rd1, Ge2+. 5. BxG, Bc1+mat.

Jawaban TTS: TTS Topik

Umum/Satwa Air




Jawaban Sudoku: 3 1 6 5 8 9 2 4 7

7 9 5 4 3 2 8 6 1

9 2 8 6 1 7 4 5 3

4 5 7 3 2 8 6 1 9

1 6 3 9 4 5 7 2 8

5 8 4 2 9 3 1 7 6

6 3 9 1 7 4 5 8 2

2 7 1 8 5 6 3 9 4

kawanan gajah yang terbagi dalam 4 kelompok besar kembali merubuhkan 4 unit rumah di kawasan Singah Mulo, Dusun Ketibung, Desa Ketibung Musara. Selain merubuhkan dan memakan isi rumah seperti gabah di karung, aksi gangguan gajah tersebut juga ikut mengobrak-abrik lahan pertanian penduduk, seperti tanaman palawija, padi, coklat, pisang dan pinang. “Sementara di areal perkebunan, gajah juga mematahkan tanaman kepala sawit,” sebut Bukhari Muslim. Geuchik Bukhari menyebut, rumah yang dihancurkan

“Sedang kita periksa untuk pengembangan. Soal sebelumnya sudah disidangkan di Pengadilan Negeri Takengen, apakah sudah divonis atau belum, itu bukan wewenang saya memberi keterangan,” kata Kapolres. Menurut Kapolres, dari pengembangan dan kasus yang ditangani pihaknya selama ini, ternyata kejahatan narkotika jenis ganja, termasuk tinggi di Aceh Tengah. Sementara itu, sebelumnya Bripka Kasmuddin Zega,

Irman Gusman, Ketua Umum Par tai Demokrat Anas Urbaningrum, Ketua Umum DPP Partai Golkar Aburizal Bakrie, dan Menteri Koordinator Kesejahteraan Rakyat Agung Laksono. (m15/ant)


disimpankan. Saat orang lain memberi sambutan ia selalu dipuja dan dibanggakan. Untuk mengetahui seberapa penting kita di hadapan Tuhan, kita dapat bertanya pada diri sendiri; seberapa penting Tuhan bagi kita dalam kehidupan. Apakah Dia kita butuhkan dalam pekerjaan; apakah bantuannya kita harapkan untuk mencapai kesuksesan, apakah Tuhan masih kita ingat saat mencapai keberhasilan-keberhasilan. Atau kita selalu merasa cukup dan tidak pernah butuh pada tuhan. (Q.S 93/al-Layl:8). Bagaimana kita memposisikan Tuhan, kurang lebih seperti itulah Tuhan memposisikan kita. Jika kamu meng-

TTS Dan Sudoku Dari Halaman Sport.

Maisaroh, petani di persawahan Tobat, Padang Bolak mengaku tidak dapat menanami sawahnya. Air dari irigasi Batang Ilung tidak dapat mengairi sawahnya. Hal yang sama diungkapkan Firman Harahap, petani di Desa Gunung Baringin, Portibi. Jebolnya saluran irigasi menjadi penyebab utama tidak cukupnya air ke sawah. “Penghasilan satu-satunya adalah bersawah. Umur padi yang masih beberapa minggu kita tanam sudah menguning. Kemungkinan panen kita pada musim tanam ini turun drastis,’’ sebut Firman. Kini, petani rakyat miskin ini hanya dapat berharap kepada semua pihak yang terkait, khususnya pengairan provinsi agar irigasi Batang Ilung benarbenar berfungsi dan bermanfaatkan bagi ma-syarakat. (csp)

PULUHAN ribu penonton memadati Gelora Bung Karno dalam pertandingan semifinal leg kedua Piala ASEAN Football Federation antara Indonesia - Filipina, Minggu (19/12).

Hargamu ....

Jawaban Problem Catur,

8 4 2 7 6 1 9 3 5

Waspada/Sori Parlah Harahap

SALURAN irigasi Batang Ilung rusak, akibatnya seluas 2.500 hektare lahan persawahan di Kec. Padang Bolak dan Portibi, Kab. Padanglawas Utara, musim tanamnya bakal terancam gagal.

ini bakal tidak dapat termanfaatkan seperti biasa. Swasembada pangan tidak dapat dipertahankan dan tidak tertutup kemungkinan, petani akan mengalih fungsikan lahannya untuk tanaman lain jika memang tidak dapat dimanfaatkan untuk tanaman padi. Yang lebih dikhawatirkan pendapatan para petani untuk tahun ini akan berkurang. Biasanya mereka mengandalkan persawahan untuk pemenuhan hidup keluarga sehari-hari. Pemerintah Provinsi Sumatera Utara khususnya Dinas Pengairan diminta secepatnya membuat kebijkan mengatasi situasi ini. “Langkah nyata mengatasi persoalan ini harus dilakukan,” kata Gusman. Sementara, pengurus irigasi Batang Ilung saat ini belum dapat dimintai tanggapannya.

yang digunakan setelah menyebarkan isu penculikan tersebut. “Bisa saja mereka membeli HP bekas. HP bekas (second) sekarang kan murah,” katanya. Untuk mengantisipasi halhal yang tidak diinginkan, Oegroseno telah memerintahkan seluruh kapolres dan polisi desa di Sumut untuk memantau perkembangan situasi. Selain itu, seluruh Kapolres dan polisi desa di jajaran Polda Sumut juga diperintahkan untuk menetralisir suasana dan memberikan penjelasan kepada masyarakat mengenai ketidakbenaran isu tersebut. “Isu itu sangat tidak dapat dipertanggungjawabkan,” kata Oegroseno. Menurutnya, Polri itu mengungkapkan, keprihatinan atas tindakan main hakim sendiri yang dilakukan masyarakat terhadap orangorang yang dicurigai sebagai pelaku penculikan. Pihak kepolisian mengharapkan masyarakat dapat menunjukkan kearifan lokal dengan memberlakukan budaya menghormati penegakan hukum dan tidak main sendiri. “Polisi merasa dilematis. Kita tidak suka dengan penculikan tetapi kenapa harus menganiaya orang tanpa bukti yang kuat hanya karena dicurigai,” katanya.


TATO DUKUNG KEISTIMEWAAN DIY. Seorang seniman tato menyelesaikan karya tato bergambar lambang Kraton Yogyakarta, di Benteng Vredeburg, Yogyakarta, Minggu (19/12).

Aksi Tatto Untuk Keistimewaan Yogya YOGYAKARTA (Waspada): Dukungan terhadap keistimewaan Yogyakarta diwujudkan dalam berbagai bentuk. Sekelompok anak muda Yogyakarta, menunjukkan aksinya dengan menggelar aksi di depan Benteng Varderburg. Aksi dengan tema Solidaritas Tatto Indonesia untuk keistimewaan Yogyakarta ini adalah sebagai bentuk dukungan atas keistimewaan Yogyakarta. Java Tattoo Club Yogyakarta menggelar aksi mentatto tubuh mereka dengan gambar keraton dan Puro Pakualaman. Sapto Raharjo yang akrab disapa Atong sebagai Presiden Java Tatto Club mengatakan, acara ini adalah sebagai wujud kepedulian seniman atas keistimewaan Yogyakarta. “Kami berharap keistimewaan tetap dipertahankan. Karena Yogya adalah multikultur,” kata Atong, Minggu 19 Desember 2010. Widi Hasto, Pimpinan Gerakan Rakyat Mataram mengatakan, acara ini merupakan aksi solidaritas seniman tatto atas keistimewaan dan mereka mengekspresikan dukungan keistimewaan dengan cara seperti ini. “Karena mereka nyaman tinggal di Jogja,” ujarnya. Sementara itu, Maria model tatto yang datang dari Magelang, menyatakan “Saya mendukung keistimewaan Yogyakarta dan penetapan dengan menatto tubuh saya dengan lambang Keraton.” Selain itu, Yogi salah satu model yang di Tatto juga menyatakan dukungannya kepada keistimewaan Yogyakarta. (vivanews)

WASPADA Senin 20 Desember 2010

Luar Negeri


PM Abishit: Fokus Reformasi Pada Masalah Kesejahteraan

Lima Warga Jalur Gaza Tewas Dalam Serangan Israel

BANGKOK, Thailand (Antara/TNA-OANA): Rencana reformasi Thailand yang akan difokuskan pada pemecahan masalah sistem kesejahteraan masyarakat, pendidikan dan keadilan adalah hadiah tahun baru kepada rakyat Thailand, kata PM Abhisit Vejjajiva Minggu (19/12). Berbicara dalam pidato mingguan di radio dan televisi, Abhisit mengatakan tentang kemajuan dalam rencana pemerintahannya untuk mengurangi kesenjangan sosial, sehingga kesejahteraan dan masalah yang kurang mampu akan dapat diselesaikan. Perawatan gizi akan ditawarkan kepada ibu hamil dan ibu menyusui sebagai aspek kesejahteraan bagi bayi. Pemerintah akan mendirikan pembibitan di semua kecamatan dan di tempat kerja. Pemerintah juga memperhatikan masalah lahan petani. Kabinet pekan lalu menyetujui pengalihan tanah kepada koperasi Klong Yong. Sebuah Lembaga Bank Administrasi Tanah, dalam bentuk organisasi publik, juga akan dibentuk. Mengenai pendidikan, Abhisit mengatakan, pemerintah telah meletakkan hampir semua strategi untuk menyediakan kesempatan pendidikan bagi anak-anak kurang mampu dan orang lain di daerah terpencil, anak-anak dari keluarga migran, anak-anak cacat, dan lalin-lain. Kesejahteraan guru juga akan ditingkatkan. Mengenai keadilan, pemerintah akan mendukung proyek komunitas keadilan, di mana mekanisme akan diakses masyarakat di komunitas mereka untuk memberikan saran dan menerima keluhan. Ketiga isu itu akan ditindaklanjuti sebagai bagian dari rencana reformasi perdana menteri, yang menganggap sebagai hadiah Tahun Baru untuk publik. Langkah-langkah itu hanya perlu anggaran kecil, dan pemerintah sedang menyelesaikan masalah dalam hal struktur untuk meningkatkan keadilan, serta mengurangi kesenjangan sosial, katanya menambahkan.

KOTA GAZA, Palestina (Antara/AFP): Lima gerilyawan Palestina tewas dalam serangan pesawat tempur Israel terhadap Jalur Gaza, demikian keterangan beberapa sumber Palestina dan militer Israel. Beberapa pesawat tempur Israel menyerang bagian tengah Jalur Gaza untuk mengusir sekelompok pejuang Palestina yang bermaksud menembakkan roket ke wilayah Israel, kata militer Yahudi tersebut Sabtu. Serangan itu adalah salah satu yang paling mematikan sejak agresi 22-hari Israel terhadap daerah yang dikuasai Hamas, Jalur Gaza. Israel menyebut agresi tersebut sebagai Operation Cast Lead, yang dimulai pada penghujung Desember 2008 dan menewaskan 1.400 orang Palestina —kebanyakan warga sipil— serta 13 orang Israel, 10 di antara mereka tentara. Beberapa saksi mata yang dihubungi AFP mengatakan beberapa pria bersenjata yang sedang menyiapkan serangan terhadap Israel diserang oleh pesawat tempur Israel, sementara petugas medis menyatakan lima orang syahid. Serangan udara itu ditujukan ke Deir el-Balah di bagian tengah Jalur Gaza, kata mereka. Dinas keamanan Gerakan Perlawanan Islam (Hamas), yang menguasai Jalur Gaza, mengkonfirmasi lima orang Pales-tina, semuanya berusia 20 tahun, meninggal dalam serangan udara Israel dan dijadwalkan dimakamkan Minggu (19/12). Beberapa saksimata mengatakan pejuang yang tewas tersebut, mantan anggota Hamas, Jihad Islam atau Komite Perlawanan Rakyat, adalah anggota salah satu kelompok Salafi di Jalur Gaza yang baru-baru ini telah meningkatkan serangan terhadap Israel. Militer Israel mengatakan di dalam satu pernyataan satu pesawat tempur “mengidentifikasi dan menyerang satu tim agen gerilyawan yang sedang menyiapkan serangan roket terhadap wilayah Israel dari bagian tengah Jalur Gaza”.

PM China Puji Perjuangan Pakistan Atasi Teror ISLAMABAD, Pakistan (AP): PM ChinaWen Jiabao mengatakan pengorbanan Pakistan dalam perjuangan global terhadap terorisme harus diakui dan dihargai oleh masyarakat internasional. Wen menyatakan komentarnya itu dalam satu pidato di depan Majelis Nasional Pakistan Minggu (19/12), hari terakhir kunjungan kenegaraannya yang terutama difokuskan pada hubungan perdagangan dan bisnis. Wen mengatakan Pakistan berada di garis depan perjuangan menghadapi terorisme dan negara itu telah memberikan ‘pengorbanan besar dan sumbangan penting.’ Dia mengatakan perjuangan itu seharusnya tidak difokuskan pada beberapa agama tertentu, namun ditujukan lebih daripada memberantas ‘faktor akar’ bibit terorisme. Kawasan kesukuan Pakistan merupakan tempat tinggal bagi ribuan militan yang melakukan atau mendukung serangan baik di dalam negeri dan terhadap pasukan Amerika di negara tetangganya. (m10)

Menlu Iran Yang Dipecat Tidak Tahu Dia Akan Disingkirkan TEHERAN, Iran (AP): Menteri Luar Negeri Iran yang barubaru ini dipecat mengatakan kepada satu kantor berita bahwa dia tidak tahu adanya rencana untuk menyingkirkannya dari jabatannya ketika dia meninggalkan posnya menjalankan misi ke barat Afrika. Manouchehr Mottaki mengatakan kepada kantor berita Mehr, dalam satu laporannya yang disiarkan Minggu (19/12), bahwa dia tidak pernah diberitahu tentang pemecatan pada saat berada dalam lawatannya di luar negeri. Mottaki menyebutkan pemecatannya selama menjalankan misinya ke luar negeri ‘tidak diplomatis dan ofensif.’ Sabtu, Mohammad Reza Rahimi, salah seorang dari selusin wakil presiden , mengatakan dalam acara perpisahan dengan Mottaki bahwa menlu itu tahu dia akan digantikan sebelum lawatannya ke Afrika. Ali Akbar Salehi, kepala departemen nuklir, menjadi penjabat menteri luar negeri Sabtu. Keputusan presiden untuk memecat Mottaki menimbulkan pro-kontra di parlemen Iran dan media pekan lalu. (m10)

Obama Terus Desak Ratifikasi Perjanjian Senjata Dengan Rusia WASHINGTON, AS (Antara/Xinhua-OANA): Presiden Amerika Serikat Barack Obama memanfaatkan pidato mingguannya untuk kembali mendesak Senat agar segera menyetujui perjanjian baru mengenai pengawasan senjata dengan Rusia. “Meratifikasi satu perjanjian seperti START bukanlah berarti kemenangan bagi satu pemerintahan atau satu partai politik,” kata Obama Sabtu (18/12). “Itu adalah mengenai keselamatan dan keamanan Amerika Serikat,” tegasnya. Berangkat dari dukungan bipartisan yang memungkinkan masuknya bagian dari tagihan pemotongan pajak Kamis, Obama menyerukan upaya bipartisan memperbarui “prioritas lain nasional yang mendesak” - Strategi baru Perjanjian Pengurangan Senjata (START). Presiden yang menandatangani perjanjian April dengan Presiden Rusia Dmitry Medvedev, menekankan bahwa perjanjian itu akan mengurangi persenjataan nuklir dunia dan “membuat Amerika lebih aman.” Perjanjian itu akan membatasi hulu ledak strategis masingmasing negara nuklir 1.550, turun dari angka tertinggi saat ini 2.200, dan membangun sistem untuk pemantauan dan verifikasi. Inspeksi senjata AS berakhir setahun lalu dengan berakhirnya perjanjian kendali senjata 1991. Sabtu itu adalah kedua kalinya sejak 20 November Obama menggunakan pidato mingguannya, yang umumnya berfokus pada isu-isu domestik, untuk mendorong perjanjian START baru, menggarisbawahi urgensi untuk memandu melalui Senat sebelum liburan.

China Desak Korut Dan Korsel Hentikan Konfrontasi BEIJING, China (Antara/Reuters): Menteri Luar Negeri China Yang Jiechi mendesak Korea Utara dan Korea Selatan agar membuka perundingan dan menghindarkan langkah yang bisa mengobarkan ketegangan di semenanjung. Pernyataan Sabtu itu memperluas upaya Beijing untuk mencegah terjadinya konfrontasi di depan pintu negaranya. Yang mengeluarkan komentar-komentar itu dalam pembicaraan melalui telepon dengan timpalannya dari Rusia Sergei Lavrov, kata laman Kementerian Luar Negeri China (www.mfa. pada Minggu, ketika Dewan Keamanan Perserikatan Bangsa-Bangsa (DK PBB) akan membahas kebuntuan pertikaian antara Korea Utara (Korut) dan Korea Selatan (Korsel). Beijing telah berusaha untuk menghindar terlibat dalam permusuhan sengit antara dua negara tetangga itu, dan Yang mengecam langsung rencana Seoul untuk mengadakan latihan militer dengan senjata tajam atau ancaman Pyongyang untuk membalas jika latihan itu dilaksanakan. Tetapi Menteri Luar Negeri China memperingatkan, bahwa ketegangan di Semenanjung Korea mengkhawatirkan berlangsung di luar kendali dan mengguncang seluruh wilayah. “Situasi di semenanjung tetap tegang dan ada risiko kerusakan lebih lanjut serta peningkatan,” kata Yang kepada Lavrov Sabtu malam, menurut laman Kementerian Luar Negeri. Militer Korsel telah merencanakan latihan selama 18-21 Desember di pulau kecil Yeonpyeong, yang diserang oleh pemboman Korut pada bulan lalu. Tetapi pejabat militer dikutip oleh kantor berita Korsel Yonhap mengatakan, latihan tersebut mungkin tertunda karena kabut dan angin. Dewan Keamanan PBB menyerukan sidang darurat Minggu (19/12) pukul 11:00 waktu setempat (16:00 GMT) untuk membahas ketegangan itu, kata seorang diplomat dewan Sabtu. China dan Rusia adalah salah satu dari lima anggota tetap Dewan Keamanan PBB, bersama dengan AS, Prancis dan Inggris.


UNJUKRASA KUMAT LAGI DI BANGKOK. Para demonstran anti pemerintah Thailand — yang lebih populer dengan sebutan kelompok kaos merah — melancarkan aksinya di distrik perbelanjaan Bangkok, Thailand, Minggu (19/12). Ribuan pemrotes anti-pemerintah berkumpul di Bangkok untuk memperingati tujuh bulan aksi maut militer di lokasi yang sama, yang mereka duduki April sampai Mei lalu. 91 Orang tewas dan sekurang-kurangnya 1.800 lainnya cedera dalam kerusuhan politik paling buruk dalam sejarah modern Thailand.

Taliban Bunuh 10 Orang Tentara Afghanistan KABUL, Afghanistan (AP): Sejumlah militan Taliban menyerang angkatan bersenjata Afghanistan di bagian utara negara itu dan di ibukota menewaskan sedikitnya 10 anggota pasukan keamanan Minggu (19/12), kata para pejabat. Di pinggiran kota Kabul, dua pemberontak yang merekatkan bahan peledak ke tubuhnya menghadang satu bus yang membawa tentara Afghanistan untuk bekerja di jam sibuk pagi hari, menewaskan lima orang, kata jubir Kementrian Pertahanan Jenderal Mohammad Zahir Azimi. Seorang penyerang berhasil meledakkan bahan peledak itu, sementara tentara lain berhasil menembak penyerang lainnya, katanya. Jubir Taliban, Zabiullah Mujahid mengaku bertang-

gungjawab atas serangan itu. Seorang saksi, Hamidullah Khan, mengatakan para penyerang menghadang bus yang tengah dalam perjalanan menuju Jalalabad Road, rute utama menuju pusat kota. “Kenderaan tentara melintasi jalan ini dan kemudian Taliban atau beberapa pemberontak mulai menembaki mereka,” kata Khan. Di Provinsi Kunduz, empat militant menyerang pusat perekrutan tentara Afghanistan di tengah hari, dan sedikitnya

satu di antara mereka berhasil meledakkan bahan peledaknya, kata Wakil Gubernur Provinsi Hamdullah Danishi. 700 Tentara asing tewas Gerilyawan Taliban melancarkan serangan di Kabul dan satu kota penting di utara, Minggu sementara jumlah korban tewas pasukan asing di Afghanistan mencapai 700 personil tahun ini.Peristiwa suram bagi kematian pasukan asing terjadi setela seorang anggota Pasukan Bantuan Keamanan Internasional (ISAF) NATO tewas Sabtu malam akibat sebuah bom pinggir jalan di Afghanistan selatan. ISAF tidak menjelaskan lebih jauh tentang insiden itu. Sejumah 521 tentara asing

tewas tahun 2009, yang sebelumnya merupakan tahun paling berdarah dari perang itu, tetapi operasi-operasi terhadap pemberontakan yang dipimpin Taliban meningkat dalam 18 bulan belakangan ini. Sekitar 2.270 tentara asing tewas sejak pemerintah Taliban di Kabul digulingkan pasukan AfghanistanyangdidukungAmerika Serikat tahun 2001, kata data yang dihimpun Reuters dan laman internet www.iCasualties. org. Rata-rata dua pertiga dari mereka yang tewas itu adalah tentara AS. Pasukan Afghanistan dan polisi menderita orban lebih banyak, tetapi jumlah pasti tidak diberikan oleh pemerintah. Korban sipil juga banyak tahun ini.(m23)

Salju Tebal Di Eropa Masih Hambat Penerbangan Dan Tutupi Jalanan PARIS, Prancis (AP): Salju tebal dan temperatur beku menutup banyak jalanan di Eropa dan memperlambat lalulintas di jalanraya Minggu (19/12), sehingga memaksa dibatalkannya sejumlah penerbangan dan menyebabkan mobil-mobil meluncur menuruni jalanan yang ditutupi es. Salju tebal menyelimuti Paris — satu situasi langka yang terjadi beberapa kali dalam beberapa minggu terakhir ini dalam satu musim dingin yang tidak biasa. Seperempat penerbangan dibatalkan di Bandara Charles de Gaulle sampai sekurang-kurangnya pukul 04:00 sore waktu setempat. Bandara Heathrow, London, tidak menerima setiap pesawat yang tiba Minggu dan hanya dilakukan keberangkatan setelah salju dan es memaksa ditutupnya sejumlah jalanraya, namun bersiap-siap untuk dibuka penuh Senin, demikian menurut satu pernyataan di websitenya. Terjadi kekacauan di terowongan yang menuju ke stasiun kereta api bawah tanah ke beberapa terminal Heathrow, dengan ratusan pelancong diberitahu para staf bandara agar pulang saja dan mengimbau perusahaan penerbangan agar memperbarui jadwal terbangnya.

Di Bandara Frankfurt, bandara terbesar di Jerman, lebih dari 500 penerbangan dibatalkan Minggu, padahal bandara tersebut normalnya menangani 1.330 penerbangan datang dan berangkat. Di Amsterdam, wanita jurubicara bandara Schiphol Mirjam Snoerwang mengatakan tim pengikisan salju di bandara itu telag membersihkan tiga jalur landasan dan beberapa pesawat telah tiba dan berangkat. Beberapa bandara di Spanyol, Belanda dan Denmark juga dilaporkan membatalkan atau menunda penerbangan Minggu. Inggris juga dilanda badai salju kembaliyang menutup bandara-bandara terbesarnya pada akhirpekanpalingramaisebelum Nataldanmenghantamjalanraya dan lalu lintas kereta api. Di Bandara Heathrow, London, bandara penumpang paling sibuk di dunia, para stafnya menutup landasan terbang sampai paling tidak Minggu untuk membersihkan salju, sementara bandara Gatwick London juga menutup landasan pacunya untuk beberapa jam. Maskapai penerbangan British Airways membatalkan semua keberangkatan jarak dekat dari dua bandara itu, dengan

semua penerbangan jarak jauh dari Heathrow dibatalkan pada hari itu. Pihak Heathrow mengatakan landasan-landasan terbang ditutup “untuk memungkinkan salju dibersihkan dan menjaga agar bandara itu tetap aman.”

Penyanyi Inggris Lily Allen termasuk salah seorang yang terkena dampak badai itu, dengan mengutarakan kemarahan dalam pesan-pesan Twitter ketika dia berusaha selama enam jam untuk mencapai Heathrow. (m10)

Kapal Terbalik Di Sungai Bangladesh, 37 Tewas DHAKA, Bangladesh (AP): Satu kapal penuh penumpang terbalik di satu sungai di timurlaut Bangladesh, dan petugas penyelamat Minggu (19/12) mengatakan, sedikitnya 37 orang tewas dan 18 lebih hilang. Kapal yang mengangkut 80 penumpang itu bertabrakan dengan kapal pengangkut pasir di kegelapan malam Sabtu di Sungai Surma, kata pejabat pemerintah setempat Abul Hashem dan Matiur Rahman. Mereka yang selamat berhasil berenang ke pantai atau diselamatkan oleh penduduk setempat. Korban tewas menjadi 37 jiwa setelah petugas penyelamat menemukan dua jenazah lagi Minggu. Tiga puluh lima jenazah ditemukan tak lama setelah kecelakaan terjadi, kata para pejabat. Minggu, petugas penyelamat masih melakukan pencarian bagi sekitar 18 orang yang dilaporkan hilang, kata dua pejabat. Semua korban tewas adalah penumpang kapal. Suratkabar Dhaka Prothom Alo melaporkan kebanyakan korban adalah wanita dan anak-anak. Kapal itu dalam perjalanan dari Sunamganj menuju distrik Kishoreganj.(m23)

ICC Periksa Tuduhan Presiden Sudan Selewengkan Miliaran Dolar DENHAAG, Belanda (Antara/AFP): Jaksa Pengadilan Kejahatan Internasional mengatakan, pemeriksaan sedang dilakukan terhadap informasi yang menuduh Presiden Sudan menyedot dana negara hingga AS$9 miliar ke rekening banknya. Dugaan itu telah dibantah oleh seorang pejabat senior Partai Kongres Nasional (NCP) yang berkuasa pimpinan Presiden Omar al-Bashir, yang muncul dalam kawat diplomatik yang diungkapkan oleh WikiLeaks Sabtu (18/12). Dokumen WikiLeaks mengutip Moreno-Ocampo mengatakan, pejabat AS harus mengumumkan dengan tuduhan tentang pengalihan uang minyak yang disimpan di rekening bank Inggris dalam rangka untuk mengubah opini publik Sudan terhadapnya. Dikatakan, Moreno-Ocampo mengatakan kepada para pejabat AS bahwa angka yang diduga dipindahkan oleh Bashir mungkin AS$9 miliar dan “akan mengubah pendapat umum Sudan dari dia sebagai ‘orang yang giat melakukan perbaikan’ dengan pencuri.” Dokumen ini disiarkan oleh laman yang memicu kekacauan dunia itu sehari setelah Julian Assange, pendirinya, dibebaskan dengan jaminan di Inggris dari tuduhan kejahatan seks di Swedia. Di Khartoum, pejabat NCP Rabie Abdul Atie menyebut Moreno-Ocampo seorang “pembohong internasional” dan mengatakan tuduhan terhadap Bashir adalah “konyol.”


A4 07.00 Doraemon 09.00 Dahsyat 11.00 Intens 12.00 Seputar Indonesia Siang 12.30 Sergap 13.00 Sinema Siang 15.00 Kabar Kabari 16.00 Minta Tolong 17.00 Seputar Indonesia 17.30 Bisik Bisik Menantu 18.00 Dia Jantung Hatiku 20.00 Putri Yang DItukar 22.30 FTV Clear 23.30 Re Run AFF Suzuki 2010 00.30 UEFA Europa 2010


07.15 Inbox 09.00 Halo Selebriti 10.00 SCTV FTV Pagi 12.00 Liputan 6 Siang 12.30 SCTV FTV Siang 14.30 Status Selebritis 15.00 Uya Emang Kuya 16.00 Cinta Juga KUya 16.30 Sensasi Artis 17.00 Liputan 6 Petang 18.00 Islam KTP 20.30 Titip Rindu 22.30 SCTV Sinema 00.30 Liputan 6 Malam

07.00 Upin & Ipin 08.30 LAyar Liburan Sekolah 10.00 Cerita Pagi 11.00 Sidik 11.30 Lintas Siang 12.00 Cerita Siang 13.00 Layar Kemilau 15.00 Disney Club 16.30 Lintas Petang 17.00 Filler Extra Tawa 18.00 Animasi Spesial 19.00 Upin & Ipin 19.30 Serial pilihan Keluarga 20.30 Sinema Utama Keluarga 21.30 Jejak Wali Songo 22.30 Sinema Pilihan 00.00 Lintas Malam

07.00 Star Kids 08.00 Sinema Pagi 10.00 Kabut Cinta 11.30 Topik Siang 12.00 Klik! 13.00 Mantap 14.00 Buaya Darat 15.00 Djarum Indonesia 17.00 Topik Petang 17.30 Katakan Katamu 18.30 Super Family 19.30 Super Deal 2 Milyar 21.00 World Most Amazing Video 22.00 Mohon Ampun Aku 23.00 Telisik 00.00 Topik Malam

07.00 Sensasi Selebritis 07.30 FTV Pagi 09.30 FTV Drama 11.30 Patroli 12.00 FTV Siang 14.00 Happy Song 15.00 KiSS Sore 15.30 Fokus 16.30 Bread, Love & Dreams 18.00 Artis Sahabat 19.00 Dia Anakku 20.00 Pejantan Cantik 21.00 Taxi 2 21.30 Mega Asia 00.00 Angling Dharman 01.00 Fokus Malam

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Headline News 10.30 Metro Xin Wen 11.05 e Lifestyle 13.05 Zero to Hero 14.30 Metro Sore 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 KPPU 21.05 Top Nine News 21.30 Sentilan Sentilun 22.05 Economic Challenges 23.00 Headline News 23.30 Metro Sports

WASPADA Senin 20 Desember 2010

07.30 Rangking 1 08.30 Derings 10.00 Suami Suami Takut Istri 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Online (Olga & Jeng Kellin) 14.30 Extravaganza 16.00 Kejar Tayang 17.00 Reportase Sore 18.00 Jika Aku Menjadi 18.45 Sketsa 19.15 3 Sahabat 20.00 Realigi 21.15 Bioskop TRANS TV 23.15 Bioskop TRANS TV 01.30 Reportase Malam

06.30 Apa Kabar Indonesia 11.00 KPP 11.30 Kabar Keadilan 12.00 Kabar Siang 13.30 Documentary One 14.30 Jendela Usaha 15.00 Kabar Pasar 16.00 Menyingkap Tabir 17.00 Renungan Hari Ini 17.30 Kabar Petang 19.30 Jakarta Lawyer’s Club 21.00 Apa Kabar Indonesia Malam 22.30 Off Road Challenge 23.00 Auto Expert 00.00 Liga Spanyol

07.30ThePenguinOfThe Madagascar 08.00 Fanboy & Chum Chum 09.00 Chalkzone 09.30 Obsesi 10.30 Bukan Sinetron 11.30 Kuliner Lebay 12.00 Awas Ada Sule 13.00 Global Siang 13.30 MTV Punk D 14.00 Persada Langit Biru 14.30 Petualangan Panji 15.00 Hand Made 15.30 Catatan Rahasiaku 16.00 Obsesi 16.30 BErita Global 17.00 Spongebob 18.00 Naruto 19.00 One Piece 20.00 The Day After Tomorrow 23.00 Farscape : The Peacekepeer Wars

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07.30 Selebrita Pagi 08.00 Tom & Jerry 09.00 Scooby Doo 10.00 Mariam Mikrolet 11.00 Rahasia Sunnah 11.30 Redaksi Siang 12.00 Selebrita Siang 13.00 Laptop Si Unyil 14.30 Dunia Bintang 15.00 Koki Cilik 16.00 Jejak Petualang 16.30 Redaksi Sore 17.00 Asal Usul Fauna 18.00 Selebrita Sore 18.30 Pintu Kejutan 19.30 On The Spot 20.00 Opera Van Java 22.00 Bukan Empat Mata 23.30 Mata Lelaki 00.00 Jam Malam


Asmirandah Anti Cinta Lokasi KENDATI dalam film terbaru garapan sutradara Habiburrahman El Shirazy bertajuk Dalam Mihrab Cinta (DMC), artis Asmirandah,21 dikisahkan tak berjodoh dengan Dude Harlino,30 namun gosip keduanya terlibat cinta lokasi atau cinlok terus merebak belakangan ini. Maklum, kedua sejoli cantik dan ganteng ini kerap tampil beduaan dan mesra baik ketika di lokasi syuting maupun berduet melantunkan singel BungaBunga Cinta – soundtrack film “DMC” produksi SinemArt Pictures yang bakal beredar di gedung bioskop tanah air mulai 23 Desember 2010 mendatang. “Alhamdulillah kalau kami berduadigosipkanadahubungan asmara khusus. Berarti akting

Dude Herlino dan Asmirandah kami di film maupun saat nyanyi duet, berpotensi besar menarik perhatian insan film maupun musik. Tapi, kabar tersebut sebenarnya tidaklah benar.

Karena saya termasuk wanita yang paling anti dengan cinta lokasi,” tandas Asmirandah kepadaWaspada selepas preview filmDMCdibioskopXXISenayan

City – Jakarta baru-baru ini. Kenapa anti cinlok ? Ditanya begitu, wanita cantik kelahiran Jakarta,5Oktober1989iniberkilah, dirinya berupaya keras untuk tidak terlibat hubungan asmara dengan pemeran pria dalam sinetron maupun film. “Pasalnya, setelah saya timbang masak-masak kalau memiliki pacar seorang aktor akan sedikit menghalangi upaya saya sebagai artis muda untuk menjunjung tinggi sikap profesionalitas. Enggak lucu kan, lantaran tuntutan skenario di layar kaca maupun bioskop saya harus berakting mesra dengan lawan main pria, eh dalam kehidupan nyata kami pun kebablasan berhubungan asmara. Tak mudah memang menghindari terjadinya cinlok. Tapi, Alhamdulillah sampai detik ini saya tetap anti cinlok,” tandas pemeran Silvie, guru les matematika meninggal dunia akibat mobil yang dikendarainya terbalik menjelang pernikahan dengan mantan pencopet yang insyaf - Syamsul Hadi (Dude Harlino).

FilmDMS diangkatdarinovel laris karya Habiburrahman El Shirazy alias Kang Abik dan berdurasi 106 menit juga dibintangi Meyda Sefira, Boy Hamzah, Tsanima Marwa serta didukung sederet aktor dan artis senior seperti El Manik, Ninik L Karim, Kaharuddin Syah hingga Iszur Muchtar, Elma Theana, Umar Lubis, Berliana Febrianti dan Neno Warisman. Kisahnya dibuka dengan gambaran perjuangan hidup penuh liku Syamsul, pemuda berusia 20-an tahun. Ia bertekad menuntut ilmu di sebuah pesantren di Kediri dengan meninggalkan kehidupan nyaman. Di pesantren, ia bertemu Zizi (Meyda Sefira), putri pemilik pesantren yang pernah ditolongnya ketika tasnya dijabret di Kereta Api. Peristiwa tersebut meninggalkan kesan mendalam bagi kedua sejoli. Namun Syamsul kemudian terusir dari pesantren karena fitnah tuduhan mencuri yang dirancang sahabatnya sendiri, Burhan (Boy Hamzah). * (AgusT)

Damang Dainang Fritz Rajagukguk, Doa Orang Tua Pada Anak

Fritz T Rajagukguk

FRITZ T Rajagukguk mengemas album perdananya dalam bentukCDdankasetmengangkat tembangDamangDainangkarya Tagor Tampubolon. Album ini diluncurkan Virgo Ramayana setelah melewati revisi ulang baik vokal maupun penataan musiknya. Saat berbicara dengan wartawan Sabtu (18/12), Fritz T Rajaguguk yang bekerja di Kanwil Depkumham Pekanbaru sebelumnya pernah bertugas di Medan menuturkan, lagu Damang Dainang merupakan refleksi perjalanan kehidupannya baik semasa kuliah sampai akhirnya dia bekerja di kantor Imigrasi. Damang Dainang menuturkan, bagaimana peran orang tua sangat besar sekali dalam mendoakankesuksesananaknya. Dulunya Fritz mengaku banyak berbuat kesalahan terhadap orang tuanya, karena itu pula selalu saja dia menemui kesulitan dalam mengarungi kehidupan ini. Namun setelah dia sujud di kaki kedua orang tuanya sambil meminta pengampunan serta didoakan agar segala kesulitan

teratasi, dirinya barulah mampu menghadapi tantangan hidup ini dengan tenang dan sukses. “Jadi memang lagu itu pengalaman pribadi ku sendiri”, tuturnya. Di album tersebut, Fritz tidak cuma mengandalkan lagu Damang Dainang, tapi juga ada tembang lainnya karya pencipta handal lainnya seperti Pargual Pargotcin Ho Do Di Rohakku, Gabe Ma Ho Boru, Na Di GaduGadui, Inang Ni Gellengku, Masihol Au Tu Ho ciptaan Tagor Tampubolon. Selain itu ada lagu Unang LomosHoHasiankaryaJohannes Purba,HasianNauliolahanMaxie Edward Mamiri, dan Pulo Sibanding Nauli ciptaan Fritz T Rajagukguk sendiri dengan musiknyadibantuDormanManik. Sebelum Damang Dainang tercipta, Frizt pernah mencurahkan isi hatinya kepada Tagor Tampubolon. Secara diam-diam pula Tagor kemudian membuatkan lirik dan musiknya tanpa sepengetahuan Fritz. Setelah selesai, Tagor menyerahkannya ke Fritz, tapi dia sendiri tidak berani membawakannya, malah menawarkannya agar diberikan kepada Vicktor Hutabarat. Namun Tagor menyatakan cuma dirinya yang pas membawakanlaguitukarenamemang bercerita tentang kehidupannya. Dengan berbagai pertimbangan akhirnya, Fritz bersedia menyanyikan sendiri lagu Damang Dainang yang memang suaranya sekilas mirip Vicktor Hutabarat. Fritz menyebutkan, dua lagu di album tersebut juga mema-

sukkan unsur musik tradisi Batak termasuk lagu Damang Dainang dan Pargual Pargotci. Tapi secara keseluruhan album ini lebih mengarah ke unsur pop Batak, dengan memasukkan unsurunsur musik tradisi Batak. Karir bermusik pria ini diakuinya otodidak dimulainya tahun 1978 mengorbitkan Lilik Marlen, Neno Warisman dan

pernah menjadi Ketua Festival LombaCiptaLaguPembangunan Tingkat Nasional memperebutkan piala ibu Tien Soeharto. Dari situ, mulai bergaul dengan pemusik-pemusik di antaranya Eddy Silitonga, Johannes Purba, kemudian sempat juga ‘menangani’ Ervina dan almarhum Richie Ricardo. Fritz juga menyampaikan

terima kasihnya kepada sejumlah orang yang banyak membantu hingga album ini bisa diedarkan seperti Kepala Kantor Imigrasi Polonia Abdurrachman, Kepala BidangIntelijenKanwilDepkumham Rostanof, Eselina Lukman Jastra Wisata, mantan Kakanwil Depkumham Mashudi yang kini Kakanwil Jawa Timur serta pihak lain yang membantu.(m19)

ARTIS Senior: Sejumlah artis-artis senior pendukung acara Nostalgia Fan’s Club diantaranya Ahmad Albar, Helmy Yahya, Cindy Claudia Harahap, Tengku Wisnu, Joni Iskandar, Hamdan ATT, Endang S.Taurina dan lainnya usai tampil ramai-ramai menyantap durian di Garuda Plaza Hotel Medan Jumat (17/12) malam. Mereka tampak santai menyantap buah durian sajian khusus Garuda Plaza Hotel ini sampai larut tengah malam. Tampak dalam gambar para artis sambil menenteng durian diabadikan di kolam renang hotel tersebut.(m19)


Tengku Wisnu berduet bersama Vonny Lidia membawakan songtrack Sinetron Cinta Fitri di acara Nostalgia Fan’s Club

Kenangan Bersama Ida Kusumah Di Acara Nostalgia Fan’s Club NOSTALGIA Fan’s Club kembali sukses menggelar Tembang Kenangan Jumat (17/ 12) malam di Balai Sidang Tiara Medan. Bukan cuma artis senior memeriahkan acara tersebut, tapi panitia memboyong sejumlah pemeran sinetron Cinta Fitri ke atas panggung diantaranya Tengku Wisnu, Sandy Syarif, Dinda Kanya Dewi, Aldy Fairuz, Bemby dan lainnya. Tak cuma tampil di atas panggung sekaligus memberikan sumbangan kepada masyarakat kurang mampu, Tengku Wisnu pun ikut bernyanyi bersama Vonny Lidiaselaku Koordinator Artis membawakan theme song Cinta Fitri. Dikawal pembawa acara Helmi Yahya acara tembang kenangan gelaran Nostalgia Fan’s Club mampu membalikkan kenangan masa lalu lewat tembang-tembang dibawakan para pendukung acara diantaranya ada Endang S. Taurina, Cindy Claudia Harahap, Ermi Kulit, Handan ATT, Ahmad Albar, Diana Nasution dan Joni Iskandar. Endang S Taurina sendiri tampil sebagai pembuka setelah sebelumnya Helmi Yahya ikut menyumbangkan suaranya lewat lagu Terlena pernah dipopuler Ramona Purba. Tak cuma Endang S.Taurina tampil memikat, AKBP Eddy Waluyo selaku penggagas Nostalgia Fan’s Club pun tak mau ketinggalan, dia membawakan dua lagu milik Broery Pesolina diantaranya Mawar Berduri dan Mimpi Sedih. Joni Iskandar kembali mengajak penggemarnya bernostalgia sambil menjemput seorang penonton membawakan lagu Judul-Judul dan tentunya hit klasiknya Pengemis Cinta. Suasana malam makin larut ditambah lagi hujan tak mau berhenti, namun penonton tetap bertahan, maka Ermi Kulit pun bernyanyi membawakan lagu Pasrah dan Kasih memang sudah menjadi tembang andalannya. Cindy Claudia Harahap tak mampu membendung air matanya saat membawakan lagu ‘Ayah’ karya Rinto Harahap yang tak lain adalah orang tuanya sendiri, Rasa Cinta dan Katakan Sejujurnya juga tak luput dibawakannya. Hamdan ATT kayaknya tak mau kalah dengan Joni Iskandar, beliau pun mengajak

pengunjung bergoyang dangdut sambil membawakan lagu Bekas Pacar sampai Termiskin Di Dunia yang terus disambung dengan penampilan Diana Nasution membawakan lagu Jangan Biarkan, Benci Tapi Rindu dan disudahi penampilan Ahmad Albar special Reques membawakan lagu Bis Kota, Panggung Sandiwara, Sudahlah Aku Pergi, Zakia, Laguku dan Semut Hitam sebagai lagu penutup dari seluruh rangkaian acara Nostalgia Fan’s Club menjelang akhir tahun 2010. Sebelum seluruh acara berakhir, di layar besar ditampilkan slide kenangan bersama Almarhumah Ida Kusumah selaku pendukung sinetron Cinta Fitri. Semua pendukung sinetron tersebut diminta Helmy Yahya menceritakan kenangan terakhirnya bersama almarhumah menjelang ajal menjemputnya. Sandy Syarif sendiri menuturkan, Oma begitu panggilan akrabnya sebelum mereka ke Medan pernah berkata.”Kita tanggal 17 Desember ke Medan, tapi ngapain ya kita di sana”, begitu ceritanya. Dinda Kanya Dewi pun punya kenangan menarik, karena katanya, sebelum meninggal, Oma mengajaknya berkumpul bersama sambil berujar ‘Kapan ya kita bisa kumpul-kumpul bersama lagi seperti ini”, itulah kalimat terakhir diucapkan Almarhumah Ida Kusumah di lokasi syuting, kata Dinda Kanya Dewi. Sementara koordinator artis Vonny Lidia usai acara menyebutkan, menggelar acara tersebut karena memang dengan lagu-lagu lama bisa banyak dibuat yaitu menjalin komunikasi baik dengan muspida, BUMN maupun masyarakat sekalian menjalin relasi. Ide membuat acara ini, menurutnya, saat Dit Narkoba Poldasu melakukan penyuluhan narkoba di kampus dan sekolah. Dengan menggabungkan unsur hiburan ternyata penyuluhan diberikan lebih mudah mengena dan dicerna peserta. Lagu-lagu nostalgia sendiri punya kekuatan sendiri yang mungkin penciptanya dulunya mengangkat gambaran kehidupan seseorang yang kemudian dijadikan lagu. Sementara lagu sekarang cepat terkenal dan cepat pula hilangnya.(m19)


WASPADA Senin 20 Desember 2010


Tropi Inter Buat Moratti ABU DHABI (Waspada): Juara Eropa Inter Milan meraih gelar Piala Dunia Klub 2010, Sabtu (Minggu WIB), setelah menggasak juara Afrika TP Mazembe 30 pada final di Abu Dhabi.


Bomber Barcelona David Villa menaiki badan rekan-rekannya ketika merayakan gol Pedro Rodriguez ke gawang Espanyol di Cornella-El Prat Stadium, Sabtu (Minggu WIB).

Barca Makin Pede Masuki Natal MADRID (Waspada): Juara bertahan Barcelona dipastikan menduduki posisi puncak La Liga Primera selama istirahat Natal pasca membantai Espanyol 5-1 di stadion CornellaEl Prat, Sabtu (Minggu WIB). Kemenangan ke-10 beruntun El Barca tersebut membuat entrenador Josep ‘Pep’ Guardiola makin percaya diri (pede) memasuki Natal tahun ini. “Kami baru saja mengalahkan tim yang sangat bagus. Ini telah membuat saya makin percaya diri,” ujar Guardiola, seperti dilansir Reuters, Minggu (19/12). Atas kemenangan tersebut, The Catalans makin kokoh di puncak, tapi rivalnya Real Madrid masih terus membuntuti di posisi dua klasemen. “Kami telah memainkan laga yang sulit. Ini malam yang luar biasa bagi kami,” papar Pep, seraya menambahkan secara keseluruhan permainan anak

Hasil Sabtu (Minggu WIB)

Klasemen Liga Primera

Villarreal vs Mallorca Deportivo vs S Gijon Levante vs Ath Bilbao Espanyol vs Barcelona Sociedad vs Valencia

Barcelona Real Madrid Villarreal Valencia Espanyol Ath Bilbao Atl Madrid Getafe Sociedad Mallorca Sevilla Hercules Deportivo Santander Osasuna Levante Almeria Malaga S Gijon Zaragoza

3-1 1-1 1-2 1-5 1-2

asuhnya telah menunjukkan grafik luar biasa. Pilar sukses Spanyol saat menjuarai Piala Dunia 2010 Pedro Rodriguez dan DavidVilla masing-masing menyumbang dua gol. Xavi Hernandez menambahkan satu gol lagi untuk memastikan kemenangan besar dalam derbi Barcelona tersebut. “Tim kami tak pernah berhenti memberi kejutan kepada saya. Kami bisa mengalahkan rival sekota,” puji Pep. “Espanyol hanya kemasukan dua gol di kandang dalam laga liga sebelum malam ini. Bukan kebetulan bahwa mereka

16 14 1 1 51- 9 43 15 12 2 1 38-12 38 16 10 3 3 30-14 33 16 8 4 4 24-19 28 16 9 1 6 18-22 28 16 8 1 7 25-27 25 15 7 2 6 24-19 23 15 7 2 6 23-20 23 16 7 1 8 22-26 22 16 6 3 7 16-20 21 15 6 2 7 21-26 20 15 5 3 7 18-22 18 16 4 6 6 13-19 18 15 5 2 8 13-23 17 15 4 4 7 15-20 16 16 4 3 9 18-26 15 15 2 7 6 13-22 13 15 4 1 10 20-32 13 16 2 6 8 13-24 12 15 1 6 8 14-27 9

semakin mendekati posisi puncak klasemen,” katanya lagi. (m15/ant/rtr/ap)

Klasemen Ligue 1

Hari Terbesar Lemoine PARIS (Waspada): Gelandang Fabien Lemoine membuktikan kepahlawanannya bagi Rennes, Sabtu (Minggu WIB), ketika dia beraksi menyiapkan terjadinya satu-satunya gol kemenangan 1-0 atas Valenciennes. Lemoine yang masuk lapangan sebagai pemain pengganti dengan apik menyodorkan bola kepada Jean-Armel Kana-Biyak, yang langsung menjebol gawang lawan pada injury-time. “Ini satu hari terbesar dari

kehidupan saya. Yang penting memperoleh poin penuh, semuanya berjalan sesuai keinginan kami,” ucap Lemoine. Paris Saint Germain ditahan imbang 2-2 tamunya oleh AS Monaco di Parc des Princes. PSG gagal naik ke puncak akibat gol yang dicetak pemain Monaco Daniel Niculae untuk menyamakan kedudukan 2-2. Montpellier ditahan 1-1 oleh Auxerre, Brest juga main seri 1-1 lawan OGL Nice. Saint-Etienne naik ke posisi

I Nerazzurri mendominasi laga dan mecetak keunggulan awal melalui Goran Pandev dan Samuel Eto’o pada babak pertama dalam waktu 20 menit. Pemain asal Prancis Jonathan Biabiany menambah gol ketiga menit 85. Dengan kemenangan itu berarti Presiden Inter Massimo Moratti telah menyamai prestasi yang pernah ditorehkan ayahnya Angelo. Alenatorre Rafael Benitez pun mengaku sangat senang dan mendedikasikan kemenangan itu buat Moratti serta semua orang yang mencintai Inter. Apalagi posisi Benitez dikabarkan menjadi taruhan dalam ajang tersebut. “Saya sangat bahagia dan ingin mendedikasikan kemenangan ini untuk semua orang yang telah bekerja dengan kami,” jelas Benitez. “Jelas saya akan berbicara dengan Presiden Massimo Moratti dan direktur Marco Branca. Saat ini saya membutuhkan dukungan dan jika itu ada, maka kami dapat melakukan bersama-sama,” ujarnya lagi dalam Football Italia, Minggu (19/12). Arsitek asal Spanyol itu optimis, La Beneamata tetap menjadi klub yang disegani lawan. Dengan masih banyaknya pemain kelas dunia, menurutnya, bukan tak mungkin Inter akan


lima setelah menang 2-0 atas Arles-Avignon, Toulouse juga naik empat tingkat ke posisi delapan pasca menggasak Lorient 3-0. (m15/ant/afp)

Lille 17 Paris SG 18 Rennes 18 Lyon 17 St-Etienne 18 Marseille 17 Brest 18 Toulouse 18 Montpellier 18 Bordeaux 17 Sochaux 17 Lorient 18 Auxerre 18 Nice 18 Nancy 17 Valenciennes 18 Monaco 18 Caen 17 Lens 17 Arles 18

8 8 8 8 7 7 7 8 7 6 7 7 4 5 6 4 2 3 3 1

7 2 32-20 31 7 3 30-19 31 7 3 18-11 31 5 4 24-19 29 7 4 25-19 28 6 4 26-16 27 6 5 20-15 27 3 7 20-18 27 5 6 15-19 26 7 4 21-18 25 3 7 27-20 24 3 8 22-24 24 10 4 24-21 22 7 6 14-18 22 4 7 19-26 22 7 7 19-20 19 10 6 17-19 16 6 8 16-26 15 6 8 15-30 15 4 13 10-36 7

sukses lagi merebut gelar Liga Champions, Liga Seri A dan Coppa Italia seperti musim lalu. Sedangkan bagi Mazembe dari Kongo, hasil di Uni Emirat tetap menjadi sejarah karena telah menjadi tim Afrika pertama yang mencapai final pasca mengalahkan juara Brazil Internacional pada semifinal. Namun di final, Mazembe kalah segalanya dari Inter yang memang difavoritkan meskipun tempur tanpa bintang Belanda Wesley Sneijder yang mengalami cedera. “Kami sangat berharap Wesley cepat kembali. Saya sangat bahagia, karena ini tropi kelima yang telah kami menangkan sejak saya datang ke sini,” ucap Pandev, yang membuka pesta La Beneamata menit 12. Dia juga tak lupa berterimakasih kepada Eto’o yang memberi umpan cantik atas golnya. “Terima kasih kepada Samuel Eto’o yang ikut andil dan

membantu saya. Tim ini telah menampilkan permainan indah dengan cepat dan tepat,” tambahnya. Klub Brazil Internacional merebut posisi ketiga setelah menang 4-2 atas klub Korsel

Seongnam Ilhwa. Gol Internacional dicetak Tinga menit 15, Alecsandro menit 27 dan 71 serta Andres D’Alessandro menit 52, dua gol balasan Songnam diborong Molina menit 84 dan 90+3. (m15/fi/ant/afp)

Javier Zanetti cs merayakan sukses Inter Milan merebut tropi Piala Dunia Klub di Zayed Sport City Stadium, Abu Dhabi, Uni Emirat, Sabtu (Minggu WIB).-AP-



WASPADA Senin 20 Desember 2010

Laskar Rencong Tanpa Sang Kapten UNTUK sementara, tangan dingin Herry Kiswanto terbukti ampuh meramu Persiraja. Terbukti, hingga empat laga yang sudah dilakoni, Abdul Musawir dkk meraup poin sempurna. Menghadapi tuan rumah Fahrizal Dillah (depan) berpeluang kembali menjadi pahlawan bagi timnya saat melawan Persires Rengat. -Waspada/Munawardi Ismail-

Persires Rengat, Laskar Rencong sedikit ‘bengkok’. Pasalnya, sang kapten Abdul Musawir, tak bisa turun karena akumulasi kartu. “Kita kehilangan satu dua pemain dalam laga itu biasa,” ujar arsitek Persiraja Herry Kiswanto saat dihubungi Waspada dari Banda Aceh, Minggu (19/12). Namun menurutnya, setiap pemain sudah siap tampil mengganti yang absen. Mantan gelandang tim nasional ini, optimis, siapapun yang diturun-

kan akan tampil bertanggungjawab. “Bola memang bukan matematika, tak bisa dinilai di atas kertas. Tapi kita sudah instruksikan anak-anak tampil ngotot,” jelasnya. Tanpa sang kapten, Herry akan memainkan skema yang sama. Bisa saja posisi Musawir akan digantikan Herisman atau Aswin Sitorus. “Apalagi Safri Umri dan Hendra Saputra tidak berangkat,” katanya lagi. Kendati Persires sedang ter-

puruk, Herry tak menganggap lawan sebelah mata. “Setiap pertandingan bagi kami bagai final. Itu terus saya instruksikan kepada semua pemain,” tukasnya. Ketika dihubungi Waspada, Abdul Musawir mengaku kecewa tak bisa main. “Saya kecewa tidak bisa tampil di Rengat,” ucapnya. Kartu kuning kedua diterima ayah Abdul Karim Benzema dan Abdul Sami Khaidera itu saat membawa timnya me-

nang 2-1 atas tuan rumah Persih Tembilahan. “Seharusnya, dalam pertandingan itu saya tak layak dapat kartu,” dalihnya. Menurut Musawir, kibasan kartu kuning itu diterimanya akibat keberpihakan wasit kepada tuan rumah. Pun begitu, itu tetap mengaku bisa berbesar hati, mengingat timnya meraih tri poin dari Tembilahan. Sang Kapten pun tetap mendukung timnya untuk fokus dan berkonstrasi penuh serta tidak terpengaruh dengan provokasi

tuan rumah. Tanpa kehadiran Musawir, besar kemungkinan, Fahrizal Dillah dan Bekatal mendapat tugas membombardir gawang lawan. “Insya Allah, jika pelatih memberi kepercayaan, saya ingin memberikan yang terbaik bagi tim. Berkat kerjasama dan bantuan teman-teman, Insya Allah, doakan saja semoga kami menang lagi,” ungkap Fahrizal, jebolan tim PON Aceh. *Munawardi Ismail

Persiraja Incar Kemenangan Kelima BANDA ACEH (Waspada): Kemenangan kedua di luar kandang sudah dibukukan kubu Persiraja Banda Aceh. Kini pasukan Herry Kiswanto mengincar kemenangan kelima di kandang Persires Rengat, Senin (20/12) sore ini di Stadion Narasinga, Kabupaten Rengat, Riau. Sampai laga keempatnya, Laskar Rencong telah menyapu bersih empat laga Divisi Utama Liga Indonesia 2010/2011, masing-masing dua di kandang dan dua tandang. Menyikapi laga kelima, di atas kertas peluang menang terbuka lebar. Mengingat kubu tuan rumah sedang dalam kondisi limbung. Apalagi dalam tiga laga dengan tim Aceh sebelumnya, yakni PSLS, PSSB Bireuen dan PSAP Sigli, mereka gagal mengutip poin. Bukan hanya itu, musim lalu saat Azhari cs saat dibesut An-

war, juga sukses membekuk tuan rumah dengan skor 2-1. Memori manis itu diharapkan akan kembali terulang kala Fahrizal Dillah melakoni pertandingan kelima musim ini. “Ini akan menjadi tantangan tersendiri bagi Persiraja untuk mengikuti jejak tiga saudara mudanya yang menang di Rengat,” kata Manajer Persiraja Banda Aceh, Tgk Adli Tjalok ketika menjawab Waspada, Minggu kemarin. Jika skenarionya berpihak pada tim tamu, Abdul Musawir dkk bukan cuma membukukan

kemenangan kelima dari lima pertandingan, atau ketiga di luar kandang, namun, posisi mereka di puncak klasemen sementara akan aman dari kejaran Persita Tangerang. Kemenangan tersebut juga akan sarat makna bagi Pasukan Oranye itu. Sebab akan menjadi kado manis bagi pendukungnya dalam menutup tahun ini. “Kami selalu berdoa semoga mereka benar-benar bermain dengan semangat tinggi,” sebut Muhajir, fan fanatik Laskar Lampineueng itu. Hingga empat laga yang sudah dilakoninya, Jibril dkk sudah mematuk PS Bengkulu 1-2 pada 19 November lalu. Dua kali laga kandang juga sukses memungut enam angka setelah mendepak PSMS Medan 0-3 dan Pro Titan FC 1-2 di Standion H Dirmurtala pada 28 November dan 2 Desember lalu.

Klasemen Sementara Grup I Persiraja 4 Persita 5 PSAP Sigli 4 Persipasi 5 Persitara 5 PSLS 6 PSSB 6 PSMS Medan 5 PS Bengkulu 8 Pro Titan 5 Persikabo 5 Persih 5 Persires 5

4 3 3 3 3 2 1 2 1 1 1 1 0

0 2 1 1 1 3 3 0 3 2 1 1 0

0 0 0 1 1 1 2 3 4 2 3 3 5

9-3 12 10-1 11 8-1 10 8-2 10 9-6 10 4-5 9 4-5 6 4-8 6 6-11 6 5-6 5 5-6 4 4-9 4 1-14 0

Kemenangan kedua di luar kandang dibukukan pada Kamis (16/12) lalu dengan menghempas Persih Tembilahan dengan skor tipis 2-1 di Stadion Beringin, Tembilahan. “Doadoa masyarakat akan sangat memotivasi anak-anak,” tutup Adli. (b05)

PSSB Tekad Singkirkan Mitos Jamu Persikabo Sore Ini BIREUEN (Waspada): PSSB Bireuen yang belum pernah sekalipun menang di kandang, berusaha bangkit sekaligus menyingkirkan mitos pecundang. Anak didik M Yahya Chan dan Mulya Saputra telah sadar, makanya menjamu Persikabo Bogor di Stadion Cot Gapu, Bireuen, Senin (20/12) sore ini, tidak ada pilihan lain kecuali belajar dari kegagalan-kegagalan sebelumnya. Pelatih PSSB M Yahya Chan didampingi asistennya Mulya Saputra mengatakan, mitos tak pernah menang di kandang sungguh sangat aneh alias hal yang jarang terjadi sebelumnya. Musim lalu betapa pun hebatnya tim yang bertandang ke Cot Gapu, mereka siap-siap untuk menjadi korban tim Kota Juang karena mereka tahu fanatismenya pemain dan pendukung PSSB.

Namun musim ini Cot Gapu tidak lagi angker bagi tamu, termasuk tim yang tidak diperhitungkan sekalipun. Kegagalan Laskar Batee Kureng disebutsebut juga karena tertekan mental. Betapa tidak, sedikit kesalahan mereka langsung kena damprat dan caci maki, belum lagi dikabarkan ada pemain yang terkesan sok menguasai PSSB. Maka, berhembus kabar pelatih bila hendak menurunkan pemainnya harus minta restu pada yang bersangkutan. “Anak-anak sudah sadari kesalahan dan mereka akan mengoreksinya dalam pertandingan melawan Persikabo. Mereka tidak mau lagi kegagalan itu terulang lagi nantinya dan dimasa yang akan datang,” jelas Mulya Saputra. Dikatakannya, PSSB tidak bisa menurunkan bek veteran Faisal Jalal. “Faisal Jalal tak bisa

Laskar Aneuek Nanggroe Jangan Gentar BANDA ACEH (Waspada): Laskar Aneuek Nanggroe Pidie diminta jangan gentar untuk mencuri angka pada partai tandang melawan tuan rumah Persih Tembilahan, Senin (20/12) sore ini. Demikian harapan Bupati Pidie H Mirza Ismail SSos, yang jauh-jauh hari telah menyatakan komitmennya sangat mendukung perjuangan PSAP Sigli. “Menghadapi tuan rumah Persih Tembilahan, tidak ada pilihan lagi kecuali harus mencuri angka penuh, guna mempertahankan rekor belum terkalahkan,” pinta Mirza melalui Waspada, Minggu (19/12). Laskar Aneuek Nanggroe Pidie yang mau mencuri poin diyakininya akan terwujud dengan tingginya kepercayaan diri pasca menanduk tuan rumah Persires 4-0, Rabu lalu. Namun Mirza mengaku, setiap lawan tidak sama. “Persih memang sedang anjlok prestasinya. Dari lima kali pertandingan yang sudah dilakoni hanya sekali menang, sekali seri, dan selebihnya kalah melulu. Namun mereka tetap perlu diwaspadai anak-anak PSAP,” timpal Asisten Pelatih PSAP, Arman SH. Menurut Arman, peluang PSAP untuk mencuri angka penuh dari Tembilahan terbuka lebar. Namun demikian, kata Arman, anak-anak PSAP diinstuksikan jangan lengah karena dalam seketika prestasi Persih bisa saja bangkit. (b21)

Formasi PSSB Harus Konsisten BIREUEN (Waspada): Pemerhati sepakbola di Bireuen, Zulkifli, Minggu (19/12) menegaskan, sebaiknya arsitek PSSB harus konsisten dan berani mempertahankan formasi terbaiknya. “Ya seperti saat melakukan lawatan ke Riau, formasi ini sepertinya layak dipertahankan,” ucap Zulkifli. Dari beberapa laga selama kompetisi Divisi Utama Liga Indonesia 2010/2011 berlangsung, menurut dia, idealnya PSSB sudah dapat menentukan formasi terbaiknya dan terus dipertahankan. “Pelatih dituntut harus tegas, jangan takut kepada pemain,” pinta Zulkifli seraya menandaskan hal ini perlu disikapi pelatih untuk membangun tim yang lebih tangguh. Hasil pengamatannya selama beberapa laga pada Piala Gubernur Aceh dan beberapa pertandingan Divisi Utama, kebanyakan gol ke gawang PSSB berawal dari tendangan bebas akibat pelanggaran yang dilakukan pemain bawah. “Pengalaman ini harus dapat dipelajari oleh pelatih, mengapa pemain bawah melakukan pelanggaran. Apakah pemain bawah PSSB tidak bisa mengambil alih bola tanpa harus melakukan pelanggaran,” tanyanya lagi. Pelatih PSSB Mulya Saputra mengaku, sebenarnya formasi tim sudah terbentuk sebelum liga dimulai. Namun beberapa hari menjelang pertandingan bergulir, beberapa pemain inti hengkang ke klub lain hingga dia harus menyusun format terbaru lagi. PSSB menurutnya, juga sedang mengasah pemain depan dalam memanfaatkan peluang untuk menciptakan gol. “Banyak peluang gol yang belum dimanfaatkan, sehingga memicu emosi di antara pemain,” tambah Mulya. (cb03)

Waspada/Abdul Mukthi Hasan

Tim Persikabo Bogor melakukan uji lapangan Stadion Cot Gapu, Bireuen, Minggu (19/12). main karena akumulasi kartu kuning, namun bagi anak-anak tidak menjadi masalah. Kita sudah menyiapkan Irsad Azmi penggantinya yang lebih siap,” tambah Mulya. Manajer Persikabo Mas Anjad Djuli saat timnya uji lapangan Stadion Cot Gapu Bireuen, Minggu (19/12) mengatakan, walaupun timnya hanya ditangani asiten pelatih, tetapi mereka siap merebut angka penuh dari PSSB. ”Target kami pasti

untuk menang lah,” tegasnya. Ditanya bagaimana kekuatan PSSB sekarang ini, pria bertubuh pendek itu dengan enteng mengatakan, “PSSB biasa-biasa saja kok, nggak lebih juga. Yang jelas kami ingin dapat poin.” “Dengan PSLS saja, nyaris dapat kami permalukan. Karena pemain kami kena kartu merah, mereka dapat menyamakan kedudukan itupun menjelang pertandingan habis,” ujarnya lagi. (amh)

Waspada/Munawardi Ismail

Skuad The Winning Team Persiraja Banda Aceh mengincar kemenangan kelima di Rengat, Senin (20/12) ini.

Khawatir Faktor Non-teknis Persih Vs PSAP Sore Ini TEMBILAHAN (Waspada): Menghadapi tuan rumah Persih di Stadion Beringin Tembilahan Tembilahan, Kabupaten Indragiri Hilir, Riau, Senin (20/ 12) sore ini, PSAP Sigli mengkhawatirkan faktor non-teknis. Terutama kepemimpinan wasit, sebab sudah menjadi rahasia umum bahwa selama ini tuan rumah selalu dibela oleh korps berbaju hitam itu. Contoh teranyar ketika PSLS Lhokseumawe kalah 0-3 dari Harimau Rawa - julukan Persih. Tiga gol bersarang ke gawang tim asal Aceh itu hasil dari bola offside dan hadiah pinalti. Pengalaman yang sama juga dirasakan dua saudara PSAP Sigli, yaitu Persiraja Banda Aceh dan PSSB Bireuen. Kendati Persiraja unggul 2-1 dan PSSB menahan imbang 1-1, namun peran wasit sangat kental membela tuan rumah Persih. Faktor non-teknis bisa saja dihalalkan, mengingat Harimau Rawa sangat berkeinginan mencapai target masuk ke kasta teratas kompetisi sepakbola di Indonesia, yaitu Indonesia Super Liga (ISL). Pelatih PSAP Anwar kepada Waspada usai memimpin latihan uji lapangan Stadion Beringin, Tembilahan, Minggu (19/ 12), pun mengaku mulai merasakan adanya atmosfir akan

Waspada/Muhammad Riza

Sehari menjelang pertandingan menghadapi tuan rumah Persih Tembilhana, PSAP Sigli melakukan latihan sekaligus mencoba lapangan Stadion, Beringin, Tembilahan, Minggu (19/12) terjadinya tekanan non-teknis. “Jujur saja dilihat dari tuan rumah yang sangat berambisi masuk ke ISL, mereka akan berusaha menempuh bermacam cara dalam upaya mengalahkan PSAP Sigli dan tim-tim lain di Stadion Beringin,” ujar Anwar. Terlebih Persih sebelumnya dikalahkan Persiraja, sehingga tuan rumah tentu tidak ingin

lagi malu kedua kalinya di kandang sendiri. Anwar sendiri sudah menginstruksikan Riza Fandi Cs untuk terus bekerja keras. Sebab lawan yang dihadapi bukan 11 pemain saja, tapi bermacam teror yang dikhawatirkan akan mewarnai pertandingan. “Kalau mau sabar dan tidak terjebak factor non tehnis, PSAP

Sigli bisa bawa pulang poin,” papar Anwar. Pelatih Persih Iwan Setiawan juga tak mau mengambil resiko dan memperpanjang rekor kekalahan kandang timnya. Maka berbagai strategi dan tehnik jitu akan dia tampilkan untuk membungkam ambisi tim tamu. (b20)

Sport Lomba 10 K Aceh Open Tuai Kritik



Senin 20 Desember 2010

BIREUEN (Waspada): Lomba Lari 10 K Aceh Open IX tahun 2010 di Bireuen sebagai tuan rumah, menuai kritik dari peserta dan masyarakat. Dua kritikan yang perlu mendapat perbaikan, yakni soal pembagian kelas atlet dan kostum pelari putri. Panitia Provinsi dinilai kurang menyentuh dalam memasyarakatkan cabang olahraga atletik kepada masyarakat. Pasalnya, Lomba 10 K Aceh Open IX 2010 tidak ada pembagian kelas, hanya dicantumkan katagori dewasa putra dan dewasa putri. Lomba diikuti seribu pe-

Waspada/H.AR Djuli

Enam gelar juara (putra) dan lima juara putri lomba lari 10 K Aceh Open IX 2010 diboyong atlet luar daerah. serta, terdiri dari 800 putra dan 200 putri dari kalangan pelajar SD, SMP, SMA, kategori dewasa termasuk atlet juara nasional.

Tgk Rusli di Bireuen, Minggu (19/12), mengeritik keras kostum atlet putri terutama dari luar daerah, karena tidak me-

nutup aurat. Erni menurut Tgk Rusli, pegawai Pemkot Salatiga (Jateng), salah seorang atlet putri yang

Johor Tinjau Program Pembinaan Atlet Aceh BANDA ACEH (Waspada): Jabatan Belia dan Sukan Negeri Johor, Malaysia, melihat langsung program pembinaan atlet Aceh di kompleks Stadion Harapan Bangsa Lhoong Raya, Sabtu (18/12). Jabatan Belia dan Sukan atau semacam Dinas Pemuda dan Olahraga Johor, bertandang ke Aceh guna mendapatkan masukkan dalam upaya program pembinaan peningkatan prestasi atlet. Jabatan Belia dan Sukan, Negeri Johor Malaysia, Dr Muhammad Gani bin Muhammad Yusuf beserta rombongan ingin menjalin silaturahmi dan kerjasama di bidang olahraga dan pemuda dengan Aceh. Dr Muhammad Gani meninjau program pendidikan, pembinaan dan latihan Pelajar (PPLP) Dispora Aceh dan Program Pembinaan Atlet Binaan Utama KONI Aceh di SMK Negeri I Banda Aceh. Dr Muhammad Gani menyebutkan, Aceh dan Johor me-

miliki banyak kesamaan dan persaudaraan yang erat, sangat baik menjalin kerjasama dalam pelaksanaan program peningkatan prestasi olahraga. Termasuk juga dalam pembinaan pemuda. Dia mengatakan, Belia dan Sukan Johor bersedia membantu dan memberikan masukan bagi KONI Aceh dalam pelaksanaan program pembinaan prestasi atlet, sehingga banyak muncul atlet handal dan berprestasi dari daerah ini di masa mendatang. Pembinaan olahraga Negeri Johor terbilang bagus, karena Negeri (provinsi) ini memilki prestasi olahraga yang baik, berada di peringkat ke-empat dalam pekan olahraga (PON) di Malaysia. Sedang Ketua Harian KONI Aceh, Drs Teuku Pribadi mengatakan, Aceh banyak kehilangan atlet yang sudah handal dan berprestasi karena menjadi korban bencana dasyat gempa dan tsunami yang terjadi 26

Waspada/Munawardi Ismail

Ketua Harian KONI Aceh, Drs Teuku Pribadi menjelaskan program pembinaan atlet Aceh kepada Jabatan Belia dan Sukan Negeri Johor, Malaysia, Dr Muhammad Gani, Sabtu (18/12). Desember 2004. Teuku Pribadi menyebutkan, guna memiliki kembali atlet yang handal dan berprestasi di even nasional dan international, Aceh selama ini terus bekerja keras melakukan pembinaan atlet, diantarannya pelaksanaan program pembinaan atlet pelajar melalui PPLP, PPLM (mahasiswa), pelatihan pelatih dan

meningkatkan kejuaraan serta mengirimkan atlet ke even nasional, regional dan international. Kecuali itu, katanya, KONI Aceh juga telah memulai melaksanakan pembinaan atlet prestasi melalui program atlet binaan utama yang dipersiapkan menghadapi Pekan Olahraga Nasional (PON) XVIII/ 2012 di Riau. (b05)

ISSI Aceh Tengah Gelar Even Balap Sepeda

Sosialisasi Formi Ke Seluruh Kabupaten/Kota Aceh

TAKENGEN (Waspada): Setelah sukses menjadi juara umum pada Porprov Bireuen 2010, Ikatan Sport Sepeda Indonesia (ISSI) Aceh Tengah mengadakan even balap sepeda tingkat pelajar dan umum. Ajang dimaksud sekaligus bertujuan mencari bibit baru sebagai langkah pembinaan berkesinambungan untuk mempertahankan tradisi juara. Demikian Ketua ISSI Aceh Tengah AKBP Edwin Rahmat Adikusumo melalui Central Aceh Bycickle comonity (CABC), Khalisuddin S Pt kepada Waspada di Takengen, Minggu (19/12). Even Tanah Gayo BMX Championship kali ini akan gelar selama dua hari (25-26 Desember 201). “Ajang ini merupakan tolak ukur bagi kami untuk menilai kesiapan atlet menuju Kejurda 2011,” jelas Khalis. Menurutnya, sebanyak 300 atlet yang berasal dari Aceh Tengah dan Bener Meriah, telah mendaftarkan diri untuk ambil bagian. Kemungkinan ajang BMX itu juga akan diikuti pembalap-pembalap dari luar daerah seperti atlet Kota Juang Bireuen. Ada beberapa kategori yang dipertandingkan, seperti kategori SD, SMP, SMA sederajat dan umum. Bagi para juara panitia menyediakan hadiah pembinaan sebesar Rp5 juta plus medali. “Kami akan memberi sejumlah hadiah serta medali emas, perak dan perunggu,” ucap Khalis, seraya menambahkan ajang tersebut akan berlangsung di arena buatan Paya Ilang, Tan Saril, Aceh Tengah. (cir)

BANDA ACEH ( Waspada): Dalam upaya pembinaan, pengembangan dan pelestarian olahraga rekreasi, masyarakat dan tradisional Aceh, Pengurus Provinsi Federasi Olahraga Rekreasi dan Masyarakat Indonesia (Pengprov Formi) Aceh melakukan sosialisasi ke seluruh kabupaten/kota di Aceh. Kegiatan sosialisasi Formi di Aceh yang akan dilaksanakan mulai 23 Desember di Banda Aceh, menghadirkan peserta yang sebagai besar pendidik dan pelaku olahraga mewakili dari semua kabupaten/kota di Aceh. Ketua Umum Pengprov Formi Aceh Drs Safwan Yusuf melalui Sekretaris Umum Drs Bachtiar Hasan MPd di Banda Aceh, Minggu (19/12) mengatakan, sosialisasi bertujuan memantapkan program kerja Formi dalam mengembangkan pembinaan dan pelestarian olahraga tradisional di seluruh kabupaten/kota di Aceh. “Sasaran yang ingin dicapai kegiatan pembinaan dan pelestarian olahraga tradisional lebih aktif dan bergairah di Aceh, sehingga olahraga tradisional Aceh bisa berprestasi dan menjadi handalan di even nasional,” beber Bachtiar. Kecuali itu, dia menyebutkan maksud penting dari sosialisasi ini diharapkan terbentuknya pengurus cabang (Pengcab Formi) di seluruh kabupaten/kota di Aceh. “Dengan adanya Pengcab Formi, kegiatan dan pembinaan olahraga rekreasi dan masyarakat bisa aktif dan berjalan maksimal, terkoordinir di seluruh kabupaten/ kota di Aceh,” jelasnya. (b07)

paling mencolok pamer aurat di Negeri Serambi Makkah. “Erni hanya mengenakan celana pendek dan singlet yang sangat minim, sehingga sangat merusak Syari’at Islam yang sedang ditegakkan di Aceh,” ujarnya. Panitia Aceh Open dinilainya terlena dalam menentukan kostum atlet. “Jangan karena mempertahankan prestasi olahraga, syari’at dikorbankan. Kalau di daerah lain terserah mereka, tapi kalau di negeri ini kostum atlet putri harus ditetapkan mendukung syari’at,” tambah Tgk Rusli. Rahmat, 30, seorang warga Bireuen juga mengungkapkan kekecewaannya setelah menyaksikan peserta lomba memasuki garis finis di Pendopo Bupati setempat Sabtu (18/12). Bukan hanya peserta dewasa putra-putri, tapi cukup banyak dari kelas kanak-kanak dan remaja. Salah seorang atlet cilik di antaranya Nanda Nadli, 8, pelajar kelas II SD-16 Peusangan Bireuen, berhasil mencapai garis finis dengan selamat sekalilgus mengagumkan bagi sejumlah pengunjung. Ketua Pelaksana Alamsyah SIP dan Drs Idris Insya selaku seksi perlombaan, kata Rahmat, melakukan penilaian enam juara dari masing-masing kelompok putra-putri kategori dewasa. “Namun penilaian untuk kelas pelajar, tingkat anak-anak dan remaja tidak ada,” sesal Rahmat. Kalau tidak ada penilaian bagi atlet pelajar SD, SMP dan SMA, tambahnya, panitia seharusnya jangan menjadikan para pelajar sebagai atlet penggembira saja. (b16)

Waspada/Syahrul Karim

Walikota Langsa Drs Zulkifli Zainon MM (paling kiri) bersama Kasdim 0104 Aceh Timur Mayor Inf Nico Dipura (2 kanan) foto bersama dengan para juara lomba lari 10 K di Langsa, Minggu (19/12).

Lomba Lari 10 K Kodim Aceh Timur LANGSA (Waspada) : Hampir seribu peserta yang terdiri dari warga masyarakat, PNS, karyawan perbankan serta anggota TNI dan Polri dari Kabupaten Aceh Timur, Kota Langsa, Aceh Tamiang dan beberapa daerah lainnya termasuk Aceh Utara, mengikuti kegiatan lomba lari 10K di Langsa, Minggu (19/12). Kasdim 0104 Aceh Timur Mayor Inf Nico Dipura secara resmi melepas para peserta lomba di garis start depan Kodim Aceh Timur/Stadion Langsa. Para peserta lomba menempuh rute jalan Ahmad Yani, Teuku Umar terus memotong samping cafe strom tembus ke jalan TM Bachrum, selanjutnya menempuh rute jalan Masjid Ibrahim sampai simpang Komondo Birem Puntong. Dari sana para peserta memasuki kembali jalan AhmadYani arah barat terus ke titik finis berlokasi di garis start. Dengan tema, “Kodam Iskandar Muda bersama masyarakat Aceh siap menjaga perdamaian Aceh, menegakan kedaulatan dan mempertahankan wilayah Negara Kesatuan Republik Indonesia,” kegiatan lomba dilaksanakan untuk

menyambut dan memeriahkan HUT ke 54 Kodam IM yang jatuh pada 22 Desember 2010. Sejumlah pejabat penting seperti Walikota Langsa Drs Zulkifli Zainon MM, WadanYonif 111/ KB, Waka Polres Kota Langsa, Atim dan Atam serta pejabat sipil dan militer lainnya, menyambut para peserta yang mencapai garis finis. Dalam lomba tersebut, Yan Mintara (anggota Yonif 111/KB Tualang Cut) tampil sebagai juara pertama. Anggota Yonif lainnya Leo Weldi merebut runner-up, posisi III diraih Murdani (warga masyarakat). Pemenang harapan I, II, III masingmasing direbut Zulkarnaen (Brimob), Salahudin (warga Aceh Utara) dan Ramlan (Aceh Tamiang). Lomba menyediakan hadiah dengan nilai seluruhnya sebesar Rp30 juta. Enam pemenang lomba lari 10-K, selain meraih piala tetap juga uang tunai yang diserahkan Walikota Langsa Drs Zulkifli Zainon MM. Panitia lomba (Kodim Aceh Timur) juga menyediakan puluhan hadiah lainnya dalam acara lucky draw, di antaranya televisi, sepeda mini dan dispenser. (b26)

Tiga Angka Harga Mati Laskar Pase LHOKSEUMAWE ( Waspada): Jelang laga PSLS dengan Persitara di Stadion Tunas Bangsa Kecamatan Banda Sakti, Senin (20/12) sore ini, para pemain Divisi Utama Liga Indonesia dilarang keras menggunakan aksesoris. Larangan diungkapkan wasit Ferdinanduha asal Sibolga dalam tecnical meeting antara PSLS dan Persitara yang digelar di aula KantorWalikota Lhokseumawe, Minggu (19/12). “Saya hanya mengingatkan satu hal agar para pemain jangan ada yang memakai aksesoris apa-

pun selama pertandingan dimulai,” tegas Ferdinanduha, tanpa merinci jenis aksesoris dimaksud. Dalam duel nanti, PSLS akan berjuang sampai titik darah penghabisan agar mampu mengamankan poin penuh. Laskar Pase pun menyusun strategi permainan secara sempurna, yang turun tanpa dua punggawa inti Ganda Sahputra akibat akumulasi kartu kuning dan kapten M Isa yang kurang sehat. Manajer PSLS, Pangkuk, didampingi pelatih Imran Juned

Problem Catur

menyatakan, tiga angka sudah menjadi harga mati dan jauh hari telah diwanti-wanti kepada para pemain. “Dengan dukungan penuh masyarakat Aceh Utara dan Lhokseumawe khususnya, saya optimis PSLS akan mampu menaklukan Persitara,” pungkas Pangkuk. Menyinggung taktik yang akan digunakan, Imran Juned mengaku, sudah pasti akan ada taktik khusus yang bisa saja berubah. “Karena semuanya itu tergantung bagaimana nantinya saat pertandingan berlang-


sung,” jelasnya Sedangkan Manajer Persitara Rizal Hafid mengatakan, timnya yang tahun lalu degradasi dari Liga Super berambisi ingin lagi promosi. Karena itu sejak awal pihaknya telah melakukan persiapan matang termasuk merekrut sederetan pemain terbaik. Bahkan di antara 18 punggawa yang diboyong ke Lhokseumawe, pelatih Samsul Bahri turut menghiasinya dengan tiga pemain asing dan dua lainnya mantan pemain nasional Indonesia.(b15)



Hitam melangkah, mematikan lawannya lima langkah.

Jawaban di halaman A2.

1. Ikan yang namanya mengutip arti kata; Kulitnya berasa kasap seperti kulit katak puru. 7. Ikan dalam kelas Actinopterygii dan familia Sphyraenidae, suka menggigit penyelam dengan giginya yang tajam dan besar. 8. Ikan yang selalu mengiringi ikan hiu 9. Ikan laut bersisik halus, dagingnya digunakan untuk bahan membuat kerupuk. 10. Ikan lebar, buntutnya berduri dan berbisa. 12. Binatang melata berbisa, di laut maupun di darat. 15. Ikan laut besar yang menyusui, bernafas dengan paru-paru. 18. Hiu (Inggris). 19. Ikan laut sekerabat dengan cakalang dan banyak jenisnya. 20. Ikan kecil-kecil, tergolong marga Stolephorus. 21. Ikan laut yang banyak dijual di pasar ikan; Antonim susahin; Eletheroma tetradactylum. 22. Ikan hias, disebut ikan _____ karena warnanya mirip logam perhiasan. 23. Ikan yang dagingnya putih bersih, mengutip nama serat berbulu putih untuk dipintal menjadi benang.

24. Binatang reptilia bertubuh besar dan berkulit tebal, hidup di air tenang.


1. Ikan air tawar/empang yang sering digoreng garing di restoran. 2. Binatang tidak bertulang, berkulit keras, berkaki sepuluh dan bersepit dua pada kaki depannya. 3. Belut. 4. Ikan berwarna merah dan putih, biasa disebut-sebut untuk kualitas kejahatan. 5. Jenis hiu paling ganas yang diembeli nama binatang buas. 6. Ikan mangsi, dapat melilit. 11. Ikan yang disebut juga dolphin. 13. Jenis udang yang mahal harganya. 14. Ikan karang yang mengandung racun tetrodoksin, bisa menggelembung seperti bola. 15. Ikan buas pemakan daging yang hidup di sungai Amazon. 16. Cumi-cumi. 17. Ikan yang terdapat di Labuhan Bilik; Orang lebih suka makan telurnya yang sudah dikeringkan. 22. Pendingin ikan-ikan yang dijual di pasar.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan hari ini: sangat mudah (*), bisa diselesaikan dalam waktu tak sampai empat menit. Jawabannya lihat di halaman A2 kolom 1.

3 4 1 7 5 6 8 1 9 3 4 7

9 4 1 2 5 6 3 4 5 8 2 4 2 2 3 8 4 7 1 5 1 2 3 9 8

6 3 7 1 8 7 5 4 6 8 9 2 ve210

Sport A8 PIMNAD Peringkat III Seri II PBL BANDA ACEH (Waspada): PIMNAD menutup Seri II PBL 2010 dengan kemenangan 76-52 atas NSH GMC Jakarta di GOR Pajajaran Bandung, Minggu (19/12). Kemenangan ini menempatkan PIMNAD pada peringkat III klasemen sementara PBL 2010 dengan mengemas 13 poin, hasil dari enam kali menang dan tiga kalah dari sembilan game yang dilakoni. Menurut pelatih A Royhim Zulfan dari Bandung, kemenangan atas NSH-GMC tidak lepas dari disiplinnya pemain dalam melakukan defense yang solid, sehingga membuat tim asal Jakarta itu tidak bisa mengembangkan permainan. Turun dengan starter Jekki Sagala, Imam Awalludin, Gigih Wiraguna, Akbar Aulia dan Rinaldi HR, PIMNAD tampil impresif dengan serangan cepat. Namun permainan cepat PIMNAD masih mampu diimbangi pemain-pemain NSH GMC yang mengandalkan

man to man half court. Begitu pun, strategi ini berhasil ditembus dengan penetrasi yang dilakukan small forward PIMNAD ke daerah keyhole, yang akhirnya memenangkan kuarter ini dengan 18-14. Pada kuarter II, PIMNAD tetap tampil menekan. Pergerakan point guard lawan berhasil dihambat, sehingga membuat permainan NSH-GMC tidak seperti yang diinginkan oleh coach Tjuk Kustanto. Alhasil serangan balik yang dilakukan PIMNAD mampu memperlebar jarak keunggulan menjadi 20-11, sehingga menutup 1st half dengan angka 38-25. Di kuarter III, NSH-GMC mencoba menerapkan zone deffense 2-3. Namun 12 poin yang dihasilkan Jekki dan

Pembalap Aceh Juarai ARRC 2010 Di Qatar BANDA ACEH (Waspada): Pembalap kawakan Aceh, Reza Fahlevi, menjuarai seri terakhir Asia Road Racing Championship (ARRC) 2010 di sirkuit Losail International Circuit (LIC) Qatar, Sabtu (Minggu WIB). Reza yang membawa bendera Indonesia di even tersebut, menunggangi Kawasaki NHK Rextor MTR Manual Tech. Tampil percaya diri, pria lajang itu melaju di urutan pertama race kedua. “Race pertama dia urutan ketiga, lalu pada race kedua melesat ke urutan pertama,� ujar Ny Rita, ibunda Reza kepada Waspada, Minggu (19/ 12), seusai mendapat kabar dari anaknya di Qatar. Seri terakhir ARRC 2010 digelar di sirkuit Losail International Circuit (LIC) Qatar berlangsung

dalam dua race. Di race 1, kelas Underbone 115cc, Reza menempati urutan ketiga di bawah Rafid Topan (CKJ Motorsports), Hadi Wijaya (Kawasaki NHK Rextor MTR Manual Tech). Di posisi keempat Gilang Pranata Sukma (Bikers Indonesia BRT) dan Denny Triyugo (Yamaha TOP 1 FDR) diurutan kelima. Kebetulan kelas ini didominasi para pembalab Indonesia. Lalu pada Race 2, Reza Fahlevi dengan Kawasaki NHK Rextor MTR Manual Tech) memimpin yang disusul rekan satu tim, Hadi Wijaya di urutan kedua. Posisi ketiga, Fitriansyah Kete (Bikers Indonesia BRT), Hokky Krisdianto (Yamaha TOP 1 FDR) dan Prawat Yannawut PETRONAS Yamaha asal Thailand. (b05)

Gigih lewat tembakan 3 poin mampu memecahkan zone deffense tersebut. Akibatnya, bukannya menghambat laju perolehan angka, tapi justru malah memperlebar margin point menjadi 23-12, sehingga kuarter ini ditutup dengan 61-47 masih untuk keunggulan PIMNAD. Memasuki kuarter IV, head coach PIMNAD dr Lukman Hasibuan merotasi sejumlah pemain inti dengan pemain-pemain muda. Skuad muda PIMNAD ini bermain cukup baik dalam melakukan defense, namun penyelesaian akhir yang kurang akurat membuat quarter ini berlangsung seri 15-15, sehingga mengunci kemenangan PIMNAD 76-52 atas NSH GMC,

Klub Pacific Caesar Surabaya memantapkan posisi di peringkat pertama sebagai tim tak terkalahkan dengan nilai 18, disusul Cenderawasih Papua di urutan kedua dengan tujuh kali menang dan dua kali kalah dengan nilai 16. Di seri II ini, PIMNAD mencatat tiga kemenangan masing-masing atas Sahabat Semarang, Champ Bandung dan NSH-GMC Jakarta, serta dua kali kekalahan dari Pasific Caesar Surabaya dan Dasatim Banjarmasin. PBL 2010 akan dilanjutkan dengan putaran kedua seri III pada 19-24 Januari 2011 dengan klub Sahabat Semarang sebagai tuan rumah, kemudian seri IV di Bogor 3-8 Maret 2011 serta final four 17-19 Maret 2011. (b07)


Senin 20 Desember 2010

Medan Metropolitan

WASPADA Senin 20 Desember 2010


Diguyur Hujan, Gerak Jalan Demokrat Meriah


GERAK JALAN : Ketua Umum Partai Demokrat Anas Ubaningrum didampingi pengurus Partai Demokrat Walikota dan Wakil Walikota Medan Rahudman Harahap/Dzulmi Eldin , ikut berpatisipasi dalam gerak jalan santai yang diadakan Sabtu (18/12), di Lapangan Benteng Medan.

MEDAN (Waspada): Hujan yang mengguyur kota Medan, Sabtu (18/12) pagi, tak menyurutkan langkah kaki masyarakat Sumut khususnya Medan yang mengikuti gerak jalan santai bersama Ketua Umum DPP Partai Demokrat Anas Urbaningrum dan para kader Demokrat lainnya. Gerak jalan yang dihadiri puluhan ribu warga ini dibuka oleh Anas Urbaningrum setelah Jumat (17/12) siang melantik pengurus DPD Partai Demokrat Sumut. Pantauan Waspada, gerak jalan baru dimulai pukul 07.15 memilih rute dari Lapangan Ben-teng Jalan P. Diponegoro – Jalan Imam Bonjol Hotel Danau Toba Cek Point I (air minum) – Jalan Diponegoro Kantor Gubsu Cek Point II (pembagian kupon undian) – Jalan Cut Nyak Dien – dan finish di Lapangan Benteng. Peserta berjalan dengan semangatnya sembari memegang kupon luckydraw yang diberikan panitia membuat acara itu berlangsung meriah. Sekitar pukul 08.12, peserta gerak jalan kembali tiba memadati lapangan. Meskipun hujan belum juga reda, masyarakat tetap semangat dan terhibur akan hadiah yang disajikan panitia. Masyarakat juga menyempatkan untuk bersalaman dan berfoto bersama dengan anggota DPR RI Ruhut Sitompul atau yang lebih dikenal dengan Poltak Si Raja Minyak. Acara yang paling dinanti peserta gerak jalan adalah pembacaan kupon undian yang beruntung untuk mendapatkan hadiah yang disediakan. Hadiah yang diberikan panitia mencapai 350 unit

PPP Beri Hak Suara Organisasi Sayap

Usut Penyerobot Tanah Negara Atas Nama Rakyat

Joko Purwanto Pimpin AMK 2010-2015 MEDAN (Waspada): Sekretaris Jenderal (Sekjen) DPP PPP Irgan Chairul Mahfidz secara resmi menutup pelaksanaan Muktamar II AMK di Aula Jabal Noor Asrama Haji Medan, Sabtu (18/12) dini hari. Dalam acara penutupan, Irgan yang juga anggota Komisi IX DPR-RI menegaskan seluruh rekomendasi yang dihasilkan oleh Muktamar II AMK termasuk memberikan hak suara bagi organisasi sayap (AMK,GPK, GMPI,WPP dan GMII) akan diakomodir pada pelaksanaan Muktamar PPP pada Juli 2011. “Saya salut dengan AMK di tengah orang sudah lelap dengan istirahatnya namun kader-kader AMK terbangun dari istrihat memikirkan kemajuan PPP. Saya yakin semangat Muktamar ini akan mampu membawa PPP menjadi lebih baik di masa yang akan datang,” ujarnya. Irgan mengharapkan Ketua AMK periode 2010-2015 terpilih, Joko Purwanto, agar menjalankan keputusan-keputusan yang diambil dalam Muktamar II AMK untuk membesarkan AMK dimas yang akan datang. Pada kesempatan itu, Irgan juga mengucapkan rasa bangganya bagi PW AMK Sumut di bawah pimpinan Aswan Jaya yang sudah mampu melaksanakan Muktamar II AMK berjalan dengan sukses dan lancar. Bahkan Irgan mengungkapkan dengan suksesnya Muktamar II AMK ini tidak menutup kemungkinan kalau Muktamar PPP Juli 2011 mendatang dilaksanakan di Kota Medan ini. Sementara itu, pemilihan yang dilakukan Sabtu (18/12)

dini hari, Joko Purwanto menggantikan Ketua Umum AMK yang lama Syafruddin Anhar. Joko yang sebelumnya merupakan Sekretaris Jenderal (AMK) berhasil menyisihkan dua calon lainnya, yakni Busrizalti yang meraih 20 suara dan Ahmad Ferry Shadat yang sama sekali tidak mendapatkan suara. Perolehan suara Joko Purwanto meraih suara 141 , Busrizalti 20 dan Ahmad Ferry Shadat tidak mendapatkan suara sedangkan absen 4 suara. Dalam acara itu juga ditentukan tim formatur yang dipilih oleh Muktamirin yang akhirnya memilih Aswan Jaya (Ketua PW AMK Sumut) menjadi tim formuatur dan Nasrullah (Ketua PW AMK Kalsel) juga sebagai anggota tim formatur yang bertugas untuk menentukan kepengurusan Pimpinan Nasional (PN) AMK periode 2010-2015. Ketua PW AMK Sumut Aswan Jaya menyampaikan rasa terimakasihnya kepada semua pihak yang sudah membantu terlaksananya acara Muktamar II AMK baik secara moril dan materi.Aswan juga memohon maaf kepada seluruh elemen masyarakat yang merasa terganggu dengan acara Muktamar II AMK tersebut Rekomendasi Dengan terbentuknya kepengurusan yang baru, maka AMK akan melaksanakan hasil rekomendasi internal dan eks-

Penyaluran Pupuk Bersubsidi Akan Bermasalah MEDAN (Waspada): Penyaluran pupuk bersubsidi 2011 untuk petani dikhawatirkan akan kembali mengalami keterlam-batan. Pasalnya, hingga Desember 2010, Surat Keputusan (SK) untuk penyaluran pupuk bersubsidi tahun depan masih belum juga ditandatangani Menteri Pertanian. “Belum ditandatanganinya SK Menteri Pertanian tentang kuota distribusi pupuk bersubsidi bagi petani ini, yang meng-hambat penyaluran pupuk bersubsidi kepada petani,” kata Anggota Komisi B Bidang Perekonomian Brilian Moktar kepada wartawan di Gedung DPRD Sumut, Kamis (16/12). Menurut Brilian, keterlambatan penyaluran pupuk bersubsidi bahkan bisa lebih parah dari tahun 2010. Diperkirakan, jika SK Menteri Pertanian turun di Desember 2010, maka kemung-kinan pendistribusian baru bisa dimulai pada Maret 2011. Namun kalau ternyata pada Desember ini SK Menteri Pertanian belum juga turun, maka hampir dipastikan sampai pada Maret 2011 pendistribusian pupuk bersubsidi tidak akan terealisasi. “Bisa-bisa distribusi pupuk teralisasi di April 2011,” kata politisi PDI Perjuangan itu. Menurutnya, di tahun-tahun sebelumnya permasalahan selalu terjadi karena kabupaten/kota tidak mengalokasikan dana pendamping untuk pupuk bersubsidi. Kemudian Pemkab/ Pemko dan Pemprovsu juga terlambat membuat SK kuota pupuk bersubsidi. “Tetapi di tahun 2011 ini, seluruh kabupaten/kota dan provinsi telah mengeluarkan SK kuota pupuk bersubsidi. Tapi Kementerian Pertanian belum juga menandatangani SK Menteri tentang kuota pendistribusian pupuk bersubsidi untuk Sumatera Utara,” kata Brilian. Melihat problem ini, tegas Brilian, maka sudah kesalahan penyaluran pupuk berada di tangan pemerintah pusat, bukannya pada produsen pupuk. Karena Pemkab/ Pemko dan Pemprovsu telah menga-jukan usulan kuota pupuk bersubsidi ke Menteri Pertanian. (m48)

ternal. Adapun isi rekomendasi internal itu, yakni meminta kepada PN AMK segera membuat buku panduan sistem pengkaderan AMK. merekomendasikan kepada PN AMK untuk mendapat mendesak PPP di Muktamar PPP yang akan datang, agar semua organisasi sayap (AMK,GPK, GMPI, GMII) untuk dapat diakui secara dejure and defacto. Selain itu merekomendasikan kepada PN AMK agar dapat mendesak PPP untuk memprioritaskan pengurus sayap untuk menjadi pengurus harian partai. Juga merekomendasikan kepada PN AMK untuk memperjuangkan secara bersama-sama dengan organisasi sayap yang lainnya agar dapat hak suara

dalam setiap permusyawaratan di semua tingkatan. Kemudian, merekomendasikan kepada PN AMK bersama organisasi sayap lainnya mengusulkan dengan segera tentang dana pembinaan untuk seluruh organisasi sayap PPP. Merekomendaskan kepada PN AMK agar forum muktamar PPP yang akan datang untuk memilih pemimpin partai yang memiliki komitment dan konsistensi dalam menjalankan roda organisasi partai, selanjutnya, kepada PN AMK agar mengusahakan keanggotaan AMK dalam KNPI tanpa persyaratan SKT. Serta Merekomendasikan kepada PN AMK unrtuk seera membuat baju seragam AMK secara nasional.

Kapolri agar tegas terhadap perjudian Isi dari rekomendasi eksternal, yakni mendesak kepada pemerintah agar segera menyelesaikanpersoalan–persoalanbangsa yang meliputi polemik pemerintahdengaprovinsiDIY,menyelesaikan carutmarut TKI, serta masalah korupsi yang terkait dengan mafia pajak dan kasus Century. Selain itu, mendesak Kapolri agar bertindak tegas terhadap pelaku perjudian, pengedar narkoba, premanisme, dan penyelundupan. Mendesak pemerintah untuk menetapkan hukuman mati kepada koruptor serta mendesak pemerintah agar dalam penanggulangan bencana bergerak cepat, tepat dan efektif tanpabirokrasi berbelit-belit.(chr)

Hanura Sumut Ikuti Rapimnas I Di Jakarta MEDAN (Waspada): Ketua Partai Hati Nurani Rakyat (Hanura) Sumatera Utara bersama anggota legislatif dari partai Hanura ditambah pengurus DPD mengikuti Rapat Pimpinan Nasional (Rapimnas) I di Hotel Sultan Jakarta yang berlangsung hari ini 20-22 Desember 2010. Hal ini ditegaskan Ketua Partai Hanura Sumut Zulkifli Efendi Siregar didampingi sekretaris Darwin Lubis, bendahara Ibrahim Husein, wakil ketua Alex A. Kawilarang, Edi Saputra Thaher, wakil sekretaris Edi Susanto Sembiring, Agus Susanto di Sekretariat DPD Partai Hanura Sumut Jalan Sei Besitang Medan, Minggu (19/12). Dijelaskan Zulkifli Siregar, Rapimnas dibuka ketua umum Partai Hanura kemudian tanggal 21 Desember diperingati HUT Partai Hanura. “Di sinilah 65 anggota legislatif Partai Hanura Sumut diundang dengan perincian anggota legislative di Kab/Kota ada 58 orang, DPRDSU 5 orang dan DPR RI 2 orang ditambah pengurus DPD,” kata Zulkifli Efendi Siregar. Rapimnas I Partai Hanura tahun 2010 mengambil tema “Saatnya membangun partai yang solid dan merakyat di semua tingkatan untuk memenangkan Pemilu 2014.” Menurutnya, dalam Rapim nanti akan dibicarakan sifatnya membangun kebijakan Partai Hanura, usul-usulan dari kita di antaranya pembenahan organisasi partai kita. “Nanti setelah

selesai Rapim ini kita melaksanakan Muscab Partai Hanura Sumut yang rencananya Januari-Maret 2011 yang diikuti 30 DPC yang ada di Kab/Kota,” jelas Zulkifli Efendi Siregar. Dalam penjaringan ketua DPC, pihaknya membuka seluas-luasnya untuk umum yang bukan kader. Sementara itu, Darwin Lubis menambahkan, pengurus DPD Partai Hanura hasil Munas I dengan SK yang diterbitkan strukturnya oleh DPP tanggal 29 Oktober 2010, diterbitkan SK defenitif oleh DPP dengan nomor SK No. Skep/167/DPPHanura/II/2010, tertanggal 10 Nopember 2010.

lebih, yang terdiri dari tiga unit sepeda motor, lima buah TV 29 inci, 10 kulkas, 10 sepeda, 20 handphone, 20 rice cooker, 20 kipas angin, 50 setrika, 50 jam dinding, 50 payung, 20 mixer, 10 dispenser, 20 kompor gas, dan lainnya. Melihat banyaknya dan semangatnya peserta gerak jalan membuat kagum Ketua DPP Partai Demokrat Sumut Anas Urbaningrum. Menurutnya, tetap tingginya semangat peserta gerak jalan, berarti Partai Demokrat di Sumut juga punya semangat yang tinggi. Adapun pengurus DPD Partai Demokrat Sumut yang dilantik Jumat (17/12) sore kemarin oleh Ketua Umum DPP Partai Demokrat Anas Urbaningrum yakni, Ketua DPD Demokrat Sumut HT Milwan, Wakil Ketua I Jhon Hugo, Wakil Ketua II Zulkarnain Damanik. Sekretaris Partai Demokrat Sumut, Tahan Manahan Panggabean, Wakil Sekretaris I Farianda Putra Sinik, Wakil Sekretaris II Yunus Rasyid, Wakil Sekretaris III T Dirkhansyah Abu Subhan, Wakil Sekretaris IV Dartati Damanik, Wakil Sekretaris V Sapta Bangun, Wakil Sekretaris VI Sopar Siburian, Bendahara, Arif Rahman, Wakil Bendahara I Meilizar Latief, Wakil Bendahara II Layari Sinukaban. Sedangkan, Majelis Pertimbangan Daerah (MPD) Partai Demokrat Sumatera Utara, terdiri dari Ketua MPD H Saleh Bangun, Wakil Ketua I Rahudman Harahap, Wakil Ketua II Palar Nainggolan, Wakil Ketua III Suherdi, Wakil Ketua IV Yani Simanjutak, Sekretaris MPD Mutawali Ginting, Wakil Sekretaris I MPD Ida Budiningsih, Wakil Sekretaris II MPD Ahmad Ikhyar. (h02)

“Inilah SK DPP hasil Musda I Partai Hanura Sumut di Ciloto, Jawa Barat dengan ketua H.Zulkifli Efendi Siregar, MSC, sekretaris Ir. H.Darwin Lubis dan bendahara Ibrahim Husein, SE,” katanya. Pengurus DPD Partai Hanura Sumut melaksanakan Rapimnas di Jakarta dengan tiga agenda, pertama Rapimnas sendiri yang pesertanya KSB (Ketua, Sekretaris, Bendara-red) Partai Hanura dari seluruh tingkat provinsi. Kemudian ada temu legislative, seluruh anggota DPR se Indonesia lebih kurang 911 anggota DPR dari Partai Hanura bertemu di Jakarta dan dilanjuti HUT ke 4 Partai Hanura. (m39)

Waspada/Rudi Arman

Pengurus DPD Partai Hanura berfoto bersama di Sekretariat Kantor DPD di Jalan Sei Besitang No.4 Medan, sebelumnya bertolak ke Jakarta mengikuti Rapimnas di Hotel Sultan, Jakarta, Minggu (19/12).

MEDAN (Waspada): Maraknya kasus sengketa tanah di Sumut harus menjadi perhatian serius dan harus diusut tuntas oleh penegak hukum. Apalagi oknum-oknum yang bermain dengan leluasa mengatasnamakan nama rakyat untuk menyerobot tanah negara milik PTPN dan memutarbalikan fakta yang ada. Seperti kasus tanah seluas 32 hektar di Pasar IV Desa Helvetia Kec. Labuhan Deli Kab. Deli Serdang milik PB Al-Washliyah, ini harus disikapi pemerintah ataupun aparat penegak hukum, baik di provinsi maupun di pusat. Sebab, kasus tanah yang ada di Sumut sepertinya tidak terselesaikan dengan tidak ada tindakan yang tegas untuk mengusut oknum-oknumnya. “Modus operandinya hampir sama yakni mengatasnamakan para penggarap yang notabene mereka cuma diperalat,” tegas Bahdin Nur Tanjung kepada wartawan seusai pelantikannya sebagai Ketua Pusat Pengkajian Kebijakan Strategis DPD Partai Demokrat Sumut, kemarin. Menurutnya, masih banyak kasus tanah

lainnya yang hingga kini belum tuntas karena ada aktor intelektual yang ada dibelakang kasus tersebut. “Seperti di KIM, itu akan merusak nama baik bangsa karena di kawasan itu banyak berdiri perusahaan-perusahaan asing. Apalagi tanah milik Al Washliyah yang ada di Helvetia, itu jelas sudah peruntukannya, namun direkayasa oleh oknum-oknum yang tidak bertanggungjawab. Al Washliyah itu juga milik masyarakat,” katanya. Menanggapi kasus sengketa tanah milik AlWashliyah yang diklaim 65 penggarap sebagai miliknya, Ketua PB AlWashliyah Lukman Hakim Hasibuan mengingatkan kepada penggarap untuk tidak menganggap enteng Al Jam’iyatul Washliyah. Pihaknya juga akan meneruskan kasus tanah itu ke KPK maupun Komisi Yudisial (KY) jika ditemukan adanya permainan dalam persidangan gugatan yang diajukan oleh 65 orang yang tidak jelas tersebut. “Ribuan warga Al Washliyah siap pertahankan tanah tersebut, karena itu milik warga Al Washliyah,” (h02)

Triliunan Proyek PLN Dikuasai Luar Sumut MEDAN (Waspada): PT Perusahaan Listrik Negara (PLN) Persero diminta lebih mengutamakan dam memberdayakan para pengusaha dan tenaga kerja lokal dalam pengerjaan proyekproyek di Sumut. Permintaan itu disampaikan anggota Komisi D bidang pembangunan DPRD Sumut dalam rapat dengar pendapat dengan jajaran PT PLN Proyek Induk Pembangkit dan Jaringan Sumut, Aceh dan Riau (Pikitring SUAR) di gedung dewan di Medan, Minggu lalu. Rapat dengar pendapat tersebut dihadiri sejumlah anggota Komisi D DPRD Sumut lainnya di antaranya, Tunggul Siagian, Budiman P Nadapdap, Rooslynda Marpaung, Abul Hasan Maturidi, Palar Nainggolan, M Nasir, dan JH Silalahi. Serta GM PT PLN Pikitring SUAR Bintatar Hutabarat itu. Dalam pertemuan itu para anggota dewan sebelumnya sempat menyampaikan kekecewaan mereka karena hampir seluruh proyek kelistrikan di daerah itu dikerjakan pihak luar, baik pengusaha maupun pekerjanya. “Triliuan rupiah proyek PLN di Sumut yang saat ini tengah dikerjakan, tapi sama sekali tidak menyentuh pengusaha dan tenaga kerja lokal. Semuanya ‘di-impor’ dari luar daerah, sementara pengusaha dan tenaga kerja di Sumut hanya menjadi penonton,” ujar Sekrestais Komisi D DPRD Sumut, Tunggul Siagian. Menurut dia, PLN Sumut seharusnya lebih mengutamakanpengusahadantenagakerjalokal. “Selama ini GM-nya kan ‘impor’, Tapi sekarang sudah putra daerah. Semula kita berharap Pak Bintatar yang putra daerah lebih mengutamakan pengusaha dan tenaga kerja lokal, tapi kita lihat harapan itu justru semakin jauh,” katanya. Politisi Partai Demokrat itu memberi contoh

pengerjaan jalan masuk PLTA Asahan III yang terbagi dalam tiga bagian dengan nilai proyek mencapai Rp175 miliar, yang semestinya dapat diberikan kepada pengusaha lokal. “Kapan lagi kita memberdayakan pengusaha dan tenaga kerja lokal,” kata Tunggul Siagian. Bintatar sendiri tidak memberikan jawaban yang jelas terhadap pertanyaan anggota dewan itu. Dia hanya menjawab akan menampung seluruh saran dan masukan dari para anggota DPRD Sumut tersebut. Banyak proyek tertunda Dalam poin kesimpulan lainnya disebutkan, Komisi D DPRD Sumut bersama pihak PT PLN Pikitring SUAR sepakat untuk bersama-sama memperjuangkan dan mendesak pemerintah pusat untuk segera merealisasikan rencana kerja dan pembangunan kelistrikan di Sumut yang tertunda pada 2010. Para anggota dewan mempertanyakan nasib pembangkit-pembangkit listrik di 15 lokasi dan sudah mendapatkan izin, namun hingga kini tidak juga dikerjakan, termasuk di dalamnya PLTD Sarulla, PLTU Medan dan PLTU Sibolga. “Kita patut mempertanyakan nasib proyekproyek pembangkit ini dan bersama-sama dengan PLN Pikitring mendesak pusat untuk segera direalisasikan. Kalau memang investor lama tidak mampu, sebaiknya kita beri peluang kepada investor lain,” kata Tunggul Siagian. Anggota Komisi D lainnya, Budiman Nadapdap, mengatakan, DPRD Sumut bersama PT PLNWilayah Sumut, Pikitring maupun Kitlur (pembangkitan dan penyaluran) Sumut perlu membuat grand design agar persoalan-persoalan yang selama ini menghambat program pembangunan pembangkit tenaga listrik di Sumut dapat diatasi.(m48)

Medan Metropolitan


WASPADA Senin 20 Desember 2010

Pedagang Tolak Bayar Kontribusi Fasilitas Pasar Hancur Rugikan Pedagang MEDAN (Waspada): Pedagang beberapa pasar tradisional di Medan tetap menolak membayar kontribusi berjualan kepada PD Pasar sebelum perusahaan daerah milik Pemko itu membenahi pasar. Ironis, di tengah fasilitas pasar hancur menyebabkan omset pedagang menurun, PD Pasar tetap memberlakukan kenaikan tarif kontribusi tempat berjualan. Tunggakan pedagang tahun 2009 akibat fasilitas pasar tidak dibenahi, membengkak menjadi Rp5,3 miliar. Di tengah kondisi tersebut PD Pasar yang sedang melakukan sosialisasi kenaikan kontribusi kepada pedagang di seluruh pasar akan mengefektifkan kenaikan tarif kontribusi tempat berjualan sebesar 100 persen tersebut mulai Januari 2011. Muslim Sikumbang pedagang Pasar Aksara, kemarin, mengatakan, PD Pasar harus menuntaskan berbagai tuntutan pedagang sebelum kenaikan diberlakukan.

Adapun tuntutan pedagang Aksara di antaranya PD Pasar harus menghilangkan seluruh pedagang kaki lima (PKL) yang berjualan di dalam pasar hingga yang berada di halaman pasar, melakukan renovasi gedung yang telah mengalami banyak kebocoran, katanya. Disamping itu perawatan sarana dan prasarana pasar juga harus dituntaskan seperti tidak berfungsinya ventilasi udara (kipas angin) Pasar Aksara, penataan jenis dagangan pedagang atau penzoningan yang tidak teratur serta lainnya, sebutnya. Apabila PD Pasar tidak da-

Efendi Capah Ketum Himpak 2010 - 2015 MEDAN (Waspada): Drs. Citra Efendi Capah,M.Sp secara aklamasi terpilih sebagai Ketua Umum Himpunan Masyarakat Pakpak (Himpak) saat Mubes Himpak II di Hotel Grand Antares Medan baru-baru ini. Wagubsu Gatot Pujonugroho yang hadir pada Mubes tersebut mengharapkan Himpunan Masyarakat Pakpak dapat menjadi suatu wadah untuk mengakomodir program-program yang bergerak dari bawah dan bagaimana merencanakan program Himpak ke depan, sehingga Himpak dapat menjadi salah satu Ormas yang besar. “Pembukaan itu ditandai dengan memukul genderang dan memotong Pelleng Ncina Mbara (makanan khas Pakpak) yang diserahkan panitia,” ujar Ketua Panitia Syamsuddin Angkat, Jumat (17/12) malam. Syamsuddin juga mengatakan, Bupati Pakpak Barat Remigo yang mewakili 4 kepala daerah Si Lima Suak juga hadir pada Mubes ini. Hadir pada Mubes itu antara lain Bupati Pakpak Bharat beserta Wakil, Wakil Bupati Dairi, Perwakilan Bupati Singkil, Perwakilan Walikota Subulussalam, Bapak Richard Eddy M Lingga, Agustinus Manik, beberapa orang anggota DPRK Subulussalam, DPRD Kabupaten Dairi, DPRD Kabupaten Pakpak Bharat, Ketua FORKALA Sumatera Utara dan ratusan masyarakat yang memadati ruangan. Pada tanggal 11 Desember 2010 mulai pagi diadakan penggodokan Pengurus DPP HIMPAK Periode 2010-2015 Lister Berutu diangkat sebagai Sekretaris Jenderal, Kasiman Berutu sebagai Bendahara. (h02)

Reuni SMA Tunas Kartika-I MEDAN (Waspada): Para alumni SMA Tunas Kartika I berencana menggelar reuni dan temu kangen di Intermezzo Restro Jl. Setia Budi Medan, Minggu (26/12). Acara yang digelar dari pukul 16:00 s/d 23:00 diharapkan dapat menganyam kembali tali silaturrahmi serta keakraban dan persaudaraan sesama alumni angkatan 83 yang mungkin kian memudar seiring kesibukan masing-masing dan tergerus waktu. Informasi ini disampaikan Ketua Reuni Kangen alumni 83 SMA Tunas Kartika I Erwan Razali Nasution didampingi Sekretaris Elly Syafrida dan Bendahara Zulaita Tanjung, saat rapat persiapan panitia di Restoran Ayam Penyet Jl. H. Adam Malik, kemarin. Ditambahkan Erwan, untuk memeriahkan acara selain mengundang para guru-guru yang pernah membimbing mereka, juga akan diadakan gerakan sosial berupa pemberian tali asih kepada anak-anak dari para alumni 83 yang telah wafat, dan cenderamata kepada ibu dan bapa guru. “Kita berharap seluruh alumni 83 dapat menyukseskan kegiatan ini dengan memberikan sumbangsih, baik tenaga, pikiran dan materi. Untuk informasi lebih lanjut dapat menghubungi Sekretariat Panitia Jl. Sikambing Gg. Pattimura No. 8 Sekip atau di nomor: 081263999200-06177788200,” kata Erwan.(m27)

Malam Amal SMPN 37 Sukses MEDAN (waspada): Malam kegiatan amal yang digelar SMPN 37 Medan di Hotel Royal Perintis Jalan Perintis Kemerdekaan Medan, Jumat (10/12) malam, berlangsung sukses denga berhasil mengumpulkan dana sebesar Rp30.200.000. Kepala SMP Negeri 37 Robert Siahaan mengatakan, dana sebanyak itu terkumpul berkat partisipasi dari orang tua murid secara spontanitas serta beberapa donatur dari BUMN-BUMD Se Sumatera Utara yang peduli terhadap pendidikan. SMP Negeri 37 Medan merupakan salah satu Komite Sekolah yang terpilih sebagai penerima Subsidi Hibah Bersaing (SHB)Tahun 2010 dengan bantuan dana sebesar Rp 10 juta yang digunakan oleh komite sekolah dalam kegiatan pengumpulan dana untuk peningkatan pendidikan di sekolah masing-masing. “Dana tersebut nantinya dipergunakan untuk pembangunan pendidikan SMP Negeri 37 Medan,” kata Robert Siahaan. Acara itu dihadiri Kabid Diknas & pelaporan Khusus Diknas Provsu Dwi Anang Wibowo mewakili Kadiknas Provsu Syaiful Syafri yang sangat apresiasi dengan kegiatan ini. (m24)

TNI AD Tingkatkan Operasional Satuan MEDAN (Waspada): TNI Angkatan Darat terus berupaya meningkatkan kesiapan operasional satuan, kualitas SDM, kesejahteraan prajurit dan PNS beserta keluarganya, disamping meningkatkan administrasi dan hukum. Selain itu melanjutkan pembangunan satuan berdasarkan kekuatan pokok minimum yang telah disusun dan direncanakan. Hal itu disampaikan Kepala Staf TNI Angkatan Darat (Kasad) Jenderal TNI George Toisutta dalam amanatnya yang dibacakan Kasdam I/BB Brigjen TNI Murdjito saat upacara peringatan Hari Juang Kartika di Makodam, Rabu (15/12). Dikatakan Kasdam, peringatan Hari Juang Kartika Tahun 2010 dipusatkan di kota Ambarawa, untuk mengenang kembali sosok Panglima Besar Jenderal Sudirman dalam pertempuran 65 tahun silam yang dikenal dengan peristiwa ‘Palagan Ambarawa’. Tema Hari Juang Kartika kali ini adalah TNI Angkatan Darat Bersama Segenap Komponen Bangsa, Siap Membantu Dan Mengatasi Kesulitan Rakyat. Pada Hari Juang Kartika ini, Kodam juga melakukan acara doa lintas agama di Masjid At Taqwa Kodam serta aula Makodam I/BB. Turut hadir Irdam Kolonel Inf M. Syaril Arsyad, Asrendam Letnan Kolonel Inf Teguh Bangun Martoto, Para Asisten Kasdam, Staf Ahli Pangdam, Para Kabalakdam, Para Danyon BS wilayah Medan, Dandim 0201/BS serta Para Perwira, Bintara, Tamtama dan PNS Kodam I/BB. (h02)

pat melakukan tanggungjawabnya secara professional, maka usaha pedagang tidak akan berjalan maksimal sehingga kenaikan kontribusi sebesar 100 persen yang akan diberlakukan akan menyulitkan pedagang untuk membayar. Sementara itu, dalam kondisi kontribusi belum mengalami kenaikan sudah banyak pedagang yang menunggak membayar kontribusi akibat kondisi usaha pedagang kurang maju akibat ketidaknyamanan pasar, sehingga jumlah pengunjung ke pasar berkurang. Terpaksa dinaikkan Kabag Hukum dan Humas PD Pasar Novi Zulkarnain kepada wartawan membenarkan PD Pasar akan menaikkan tarif

kontribusi tempat berjualan rata-rata sebesar 100 persen akan berlaku efektif Januari 2011. Kenaikan 100 persen tersebut terpaksa dilakukan karena sejak tahun 2003 hingga saat ini PD Pasar belum ada menaikkan kontribusi tempat berjualan, sementara itu beban operasional setiap tahunnya meningkat sehingga langkah tersebut terpaksa dilakukan, ujarnya. Belum ada keringanan Terkait tunggakan kontribusi pedagang menurut data tahun 2009 telah mencapai Rp5,3 miliar setelah kurang terlindunginya usaha mereka diakibatkan lemahnya kinerja PD Pasar memberikan pelayanan, Novi mengatakan belum

ada kebijakan PD Pasar memberi keringanan. Sebagai perusahaan daerah, PD Pasar harus mempertanggungjawabkan laporan keuangan pada inspektorat pemerintah, BPK, BPKP, dan Badan Pengawas Pemko Medan, sehingga keringanan tidak mudah dilakukan, sebutnya. Saat ini PD Pasar sedang melakukan sosialisasi ke 52 pasar-pasar tradisional yang merupakan aset Pemko, sedangkan pasar yang telah selesai disosialisasikan di antaranya sebanyak sembilan pasar di cabang I, dua pasar di Cabang III dan dua pasar di Cabang II termasuk, Pusat Pasar, Petisah, Pasar Aksara dan lainnya, ujarnya.(m40)

Ketum MUI Bagikan Bukunya Gratis MEDAN (Waspada): Ketua Umum Majelis Ulama Indonesia (MUI) Kota Medan Prof DR H Moh Hatta resmi meluncurkan dua buku pada ulang tahunnya yang ke 60 dan perkawinannya ke 33 di Hotel Garuda Plaza, Jumat (17/12) malam. Pada acara itu, sebanyak 800 buah buku itu diberikan secara gratis kepada para pejabat, tamu dan undangan yang hadir di acara peluncuran buku dengan judul “Simbiotika Dakwah Islam” dan Mutiara Melayu dari Langkat.” Hatta mengaku sangat bahagia dan terharu. Betapa tidak, di acara peluncuran buku dalam rangka milad ke-60 dan 33 tahun perkawinannya dengan Dra Hj Pipih Shopiah dihadiri berbagai tokoh nasional dan Sumut. Bahkan, sebelum diluncurkannya dua buku ini, buku ini dibedah oleh tokoh-tokoh dariJakarta,SurabayadanMedan. Di antara tokoh tersebut yakni, Brigjen TNI Ahmad Yani Basuki, DR HjWahidah Zein dan DR M Yacub Amin, MA. Yang

membuatnya bahagia, semua kegiatan tersebut diselenggarakan oleh anak, yunior, dan alumni Fakultas Dakwah IAIN Sumut. “Saya tak menyangka begitu besar darma bakti mahasiswa saya. Judul buku saya Simbiotika Dakwah Islam dibuat anak saya Prof DR H Syahrin Harahap dan sebagai editor DR Sulidar MA, tamatan Malaysia,” papar Hatta. Dikatakan Hatta, buku “Simbiotika Dakwah Islam” merupakan bagian dari renungan, pikiran, dan catatan pengalamannya yang dengan komitmen tradisi intelektual DR Sulidar, diedit untuk dipublikasikan. Sulidar sendiri merupakan doktor Islamic Studies dari Universitas Malaya. Mengenai buku Mutiara Melayu dari Langkat, awalnya Hattamalu dikatakan sebagai mutiara. Karena dia khawatir yang ditulis itu tidak sesuai dengan apa yang sesungguhnya ada pada dirinya. “Saya yang lemah dan dhoib

ini. Tapi anak-anak saya katakan ke saya, biarlah kami tulis seperti ini, niat kami mendorong orangorang Langkat meniti jejak seperti bapak. Saya terpaksa menyerah karena saya pikir untuk syiar dan kebaikan. Hingga akhirnya saya harus menerima sesuatu yang sebenarnya belum tentu sesuai dengan kata hati kecil saya,” papar Hatta. Sejumlah pejabat hadir dalam peluncuran buku itu. Diantaranya, Walikota Medan dan wakilnya Rahudman Harahap dan Dzulmi Eldin, Pj Walikota Tebing Tinggi Eddy Syofian,Kepala Kanwil Kementerian Agama Sumut Syariful Mahya Bandar. Berikutnya, mantan Sekdaprovsu RE Nainggolan, Ketua Umum MUI Sumut Prof DR H Abdullah Syah, MA, Tuan Guru Babussalam, Syekh Hasyim Al-Syarwani, Rektor IAIN Sumut Prof DR Nur Ahmad Fadhil Lubis, Pembantu Dekan Fak. Dakwah IAIN Sunan Ampel Surabaya, DR HjWahidah Zein, tokohmelayuTengkuLukmanSinar, Raja Muda dan lainnya. (h02)

Pemko Minta Hubungan Sister City Ditingkatkan MEDAN (Waspada): Hubungan antar luar negeri (LN) khususnya dengan kota-kota bersaudara (sister city) perlu ditingkatkan. Sebab, melalui hubungan tersebut merupakan peluang bagi Kota Medan untuk mempromosikan seni, budaya dan lainnya. Hal itu disampaikan Walikota Medan Rahudman Harahap diwakili Wakil Walikota Dzulmi Eldin ketika membuka acara sosialisasi hubungan kerjasama LN dan kota bersaudara (Sister City) Kota Medan di Ruang Roosewood Hotel Grand Aston City Hall Medan, kemarin. Menurut walikota, terjalinnya hubungan dengan LN tentu diharapkan dapat meningkatkan taraf kehidupan bagi masyarakat Kota Medan. Bila ini tidak terwujud, maka tidak ada artinya hubungan dengan LN. “Menjalin hubungan dengan kota-kota bersaudara harus

ada manfaatnya. Apa saja yang menyentuh segala aspek kehidupan masyarakat perlu dievaluasi sehingga Kota Medan nantinya dapat menjadi kota yang berbudaya,” ucapnya. Sementara itu, Kabag Hubungan Kerjasama Setda Kota Medan Rivai Nasution dalam laporannya secara transparan memberikan gambaran yang jelas kepada para stakeholder dan mitra Pemko Medan tentang hubugan kerjasama LN dan kota bersaudara. Rivai mengungkapkan, acara sosialisasi tersebut bertujuan untuk memperoleh masukan, kritik dan saran dari para stakeholder dari para mitra Pemko Medan, termasuk para narasumber serta pemerintah pusat, khusunya kementerian dalam dan luar negeri sebagai Pembina dan fasilitator hubungan kerjasama LN dan Sister City. Adapun sebagai pembicara

pada acara sosialisasi, yakni Staf Kementerian Luar Negeri RI Auren Ricardo Lawalata dan Kabid Kerjasama Antar Negara Ke m e n t e r i a n L N D R A l Muhtabar. Ricardo mengatakan perubahan pola dan tata hubungan internasional yang dipicu kemajuan ilmu pengetahuan dan teknologi (Iptek), globalisasi dan komunikasi melahirkan ‘aktor-aktor’ pelaku hubungan internasional. Turut hadir pada sosilisasi tersebut, para konsul negara sahabat yang salah satu kotanya tergabung dalam Asosiasi Sister City yakni Ichikawa (Jepang), Chengdu (Korea Selatan), Guangzu (China), Penang (Malaysia) dan Burgas (Bulgaria) serta delegasi dari Korsel tersebut dirangkai dengan seminar yang dimoderatori Sekretaris Eksekutif Asosiasi Kota Bersaudara Kota Medan Djauzi Ilmi. (m50)

MPI Imbau Kader Sambut Damai Tahun Baru MEDAN (Waspada): Ketua Umum Dewan Pimpinan Nasional Masyarakat Pancasila Indonesia (Ketum DPN MPI) Meher Ban Shah mengimbau kadernya yang berada di seluruh Indonesia agar melaksanakan perayaan malam tahun baru 2011 dengan tenang, tertib, damai dan tidak berlebihan. “MPI akan merayakan malam tahun baru di Graha MPI dengan berbagai kegiatan positif untuk mencegah para kader mudanya seperti Brigade Mahasiswa dan Pelajar agar tidak merayakan malam pergantian tahun ini, dengan kegiatan negatif yang dapat merusak moral generasi muda,” kata Meher Ban Shah, Sabtu (18/12) malam, seusai memimpin rapat panitia pelaksanaan malam tahun baru yang akan digelar di Graha MPI Jalan Alfalah Medan. Ketum DPN MPI Meher Ban Shah didampingi Wakil Ketua OKK DPN MPI Herman Sadek. Wasekjen Ir. Arief Haryadian, Lilik S Lubis,Sekretaris DPP MPI Kusnan, Bendahara DPP MPI Sumut Bobby Octavianus dan Sutan Ketua Bakorwil Brigade Mahasiswa Sumut serta pengurus lainya menjelaskan, pada malam pergantian tahun kegiatan yang diadakan di antaranya bakar ikan dan kambing, serta pembagian laptop 7 unit

Waspada/Surya Efendi

MENGECAT MASJID RAYA: Beberapa pekerja sedang mengecat bagian dinding Masjid Raya Al Mashun Medan,Senin (6/12). Masjid Raya Al Mashun Medan yang bersejarah ini mulai dibangun 21 Agustus 1906 dan selesai atau dibuka untuk umum 10 September 1909. Saat itu, seluruh biaya pembangunan masjid ini senilai satu juta gulden ditanggung oleh Kesultanan Deli yang berkuasa waktu itu, yakni Sultan Makmoen Perkasa Alamsyah IX.

Kewenangan KY Harus Diperluas MEDAN ( Waspada): Anggota Komisi Yudisial (KY) RI terpilih Suparman Marzuki menegaskan pentingnya untuk meningkatkan dan meluaskan kewenangan KY. Dengan begitu, lembaga ini bisa berkontribusi lebih besar bagi proses penegakkan hukum di negeri ini. Lembaga KY diharapkan menjadi lembaga yang kuat dan lebih memiliki greget seperti halnya Komisi Pemberantasan Korupsi (KPK) ataupun Mahkamah Konstitusi (MK). ‘’Ini momentum yang baik, sejalan dengan dibahasnya revisi Undang-undang Nomor 22 tahun 2004 tentang Komisi Yudisial,’’ kata Suparman di Medan, kemarin. Sebelumnya, dalam UU ini telah pula diusulkan beberapa kewenangan KY, namun menemui jalan buntu karena terjadi penolakan beberapa pihak. Hal yang dijadikan alasan untuk menolak penguatan peran KY itu adalah soal independensi para hakim. Jadi, independensi itu justru dijadikan benteng tempat berlindung atas dugaan kesalahan yang dilakukan. ‘’Padahal, KY masuk sebagai terjemahan pengawasan internal dalam rangka akuntabiliti, karena indenpendensi tanpa akuntabiliti ini bisa anarki, kan?’’ katanya. Sebagai personel yang baru terpilih, Suparman yang merupakan calon kuat Ketua KY menggantikan Busyro Muqoddas itu mengatakan, pihaknya telah mengusulkan beberapa poin kewenangan KY dalam pembahasan revisi UU tersebut, di antaranya adalah menyangkut kewenangan KY untuk memberhentikan hakim-hakim yang terbukti melakukan tindakan melawan hukum dalam putusannya. ‘’Revisi kewenangan KY ini untuk kewenangan yang lebih luas. Jadi, tidak hanya sebatas bertugas mengusulkan pengangkatan hakim agung, tapi justru dapat menilai putusan hakim di tingkat pengadilan tingkat pertama dan pengadilan tinggi. Jika terbukti tidak benar, kita berhak mengusulkan pemecatan kepada presiden,’’ katanya. Tentu saja ini penting, karena di tengah ketidakpercayaan publik terhadap lembaga hukum, termasuk pengadilan, maka perlu dilakukan berbagai terobosan yang menjadi solusi. Kenyataannya memang banyak orang

yang tidak puas atas keputusan hukum di pengadilan. Menurut Suparman, dalam memori sidang, dari 1.200 putusan hakim yang dirinya pernah ikut terlibat riset, ternyata banyak hakim tidak serius dalam membuat putusan. ‘’Tidak ada lompatan pengetahuan hukum yang bisa ditawarkan. Putusan hakim bukan hanya memutus perkara itu saja, ini filosofi putusan yang sering diabaikan hakim. Putusan hakim itu akan bermakna dalam kehidupan yang lebih luas, bukan hanya sekadar dia menghukum si A, si B,’’ katanya. Belum lagi banyaknya kasus-kasus ketimpangan putusan hakim yang dirasakan para pihak yang terlibat di dalamnya. Ini semua telah mengakumulasi sehingga tingkat ketidakpercayaan publik kepada lembaga hukum jadi sedemkian kronis. Oleh karenanya perubahan dalam kewenangan KY diharapkan bisa muncul dalam putusan di tingkat DPR RI nanti. Suparman beserta enam lainnya akan dilantik pada hari ini, Senin (19/12). Selanjutnya ketujuh personel KY ini akan bersidang melakukan pemilihan siapa yang akan menjadi ketua lembaga ini. KY perlu diperkuat Sementara itu, Ketua Umum DPP Partai Demokrat Anas Urbaningrum tidak sependapat jika kewenangan KY diperluas memecat hakim yang menyimpang. Pemecatan hakim cukup menjadi kewewenangan Mahkamah Agung. “Biarlah MA yang melakukan penindakan terhadap hakim yang nakal,” kata Anas saat kunjungannya di BumiWarta Harian Waspada, Sabtu (18/12). Anas lebih sependapat jika kewenangan KY diperkuat untuk melakukan pengawasan terhadap hakim-hakim yang menyimpang. Dari pengawasan itu, KY memberikan rekomendasi yang kuat kepada MA untuk menindak para hakim. “Dalam upaya penguatan KY lantas diberi wewenang langsung bisa memecat hakim, tidak pas juga. Biarlah MA yang bertindak. Tetapi rekomendasi KY memiliki kekuatan yang harus ditindaklanjuti oleh MA. Di situlah perlu diperkuat KY,” katanya. (m07/m13)

Kerusakan Jalan Belum Teratasi MEDAN (Waspada): Meskipun sudah berkali-kali dipersoalkan seluruh tim reses DPRD Sumut, namun kondisi infrastruktur jalan yang rusak parah ternyata belum juga diperbaiki. Kerusakan umumnya diakibatkan kenderaan yang bertonase lebih dari yang ditemukan hilir mudik tanpa ada pengawasan. Juru bicara Tim Reses daerah pemilihan (Dapil) I, Medan, Nurhasanah mengatakan belum satu pun hasil temuan reses DPRD Sumut sebelumnya, yang direalisasikan Pemerintah Provinsi Sumut (Pemprovsu) dan Pemerintah Kota (Pemko) Medan. Terutama mengenai infrastruktur jalan yang masih buruk. “Hasil reses kali ini kami hanya kembali menajamkan dan menegaskan temuan reses tiga kali sebelumnya. Karena kondisinya masih sama belum ada realisasi. Termasuk infrastruktur jalan,” kata anggota Fraksi Partai Demokrat itu saat membacakan laporan reses Dapil I dalam rapat paripurna di gedung dewan, Jalan Imam Bonjol, kemarin. Dipaparkannya, meski Pemko Medan melalui Sekretaris Daerah mengaku telah memperbaiki jalan yang dilakukan oleh Dinas Bina Marga dengan sistem petugas bekerja setiap hari. Namun pada kenyataannya masih banyak jalan yang rusak dan berlo bang. Seperti Jalan Kayu Putih Kelurahan Mabar, Medan Deli kondisinya sangat memprihatinkan. Kerusakan di jalan tersebut karena bebasnya truk kontainer melintas di jalan tersebut dengan beban melebihi kapasitas. Selain itu ada juga jalan lubangnya sudah seperti anak

sungai di Jalan Lingga Raya serta beberapa jalan lainnya. Hal yang sama juga ditemukan Tim Reses Dapil Sumut VI, Mandailing Natal, Tapanuli Aelatan, Padangsidempuan, Padang Lawas Utara, Padang Lawas. Infrastruktur jalan provinsi jurusan Jembatan Merah hingga Muara Soma serta jurusan Gunung Tua hingga Sibuhuan sering dilewati angkutan barang bertonase melebihi kapasitas. Akibatnya kondisinya amat memprihatinkan. Ketua Tim Reses Dapil VI Tiasiah Ritonga memaparkan kerusakan jalan provinsi tersebut berdampak buruk bagi masyarakat. Karena dengan buruknya infrastruktur jalan berarti mereka harus menyediakan pengeluaran lebih tinggi untuk biaya distribusi hasil bumi. Karena itu Pemprovsu diminta senantiasa menjaga agar kondisi jalantetap baik. Serta pengawasan kenderaan angkutan barang pada jembatan timbang diperketat. Tim Reses Dapil Sumut XI Langkat, Binjai menemukan sekitar 34,5 kilometer jalan provinsi rusak berat. Jalan provinsi di dapil tersebut terdiri dari 4 ruas jalan dengan panjang 144,56 kilometer. Tim reses yang diketuaiYan Syahrin tersebut ketika bertemu dengan para konstituen mereka umumnya berharap ada upaya untuk mengurangi kemacetan lalu lintas Binjai – Deli Serdang – Medan. Satu-satunya harapan adalah dengan membangun jalan alternatif yang mampu mengurangi penumpukan kenderaan di sepanjang Jalan Medan – Binjai.(m48)

UMA Wisuda 482 Sarjana Waspada/Rudi Arman

Ketua Umum Dewan Pimpinan Nasional Masyarakat Pancasila Indonesia (Ketum DPN MPI) Meher Ban Shah ( duduk no 3 dari kiri) berfoto bersama pengurus MPI lainya, seusai memimpin rapat panitia perayaan Tahun Baru 2011 di Hotel Cambridge Jalan S Parman Medan Sabtu (18/12) malam. kepada Bakornas, Bakorwil, Bakorcab serta sekretariat – sekretariat terbaik di setiap universitas. “Tujuan dari pelaksanaan acara ini untuk menghibur para kader di Brigade Mahasiswa dan Pelajar untuk melakukan hal – hal positif,” ujarnya. Menurut pendiri organisasi massa anti korupsi ini juga menilai, apa yang dilakukan para kadernya selama ini khususnya Brigade Mahasiswa dan Pelajar sudah cukup baik. “Diharapkan pada tahun mendatang dan selanjutnya, kebaikan ini terus ditingkatkan dengan sifat – sifat terpuji serta dapat mengabdikan dirinya

kepada masyarakat dengan akhlak dan moral yang baik nantinya jika menjadi pemimpin di negara ini,”terangnya. Acara ini juga merupakan bentuk rasa sayang dan kasih Ketua Umum DPN MPI Meher Ban Shah kepada anak – anak di Brigade Mahasiswa dan Pelajar. Sementara Sutan, ketua Bakorwil Brigade Mahasiswa Sumut, kepada wartawan mengatakan, acara ini diharapkan dapat menjadikan wadah untuk lebih meningkatkan silatturahmi antara Brigade Mahasiswa dan Pelajar serta DPN,DPP,DPK serta organisasi sayap MPI lainnya. (m39)

MEDAN (Waspada): Rektor Universitas Medan Area (UMA) H A Ya’kub Matondang mewisuda 481 wisudawan terdiri dari 446 sarjana S-1 dan lulusan S2 berjumlah 36 orang yang telah menyelesaikan pendidikannya dengan baik. “Dengan tema peningkatan kultur akademik kita perkuat daya saing bangsa, diharapkan alumni UMA terampil dalam kegiatan keilmuan serta ahli dalam menerapkan teknologi dalam rangka meningkatkan kecerdasan, keterampilan dan karakter bangsa yang bermartabat,” kata Prof Matondang di hadapan para wisudawan, Sabtu (18/12). Hadir pada wisuda tersebut, Koordinator KopertisWilayah I Sumut-NAD Nawawiy Lubis pengurus Yayasan Pendidikan Haji Agus Salim seperti Bendara Yayasan Erwin Siregar, para wakil rektor, dekan dan sivitas akademika UMA. Rektor mengatakan, UMA di usia 27 tahun telah berkiprah melaksanakan fungsi penyelenggaraan tri dharma perguruan tinggi semakin meningkatkan peran pengabdiannya di dunia pendidikan tinggi. Pengembangan UMA ke depan tetap berorientasi pada tiga pilar pendidikan yaitu, pemerataan dan perluasan akses pendidikan, peningkatan mutu, relevansi

dan daya saing serta penguatan tata kelola, akuntabilitas dan pencitraan publik. “Pendidikan adalah usaha mencerdaskan dan menjadikan alumni menjadi insan yang kompetitif serta relevan bagi kebutuhan masyarakat global. Untuk itu para wisudawan telah dibekali dengan kompetensi utama meliputi tiga komponen yang terintegrasi yaitu, keilmuan, kepribadian dan kewirausahaan,” paparnya. Secara kelembagaan, UMA telah membentuk lembaga pengembangan pendidikan dan penjaminan mutu (LP3M) yang memiliki tugas pokok dan fungsi untuk menangani masalah penjaminan mutu internal. UMA secara lengkap telah menyampaikan laporan evaluasi program studi berdasar evaluasi diri (EPSBED) yang merupakan basis data untuk penjaminan mutu pendidikan. Koordinator KopertisWilayah I Sumut-NAD Nawawiy Lubis mengharapkan UMA bisa melahirkan inovasi pembelajaran dan pemikiran sesuai tuntutan kebutuhan masyarakat dan pasar kerja. Sehingga para lulusannya bisa diterima dan memenuhi standar pembelajaran sesuai ketentuan yang berlaku. (m41)

Medan Metropolitan Evaluasi Kinerja Kadishub



Senin 20 Desember 2010

Dinilai Membangkang Kepada Walikota Dan Sekda MEDAN (Waspada): Sikap Kadis Perhubungan Kota Medan Dearmando Purba yang terkesan membangkang terhadap instruksi Walikota H Rahudman Harahap dan Sekda HM. Fitriyus tentang pembongkaran jalur khusus antar jemput anak sekolah, telah menimbulkan reaksi keras di kalangan anggota dewan. Wakil rakyat tersebut mendesak walikota segera mengevaluasi kinerja Dearmando Purba selaku Kadishub dan tidak mempertahankan pejabat yang membangkang. Sebab, Dearmando tetap mempertahankan jalur khusus yang ada di depan sekolah tertentu sehingga terjadi diskriminasi dan menyebabkan kemacetan lalu lintas. “Kita mendesak walikota segera mengevaluasi kinerja Kadishub Dearmando Purba yang sampai saat ini masih mempertahankan jalur khusus di sekolah-sekolah tertentu. Padahal, sudah banyak keluhan masyarakat soal jalur khusus,

tapi kenapa Pemko tidak juga membongkarnya. Ada apa ini?,” kata anggota DPRD Kota Medan Bahrumsyah yang dihubungi Waspada melalui telefon, Minggu (19/12). Karena jalur khusus itu tetap dipertahankan, lanjut Bahrumsyah, maka Kadishub dinilai sebagai pembangkang. Pasalnya, walikota dan sekda pernah mengatakan jalur khusus tersebut mengganggu kenyamanan masyarakat selaku pengguna jalan sehingga harus dibongkar. Anehnya, Kadishub tetap mempertahankan portal dan rambu jalur khusus tersebut.

Wartawan Dipukul Satpam Ngadu Ke Polisi MEDAN (Waspada): Bermaksud hendak meliput masalah properti, seorang wartawan dipukul seorang Satpam di Jalan Sutrisno Medan, Sabtu (18/12) sekira pk 15:00. Akibatnya M Tazli, 26, warga Jalan Titi Pahlawan, Medan Marelan, menderita luka dan melaporkan peristiwa tersebut ke Polsekta Medan Area. Kepada petugas Polsekta Medan Area, M Tazli mengatakan, saat itu dirinya sedang menjalankan tugas jurnalistik, hendak meliput berita mengenai perkembangan bisnis Properti di Jalan Sutrisno, Medan Area. Sebelumnya, korban yang bekerja di salah satu suratkabar harian itu sudah berkordinasi dengan Manajer Properti Icon Real Estate (IRE) Merick Salim. Korban langsung menuju ke lokasi pengembang itu. Setibanya di lokasi properti itu, M Tazli langsung dihadang oleh Satpam Propeti berinisial Ram. Kemudian oknum satpam tersebut langsung memukul korban hingga terjatuh. Merasa tidak bersalah, Tazli langsung menanyakan apa maksud oknum satpam tersebut memukulnya. Namun, pertanyaan korban tidak digubris, oknum satpam tersebut langsung pergi meninggalkan Tazli sembari menutup pintu pagar properti. Selanjutnya, Tazli membuat pengaduan ke Polsekta Medan Area, atas tindakan satpam yang telah menganiaya dan arogan terhadap profesi jurnalistik yang dinilai sudah melanggar UU Pers No 40. (h04)

Bibi Dianiaya Keponakan MEDAN (Waspada): Seorang ibu rumah tangga Nafsiah, 35, yang menjadi korban penganiayaan keponakannya sendiri berinisial Im, 22, warga Jalan Ismaliyah, mengadu ke Polsekta Medan Area, Sabtu (18/12). Penganiayaan itu berawal saat korban menegur keponakannya itu saat menonton TV di ruang tamu. Merasa telah menganggu kesenangannya, Im langsung mendorong dan menyeret Nafsiah ke lantai hingga korban mengalami luka di bagian tangan sebelah kanan. Perbuatan Im tidak sampai disitu. Merasa kurang puas, Im juga menyiksa bibinya dengan mencakar wajahnya hingga mengalami luka. Menilai perlakuan keponakannya sudah tidak berprikemanusiaan, akhirnya sekitar pukul 14.00 WIB, korban langsung membuat pengaduan ke polisi. Saat ditemui di Mapolsekta Medan Area, Nafsiah mengaku selain dipukuli keponakannya itu, korban juga pernah disiram air panas sama orangtua Im. Nafsiah mengatakan, perbuatan yang dilakukan keluarga Im diduga hanyalah ketidaksenangan mereka terhadap korban yang tinggal di rumah yang ditempati keluarga itu. “Padahal rumah yang mereka tempati adalah warisan dari orang tua saya, jadi wajar saya tinggal di rumah tersebut,” ujarnya.(h04)

Polisi Tingkatkan Patroli MEDAN (Waspada): Mengantisipasi aksi kejahatan jalanan menyambut Natal dan Tahun Baru, Polsekta Medan Sunggal menurunkan puluhan personel melakukan patroli secara rutin. “Gebrakan ini sesuai instruksi Kapoldasu Irjen Pol Drs Oegroseno, SH dan Kapoltabes Medan Kombes Pol Tagam Sinaga, SH,” kata Kapolsekta Medan Sunggal AKP Sonny Marisi Nugroho Tampubolon, SH,SIK melalui Waka Polsekta/Kanit Binmas AKP RE Samosir, SH kepada Waspada, baru-baru ini. Menurutnya, selain melakukan patroli pihaknya juga mengadakan pengamanan di gereja, pusat perbelanjaan yang dilakukan secara terbuka maupun tertutup. Pengamanan secara langsung dengan mengedepankan kegiatan pencegahan, penangkalan dan didukung kegiatan intelijen. Selain itu kegiatan penindakan serta penegakan hukum guna mewujudkan dan memelihara stabilitas Kamtibmas yang aman serta tertib dan lancar. “Kita juga minta satpam harus peduli dan proaktif menjaga lingkungan di tempat tugasnya untuk menghindari terjadi hal yang tidak diinginkan. Sebab selain satpam sebagai Pam Swakarsa di kompleks perumahan, perusahaan, pabrik dan gudang, juga sebagai perpanjangan polisi,” tutur Samosir. Pantauan Waspada di lapangan, personel Polsekta Medan Sunggal, Lantas, Samapta, Patra Brimob Poldasu terlihat silih berganti melakukan patroli bahkan di setiap persimpangan terlihat personel terus berjaga-jaga mengantisipasi aksi kejahatan jalanan. (m36)

Redam Isu Penculikan MEDAN (Waspada): Isu penculikan anak di Sumatera Utara semakin merebak hingga memicu kekhawatiran di kalangan masyarakat. Tokoh agama dan tokoh masyarakat diminta berperan aktif memberi ketenangan agar warga tidak mempercayai isu tersebut. “Pihak kepolisian telah berupaya keras melakukan berbagai upaya meredam isu itu, bahkan melacak keberadaan si penyebar isu tersebut. Kami juga meminta tokoh agama dan masyarakat berperan aktif memberi penjelasan kepada warga supaya tidak resah dan tak melakukan aksi main hakim sendiri,” kata Kasubid Dokliput Polda Sumut AKBP MP Nainggolan, Jumat (17/12). Harapan itu disampaikan karena tanpa didukung tokohtokoh tersebut, upaya kepolisian sulit meredam aksi tersebut. Apalagi, secara keseluruhan di Sumut tercatat 8.000 desa dan polisi baru bisa menempatkan personelnya di 2.500 desa. “Kekurangan personel membuat keterbatasan pihak kepolisian. Karena itulah, diharap bantuan dari kalangan masyarakat untuk bersama-sama memberi pemahaman agar isu meresahkan ini bisa hilang,” harap Nainggolan. Disinggung aksi main hakim sendiri yang dilakukan warga di beberapa daerah misalnya di kawasan Serdang Bedagai (Sergai) dan di Labuhan Deli akibat kecurigaan adanya penculikan, Nainggolan menegaskan siapapun yang melakukan tindak pidana pasti akan diproses. “Masyarakat jangan main hakim sendiri karena itu merupakan tindak pidana dan bisa diproses. Sebaiknya jika melihat orang-orang yang mencurigakan, segera laporkan ke pihak kepolisian,” pintanya. (m27)

“Kalau perintah walikota dan sekda tidak dilaksanakan, maka kinerja Dearmando Purba harus dievaluasi. Bila perlu dicopot saja dari jabatannya. Kita juga meminta walikota dan sekda agar bertindak tegas sehingga tidak ada lagi bawahannya yang membangkang,” tegas Bahrumsyah. Di tempat terpisah, anggota Komisi A DPRD Medan Surianda Lubis berpendapat, Dinas Perhubungan Kota Medan harus membongkar jalur khusus yang ada di depan sekolahsekolah tertentu. Sebab, tidak ada alasan bagi Kadishub mempertahankan jalur khusus tersebut karena telah menyebabkan terjadinya diskriminasi terhadap warga Kota Medan dan kemacetan lalu lintas. “Pembuatan jalur khusus di sekolah-sekolah tertentu tidak dibenarkan. Semua jalan umum yang dibangun melalui APBD, tidak bisa digunakan untuk kepentingan kelompok

masyarakat tertentu. Jadi, dalam hal ini Dinas Perhubungan Kota Medan tidak bisa memberi fasilitas istimewa kepada siapapun dengan mengorbakan hak-hak orang lain,” tambah Surianda. Sebelumnya, Walikota Medan Rahudman Harahap telah menginstruksikan Kepala Dinas Perhubungan Kota Medan agar meninjau ulang keberadaan jalur khusus antar jemput anak sekolah di Jln. Perintis Kemerdekaan, Jln. Thamrin dan sejumlah ruas jalan lainnya.. “Saya sudah menerima keluhan masyarakat soal jalur khusus di Jln Perintis Kemerdekaan depan sekolah Methodist dan Jln. Thamrin depan sekolah Sutomo. Karena itu, Dishub harus meninjau ulang keberadaannya. Bila perlu jalur khusus itu dibongkar saja, karena keberadaannya menjadi pemicu kemacetan lalu lintas,” katanya. Rahudman berjanji tidak

akan mempertahankan jalur khusus tersebut jika pada akhirnya menjadi pemicu kemacetan lalu lintas. “Jalur khusus ini sangat mengganggu kenyamanan masyarakat berlalulintas. Saya sempat berpikir ada apa dengan jalur khusus itu? Mengapa Dishub mempertahankannya? Saya perintahkan agar Kadishub jangan mengulur-ulur waktu untuk meninjau ulang jalur khusus tersebut,” tegasnya. Sementara itu, Kadis Perhubungan Kota Medan Dearmando Purba semakin sulit dikonfirmasi sejak masalah jalur khusus antar jemput anak sekolah itu merebak. Waspada yang mendatangi kantor Dinas Perhubungan Kota Medan selama sepekan terakhir, tidak bisa bertemu dengan Dearmando. Menurut stafnya, Dearmando tidak berada di tempat. Terakhir, Waspada menghubungi telefon seluler milik Dearmando, Minggu (19/12), namun tidak aktif. (m50)

5 Pria Bersenpi Bawa Kabur Truk Tronton MEDAN (Waspada): Lima pria mengaku polisi, membawa kabur truk tronton BK 8001 SS di Jln Djamin Ginting, Desa Rambung Baru, Kecamatan Sibolangit, Sabtu (18/12) dinihari sekira pukul 04:30. Pelaku sempat menodongkan senjata api ke arah sang sopir. Sopir cadangan Surino, 23, warga Kecamatan Tiga Panah, Tanah Karo, berhasil menyelamatkan diri. Sedangkan sopir utama Heri Surbakti, 30, warga Tiga Binanga, Tanahkaro, dibuang di jalan tol Belmera. Sementara truk tronton ditinggalkan begitu saja di Jln SM Raja depan markas Poldasu. Informasi yang diperoleh di Mapolsekta Pancurbatu, Sabtu (18/12) sekira pukul 17:00, kelima pelaku yang mengaku anggota Polsekta Pancurbatu itu mengendarai mobil BK 1234 MY warna hitam. Mereka menghentikan truk yang dikemudikan Surino. Saat itu, truk tersebut hendak menuju Mabar, guna mengambil semen yang akan dibawa kembali ke Tanahkaro. Saat Surino menghentikan truknya, seorang pelaku turun dari mobil serta menyuruh Surino dan Heri turun dari truk. Pelaku meminta SIM, STNK dan

speksi. Selanjutnya, kedua sopir disuruh masuk ke dalam mobil pelaku dengan ancaman senjata api. Namun, sebelum kedua korban dibawa, Heri berhasil melarikan diri. Sedangkan Surino bersama truknya dibawa para pelaku. “Aku disuruh bawa truk ke arah Pancurbatu, tapi setelah dekat Polsek Pancurbatu aku melambat, aku pikir dibawa ke Polsek, tapi aku ditodongkan senjata oleh pelaku yang saat itu ikut di dalam truk,” ungkap Surino. Setibanya di Jln Sisingamangaraja Tanjung Morawa, truk yang dikemudikan Surino diparkirkan di badan jalan yang tidak jauh dari markas Poldasu. “Truk parkir di sana, aku dibawa dengan mobil mereka ke jalan tol arah Tanjung Morawa. Namun sebelum dibawa, aku sempat dibawa jalan-jalan. Di dalam mobil tersebut aku disuruh mengatakan dimana ganja itu aku simpan,” ucap Surino lagi. Surino yang merasa tak ada membawa atau menyimpan ganja sebagaimana disebutkan pelaku, tentu saja menolak tuduhan itu. Karena tidak mengakui apa yang dituduhkan, akhirnya Surino dibuang di pinggir jalan tol Tanjung Mo-

rawa dengan kondisi tangan terikat ke belakang, tidak mengenakan baju dan luka pada bagian kepala akibat terkena pukulan benda tumpul. Sementara truk tersebut berhasil ditemukan di jalan besar Tanjung Morawa oleh salah seorang kerabat majikan Heri dan Surino. Truk ditemukan dengan kaca tidak tertutup serta kunci kontak masih melekat. Sedangkan SIM dan handphone milik Heri, STNK serta Speksi truk, tas warna hitam berisi pakaian Heri dan uang tunai Rp60 ribu raib diduga dibawa kabur kelima pelaku. Kapolsekta Pancurbatu AKP JK Tampubolon di dampingi Kanit Reskrim AKP Paidir Chaniago saat dikonfirmasi membenarkan kedatangan Heri dan Surino guna mengadukan peristiwa itu. “Kita belum bisa memastikan motif sebenarnya. Apakah itu senjata mainan atau senjata api, kita masih melakukan penyidikan,” ujarnya. Menurut Tampubolon, saat ini truk yang sebelumnya dititipkan di Laucih, telah dibawa ke Polsekta Pancurbatu. “Truk tronton sebagai barang bukti sudah diamankan di Mapolsekta,” katanya. (h04)

Polisi Jadi Korban Kejahatan MEDAN (Waspada): Aksi kejahatan di Kota Medan dan sekitarnya memang tidak pandang bulu. Kali ini, seorang anggota polisi menjadi korban pelaku kejahatan. Pada Jumat (17/12) dinihari, maling membobol mobil BK 1808 SR milik seorang anggota Polri, Dhani Marisi, 22, yang sedang parkir di Jln Pasundan Medan. Pelaku merusak kaca mobil dan membawa kabur sebuah tas yang ada di dalamnya. Sebelumnya Marisi, warga Jln Pelopor Medan, berkunjung ke rumah temannya Maya, 22, di Jln Pasundan Medan, Kamis (16/12) malam sekira pukul 23:30. Saat itu, pintu mobil dalam keadaan terkunci. Namun saat hendak pulang, sekira pukul 04:00, Marisi melihat kaca pintu belakang mobilnya pecah. Kemudian, tas milik abang sepupunya yang berisi

pakaian dan lain-lain telah raib. Kasus tersebut ditangani Polsekta Medan Baru dan pelakunya sedang dalam pengejaran. Sementara itu, satu unit mobil milik seorang Pegawai Negeri Sipil (PNS) dibobol maling. Pelaku mengambil barangbarang berharga di dalam mobil tersebut setelah merusak kunci pintu. Informasi Waspada peroleh di lapangan, korban Ir Tajudin Siregar, 54, penduduk Jln Klambir V Gg Uncu, Tanjunggusta, memakirkan mobil dinasnya BK 1528 H (plat merah) di halaman Masjid Al Jihad Jln Abdullah Lubis, Kelurahan Babura Medan, Kamis (16/12) pukul 13:00. Setelah mengunci pintu mobilnya, korban masuk ke masjid untuk melaksanakan shalat Zuhur. Usai shalat, korban kembali ke mobilnya dan berge-

gas ke kantor. Ketika hendak membuka pintu mobil, ternyata lubang kuncinya telah dirusak maling. Saat diperiksa ternyata tas berisikan polis asuransi, buku tabungan, uang tunai Rp15 juta dan lainnya telah hilang. Perampokan Sementara itu, dua pelaku yang mengendarai sepedamotor Yamaha Vixion merampok tas milik Ucin, 27, di Jln Kapten Muslim dekat RS Sari Mutiara Medan, Kamis (16/12). Korban Ucin, penduduk Jln Ismailiyah, Kecamatan Medan Area, dirampok saat menumpang becak bermotor menuju ke kantor PT Mekada. Setibanya di Jln Kapten Muslim, tas sandang milik korban dirampok kedua pelaku. Akibatnya korban menderita kerugian tas berisikan kartu ATM, SIM-C dan uang tunai Rp1,5 juta. (m36)

Warga Protes Pabrik Gas MEDAN (Waspada): Warga Jalan Bunga Raya III, Asam Kumbang, Kecamatan Medan Selayang, melakukan unjuk rasa memprotes keberadaan bangunan diduga sebagai tempat pengoperasian pabrik gas milik PT Total Logistik Cabang Medan, Jumat (17/12). Mereka melakukan aksinya dengan damai sambil membentang poster minta kegiatan pabrik gas itu dihentikan karena lingkungan Jalan Bunga Raya III menjadi tercemar sisa gas. Selain itu, warga juga meminta pihak berwenang melakukan peninjauan ke pabrik. “Kami sudah yang kedua kalinya melakukan aksi demo ke pabrik,” ungkap seorang warga yang melakukan unjuk rasa. Sementara Darbara Singh, warga lainnya mengatakan, kami melakukan unjuk rasa ini hanya minta instansi terkait meninjau ulang kehadiran usaha tersebut.“Apabila usaha itu tidak menimbulkan pencemaran, mana mungkin warga protes,” jelasnya. Menurutnya, kawasan pe-

mukiman mereka saat ini sudah tercemar akibat pembuangan sisa-sisa gas dari operasional pabrik tersebut. Akibatnya anak-anak kami terserang penyakit batuk, muntah dan akan berdampak negatif terhadap pertumbuhan anak,” ungkapnya. Menurutnya, awalnya warga tidak ada masalah dengan pengoperasian pabrik gas yang dimulai sejak dua pekan lalu. Namun, akhir-akhir ini warga mulai resah dengan kehadiran pabrik gas tersebut. Setelah ditelusuri, ternyata warga Jalan Bunga Raya, Asam Kumbang yang menyutujui kehadiran pabrik tersebut, sedangkan sebagian besar warga Jalan Bunga Raya III tidak setuju. Pasca keresahan beberapa warga, kata Darbara, lurah setempat sudah mendatangi perusahaan itu dan telah menganjurkan agar menghentikan sementara operasionalnya. “Dalam masalah ini, kami sudah melayangkan surat ke Camat Medan Selayang, Dinas Perindustrian dan Walikota Medan,”

jelasnya. Penanggungjawab PT Total Logistik Cabang Medan Rony kepada Waspada mengatakan, perusahaan ini bukan pengoperasian pabrik gas, melainkan tempat pengecetan tabung gas ukuran 3 kg dan juga melakukan penggantian valve (pentil/ penutup tabung gas). “Mana mungkin kami mengisi gas, sementara di sekitar sini banyak rumah penduduk,” ujarnya. Menurut Rony, usaha tersebut telah membantu perekonomian warga sekitarnya dengan mempekerjakan 40 orang warga sekitar. Kapolsekta Medan Sunggal AKP Sonny Marisi Nugroho Tampubolon, SH,SIK didampingi Kanit Reskrim Iptu Widi Setiawan SH mengatakan, warga melakukan aksi demo dengan damai. PantauanWaspada di lokasi perusahaan itu, tidak terlihat ada pengisian gas ke dalam tabung, melainkan hanya pengecetan tabung dan pergantian pentil gas menggunakan alat canggih. (m36)

Waspada/Andi Aria Tirtayasa

Mayat balita berusia 2 tahun yang teridentifikasi bernama Melisa boru Manurung ditemukan warga tewas terapung di Sungai Denai dekat Jalan Pelikan Raya Perumnas Mandala, Minggu (19/ 12) sekira pk 12:00.

Wanita Diduga Over Dosis Tewas Dalam Hotel Mayat Balita Ditemukan Terapung MEDAN (Waspada): Dua mayat berkelamin wanita ditemukan tewas di dalam kamar hotel Simpang Selayang, Kecamatan Medan Tuntungan, dan di pinggir Sungai Denai, KecamatanPercut Seituan, Minggu (19/12) sekira pk 12:00. Informasi yang diperoleh di lokasi kejadian, sebelumnya Minggu dinihari sekira pukul 24:00, wanita yang diperkirakan berusia 23 tahun itu datang ke hotel kelas melati tersebut diantar oleh seorang pengemudi beca bermotor bernama N Wilman, 30, warga Jalan Syahbandar, Kel. Kampung Aur, Kec. Medan Maimun. Selanjutnya, wanita tersebut check-in di kamar no 15 dan menginap sendirian. Sekira pukul 11:30, room-booy hotel Andri Tobing, 21, mengetok pintu kamar yang dihuni wanita tersebut untuk mempertanyakan, apakah tamunya akan check-out atau menyambung masa nginapnya. Berkali-kali pintu kamar diketuk, tidak ada jawaban dari dalam. Akhirnya, Andri Tobing membuka pintu kamar dan melihat tamu wanita itu telah tewas di atas ranjang dengan posisi telentang dan mulutnya berbuih. Diduga, korban tewas karena over dosis. “Saat pintu kamar kubuka, wanita itu sudah tewas telentang di atas ranjang. Dari mulutnya keluar buih,” ujar Andri Tobing saat ditemui di Pos Polisi Simpang Selayang, sembari menyebutkan, mayat wanita itu masih mengenakan celana jeans dan t-shirt warna hitam. Sementara pengemudi betor, NWilman yang dikonfirmasi mengaku tidak mengenal wanita tersebut. Menurutnya, saat dia berada di café kawasan Simpang Selayang, melihat ada seorang wanita sedang duduk di atas beca bermotornya. “Saat itu saya sedang mabuk dan wanita itu saya

antar saja ke hotel Murai. Saya yang membayar uang sewa kamarnya Rp32 ribu per malam,” ujar Wilman. Disebutkannya, usai membayar uang sewa kamar tersebut, dirinya langsung pergi meninggalkan hotel kelas melati itu. Kanit Reskrim Polsekta Delitua Iptu Semion Sembiring menyebutkan, mayat wanita tanpa identitas itu diduga berusia 23 tahun dan diduga meninggal karena over-dosis. “Di sekujur tubuh korban tidak ditemukan tanda-tanda yang mencurigakan. Diduga korban meninggal karena over-dosis,” jelasnya. Tewas Hanyut Sementara itu, mayat balita Melisa boru Manurung berusia 2 tahun ditemukan oleh warga dalam kondisi terapung di Sungai Denai dekat Jalan Pelikan Raya Perumnas Mandala, Kecamatan Percut Seituan. Mayat balita itu pertama kali ditemukan oleh seorang warga bermarga Silitonga, 55, yang saat itu berada di pinggir sungai tersebut. Awalnya, Silitonga menduga mayat terapung itu boneka mainan anak-anak. Karena penasaran, Silitonga mengambil kayu dan mengaitnya ke pinggir sungai. Begitu mendekat, barulah Silitonga mengetahui benda itu bukan boneka melainkan mayat perempuan berusia 2 tahun. Penemuan mayat terapung itu sontak membuat kaget sejumlah warga lainnya dan kemudian melaporkan penemuan mayat tersebut ke Polsekta Percut Seituan. Setelah diperiksa, ternyata mayat tersebut diketahui bernama Melisa boru Manurung, warga Desa Patumbak Pasar XII, Kecamatan Patumbak, Deliserdang, yang sebelumnya telah dilaporkan hilang ke Polsekta Patumbak. (h04)

30 Pemain Judi Samkuan Resmi Ditahan MEDAN (Waspada): 30 Pemain judi samkuan yang ditangkap Polresta Medan dari kawasan Jln Karang Sari Medan, Sabtu (18/12) malam sekira pukul 22:30, kini resmi ditahan. “Dari 52 orang yang diamankan terdiri dari 34 laki-laki dan 18 perempuan, tercatat hanya 30 orang yang resmi ditahan,” jelas Kapolresta Medan Kombes Tagam Sinaga, SH melalui Kasat Reskrim Kompol Fadillah Zulkarnaen, Minggu (19/12). Mereka yang ditahan Apo, Ani, Ayen, Hendri, Lily, Ricky Salin, Azin, Arman Tanata, Eddy alias Ahwat, Hendra Tiara, Teddy, Samin, The Lai Tiam alias Nahari, Tjan Alin alias Tumin, Aha, Nani, Edy, Ayu, Ratna, William, Roni alias Ramli Kusuma, Ana, Hongsin Husin, Wiwik, Yanti, Suryanto, Udoyo, Sri Wahyuni, Suciana alias Sisina. Selain itu, lanjut Fadillah, polisi mengamankan barang bukti berupa uang tunai Rp9,2 juta yang dijadikan taruhan, 19 unit mobil milik pemain, lima sepedamotor, delapan gelas kaca, dua dadu, 20 kayu kecil untuk pengganjal uang taruhan pemain di meja, dua spidol, tiga terpal, dua papan tulis, empat kipas angin, satu mesin genset, tiga kursi plastik, satu meja plastik, tiga meja kayu, empat bangku panjang dan kabel listrik. Para pemain dan bandar judi samkuan masih menjalani pemeriksaan intensif di Mapolresta Medan guna proses selanjutnya. “Mereka dikenakan pasal 303 sub 303 sebagaimana tercantum dalam KUHPidana dengan ancaman kurungan penjara 10 tahun,” jelasnya.

Jadi target Menurut Fadillah, selama ini markas judi samkuan di Jln Karang Sari Medan menjadi target petugas. Namun baru sekarang berhasil digerebek dan mengamankan puluhan pemainnya. Warga sudah resah dengan aktivitas judi disana dan menginformasikannya kepada polisi. “Semula petugas mendapat informasi dari masyarakat ada markas judi. Berdasarkan laporan tersebut petugas turun ke Tempat Kejadian Perkara (TKP) guna melakukan pemeriksaan,” jelasnya. Setibanya di lokasi, petugas curiga melihat banyak orang berkumpul dan mondar-mandir di sebuah rumah di kawasan Jln Karang Sari Medan. Kemudian petugas menggerebek markas judi tersebut dan mengamankan puluhan pemainnya berikut barang bukti. Fadillah menginstruksikan seluruh anggota agar terus melakukan pemberantasan judi. “Tim khusus pemberantasan judi yang sudah saya bentuk terus melakukan pemberantasan dan mencari keberadaan judi,” ujarnya. Sebelumnya Polresta Medan juga menggerebek dua lokasi judi togel GASS di kawasan Tanjung Gusta Medan namun tidak mendapat hasil karena markas judi tersebut sudah ditinggalkan para pemainnya. Setelah itu, Polresta Medan bekerjasama dengan Pomdam I/BB juga menggerebek lokasi judi samkuan di gudang barang bekas Jl Bama, Kec Medan Timur. Namun, operasi pemberantasan judi itu diduga bocor karena tak seorang pun ditemukan sedang bermain di dalam gudang tersebut.(m39)

1.341 Polisi Amankan Natal Dan Tahun Baru MEDAN (Waspada): Polda Sumut mengerahkan 1.341 personel untuk pengamanan perayaan Natal dan Tahun Baru 2011 dengan sandi operasi Lilin Toba, yang dimulai 24 Desember 2010 sampai 2 Januari 2011. Jumlah itu termasuk dari Brimob yang disiagakan membantu pengamanan di tempattempat rawan kejahatan. “Keseluruhan jumlah itu terdiri dari satuan tugas Polda Sumut yaitu, 924 personel dan dari 18 Polresta/Polres. Fokus pengamanan mencapai 924 personel,” kata Kasubid Dokliput Polda Sumut AKBP MP Nainggolan, Selasa (14/12). Mengenai kesiapan sniper (penembak jitu) dan Tim Penjinak Bahan Peledak (Jihandak), Nainggolan menyatakan, tim itu tidak perlu karena Sumut terbilang kondusif. “Tergantung situasi di lapangan, jika dianggap dibutuhkan, maka otomatis dikerahkan,” kata dia. Ops Lilin Toba diprioritaskan pada 18 Polres

yakni, Polresta Medan, Deliserdang, Serdang Bedagai, Tebingtinggi, Simalungun, Siantar, Toba Samosir (Tobasa), Tapanuli Utara, Humbang Hasundutan, Samosir, Sibolga, Karo, Dairi, Phakpak, Nias, Nias Selatan dan Belawan. Di Sumut, tempat-tempat yang diantisipasi antara lain, 1.128 gereja, 114 lokasi keramaian dan 114 lokasi Pos Pam. Paling banyak gereja di Deliserdang mencapai 331, Tebingtinggi 131 gereja dan Medan 8 gereja. Masing-masing gereja dijaga 2 polisi berpakaian dinas, dibantu petugas berpakaian sipil. Sedangkan tempat keramaian paling banyak di Simalungun mencapai 26 titik, Samosir 12 lokasi, Siantar dan Nias masing-masing 9 tempat. “Pos Pam paling banyak di Medan 15 lokasi, Karo 9 dan Tobasa 6,” jelas Nainggolan. Dengan Ops itu, kata dia, diharap terjamin keamanan dan keselamatan masyarakat yang merayakan Natal dan Tahun Baru. (m27)



WASPADA Senin 20 Desember 2010

Kampanye Nasional Kerukunan Oleh M Ridwan Lubis …melakukan kebijakan reward and punishment terhadap tindakan atau gagasan yang berkaitan dengan pemeliharaan kerukunan khususnya di bidang keberagamaan karena kerukunan beragama menjadi bagian penting dari kerukunan nasional


Opsi ‘Tersembunyi’ Pembatasan BBM Subsidi


onjang-ganjing pembahasan BBM khususnya jenis premium/solar bersubsidi terus berlanjut. Namun keputusan sepihak dari pemerintah, tepatnya Menko Perekonomian Hatta Radjasa bahwa terhitung 1 Januari 2011 pemerintah memutuskan untuk melarang mobil produksi tahun 2005 ke atas menggunakan premium maupun solar bersubsidi akhirnya batal. Setidaknya tertunda sampai akhir Maret mendatang setelah dilakukan pembahasan alot di DPR-RI. Dampak dari putusan pemerintah itu membuat pengusaha SPBU Pertamina mengeluh karena rata-rata mereka harus menambah investasi membangun tangki baru untuk konsumen BBM non-subsidi sekelas pertamax dan pertamax plus yang harganya mencapai Rp7000 s/d Rp8000an. Tidak demikian halnya dengan SPBU asing semisal Shell, Petronas dll. Mereka sudah lama membangun perangkat SPBU-nya tapi sepi konsumen karena harga premium jauh lebih murah . Itu sebabnya, pengusaha SPBU asing terus-menerus mempersoalkan, melakukan protes, karena subsidi premium masih dijalankan pemerintah. Selama premium masih disubsidi selama itu pula SPBU asing akan ‘’mati suri’’. Untuk membayar gaji karyawan dan menutup biaya operasional sehari-hari saja mereka sulit, otomatis terancam gulung tikar jika tekanan asing tetap diabaikan pemerintah. Tampaknya, ketahanan pemerintah semakin rapuh sehingga meskipun pendapatan rakyat Indonesia jauh di bawah rakyat Malaysia, apalagi Singapura kelihatannya ke depan harga BBM di dalam negeri akan diberlakukan harga pasar mengikuti kemauan negara luar (asing). Hemat kita, sekalipun pembatasan untuk mobil produksi tahun 2005 ke atas menggunakan premium maupun solar akhirnya batal menjadi seluruh mobil plat hitam wajib menggunakan pertamax dan solar harga pasar, namun tetap saja menimbulkan dampak di lapangan. Sebab, orang Indonesia dikenal paling pandai main ‘’akal-akalan’’. Lihat saja mobil tahun 1970-an pun masih tetap eksis di jalan raya. Padahal, onderdilnya sudah sulit dicari karena tidak diproduksi lagi oleh pabrik. Jumlah mereka masih sangat banyak, apalagi kalau ditambah mobil keluaran tahun 1980 Intisari dan 1990an. Mereka pasti keberatan memakai pertamax sehingga akan mencari dengan harga subsidi. Dan hal Penjualan sepedamotor premium itu tidak sulit. Sebab, rata-rata keluarga makin laku, jalan semakin mereka juga memiliki sepedamotor yang anak-anaknya pergi sekolah, macet, jika kebijakan pem- digunakan sehingga setiap hari si anak akan mengisi batasan BBM subsidi di- sepedamotornya kemudian disedot untuk mengisi mobil orang tuanya. Sehingga mulai awal April 2011. target pemerintah tidak akan terwujud, konon dapat menghemat anggaran subsidi BBM sekitar Rp 10,6 triliun per tahun atau bisa membayar lima bulan BLT kepada keluarga miskin akan sulit tercapai. Oleh karena itu, besar kemungkinan pemerintah dan DPR-RI sudah menyiapkan kejutan atau opsi ‘’tersembunyi’’ yaitu tidak melakukan pembatasan sama sekali, tapi menaikkan harga premium dan solar untuk semua kendaraan roda dua, tiga, empat. Kalau besarnya Rp500 per liter hal itu masih dapat diterima oleh rakyat, tidak terlalu besar, sekalipun tetap saja akan menimbulkan dampak seperti kenaikkan harga barang dan inflasi tapi tidak terlalu besar. Menaikkan harga BBM memang tidak popular. Itu sebabnya pemerintah sangat berhati-hati. Ide melakukan pembatasan tahun keluaran mobil, kemudian melakukan pukul rata untuk seluruh kendaraan pribadi (plat hitam) bisa saja sekadar memancing pendapat masyarakat agar pemerintahan SBY tetap populer. Namun opsi awal itu tetap saja pemerintah akan ditekan oleh investor asing sesuai kesepakatan untuk menghapus subsidi dan pemberlakuan pasar bebas. Yang pasti, bila pembatasan BBM bersubsidi dijalankan mayoritas pemilik mobil tahun lama beralih menggunakan motor, atau tetap menggunakan mobilnya dengan memanfaatkan sepedamotor membeli premium dengan harga subsidi Rp4500 per liter. Sejumlah supir angkot pun sudah senang dengan adanya niat membatasi BBM bersubsidi ini. Sebab, mereka tidak perlu lagi kerja keras narik penumpang siang-malam, cukup mengisi tangki angkotnya sebanyak-banyaknya. Kalau takut ketahuan bisa berpindah dari satu SPBU ke SPBU lainnya—karena untuk angkot/ plat kuning—tidak dilakukan pembatasan. Dari ‘’jual-beli’’ premium saja mereka dapat meraih keuntungan sampai Rp100 ribu seharinya. Sebulan Rp3 juta kerja tak capek untung besar. Konsekuensi bila pembatasan premium dan solar dijalankan, jumlah sepedamotor yang mengisi premium bisa meningkat dua kali lipat dari biasanya. Itulah impactnya karena perbedaan harga cukup besar. Yang biasanya Rp 4.500 per liter jadi Rp 7.000 per liter untuk mobil plat hitam. Akan terjadi antrean panjang di tempat-tempat pengisian sepedamotor. Hal seperti itu sudah seharusnya dipikirkan. Dan kita yakin pemerintah bersama DPR-RI sudah memiliki opsi lain. Sehingga dalam dua bulan mendatang kemungkinan besar masih ada perubahan lagi, apakah BBM bersubsidi dibatasi, atau dilakukan kenaikan harga saja sebesar Rp500 per liter untuk jenis premium dan solar mengingat opsi ‘’tersembunyi’’ (kedua) itu tidak perlu pengawasan.+


erkembangan kehidupan masyarakat memperlihatkan kecenderungan mudahnya terjadi gesekan sosial. Oleh karena itu sedikit saja muncul persoalan maka berbagai kemungkinan munculnya pemicu yang dapat berkembang menjadi konflik sosial. Sebagian analisa berpandangan bahwa hal itu merupakan dampak dari berbagai kesulitan hidup di bidang ekonomi, politik, pendidikan, hukum dan lain sebagainya. Karena itu, berbicara tentang gerakan kerukunan hendaklah secara serentak dilakukan perbaikan bangunan sosial di berbagai bidang. Hal ini disebabkan dampak reformasi yang harus dibayar bangsa ini karena pengembangan demokrasi kita tidak dikemas terlebih dahulu melalui penguatan kualitas pendidikan bangsa. Akibatnya, wawasan pemikiran masyarakat cenderung terpaku kepada hal-hal yang bersifat simbol. Sehingga simbol yang semestinya dipahami se-

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002

� Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385 � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109

KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta Pusat 10340 Tel: (021) 31922216, Faks: (021) 3140817.

� Biro Asahan: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412 Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan hitam-putih Rp. 33.000,Halaman depan berwarna Rp. 90.000,Ukuran kolom: 40,5 mm E-mail Iklan: Pencetak: PT Prakarsa Abadi Press Isi di luar tanggung jawab percetakan

saatnya ditingkatkan menjadi kampanye nasional mengingat semakin mudahnya emosi masyarakat tersulut akibat berbagai peristiwa yang awalnya kecil pemicunya akan tetapi kemudian dalam sekejap berubah menjadi emosi yang meluap-luap. Namun kampanye nasional gerakan kerukunan ini tidak akan banyak menolong manakala para pemuka masyarakat khususnya di bidang politik dan komunitas keagamaan belum dapat memberikan contoh keteladanan tentang pola kehidupan yang rukun. Kampanye nasional kerukunan itu dapat dikemas dalam berbagai program antara lain penyadaran terhadap semua masyarakat untuk meningkatkan kesadaran pentingnya pemeliharaan kerukunan; pengkajian terhadap berbagai peraturan atau kebijakan yang dapat menurunkan kadar kerukunan; serta melakukan kebijakan reward and punishment terhadap tindakan atau gagasan yang berkaitan dengan pemeliharaan kerukunan khususnya di bidang keberagamaan karena kerukunan beragama menjadi bagian penting dari kerukunan nasional. Gerakan kampanye nasional kerukunan sudah semakin sering disuarakan dalam berbagai pertemuan para pemuka agama dan agaknya sudah waktunya memperoleh apresiasi dari pemimpin nasional. Penulis adalah Dosen UIN Syarif Hidayatullah Jakarta

Kukuhkan Gerakan Wakaf Tunai Oleh Suhrawardi K Lubis Gerakan wakaf tunai yang telah dirintis pada periode 2005-2010, bahkan patut dijadikan sebagai program unggulan dan digerakkan secara terpadu


idak berapa lama lagi, akan berlangsung Musyawarah Wilayah Muhammadiyah dan Aisyiyah Sumatera Utara di Asrama Haji Medan. Sesuai ketentuan dalam Anggaran Rumah Tangga Muhammadiyah, acara Musyawarah Wilayah adalah a. Laporan PimpinanWilayah tentang: 1. kebijakan pimpinan, 2. Organisasi, 3. pelaksanaan keputusan-keputusan Muktamar,Tanwir, Instruksi Pimpinan Pusat, pelaksanaan keputusan MusyawarahWilayah, Musyawarah PimpinanWilayah dan Rapat Pimpinan Tingkat Wilayah, 4. Keuangan. b. Program Wilayah, c. Pemilihan Anggota PimpinanWilayahdanpengesahanKetua, d.PemilihanAnggotaTanwirwakilWilayah, e. Masalah Muhammadiyah dalamWilayah Sumatera Utara, dan f. Usul-usul. Dari sekian banyak materi acara MusyawarahWilayah, dalam kesempatan ini diketengahkan tentang acara point b, yaitu ProgramWilayah Muhammadiyah Sumatera Utara untuk tahun 2010-2015. ProgramWilayah merupakan dasar dan panduan kerja pimpinan terpilih untuk lima tahun kedepan dan menjadi acuan program Pimpinan Daerah Muhammadiyah se-Sumatera Utara, demikian seterusnyasecaraberjenjangsampaiketingkat Pimpinan Ranting. Dalam penyusunan Program Kerja lazimnya berjalan lancar, sebab Pimpinan Wilayah telah mempersiapkan terlebih dahulu rancangan program yang akan disampaikan pada acara persidangan. Program itu lazimnya sangat bagus. Namun yang menjadi masalah adalah action program. Sebab untuk menjalankan suatuprogramselaludiperlukanpendanaan, dan sumber pendanaan lazimnya terbatas dari warga dan amal usaha Muhammadiyah. Akibatnya hanya sebahagian kecil saja program yang dapat diaplikasikan. Untuk mengoptimalkan pencapaian program Muhammadiyah SU 2010-2015 (terutama sekali program pemberdayaan masyarakat), selain mengandalkan sumber pendanaan yang lazim, Musywil perlu mengkajisecarainovatifsumberpendanan

Hubungi kami Penerbit: PT Penerbitan Harian Waspada

kedar sebagai identitas namun dalam kenyataannya dipahami sebagian masyarakat sebagai inti. Kondisi yang demikian selayaknya tidak dibiarkan berlama-lama karena akan dapat mengganggu tatanan tradisi budaya yang sudah sejak lama diwariskan para pendahulu kita yang disemboyankan dengan bhinneka tunggal ika yaitu menerima dengan terbuka bangunan masyarakat yang majemuk di dalam suasana saling penghargaan namun pada saat yang sama setiap orang berpegang teguh kepada keyakinannya. Sekarang masih cukup tersedia waktu bagi kita untuk melakukan rekayasa terhadap kemajemukan itu agar tidak menjadi liar yang dapat menjauhkan kita dari budaya bangsa. Memang para pemuka agama umumnya telah melakukan upaya dengan mendorong agar terus terjadi proses internalisasi kerukunan melalui pertemuan para pemuka agama yang semakin intens guna lebih menarik pendulum pola hubungan umat beragama

ke arah pemantapan kerukunan di antara umat beragama dalam kehidupan berbangsa dan bernegara. Gesekan sosial kehidupan umat beragama terkadang tidak hanya terjadi pada umat yang berbeda iman akan tetapi juga dapat terjadi di dalam kelompok agama seiman namun berbeda aliran. Empat pilar penguatan kebangsaan telah diperkenalkan yaitu Pancasila, UUD 1945, Bhinneka Tunggal Ika dan Negara Kesatuan Republik Indonesia. Akan tetapi, gerakan kemasyarakatan yang dilakukan pemuka masyarakat ini ternyata belum cukup menarik minat dan perhatian karena belum dipAndang masyarakat sebagai hal yang mendesak. Karena itu, sudah pada waktunya manakala gerakan penguatan kerukunan sosial ini ditingkatkan menjadi kampanye nasional. Selama ini instansi yang secara langsung memprogramkan kerukunan ini adalah Kementerian Agama dan Kementerian Dalam Negeri. Terkadang, oleh karena persoslan otonomi daerah maka sinergi program dua instansi inipun di lapisan bawah masih kurang sejalan. Ditambah lagi program penguatan kerukunan yang mereka lakukan masih kurang optimal mengingat luasnya beban tugas yang dikelola masing-masing kementerian itu sehingga agenda pengembangan kerukunan hanya merupakan bagian kecil dari program kerja dua kementerian ini. Penguatan kerukunan ini sudah

yang akan digalang. Solusi sumber pendanaan Musywil Muhammadiyah SU ke-10 di Pematang Siantar pada tahun 2005 telah memprogramkan“GerakanWakaf Tunai Muhammadiyah Sumatera Utara” (GWTM-SU). Program ini sebenarnya sudah dijalankan oleh PWM 2005-2010, namun belum berjalan sesuai rencana, karena kurangmendapatperhatiandaripimpinan dan keluarga besar Muhammadiyah. Akibatnya dana wakaf tunai yang dapat dihimpun masih sedikit. Namun demikian, walaupun dana yang dihimpun masih sedikit, dana wakaf tunai tersebut sudah bermanfaat besar. Sebahagian dari dana wakaf tunai itu telah diinvestasikan di Rumah Sakit Umum MuhammadiyahSumateraUtara(RSUMSU).RSUM-SUpundapatberoperasilebih baik sehingga mampu memberikan hasil investasi setiap bulannya untuk dimanfaatkan sesuai dengan program yang telah direncanakan. Belajar dari GWTM-SU yang telah dilaksanakan, sesungguhnya wakaf tunai berpotensi besar untuk dikembangkan seacaraterpadu.Kalauitudapatdilakukan, tentunya GWTM-SU berpeluang menjadi amal usaha andalan yang khusus bergerak untukmenyiapkandanauntukpembiayaan aktivitas Muhammadiyah sampai ke tingkat ranting. Potensi GWTM-SU ini sangat besar, andaikan saja ada 50.000 orang anggota dan simpatisan Muhammadiyah Sumatera Utara mau berwakaf uang sebesar Rp10.000 (sepuluh ribu rupiah) setiap bulan, dalam satu tahun akan terhimpun dana Rp6.000.000.000.- (enam milyar rupiah), dan selama periode 2010-1015 akan terhimpun dana wakaf tunai (dana abadi Muhammadiyah SU) sebesar Rp30.000. 000.000.-(tigapuluhmilyarrupiah).Apabila dana ini diinvestasikan dan memberikan hasilsetaradengan1%sajadalamsebulan, maka Muhammadiyah SU akan memperoleh dana sebesar Rp300.000.000.-(tiga ratus juta) setiap bulan. Dengan dana tiga ratus juta setiap bulan tentunya banyak

programyangdapatdilaksanakan.Potensi Wakaf Tunai ini semakin besar apabila jumlah dana wakaf yang terhimpun lebih besar lagi. Jadikan wakaf tunai program unggulan Musywil Muhammadiyah maupun Aisyiyah Sumatera Utara layak mengukuhkan kembali gerakan wakaf tunai yang telah dirintis pada periode 2005-2010, bahkan patut pula dijadikan sebagai program unggulan dan digerakkan secara bersama-samadisemuatingkatkepemimpinan, sehingga gerakan wakaf tunai menjadi program terpadu segenap warga Persyarikatan Muhammadiyah di SumateraUtaradandilaksanakandiseluruhamal usahaMuhammadiyahmaupunAisyiyah. Kenapa wakaf tunai layak dijadikan program unggulan? Karena wakaf (tunai) merupakan ibadah yang unik. Keunikan wakaftunai,selainbermanfaatsecaraabadi untuk kemaslahatan umat manusia (hablumminannas),jugamerupakanaplikasi ketakwaan kepada Allah swt (hablum min Allah). Dengan kata lain wakaf tunai merupakanibadahyangbermanfaatbesar untuk mendorong kemaslahatan umat manusia karena hasilnya dapat digunakan untuk pemberdayaan umat secara berkesinambungan, dan selain itu orang yang berwakaf mendapatkan limpahan pahala berlipat ganda secara terus menerus, walaupun ia telah meninggal dunia. Adapun keunggulan lain wakaf tunai ini mudah untuk dilaksanakan, mudah memanfaatkannya, lebih aman dan lebih produktif.Wakaf tunai mudah dilaksanakan karena dapat diamalkan oleh setiap orang tanpa harus menunggu menjadi kaya terlebih dahulu. Kalau tidak dapat berwakaf uang atas nama perseorangan bolehdilakukanatasnamajamaahdengan cara masing-masing anggota jamaah berwakaf sesuai dengan kemampuan keuangan masing-masing. Dengan mudahnya ibadah wakaf tunai ini dilaksanakan, tentunya akan berpeluang mengumpulkan dana wakaf dalam jumlah yang besar, dan semakin banyak orang yang memperoleh sedekah jariah. Selain itu wakaf tunai mudah untuk dimanfaatkan. Kenapa kemudahan memanfaatkan wakaf menjadi keunggulan? Sebab harta wakaf, yang dapat dipergunakan adalah manfaat dari harta wakaf itusendiri,sedangkanhartawakafnyatidak boleh habis. Pemanfaatan harta wakaf dalam bentuk uang tunai tentunya jauh

lebihmudahdibandinghartawakafdalam bentuk tanah atau benda lainnya. Sebab memanfaatkan wakaf uang tidak diperlukan modal tambahan, sedangkan untuk pemanfataan harta wakaf dalam bentuk tanah diperlukan modal tambahan untuk memanfaatkannya. Sedangkandarisudutkeamananharta wakaf, wakaf uang jauh lebih aman dari pada wakaf tanah. Wakaf tanah selalu berpeluang untuk dipersoalkan oleh pihak lain, misalnya ahli waris atau pihak ketiga lainnya, apalagi perwakafan tersebut tidak melalui prosedur perundang-undangan wakaf dan tidak memiliki sertifikat wakaf. Sedangkan wakaf uang prosedurnya tidak rumit, begitu uang wakaf diserahkan, tidak lama kemudian Lembaga Keuangan Syariah PenerimaWakaf Uang mengeluarkan Sertifikat Wakaf Tunai Keunggulan lainnya, wakaf tunai lebih produktif? Lebih produktif karena setalah uang wakaf diterima langsung dapat diinvestasikandisektorriil,atausetidaknya (sambil menunggu uang wakaf memadai untuk diinvestasikan) didepositokan di perbankan syariah. Dengan cara ini wakaf uang lebih cepat menghasilkan, sehingga wajarsajakalauwakafuanglebihproduktif dibandingwakafdalambentukbendalain. Bahkan wakaf uang dapat pula digunakan untuk menjadikan harta wakaf lain lebih bermanfaat. Demikianlah tulisan ini, mudahmudahan dapat menjadi bahan masukan bagipesertaMusywilMuhammadiyahdan Aisyiyah yang akan dilangsungkan pada tanggal 6 s/d 9 Januari 2011. Semoga Muhammadiyah dapat menghantarkan umat Islam ke pintu gerbang surga Jannatun Na’im dengan keridlaan AllahYang Rahman dan Rahim. Penulis adalah Dosen UMSU, Ketua LAZISWA Muhammadiyah SU, dan Candidat PhD ISDEV-USM

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik


Faks 061 4510025

+6285275076031 Bpk Bupati Simalungun yth, tlng di tnjau jmbtn yg mnghbung kan Desa Parhundalian dgn Desa Proyek yg trltak di Kec. Hatonduhan,Kab.Simalungun.Jmbtantsbthnyaditu2pidgnpapan2 sja yg sdh lapuk & sdh prnh mnLan korban. Apa krna Desa tsbt brda di pLosok2 mka nya gk diprbaiki? Org2 yg mLwati jmbtan tsbt sdh brgoyang dngdut kalau tiba saat ny hrs mlwti jmbtan tsbt. Aplgi kalau anak2 prgi skLh hrs mLwati jmbtn tsbt pda pagi2 hri sekali kira2 jm 04.30WIB, krna skLh mrka jauh dri tmpat mrka tinggal. Itu kan sgt mngncam ksLmtan. Terima kasih ! +6285275709700 Hidup adalah kesenangan yg memperdayakan,jganlah kamu lupa akan urusan akhiratmu krn dsana kekal tiada kematian.perbanyaklah amal yg benar utk urusan akhi-ratmu,sungguh rugijkmenghabiskanwaktukitahnyutkperkataandanperbuatan sia2dantiadaguna.mkperba-nyaklahperkataandanprbuatanmu utk akhiratmu.carilah urusan akhiratmu seola engkau akan mati

Face Book username: smswaspada

besok dam carila urusan duniamu seola engkau hidup slamany.ingatlahsebaikbaikbekaladalahtaqwa.adahtptdkpernah atw tdk sesuai dgn ajaran rasulullah saw.sdngkan KHILAFIYAH adalah masalah yg msh bs diprdebatkan guna mencari titik kebenaran.tetapi gn mengatan‘jgn membesar besarkan masalah khilafi-yah’,padhal it mslah ksyirikan yg hrs dibrantas hgga k akarnya,yg lbh ironisny lg pembelaan2 yg batili +6281375598560 Yth, redaksi harian Waspada, mohon penjelasan tentang penggunaan bahasa : Tim NASIONAL ACEH. Ini sering saya baca di harian Waspada ini saat memberitakan tim sepak bola Aceh yang berlatih di luar negeri. Bagi saya, penggunaan kata Nasional Aceh, seakan tidak menyurutkan keinginan Aceh untuk merdeka. Redaksi. Terima kasih atas masukannya.

SUDUT BATUAH * Sultan: Suara rakyat adalah suara uang - Money Politik! * Perubahan arus lalu lintas kajian gagal - Kayaknya senang bikin orang susah * 2013 Inalum menjadi perusahaan negara - Biar lebih mudah dialihkan


D Wak


Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Sofyan Harahap, H. Azwir Thahir, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Desk Edisi Luar Kota: H. Halim Hasan. Desk Edisi Medan & Sekitarnya: H. Akmal AZ. Asisten Redaktur: Rudi Faliskan (Berita), David Swayana (Kota Medan, Infotainmen), Irwandi Nasution (Kota Medan), Feirizal Purba, Diurna Wantana (Sumatera Utara), H.T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, KMS Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (KMS Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Humas: H. Erwan Effendi, Aidi Yursal. Litbang: Hj. Emma Sujianti Tarigan. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (Aceh). Wartawan Kota Medan (Umum): H. Erwan Effendi, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), Nurkarim Nehe, Bustami Chie Pit, Sapriadi (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat), Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap (Padang Sidimpuan), Sori Parlah Harahap (Gunung Tua), Idaham Butarbutar, Syarif Ali Usman (Sibuhuan), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Sudarmansyah (Blang Pidie), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

� Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �


WASPADA Senin 20 Desember 2010

Abu Di Atas Kacau Di Bawah Oleh Rosihan Anwar


INGGU petang tanggal 7 November 2010 di desa Gemampir yang terletak kurang lebih 12 Km dari puncak gunung Merapi Puranti berdiri menangis tidak tahu apa yang harus diperbuatnya. Merapi menyemburkan abu ke udara, bunyi letusan masih kedengaran. Beberapa jam sebelumnya ahli keluargaPuranti naik lagi mendaki Merapi menuju desa yang telah mereka tinggalkan untuk mengambil pakaian bersih di rumah. Pada hari Minggu itu pejabat-pejabat pemerintah melaksanakan perintah pengungsi di Gemampir yang dianggap cukup aman buat menampung para pengungsi. Tapi keluarga Puranti belum juga kembali dari desa mereka. “Saya tidak tahu apa yang akan terjadi. Mereka telah pulang ke rumah dan mereka belum juga kembali. Dan saya tidak bisa berhubungan dengan mereka” kata Puranti yang mengamati arus pengungsi turun dari Merapi. Itulah lagi sebuah cerita ditulis oleh dua wartawan International Herald Tribune Aubrey Belford dan Norimitsu Onishi dalam edisi Senin, 8 November 2010 dengan judul: “Abu di udara, kekacau-balau di darat”. Nyaris dua minggu, setelah Merapi pertama kali menyemburkan abu yang mematikan tanggal 26 Oktober, Indonesia terus bergumul dengan masalah korban manusia dari bencana itu. Lebih dari 135 orang tewas, menurut Badan Nasional Pengelola Bencana (BNPS). Erupsi telah mengirim puluhan ribu orang mengalir masuk kamp-kamp yang tidak siap di sepanjang Jawa Tengah. Mereka telah melarikan diri dari daerah yang sebelumnya dianggap di luar jangkauan Merapi. Tidak jelas berapa jumlah pengungsi. Pemerintah menaksir sebanyak 278.000 orang. Palang Merah Indonesia memperkirakan 135.000 orang. Pada hari Sabtu banyak penerbangan asing membatalkan penerbangan ke Jakarta, karena ketakutan abu Merapi akan menyebar. Tapi kebanyakan perusahaan itu beroperasi lagi pada hari Minggu. Para pembesar mengatakan pada umumnya mereka bisa mengendalikan keadaan dengan cukup makanan, obat-obatan, dan atap perlindungan. Akan tetapi di beberapa daerah yang terkena bencana, koordinasi dan pasokan (suplai) masih kurang sekali, demikian tulis kedua wartawan Amerika.Dan sekalipun di daerah-daerah yang paling bagus diorganisir, ancaman erupsi berkelanjutan oleh gunung tak bisa diramalkan itu berarti para pengungsi akan semakin menghadapi risiko penyakit dengan berkisarnya sang waktu, demikian menurut para pejabat Palang Merah Indonesia. Menurut Philip Charlesworth kepala Federasi Palang Merah Internasional di Jakarta “Sesuatu harus dilakukan untuk rakyat yang hidup berdempetan tumpang tindih di kampkamp pengungsi”. “Banyak sekali orang tidak akan mampu kembali ke kediaman dan kehidupan mata pencarian mereka. Pemulihan jangka panjang akan sulit sekali” kata ketua Federasi Palang Merah Internasional itu. Di Gemampir kurang lebih 13 Km dari pinggiran Merapi penduduk desa tinggal di sana, kendati pemerintah menyatakan suatu zona berbahaya 15 Km hari Jumat, lebih dari 2000 penduduk desa menampung 400 pengungsi dari daerah lebih ke atas dari Merapi dan bukannya mereka melakukan pengungsian. Berdiri dekat sebuah sepeda motor dengan isterinya, ibu dan anak, Suyadi seorang petani setempat berkata dia kecewa zona pengungsian tidak dipaksa dilaksanakan. “Saya khawatir, saya betul-betul cemas” katanya, seraya penduduk desa menumpuk menumpang truk-truk dan kendaraan dan bersesak-sesak naik sepeda motor.“Pemerintah seharusnya memberitahukan kepada kami hari itu untuk mengungsi”. Sutopo Purwo Nugroho direktur Badan Nasional Pengelola Gemampir datangnya begitu kasih. Akan tetapi dia mengatakan pemerintah menawarkan ganti rugi antara 7 dan 12 juta rupiah untuk satu sapi yang hilang, untuk meyakinkan penduduk meninggalkan rumah kediaman mereka. “Kami harap ini akan menghentikan penduduk untuk balik kembali ke desa-desa mereka’ kata Nugroho. Lebih jauh ke bawah di lereng gunung, para relawan mengeluh terdapat banyak pengungsi sebelah timur Merapi yang masih belum terjangkau oleh pemerintah. “Erupsi Merapi pada hari Jumat menghancurkan segala-galanya” ujar Muhammad Joko Saptomo yang mengorganisir pemondokan sementara waktu dalam kamp-kamp pengungsi yang tidak resmi bagi 1500 orang di Kecamatan Klaten, sebelh timur Merapi. “Tiap orang melarikan diri sendiri-sendiri dengan tiada koordinasi bagi ke mana mereka hendak pergi”. Di Yogya Rumah Sakit Dr Sardjito satu-satunya fasilitas medis di daerah itu yang punya unit luka bakar menampung korban-korban luka bakar. Pada hari Minggu ada 28 orang korban, kebanyakan menderita kebakaran lebih dari 70 persen tubuh mereka, kata Dr Sigit Priohutomo dari rumah sakit itu. Diharapkan hari Minggu akan tiba ventilator, obatobatan dan suplai lain dari Jakarta dan dari tempat lain, katanya. “Jika kita terus mengalami erupsi-erupsi kecil, saya pikir kami akan Oke, karena daerah-daerah telah dievakuasikan. Tapi jika ada letusan yang lebih besar, maka itu berarti kesulitan” kata Dr Priohutomo, demikian tulis wartawan koran Amerika. Jangan menganggap cerita ini sudah using, sebab di dalamnya terdapat bahan pembelajaran bagi kita. (+++)


Dedi Sahputra

Penegakan Hukum: Keadilan & Kepastian Oleh Prof Dr Sunarmi, SH,MHum …hakim seyogianya mendasarkan putusannya sesuai dengan dan memperhatikan kesadaran hukum dan perasaan hukum serta kenyataan masyarakat, yang sedang hidup di dalam masyarakat ketika putusan itu dijatuhkan


residen Susilo BambangYudhoyono dalam kunjungannya ke LembagaPemasyarakatanKelas II-A Anak Pria, Tangerang Banten,Selasa,16Februari2010menilai,dalam praktik penegakan hukum saat ini, rasa keadilan masyarakat kerap terusik. Keadilantidakselalusejalandenganhukummeskipun penegakan hukum itu sendiri harus sedekat mungkin dengan keadilan. Manakala ada jarak antara hukum dan keadilan, mari kita tata kembali agar keadilan itu betul-betul tegak. Sesungguhnya apa yang disampaikan presiden tersebut merupakan dambaan semua para pencari keadilan di Indonesia. Sejaklamaparapencarikeadilanmendambakanpenegakanhukumyangadil.Berbagai putusan pengadilan sepertinya menggambarkankekecewaanmasyarakatterhadap penegakan hukum di Indonesia. Kalau begitu, manakah yang lebih diutamakan dalam penegakan hukum? Hukum memiliki tujuan yaitu keadilan, kepastian hukum dan manfaat.Tetapi dalam pelaksanaannya apabila hukum mengutamakan kepastian hukum, maka penegakkannya akan menggeser nilai keadilan, demikian sebaliknya. Dalam praktik penegakan hukum yang sedang berlangsung saat ini, pengutamaan nilai kepastian hukum lebih menonjol dibandingkan dengan rasa keadilan masyarakat. Pada hakekatnya hukum itu sendiri adalah keadilan. Socrates hidup pada tahun 469 – 399 SM, filsuf dan kritikus yang paling berpengaruh diYunani pernah menyatakan hakekat hukum adalah keadilan. Socrates dalam usahanya menemukan dan mengajarkan prinsip-prinsip keadilan menyebutkan bahwa keadilan yang sesungguhnya serta hukum yang benar itu tidak akan ditemui dalam undangundang yang dibentuk penguasa-penguasa Negara. Ia bertempat tinggal di dalam diri dan dalam kesadaran manusia itu sendiri. Selanjutnya Socrates menyebutkan : dalam nurani tiap insan bersemayamlah keadilanyanghakikiatausesungguhnya— di situ mereka dapat mendengar bagaimana irama dari degup jantung yang merah, bersih dan suci. Hanya dengan degupan yang bersih, organ yang suci ini (nurani) menjadi terlindungi dari kungkungan kabut keserakahan, kelicikan, kecurangan, danlainsebagainya.Hukumsertaperasaan keadilan dalam pengertian sesungguhnya itu hanya akan ditemukan di dalam nurani tiap-tiapinsan,daniaakanselalumendampingi, terutama manakala mereka mene-

*** Sikap yang selalu dianjurkan adalah menjaga prasangka baik (husnuzhon) dan menghindari prasangka buruk (su’uzhon). Kalimat ini dihapal banyak orang dan sering dilafalkan dalam kehidupan sehari-hari. Adakah yang salah dari sikap seperti ini? Tentu saja tidak. Bahkan Allah SWT telah memberi garis:… jauhilah kebanyakan dari prasangka, sesungguhnya sebagian prasangka itu adalah dosa dan janganlah kamu mencari-cari kesalahan orang lain…” QS.49:12. Tetapi dalam penggunaannya, kalimat ini bisa mengandung subhat kepada keburukan itu sendiri. Dan di sinilah letak masalahnya. Terutama jika sikap yang diyakini sebagai husnuzhon itu kemudian melandasi perilaku kita. Husnuzhon adalah untuk sesuatu yang belum kita yakini kesalahannya atau untuk sesuatu yang belum jelas benar-salahnya. Tetapi ber-husnuzhon untuk sesuatu yang sudah jelas menyimpang. Atau malah memberi ruang bagi penyimpangan itu untuk membesarkan dirinya. Tidak bisa tidak, inilah subhat itu. Maka ketika Anas Urbaningrum mengatakan dia sedang ber-husnuzhon ketika mengangkat tokoh Islam Liberal, Ulil Abshar Abdalla menjadi Ketua Divisi Pengembangan Strategi DPP Partai Demokrat. Tingkat subhatnya menjadi sangat kental. ‘’Paling tidak biar kita tidak jumud dalam pemikiran Islam,’’ katanya ketika bertandang ke redaksi Waspada kemarin. Ini lebih salah lagi. Apakah kalau tidak liberal sudah pasti jumud!

tapkan atau mengambil sebuah keputusan (termasuk keputusan hukum itu sendiri). Socrates pernah menyampaikan kepada salah seorang sahabatnya: “Wahai sahabatku, tahukah Anda, sesungguhnya keadilan adalah tidak seperti yang terlihat (sesuatu yang diputuskan secara secara aktual oleh magistrat dan legislatur, melainkan sesuatu yang (tingkat abstraksinya) melampaui keseluruhan dari apa yang negara dapat lihat sebagai hukum, karenanya Anda harus ingat, bahwa hukum bukanlah apa yang secara umum dituangkan dalamprodukperundang-undangannegara, melainkan apa yang kita (warga masyarakat) anggap sebagai hukum.(Herman Bakir, 2007: 162). Jauh sebelum masa Socrates, Anarcharsis, satu dari“tujuh orang bijak”Yunani yang hidup pada abad ke 7 SM menyampaikan pada Solon :”Ketidakjujuran dan keserakahan yang belakangan mewarnai sejumlah segi kehidupan warga Athena hanya dapat ditertibkan dan dikendalikan dengan menerbitkan aturan-aturan dalam bentuk tertulis, tapi Anda jangan terlalu berharap banyak, sebab keseluruhan produk hukum yang Anda komposisikan itu hanyaakanmenjadisemacam“jaringlabalaba”, bahwa ia hanya akan menangkap si lemah dan si miskin, sedang mereka yang kaya dan kuat dapat dengan mudah merobekdanmenembusjaringhukumitusecara berulang-ulang. Apa yang disampaikan filsuf besar pada masanya tersebut sesungguhnya banyak terjadi dalam penegakan hukum di Indonesia saat ini. Penegakan hukum saat ini cenderung lebih menekankan pada kepastian hukum dibandingkan dengan keadilan. Penerapan hukum lebih bersifat positif legalistis yaitu cara berhukum berdasarkan Undang-undang (alles binnen de kader van de et). Dalam hal ini hakim tidak berpikir jauh kecuali membaca teks dan logika penerapannya. Cara berhukum seperti ini ibarat menarik garis lurus antara dua titik, yang satu adalah (pasal) Undang-undang dan titik yang lain adalah fakta yang terjadi. Segalanya berjalan secara linier, sehingga cara berhukum adalah seperti mesin otomatis. Paul Scholten menyebut“hanteren van logische figuren”. O.W. Holmes menyebutkan “ a book of mathematics). Hukum bukan suatu proses yang logis semata. Akibat penerapan hukum positif legalistis ini akan menggiring penegakan hukum pada legisme. Hakim tidak boleh berbuat selain daripada menerapkan undang-undangsecarategas.Hakimhanya

sekedarterompetundang-undang(bouche de la loi). Hanya menyuarakan bunyi undang-undang tanpa mempertimbangkan rasa keadilan masyarakat. Semakin jauhnya nilai keadilan dalam penegakan hukum di Indonesia dinarasikan Prof. Arief Sidharta sebagai berikut : “Ketika dewi Themis (Lady of Justice, Ibu keadilan) berkunjung ke berbagai negara di seluruh dunia untuk melihat bagaimana kondisi penegakan hukumnya, dia begitu tersenyum sampai di Singapura, Jepang, Inggris dan juga Kanada. Hal yang membuat Sang Dewi tersenyum adalah bahwa di tiap-tiap negara yang ia kunjungi, ia sudah melihat bahwa dalam penegakan hukum, pengutamaan keadilan sudah beradadigaristerdepan.Namunketikakakinya diinjakan di Indonesia, dia mengurungka niatunukmeneruskanperjalananya.Iamemutuskan untuk segera pulang saja ke Gunung Olympus, kemudian di sana dia duduk merenung di sebuah batu, lalu menangis. Dia betul-betul bermuram durja melihatkondisipenegakanhukumyangterjadi di Indonesia, dia betul-betul merasa di lecehkan, ditelanjangi bahkan mau diperkosa oleh permainan politik para penguasa......” St. Augustine menyebutkan“Apa jadinya sebuah negara tanpa keadilan kalau bukan segerombolan perampok”. Kondisi penegakan hukum yang demikian sangat menyakiti rasa keadilan masyarakat, Prof. Sacipto Rahadjo menanyakan, sebenarnya tujuan hukum itu untuk siapa, untuk peraturan itu sendiri atau untuk masyarakat. Bila sesungguhnya hukum itu untuk kepentingan masyarakat maka seharusnya hukum memenuhi rasa keadilan masyarakat. UU No.14 tahun 1970 tentang UU Pokok Kekuasaan Kehakiman telah mengatur hal ini dalam Pasal 27 ayat (1) UUPK : hakim sebagai penegak hukum dan keadilan wajib mengadili, mengikuti dan memahami nilai-nilai hukum yang hidup dalam masyarakat. Pasal ini secara tegas mewajibkan hakim untuk menggunakan seluruh kemampuannya, berdasarkan tugas dan wewenangya agar menggali, mengikuti, dan memahami nilai-nilai hukum yang hidup dalam masyarakat. Ketentuan ini diadopsi lagi dalam UU No. 24 tahun 2004 tentang UU Pokok Kekuasaan Kehakiman dalam Pasal 28 ayat (1) UU No. 4 Tahun 2004 menyebutkan bahwa Hakim wajib menggali, mengikuti dan memahami nilai-nilai hukumdanrasakeadilanyanghidupdalam masyarakat. Masyarakat lebih menghendaki penegakan hukum sesuai dengan rasa keadilan masyarakat. Hal ini sejalan dengan Aliran Interessenjurisprudenz (Freirechtsschule), menyatakan bahwa hakim dan pejabat lainnya mempunyai kebebasan yangseluas-luasnyamelakukanpenemuan hukum. Tidak sekedar menerapkan undang-undang, tetapi mencakup memperluas, mempersempit dan membentuk peraturan dalam putusan hakim dari tiaptiap perkara konkrit yang dihadapkan pa-

danya—agar tercapai keadilan yang setinggi-tingginya dan dalam keadaan tertentu hakim bahkan boleh menyimpang dari undang-undang—demi kemanfaatan masyarakat. Jadi yang diutamakan bukanlah kepastian hukum, karena peraturan perundang-undangan, hukum kebiasaan, yurisprudensi, perjanjian internasional. Doktrin hanyalah sebagai “pengantar” atau “pembuka jalan”, “pedoman” dan “bahan inspirasi” atau sarana bagi hakim untuk membentuk dan menemukan sendiri hukumnya yang dinyatakan dalam putusannya atas suatu perkara yang diadilinya dan dihadapkan padanya itu. Selain itu Aliran Soziologische Rechtsschule, mengajarkan bahwa hakim seyogianya mendasarkan putusannya sesuai dengan dan memperhatikan kesadaran hukum dan perasaan hukum serta kenyataan-kenyataan masyarakat, yang sedang hidup di dalam masyarakat ketika putusan itu dijatuhkan. Begitu pentingnya nilai keadilan dalam masyarakat ini ditegakkan di samping nilai kepastian hukum. Putusan pengadilan haruslah menjamin keadilan dan kepastian hukum serta bermanfaat. Selain itu penegakan hukum diterapkan tanpa diskriminasi. Penegakan hukum yang tidak mengindahkan prinsip“equality before the law “ sehingga menghasilkan perilaku diskriminatif akan merusak tatanan sistim, sekaligus akan menciderai serta kegagalan dalam melaksanakan sistim yang menimbulkan citra buruk pada semua kalangan masyarakat termasuk masyarakat internasional. Apabila kurang terwujudnya nilai keadilan dalam masyarakat ini salah satunya disebabkan meningkatnya kuantitas perkara, sedangkan jumlah Sumber Daya Manusianya terbatas, alternatif yang dapat ditawarkan adalah difungsikannya lembaga Alternatif Dispute Resolution (ADR, dibatasinya perkara-perkara yang diproses di Pengadilan). Bukankah langkah ini dulu pernah dilakukan pada masa kolonial dengan menentukan bahwa hanya perkara-perkara pentinglah yang dapat dibawa ke Landraad. Untuk perkara yang kurang penting dapat diselesaikan di Rechtspraak. Dalam rangka mewujudkan nilai keadilan masyarakat, menurut Presiden, saat ini pemerintah akan menyusun kembali sistem yang tidak menyamaratakan perbuatan kriminal yang dilakukan oleh anak-anak, penyAndang cacat berat, orang lanjut usia, atau pelanggaran ringan yang terjadi karena tekanan kemiskinan. Namun sejak pernyataan bapak Presiden disampaikan pada bulan Februari sampai saat ini belum terlihat realisasi tersebut. Masyarakat menanti perubahan tersebut. Apakah pernyataan itu hanya janji atau kita masih menunggu lama realisasinya ? Mudah-mudahan dapat segera diwujudkan. Amin. Penulis adalah Guru Besar Fakultas Hukum USU

Trio Hukum Dan Lembaga Peradilan

Keyakinan Yang Mengerikan Ketika menerima penjualan koran bekas yang sudah menggudang di rumah kami, tukang botot keliling itu sangat bergembira. Sambil menyanyi-nyanyi kecil lelaki setengah baya yang sederhana itu mengumpulkan dan menimbang kertas-kertas tersebut. Untung lumayan sudah terbayang dari penjualan barang bekas itu. Saya ingin membuatnya lebih gembira lagi. ‘’Mau juali TV kami?’’ tanyaku. Dia agak heran sambil melirik TV kami yang masih aktif, ‘’Gak bisa,’’ katanya menggeleng sambil tersenyum. ‘’Kalu juali HP..?” Dia kembali menggeleng kemalu-maluan. ‘’Kalau jual mobil ini gimana?’’ tanyaku lagi, yang dijawab dengan reaksi yang sama. Saya jadi terpana, betapa yakinnya dia pada ketidakmampuan dirinya.


Saya kira juga tidak. Kata Anas lagi, ‘’Saya mengambil yang baik-baiknya saja. Tidak ada yang semuanya baik, pasti ada yang tidak baiknya. Jadi saya mengambil yang baik-baiknya saja.’’ Atas jawaban-jawaban tersebut, izinkan saya memberi penilaian betapa rendah hatinya sosok Ketua Umum Partai Demokrat ini untuk berlaku “gagap” ketika menjawab pertanyaan tentang Ulil. Karena Ulil dan kelompoknya adalah orang yang gemar berdakwah agar umat Islam menjauhi agamanya. Mereka berdakwah secara tersistim mengajak kaum Muslimah tidak usah menutup aurat, membolehkan pernikahan beda agama, memarahi orang yang melarang kaum homoseksual dan lesbian dan lain-lain yang sungguh memprihatinkan. Kata mereka, inilah cara untuk kemajuan Islam. Maka jelas, sungguh besar tingkat kontroversi Ulil dan teramat besar resistensi mengangkatnya menjadi pengurus sebuah partai yang butuh dukungan khalayak. Maka sulit sekali membantah asumsi bahwa ada kekuatan besar yang mempengaruhi keputusan Anas mengangkat Ulil. Atau jangan-jangan memang Anas sama dengan Ulil. *** Soal pemikiran liberal ini adalah soal keyakinan pada kebenaran sekaligus kepada kekeliruan dalam beragama. Orang-orang liberal itu meyakini kelompoknya sebagai orang yang membawa suatu “kebenaran baru” dalam beragama. Maka menjadi menarik apa yang dikatakan seorang budayawan, Prie GS tentang kebenaran. “Keyakinan menjadi menarik bukan cuma karena kekuatannya, melainkan juga sikapnya yang tanpa prasangka. Ia bisa untuk meyakini apa saja tak peduli kebenaran maupun kekeliruan. Itulah kenapa selain ada orang yang amat kuat meyakini sebuah kebenaran, juga ada orang yang sangat kuat menyakini kekeliruan. Keduanya sama-sama kuat, dengan hasil yang sama-sama mencengangkan. Bedanya hanya, jika yang pertama bersifat gigantik, yang kedua besifat dramatik. Jika yang pertama lebih layak disebut menakjubkan, yang kedua lebih cocok disebut mengerikan.” Saya kira juga begitu. Jika sebuah keyakinanpadakekeliruanyangsudahberlangsungsecara sistimatis itu bertemu dengan kekuatan sebuah partai politik terbesar di negeri ini. Maka tinggal menunggu waktunya saja, mereka akan memasuki urat-urat regulasi. Selanjutnya, keyakinan pada kekeliruan itu akan menjadi konstitusional. Betapa mengerikannya.

Kolom foliopini dapat juga diakses melalui

Oleh Drs M. Amin, SH, MH Sebuah lembaga publik yang dianggap agung (berwibawa dan disegani), manakala lembaga itu dipercaya oleh masyarakat


engan terpilihnya Trio Penegak Hukum Indonesia; Bustro Muqaddas, 58, sebagai Ketua Komisi PemberantasanKorupsi(KPK),BasrieArief, 63,sebagaiJaksaAgungdanTimurPradopo sebagai Kapolri, ekspektasi masyarakat terhadap penegakan hukum di Indonesia sangat tinggi. Busro Muqaddas, banyak diyakini sebagai sosok yang memiliki karakter lemah gemulai namun tegas dalam prinsip. Basrie Arief, sebagai orang “dalam” yang banyak mengetahui seluk beluk perilakukoruptifdanmanipulatifdijajaran kejaksaan, diharapkan akan sukses memperbaiki lembaga kejaksaan, dan bukan justru sebaliknya menampilkan kompromistis.SedangkanTimurPradopodiharapkan mampu membenahi institusi kepolisian yang dinilai sangat jauh dari memenuhi harapan dalam penegakan hukum. Di satu sisi, tingkat korupsi di berbagai lini kehidupan bernegara dan bermasyarakat telah sangat mengkhawatirkan dan dapatmeruntuhkansendi-sendikehidupan manusia bermoral di bumi Indonesia. Di sisi lain, rendahnya tingkat kepercayaan masyarakat terhadap penegak hukum sangat membutuhkan kerja nyata. Sehingga ketiga lembaga penegak hukum itu harus sungguh-sungguhbersinergidalamupaya membongkar berbagai kasus korupsi dan membawa pelakunya ke pengadilan guna diberi hukuman yang berat dan setimpal. Mengenai menurunnya kepercayaan masyarakatterhadappenegakanhukum,juga diakuiPresidenSBYketikamembukarapat kerja Kejaksaan Agung baru-baru ini. Sesungguhnya,institusikepolisiandan kejaksaan sebagai lembaga pertama dan utama penjerat pelaku korupsi sudah cukup“malu”-engan dibentuknya lembaga lain, seperti KPK dan Satgas Pemberantasan Mafia Hukum (PMH). Karena dengan begitu menunjukkan betapa kurang efektifnya lembaga-lembaga itu menjalankan tugasnya, sehingga harus dibentuk lembaga lain. Penulisberpendapat,penegakhukum sebenarnya telah mengetahui betul berbagaimodusoperandidanpraktekkoruptif serta cara membongkar dan menemukan bukti-buktinya.Sehinggasebenarnyatidak ada alasan untuk tidak dapat bekerja dengan baik dan profesional. Tinggal lagi, sayangnya,faktornonhukumselalumempengaruhi dalam setiap menangani sebuah perkara. Oleh karena itu, menjadi

tantangan bagi pimpinan Kepolisian dan Kejaksaan untuk memperbaiki kinerjanya. Hal yang sama, sebagai sebuah tantangan, juga bagi lembaga peradilan, sebagai benteng pemberi keadilan masyarakat. Lembaga yang aparatnya telah memperoleh tunjangan kinerja ini tidak boleh mengabaikan kondisi dan semangat negara dalam memberantas korupsi dan segala kejahatanyangada.SurveiTII(TransparencyInternationalIndonesia)tahun2009yang menempatkaninstitusiperadilandibawah Partai Politik, Legislatif dan Kepolisian pada posisi lima besar lembaga negara terkorup, harus memacu kinerjanya dalam menegakkan hukum secara profesional dengan tidak terpengaruh oleh pertimbangan non hukum. Adanya keluhan masyarakat yang merasatersayathatinyaolehperilakupenegak hukum, kepolisian dan kejaksaan di tingkat penyidikan dan penuntutan, serta peradilan, akibat putusan yang dinilai tidak adil, harus diterima sebagai sebuah kenyataan dan sekaligus dijadikan sebagai pemicu perubahan. Pendekatan humanis Pelaku dan perilaku korupsi adalah sebuah perilaku yang menganggap materi menjadi tujuan hidup. Menjadi tuhan-nya. Yang berarti pula, harta adalah sumber kebagiaan dan kesenangan, namun ia lupa bahwa kesenangan seperti itu bersifat sementara, yang pada akhirnya, lambat atau cepat, akan timbul berbagai ketidaktenangan. Oleh karena itu, perlawanan terhadap pelaku dan perilaku korupsi yang digulirkan saat ini, menurut Busro, kurang efektif. Maka konsep kenabian yang ditawarkan Busyro Muqaddas, ketika mengikuti teskandidatpimpinanKPK,adalahrelevan, yaitu selain menggunakan tindakan yang bersifat perlawanan, juga menggunakan cara-cara humanis transendental, tanggung jawab kepada Tuhan. Tindakan korupsidianggapsebagaiupayadehumanisasisehinggakonsepkenabiansebagaiupaya “me-manusia-kan” kembali manusia Sebagaimana diketahui bahwa pelaku korupsi banyak melibatkan pejabat dan pengusaha dan orang-orang yang telah memiliki harta kekayaan yang melimpah. Hal tersebut menunjukkan bahwa hidupnya mengutamakan mencari harta dan kesenangan hidup tanpa dillandasi nilainilaiagama.Kesenangannyadigantungkan kepada seberapa banyak harta yang dikumpulkan dan dimilikinya, sehingga ber-

bagaicaradilakukannyaasalmenghasilkan harta kekayaan. Menyuap, memeras dan me-“nyunat” dana pembangunan adalah cara-cara yang dilakukan tanpa memperhatikan kerugian di pihak lain. Hati dan jiwa orang seperti inilah yang mesti di“garap” untuk diberi pencerahan dan keyakinansebagaimanasabdaNabiMuhammad Saw bahwa“Jika manusia diberi dua gunung dari emas, ia masih akan mencari yang ketiganya”. Agaknya, antara lain inilah yang diinginkan oleh Busro Muqaddas dengan konsep ke-nabian-nya. Reformasi birokrasi peradilan Lembaga yang tidak kurang mendapat sorotan tajam beberapa tahun ini adalah peradilan. Lembaga peradilan sebagai harapanterakhiruntukmemperolehkeadilan inimenjadisorotankarenaputusan-putusan yang dikeluarkan dinilai tidak memihak kepada keadilan. Meskipun keadilan selalu mengandung nilai subjektif, ternyata sebagian besar masyarakat merasakan banyaknya ketidakadilan dari putusan yang dijatuhkanolehlembagaini.Masyarakatmasih menilai banyak putusan yang tidak mencerminkan keadilan dan mencium adanya “faktor lain” sehingga putusannya seperti itu. Namun mereka tidak dapat menemukan “faktor lain” itu. Menyikapihaltersebut,berbagaiupaya perbaikan memang telah dan sedang dilakukan oleh Mahkamah Agung RI, yaitu melaksanakan program Reformasi Birokrasi (RB) sebagai tuntutan diberikannya remunerasi (tunjangan kinerja). Namun agaknya RB yang dilakukan belum terlalu dirasakan oleh masyarakat luas, karena kurangmenyentuhsikapdanperilakuaparatnya. Setidaknya ada lima program RB yang disebut QuickWins yang sedang giatgiatnya dilakukan oleh lingkungan peradilan (MA-RI), yaitu : 1. Publikasi Putusan, 2. PengembanganTI, 3. Pedoman Perilaku Hakim, 4. PNBP,dan 5 Evaluasi Kinerja, dan ditambah lagi pelayanan publik. Dari program unggulan RB MA-RI terlihat setidaknyaadaempathalyangmestidilakukan secara sungguh-sungguh, yaitu transparansi, perbaikan moral aparat peradilan serta peningkatan kinerja dan pelayanan kepada masyarakat. Kerja keras dan sungguh-sungguh dari seluruh unsur di lingkungan peradilan, terutama pimpinan, hakim dan panitera pengganti serta semua yang terlibat dalam program perbaikan birokrasi mutlak diperlukan. Jika kelima program RB tersebut dilaksanakan dan dijalankan dengan baik, makadiharapkankepercayaanmasyarakat terhadap penegakan hukum akan berangsur-angsurpulih.Sebaliknyatanpaadanya kerja kerasa dan kesungguhan, jangan harap lembaga peradilan akan menjadi agungsebagaimanavisiMahkamahAgung

RI,yangingin“mewujudkanlembagaperadilan yang agung.” Hal tersebut juga sejalan dengan tema Rapat Kerja Nasional MARIdiBalikpapantanggal10-14Oktober2010 dengan tema “Dengan semangat perubahan memperkokoh landasan menuju lembaga peradilan yang agung”. Sebuah lembaga publikyangdianggapagung (berwibawa dan disegani), manakala lembaga itu dipercaya oleh masyarakat sehingga masyarakat akan melaksanakan apa pun keputusan yang dijatuhkan. Karena sebagai lembaga yang memutus atas namaTuhan(independen),sudahsemestinya akan memutus suatu kejahatan atau sengketa didasarkan kepada fakta-fakta hukum yang konkrit (bukan dibuat-buat/ rekayasa) dengan dilAndasi kejujuran. Menurutpenulis,setidaknyaadaempat hal konkrit dari hasil sebuah upaya perbaikanlembagaperadilan,yaitu:1)layanan yang cepat, yang berarti administrasi berjalan dengan tertib dan sederhana, 2) tidak ada pungutan uang selain yang ditentukan oleh suatu keputusan resmi yang didasarkan pula kepada peraturan perundangundangan, 3) transparansi informasi mengenai berbagai hal peradilan berdasarkan Keterbukaan Informasi Publik (UU No 14/ 2008) dan UU Pelayanan Publik (UU No. 25/2009)sertaKMA144/2007,dan4)putusan hakim yang baik yang jauh dari pertimbangan non hukum, misalnya karena adanya suap. Akhirnya, kini masyarakat luas sedang menanti tindakan konkrit dari para hamba hukum (penegak hukum). Kepolisian, Kejaksaan, KPK dan Lembaga Peradilan, yang bertanggung jawabuntukmeluruskanberbagai tindakan menyimpang dari oknum yang tidak bertanggung jawab. Kepolisian ditantang untuk melakukan penyelidikan dan penyidikan terhadap suatu tindakan korupsi dan kejahatan lain secara jujur dan profesionalsertajauhdariinterest.Demikian juga Kejaksaan dan KPK agar dapat melaksanakan tugas secara sinergis guna membongkar berbagai kasus korupsi dan kejahatan lain dengan penuh tanggung jawab, tidak saja kepada bangsa dan Negara tetapi juga kepada Tuhan. Lebih-lebih lagi lembaga peradilan, agar benar-benar memberikan putusan secara adil dan sikap jujur atas nama Tuhan Yang Maha Esa. Tanpa adanya sikap tanggung jawab dan kejujuran, jangan harap penegakan hukum di Indonesia akan berjalan dengan baik. Kita berdoa semoga para pemimpin dan penegak hukum diberi kekuatan oleh TuhanYang Maha Esa, agar dapat melihat kebenaran adalah benar dan kebatilan (kesalahan) adalah batil adalah memang salah yang tak perlu mencari cara untuyk membenarkan. Penulis adalah Wakil Ketua PA Kabanjahe

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

Rp. 65.000 Rp. 78.000


Informasi Pembaca

SUZUKI APV Th. 2005. W. Hitam, Tipe L. Hrg. Rp. 93 Jt. Nego. BK Medan. L-300 Pick Up Th. 2007. W. Hitam. BK Panjang. Speksi Hidup. Hub. 061-77756099



5 CM 6 CM

MITSUBISHI Kuda Diamond Diesel Thn. 2003. Merah Maron Met, BK Mutasi Rp. 105Jt. Hub. 77863981

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 3201 Manual Merah met Th. 94, sgt mewah, balik DP 20Jt. Asuransi All Risk 3 thn. Perbulan Rp. 1.565.000 x 33 Hub. 061 6967 9753

CHEVROLET Trooper 4x4 Bensin Thn. 91 Silver metalic. Mobil luar biasa. Hrg. 46Jt. Hub. 0852 5485 9636 DAIHATSU BARU AKHIR TAHUN Xenia......DP 11 Jt-an.......Angs. 3 Jt-an Terios.......DP 15 Jt-an.......Angs. 4 Jt-an Luxio........DP 10Jt-an.......Angs. 4 Jt-an Hub. JOSUA (061) 77004944 / 0812 6311 0820


Gran Max Pick Up DP 8 Jt-an Angs. 2 Jt’an Luxio D M/T DP 11 Jt’an Angs. 4 Jt-an Xenia 1.0 DLX DP 10 Jt’an Angs. 3 Jt-an Terios TS Xtra M/T DP 14 Jt’an Angs. 4 Jt’an

Hub. ERWIN HP. 0812 6315 4132 - 061.7740 2067 DAIHATSU XENIA Thn. 2005 Silver, mulus & Terawat. No. Pol. Pilihan. Jual Cepat. Hub. 0811 614 466 “DAIHATSU READY STOCK UTK NATAL & TAHUN BARU” Xenia DP 10Jt-an Terios DP 13 Jt-an Pick Up, Minibus & Luxio, Proses Cepat Data dijemput. Full Cash Back & Hadiah Hub. TRISNA 0813 6177 3589 / 7794 3677

DAIHATSU Xenia Xi 1.3 VVTi Sporty Thn. 07. Biru muda met, BK Mdn Rp. 115Jt. Hub. 91327433 DAIHATSU Zebra MB 1.3 Thn. ‘91. Masih original. Siap pakai, Harga damai. Hub. 0813 7063 0511

SUZUKI Carry Minibus Extra ‘87/88 akhir, Lampu petak, W. Hitam Metalic, Jok oscar baru thn tinggi, VR, Ban baru, BK baru Hub. Acuan Jl. Kirana 17 bisa T. tamb 7715.9251/ 0811.635.101 mobil sgt mulus & terawat, W. Biru Metalic, Cp/ terlambat, Tinggal pakai saja

SUZUKI Carry Adventura Thn ‘97 Dijual, Warna Hijau Met Hub. 0812.608.6094 NISSAN FRONTIER ‘02, HTM. Double Cabin 4x4, Turbo DSL. Intercooler 3.0 T, Ban 31, VR, Jok Klt, AC, RT, PW, PS, DP25Jt. Angs: 4,48Jt. Hub. 061.76700.976 TOYOTA Kijang Super Commando Short 6 Speed, Th. 97. Hitam met, Asli Mdn, 5 pintu, VR, BR, PS, PW, CL, AC DB, RTP. Hrg.60Jt. Nego. Hub. 061 7640 8508 TOYOTA Kijang Capsul Model LGX New Bensin 1,8 EFI Th. 2003. Hitam Met, Asli Mdn, VR, BR, PS, PW, CL Rmt, E. Miror, AC DB, S. Sistem Pake TV, Hrg 139Jt. Nego. Hub. 0812 4431 7686

TOYOTA Avanza Tipe G Th. 2004. W. Silver. H. Rp. 116Jt. Nego. HP. 0813 6212 2339 TOYOTA Avanza Hitam 2010. BK Medan Asli. Mulus, Hub. 4142161 (061) 0813 7699 6341. Khusus Pemakai.

TOYOTA Kijang Grand Rover Diesel Thn. 98. Biru, BK Mutasi Rp. 75Jt. Hub. 0812 6594 2789 !! TOYOTA BARU !!



TOYOTA Kijang LGX, DSL ‘00. Htm, AC DB, VR, BR, Jok Klt. Rp. 26Jt. Angs: 3,59Jt (langsung BW Plg). Toyota Soluna XLI ‘02, BK Medan asli, silver, AC, RT, VR, BR (baru), DP 16Jt. Angs: 2,23Jt. Hub. 061.76700 976


TOYOTA Kijang Krista Thn. 97, W. Hijau Silver, Pjk baru. Komplit, AC Double, Tape, VR, BR, CL, PS, Mulus, Original. Body kaleng. Dijual Cepat. Hub. HP. 0813 9795 1579 Mdn.

Xenia..................DP 11 Jt-an Pick Up...............DP 9 Jt-an Luxio...................DP 10 Jt-an Hub. DIKA (061) 77443877 - 0852 7074 7744

Xenia Sporty DP 31Jt-an, G.Max 9Jt Terios TS DP 15 Jt-an, Luxio, dll. 10Jt Hub. IQBAL ASTRA 0813 6100 7907 / 66907 084

FORD Everest XLT 4x4 M/T Thn. 05. Biru met, BK Mdn, pajak STNK Baru, Ban Baru Rp. 180Jt. Hub. 91327433 HONDA Odyssey Matic Thn. 97 Hitam, BK Mdn Mutasi a/n. sendiri Rp. 80Jt. Hub. 91144382


Thn ‘93 Warna Hitam, BK Mdn, Harga 60 Jt/nego Hub. 0852.7552.6758 HYUNDAI Thn. 96 Dijual. Warna hitam, Harga 27 Jt. Jual Tanah L.20. P. 144. Sertifikat. P. Biar. K. Namu. Hub. 061.9107 1570 / Tanpa Perantara ISUZU Troper Thn. 88 Diesel Long 5 pintu 4x4. AC, Tape, VR, BR, Jok kulit. P. Steering, Pwr. Window. Hitam. Rp. 40Juta/ Nego. 0812 6578 790 - 777 88 647


Panther High Grade 94, Merah Maron metalik. P. Steering, P. Window, AC DB, Jok baru, BK Baru, Remote, Cantik luar dalam & sehat. H. 60/Nego. Panther LDX 91. Coklat metalik. P. Steering, P. Window, AC, Jok, Remote, sehat. BK Panjang, mulus. H. 45/Nego. Hub. 0812 6568 816 / 77305875

OVER KREDIT Fanther Thn. 1995. Deluxe. Harga 22 Jt. Siap pakai. Hub. 0812 6508 4733 ISUZU HI-SPORTY PANTHER 2.5 Hijau, 97, AC DB, VR, BR, PW, CL, Jok Klt, DP 20Jt. Angs: 2.055 RB. Hub: 061.76700976/Nego!

Sedan Exclusive - New KIA RIO Pride Cuma Rp. 37Jt, Mobil milik Anda Gratis BB, HP. 0813.7589.6778

TOYOTA Kijang Super Commando Th. 94. W. biru met. Body kaleng. Mesin bagus, AC Dingin, Ban Baru, VR, Hrg. 58Jt. Damai. Hub. 0852 7681 4491 - (061) 7649 0789


- Pesan Sekarang juga.... Harga Mengikat !! (Avanza, Innova) HP. 0812 6048 1001

TOYOTA Kijang Kapsul LX Thn. 97, Silver metalic. Hrg. 85Jt. Hub. 0812 6542 4866 TOYOTA Corolla Twincam Thn. 89. Hitam, BK Medan, lengkap. Hub. 0852 7598 4990 BUNGA O % atau


Rp. 91.000 Rp. 104.000




Jaminan BPKB Mobil (1%) Pelunasan BPKB & Over Kredit Bantu Bayar Leasing Macet Kredit Bulanan & Tahunan Rumah, SHM, SK. Camat, Hotel, Mall, SPBU, Villa, Kredit Macet.


081260481918 (Hotline) 087868009928 / 76402010

9 CM Rp. 126.000 10 CM Rp. 140.000



- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954



DANA EXPRESS SHM, SK Camat 1 Hari Clear 0813 6229 0001 0812 6095 5531 (Henrik) BUTUH DANA CEPAT

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633


Jaminan Apa Saja, Sertifikat Tanah. Spd. Motor, Take Over Mobil. Hub. 061-8222774, HP. 0816 314 1807


SEPEDA MOTOR YAMAHA Mio CW (Putih) Dijual. Th. 2008 + Acesoris, jarang pakai, a/n & pemakai wanita / TP. Nego. Hub. 0812 6568 274 / 0812 6596 019 YAMAHA Mio Sporty CW 2007/08. Merah asli BK Medan, 1 nama, Pakai dari baru. Jual Rp. 7,3Jt. Nego. Mau pindah luar daerah. Hub. 0852 7712 3673


IKLAN KHUSUS 6x1,5 kolom Rp. 120.000




Jl. Dazam Raya No. 1 (Petisah)

BUTUH DANA CEPAT Jaminan BPKB Mobil Sp. Motor Betor, dll. Semua tahun. Bunga Ringan. Hub. ADI JAYA FINANCE Jl. Bakti No. 100 Simp. Jln. Bromo Telp. (061) 76336525 - 0812 6081 3010

11 CM Rp. 165.000 12 CM Rp. 180.000


Ciri2 Ambeyen: Disekeliling Dubur Ada Benjolan Seperti Daging Tumbuh/Jerawat, Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur Seperti Luka, Solusinya Datang dan Berobatlah ke


Jl. Prof. H.M. Yamin S.H No. 251 A Simpang Pahlawan Tel.(061) 4563067 Cabang I

Jl. Bunga Harum (Benteng) No. 26 Suka Jadi Telp. 0761-45368 -HP. 0812 6568 700 Pekan Baru Telp. (0761) 45368 HP. 0812.656.8700 Cabang II: Komp. Perhub. Laut Jl. Baruna II/II Telp. 0765 36906 HP. 0852 6201 0594, 0812 60311 695 Dumai



Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106

Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan sampai tuntas, Insya Allah

Free WiFi

My Residence in Medan




JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN

FAX.4561347 Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput




Izin Usaha : 503/1099.SK.HO/SL/NT/08 JADWAL HARGA UMROH TAHUN 2011 / 1432 H

Berpengalaman - Profesional



Segera daftar ke Multazam JL. TITIPAPAN / PERTAHANAN NO. 10 SEI SIKAMBING MEDAN TELP. 061-457.6116 - 0813.6137.2321 - 77313385





Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan







REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Yang sudah dipercaya dan Bisa bukti di tempat !! Ditangani oleh: A. SAEPUDIN DARI PELABUHAN RATU


Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757- 0812 1671 84742 Siap Ketempat



KULKAS, DISPENSER, M. CUCI HUB. MAJU TEKNIK Tel. 7030118, Flexi 76750084


Service: AC, KULKAS, M. CUCI, TV, CCTV, PABX, B. PASANG, CUCI, BERGARANSI HUB. 061-77913537, 0813 75533375

Pelanggan Yang Terhormat HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI apabila anda ingin TI-HA HATI-HA TI-HATI dan HA melakukan transaksi jual beli melalui transfer.

silahkan hubungi kami di

061-4576602. Terimakasih

Kami memberi bukti bukan janji, alat vital besar dan panjangditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama. Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin menceng-kram, wangi. Buktikan disini (Bergaransi) HP. 0812.8481.8889 Alamat praktek: Jl. SM. RAJA SAMPING UISU MASUK JL. SEMPURNA 300M NO. 49 MEDAN

Jika anda cari pengobatan harus teliti dulu sebelum berobat, mana yang ahli dan mana yang asli. Sebenarnya banyak pengobatan lain juga yang memberikan bukti, tapi kenyataannya tidak ada perubahan sama sekali. Makanya kalau berobat harus serahkan kepada ahlinya. Cuma disini satusatunya pengobatan asli dan benar-benar bukti langsung kelihatan perubahannya ditempat. Jika ada keinginan datang dan buktikan di tempat kami. Dijamin anda tidak akan kecewa, pasti berhasil. Bahkan banyak pasien dari tempat lain juga yang datang berobat kesini semua berhasil.

Khusus Wanita ! Khusus Pria ! * Lemah syahwat, Kuat, Keras, Tahan Lama * Susuk Banyu Sapu Jagad * Susuk Banyu Bulan Tgl 14 DIJAMIN * Memperbesar, Panjang, Impotensi * Mani Encer, Ejakulasi Dini, Hernia * Susuk Bintang berkelip-kelip * Susuk Keruncang * Mati Rasa/Total, Kencing Manis. * Susuk Siraja Asem * Diabetes, Mandul * Ingin kembali perawan, buka aura Alamat: * Memperbesar/ Kencang payudara, Pelet Jln. Amaliun Simpang Laksana * Ingin punya keturunan, Pengasihan No. P.33, 100 M dari Yuki * Penglarisan Usaha, Problem Rmh Tangga Simpang Raya * Ingin cepat dapat jodoh, Ditinggal pacar HP: 0813 6203 0992 Izin Kejari DSP 22/-0-101-/2009



(Untuk Ambeien)

(izin Kejaksaan No. B.170/DSP5/12/2009) Cara terapi pengobatan di totok dibagian syarafsyarafnya dan diberikan ramuan/ jamu, mengobati segala keluhan pria/ wanita MENGOBATI PRIA Tambah besar: 4, 5, 5.5, 6 Tambah panjang: 14, 15, 16, 17, 18, 19, 20 Impotensi Ejakulasi dini, Kurang ereksi Tahan lama/ Tidak punya keturunan Hernia, Penyakit Gula Pengobatan ini Alami 100% tanpa efek samping, bebas untuk semua Agama, Tanpa pantangan (reaksi ditempat)

Wasiri berani menjamin kesembuhan tuntas ambeien/wasir anda. Sangat berkhasiat dan cepat menghilangkan ambeien. Wasir yang menonjol maupun yang tumbuh di dalam. Redakan rasa sakit, perih dan menghentikan pendarahan waktu buang air besar, mencegah infeksi dan panas dalam serta melancarkan buang air besar.

Praktek menetap: Jl. Pelangi (± 100 meter dari Simpang UISU SM. Raja) No. 42 Medan HP. 0812.6350.4441 - 0821.6504.0904




Mengatasi keluhan serta solusi penyembuhan yang paling tepat, asli alami, paten, permanen tanpa efek samping, bebas usia dan agama cukup satu kali berobat



Besar Impotensi Total Kuat tahan lama Ejakulasi dini Lemah syahwat Kencing manis/ diabetes


Penghasihan dan kecantikan Memperbesar payudara Mengembalikan keperawanan Kharisma/ Aura Pemikat lawan jenis/ pelet Buang sial

Bentuk ukuran yang dapat dipilih: Panjang: 13cm, 14cm, 15cm, 16cm, 17cm, 18cm, 19cm.

Anda yakin dan berminat silahkan datang langsung ketempat kami. Kami siap mengatasi keluhan anda Anda jangan ragu kami ahlinya, ilmu pewaris leluhur kami


USD 1.575

Khusus bagi jema’ah dari luar kota nginap di Hotel Madani Gratis OFFICE: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4 / 18 Medan Telp. 061- 7326981, 0811647795 Fax. 061-7326981




USD 1.750

Harga Ekonomis Fasilitas Paket Bisnis


Cuci AC, Isi Freon Bongkar - Pasang Reparasi: 061 763 99964 0812 60 899964

TANGGAL 1, 4, 14, 25 MARET 1, 11, 22 APRIL 9 , 23 MARET 8, 22 APRIL 16 MARET, 21 APRIL

UMROH + CAIRO 12 HARI USD 2.300 UMROH + TURKEY 12 HARI 22 MARET, 19 APRIL USD 2.600 UMROH + AQSHO 11 HARI 25 MARET, 26 APRIL USD 2.800 NB: untuk perubahan type kamar menjadi : Triple menambah USD 50 Double menambah USD 100 AKOMODASI HOTEL BERBINTANG HOTEL MADINAH: DALLAH TAIBA, Setaraf ***** HOTEL MAKKAH : AL BUSTAN, AN NADWAH, Setaraf **** HOTEL JEDDAH : AL AZHAR *****

Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar web: ffaridar aridar aridara




Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll

Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, KREDIT VIA:

Hubungi Dealer

7 CM 8 CM

TOYOTA Kijang Thn. 90 Biru Metalik, VR, Ban Baru, Jok Kulit. Tape, An. Sendiri. BK Medan Asli, Harga Nego. Hub. 0852 6268 2022, 0831 9915 8389

Senin, 20 Desember 2010

Alamat tetap Jl. SM. Raja masuk Jl. Amaliun Gg. Paduan Tenaga Gg. Genteng No. Rumah 17B, Izin Depkes : HP. 0821 6080 1977

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda



WASIR/ AMBEIEN Garansi 10 Hari Sembuh Tanpa Operasi Hubungi Spesialist Wasir


Jl. Brigjend. Katamso No. 683C Medan ( ± 50m dari Simpang Pelangi) HP. 0852.9751.4253 - 0812.6050.0881


Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481

Pengobatan Alat Vital H. Suhendar

Pengobatan Alat Vital H. Suhendar

Besar dan panjang di tempat Tidak ada hasil, Mahar kembali Ditangani secara profesional Alami bukan suntik, menggunakan metode terapi dan ramuan tradisional, Paling aman tidak ada efek samping

Untuk keluhan dan pengaduan silahkan hubungi langsung:

H. Suhendar sudah di kenal sebagai pakar kejantanan yang sudah berpengalaman, sanggup mengatasi keluhan alat vital khusus pria, memperbesar, memperpanjang (garansi), meningkatkan kekerasan, tambah kuat dan tahan lama dalam berhubungan

Mahar Rp. 500 ribu

Klinik H. Suhendar di bawah kontrol dan pengawasan langsung H. SUHENDAR Diberitahukan kepada masyarakat untuk berhatihati terhadap pengobatan sejenis yang mengakungaku kerabat atau saudara, soal cara boleh sama tapi keahlian yang membedakan

H. SUHENDAR HP. 0812.131.6364 Jl. Tempuling No. 43 B - Serdang (masuk Gg. Sado) Medan Telp. (061) 663.4220 �������� !!! Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu Malam Minggu Pukul 20.00 WIB

Ekonomi & Bisnis

WASPADA Senin 20 Desember 2010


NPWP Tak Hambat Penyerapan Rumah Bersubsidi JAKARTA (Waspada): Nomor Pokok Wajib Pajak (NPWP) bukan hambatan untuk penyerapan rumah bersubsidi yang didukung program Fasilitas Likuiditas Pembiayaan Perumahan (FLPP). Ketimpangan yang terjadi saat ini justru pada persoalan suplai dan demand. “NPWP bukan hambatan penyerapan rumah bersubsidi, itu hanya sedikit hambatan di administrasi. Hanya saja sekarang ketimpangan terjadi di suplai dan demand,” kata Direktur Treasury Bank Tabungan Negara (BTN) Tbk, Saut Perdede

usai peluncuran BTN Junior, BTN Juara, dan Tabungan Haji BTN di Jakarta, akhir pekan lalu. Persoalannya, lanjut Saut, d i k a re n a k a n F L P P b a r u diterbitkan pada bulan Oktober ini sehingga pihak pengembang belum siap untuk penyediaan perumahan bersubsidi. “Memang untuk penyediaan rumah kita selalu kekurangan. Per tahun yang tersedia hanya 300-400 ribu unit, tapi peminatnya jutaan,” ujarnya. Untuk itu pihak BTN tahun 2011 mentargetkan pertumbuhan kredit sebesar 25-30 persen pada 2011. BTN akan menfokuskan diri di kredit subsidi melalui dukungan FLPP dari Pemerintah dan kredit komersial. Dia mengakui ada slowdown untuk penyerapan kredit perumahan bersubsidi di 2010 dibanding 2009. Dimana kredit komersial masih lebih tinggi

dibanding kredit bersubsidi, dengan kredit komersial di atas 30 persen dan kredit subsidi yang di bawah 30 persen. Tapi, lanjutnya, di 2011 dengan developer yang sudah lebih familiar dan anggaran pemerintah yang lebih besar serta permintaan yang terus meningkat, kredit bersubsidi ini akan bisa ditingkatkan menjadi 100 ribu unit. Sementara untuk Dana Pihak Ketiga (DPK), BTN menargetkan pertumbuhan di atas 30 persen. “Ini karena kita ingin mengcapture opportunity di kredit perumahan,” ujar Saut. Guna meningkatkan kinerja di bidang pendanaan, BTN akan meluncurkan beberapa produk baru tabungan. “Sekarang ini baru tiga yakni BTN Junior, BTN Juara, dan Tabungan Haji. Tahun 2011 akan ada lagi produk baru yang akan kita luncurkan,”

kata Direktur Konsumer BTN, Irman A Zahiruddin. Khusus Tabungan Junior, menurut Irman, produk ini sebetulnya merupakan relaunching dari produk BTN Batara Junior. Ditujukan anakanak agar gemar menabung dengan usia 12 tahun (Junior) dan di atas 12 tahun (Juara). Dengan jumlah nasabah BTN yang saat ini sebanyak 6 juta orang, menurut Irman, kalau ada tambahan 10 persen saja tambahan dari produk baru ini, itu berarti ada tambahan nasabah sebanyak 600 ribu orang. Irman mengakui peluncuran produk baru ini juga masih akan dilanjutkan di 2011. “Banyak produk yang akan kita keluarkan di 2011, karena secara teknologi sudah mendukung untuk itu. Namanya produk apa, nanti tunggu peluncurannya,” ujarnya. (j03)

Asing Kuasai 50 Persen Lahan Sawit Lokal JAKARTA (Waspada): Penguasaan asing terhadap lahan perkebunan sawit nasional hingga tahun ini tercatat mencapai 50 persen lahan yang tersedia atau sekitar 9,2 juta hektar (ha). Menurut data yang dilansir Sawit Watch, perusahaan asing itu berasal dari Malaysia, Singapura, Amerika Serikat, Belgia, dan Inggris. “Hanya 3,6 juta ha lahan yang tersisa dan dikelola 2,5 juta petani sawit di dalam negeri,” kata Koordinator Serikat Petani Kelapa Sawit (SPKS) Mansuetus Darto di Padang, akhir pekan lalu. Persoalan kapitalisme di


PENDIDIKAN INGIN LULUS PTN ? Di UMB-PTN/ SNMPTN 2011 IKUTI SEGERA...!!! PROGRAM INTENSIVE 2011 Untuk alumni SMA/ SMK agar lulus testing ke PTN melalui USM ITB, SIMAK, UI, UM UGM, UMB PTN, SNMPTN, USM UNDIP, STAN, STT TELKOM, dll Tahun 2011 Mulai belajar: Senin, 17 Januari 2011 Daftarkan sekarang juga Di BT/ BS MEDICA Jl. Bantam No. 12 Medan Telp. (061) 457.8058 Jl. Iskandar Muda No. 19B Medan Telp. (061) 415.9280 Belajar pagi hari: Jl. Bantam No. 12 Medan Belajar pagi atau sore hari: Jl. Iskandar Muda No. 19B Medan




2 Org Teknisi AC Split & Central Hub. JMS 0813.7575.1960


Stylish Salon yang berpengalaman dibidangnya, menguasai guntingan, blow, variasi, dll Hub. Kie-kie Salon Jl. Darusalam No. 45B Medan (HP. 0821.6746.6779


Menerima Karyawati Muslim - Rental Computer/ Fotocopy - Tenaga Foto copy Diutamakan yg sudah berpengalaman Lamaran diantar langsung kepada: FOTO COPY SEPAKAT Jl. SM. Raja 338H/ Gg. Sepakat - Medan (disamping Hotel Grand Antares)


Perusahaan kontraktor BUMN mencari seorang dragmen yang menguasai Autocat diutamakan STM Bangunan/ Politeknik/ D3 di tempatkan di Tapsel kirim lamaran photoshop, CV ke email: cool. HP. 0821.7325.8210


Dalam rangka rekrutmen karyawan PT. Bank Muamalat Indonesia (PT. BMI), MES Institute bekerjasama dengan PT. BMI Cab. Medan, menyelenggarakan Training “Dasar-dasar Perbankan Syariah” Output training: 20% peserta terbaik hasil evaluasi direkomendasikan sebagai karyawan PT. BMI Cab. Medan untuk posisi: 1. Costumer Service (CS) 2. Teller 3. Marketing Persyaratan: 1. Pendidikan S1 semua disiplin ilmu 2. Usia maksimal: CS dan Teller 25 tahun dan Marketing 27 tahun 3. Biaya pendaftaran training: Rp. 300.000 Pendaftaran ditutup tanggal 23 Desember 2010 Pukul : 8.30 s/d 17.00 WIB Training: 24 s/d 25 Desember 2010 Informasi dan Pendaftaran:

MES Institute

Gedung Graha MES Sumut Jl. Gagak Hitam No. 32-33 Ringroad Medan Telp. (061) 844.8274 HP. 0815.315.6285

sektor perkebunan sawit ini dinilai Darto merugikan masyarakat petani sawit di dalam negeri. Dengan luas lahan sawit yang hanya mencapai rata-rata 2 ha lahan per orang, hal itu menurutnya memperburuk kesejahteraan petani kelapa sawit. Data Sawit Watch menunjukkan, perusahaan asing yang menguasai lahan sawit terbesar di dalam negeri yakni Wilmar Group, Cargill, dan Sime Derby dari Malaysia. Sedangkan perusahaan nasional hanya menguasai sekitar 3,5 juta ha lahan perkebunan sawit nasional yang diisi empat grup perusahaan. Tingginya penguasaan asing atas lahan sawit di dalam

negeri membuat SPKS dan Sawit Watch mendesak pemerintah membuka lahan sawit baru dalam skala besar. “Hal itu hanya akan memperburuk kondisi petani sawit nasional,” tutur Y Hardiana dari Sawit Watch. Menurut Hardiana, pembukaan lahan secara besar berdampak buruk bagi posisi tawar masyarakat pemilik tanah terhadap investor. Kondisi terburuk yang berkembang sepanjang 2010, yakni tingginya kriminalisasi terhadap petani sawit hingga tahun ini. Sejak 2002, tercatat sebanyak 129 petani sawit dipolisikan dengan tuduhan penyerobotan lahan. Kasus terbesar ter-



Dibutuhkan segera P/W min SLTA untuk kerja “dikantor” PT. UNITY yg buka cabang baru di Medan, bergerak dibidang distributor pengolahan Susu (100% bukan sales, terbuka bagi mahasiswa/ i) penghasilan memuaskan + ada harian, alamat: Jl. Gatot Subroto Komp. Merbau Mas No. 12A (belakang Pintu keluar Carrefour), Jam 10.00-16.00 Wib, bawa guntingan iklan ini. Hub. IBU MEILANI HP. 0812.6343.1122 - Bp. M. Bakti HP. 0821.6521.7941


Wa n i t a G a d i s / J a n d a , M u s l i m d i pekerjakan: Prwt anak, Prwt orang sakit, Jaga TK, Gaji Rp. 700 Rb - 1,2 Jt/ bln (Bersih) + Bonus Hub. Ibu Yaca Jl. G. Subroto/ Jl. Abdul Hamid No. 4E HP. 0812.6514.3676 - 0852.6207.9555 Mdn


LPG TK/ PAUD Favorit bth cpt SMU/ D3 sbg guru syrt kreatif, dtg lgs isi frmlr & psikotes hub: Jl. KH. Wahid Hasyim 92 Medan Tp. 7623.5314/ 9158.3487 / 453.3875 / 456.9269/ 882.5895


(Status: Dalam Proses Menjadi R. Sakit) Menerima Pegawai Bidan/ Perawat Lamaran diantar langsung atau Hub. 0812.6418.7838

SIMB Bisa 4 Tingkat Jl. Besar Pekan Tembung No. 19B Hub Telp. 453.7861, TP


Jl. Gatot Subroto, Kel. Bandar Sinembah, Kec. Binjai Barat, Binjai, Ukuran: Luas Bangunan 4m, Panjang bangunan 21½m, Panjang Tanah Bangunan 26½m Hub HP. 0815.3469.9088


5x16m, 1½ Tingkat beserta perabot Harga Rp. 185 Jt Jl. Seroja Gg. Pribadi No. 15A Hubungi HP: 0813.9737.984 Flexy (061) 7703.6487


Minimalis TIpe 55, Tanah112m² Perumahan Taman Pesona Johor Blok B12 (Bersertifikat) Jl. Eka Surya - Jl. Sidodadi - Medan Johor Hub. 0813.6001.6695 (no SMS)


Butuh tenaga kerja P/W (17 - 35 thn) untuk posisi dlm kantor, syarat: - Pendidikan min. SMU/ sederajat - Bawa berkas surat lamaran lengkap + Guntingan iklan ini untuk proses interview Penghasilan: Rp. 1800.000/ bln HUB. IBU NURHALIMAH HP. 0812.6388.5458 Alamat kantor: Jl. Brigjen. Zein Hamid No. 8B (±5m dari jembatan kanal) arah Delitua Medan


PELUNCURAN BTN JUNIOR: Direktur Bank BTN Saut Pardede (kanan), disaksikan Direktur lainnya Alvian Zahirrudin (kiri belakang) dan Purwadi (kanan belakang), secara simbolis menyerahkan buku tabungan kepada tiga orang anak saat peluncuran tabungan BTN Junior, di Jakarta, Sabtu (18/12). Selain tabungan BTN Junior yang mengajak anak-anak agar gemar menabung, BTN juga meluncurkan tabungan BTN Juara dan BTN Haji. jadi di Kabupaten Sarolangun, Jambi. Sebanyak 35 petani dilaporkan ke polisi dengan alasan yang sama. Di Sumbar, tercatat sebanyak 28 kasus menimpa petani sawit. “Tiga orang petani saat ini menjalani tuntutan pihak perusahaan di Nagari Lingkuang Aur, Pasaman Barat, Sumbar, dengan tuduhan penyerobotan lahan,” ujar Hardiana. Kasus-kasus tersebut karena lemahnya komitmen perusahaan sawit menggarap lahan yang telah dikuasainya. SPKS dan SawitWatch meminta pemerintah bersikap tegas pada perusahaan sawit yang menelantarkan lahan. (vvn)



HILANG Asli Sertifikat Hak Milik Nomor 251/ Kel. Tanjung Sari. Terletak Jl. Melati II No. 22. Tanjung Sari A/n. Ny. Erna Anita, Amir Siregar. Dkk. Hilang disekitar Jalan Setiabudi - Tanjung Sari Hub. 061-77227355 TELAH TERCECER



SEWA FLOOR STANDING HUB: 3 Pk Jln. Sutomo No. 139 C. & 5 Pk


TEL. 061-7347810 - 7360741 TEL. 77982281 medan INSTALASI & PEMASANGAN SERVICE, REPARASI AC - KULKAS

SERVICE COMPUTER/LAPTOP/WARNET Hang, Padam, Kena Virus, Upgrade Software/Hardware, Merakit PC, dll. Hub. FAUZAN (0857 6320 0002)


- 9 unit Laptop, Toshiba, IBM, NEC, Lengkap cas, Ada yang hidup & mati (Centrino/ P-IV) Rp. 6,5 Jt - 1 unit Sp. Motor merek TVS-Neo Thn 2010 (99%) Rp. 6,5 Jt Hub. 0813.7536.3710 - 0852.6230.3667




Dijual tanah ± 200 H di Subusalam, Cocok utk kebun sawit Hub. 0852.6192.1442

RUMAH Dikontrakkan Komp. Johor Indah Permai “R4”, 3 Kamar Tidur, 2 Kmr mandi, Telp, PAM Hub HP. 0813.6002.1949, TP

Uk. 9x22m, Sertifikat Hak Milik Jl. Bajak II-H Marendal Mdn depan Villa Mutiara, Lokasi tinggi Hub. 0813.9673.6996 - 0815.3108.739

RUMAH 2 Tkt Dijual Uk. 9,5x19m, Full keramik, 3 Km, 3 KT, SHM, Jl. Jermal III No. 19A Denai Hub. 0811.6021.321


Jl. Teratai Binjai, H. 750 Jt, SHM 1. Bisa diangsur 1 thn (Tanpa bunga) 2. Bisa diangsur lama: 5 thn, 10 thn (bunga) Bunga KPR Bank) 3. Diberi $150/ bln selama 5 thn 4. Jaminan dibeli kembali dgn harga 30% diatas harga skrg 5 thn kmdn Hub. 0813.9244.1008

Mr Mr.. Sulthan Salim. Phone Phone.. 0812 6960 8070





: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu



Seluas ± 3,2 Rante (Uk. 20x70m) di Tepi Jalan Lintas Sumatra/ Labuhan Batu Utara (Labura), Cocok untuk: Bengkel/ Ruko/ Rumah makan, Letak ±500mtr dari Galon/ SPBU Mangga², Kongsi Anam - Pamingkei Harga Rp. 100 Jt/nego Serius hub langsung HP. 0813.7506.3188




Melayani segala acara Hub. 77875018 - 0812 6074 185








Melayani Jasa Pengiriman Barang Tujuan Kota² di Pulau Sumatera & Pulau Jawa, Baik Barang Eceran, Pindahan, dll Alamat: Kantor Pusat: Jl. Administrasi Negara I No. 24 Penjernihan/ Pejompangan, Jakarta Pusat Telp (021) 570.8414 / 5733.275 Fax (021) 573.3275 Kantor Cabang: Jl. Letda Sujono No. 133 Medan Telp (061) 7388.222 - 7388.333 Fax (061) 7388.333



Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410

TANAH DIJUAL Uk. 14,5x49,90, SHM Rp. 450 Jt/nego Jl. Beringin No. 145 Tembung HP. 0812.6039.079 - 0813.7095.6597



PELUANG BISNIS 1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & R O Rp. 14 Jt s/d 38 Jt 2. Air Pegunungan 6700 s/d 7000 Liter Rp. 230.000 / Tangki 3. Menyediakan Spart Part & Perlengkapan Depot Air Minum


Fax. 4151359


PELUANG BISNIS ANDA akan dibimbing menghasilkan jutaan rupiah perbulan. Strategi mudah telah teruji kesuksesannya. Hub.






Cocok untuk segala tanaman pertanian dan perternakan Sudah dipakai dan diakui 40 negara Hub. 0812.600.7000 - 0821.6600.7000





ADHIKA COMP COMP.. M. Idris 23. 4150371-77426432 10 SET INTEL PIV DUO CORE 1,8GHZ Hanya 28.000.000 10 SET AMD ATLON X2 Hanya 28.500.000

rena belum tentu jadi,” kata dia. Sementra itu, selama sembilan bulan pertama 2010, Telkom mencatat penurunan laba bersih sebesar 3,9 persen menjadi Rp8,9 triliun dari sebelumnya Rp9,3 triliun. Penurunan laba selisih kurs sebesar Rp644 miliar dibanding periode sama tahun sebelumnya, mengakibatkan adanya peningkatan biaya lain-lain bersih sebesar Rp545 miliar. (vvn)




ASEAN menjadi pilihan? Rinaldi hanya tersenyum. Telkom juga diketahui tengah mengincar perusahaan telekomunikasi di Kamboja. Perusahaan pelat merah ini membidik kepemilikan saham mayoritas. Penawaran saat ini dilakukan melalui mekanisme lelang terbuka. Meski begitu, Rinaldi enggan menjelaskan lebih lanjut. “Bukan Kambojanya, tapi saya belum bisa bicara banyak ka-

1 Bh BPKB BK 6558 UU a/n. RUSMANI NURLIA SIANIPAR. Tercecer sekitar Jl. Bilal Ujung dan Jl. Sampali. Bagi siapa yang menemukan Hrp. Menghubungi Pantun Situmorang No.HP. 0813 760 45557. Tidak akan dituntut dan akan diberikan hadiah sepantasnya.


TV, LCD, PS, AMPLI, SPK, AC, KULKAS, M.CUCI. Laptop. Projector, Handicam, Camera, Keyboard dll. Hub. UD. SENANG HATI: 4517509 - 69677449 Jl. Sekip 67 A


Informasi Pembaca Bursa Property



Jl. Sisingamangaraja no. 8 Medan 20213 (paling lambat 22 Desember 2010)

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

bukan pertama kalinya bagi Telkom. “Kita pernah coba di Iran tapi tak berhasil, kita coba lagi,” kata dia. Dua tahun lalu (2008,) Telkom berencana mengakuisisi perusahaan telekomunikasi milik pemerintah Iran. Penghentian itu, karena pertimbangan politis, meski secara potensi bisnis, perusahaan telekomunikasi Iran itu dinilai cukup menjanjikan. Ketika ditanya apakah pasar




J A K A RTA ( Wa s p a d a ) : Industri telekomunikasi Indonesia disinyalir sudah jenuh. Hal itu rupanya membuat PT Telekomunikasi Indonesia Tbk terus berekspansi mencari pasar baru. “Kita sudah kuat di Indonesia, makanya kita terus mencari pasar baru,” kata Direktur Utama perseroan Rinaldi Firmansyah di Jakarta, akhir pekan lalu. Rinaldi mengakui, sebenarnya ekspansi ke luar negeri


Ram 1 gb, Casing USB, Hd 160gb, Key, Mou, Headset, LCD 15,6” ACER BONUS: Instalasi Jaringan, Games Online - Offline, Billing, Switch

Asisten Apoteker dengan syarat² sbb: 1. Pria/ wanita, tamatan SMF/ SAA 2. Usia max. 25 thn & Tdk sedang kuliah 3. Bersedia bekerja shift Lamaran langsung antar ke alamat:

Telekomunikasi Indonesia Sudah Jenuh


PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Anda Butuh Perabot Jepara Asli?


Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

Ingin Trading Futures : Forex, Index, Commoditi, Metals, Cfd Stock US, Cfd Indices, Cfd Financial Gold, Silver. Spread Mulai dari 2 Point Bebas Biaya (Swap Dan Cash Komisi) Kami memiliki Solusi Trading yang Nyaman dan menghasilkan minimal 100 pips/ hari. Metode CHAOS TRADING Biaya Training Rp 15.500.000,MasterForex Sumatera Training Center Mandiri Building Lt.6, Jl. Imam Bonjol No. 16 D Medan 20112 Sumatera Utara – Indonesia Tel. +62-61-3000 33 00 Fax. +62-61-3000 33 84 e-mail :


WC TUMP TUMPAAT, Sal. AIR, K. Mandi Tel. 081361718158, 0813 6230 2458 NARO SERVICE Jl. Sisingamangaraja




Jl. Gatot Subroto Medan Ada Garansi

WC 0812 642 71725





WC 0813 6147 0812 WC 0812 60444275 WC Setia Budi




Hub. 8219951 Jl. Setia Budi No. 2

Ekonomi & Bisnis

B8 Inspirasi Bisnis

WASPADA Senin 20 Desember 2010

Pengamat & Praktisi Manajemen

Cahyo Pramono

Kisah Yang Menjual TAPI, yang benar benar membuat tempat ini istimewa adalah pengalaman ngopi yang diciptakan Ben. Dia tidak sekedar meramu, mengecap rasa, tapi juga merenungkan kopi yang dia buat. Ben menarik arti, membuat analogi, hingga terciptalah satu filosofi untuk semua jenis ramuan kopi. “Itu yang membuat saya mencintai minuman ini. Kopi itu sangat berkarakter,” Kudengar sayup sayup Ben berkata pada salah satu pengunjung perempuan yang duduk di bar. “Seperti pilihan anda ini, cappuccino. Ini untuk orang yang menyukai kelembutan sekaligus keindahan. Ben tersenyum seraya menyorongkan cangkir. ‘Anda tahu, cappuccino ini kopi paling genit?” Perempuan itu tertawa kecil. “Berbeda dengan cafe latte, meski penampilannya cukup mirip. Untuk cappuccino dibutuhkan standar penampilan yang tinggi. Mereka tidak boleh kelihatan sembarangan, kalau bisa terlihat seindah mungkin.” “Oh, ya?” “Seorang penikmat cappuccino sejati, pasti akan memandangi penampilan yang terlihat dicangkirnya sebelum mencicip. Kalau dari pertama sudah kelihatan acak-acakan dan tak terkonsep, bisa bisa mereka nggak mau minum.” Sambil menjelaskan, dengan terampil ben membentuk buih cappuccino yang mengapung di cangkir itu menjadi bentuk hati yang apik. “Bagaimana dengan kopi tubruk,” seseorang bertanya iseng. “Lugu, sederhana, tapi sangat memikat kalau kita mengenalnya lebih dalam,” Ben menjawab cepat. “Kopi tubruk tidak perduli penampilan, kasar, membuatnyapub sangat cepat. Seolah olah tidak membutuhkan skill khusus.” Tapi, tunggu sampai anda mencium aromanya. Bak pemain sirkus Ben menghidangkan secangkir kopi tubruk. “Silakan, komplimen untuk anda.” Dengan wajah terpukau, orang itu menerima cangkir yang disorongkan Ben, siap menyeruput. “Tunggu dulu!” tahan Ben. “Kedahsyatan kopi tubruk terletak pada temperatur, tekanan, dan urutan langkah pembuatan yang tepat. Semua itu akan sia sia kalau Anda kehilangan tujuan sebenarnya: aroma. Coba hirup dulu aromanya. Ini kopi spesial yang ditanam di kaki gunung Kilimanjaro.” Orang itu mengembangkan cuping hidung, menghirup dalam dalam kepulan asap yang membubung dari cangkirnya. Mata itu tampak berbinar puas. ... Berkisah Tulisan di atas adalah kutipan yang sangat menarik dari sebuah buku Filosofi Kopi, Kumpulan Cerita dan Prosa Satu Dekade (1995-2005), Dee. Cuplikan kisah itu mengguit peminum kopi yang selama ini hanya meminumnya dan mengantungkan sensor otaknya ke cafein yang ada di dalamnya. Lalu bagi mereka yang bukan peminum kopi, setidaknya kisah tadi menjadi semacam referensi untuk mengenal sisi lain kopi dan peminumnya. Kisah di atas menjadi topik yang menarik untuk diobrolkan, menarik untuk dilihat dan pada akhirnya, produk itu menjadi mudah diingat karena ada kisah menarik dibaliknya. Seperti produk ‘biasa’ yang banyak pesaing sejenisnya, Kopi bagi sebagian orang hanyalah sebuah perasa minuman. Tidak

lebih. Karena Kopi bisa ditemukan di banyak tempat di permukaan planet ini. Bagi kebanyakan orang rasa kopi tetaplah rasa kopi, “biasa saja...!” Tentu harus ada strategi yang cantik untuk menyajikan produk ‘biasa’ itu menjadi “luar biasa”. Benar bahwa perbedaan jenis kopi, lokasi tumbuh, waktu panen, usia panen, tingkat kandungan air, tingkat kekeringan, cara memasak hingga wadah yang digunakan untuk menyajikannya akan menghasilkan rasa yang berbeda. Tetapi sebenarnya pesona rasa itu akan lebih melambung tinggi ketika ada kisah unik yang menyertainya. Bayangan seseorang akan melambung jauh ke dataran Toraja ketika mendengarkan kisah petani kopi yang sudah membudidayakan komoditi ini sejak jaman kolonial Belanda. Konon kopi Toraja juga di sebut sebagai celebes kalossi, nama tua Sulawesi. Konon kopi-kopi itu diolah dengan kesungguhan turun temurun dan kini masih menjadi sebuah kebanggaan untuk bisa mencicipi kopi arabica ini. Pada suatu kesempatan Oprah Winfrey membahas kopi Luwak dalam pertunjukkannya, bagaimana dia merasakan kelezatan kopi ini jelas menjadi bahan pembicaraan yang menarik. Semakin menarik ketika terbuka kisah sejarah bagaimana petani-petani Lampung yang dipaksa menanam kopi oleh penjajah dan semua hasil panennya diambil habis oleh penjajah sehingga mereka terpaksa mengkonsumsi biji kopi yang berjatuhan terserak ditanah termasuk biji-biji kopi yang dikeluarkan dari perut Binatang Luwak. Semua pasti ada ceritanya. Semua ada kisahnya. Gali dan kreasikan untuk dijadikan ‘bumbu’ saat kita menjual produk ‘biasa’ itu. Selalu ada sisi menarik dari semua produk, proses produksinya atau orang-orang yang terhubung dengannya. Saya ingat bagaimana Blackberry mendadak melambung tinggi ketika Barack Obama diketahui sangat menyukai pesawat telepon pintar ini. Saat itu banyak orang yang membeli pesawat telepon itu bukan karena tahu kehebatannya tetapi karena mereka terkena kisah dibaliknya, kisah seorang Barack Obama dan pesawat teleponnya. Kabarkan Pilihlah cerita atau kisah yang menarik dan menguntungkan promosi produk kita. Setelah tercipta kisah itu lalu kabarkanlah. Komunikasikan kepada target kita melalui media-media promosi. Kreatiflah memanfaatkan semua sisi yang mungkin dijadikan media penyampai kisah itu. Semua kehebatan tidaklah akan mempengaruhi perilaku pembeli jika mereka tidak pernah mendengar kisahnya. Biarkan kisah itu mengalir dari mulut yang satu ke mulut yang lain. Setiap kisah yang berpindah dari satu kepala ke kepala yang lain biasanya akan mendapatkan bumbu-bumbu tambahan yang membuat kisahnya semakin lezat dan enak didengar. Kisah-kisah itu lama-kelamaan akan menjadi legenda dan pada urutannya, orang akan membeli legenda itu. Mereka akan melupakan sisi ‘biasa’ dari produk itu, mereka akan menelan legendanya begitu saja. Pada saat itulah kompetisi dengan produk sejenis tidak lagi menjadi masalah. Karena pembeli tidak lagi membutuhkan produk itu semata, tetapi menginginkan legendanya. Bagi mereka yang pernah berkunjung ke kota Pematang Siantar, salah satu spot yang tidak boleh di hindarkan adalah meminum kopi Kok Tong dan membeli Roti Ganda. Padahal puluhan kedai kopi dan toko roti ada di kota kecil itu, tetapi legenda Kok Tong dan Roti Ganda begitu jauh lebih mempesona. Konsultasi & Pelatihan;

Pemerintah Bentuk Pokja Pembatasan BBM JAKARTA (Antara): Pemerintah membentuk sejumlah kelompok kerja untuk melaksanakan pembatasan konsumsi BBM bersubsidi, kata Menteri Energi dan Sumber Daya Mineral Darwin Z Saleh di Jakarta, Jumat malam. “Kita rapat membahas dan memperdalam fungsi kelompok kerja-kelompok kerja itu,” katanya usai rapat koordinasi di Kantor Menko Perekonomian Jakarta tersebut. Dia menyebutkan pemerintah membentuk sejumlah kelompok kerja yang memiliki tugas masing-masing. Kelompok kerja dimaksud

adalah Kelompok Kerja Operasional dengan penanggung jawab PT Pertamina, Kelompok Kerja Pengawasan penanggung jawabnya BP Migas yang di dalamnya terdapat kepolisian. Selain itu juga ada Kelompok Kerja Sosialisasi dengan penanggung jawab Kementerian ESDM dan Bappenas, Kelompok Kerja Regulasi dengan penanggung jawab Kementerian Hukum dan HAM. “Kelompok Kerja Sosialisasi dengan penanggung Bappenas dan ESDM termasuk di dalamnya BPS dan instansi sektoral yang akan merasakan dampak pembatasan konsumsi BBM

bersubsidi,” kata Darwin. Instansi sektoral itu antara lain Kementerian Pertanian, Kementerian Koperasi dan UKMK, Kementerian Perhubungan, Kementerian Kelautan dan Perikanan, dan Kementerian Perindustrian. “Untuk menghindari penyimpangan memang pengawasan harus benar-benar berfungsi, upaya preventif perlu dilakukan, penegakan hukum juga dilakukan,” kata Darwin. Sementara itu Menteri Perencanaan Pembangunan Nasional/Kepala Bappenas, Armida S Alisjahbana mengatakan, pihaknya bertanggung

jawab terkait aspek sosial ekonomi setelah adanya pembatasan konsumsi BBM bersubsidi. “Tugas kita terkait aspek sosial ekonomi. Ini baru akan kita siapkan pekan depan dengan instansi terkait lainnya,” katanya. Dia menyebutkan yang mungkin akan terpengaruh dengan pembatasan BBM bersubsidi antara lain adalah nelayan, angkutan umum, industri kecil. “Kita akan membahas dengan instansi terkait, karena mereka adalah kelompok yang memang berhak mendapatkan BBM bersubsidi,” demikian Armida.

DPR Desak Aturan Bahan Bakar Segera Dirampungkan JAKARTA (Antara): Anggota Badan Anggaran DPR RI Bambang Soesatyo meminta pemerintah segera merampungkan mekanisme implementasi pembatasan konsumsi bahan bakar minyak (BBM) bersubsidi guna mencegah gelembung belanja subsidi BBM pada APBN 2011. “Cepat atau lambat, pembatasan konsumsi BBM bersubsidi harus direalisasikan demi penyehatan penggunaan keuangan negara,” kata Bambang Soesatyo dari Fraksi Partai Golkar, di Jakarta, Minggu (19/

12). Bambang menjelaskan, potensi gelembung belanja subsidi BBM pada awal 2011 sangat besar, karena harga minyak dunia pada pekan lalu sudah mendekati level 92 dolar AS per barel. Permintaan minyak bumi yang tinggi sepanjang musin dingin di Eropa, kata dia, bisa terus mendongkrak naik harga minyak dunia. “Dampaknya sangat serius bagi APBN 2011. Pada level harga 80 dolar AS per barel, APBN 2010 harus mengalokasikan belanja subsidi BBM sampai

Rp200 triliun,” kata Wakil Bendahara DPP Partai Golkar ini. Karena itu, menurut Bambang, pembatasan konsumsi BBM bersubsidi menjadi opsi pertama yang harus direalisasikan, karena jika pemerintah tidak melaksanakan program tersebut maka alokasi anggaran belanja pemerintah akan sangat besar untuk program subsidi BBM yang tidak seluruhnya produktif. Apalagi, kata dia, sudah ada perkiraan bahwa lebih dari 50 persen BBM bersubsidi tidak tepat sasaran.

“Fakta ini mendorong pemerintah segera memperbaiki implementasi politik subsidi negara,” katanya. Wakil Ketua Umum Kadin Indonesia ini menambahkan, sejalan dengan tantangan yang dihadapi perekonomian nasional, sudah waktunya subsidi dari negara terhadap BBM dialihkan untuk mendukung kegiatan yang lebih produktif bagi masyarakat, misalnya subsidi suku bunga kredit bagi kegiatan usaha kecil mikro dan menengah (UMKM).

Mendag: Perdagangan Bebas Bukan Tujuan YOGYAKARTA (Antara): Menteri Perdagangan Mari Elka Pangestu mengatakan perdagangan bebas bukan merupakan tujuan utama tetapi upaya pertumbuhan pembangunan perekonomian yang berkualitas berkesinambungan dan menyentuh semua lapisan masyarakat. “Perdagangan bebas sebagai cara untuk mencapai tujuan tersebut. Karenanya jangan melihat perdagangan bebas sebagai tujuan akhir, tetapi upaya negosiasi dengan bentuk yang disepakti dan diyakini merupakan hal yang terpenting untuk mencapai tujuan tersebut,” katanya di Yogyakarta, Sabtu lalu. Dalam seminar nasional ‘Dampak Liberalisasi Perdagangan Bebas’ yang diselenggarakan Magister Manajemen Universitas Gadjah Mada Yogyakarta, ia mengatakan pembangunan ekonomi yang ber-

kesinambungan dan berkelanjutan serta berimbang merupakan hal yang terpenting serta didukung dengan terciptanya perdagangan yang adil serta transparan. “Pertumbuhan ekonomi yang berkesinambungan dapat dilihat dari berbagai lingkungan. Sedangkan pembangunan ekonomi yang berkelanjutan, bukan berarti sumber daya alam yang ada dieksploitasi hingga habis, tetapi bagaimana kita bisa mengolah sumber daya alam tersebut serta tidak merusak lingkungan, juga bagaimana cara kita melihat prdagangan bebas bukan sebagai tujuan” katanya. Menurut dia, hal yang terpenting adalah bagaimana mencapai keuntungan yang maksimal dalam perdagangan serta mengelola risiko dampakdampak yang timbul dalam perdaganan bebas itu sendiri.

Dia juga mengatakan wilayah perdagangan di Indonesia sangat berpotensi. Didukung dengan kondisi geografis Indonesia yang sangat mendukung proses terjadinya perdagangan. “Awal mula perdagangan di Indonesia terjadi sebelum masehi, sejak zaman nenek moyang terlebih dulu,” katanya. Selain itu, dia mengatakan dengan adanya perdagangan mengakibatkan semua masyarakat dapat menikmati sejumlah barang yang tidak diproduksi. Pengaruh teknologi mempunyai pengaruh yang besar dalam perdagangan. “Dengan perkembangan teknologi memudahkan proses perdagangan, misalnya dengan adanya media website, dapat menghemat biaya untuk memasarkan produk,” katanya. Sementara itu, terkait dengan upaya bagaimana mencapai keuntungan yang maksimal,

dia mengatakan, dalam proses perdagangan harus mempunyai daya saing dan keunggulan. “Indonesia mempunyai daya saing dan keunggulan yang cukup tinggi di antaranya kekayaan alam dari sektor migas. Namun kekayanan tersebut jangan dieklpoitasi secara habishabisan serta tetap menjaga dan melestarikan lingkungan dalam proses pengeklpoitasiannya, misalnya dengan tidak membuang limbah sembarangan” katanya. Selain itu, ia mengatakan, daya saing Indonesia dalam perdagangan tidak hanya dari sumber daya alam saja, tetapi juga dari sektor lainnya yakni dari tekstil, makanan olahan serta mebel juga memilki potensi daya saing yang cukup tinggi. “Banyaknya daya saing dan keunggulan dari berbagai sektor, dapat meningkatkan nilai tambah kualitas, “katanya.


BANGUN EKONOMI BANGSA: Menteri Perdagangan Mari Elka Pangestu (tengah), Wakil Menteri Pendidikan Nasional Fasli Jalal (kanan) dan Ketua Umum Ikatan Ilmuwan Indonesia Internasional (I-4) Nasir Tamara menjadi nara sumber dalam sesi diskusi pada acara Gala Dinner Networking Session International Summit di Jakarta, Sabtu (18/12) malam. Mari Elka Pangestu mengatakan, menjalin kerja sama dengan para ilmuwan yang merupakan sumber ide dan kreativitas merupakan langkah yang strategis untuk mendorong lebih maju perkembangan ekonomi kreatif Indonesia sehingga mampu menambah daya saing dalam berkompetisi di dunia internasional.

Diversifikasi, Waspadai Stok BBG JAKARTA (Waspada): Terkait rencana pemerintah untuk mendiversifikasikan dari bahan bakar minyak (BBM) ke bahan bakar gas (BBG). Menteri Perhubungan Freddy Numberi mengimbau agar stok diperhatikan. “Pengalaman kita yang lalu ternyata stok kurang. Jadi banyak bus beralih. Kita minta jangan sampai terulang yang sama lagi,” ungkapnya ketika ditemui di Kementrian Ekonomi akhir pekan kemarin. Namun begitu Freddy mengungkapkan kalau BBG akan terus berjalan. “Tapi BBG ini harus tetap ada, kala kita ada komitmen untuk pengurangan emisi tadi ini akan berjalan,” tambahnya. Sementara untuk mekanisme peralihan beberapa kendaraan dari plat hitam ke kuning dia mengatakan jika ini masih

dalam tahap pembahasan. ”Masih dalam pembahasan, namun ada empat operasional. Pengawasan, sosialisasi, regulasi, dan sosial ekonomi,” tambahnya. Menurutnya saat ini fokus pada pengalihan plat hitam ke kuning harus terlaksana, hingga penyaluran bbm bisa tepat sasaran. Adapun plat hitam yang akan dialihkan nantinya termasuk kendaraan box dalam kota. “Itu (pengalihan) akan dibahas. Ada saran-saran supaya jangan dipungut biaya diubah saja dari hitam ke kuning. Nanti kan otomatis dapat BBM subsidi,” tutupnya. Guna mendiversifikasikan dari bahan bakar minyak (BBM) ke bahan bakar gas (BBG) paling tidak ada empat cara yang harus dilakukan oleh pemerintah. Hal tersebut diungkapkan Menteri Ekonomi Hatta Rajasa terkait dengan subsidi BBG ke transportasi umum. “Pokoknya BBG harus jadi prioritas untuk mendiversifikasikan dari BBM ke BBG. Untuk itu ada setidaknya empat hal yang harus kita lakukan,” paparnya.

Harga Daging Sapi Di Medan Merambat Naik MEDAN (Waspada): Menjelang perayaan Natal 2010 dan Tahun Baru 2011, ternyata sangat mempengaruhi harga sejumlah kebutuhan, terutama bahan makanan. Salah satunya harga daging sapi yang terus merangkak naik di sejumlah pasar di Medan, Sumatera Utara. Berdasarkan pantauan di Pusat Pasar, Medan, Minggu (19/12), harga daging sapi telah capai Rp63.000 per kg. Padahal, sebelumnya harga daging sapi masih sekira Rp55.000 pada akhir November lalu. Berarti, harganya telah naik sebesar Rp8.000 per kg. “Harga daging sapi memang seringkali sensitif dengan perayaan besar. Asal ada perayaan hari besar keagamaan atau nasional pasti terus naik. Penyebabnya, apa lagi kalau bukan karena permintaan yang juga meningkat,” tutur Ginting, salah seorang pedagang daging sapi

di Pusat Pasar, Medan, Minggu (19/12). Meski begitu, para pedagang ini membantah jika dinilai kenaikan harga daging sapi ini hanyalah merupakan akalakalan pedagang yang ingin meraup keuntungan besar dengan memanfaatkan momen hari perayaan keagamaan. Karena, menurut mereka, modal penjualan daging sapi juga ikut naik. “Kalau tidak kita naikkan harga, kita yang rugi. Karena, waktu kita ambil dari agen, harganya juga sudah naik. Jadi, mau bagaimana lagi. Kita harus ikut harga pasar,” jelas Syahril pula. Namun, hingga saat ini penjualan harga daging sapi di Pusat Pasar Medan tetap stabli. Meskipun harganya telah naik, masyarakat tetap saja membeli daging sapi untuk kebutuhan mereka, terutama dalam perayaan Natal 25 Desember nanti.(okz)

Pertama, jangan sampai nantinya ada persaingan di antara BBM dan BBG.”Tidak boleh ada rivalitas harga antara pertamina BBM dan BBG,” ungkapnya. Hal kedua adalah masalah infrastruktur. Menurutnya pengembang Stasiun Pengisian Bahan Bakar Gas (SPBG) juga harus membantu pengembangan infrastruktur. “Kita harus membantu mengajak para pengembang SPBG-SPBG untuk membangun infrastruktur,” ungkapnya. Namun menurut Hatta, hal tersebut harus juga diimbangi dengan margin yang cukup. Yang ketiga dan tidak kalah pentingnya ialah masalah converter dari BBM ke BBG. “Perlunya agar kendaran itu membeli converter unit, sampai saat ini belum kita pikirkan, ini yang harus kita bicarakan,” tambahnya. Dia mengatakan, dengan

harga konverter Rp9 juta per unit BBG masih kurang menarik dikarenakan tidak menguntungkan jika dibandingkan dengan murahnya premium. “Nanti kalau beralih ke pertamax selisih besar, jadi akan menarik,” paparnya. Sedangkan hal terakhir adalah masalah reciving terminal yang cukup.”Jadi secara teknis harus handal jangan sampai presurrenya drop, nanti pengisian BBG-nya perlu waktu lama, terus bikin ngantre jadi lama, kan malah bikin kabur pengembangnya. Jadi pemerintah sangat serius dalam membenahi sektor itu,” paparnya. “Dengan adanya disversifikasi dan konservasi yang beriringan maka masyarakat akan mempunyai pilihan dengan adanya BBG yang lebih murah. Makanya BBG harus j a l a n , t i d a k b i s a t i d a k ,” tutupnya.(okz)

Sido Muncul Tetap Canangkan CSR JAKARTA (Waspada): PT Sido Muncul tetap fokus mencanangkan gerakan corporate social responsibility (CSR) untuk membantu masyarakat di Indonesia, kata direktur utamanya. Terutama pada pelayanan kesehatan yang di Indonesia sampai saat ini masih dianggap terlalu mahal. “Kali ini kita coba masuk ke wilayah CSR yang menggerakkan mengupayakan pengurangan pada penderita katarak. Karena Indonesia merupakan salah satu yang tertinggi di Asia Tenggara. Mahalnya biaya pengobatan untuk katarak menjadikan masyarakat enggan untuk mengobatinya,” kata Irwan Hidayat, direktur utama PT Sido Muncul, akhir pekan lalu. PT Sidomuncul yang dikenal sebagai perusahaan yang bergerak di bidang industri jamu dan farmasi dengan visi berikan manfaat bagi masyarakat dan lingkungan, akhir tahun ini mencanangkan program itu bekerjasama dengan Persatuan Dokter Mata Indonesia (Perdami) dan gerakan mata hati.

Program CSR yang dilakukan Sidomuncul, melalui produk Tolak Angin dan Kuku Bima Energi di mulai dengan memberikan bantuan operasi gratis pada Jumat, (10/12) di RS Panti Wilasa Citarum Semarang. Seperti yang dijelaskan Dirut PT Sido Muncul Irwan Hidayat program tersebut akan dilaksanakan sampai dengan akhir tahun 2011 dengan target minimal 5.000 operasi bagi warga kurang mampu di Indonesia. Acara ini ditandai dengan penyerahan bantuan secara simbolis Dirut PT Sidomuncul kepada Dirut RS Panti Wilasa yang diwakili dr. Susetyo, Sp. A. Sidomuncul dikenal dengan produk-produknya yaitu Tolak Angin, Kuku Bima Energi, Kuku Bima Kopi Ginseng dan Kopi Jahe Sidomuncul, tahun ini banyak mendapatkan penghargaan seperti top brand, Indonesian Best Brand Award (IBBA), Indonesian Customer Satisfaction Award (ICSA), Word of Mouth Marketing (WOMM) Award, Indonesia Original Brands 2010, dll.(rel)

Paklina Dorong Clean Energy Di Indonesia MEDAN (Waspada): Kehadiran Persatuan Kontraktor Listrik Nasional (Paklina) di Sumatera Utara merupakan bentuk komitmen untuk mendorong penggunaan energi yang terbarukan (clean energy) di Indonesia. Hal ini diungkapkan Sekretaris Jenderal DPP Paklina Abdul Kholik dalam keterangan persnya di sela-sela Musyawarah Daerah (Musda) dan Pelantikan DPD Paklina Sumut di Hotel Madani Medan, Sabtu lalu. “Selain mendorong iklim kompetisi yang sehat dalam penyediaan jasa elektrikal mekanikal, kami juga mendorong peningkatan layanan penyediaan energi listrik yang lebih berkualitas, dengan mempromosikan penggunaan sumbersumber energi terbarukan seperti listrik tenaga surya, mikro hydro, tenaga angin, atau geothermal,” ujarnya. Dia menambahkan untuk peningkatan pelayanan penyediaan energi listrik, dalam sepuluh tahun ke depan, kebutuhan akan energi listrik dipastikan meningkat. Untuk itu, Indonesia mesti lebih menggalakan pe-

manfaatan sumber energi terbarukan yang ramah lingkungan untuk memperkuat portofolio energy nasional, khususnya di luar jawa yang tidak banyak memiliki sumber energy hydro (PLTA). “Ini penting untuk menjamin keamanan energi nasional sehingga tidak terlalu tergantung pada satu sumber energi seperti sekarang (fosil fuel, red), dimana jika sumber energi tersebut mengalami kenaikan atau kelangkaan dapat mengakibatkan tidak tercukupinya pasokan listrik sehingga mengganggu kegiatan masyarakat. Dengan begitu, pembangunan di Indonesia akan lebih stabil di berbagai sektor,” tukas Kholik. Sementara Ketua DPD Paklina Sumut yang baru dilantik Abdul Razak Hutasuhut menambahkan sumber energi fosil semakin lama semakin sedikit depositnya dan sangat dipengaruhi oleh fluktuasi harga minyak internasional, sehingga mempengaruhi kontinuitas penyediaan listrik. Belum lagi masih banyaknya masyarakat pedesaan yang masih belum

dapat menikmati layanan listrik. “Itu sebabnya, Paklina juga turut mendorong pemanfaatan sumber energi bersih dan terbarukan ke depannya yang potensinya tersedia di banyak wilayah Sumut,” tukasnya. Memang kata dia, biaya investasi energi terbarukan lebih tinggi dari energi fosil. Tapi bila dikomparasi dengan biaya operasional selama 10 tahun misalnya itu sama saja dengan yang dipakai sekarang. “Yang mesti diingat adalah energi listrik itu merupakan investasi jangka panjang. Makanya kami mendorong pemanfaatan sum-ber energi terbarukan ini lebih dimaksimalkan,” tegas Razak. Sebagai bentuk penggunaan energi terbarukan itu, menurut Sekretaris DPD Paklina Sumut Ronny Hutahean, mereka saat ini sedang mengerjakan pembangunan PLTA di Aek Silam dengan kapasitas 2,5 MW x 2. “Ini merupakan bukti, mikro hydro merupakan potensi sumber energi yang cukup besar bagi Sumut,” pungkasnya. Menurut catatan Perusahaan Listrik Negara (PLN) misal-

nya, konsumsi listrik nasional tahun 1990 hingga 2002 meningkat dengan laju pertumbuhan rata-rata sebesar 10 persen pertahun dari 27,7 TWh (1990) menjadi 87,1 TWh (2002). Jenis bahan bakar yang digunakan oleh pembangkit listrik yang mengalami peningkatan tertinggi selama periode tersebut adalah bahan bakar gas bumi, yaitu sebesar 27,8 persen per tahun. Kemudian diikuti pemakaian panas bumi yang mengalami peningkatan sebesar 15,1 persen, batubara sebesar 10,1 persen, minyak solar sebesar 9,5 persen, dan tenaga air sebesar 2,7 persen. Adapun pemakaian minyak diesel dan minyak bakar untuk pembangkit listrik selama kurun waktu 12 tahun. “Jadi, pemanfaatan energi terbarukan tentu saja tidak sekedar untuk mengimbangi kebutuhan energi yang terus melonjak secara signifikan, tapi juga untuk menjamin keberlangsungan dari ketersediaan sumber energi yang dibutuhkan masyarakat Indonesia itu sendiri,” sambung Kholik.(m06)

Sumatera Utara

WASPADA Senin 20 Desember 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:24 12:37 12:25 12:32 12:31 12:28 12:25 12:20 12:27 12:27

‘Ashar 15:48 16:00 15:48 15:54 15:54 15:53 15:49 15:44 15:51 15:50

Magrib 18:22 18:32 18:23 18:27 18:27 18:30 18:24 18:19 18:25 18:23



Shubuh Syuruq


19:36 19:46 19:37 19:41 19:42 19:44 19:38 19:34 19:39 19:37

04:53 05:10 04:54 05:04 05:03 04:53 04:53 04:49 04:56 04:58

05:03 05:20 05:04 05:04 05:13 05:03 05:03 04:59 05:06 05:08

L.Seumawe 12:30 L. Pakam 12:23 Sei Rampah12:22 Meulaboh 12:34 P.Sidimpuan12:21 P. Siantar 12:22 Balige 12:22 R. Prapat 12:19 Sabang 12:37 Pandan 12:23

06:24 06:41 06:25 06:35 06:34 06:24 06:24 06:20 06:27 06:29

Zhuhur ‘Ashar 15:53 15:47 15:46 15:57 15:46 15:46 15:47 15:44 15:59 15:48





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:25 18:21 18:20 18:31 18:23 18:22 18:23 18:20 18:31 18:25

19:39 19:35 19:34 19:45 19:38 19:36 19:37 19:34 19:45 19:39

05:02 05:53 04:52 05:04 04:47 04:51 04:50 04:46 05:10 04:50

05:12 05:03 05:02 05:14 04:57 05:01 05:00 04:56 05:20 05:00

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:23 12:25 12:35 12:27 12:24 12:31 12:19 12:30 12:23 12:22

18:25 18:24 18:30 18:28 18:22 18:28 18:19 18:28 18:24 18:20

19:39 19:38 19:44 19:42 19:36 19:42 19:33 19:43 19:38 19:35

04:50 04:53 05:07 04:55 04:54 05:02 04:48 04:59 04:49 04:51

05:00 05:03 05:17 05:05 05:04 05:12 04:58 05:09 04:59 05:01

Panyabungan 12:20 Teluk Dalam12:27 Salak 12:25 Limapuluh 12:21 Parapat 12:23 GunungTua 12:20 Sibuhuan 12:20 Lhoksukon 12:29 D.Sanggul 12:23 Kotapinang 12:18 AekKanopan 12:20

06:33 06:23 06:23 06:35 06:18 06:22 06:20 06:17 06:41 06:21

15:48 15:49 15:57 15:52 15:48 15:54 15:44 15:54 15:47 15:46

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:21 06:24 06:38 06:26 06:25 06:33 06:19 06:30 06:20 06:22

Zhuhur ‘Ashar 15:46 15:53 15:50 15:45 15:47 15:45 15:45 15:52 15:48 15:43 15:44




Shubuh Syuruq

18:23 18:31 18:25 18:19 18:22 18:22 18:22 18:25 18:24 18:19 18:20

19:37 19:45 19:39 19:34 19:37 19:36 19:36 19:39 19:38 19:33 19:34

04:45 04:51 04:53 04:50 04:51 04:46 04:45 05:01 04:51 04:45 04:47

04:55 05:01 05:03 05:00 05:01 04:56 04:55 05:11 05:01 04:55 04:57

06:16 06:22 06:24 06:21 06:22 06:17 06:16 06:32 06:22 06:16 06:18

PT Inalum Dan Koppling Latih 16 Sekolah Di Batubara Daur Ulang Sampah

Waspada/Agusdiansyah Hasibuan

MENGARAHKAN SISWA: Pembina Koppling Dewi Budiati TJ Said mengarahkan siswa - siswi yang mengikuti pelatihan daur ulang sampah di Gedung MPH Tanjunggading, Minggu (19/12).

Mitos Bantu Pesantren Al-Ikhlas P.BRANDAN ( Waspada): Putra-putri etnis Tionghoa yang tergabung dalam kelompok sosial kemasyarakatan Mitos-Medan dipimpin Gunawan dan Jiman melaksanakan bakti sosial ke Pesantren Yayasan AlIkhlas pimpinan H. Khailid Batubara, Kel. Bukit Jengkol, Kec.P Susu Langkat baru baru ini. Rudolf Alfonso, putra kelahiran P.Susu selaku kepala rombongan menyatakan dalam kegiatan bakti sosial memberikan 60 paket sembako, roti, pakaian, bekas, alat tulis, barang keperluan seharihari seperti shampoo, odol, sikat gigi, sabun mandi, cream, obat nyamuk, ember,sikat ijuk, sandal jepit serta kain pel. Menurut, Rudolf kegiatan lintas agama ini didukung Vihara Cetyia Sukyamuni P. Susu dan donatur yang peduli sesama umat manusia. Sementara, anak anak bebaur bermain dengan anak pesantren dengan bermain lompat karung, sendok guli, makan krupuk, gantung dan lain lain. Membuat suasana ceria di antara anak anak dan guru pembibing Ketua Yayasan Al Ihklas P.Susu H. Khailid Batubara melalui H. Asraruddin, BA menyampaikan ucapan terima kasih kepada Mitos yang di antara anggotanya warga P.Susu. (c02 )

Pengurus MUI Kota Binjai 2010-2015 Dikukuhkan BINJAI (Waspada): Ketua umum MUI Sumatera Utara Prof. DR H Abdulah Syah, MA, Minggu (19/12) di Pendopo Umar Baki mengukuhkan Pengurus MUI Kota Binjai masa khidmat 20102015 dipimpin Ketua umum DR.HM Jamil,MA Ketua MUI Sumut Abdullahsyah berharap kepengurusan MUI Kota Binjai hasil Musdalub lalu dapat bekerja sesuai AD/ ART guna mengayomi umat. Selanjutnya, Ketua MUI Binjai HM Jamil,MA melantik komisi-komisi MUI Kota Binjai. Wakil Walikota Binjai Timbas Tarigan mengemukakan, MUI sebagai mitra pemerintah hendaknya melaksanakan pembinaan umat agar lebih taqwa. Sedangkan Ketua MUI Binjai yang baru DR.HM Jamil, MA dalam sambutanya menyatakan prihatin terhadap dekadensi moral di Indonesia. Sebab, katanya, hasil surve yang dilansir media baru-baru ini, 50 persen remaja Indonesia sudah melakukan hubungan sex sebelum berumah tangga. Surabaya ranking atas dan Kota Medan rangking dua. ”Saya belum tau, apakah disebutkan Kota Medan itu termasuk pula Kota Binjai,’’ujarnya. Oleh sebab itu di Kota Binjai, pendidikan harus ditingkatkan, terutama pendidikan agama dan etika. Dia juga mengimbau masyarakat jika mahgrib mematikan televis. Kemudian, UstadzYafizYazid dari Kota Medan dalam tabligh akbar menyebutkan, berbagai hal yang kini sangat merusak moral bangsa.BanyakmusibahterjadidiNusantaraakibat tingkahmanusia yang tidak peduli terhadap alam. Musibah yang terjadi, selain karena kerusakan alam, juga akibat banyaknya penjabat yang korupsi. Oleh sebab itu faktor pendidikan, terutama pendidikan agama harus terus dikembangkan dan Binjai harus menjadi kota yang mampu memberikan contoh untuk mengatasi dekadensi moral, terutama kalangan remaja.(a03)

IPQAH Binjai Terbentuk BINJAI (Waspada):Walikota Binjai HM Idaham, SH MSi, Kamis (16/12) di ruang kerjanya menerima Pengurus Daerah Ikatan Persaudaraan Qori Qoriah dan Hafizh Hafizhah (PD IPQOH) Kota Binjai periode 2010-2015 yang dipimpin ketua umumnya HM Yusuf, SH, MHum. Kunjungan itu untuk melaporkan tentang telah terbentuknya PD IPQOH Kota Binjai hasil musyawarah sekaligus melaporkan akan dilaksanakan Muktamar ke-2 IPQOH di Batam. M.Yusuf menyampaikan PD IPQOH sudah memiliki kantor dengan menempati bangunan ruko miliknya secara gratis tanpa perlu membayar sewa. Namun pria yang akrab dipanggil Ucok Aang ini berharap agar pemerintah kota dapat membantu dana untuk pembelian alat tulis kantor ( ATK ). Walikota Binjai mengucapkan selamat atas terbentuknya PD IPQOH sembari berharap IPQOH dapat menumbuhkan kegemaran membaca Al-Quran di kalangan umat Islam khususnya generasi muda. Untuk itu, Idaham mengusulkan agar diadakan kegiatan membaca Al Quran di setiap masjid dan langgar usai sholat maghrib hingga menjelang isya. Kegiatan ini bisa dimulai di Masjid Agung Binjai, lalu secara perlahan ke masjid dan langgar lainnya, kata Idaham. Walikota menilai kegiatan ini bermanfaat jauh ke depan daripada menggelar lomba diikuti peserta yang sudah pintar. Terlebih jika tujuannya hanya untuk menang dengan cara mengambil peserta dari daerah lain. Walikota menegaskan dirinya siap memimpin di depan dalam upaya menumbuhkan semangat belajar membaca Al Quran. Apalagi saat ini di tengah masyarakat sudah mulai terjadi pergeseran nilai yang cukup memprihatinkan. Dulu, sejak kecil anak – anak sudah diajari orangtua untuk mengenal agama Islam. Bahkan jika hari menjelang maghrib orang buru-buru segera berada di rumah. “Kalau sekarang, enjoy aja,“ ujarWalikota. Pada audiensi tersebut, MYusuf didampingi unsur pengurus lain,Wakil Ketua H. Ahmad Nasir, Zisferdi, Hj. Khairani, Drs. Muslim Bakhtiar, Sekretaris Umum Adenan Haris,Wakil Sekretaris Zulham, SAg, Ir. Hotmansyah, Armaya Azmi, Zakiaturrahman, Bendahara Rubiah Hanum. (a03)

Pemilukada Labusel

Panwas Terima 57 Laporan Pelanggaran KOTAPINANG (Waspada) : Dalam dua hari terakhir, Panwaslukada Labuhanbatu Selatan (Labusel) menerima 57 laporan kasus pelanggaran Pemilukada putaran kedua Labusel yang digelar, Rabu (16/12) lalu. Sebagian besar pelanggaran yang dilaporkan yakni tentang adanya praktik money politik. Divisi Penanganan Pelanggaran Panwaslukada Labusel Ridwan Hasibuan didampingi Divisi Pengawasan dan Humas Mahrizal Hasibuan yang dikonfirmasi Waspada,Minggu(19/12)mengatakan, seluruh kasus tersebut dilaporkan oleh masyarakat. Seluruh kasus yang dilaporkan tersebut menyangkut dugaan praktik money politics yang dilakukan pasangan calon yang bertarung di Pemiluakda ini. “Mereka sebagian besar mengadukan kasus money politik yang terjadi di sejumlah daerah yang dilakukan sebelum pelaksanaan pemungutan suara,” kata Ridwan. Dijelaskan, Panwaslukada mulai menerima laporan tersebut sejak dua hari pasca pemungutan suara yakni, Jumat (17/ 12)malam.Saatitu,katadia,pihaknyamenerima30laporanpelanggaran, sedangkan, Sabtu (18/12)

malam pihaknya kembali menerima 27 laporan. Menurutnya, la-poran tersebut sah-sah saja sesuaidenganPPNo.6tahun2005 tentang sarat-sarat laporan yang didukung peraturan Bawaslu No.20 tahun 2009. Beberapalaporanyangditerima itu di antaranya laporan tentangpenggunakanhakpilihorang lain di Dusun Bangun Jaya, Kec. Torgamba yang dilakukan SW, warga Dusun Bakti, Rokan Hilir. Selanjutnya kasus money politik di KompleksPTMujurLestari pada 15 Desember 2010 yang dilakukan MR, warga Kompleks PT. Mujur Lestari dengan memberikan uang Rp50 ribu per orang. Kasus money politik juga terjadi di hari yang sama di Desa Sapilpil, Kecamatan Sei Kanan yang dilakukan JM warga setempat, dia membagikan uang Rp50 ribu kepada pemilih. Kasus yang sama juga terjadi di Sei Rumbia Kec. Kotapinang yang dilakukan oleh ED. Dari ke 57 kasus tersebut lanjutdia,enamdiantaranyasudah layak diajukan ke Kejaksaan untukdisidangkan.LangkahselanjutnyakataRidwan,pihaknyaakan melakukan pleno selambatnya 21 hari ke depan untuk melimpahkan kasus itu ke kejaksaan. Sekretaris Tim Pemenangan Wilmas Jappar Siddik Nasution mengatakan, pihaknya tak keberatan dengan laporan tersebut sepanjang memiliki bukti yang nyata.

Bakal Digugat Di MK Sementara itu, tim sukses pasangan calon bupati Labuhanbatu Selatan Sudarwanto-Weldy Ritonga (Suwer), akan melayangkan gugatan terhadap hasil Pemilukada Labusel putaran kedua ke Mahkamah Konstitusi (MK). Ketua PDIP Kab. Labuhanbatu Selatan Zainal Harahap, mengatakan, PDIP salah satu partai pengusung pencalonan pasangan Suwer mengaku, banyak menemukan dugaan pelanggaran selama proses Pemilukada yang diduga dilakukan tim Pasangan Wildan-Maslin Pulungan. “Kalau kita (PDIP) hanya sebagai partai pengusung. Pada prinsipnya kita akan mendukung gugatan itu asal bukti-buktinya ada, karena mereka (Tim Sukses Sudarwanto–Weldy) saat ini sedang mencari bukti-bukti karena belum ditetapkan KPU hasil Pilkada,” kata pria yang juga pimpinan DPRD Labusel itu. Dia mengatakan, menurut informasi yang diperoleh dari pihakSudarwanto,salahsatuitem yang akan dijadikan alasan pengajuan gugatan adalah dugaan adanya politik uang menjelang Pemilukada yang diduga dilakukanolehtimpasangan Wildan– Maslin Pulungan. Dia juga mengatakan, Suwer juga direncanakan akan menolak menandatangani berita acara (BA) rekapitulasi perolehan suara di KPU Labusel yang akan ditetapkanbesok,Selasa(21/12). (cden)

TANJUNGGADING (Waspada) : Keberhasilan dalam program pengelolaan dan daur ulangsampahnantinyasangatbermanfaatuntuk menciptakan kualitas lingkungan yang lebih baik di lingkungan sekolah. Demikian Senior Manager Departemen Humasy PT Inalum H Subagyo Ibnoe pada pidato tertulisnya yang dibacakan Manager Humasy Moranta Simanjuntak pada pelatihan daur ulang sampah kepada 32 siswa SLTA dari 16 sekolah di Kec. Air Putih, Sei Suka dan Medang Deras, Kab.Batubara, Minggu (19/12). Kegiatanpelatihandaurulangyangdilakukan PT Inalum bekerjasama dengan Komunitas Pemuda Peduli Lingkungan (Koppling) yang dihadiri langsung Inisiator dan Pembina Dewi Budiati TJ Said. “Melalui program ini diharapkan akan mendorong para generasi muda, khususnya para siswa sekolah untuk peduli akan lingkungan. Untuk mendukung terlaksananya program ini nantidilapangan,perusahaanjugatelahmeminta kerjasama para kepala sekolah terkait melalui dinas Pendidikan Batubara untuk membentuk Unit Kegiatan Sekolah (UKS) di bidang lingkungan,” kata Moranta. Ia juga mengharapkan ke depan peserta pelatihaninilahyangakanmengimplementasikan pengetahuan dan keahlian yang didapat di

Ketua DPRD Binjai Haris Harto

Sehat Bersama Waspada Momentum Sosialisasi Kesehatan Kepada Rakyat BINJAI (Waspada): Ketua DPRD Kota Binjai Haris Harto (foto) berharap pelaksanaan Sehat Bersama Waspada yang dijadwalkan 6 Januari 2011 di Lapangan Merdeka menjadi momentum sosialisasi kesehatan kepada rakyat. Haris mengemukakan itu, Jumat( 17/12). Dia menyebutkan, Waspada sebagai media berpengaruh di Sumut dan Aceh, dalam memperingati hari jadinya ke-64 menggelar berbagai kegiatan yang sangat menyentuh masyarakat. Seperti, Program Sehat bersama Waspada dan di Kota Binjai ternyata mendapat dukungan penuh dari Pemko Binjai. Pemberian pengobatan gratis dengan mengaktifkan beberapa tenaga dokter spesialis, sudah tentu berdampak positif. Masyarakat yang selama ini kurang memperoleh informasi tentang tenaga kesehatan di Kota Binjai akan mengetahui dan memperoleh pelayanan gratis. Sebagai wakil rakyat, Haris berharap, acara Sehat Bersama Waspada di Lapangan Merdeka

T Johnson: Sehat Bersama Waspada Berlanjut KISARAN(Waspada):AnggotaKomisiCDPRDAsahanTJohnson mengatakan, Sehat bersama Waspada sebaiknya terus dilanjutkan,karenahalitusangaberarti bagi masyarakat apa lagi pada kalangan bawah. Hal itu diungkapkannya setelah memeriksakan kadar gula darahnya yang dilakukan Harian Waspada perwakilan Kisaran, di Kafe Batik di Jalan Imam Bonjol, Kisaran, Jumat (17/12) dalam rangka menyambut HIT ke-64. Dia menilai kepedulian itu sangat bermanfaat, walaupun dilakukan dengan sederhana, namun sangat besar pengaruhnya kepadamasyarakatekonomirendah. “Sebagian masyarakat yang tergolong prasejahtera perlu kita perhatikan,karenamerekamempunyai keterbatasan dana untuk memeriksakan kesehatannya, sama halnya dengan khittan massal. Oleh sebab itu saya berharap kegiatan ini terus dapat dilanjutkan untuk memberikan yang terbaik kepada masyarakat selain tugas rutin menyediakan berita yang atraktif dan aktual,” ungkap Johnson. Kagiatan itu, menurut Johnson, bisa lebih ditingkatkan dengan pemeriksaan mata, gigi pada anak, dan THT atau kesehatan lainnya, karena tidak bisa kita pungkiri, makanan yang kita konsumsi saat ini banyak mengandung zat kimia, bila tidak dinetralisir akan mengganggu kese-

sekolah serta menyebarluaskannya kepada sahabat dan lingkungannya. Pembina Koppling Hj Dewi Budiati TJ Said dalam arahannya kepada para siswa mengungkapkan kerajinan tangan dengan memanfaatkan sampah kering dapat bernilai ekonomis. “Dengan modal yang murah ditambah kreativitas yang baik, barang - barang yang semula tidak berharga akan bernilai seni dan layak jual,” ujar Dewi memotivasi siswa. Ia juga menegaskan jika taraf latihan ini sudah berubah menjadi komoditas untuk industri, kerajinan yang dihasilkan harus berkualitas jangan asal – asalan. “Saya sudah berbicara dengan Dinas Perindustrian, jika sudah ada produksi massal akan disiapkan display di tempat - tempat umum seperti bandara, perkantoran dan lainnya, hingga suatu saat kerajinan daur ulang ini akan jadi sovenir khas Sumut,” terangnya. Salah seorang peserta pelatihan Rizki Putri Dzulqaidah, siswi dari SMU I Indrapura menerangkan kesannya dalam acara ini berguna bagi para siswa. “Di sekolah maupun di rumah banyak sekali sebenarnya sampah yang dapat dijadikan bahan kerajinan. Apalagi mengolah sampah menjadi benda layak jual dapat dilakukan dengan modal yang minim, hanya butuh kreativitas,” jelasnya. (a31/a11)

Kota Binjai bisa dimanfaatkan rakyat untuk memeriksakan kesehatan secara cuma-cuma. Kemudian Haris Harto juga minta pada acara itu dilakukan sosialisasi kepada rakyat tentang program kesehatan di Kota Binjai, baik Jamkesda dan penyediaan pelayanankesehatandiPuskes-mas dan Pustu. Pemko Binjai yang sudah memprogramkan pelayanan kesehatan bagi masyarakat tak mampu melalui Jamkesda, hendaknya dapat diinformasikan prosesnya, sehingga masyarakat Kota Binjai benar-benar dapat terlayani dengan program kesehatan yang sudah tersedia anggarannya. Sosialisasi, katanya, sangat penting, sehingga bidang pelayanan kesehatan bisa diketahui masyarakat secara benar. Oleh sebab itu Ketua DPRD Haris Harto sangat mendukung pelaksanaan Sehat BersamaWaspada dan momen itu harus dijadikan kepedulian Pemerintah Kota Binjai pada kesehatan rakyat, sesuai visi dan misi Walikota Binjai. (a03)


MENERIMA: Pj Walikota Tebingtinggi Drs H Eddy Sopyan MAP (kiri) menerima Ketua Harian Panpel HUT ke- 64 Waspada Edwar Thahir didampingi Redaktur Olahraga Waspada Jonny Ramadhan Silalahi (kanan) di rumah dinasnya, Sabtu (18/12).

2 Pemukiman Padat T. Tinggi Masuk Agenda ‘Sehat Bersama Waspada’


MEMERIKSA: Anggota Komisi C DPRD Asahan T Johnson sedang memeriksakan kadar gula darahnya, begitu juga personil Polisi Lantas Polres Asahan di sebelahnya, dalam kegiatan Sehat Bersama Waspada di Kafe Batik Kisaran, selain itu Harian Waspada Perwakilan Kisaran melakukan khittan massal. Foto direkam, Jumat (17/12). hatan masyarakat. “Kegiatan ini bisa juga dilakukandidaerahlainyangmerupakan pasar-pasar Harian Waspada, sehingga kegiatan ini terus bergulir,dantidakhanyamenyambut HUT Harian Waspada, namun berkelanjutan,”kataJohnsonyang juga Ketua DPD IPK Asahan. HarianWaspada, kata Johnson, banyak memberikan pencerahan dalam informasi, karena beritayangdisajikansesuaidengan

fakta yang terjadi saat ini. Namun iniakanlebihbaiklagi,bilakegiatan Sehat Bersama Waspada terus berlanjut. “Saya yakin semua elemen masyarakatakanmenyambutnya dengan senang hati, karena mereka mempunyai kesempatan untuk memeriksakan dirinya. Selain itu program Pemprop Sumut juga akan tercapai, bahwa warga tidak ada yang sakit,” jelasnya. (csap)

MEDAN (Waspada): Dua kawasan pemukimanpadatpendudukdiKotaTebingtinggimasuk agenda bakti sosial ‘Sehat Bersama Waspada’ pada 15 Januari 2011, terkait kegiatan HUT ke 64 Harian Waspada. Demikian terangkum dalam pertemuan Pj Walikota Tebingtinggi Drs H Eddy Sopyan MAP dengan Ketua Harian Panpel HUT ke64 Waspada EdwarThahir didampingi Redaktur Olahraga Waspada Jonny Ramadhan Silalahi SH. Dalam pertemuan di Rumah DinasWalikota Tebingtinggi, Sabtu (18/12), Eddy Sopyan sangat antusias menyambut program kegiatan HUT ke-64 Waspada yang langsung menyentuh pada masalah sosial di beberapa kabupaten/kota di Sumatera Utara. Selain Tebingtinggi yang akan menutup rangkaian bakti sosial‘Sehat BersamaWaspada’, menurut Edwar Thahir, kegiatan serupa juga digelar di Kisaran (Asahan) pada 17 Desember, Kota Binjai, Kabupaten Deliserdang dan Serdang Bedagai. “Inilah yang sangat dibutuhkan masyarakat. Waspada bukan hanya mementingkan kegiatan internal, tapi juga masyarakat secara keseluruhan pada setiap acara ulang tahunnya,” sambut Eddy Sopyan. Waspada sebagai media tertua di daerah ini,kataEddy,berartiikutmembantupemerintah kota/kabupaten dalam mengupayakan kehidupan rakyat sehat, pendidikan baik, nyaman,

dan sejahtera. Khusus untukTebingtinggi, dia meminta bakti sosial ‘Sehat BersamaWaspada’ dipusatkan pada dua kawasan pemukiman padat penduduk Kelurahan Bandar Setia dan Kelurahan Bandar Utama, Kecamatan Tebingtinggi Kota. “Duakelurahanitumerupakankawasanrawan banjir,populasipenduduknyabegitubesar,sanitasi dan tata ruang sangat memprihatinkan,” jelas putra daerah Kota Lemang tersebut. Diapunmenawarkanbanyakprogramkesehatanpadakegiatan15Januarimendatang,semuanya gratis buat masyarakat. Di antaranya pemeriksaan gula darah, vaksmir, pemasangan kontrasepsi, pemeriksaan gigi dan pencanangan sanitasi sehat. Juga kampanye sikat gigi, gerakan cuci tangan pakai sabun, sosialisasi pencegahan/pengobatan demam berdarah, dan gerakan penanaman pohon massal. Untuk mendukung sekaligus menyukseskan rangkaian kegiatan bakti sosial tersebut, PjWalikota Tebingtinggiituakanmelibatkanlangsungbeberapa jajaran Pemerintah Kota. Khususnya Dinas Kesehatan, Pendidikan, Tata Kota, Kebersihan, Pertamanan, dan RSU Tebingtinggi. “Kelurahan Bandar Setia dan Bandar Utama saat ini memang menjadi prioritas PemkoTebingtinggi bersama beberapa kawasan lainnya yang cukup memprihatinkan. Semoga kegiatan ini bisa mendorong percepatan pembangunan kawasankawasan dimaksud,” tutur Eddy Sopyan. (m15)


Sumatera Utara Muscab PPP Asahan Kisruh

Proyek Lanjutan Jalan Wisata Pendayangan Sudah Selesai

Gugatan Hukum Akan Dilancarkan Ke PN

RANTAUPRAPAT (Waspada) : Proyek Dinas Pekerjaan Umum, Pertambangan dan Energi (PUPE) Kabupaten Labuhanbatu Selatan (Labusel) Tahun Anggaran (TA) 2010 yakni Lanjutan JalanWisata Pendayangan Desa Ulumahuam, Kecamatan Silangkitang yang dilaksanakan CV RUNI dengan kontrak Rp533 Juta sudah selesai pengerjaannya. “Pekerjaan kita sudah selesai sesuai jangka waktu pelaksanaannya, sedangkan pengerjaannya dapat kita laksanakan dengan baik sesuai bestek yang kita tandatangani dalam kontrak,” ujar Hj Juliati, Direktur CV RUNI melalui telefon selulernya, Minggu (19/12) di Rantauprapat. Lebih lanjut dipaparkannya, proyek lanjutan pembangunan jalan pendayangan tersebut dikerjakan sesuai volume dalam dokumen kontrak antara lain aspal hotmix sepanjang 500 m x lebar 3 m. “Selain itu, kita juga mengerjakan lapisan pondasi bawah (LPB) sebanyak 209 M3 sertu dan 108 M3 lapisan pondasi atas (LPA),” katanya. Pantauandilapangan,Sabtu(19/12),pelaksanaanpembangunan jalan pariwisata pandayangan yang merupakan objek wisata di Kabupaten Labusel kelihatan pengerjaannya sudah selesai. Selain mengerjakan pengaspalan, kontraktor juga kelihatan mengerjakan LPB dan LPA agar pondasi jalan berkualitas sesuai perencanaan. Pejabat Pembuat Komitmen (P2K) Proyek Dinas PUPE Kabupaten Labusel Aunila membenarkan, pengerjaan lanjutan pembangunan jalan pendayangan yang dilaksanakan CV RUNI sudah selesai pengerjaannya sesuai jangka waktu pelaksanaan. (c01)

Pemerintah Kecamatan Kualuh Leidong Gelar Tolak Bala LABURA(Waspada):PemerintahKecamatanKualuhLeidong dan Kantor Urusan Agama (KUA), Muspika plus, pemuka masyarakat dan tokoh agama menggelar tolak bala dengan melakukan zikir keliling kampung sebagai rangkaian semarak Muharram dan memeriahkan Tahun Baru Hijriyah 1432, Rabu (15/12) di Masjid Darul Hasanah Tanjung Leidong. Sofyan Yusma MSi selaku Camat Kualuh Leidong dalam sambutannya mengatakan, Bupati Labuhanbatu Utara H Khairuddin Syah dan Wakil Bupati H Minan Pasaribu pada hari ini genap bertugas satu bulan, dalam kurun waktu satu bulan ini terjadi perubahan secara drastis terutama di kalangan PNS dan CPNS. Hal ini ditandai dengan tingkat kedisiplinan para abdi negara ini meningkat dibandingkan dengan hari-hari sebelumnya. Camat menyampaikan bahwa tahun ini kegiatan tolak bala dengan Ratif Saman sudah dua kali dilaksanakan. Berkenaan dengan sepuluh Muharram, Sofyan mengimbau kepadaparadermawanagarmaudanmemberikanpenyantunan kepada kaum duafa terutama anak yatim piatu. (c01)

3.000 Warga Batubara Belum Dapat Kompor Elpiji T.TIRAM (Waspada) : 3.000 Warga di Kecamatan Tanjungtiram, Batubara hingga kini belum mendapat bantuan kompor ags elpiji gratis. Hal ini terungkap pada acara sosialisasi edukasi, konversi minyak tanah menggunakan kompor gas dilakukan tim Organizer Flash/Pertamina Medan di halam an kantor Camat Tanjungtiram, Jumat (10/12). Hadir Bupati Batubara diwakili Ka ban BPD Achmadan Choir,Camat Tanjungtiram Nasir Yuhanan, unsur Muspika, Kades/Kadus setempat. CamatTanjungtiram NasirYuhanan maupun Bupati diwakili Kaban PBD Achmadan Choir mengharapkan, sosialisasi dapat meyakinkan warga tidak merasa takut pemakaian kompor gas elpiji lagi. Iskandar, tim Organizer Flash meminta masyarakat mempergunakan kompor gas bantuan pemerintah sesuai dengan petunjuk. Harus diperhatikan kompor, tabung, slang berlabel SNI Kalau tidak sesuai kembalikan sa ja atau ditukar untuk mengantisipasi terjadi kecelakaan. (a30)

Warga Pematang Panjang Lega Jalan Diaspal LIMAPULUH (Waspada) :Warga Desa Pematang Panjang, Kec.Talawi, Batubara merasa lega dan mengucapkan terima kasih kepada Bupati Batubara H OK Arya Zulkarnain yang peduli membangun jalan di desa tersebut. Zulkifli, warga Pematang Panjang, Minggu (19/12) terus terangmengatakansudahpuluhantahunkondisijalanberlubang berlumpur tidak diperhatikan. “Syukurlah setelah pak OK Arya menjadi orang nomor satu di Batubara memberi perhatian membangun jalan rusak tersebut,” ujar Zulkifli. Sekarangberbagaijeniskendaraanramaimelintashubungan lebih dekat dari Tanjungtiram ke Simpang Gambus. Bila jalan biasa Tanjungtiram-Limapuluh -Simpang Gambus sejauh 29 Km melalui jalanTanjungtiram -Kedaisianam- Simpang Gambus hanya 23 Km selisih 6 Km tidak macat di jalan. (a30)

Guru Di Batubara Harus Sadar Pendidikan Pengabdian PERUPUK -BATUBARA (Waspada) : Kadis Pendidikan Kab. Batubara TM Syafii menegaskan, para guru di Kab.Batubara harus menyadari bahwa pendidikan adalah bidang pengabdian terhadap Allah SWT, bangsa, negara serta kemanusiaan umumnya. Penegasan itu disampaikan pada acara HUT ke-65 PGRI Kab.Batubara dimeriahkan lomba jalan santai dan lucky draw diikuti 2000 peserta di lepas Bupati Batubara H OK Arya Zulkarnain di lapangan Kantor Dinas Pendidikan di Perupuk, Minggu (19/12). Syafii menyatakan, tidak ada guru maka tidak ada pendidikan.Tidak ada pendidikan maka tidak ada perubahan. Sebab itu guru Indonesia khusus di Batubara harus terpanggil untuk menunaikan pengabdian dalam bentuk kekaryaannya mencerdaskan kehidupan bangsa melalui perubahan lebih baik dan bermutu. Pelaksanaan HUT PGRI didukung Capem Bank Sumut di Limapuluh menyediakan hadiah laptop 14 inc Acer jatuh kepada Santun Silitonga, guru SD di Lauttador, Sei.Suka.(a30)

SOKSI Adakan Konsolidasi Se Teluk Aru P.BRANDAN (Waspada): Sentral Organisasi Karyawan Swadiri(SOKSI)Kab.Langkatmengadakankonsolidasiorganisasi SOKSI – Kecamatan Babalan masa bhakti 2010– 2015 di g edung PWP Pertamina Refinery-UP II Dumai di P. Brandan Langkat baru-baru ini. Hadir,pengurusDepidarSOKSISumutImamSuyadiGinting Wakil Bendahara/Olah Raga dan Pemuda, Yani Nasution selaku SekretarisSOKSI-Sumut,DrsZulkarnainLubisSekretarisDepicab Soksi Tk-II Langkat dan pengurus Soksi Se Teluk Aru lainnya. Pengurus Soksi Kecamatan Babalan masa bhakti 2010 1015, Dewan Penasihat, H Syahrum Hakim, Drs Khaidir Siagian, Drs Djamal Ritonga dan Johar Makmum Almie.Pengurus Harian, Ketua /Wakil M Aliyuddin, Ir Zulkarnain, M Akhyar SSTP, Irham Effendy, SAg. Sekretaris / Wakil,Ridwan, Syahbandi dan Siti Komariah. Dalam waktu dekat ini pengurus pengurus yang terbentuk akan dilakukan pelantikannya. (c02 )

WASPADA Senin 20 Desember 2010

Waspada/Armansyah Abdi

MENINJAU: Bupati L.Batu dr H Tigor Panusunan Siregar bersama Dirut PDAM Tirta Bina Rantauprapat Amin Prasetyo dan Dirtek meninjau waduk penyaringan air, Jumat (17/12).

Warga L. Batu Minum Air Tidak Sehat RANTAUPRAPAT (Waspada): Bupati Labuhanbatu dr H Tigor Panusunan Siregar mengatakan, sebagai bupati dan dokter dirinya berpandangam, masyarakat selama ini telah meminum air yang tidak sehat yang disalurkan PDAM Tirta Bina Rantauprapat. Tigor mengatakan itu saat mengambil sumpah dan melantik Amin Prasetyo sebagai Direktur Utama (Dirut) Perusahaan Daerah Air Minum (PDAM) Tirta Bina Rantauprapat menggantikan Mukhlis Sirait yang telah

pensiun, Jumat (17/12) di Kantor PDAM Tirta Bina Jalan WR Supratman Rantauprapat. Amin yang seorang akademisi itu diminta untuk meningkatkan kualitas, kuantitas dan kontinuitas air minum dari perusahaan daerah ini untuk disalurkan kepada pelanggan. Dikatakan, persoalan terkait masalah air bersih merupakan masalah negara berkembang. Air yang tersalur kepada pelanggan belum layak konsumsi sebagai air yang sehat dan layak minum. Di samping itu air mengalir sedikit dan mengalirnya ke rumah-rumah pelanggan tidak kontinu (macet). Dengan demikian, Amin Prasetyo perlu melakukan terobosan membenahi kualitas air (bersih dan sehat),

kuantitas dan kontiniutasnya. Bupati yakin Amin Prasetyo bisa menyesuaikan diri dengan tugas dan kerjanya yang baru membenahi PDAM. Apalagi, Amin telah meneken kontrak dan berjanji membenahi perusahaan air minum itu selama 2 tahun. “Saat ini PDAM Tirta Bina masih kelas C dan kalau bisa dinaikkan menjadi kelas B, anda akan lebih baik dari yang sekarang. Saya selaku bupati akan mendukung sepenuhnya demi membuat PDAM ini lebih baik,” sebut Tigor. Pada kesempatan itu, bupati menyebut akan ada cabang PDAM Tirta Bina di Negeri Lama, Kecamatan Bilah Hilir, disusul tahun depan di Kec. Hulu. (a27)

908 Pensiunan Karyawan PTPN II Terima SHT TANJUNGMORAWA (Waspada): 908 pensiunan karyawan PTPNIImenerimaSantunanHari Tua(SHT)yangdiserahkandireksi berkerjasama dengan BRI Tanjungmorawa, di Aula Puri Triadiguna PTPN II,Tanjungmorawa, Deliserdang, Jumat (17/12). Santunan diberikan kepada seluruhpensiunankaryawan2006 hingga 2010 yang meliputi kantor direksi, distrik, unit dan 42 kebun dengan total pengeluaran Rp27 miliar. DeputiBidangUsahaIndustri Primer Kementerian BUMN selaku Komisaris Utama PTPN II Megananda Daryono mengatakan, perusahaan baik pimpinan maupunkaryawantelahberusaha dan bekerja keras untuk memberikan hasil yang memuaskan kepada perusahaan. Lebih lanjut Megananda mengatakan, saat ini perusahaan

terus berusaha dan berbenah dalam menyelesaikan permasalahan-permasalahan yang ada dan dimasa-masa yang akan datang diharapkan PTPN II kembali meraih prestasi dan kinerja yang baik. Sedangkan Dirut PTPN II Bhatara Moeda Nasution menyebutkan,sebelumSHTdiserahkan maka menjadi beban moral yang dipikul perusahaan karena perusahaan merasa terutang kepada para pensiunan. “Alhamdulillah berkat buah kesabaran kita semua perlahanlahan kewajiban perusahaan dapat diselesaikan,” ujar Bhatara. Dikatakan Dirut, santunan sengaja diberikan dalam bentuk tabungan agar para pensiunan memperoleh rasa aman dan nyaman dalam menyimpan dan mencairkan dana SHT tersebut. Ditegaskan Bhatara, kepada

para pensiunan jangan sekali-kali memberikan uang kepada karyawan yang mengurus SHT sebagai tanda terimakasih. “Dan karyawan yang ketahuan memperoleh uang tanda terimakasih dari pensiunan akan dikenakan sanksi yang telah ditetapkan,” tegas Dirut. Di samping itu, Dirut juga menandaskan keberhasilan yang diraih saat ini bukan merupakan hasil akhir karena masih banyak tugas dan kewajiban perusahaan yang harus dilaksanakan dan kedepannya diharapkan perusahaan dapat kembali meraih kesuksesan seperti yang pernah diraih dimasa lalu. Seusai penyerahan SHT yang dihadiri Dirut PTPN IV, seluruh direksi dan karyawan serta serikat pekerja PTPN II dan undangan lainnya, BRI Tanjungmorawa mengadakan lucky draw. (csn)

KISARAN (Waspada): Musyawarah Cabang PartaiPersatuanPembangunan(PPP)Kabupaten Asahan ke-7, Jumat-Sabtu (16-17 Desember 2010) kisruh, karena diduga melanggar ADRT dan azas demokrasi, sehingga gugatan hukum akan dilakukan untuk mendewasakan berpikir kader dan pengusung dalam menyelesaikan permasalahan yang bergejolak. PantauanWaspada,paripurnayangmembahas terkait tentang laporan pertanggungjawaban keuangan DPC. PPP Asahan masa bakti 20062011, lantai 4 Sabty Garden Hotel, Jalan Diponegoro Kisaran, Kamis (16/12) diwarnai protes para peserta dan sarat keributan. Bahkan baku hantam nyaris terjadi, sebab oknumtanpaatributpanitiadanpartaimemasuki ruang sidang ikut melakukan tindakan intervensi dan pengancaman kepada peserta yang protes, namun hal itu bisa netralisir dengan mengeluarkan orang tersebut dari ruangan sidang. Keributan dipicu karena materi musyawarah dan laporan keuangan disampaikan saat sidang akan dimulai, padahal peraturan dalam ADRT PPP Asahan, laporan itu disampaikan sebulan sebelum muscab dilakukan. 16PimpinanAnakCabang(PAC)Kecamatan, menerima laporan itu, sedangkan sembilan PAC (Buntu Pane, Pulau Rakayat, Teluk Dalam, Simpang-empat, Silau Laut, Setia Janji, Aek Ledong, Kisaran timur dan Rahuning) tidak menerimanya, karena materi dan laporan keuangan tersusun tebal, dan tidak mungkin dalam satu malam kan bisa terbaca apalagi membahasnya, namunpertentangantidakmengganggujalannya sidang. “Muscab PPP Asahan kali ini adalah yang terburuk dalam sejarah kepartaian PPP Asahan. Ini kebobrokan panitia dan pimpinan sidang tidak becus. Bahkan kami menyayangkan sikap

Ketua DPC PPP Asahan yang mengambil alih pimpinan sidang tanpa melalui mekanisme dan ketentuan persidangan. Ada nuansa diktator dan intimidasiuntukmemaksakankehendakyangterjadi di persidangan,” jelasWakil Ketua DPC PPP Asahan Syaifuddin Zuhri. Akibatnya, dia beserta Supriadi (Wakil Ketua DPC PPP Asahan) dan M Shaleh (Wakil Sekretaris DPC PPP Asahan) mengambil langkah walk out (keluar) dari persidangan karena mereka menilai muscab ini sudah melanggar ADRT Partai. Ketua PAC PPP Kecamatan Kisaran Timur, Ramli Tambunan didampingi Sekretarisnya Kamil Sirait, Sabtu (17/12) mengatakan, hasil muscab tahun ini akan digugat, karena proses berjalannya sidang tidak sesuai dengan ADRT PPP, serta azas demokrasi, serta tranparansi. Dipaksakan Mantan Wakil Ketua Pengurus Harian PPP Asahan 2006-2011 Tri Pernomowidodo menilai selain melanggar ADRT, muscab ini juga terkesan dipaksakan, untuk kepentingan kelompok sehingga jauh dari nilai demokrasi dan kepentingan umat. Oleh sebab itu pihaknya dengan sembilan PAC akan juga melakukan tuntutan baik itu perdata danpidana,karenainiterkaittidakadanyatranparansi dalam tubuh partai. Ketua DPC PPP Asahan yang terpilih Jamiyus Silalahi, Minggu (19/12) mengatakan, berjalannya muscab sesuai dengan peraturan yang ada. Sedangkan draf muscab telah dibahas dalam rapat koordinasi dengan pengurus partai dan disetujui, kemudian diberikan kepada 25 PAC untuk dibahas. Dalam Muscab 16 PAC menerima LPJ itu, sedangkan sembilan PAC lainnya belum menerima.“Kita memegang azas demokrasi, karena lebih banyak yang menerima dari pada yang belum menerima, maka Muscab PPP Asahan ke-7 bisa terus dilanjutkan, dan hasilnya sah,” ungkap Jamiyus. (csap)

Al Ittihad Diminta Pertanggungjawabkan Kepengurusan Kepada Warga RANTAUPRAPAT (Waspada): Perguruan Pendidikan Al Ittihad Aek Nabara, Kecamatan Bilah Hulu, Kabupaten Labuhanbatu, diminta melakukanpertanggungjawabanpenguruslama kepada warga. Demikian permintaan Amran Harahap, HM Nur Latif, Buyung Muchfajal, Ahmad Taufik Nasution dan Azwardin Rambe, Minggu (19/ 12) di Rantauprapat. Sesuai dengan surat mereka yang ditujukan kepada pengurus perguruan tersebut pada 8 Desember lalu, Amran Harahap menuturkan, Perguruan Al Ittihad adalah yayasan milik masyarakatyangberdiriataspartisipasidankerjasama masyarakat. Karena itu, pertanggungjawaban pengurus lama semasa Amanegoro belum dilaksanakan walau kepengurusan baru sekarang di bawah kepemimpinan Aspan Rambe telah berjalan hampir satu tahun.

Menurut mereka, pengurus baru Perguruan Al Ittihad juga belum membuat akta anggaran dasar dan anggaran rumah tangga (AD/ART) yang sesuai dengan dasar dan tujuan didirikannya perguruan dimaksud. Untuk keabsahannya, harus dibuat akta baru yang mencerminkan bahwa Al Ittihad adalah lembaga pendidikan milik masyarakat. Masyarakat juga merasa aneh atas pernyataan pengurus lama yang mengungkapkan di hadapan masyarakat bahwa pengurus baru memiliki utang Rp190 juta kepada pengurus baru. Karena itu, pengurus lama wajib melaksanakan pertanggungjawaban agar masyarakat bisa melihat secara transparan apa yang mendasari adanya utang tersebut. Selain itu, masyarakat juga meminta agar kepengurusan Perguruan Al Ittihad yang saat ini terlalu gemukbagaigerbonglokomotif,perluperampingan melalui Fit and Proper Tes agar kepengurusan berjalan lebih efektif. (a27)

Sosialisasi Perpres No. 54 Tahun 2010 Di Pemkab Batubara

Sekdakab: Peraturan Tetap Dijalankan LIMAPULUH (Waspada) : Penerapan Perpres No:54 Tahun 2010 Tentang Pengadaan Barang dan Jasa di lingkungan pemerintah dapat mengurangimultitafsirdalampelaksanaanlelang proyekAPBDmaupunAPBNsebagaimanaterjadi selama ini. Kepala Sub Direktorat Lembaga Pelatihan Pengadaan Barang dan Jasa Pemerintah (LKPP), Muji Santosa mengatakan itu dalam sosialisasi Perpres di lingkungan SKPD Pemkab Batubara di Inna Hotel Parapat, Sabtu (17/12). Disamping mempermudah bagi rekanan mengikuti karena prosesnya nanti mengedepankan transparansi melalui webset Internet sehingga lebih dapat diketahui oleh masyarakat secara luas. ‘’Disini tidak ada lagi penjatahan proyek apakahitupaketPengadaanLangsung(PL)karena seluruh diproses secara transparan dan profesional oleh Unit Layanan Pengadaan (ULP) sebagai mengganti kedudukan Panitia

Pengadaanyangidealnyadimilikkidaerah,’’tuturnya. Begitu juga pagu anggaran meningkat dari sebelumnya Rp50 juta menjadi Rp100 juta bagi paket PL yang semuanya diproses melalui mekanisme. Penyesuaian Sekdakab Batubara H Sofyan MM mengatakan, sepanjang peraturan tetap dijalankan dan saat ini barudijelaskansecaraumumdanmasihmenunggu tahapan tehnis lebih lanjut untuk dijalankan secara efektif. ‘’Sekarang proses Pengadaan Barang dan Jasa Pemerintah Daerah masih berpedoman kepada Kepres No:80 Tahun 2003, sebab Pepres No:54 masih tahap sosialisasi dan belum efekif masih menunggu tahapan tehnis lebih lanjut,’’ paparnya. Sedangkan kepada Kepala SKPD boleh saja menjalankan sepanjang dapat diserap untuk selanjutnya diturunkan kepada staf di lingkungan unit kerja sebagaimana metode pelelangan diatur dalam Perpres. (a11)

Sergai Di Mata Putri Indonesia KUNJUNGAN Putri Indonesia 2009 Qory Sandioriva ke Kab. Serdang Bedagai (Sergai) selama tiga hari mulai 17 hingga 19 Desember 2010 mendapat perhatian khusus masyarakat terlebih-lebih di lokasi-lokasi yang dikunjunginya. Namun yang lebih menarik, papar Qory terhadap Sergai, seperti yang ia sampaikan kepada Waspada, Sabtu (18/12) sore di sela-selapenanamanpohon,adalah obyek wisata bahari Theme Park Pantai Cermin, Qory Sandioriva didampingi Kepala Dinas Pariwisata dan Kebudayaan Kab.Sergai dan Kepala Dinas Kehutanan dan Perkebunan Kab.Sergai Ir. M.Taufik Batubara menuturkan, Sergai mempunyai banyak potensi bukan hanyapariwisatatetapiagrowisata yang dengan kedatangan saya diharapkan lebih bisa meningkatkan industri pariwisata, sesuai dengan misi kedatangan saya kesini, tuturnya. Dengan garis pantai sepanjang 95 kilometer, lanjut Putri berdarah Aceh itu, wisata bahari di Sergai, potensinya masih sangat mungkin untuk ditingkatkan dan dikembangkan tentunya dengan

peran serta para investor. “ Saya yakin Pemkab Sergai akan mampu mencari solusinya mengingat sejauh ini Kab.Sergai telahbanyakmenerimapenghargaan di berbagai bidang, yakni 135 penghargaan,” ungkap Qory. Disamping itu, katanya lagi, sebagai putri Indonesia saya juga menjalankantugasdankewajiban saya dalam kunjungan beberapa hariinimenyempatkanmengunjungi Pendidikan Anak Usia Dini (PAUD)dilanjutkan mengunjungi PantiJompo,kemudian memberikan pembekalan kepada para Taruna dan Belia Kab.Sergai 2010 yang saya harapkan bisa menjadi duta (perwakilan) yang bisa mengembangkandaerahini,”imbuh Mahasiswi Sastra Prancis di Universitas Indonesia itu. Menurut Putri Indonesia itu dengan artian lebih luas bukan hanyamenjadiseorangdutaseremoni, tetapi memang kepintarannya, kepribadiannya serta tampilan fisik yang bisa dimanfaatkan dari dalam diri yang benar-benar putra Sergai. “Biasanya saya hanya berkunjung ke propinsi, jadi saat ini sangatbahagiasekalibisaberkunjung ke Sergai , yang mau membuka peluang untuk saya berobservasi di sini,semogakedepan ada program-program yang bisa dilaksanakan khusunya ke Sergai. Ketika disinggung Waspada terkait penanaman pohon untuk Kab.Sergaisebagaikabupatenpe-

mekaran baru, Qory Sandioriva mengatakan, semoga Sergai bisa berkembang dan tumbuh, walaupun semakin tinggi pohon ituakansemakintinggijugaangin yang akan menggoyang dan mengguncangnya. Namun,sayaberharapSergai bisa sekuat pohon yang tidak mudahrubuh,daunnyahijaubisa menaungi tumbuhan yang ada dibawahnya dengan artian bisa semakin mensejahterakan masyarakatnya, ketus putri kelahiran Jakarta17Agustus1991itu,dengan senyumnya yang khas. Sebagai Putri Indonesia tentunya saya sangat mencintai Indonesia yang berarti masyarakat Sergai disini juga harus mencintai daerah dengan jati dirinya. Bukan hanya sekedar kita tinggal dan menikmatinya tetapi juga harus mengetahui lebih jauh tentang daerah ini. Selanjutnya menginformasikankepadaorang lain sehingga industri pariwisata sebagaisalahsatuunggulandapat semakin berkembang yang pada akhirnya dapat meningkatkan kesejahteraan masyarakat. Duta Harimau Indonesia SelainsebagaiPutriIndonesia, sayajugamenjabatDutaHarimau Indonesia yang ada di Departemen Kehutanan. Salah satu tugas saya juga bergerak di GlobalWarming, yang mengartikan Harimau itu adalah Top Predator, dengan segitiga rantai makanan.

Waspada/Edi Saputra

TANAM POHON: Putri Indonesia 2009, Qory Sandioriva disaksikan Kadis Pariwisata dan Kebudayaan Sergai dan Kadis Hutbun Sergai Ir M Taufik Batubara ketika menanam pohon cemara laut di obyek wisata Theme Park Pantai Cermin, Kab.Sergai, Sabtu (18/12). yang saat ini populasinya sepuluh tahun terakhir tinggal 400 ekor Harimau di Sumatra. “ Kalau Harimau itu punah, maka seluruh ekosistem yang ada termasuk tumbuh-tumbuhandanmanusiajugaakanterancam punah. Jika kita tidak turut memelihara ekosistem maka dikhawatirkan 20 tahun lagi kondisinya akan semakin parah. Dengan artian dengan meli-

hara populasi Harimau secara tidak langsung juga ikut melestarikanlingkungantempatberkembang biaknya,sehingga akan menekan permasalahan Global Warming ,” papar Qory. Dalam kesempatan itu Kadis Hutbun Sergai Taufik Batubara didampingiKadisParbudmengatakan, semangat penanaman pohon yang dilakukan Putri Indonesia kiranya dapat merang-

sang semangat putra-putri denganIndonesia,khususnyaSergai gemar menanam pohon, tentunya dibarengi dengan dengan semangatmemeliharadanmerawatnya, ujarnya. Penanaman pohon 50 batang jenis cemara laut dan trembesi selain dilakukan oleh Qory juga oleh 47 pesertaTaruna dan Belia Sergai 2010. Edi Saputra

Sumatera Utara

WASPADA Senin 20 Desember 2010


Sosialisasi Pemutakhiran Data 2010 Dan Langkah Menuju OWTP PEMATANGSIANTAR (Waspada): Kegiatan pemutakhiran data tahun 2010 dan langkah-langkah menuju opini wajar tanpa pengecualian(OWTP)disosialisasikandiruangdataPemko,Pematangsiantar, Kamis (16/12). “Pemutakhiran data dilaksanakan berdasarkan surat Mendagri nomor 700/618/A.2/IJ tanggal 31 Juli 2010 tentang rapat pemutakhiran data sebagai tindak lanjut dari pengawasan serta Perda nomor 4 tahun 2010 tentang susunan organisasi dan tata kerja lembaga teknis daerah Pematangsiantar,” ucap Inspektur Pemko Pardamean Silaen dalam laporannya saat pembukaan kegiatan pemutakhiran data dan sosialisasi itu. Selain itu, sebut Silaen, Keputusan Walikota Pematangsiantar nomor 800/687/WK-tahun 2010 tanggal 10 Mei 2010 tentang pembentukanpanitiapenyelenggarapemutakhirandatatingkatInspektorat Pematangsiantar agar menjamin pemerintahan dapat berjalan sesuai rencana ketentuan perundang-undangan yang berlaku serta materi sosialisasi langkah menuju OWTP, tindak lanjut temuan-temuan pemeriksaan Inspektorat Provsu serta kasus-kasus pemeriksaan yang lain seperti BPK dan lainnya. Walikota Pematangsiantar Hulman Sitorus mengharapkan SKPD dan seluruh peserta yang mengikuti kegiatan saat itu agar mengikuti denganbaik,sebabkegiatanitusangatpentingdemiuntukmengevaluasi kinerja dan kondisi akhir pelaksanaan tindak lanjut hasil pemeriksaan aparat pengawas fungsional serta mewujudkan tata pemerintahan yang baik (good governance) yang mengundang prinsip transparansi, akuntabilitas, efisiensi, efektifitas dan professional agar terwujud menuju Siantar Mantap, Maju dan Jaya. (a14)

Natal Oikumene P. Siantar Diwarnai Pengobatan Gratis Dan Bazar P.SIANTAR (Waspada): Perayaan Natal Oikumene Kota Pematangsiantar di halaman Perguruan HKBP di Jalan Gereja pada 27 Desember mendatang akan dirangkai dengan pengobatan gratis dan bazar. “Perayaan Natal Oikumene bersama itu akan melibatkan BUMN dan seluruh lapisan masyarakat dan gereja di Pematangsiantar,” sebut Kabag Humas dan Protokoler Pemko Pematangsiantar Daniel H Siregar di Pematangsiantar, Jumat (17/12). Menurut Daniel, biaya perayaan Natal Oikumene itu ditampung di APBD Pemko TA 2010 sebesar Rp150 juta. Daniel menambahkan, perayaan Natal Oikumene itu akan diisi dengan berbagai kegiatan dan hiburan dari para artis lokal. “Perayaan Natal Oikumene 2010 ini diprakarsai Ketua Pengadilan Negeri selaku Ketua Umum Panitia Pastra Joseph, Sekda Donver Panggabean selaku Ketua Panitia Pelaksana, Asisten III Robert Dontes Simatupang selaku Sekretaris Umum Panitia. (a14)

Waspada/Dede Basri

SAHABAT KERBAU: Bahri Ginting, 45, warga Desa Sumbur, Kec. Kabanjahe, Kab. Karo, lebih dari 20 tahun bersahabat dengan kerbau. Kerbau tersebut setiap Senin dan Kamis selalu menjadi teman Bahri mengangkat sayur dan buah, baik jeruk, kakao, kentang wortel serta sayur kubis, bunga kol dan sayur mayur lainnya. .

2015, Madina Miliki Pembangkit Tenaga Kaum Dhuafa Di Berastagi Listrik Panas Bumi Terima Santunan

BERASTAGI (Waspada) : Keluarga besar Badan Dakwah Islamiyah PT Pertamina Geotarmal Energi Area Sibayak,bekerjasama dengan Tempat Pengajian Anak An’Nur Mesjid Isthrar Berastagi, Kamis (16/12) menyerahkan bingkisan kepada sejumlah kaum duafa dan fakir miskin berupa beras Siudang kepada para dhuafa. Penyerahan bingkisan dan bantuan dari keluar besar Badan Dakwah Islamiyah PT Pertamina Geotermal Energi Area Sibayak tersebut, sebagai rasa kepedulian terhada sesama umat muslim, terutama bagi kaum Dhuafa (fakir miskin ) dalam rangka menyemangati Tahun Baru Islam 1Muharram 1432 H. SebelumnyaparajamaahyangmemenuhiruanganMasjidIstihrar mendapat siraman rohani dari Al Ustadz AnsariYamamah. Sementara itu ketua panitia pelaksana Ustazd Suherman Hutapea mengatakan, kerjasama yang mereka lakukan dengan pihak BDI PT Pertamina adalah yang pertama kali dilakukan di Berastagi. “Tujuankitayangbaikini,jangandilihatdaribanyakatausedikitnya bantuan yang kita salurkan, tapi ini rasa kepedulian kita sesama umat Islam yg tinggal di Kota Berastagi,” ini ungkap Suherman. Sementara itu sebagai mewakili GM.PT.Pertamina AG Sibayak HarisWarsita didampingi Alfani Gunawan, Rida Elfreda selaku Humas mengatakan, bantuan yang mereka salurkan ini merupakan kas yang belum terpakai pada 2010 ini. (c06)

PANYABUNGAN (Waspada): Pada tahun 2015 nanti, Kabupaten Mandailing Natal direncanakan memiliki Pembangkit Tenaga Listrik Tenaga Panas Bumi (PLTP). “DenganterbangunnyaPLTP ini diharapkan defisit listrik di Madina yang selama ini terjadi akanteratasi,”ujarPj.BupatiMandailing Natal Aspan SopianM melalui Kabag Humas M.Taupik Lubis di Panyabungan, Minggu (19/12). Hal tersebut disampaikan Taufik sekaitan dengan kegiatan sosialisasi digelar PT Sorik Marapi Geothermal Power (SMGP) yang bergerak di bidang panas bumi kepada masyarakat tiga kecama-

tandidaerahituyakniKecamatan Panyabungan Selatan, Puncak Sorik Marapi dan Panyabungan Barat yang berakhir Jumat (17/ 12) lalu. “Untuk merealisasikan ini kita bekerjasama dengan PT Sorik Marapi Geothermal Power untuk melakukan eksplorasi dan eksploitasipanasbumi.Saatini,pihak perusahaan sedang melakukan sosialisasi kepada masyarakat terhadap kehadiran proyek PLTB ini dan pertengahan Januari 2011 ini pihak perusahaan akan turun kedesa-desa di wilayah ketiga kecamatan guna mengetahui gambaran potensi dan pencarian titik sumber daya alam panas bumi tersebut”, ujarnya. “Kita berharap, rencana ini nanti didukung semua elemen masyarakat Madina, sebab kalau proyek ininantinyajadidiperkira-

kan akan mampu mengatasi defisit listrik di Madina. Bukan itu saja, bahkan Madina bisa menjadi surplus listrik. Sebab, menurut sosialisasi disampaikan PT.Sorik Marapi Geothermal Poower ke masyarakat, kandungan tenaga panas bumi yang ada di daerah Sorik Marapi-Roburan-Sampuraga akanmampumenerangi500ribu rumah dan perusahaan lainnya. Lisa G Januar selaku Office Manager Project Develompent dari PT Sorik Marapi Geothermal Power didampingi JhonWheble selaku Direktur Utama dan Jhon Scott selaku General Manajer Engineering mengatakan, kehadiran dan rencana pembukaan Proyek Pembangkit ListriTenaga Panas Bumi ini gunanya untuk mengatasi defisit listrik sekaligus pemanfaatkan sumber alam yang ada di Madina. (a24)

Pemko P. Sidimpuan Peringati Hari Ibu P. SIDIMPUAN (Waspada) : Untuk memeriahkan hari ibu ke82, unsur Ibu Muspida Pemerintah Kota Padangsidimpuan mengadakan acara peringatan di AlamanBolak,Sabtu(18/12)dihadiri antusias warga sekitar ratusan orang serta dari ibu-ibu pengajian akbar. Ketua PKK sekaligus penasehat dalam peringatan hari ibu Hj MelianiZulkarnainNasution,yang tidak lain ibuWalikota turut melepas gerak jalan santai yang dihadiri masyarakat dan ibu Muspida dengan rute mulai dari Alaman Bolak-Jalan Kapt Koima hingga

Waspada/Dede Basir

MENGINGATKAN MANUSIA: Mungkin sekadar untuk mengingatkan manusia tentang kematian, warga Desa Tangkuhen,Kabupaten Deliserdang membuat plang pada kayu menuju ke pemakaman umum dengan harapan warga yang mengantarkan keluarganya ke pemakaman ingat tentang 4 syarat masuk untuk surga di antara; tidak pernah korupsi, tidak memiliki Begu Ganjang/gendek.Tidak memiliki ilmu hitam berupa incuk, santau, sogo sogo. Tidak rangkap jabatan, menjadi dukun dan pengurus agama. Tulisan yang disampaikan membuat banyak wisatawan yang melintas tersenyum seperti yang terlihat dalam gambar yang terekam Sabtu (18/ 12) seorang wisatawan nusantara sempat turun dari mobil melihat sebuah kayu besar di jalan menuju pemakaman umum.

ke Jalan Thamrin dan kembali ke tempat semula di Alaman Bolak. Selainjalansantai,panitiajuga mengadakan lomba berjoget ria dengan balon diiringi lantunan musik kocak Batak Angkola, sehingga peserta yang lebih lama bertahan untuk balon yang diapit antara wajah peserta acara mendapat hadiah dari panitia berupa cendera mata dan alat-alat memasak. Lebih uniknya bagi peserta acara, lomba memasukkan belut dalam botol, selain belut licin, para peserta banyak yang takut terhadap jenis ikan yang penuh

gizi itu, sehingga peserta yang nekat dan berani, akan mendapatkan hadiah, berupa alat-alat dapur. ‘’Acara hari ibu ke-82 tahun ini tidak boleh kita lupakan, bila kita lupa akan hari ibu, itu namanya mendekati kedurhakaan terhadapibu,’,ujarwakilpenasehat hariibuyangsekaligusWakilKetua DPRD Kota Padangsidimpuan Taty Aryani. Walikota Padangsidimpuan Zulkarnain Nasution mengatakan,hariibuharusdihargaipenuh untuk salah satu ungkapan rasa hormatdansantunterhadapyang melahirkan anak-anaknya. (crm)

Musda Ke-2 PKS P. Sidimpuan P.SIDIMPUAN (Waspada): Musyawarah Daerah (Musda) ke-2 Partai PKS Kota PadangsidimpuandibukaSabtu(18/12).00 oleh Ketua panitia Musda, Banua Solih Siregar dan panitia lainnya, sekaligus dilanjutkan acara pelantikan sore harinya setelah ketua umum terpilih oleh peserta hasil Musda. Acara yang dihadiri Ketua Umum PKS Sumut H Muham-

mad Hafez diwakili Amsal Nasution besertaWalikota Padangsidimpuan Zulkarnain Nasution diwakili Asisten III Khairul Alamsyah, serta unsur anggota DPRD Kota Padangsidimpuan. Pengurus PKS Kota Padangsidimpuanpriodeahun2010-2015 dilantik oleh Amsal Nasution diantaranya Ketua Umum H Mukhtar Shabri Lc, sekretaris, Mar-

wan Saleh Lubis dan untuk bendahara dipegang Intan Vira Hariyati, Sabtu (18/12). Dengan mengucapkan sumpah, yang dibacakan bersama oleh pengurus baru dan bidang kepengurusan yang telah tersusun di SK (Surat Keputusan) dari DPW(DewanPimpinanWilayah) Nomor : 042/D/SKEP/DPW-ABPKS/1432.(crm)

Remigo Resmikan Aset Pemkab Pakpak Bharat MEDAN (Waspada): Remigo Yolando Berutu (Bupati Pakpak Bharat-red), Jumat (17/12) meresmikanasetmilikPemerintahan Kabupaten (Pemkab) Pakpak BharatdiJalanNgumbanSurbakti Simpang Selayang, Medan. Adapunasetdimaksudadalah bangunan mess Pemkab, mess dan asrama mahasiswa yang pembangunannya sekira dua tahun lalu telah rampung usai dikerjakan dengan memakan dana hingga miliaran rupiah. Hadir dalam pada acara tersebut, Ketua Ir Agustinus Manik dan beberapa anggota DPRD Pakpak Bharat, Wabup H Maju Ilyas Padang, Kapolres AKBP Suriadi Bahar, Asisten I dan II, parapimpinanSKPD,paraCamat dan Kepdes, Prof Menet Ginting dan Massal Munthe (tokoh ma-

syarakat di Provsu-red), Fahrudin Kudadiri tokoh pemuda (penasehat DPP HIMPAK-red), tokoh adat, agama, masyarakat, pemuda dan pengurus DPP HIMPAK (Himpunan Masyarakat Pakpak), mahasiswa/i pakpak serta para undangan lainnya. Ketua DPP HIMPAK Efendi Citra Capah dalam sambutannya menyebutkan, setelah dia berkeliling-keliling dan mengamati bangunan mess Pemkab kabupaten lainnya yang ada di seputaran Kota Medan, menurutnya bangunan ini merupakan bangunan yang paling megah dibandingkan dengan bangunan mess milik Pemkab lainnya. “Untuk itu, mari kita dukung dan doakan semoga Kabupaten PakpakBharatmenjadikabupaten yang semakin sukses ke depan

di bawah pimpinan Remigo Yolando Berutu danWabup Maju Ilyas Padang serta pimpinan DPRD juga unsur muspida,” katanya. Agustinus Manik selaku Ketua DPRD Pakpak Bharat dalam sambutannya terkait bangunan itu menyarankan agar bangunandimaksud dipeliharadan dirawat dengan baik karena ini merupakan aset yang berharga bagi kebutuhan masyarakat PakpakBharatkhususnyamahasiswa Pakpak Bharat yang sedang menempuh pendidikan di Kota Medan. BupatiPakpakBharatRemigo Yolando Berutu menjelaskan, dari sekian banyak mess Pemerintah Daerah di Sumatera Utara ini dari 32 kabupaten/kota, bangunan ini merupakan salah satu yang termegah. (c08)

Waspada/Arlius Tumangger

RESMIKAN : Bupati Pakpak Bharat Remigo Yolando didampingi Wabup H Maju Ilyas Padang dan Ketua DPRD Ir Agustinus Manik (tengah berlipat tangan), Kapolres AKBP Suriadi Bahar (samping kanan Ketua DPRD) danWakil Ketua DPRD Edison Manik (kanan) menggunting pita tanda diresmikannya bangunan mess Pemkab, mess dan asrama mahasiswa Pemkab Pakpak Bharat di Jalan Ngumban Surbakti, Simpang Selayang, Medan, Jumat (17/12).

Water Park Akan Dibangun Di Pematangsiantar Walikota: Bisa Menerima Investor, P.Siantar Akan Maju P. SIANTAR (Waspada): Walikota Pematangsiantar Hulman Sitorus menegaskan, bila bisa menerima investor menanamkan investasinya dengan aman, maka Kota Pematangsiantar akan maju. “Kebersamaan itu, kita akan pelihara,” tegas WalikotasaatpeletakanbatupertamapembangunanWater Park dan peluncuran Siantarmas Residence di Jalan Rakutta Sembiring, Kelurahan Nagapita, Kecamatan Siantar Martoba, Pematangsiantar, Sabtu (18/12). Peletakan batu pertama dan peluncuran itu dihadiriWakilWalikota KoniIsmailSiregar,Kasdim 0207/Simalungun Mayor Inf Iqbal Zulkarnain, Waka Polres Kompol Donald P Simanjuntak, pimpinan perusahaan water park dan Siantarmas residence Hameng Prayitno dan Sulastri, Ketua Panitia Daulat Sinaga, Notaris Nelsi Sinaga, anggota DPRD, para pejabat Pemko, pimpinan perusahaan negara dan swasta, tokoh masyarakat dan tokoh agama serta lainnya. Menurut walikota, bila melihat Pematang-

siantar dengan keberadaan APBD, sulit membangun, karena sudah dihabiskan untuk belanja pegawai hingga terpaksa dibuat skala prioritas agar pembangunan dapat tetap berjalan. Kehadiran dari para investor, lanjutWalikota, kalau dilihat sekarang sudah banyak pekerja yang bisa memakai batik dan mungkin mereka sebelumnya belum mempunyai pekerjaan dan sekarang sudah bekerja. Menurut walikota, kegagalan ruislagh (tukar guling) lahan dan bangunan SMA Negeri 4 di Jalan Pattimura yang dilakukan mantanWalikota RE. Siahaan, padahal sudah disetujui DPRD, menjadi preseden buruk buku investor. Pimpinan Water Park dan Siantarmas Residence Hameng Prayitno menyebutkan, tempat rekreasi yang dibangun di komplek Siantarmas Residence seperti kolam renang, tempat permainan anak-anak, luncuran dan lainnya merupakan wujud dari kepedulian mereka terhadap pembangunan Pematangsiantar. (a14)

Menyambut Natal-Tahun Baru, Hotel Di Berastagi Suguhkan Atraksi BERASTAGI (Waspada): Meskipun jumlah wistawan nusantara yang akan berlibur di daerah pegunungan Berastagi diperkirakan akan mengalami penurunan menyusul kondisi jalan raya yang menghubungkan Medan – ke Berastagi mengalami kerusakan , namun masyarakat dan sejumlah hotel berbintang di pusat pariwisata Berastagi tetap optimis melaksanakan acara khusus menyambut Natal danTahun Baru 2011. Mikie Holiday Resort Berastagi misalnya akan kembali memeriahkan suasana Natal 2010 di Berasstagi dengansajianberbagaiacara termasuk membuat dekorasi pohon Natal setinggi 10,5 Meter yang ditempatkan di halaman hotel, Jumat (17/12). Hal ini dikatakan Sales Manager Deliasa Zalukhu serta Manager Fun Land Ismail Tanjung kepada Waspada, Sabtu (18/12). Dikatakannya, pada 24-25 Desember 2010 para tamu yang berlibur di daerah pegunungan dapat menikmati sajian khusus makan malam di Azalea Restaurant dengan thema “Magical Christmas Dining Extravaganza”, Disebutkan,dilokasiinidipersiapkanberbagai santapan menarik mulai dari menu lokal, Asian dan jugaWestern, dan juga ada atraksi chef yang akan masak langsung di depan para tamu. Dibanding dengan tahun sebelumnya, ditanggal 25 – 26 Des 2010, dari pukul 17:00 – 18:00, para wisatawan disuguhkan Magical

Momentdimanasetiaptamuambilbagianseperti Lets GetWet bermain denganair dikolamrenang, selanjutnya pukul18:00 – 19:00 dilanjutkan dengan pertukaran hadiah natal yang dipandu Lolita. Sambil menikmati makan malam Choir Group Mikie Holiday menyuguhkan lagu-lagu X-Mas, selesai makan malam pukul 20:00 – 22:00 dilanjutkan acara “Welcome to Children Land”, dimanaSantamembagikanhadiahNatalistimewa. Sedangkan pada 31 Desember 2010 dan 1 Januari 2011, pukul 19:00 – 22:00, Azalea Restaurant kembali menghidangkan makan malam bersama dengan thema “New Year’s Eve Buffet Dinners”, menyajikan variasi menu menarik dengan atraksi para chef yang berpengalaman international langsung di depan wisatawan yang tengah belibur menyamnbut tahun baru, dan dilanjutkan dengan event spektakuler kembang api dengan simponi musik yang mengiri di kegemerlapan malam di tanggal 31 Desember 2010. Staf Manager Hotel Sinabung Berastagi Elly Meliala mengatakan, dalam menyemarakan suasana Natal dan Tahun Baru 2010, wisatawan yangberkunjung akandisuguhi santapanmakan dengan menu daging/ikan baker dan di malam Tahun Baru pengunjung bisa menyaksikan hiburan berupa Band yang telah disiapkan pihak hotel. (cdb/cmm/a17)

Silaturrahmi Masyarakat Labuhandeli Dan Kapolres KP3 Belawan LABUHANDELI (Waspada): Kapolres KP3 Belawan AKBP Hendro Kiswanto, SIK bersilaturrahmi dengan masyarakat Kec. Labuhandeli, Kab. Deliserdang, Jumat (17/12) malam bertempatdikediamantokohmasyarakat/anggotaDPRD DS Hasaidin Daulay, Desa Helvetia. Selain itu, dalam acara yang diprakarsai masyarakat tersebut, hadir Camat Labuhandeli Dedy Maswardi, Kades Helvetia Zakaria, Kades ManunggalMisgiat,WakapolsekMedanLabuhan, Kanit Reskrim serta tokoh masyarakatlainnya maupun segenap KepalaDusun. Camat Dedy Maswardi dalam sambutannya, antara lain mengemukakan, kemitraan antara masyarakatdankepolisianperluselaludikedepankan. Apalagi mengingat rentang kendali wilayah hukumPolsekMedanLabuhanyangmembawahi empat kecamatan, yang salah satunya adalah Labuhandeli. ‘’Salah satu cara yang efektif adalah dengan memfungsikankembaliperanDasaWisma.Peran masyarakatmelaluidasawismaadalahmerupakan upaya represif dalam memberikan masukan kepada polisi terhadap kecurigaan-kecurigaan pada kejahatan, terorisme selain juga berfungsi memberi informasi yang paling akurat dan terdepan apabila terjadi tindak kriminalitas di sekitar komunitas dasa wisma,’’papar Dedi. Sedangkan tokoh masyarakat Hasaidin

Daulay dalam kesempatan itu, mengemukakan, acara silaturrahmi ini akan dilakukan secara rutin. Di sisi lain, Hasaidin selaku anggota DPRD Deliserdang ini berjanji untuk memperjuangkan pembangunan Kantor Polsek Medan Labuhan di Kecamatan Labuhandeli, melalui APBD Provinsi Sumut maupun APBD Deliserdang. Sementara, Kapolres KP3 Belawan dalam arahannya menyampaikan rasa terimakasih pada masyarakat yang sudah menyelenggarakan acara silaturrahmi ini. AKBP Hendro juga berpesan, agar masyarakat serta pemerintah Kecamatan Labuhandeli maupun Pemkab Deliserdang selalu dapat membantu kerja kepolisian, terutama memanfaatkan Polisi Desa yang telah ditugaskan sesuai program Kapoldasu. Hendro juga menegaskan akan berada di belakang pemerintahan desa dan kecamatan dalam upaya menertibkan kios-kios dan kafekafe yang dirasakan sangat meresahkan. Pada akhir sambutan serta arahannya, Kapolres memberikan no telepon genggamnya kepada seluruh warga yang hadir dalam acara itu, sekaligus berpesan agar dapat melaporkan apasajayangmemerlukanbantuanpolisi,melalui sms.(m34)

Sumatera Utara

C4 Warga Baganbaru Batubara Minta Perbaiki Jalan Rusak BAGANBARU-BATUBARA (Waspada) : Warga Baganbaru, Kec.Tanjungtiram, Batubara mengeluhkan jalan desa sepanjang 7.000 meter rusak berat berlubang berlumpur sulit dilintasi kendaraan roda empat Paling dirugikan warga petani hasil pertanian sawit, kelapa gandeng terpaksa diangkut menggunakan jasa angkutan sungai (boat) dan penggalas sepeda motor. Jalan yang rusak antara Simpang Posko - Pasar Senin 3.000 meter, Pasar Senin –balai desa Baganbaru sepanjang 4.000 meter. Sairan, warga Baganbaru, Sabtu (17/12) mengatakan, keadaan jalan rusak sudah puluhan tahun menderita sulit memasarkan hasil pertanian mereka ke Pasar Tanjungtiram. Menurut warga, harga sawit,kelapa gandeng jadi murah dibanding desa tetangga yang jalan desa lebih baik. Pemerintahan desa sudah mengajukan proposal kepada Bupati/DPRD Batubara mohon jalan sepanjang 7 kilometer yang rusak diperbaiki ternyata belum berhasil. Kades Baganbaru Ponirin, Minggu (19/12) mengaku prihatin kondisi jalan desa sudah puluhan tahun belum mendapat perbaikan layak. Bahkan sudah diajukan proposal ke Pemkab Batubara, tetapi belum berhasil. (a30)

Tersangka Judi Togel Ditangkap SIMPANGEMPAT (Waspada) : Kepolisian Sektor Simpangkawat menangkap tersangka judi togel di Kec. Telukdalam, Kab. Asahan, Minggu (19/12). Tersangka Sub, 42, warga Dusun IV Desa Anjungganjang, Kec. Telukdalam ditangkap bersama barang bukti 1 unit ponsel, uang tunai dan kalkulator. Informasi dihimpun, penangkapan berawal dari laporan warga yang mengaku resah dengan aktivitas tersangka. Menindaklanjuti laporan itu, Kapolsek Simpangkawat AKP Rudy Chandra bersama anggota menyisir dan mengintai keberadaan tersangka. Hasil penyelidikan, ternyata informasi warga itu benar sehinggaPolisilangsungmenangkaptersangkatanpaperlawanan. “Polri komitmen dan tidak pandang bulu memberantas segala perjudian, termasuk judi toto gelap,” tegas Kapolres Asahan melalui Kapolsek Simpangkawat. Ditambahkan Kapolsek, untuk memberantas judi di wilayah hukumnya, dia siap mempertaruhkan jabatan dan harga dirinya. Sementara, tokoh agama H Yoes mengakui keseriusan Kapolsek Simpangkawat memberantas judi. KataYoes, wilayah mereka jadi aman dan kondusif sebab segala bentuk kriminalitas diberantas habis, khususnya judi. (a37)

Binsar Panggabean Serahkan Bantuan Natal Ke Panti Jompo TARUTUNG (Waspada) : Dalam rangka menyambut Natal, 25-26 Desember 2010 dan Tahun Baru 1 Januari 2011, Direktur UD SuryaTimur Perkasa (STP) CabangTaput Binsar Panggabean menyantuni sejumlah warga Binaan Sosial (WBS) lanjut usia/ Jompo di UPTD Uli/Hasonangan Dinas Sosial Siborongborong, Taput, Sabtu (18/12) di aula UPTD setempat. Binsar Panggabean yang bergerak dalam usaha perkayuan/ Sawmil itu dalam santunanya memberikan bantuan berupa 17 selimut, 17 helai sarung, 17 Kg gula putih dan uang Rp50.000 per orang. Penyerahan bantuan sosial tersebut disaksikan Manajer Umum UD STP Leo Panggabean, manajer lapangan Edy, Subbag TU UPTD Uli Siborongborong Tohap Lumbantoruan. Binsar Panggabean dalam acara pemberian bantuan tersebut menyampaikan kehadiranya untuk menyantuni orangtua didorong dengan rasa kasih sayang dan solidaritas terhadap sesama khususnya kepada jompo, selaku mahluk ciptaanTuhan. Subbga TU UPTD Siborongborong Taput Tohap Lumbantoruan menyampaikan rasa haru dan terima kasih kepada pimpinan STP. (c12)

Fogging DBD Di Komplek PGP Kampung Baru Tak Merata RANTAUPRAPAT (Waspada): Demam Berdarah (DBD) di lingkungan Komplek Perumahan Guru dan Pegawai (PGP) Kampung Baru, Kelurahan Sioldengan, Kec. Rantau Selatan, sekitar bulan September 2010, satu orang korban dewasa meninggal dunia dan dua orang anak yang masih dirawat di RSUD akibat DBD. Fogging/penyemprotan DBD yang dilakukan Dinas Kesehatan Kabupaten Labuhanbatu bersama Puskesmas Perdamean Sigambal Rantau Selatan di lingkungan komplek PGP, Jumat (17/12) tidak menyeluruh. Penyemprotan hanya dilakukan di sekitar rumah dua orang anak yang terkena DBD yang masih dirawat di RSUD Rantauprapat. Sedangkan di sekitar rumah korban yang meninggal dunia sekitar September 2010 tidak dilakukan fogging/penyemprotan DBD. Warga setempat sangat kecewa atas kinerja Dinas Kesehatan Labuhanbatu beserta Puskesmas Perdamean Sigambal Rantau Selatan dalam fogging/pemnyemprotan DBD. (c01)

Terkait rencana besar ini, masing-masingelemenmasyarakat sudah membuka suara untuk mengungkapkan pendapatnya. Ada yang setuju dimekarkan menjadi dua kabupaten. Bahkan ada juga yang menyatakan, dimekarkan menjadi empat kabupaten. Sebenarnya, gaung pemekaranSimalungunsudahadasejak lama. Namun, karena berbagai kepentingan gaungnya lenyap ditelan masa. Seiring dengan era reformasi 1999, teriakan pemekaran muncul lagi. Tetapi lagi-lagi dipenghujung 2004, wacana pemekaran itu ‘kandas’. Meskipun ketika itu, dewan sudah setuju pemekaran Simalungun menjadi dua daerah otonom, namun rekomendasi pemekaran tak kunjung keluar.

Kemudian, 2007 gaung pemekaran kembali berkobar saat kepemimpinan HT Zulkarnain Damanik. Karena didesak terus, akhirnya eksekutif dan legislatif sepakat merekomendasikan pemekaran Simalungun menjadi dua daerah otonom, yakni Kab. Simalungun sebagai induk beribukotadiPamatangRayadan Kab.SimalungunHatarandengan ibukotanya di Perdagangan. Setelah rekomendasi ditandatangani, lalu dilayangkan ke Pemprovsu dan selanjutnya dilayangkan ke DPR-RI dan Mendagri.Tetapi sangat disayangkan, rekomendasi pemekaran yang telah ditunggu bertahun-tahun itu akhirnya juga kandas karena terbitnya Peraturan Pemerintah (PP) 78 tahun 2007. Sedangkan rekomendasi yang disampaikan mengacu kepadaPPNomor129tahun2000 danselanjutnyadinyatakansudah tidak berlaku lagi. Lagi-lagi masalah rekomendasi. Pasca Pemilukada Simalungundanpelantikan bupati terpilih periode 2010-2015, JR Saragih, wacana pemekaran Simalungun kembali mencuat. JR Saragih yang berpasangan

Senin 20 Desember 2010

Sopir Ngantuk

Truk Tronton Masuk Sei Batanggadis PANYABUNGAN (Waspada): Kecelakaan tunggal kembali terjadi di ruas jalan lintas Sumatera (Jalinsum) MedanPadang.

Sebuah truk tronton dengan nomor polisi BA 9522 yang bermuatan roti terjun ke sungai (aek) Batanggadis di Desa Singengu, Kecamatan Kotanopan, Kabupaten Mandailing Natal, Sabtu (18/12) sekira pukul 21:00 dengan kedalaman sekitar 10 meter dari badan jalan. Informasi dihimpun di TKP

(Tempat Kejadian Perkara) Minggu(20/12),kecelakaanmobil tronton bak tertutup itu tepatnya berada di kawasan kilometer 3738 Panyabungan-Kotanopan. Truk yang terjun ke sungai melaju dari arah Padang-Medan,yang dikemudikan Manahara Hutahaen, 32, penduduk Jalan F Pasaribu No 39/ 66 Kelurahan Suka Maju Pematangsiantar. Beberapa warga mengungkapkan, kejadian itu disebabkan sopir truk yang diduga mengantuk.Iatidakdapatmengendalikan laju truk sebelum oleng ke arah kanan dan terjun ke dasar sungai. “Laju truk sebenarnya tidak terlalu kencang. Namun, sopir

kuat dugaan mengantuk, dan badan truk sendiri tiba-tiba oleng ke kanan, naik ke trotoar dan nyaris menghantam tiang listrik, dan terjun ke sungai,” kata Lokot, 34, penduduk setempat. Meski demikian,tidakadakorbandalam kecelakaan ini. Beberapa saat kemudian, petugas dari Pos Satlantas Polsek Kotanopan datang ke lokasi. Kasat Lantas Polres Madina melalui Kepala Pos Satuan Lalu Lintas Polsek Kotanopan Bripka Jafar Lubis mengatakan,dugaan sementara pengemudi mengantuk hingga mobil oleng hingga akhirnya terjun bebas ke dasar sungai. (a24)

Waspada/Sarmin Harahap

TINJAU: Pj Bupati, Kapolres, Kajari, Kadis Pendidikan Madina dan Camat Batang Natal, saat foto bersama peserta putra pramuka Saka Bahayangkara Sejajaran Polres Madina, Sabtu (18/12) di SMA Negeri I Kec. Batang Natal.

Pramuka Saka Bhayangkara Wujudkan Generasi Muda Mandiri

Waspada/Munir Lubis

BELUM DIEVAKUASI: Truk tronton BA 9522 kelihatan masih dibiarkan berada di dasar sungai belum ada tanda-tanda untuk dievakuasi. Foto direkam Minggu (19/12).

Pemkab Sergai Serahkan Bantuan SKPG TANJUNGBERINGIN,Sergai (Waspada): Pemerintah Kabupaten Serdang Bedagai melalui Badan Ketahanan Pangan menyerahkan bantuan Sistem Kewaspadaan Pangan dan Gizi (SKPG) kepada 370 Kepala Keluarga rawan pangan di Desa Bagan Kuala, Kec. Tanjung Beringin, Sergai, Jumat (17/12). Paket bantuan berupa beras diserahkan secara simbolis kepadawargaolehKepalaBadanKetahanan Pangan Sergai (Kaban Ketapang) Ny. Ir. Hj. Rosmeli Nasution di aula kantor Kepala Desa Bagan,Tanjung Beringin disaksikan Kabid Distribusi dan Kewaspadaan Pangan Badan Ketapang Hamdan SP, MM, Kasie Kessos Kantor Camat Tanjung Beringin Idham, Sekdes Bagan Kuala

AbdulganidanZulhamHasibuan selaku tokoh masyarakat. Kaban Ketapang Ir. Hj. Rosmeli Nasution pada kesempatan penyerahan bantua itu menyatakan pemberian bantuan tersebut merupakan wujud nyata kepedulian Pemkab Sergai atas terjadinya fenomena alam yang tidak menentudiTanjungBeringindan sekitarnya akhir-akhir ini. Menurut Rosmeli, dampak fenomena alam yang terjadi ini menyebabkan masyarakat Tanjung Beringin terutama di Desa Bagan Kualayangmayoritasnelayan mengalami kesulitan bahan pangan. Untuk itu Pemkab Sergai memberikan kebijakan dengan mengalokasikan dana tanggap darurat untuk dipergunakan membantu meringankan beban

masyarakat selama masa paceklik. Pada kesempatan itu Kaban Ketapang Ir. Hj. Rosmeli Nasution juga mengimbau masyarakat Desa Bagan Kuala untuk tetap berusaha mandiri dalam segala keterbatasan, salah satunya denganmembuattabungankelompok. Upaya ini dimaksudkan agar masyarakat tidak hanya mengandalkan bantuan dari pemerintah dalam mengantisipasi kesulitan bahan pangan selama masa paceklik. Kepada masyarakat juga diharapkannya untuk mampu menjaga dan mengembangkan setiap bantuan yang telah diberikan oleh Pemkab Sergai agar lebih bermanfaat.(a07)

Petugas Kebersihan RSUD P. Sidimpuan Keluhkan Minimnya Upah P. SIDIMPUAN (Waspada): Puluhanpetugaskebersihanyang dikontrak pihak RSUD Kota Padangsidimpuan tahun 2010, mengeluhkan minimnya upah yang mereka terima, setiap orang per bulannya hanya Rp500 ribu, sehingga upah yang masih paspasanmasihdibutuhkanpenambahan,akibatmeningkatnyaharga bahan pokok. Hal itu disampaikan beberapa petugas kebersihan (cleaning service) kepada Waspada beberapa hari yang lalu, para pekerja sangat mengeluhkan gaji yang sangat minim dan terjadi pemotongan terhadap mereka, yang mereka ketahui per orangnya setiap bulan Rp600 ribu, namun kenyataannya yang sampai ditangan mereka hanya Rp500

ribu perorang setiap bulannya. ‘’Kamiheranmengapaterjadi pemotongan gaji dan minimnya upah, apakah pihak RSUD rela memakan kucuran keringat kami pekerja kasar ini, harapan kami Walikota Padangsidimpuan mengkajikinerjadirekturrumahsakit umum ini,” ujar pekerja dengan memegang sapunya. Di tempat terpisah Direktur Rumah Sakit Umum Daerah (RSUD), Dr Aminuddin kepada Waspada mengatakan, terkait minimnya upah untuk pekerja cleaning service diakibatkan kondisi rumah sakit yang masih minim pendapatannya. ‘’Kita akui memang upah pekerja cleaning service di RSUD per orangnya setiap bulan Rp 600 ribu, bila mereka terima Rp 500

ribu setiap bulannnya, berarti ada oknum yang sengaja memotong upah mereka, itu akan kita periksa,’’ ujar Aminuddin didampingi istrinya usai acara Hari Ibu di Alaman Bolak. Ketika ditanyakan Waspada minimnya upah di RSUD tidak sesuai UMK (Upah Minimim Kota) yang diberlakukan Pemko Padangsidimpuan terhadap para pekerja kebersihan yang berjumlah puluhan orang? ‘’Kita bukan tidak tahu masalah UMK, namun pendapatan RSUDmasihminim,belumsanggup memberikan upah sesuai perdatersebut,namunbilasudah maju pesat pengobatan di RSUD, itu pastinya dapat dilaksanakan,” ungkap Direktur RSUD itu, Sabtu (18/12) siang.(crm)

Pemekaran Simalungun, Lain Di Bibir Lain Di Hati RENCANA pemekaran Kabupaten Simalungun menjadi dua kabupaten masih terus menjadi bahan perbincangan menarik, baik kalangan tokoh masyarakat, eksekutif maupun legislatif.


dengan Hj. Nuriaty Damanik dalam kampanye Pemilukada berjanji akan merealisasikan pemekaran Simalungun menjadi dua kabupaten. Rekomendasi baru kembali dikeluarkan pihak legislatif dan selanjutnya diserahkan kepada pihak eksekutif (Bupati Simalungun). Bahkan untuk urusan ini, sejumlah anggota DPRD Simalungun didampingi beberapa staf Pemkab Simalungun telah berkunjungkeDPR-RIdanDepdagri, namun hasil yang diperoleh, Simalungun tidak memenuhi persyaratan administrasi, sehingga tidak termasuk dalam salah satu daerah yang akan dibahas. Sementara, Ketua DPRD Simalungun,BintonTindaon,SPd, menegaskan,pemekaranSimalungun tidak ada masalah. Bahkan, politisi dari Partai Golkar itu menyatakan, legislatif siap memback up terealisasinya pemekaran Simalungun. Menurut Binton, pemekaran merupakan salah satu upaya untuk mempercepat pembangunan daerah serta peningkatan kesejahteraan masyarakat, sehingga memang harus didukung. “Seluruh berkas persyaratan

yang dibutuhkan sudah dilengkapi, namun jika masih ada yang kurang, dewan siap melengkapinya sesuai dengan kewenangan yang ada,” tegas Binton, seraya menyatakan rekomendasi pemekaran telah diserahkan kepada Pemkab Simalungun. Hanyasaja,diatidakmengetahui secara pasti, apakah Pemkab Simalungun telah melayangkan rekomendasi itu ke Pemprovsu, DPR-RI dan Mendagri. “Kita tidak tau,” ucapnya. Menyimakmaterikampanye pasangan JR Saragih dan Hj. NuriatyDamaniksaatmasihmenjadi calon Bupati/calonWakil Bupati Simalungunbeberapawaktulalu, khususnyamenyangkutpemekaran Simalungun, terkesan hanya sebuah ‘sandiwara’. Dalamucapan,JRSaragihdan Nuriaty Damanik sepertinya benar-benar ingin menyahuti aspirasi masyarakat untuk pemekaran Simalungun menjadi dua daerah otonom. JR saat kampanye dengan suaralantangdihadapananggota dewan terhormat mengatakan akan merealisasikan pemekaran demi percepatan pembangunan dan peningkatan perekonomian

masyarakat. Diajugamengatakan,dengan direalisasikannya pemekaran maka masyarakat Kec. Ujung Padang, Bosar Maligas dan wilayah Simalungun bagian bawah (Hataran)tidakperlulagicapek-capek datang ke Raya hanya untuk menandatangani satu surat. Tetapi, pernyataan ketika masih calon bupati dengan pernyataan setelah resmi menjadi bupati terpilih sangat bertolak belakang, kenyataannya lain di bibir, lain pula di hati. JR, ternyata tidak pro pemekaran.MalahJRmengatakanbaru bersedia memekarkan Simalungun apabila ibukota Kab. Simalungun, Pamatang Raya, sudah mapan, artinya sudah menjadi kota yang sesungguhnya. Di samping itu, sejumlah kecamatan khususnya yang berada di daerah pemilihan (Dapem) IV danV sudah meningkat pembangunannya. Kalaulah indikatornya Ibukota Pamatang Raya sudah mapan baru ada pemekaran, maka pengertiannya10tahunlagiSimalungun belum tentu dimekarkan. Hasuna Damanik

PANYABUNGAN, Batang Natal (Waspada): Perkemahan Pramuka Saka Bahayangkara sejajaran Polres Madina merupakan kegiatan menciptakan generasi muda mandiri dan bertanggung jawab. Itu dikatakan Kamabisaka yang juga Kapolres Madina AKB Hirbak Wahyu Setiawan, SIK, saat pembukaan perkemahan Saka Bahayangkara, Sabtu (18/12) di halaman SMA Negeri 1 Batang Natal. Harapannya, adik-adik pramuka mampu menerapkan ilmu yang didapat di tengah-tengah masyarakatdankeluarga.Dengandemikian,kader pramuka telah berhasil mewujudkan visi dan misi pramuka (Praja Muda Karana) bagian pioner pembangunan. Sementara Pj Bupati Madina, Ir Aspan Batubara, MM saat peninjauan mengharapkan, perkemahan pramuka tidak hanya sebatas seremonial. Tapi mampu melahirkan pemikir-pemikir dan berpartisipasi dalam mewujudkan kemajuan dan kemakmuran bangsa. Ia berharap, kegiatan pramuka dapat membentengi generasi muda dari berbagai kenakalan remaja, yang sekarang sangat mengancam perkembangan masa depan anak bangsa akibat

kemajuantekhnologi,dankurangnyapendalaman agama. Kadis Pendidikan Madina, Musaddad Daulay mengatakan, kegiatan pramuka salah satu agenda pendidikan untuk meningkatkan sumber daya manusia (SDM) supaya tidak bodoh. “Kalau sudah tidak bodoh, berarti kemiskinan dan kelaparan bisa diatasi,” ucapnya. Data dihimpun dari Ketua Panitia Perkemahan, Kapolsek Batang Natal AKP Syahril Daulay, perkemahan berlangsung dari 17-19 Desember 2010.Pesertaperkemahandiikuti10oranganggota pramuka/Polsek. Jumlah Polsek di Madina berjumlah10unit.Dengandemikianpesertasebanyak 100an orang ditambah pengurus. Kegiatan yang didakan, antara lain, senam tongkat bersama, tekram/PBB. Pengetahuan tentang krida Narkoba, Lantas, PBB,TPTKP, Kerohanian, Kamtibmas, sejarah singkat pramnka. Kemudian sandi, semaphore, tali temali, tari tradisional, daur ulang, haling rintang, dan sayonara. Saat peninjauan, Muspida Madina menyempatkan diri melihat tenda perkemahan peserta, dan dokumentasi Lakalantas dan jenis narkoba. Kemudian menyaksikan uji coba pengetahuan perserta di bidang lalu lintas.(csh)

Pemkab Madina Tidak Ikut Sosialisasi Elpiji PANYABUNGAN (Waspada): Pemkab Madina c/q Bagian Perekonomian Madina tidak diikutkan pihak ketiga dalam sosialisasi penggunaantabunggaselpijidiMadina.Itudejelaskannya pada Waspada, Kamis (16/12) di ruang kerjanya. Katanya, pihaknya hanya menerima laporan ataupun surat tembusan dari PT Kencana Madia Uli Nusantara dan PT Sehat Pratama Sejati selaku pihak ketiga penyalur, yang memilih merekrut putra daerah langsung. Ia mengaku heran kenapa Bagian Perekonomian tidakdilibatkan. Padahal, jika nanti terjadi yangtidakdiinginkan,tetapsajapemerintahdaerah turun tangan dan dituntut masyarakat. Data dihimpun, pihak ketiga telah melakukan pendataan di 14 dari 23 kecamatan di Madina, antara lain Kecamatan Panyabungan, Panyabu-

ngan Barat, Panyabungan Utara, Panyabungan Selatan. Kecamatan Bukit Malintang, Siabu, Tambangan, Puncak Sorik Marapai, Batang Natal, Lingga Bayu, Natal, Tambangan, Muara Sipongi, dan Pakantan. Khusus Kecamatan Panyabungan, ada 3 desa tidak diadakan sosialisasi, yakni, Desa Silogun, Siobon Jae, dan Aek Mata. Sedangkan yang tidak didata dan tanpa sosialiasi di Desa Aek Mata. Sejumlah desa dimaksud walaupun berada di Kecamatan Panyabungan Kota, namun kesannya seperti semi terisolir akibat pembangunan minim. Salah satu pimpinan perwakilan pihak ketiga, Abdul Rohmad dari PT Sehat Pratama Sejati saat di hubungi via selular tidak menjawab. Sementara kantor perwakilan perusahaan itu di Madina tidak di ketahui.(csh)

H Irwan Assehat Ketua DPD PKS Di Paluta GUNUNGTUA (Waspada): H Irwan Assehat Siregar, Lc, SPdi terpilih sebagai Ketua Dewan Pengurus Daerah (DPD) Partai Keadilan Sejahtera (PKS) Kab. Padanglawas Utara periode 20102015dalamMusyawarahDaerah(Musda)perdana DPD PKS Paluta yang berlangsung di Aula serba guna YPIPL Gunung Tua, Sabtu (18/12). Ketua Umum DPD PKS Paluta, H Irwan Assehat Siregar, Lc, SPdi dalam pidato politiknya, mengakusiapmelanjutkanestafetkepemimpinan dan misi dakwah PKS di Kab. Padanglawas Utara. “Insya Allah kami akan seoptimal mungkin menjalankan sekaligus melaksanakan narasinarasibesaruntukbersama-samamembangunan Palutayanglebihberkeadilandanberkesejahteraan serta menjadikan PKS sebagai partai dakwah

yangkokohdantransparatifsepenuhnyamelayani kepentingan masyarakat,” ucapnya. Adapun susunan pengurus DPD PKS Kabupaten Padang Lawas Utara periode 2010-2015 antara lain, Ketua Umum H Irwan Assehat Siregar, Lc. SPdi, Sekretaris Umum Riswan Saleh Siregar, SSi. MSi, Bendahara Umum Nurhasanah Harahap, SPd, Kabid Kaderisasi Palit Rambe, SAg, Kabid Cabang Dakwah Abdul Gani Harahap SSi. Selanjutnya, Kabid Bidang Pembangunan Ummat Mulkan Edi Harahap, Kabid Perempuan Samaria Harahap, SAg, Kabid Kepanduan dan Olahraga, Erwin Harahap dan Kabid Kebijakan Publik, Pengembangan Ekonomi dan Kewirausahaan Mudavair Ritonga, SE.(csp)

Sabirin LC Ketua DPD PKS Madina PANYABUNGAN (Waspada):Musda Ke 2 DPD PKS Madina yang digelar , Minggu (19/12) di Hotel International Payalothing, hantarkan H Sabirin LC sebagai ketua periode 2010-2015 mendatang. Acara Musda dirangkai sekaligus pembaaitan (pengangkatan sumpah) ketua terpilih dan pelantikan pengurus baru, yang susunannya telah ditetapkan secara internal partai bulan Oktober 2010 lalu. Ketua panitia pelaksana, Syarifada SHi menjelaskan , Musda disambut dengan sejumlah kegiatan jenis kompetisi antar sekolah semua tingkatan mulai TK hingga SLTA, sebagai bentuk motivasi bagi siswa untuk lebih giat mengembangkan bakat yang dimiliki. Musda DPD PKS Madina dibuka langsung Pj Bupati Madina, Ir H Aspan Sofian Batubara, MM dan dihadiri Muspida plus, yakni, Kapolres Madina, AKBP HirbakWahyu Setiawan dan ormas Islam. Ormas Islam hadir antara lain, Ketua PC NU Madina Drs H Zainal Arifin MM, Ketua MUI Madina H Mahmudin Pasaribu, Ketua DPC PKB Madina, Khoiruddin Faslah Siregar, serta ratusan kader PKS Madina dan undangan lainnya. Hadir juga DPW PKS Provinsi Sumatera Utara, Ketua Dewan Syariah, yakni, Yusuf Fahmi Batubara LC, dan Ketua Bidang Dakwah, Amsar Nasution B.Eng. Pj Bupati Madina dalam sambutannya menyampaikan, masih banyak persoalan yang harusdiselesaikanpemerintahsecepatnya.Semua

masalah tersebut menurutnya tidak akan selesai tanap dukungan semua pihak, terutama partai politik dalam mewujudkan program pembangunan untuk kesejahteraan masyarakat. Katanya, meskipun kaya SDA, namun masyarakat belum juga sejahtera. Untuk itu, ia berharap semua masyarakat, khususnya kader PKS saling mendukung etiap program pembangunan. Harapnya, DPD PKS Madina semakin maju dan sukses ke arah lebih bagus dan militansi yang dimiliki kader-kader PKS selama ini telah memberikan kontribusi yang cukup besar bagi perkembangan kabupaten Madina. Ketua DPD PKS Madina demisioner, H Maratua Nasution, LC. MA mengatakan, selama kepengurusannya, PKS Madina terus berupaya untuk melakukan kaderisasi atau rekrutmen anggota baru sehingga kepengurusan PKS Madina telah sampai ke seluruh kecamatan di Madina. Selaku ketua domisioner dihadapan seluruh kader ia menyampaikan maaf atas kekurangan dan kelemahan selama menjabat ketua. Baginya, jabatan itu bukan berarti supaya bisa bekerja, tetapi sebaliknya, apapun posisi seorang kader itudikepengurusanPKSakantetapberkaryauntuk partai dan untuk bangsa terutama daerah. Ketua umum terpilih, H Sabirin dalam sambutannya mengatakan akan berbuat yang terbaik untuk masyarakat lewat partai. Karenanya, kepengurusan partai yang baru sangat berharap dukungandariseluruhkaderpartaidiMadina,utamanya dukungan seluruh elemen masyarakat dan pemerintah daerah bersama Muspida. (csh)

Sumatera Utara

WASPADA Senin 20 Desember 2010

Pemko P. Siantar Terima Anugrah Raskin Award 2010

Pemkab Sergai Gelar Musrenbang SEIRAMPAH (Waspada): Untuk membahas rancangan Rencana Pembangunan Jangka Menengah Daerah (RPJMD) Kabupaten Serdang Bedagai (Sergai) tahun 2011 – 2015, jajaran Pemkab Sergai terdiri dari Asisten, Staf Ahli Bupati, Kepala Dinas, Kepala Badan, Kepala Kantor, Camat dan pimpinan ormas, cendiakawan, LSM serta tokoh masyarakat Sergai laksanakan musrenbang di aula Sultan Serdang kantor Bupati di Sei Rampah, Kamis (16/12). Musyawarahrencanapembangunan(musrenbang)pembahasan RPJMD itu dibukaWakil Bupati Sergai Ir. H. Soekirman dan dihadiri Kabid Pengendalian dan Evaluasi Bappeda Sumut Marihot Sormin, SE, MM, para nara sumber dari USU dan birokrat Pemprovsu antara lain Prof Dr Marlon Sihombing MA, Prof Dr Lc Reg reg. Sirojuzilan, Dr Ir Budi Sinulingga MSi, Ir. Dwi Lindarto, MT, Drs Iskandar Muda MSi, Faisal Eriza, S.Sos. M.SP dan Armaulizas Irawan S.Sos.MSi. Wakil Bupati Sergai Soekirman di depan peserta musrenbang itu dalam pengarahannya mengatakan, membuat RPJMD diibaratkan sama dengan membangun suatu restoran karena di dalamnya banyak hal yang mau disajikan. Rancangan RPJMD Kabupaten Sergai yang akan dibahas menurut Wabup H Soekirman merupakan hulu yang sangat vital dalam mengejawantahkan visi dan misi kepala daerah untuk pelaksanaan pembangunan ke depan, dan RPJMD tahun 2011 – 2015 diminta lebih baik dari RPJMD lima tahun lalu.(a07)

P. SIANTAR (Waspada): Pemko Pematangsiantar menerima anugrah Raskin Award 2010 Tingkat Sumut karena dinilai menunjang terlaksananya program beras miskin (raskin) demi kesejahteraan masyarakat. Penyerahan Raskin Award itu sebut Kabag Humas dan Protokoler Pemko Drs. Daniel H Siregar, Jumat (17/12) dilaksanakan Tim Koordinasi Raskin Award Sumut kepadaWalikota Pematangsiantar Hulman Sitorus, SE di ruang data Pemko, Jumat (16/12), Ketua Tim Koordinasi Raskin Award tahun 2010 Sumut Bobi Darman S menyebutkan, penyerahan Raskin Award 2010 untuk Pematangsiantar, karena meraih peringkat harapan III tingkat Sumut. “Raskin Award ini diharapkan menunjang terlaksananyaprogramraskindemikesejahteraan masyarakatdidaerah.Programraskinmerupakan wujud nyata dan komitmen pemerintah dalam memenuhipanganbagimasyarakatmiskinuntuk mengurangi beban pengeluaran rumah tangga miskin yang merupakan salah satu program penanggulangan kemiskinan yang saat ini sedang kita laksanakan,” terang Bobi.

PHBS Masyarakat Di Pakpak Bharat Masih Rendah SALAK (Waspada): Permasalahan Perilaku Hidup Bersih dan Sehat (PHBS) masyarakat di Kabupaten Pakpak Bharat masih rendah dan begitu juga halnya dengan permasalahan kekurangan dari pada tenaga spesialis di RSUD (Rumah Sakit Umum Daerah) Salak, Kecamatan Salak. Demikian Bupati Pakpak Bharat Remigo Yolando Berutu ketika membuka acara Rakerkesda (Rapat Kerja Kesehatan Daerah) Kabupaten, Kamis (16/12) di Gedung Serbaguna Salak yang dihadiri Ketua Komisi C DPRD Midun Angkat, Ka BAPPEDA (Badan Perencana Pembangunan Daerah) Sahat Bancin, Pelaksana Dinkes (Dinas Kesehatan) dr Tomas, Direktur RSUD Salak, dr Pintar Manihuruk, Kepala Puskesmas se-Kabupaten Pakpak Bharat beserta staf, para Kabid, Kasi, Kasubbag Dinkes dan RSUD Salak serta para undangan lainnya. Remigo menambahkan, ditambah lagi atas masalah lainnya, yakni masalah pelayanan kesehatan yang meliputi antara lain, keterjangkauan (Accesibility), yaitu pelayanan kesehatan untuk daerah terpencil dan tertinggal belum bisa dilaksanakan secara maksimal. Masalah kemampuan (Affordability), yaitu ketidakmampuan masyarakatdalamhalmemanfaatkansaranadanprasaranakesehatan. Masalah kualitas (Quality), yaitu kualitas pelayanan kesehatan baik pada sarana pelayanan kesehatan rujukan masih kurang. (c08)

Sepeda Motor Disikat Maling BINJAI (Waspada) : Sepeda motor Yamaha Mio Soul BK 6107 SY milik Harry, 45, pengelola Herry Ponsel di Jalan Sudirman, Kecamatan Binjai Kota, Rabu (15/12) pukul 19:00 disikat maling dari depan tokonya, hingga kerugian akibat sepeda motornya dijarah diperkirakan Rp13 juta. Persoalannya sudah dilaporkan ke Polres Binjai dan pelakunya masih diburon. Kapolres Binjai AKBP Rina Sari Ginting melalui Kasat Reskrim AKP Ronni Bonic, Jumat (17/12) membenarkan kejadian itu. Menurut Kasat, begitu pihaknya terima pengaduan tentang dijarah maling sepeda motor korban langsung pelakunya diburon. Keterangan diperoleh, malam itu setelah tokonya mau ditutup mobil dan sepeda motor yang diparkirkan di depan toko hendak dimasukkan ke dalam ruko. Setelah mobil masuk ke dalam ruko, ketika sepeda motor ini akan dimasukkan ternyata tidak ada lagi di tempatnya, padahal sepeda motor dalam keadaan stang terkunci. (a04)

Ketua HNSI Deliserdang Bantu Korban Kebakaran MEDAN (Waspada): Ketua Himpunan Nelayan Seluruh Indonesia (HNSI) Deli Serdang Rakhmatsyah, SH menyerahkan bantuan 7 karung beras kepada 8 kepala keluarga korban kebakaran di Bagan Desa Percut Kec. Percut Sei Tuan, yang diterima secara simbolis oleh Kepala Desa Percut, Faisal, Selasa (14/12). Penyerahan bantuan tersebut dihadiri Wakil Ketua HNSI Deli Serdang M. Nasir, sekretaris M. Syari dan puluhan pengurus dan anggotanya, Pengurus Ranting Partai Kebangkitan Bangsa (PKB) Desa Percut, Syamsir dan B. Dayat, pengurus Pokmaswas, Aslim B, serta tokoh masyarakat Percut, H. Syamsir dan Sulaiman Sinaga. Rakhmatsyah, yang juga anggota DPRD Deli Serdang dari PKB, memberikan bantuan kepada para korban musibah kebakaran yang masih tetangga dan keluarga dekatnya. “Sebagai warga desa ini, saya sangat prihatin atas musibah ini, saya mengajak seluruh masyarakat dan Pemkab Deli Serdang dapat membantu korban, setidak-tidaknya untuk menyediakan sandang dan pangan selama korban berada di penampungan sementara,” harapnya. Kepala Desa setempat, Faisal, menyatakan kini pihaknya bersama pemerintah Kecamatan Percut Sei Tuan akan mencoba memohon bantuan ke Dinas Sosial dan Kesbanglinmas DS. Untuk bantuan yang baru masuk, tambahnya lagi, masih dari Camat Percut Sei Tuan Drs. Darwin Zein berupa beras sebanyak 7 goni, Indomie 7 kotak, minyak makan 0,5 Kg/ KK, air mineral 8 kotak dan dari Rumah Sakit Sehat sebanyak 1 goni beras ukuran 30 Kg. Kerugian diperkirakan lebih dari Rp200 juta. Karena salah satu rumah korban yang terbakar adalah grosir pensuplai kebutuhan nelayan melaut. (m41)

Waspada/Abdul Hakim

CARA LAIN: Komunitas anak jalanan di Kota Stabat sejak beberapa bulan terakhir meningkat. Mereka mengamen di persimpangan jalan dan di warung-warung demi mendapatkan uang receh. Setiap sore ketika hendak pulang ke ‘markas’ mereka yang diduga berada di kawasan P. Brandan dan Besitang, anak punk memiliki cara ganas untuk mendapatkan tumpangan. Saat melihat truk yang diincar, mereka semua berlari dan berdiri di tengah-tengah badan jalan menghentikan paksa agar truk berhenti. Otomatis sopir menginjak pedal rem mendadak jika tidak ingin menubruk, seperti dalam gambar yang diabadikan belum lama ini di persimpangan Sudirman Stabat. Selanjutnya mereka naik dan melambaikan tangan kepada siapa saja yang melihat aksi nekat mereka.

Masyarakat Agar Patuhi Aturan Berlalulintas SEI RAMPAH(Waspada): Guna menghindari kecelakaan lalulintas di jalanan, diminta kepada masyarakat agar mematuhi peraturan berlalulintas yang berlaku. Hal itu disampaikan Kapolres SergaiAKBPDrs.EriSafari diwakili Kompol SyafrilYusuf didampingi Kadisdik Drs. H. Rifai Bakri Tanjung, M.AP, Kadispora Drs. Joni Walker Manik, MM, Ketua KNPI Sergai Drs. Indra Syharin, M.Si, saat melepas siswa SMA sederajat peserta safety ready dari halaman kantor Bupati Serdang Bedagai di Firdaus, Sabtu(18/12) pagi dan finish di arena sirkuit motor croos Sergai 2010 seriVII, Lingkungan I, Kelurahan Pekan Dolok Masihul, Kec. Dolok Masihul. Pada kesempatan itu Wakapolres Sergai Kompol SyarifYusuf mengatakan, kegiatan ini sangat baik diterapkan kepada para siswa untuk mendisiplinkan diri dalam berlalulintas. Justru itu diharapkan kepada para pelajar yangmengikutinyadapatmenjadi contoh bagi para pengendara sepeda motor lainnya. Dengan adanya kegiatan itu, juga Wakapolres meminta agar para siswa SMA di Serdang Bedagai mengurangi aksi balapan liar yang mayoritas dilakukan oleh para pelajar pada malam hari. Karena, kataYusuf, kegiatan balapan liar itu tidak baik dan dapatmembahayakannyawapengendara itu sendiri dan merugikan orang lain. Bagi pelajar yang memenuhi ketentuan dan aturan dalam mengendarai sepeda motor seperti mempergunakan helm Standar Nasional Indonesia(SNI), kaca spion, Surat Izin Mengemudi (SIM) C,akan dinilai oleh tim juri dan diberikan hadiah. SelainituWakapolresjugamengimbau masyarakat agar mematuhi semua aturan berlalulintas seperti yang tercantum dalam

lembaga pembina dan pengembang perpustakaan, kearsipan dan dokumentasi yang profesional, keberadaan semua jenis perpustakaan di Sumut sangat penting dalam mendukung program pendidikan nasional yakni mencerdaskan kehidupan bangsa dan mewujudkan komitmenGubsuSyamsulArifindalam membangun masyarakat Sumut agar semakin takwa, tidak sakit, tidak lapar, tidak bodoh dan punya masa depan. “Komitmen Gubsu dan program pendidikan nasional akan dapat diwujudkan dalam lima tahun kedepan bila masyarakat mau belajar dengan cara sekolah, membaca, meneliti dan berdiskusi sehingga masyarakat akan memperoleh ilmu pengetahuan dan keterampilan,” tegas Nurdin. Diamenyebutkan,bilamasyarakat mau melaksanakan ilmu pengetahuan dan keterampilan yang dimiliki maka masyarakat akan semakin takwa, sehat, pintar dan punya pendapatan yang baik sehingga memiliki depan yang cerah. “Untuk mewujudkannya maka didirikanlah perpustakaan dan membagikan berbagai jenis buku hingga ke desa/kelurahan

Waspada/Eddi Gultom

LEPAS PESERTA: Kadisdik Kab. Sergdang Bedagai Drs H Rifai Bakri Tanjung, MAP melepas peserta Safety Readi yang terdiri dari siswa SLTA sederajat se Kab.Serdang Bedagai di halaman kantor Bupati Sergai di Firdaus,Sabtu(18/12) pagi. Undang- Undang Nomor 22 tahun 2009, tentang lalulintas dan angkutan jalan. Sementara, Kadisdik Serdang Bedagai Drs.H. Rifai Bakri Tanjung, M.AP dalam arahannya kepada para siswa mengatakan, pelaksanaan safety ready itu merupakan penambahan ilmu pengetahuanbagisiswadalamtertib berlalulintas dan diharapkan seluruh siswa mentaati aturan lalulintas yang telah berlakukan. Untuk mengetahui lebih dalam lagi mengenai peraturan tersebut, kata Kadisdik, pihaknya akan memasukannya dalam program pembelajaran lalulintas muatan lokal di sekolah- sekolah, khususnya tingkat SLTA/sederajat. (a07)


FOTO BERSAMA: Kepala BPAD Provsu Nurdin Pane, SE, MAP foto bersama para pengelola perpustakaan desa/kelurahan di Hotel Madani, Medan. Foto direkam baru-baru ini. sebagaisalahsatuupayamenambah ilmu pengetahuan dan keterampilan masyarakat,” ujar Nurdin. Lebih lanjut lagi Nurdin mengatakan, pendirian perpustakaan di desa/kelurahan merupakan wujud dari intstruksi Mendagri No. 28 tahun 1984. “ Dengan adanya UU No. 43 tahun 2007, maka eksistensi perpustakaan menjadi sangat urgent terutama dalam mencerdaskan kehidupan bangsa. Untuk mewujudkannya dibutuhkansaranadanprasaranaperpustakaan yang dikelola dengan

Sementara, Walikota menyebutkan 2010 Pemko Pematangsiantar sudah menyalurkan raskin 1.971.320 kg untuk keluarga miskin 11.596 KK di delapan kecamatan serta 52 kelurahan. Setiap keluarga miskin selama Januari sampai Oktober 2010 sudah memperoleh 15 k per KK danNovember 20kgperKKdenganhargaRp1.600 per kg. Menurut Walikota, keberhasilan program raskin di Pematangsiantar merupakan tanggung jawab bersama dengan memberikan pelayanan yang terbaik kepada masyarakat. “Kami mengharapkan kepada instansi terkait, khususnya camat, lurah dan RT/RW serta seluruh masyarakat Pematangsiantar dapat mendukung terlaksananya program raskin ini. Ke depan, pelaksanaan program raskin ini dapat lebih kita tingkatkan untuk terwujudnya rakyat tidak lapar serta menuju Pematangsiantar mantap, maju dan jaya.” Penyerahan Raskin Award juga disaksikan Sekda Drs.Donver Panggabean, MSi, dan Asisten II Djumadi, SH serta pimpinan SKPD, seluruh camat dan lurah.(a14)

Musda IV PAN Simalungun 27 Desember 2010 SIMALUNGUN (Waspada): Musyawarah Daerah (Musda) IV Partai Amanat Nasional (PAN) Kab. Simalungun direncanakan digelar 27 Desember 2010. Sekaitan dengan itu, DPD PAN Simalungun melalui rapat pleno pengurus harian telah membentukPanitiaPengarah(SC)danPanitiaPelaksana (OC) Musda IV PAN Simalungun. SC diketuai Ir. Endi Cuaca, Sekretaris M. Ilham Lubis, anggota Rudi Damanik, Edi Sumanto dan Asmino Damanik. Sedangkan OC diketuai M. Munap MR, Sekretaris Chairul Purba dan Bendahara Ir. Sri Hayana serta dilengkapi seksi-seksi. Ketua OC, M Munap MR didampingi Chairul Purba, Endi Cuaca serta lainnya di kantor DPD PANSimalungun,JalanSangnaualuhkepadaWaspada, Jumat (17/12), mengatakan, Musda IV diikuti para peserta yang terdiri dari Ketua, Sekretaris dan Bendahara DPD PAN Simalungun, 1 Ketua MPP DPD PAN Simalungun, 1 unsur DPW PAN Sumut, masing-masing Ketua dan Sekretaris DPC PAN serta para Ketua DPRt PAN seSimalungun.

Munap menjelaskan, Musda 27 Desember 2010.Sedangkantempat pelaksanaan,masih akan ditetapkan kemudian karena ada dua pilihan antaralaindiPematangsiantaratauParapat.Selain dihadiri unsur pengurus DPW PAN Sumut, pelaksanaanmusdajugaakandihadirisejumlahanggota DPR-RI dari fraksi PAN asal daerah pemilihan Sumut. Menurut Munap, pendaftaran para peserta ditentukan hingga hari ’H’, sedangkan pendaftaran calon ketua formatur atau calon ketua DPD berlangsung sejak 18 hingga 24 Desember 2010 pukul 00.00. Sementara, menyangkut persyaratan bagi calon ketua formatur, selain telah memahami platform partai dan memiliki KTA (Kartu Tanda Anggota) PAN, minimal calon memiliki ijazah SLTA. Selaku ketua panitia Musda (OC), Munap berharap pelaksanaan MusdaIVPAN Simalungun dapat terlaksana sesuai dengan jadwal yang telah direncanakan. Kemudian bagi semua kandidat calon ketua diharapkan mendaftar sesuai waktu yang ditentukan dan diminta dapat bersaing secara sehat dan tidak saling menghujat.(a15)

Reuni Akbar Alumni SMPN 1 Kisaran 26 Desember

Perpustakaan Sebagai Pusat Informasi Dan Ilmu Pengetahuan PERPUSTAKAAN sebagai wadah dan pusat dokumentasi serta informasi bagi masyarakat adalah dua hal yang saling berhubungan yang diibaratkan sebagai dua sisi mata uang yang saling melengkapi dan bergandengan erat dalam mewujudkan hubungan yang harmonis. Perpustakaan dengan kemampuan mengolah dan menyajikan informasi serta segala fasilitas yang dimiliki terus mengembangkan diri dalam melayani pengguna informasi. Begitu juga dengan masyarakat akan terusmemanfaatkanperpustakaan sebagai wadah dan pusat informasi. Perpustakaan yang ada saat iniakanterusberkembangsebagai salah satu pusat informasi, sumberilmupengetahuan,pelestarian khasanah budaya bangsa, penelitian serta memberikan berbagai layanan jasa lainnya. Demikian Kepala Badan Perpustakaan, Arsip dan Dokumentasi Provinsi Sumatera Utara (BPAD Provsu) Nurdin Pane, SE, MAP seusai menjadi narasumber pemantapanpengelolaperpustakaan desa/kelurahan di Hotel Madani, Medan baru-baru ini. Menurut Nurdin, sesuai dengan visi BPAD untuk menjadi


sistem dan manajemen yang benarsehinggadapatberkembang,” jelas Nurdin. Turut sebagai narasumber Sekretaris BPAD Provsu Drs Chandra Silalahi, Kabid Layanan dan Informasi Perpustakaan Dra Elli Suhaeriyah dan Dr Rajab Lubis. Peserta berasal dari desa/ kelurahan di 18 kabupaten/kota di Sumut antara lain Kabupaten Mandailing Natal,Tapanuli Utara, Serdang Bedagai, Deliserdang, Asahan, Labusel, Labura, Batubata, Langkat dan Kota Medan. (m43)

MEDAN(Waspada):ReuniakbaralumniSMP Negeri 1 Kisaran, Kab. Asahan dari semua angkatan akan diselenggarakan 26 Desember 2010 di sekolah itu di Jalan Madong Lubis, Kelurahan Mutiara Kisaran. DemikiandikatakanKetuaPanitiapenyelenggara reuni Ponara Siagian (angkatan ‘84) didampingiSekretarisMujiono(angkatan‘88),bendahara Sri Hastuti (angkatan ‘86) serta Dohar Simatupang dan Anita Hasibuan (kordinator angkatan ‘85) kepada wartawan, Minggu (12/12) di Medan. Reuni berthema ‘Ingat Sekolahmu, Ingat Gurumu, Ingat temanmu’, menurut Ponara Siagian, bertujuan untuk lebih menjalin tali silatuhrahmi, kebersamaan yang lebih besar dan solid di antara sesama alumni. Selain itu, imbuh Ponara Siagian, untuk meningkatkankepeduliansosialdiinternalalumni maupundimasyarakatluas.Sehingga,diharapkan

dapat mempererat keakraban seluruh alumni dan bersama melakukan langkah nyata dalam mengumpulkan semangat serta memadukan komitmen bagi almamater tercinta untuk melestarikan dan menularkan pendidikan yang berkarakter ke generasi berikutnya bagi bangsa dan negara. Sementara itu ikatan alumni SMPN 1 Kisaran telah terbentuk sejak Oktober 2010 lalu di Kisaran diketuai Chaeruddin. Bagi alumni SMPN 1 yang belum mendapat informasi reuni akbar ini dapat mengkonfirmasinya ke sekretariat panitia, Radio Suara Asahan Kisaran di Jalan Diponegoro Kisaran atau kontak person lewat 085261993432 (Ponara Siagian), 085261270172 (Mujiono), 081397810155 (Siti Zuraidah) dan 08126361275 (Nina hasibuan). Danapartisipasiuntuksuksesnyaacarainiminimal Rp20 ribu dikirimkan lewat rek. BRI 3355-01013879-533 an. Chaeruddin. (rel/ces)


WASPADA Senin 20 Desember 2010

C6 NAE IV Media Komunikasi Pelayanan Kesehatan Rakyat Di Aceh

WH Jaring 51 Perempuan Tak Berpakaian Muslimah BIREUEN (Waspada): PetugasWilayahtul Hisbah (WH) Kabupaten Bireuen, Jumat (17/12) petang menjaring 51 perempuan yang tidak berpakaian muslimah melalui razia yang digelar di Jalan Bireuen-Takengon, depan mesjid Agung. Razia WH dan didukung Polisi Militer, polisi, dan Majelis Permusyarawatan Ulama (MPU) itu, menghentikan penggendara sepeda motor yang dinilai tidak berpakaian muslimah. Mereka yang tertangkap umumnya kalangan remaja putri yang berpakaian ketat. Kemudian petugas mencatat nama dan alamat mereka dan diberikan pengarahan. “Kita berikan pencerahan agar ke depan mereka dapat merubah penampilan dan cara berpakaian yang muslimah,” jelas Kasie Penyidik dan Penyelesaian Masalah Dinas Syariat Islam, Tgk. M. Daud didampingi Ketua MPU Bireuen, Jamaluddin Abdullah. Tgk. M. Daud melanjutkan, razia gabungan ini direncanakan dilaksanakan secara rutin untuk pengawasan pelaksanaan Qanun Syariat Islam di Bireuen. Bahkan, katanya, pihaknya akan menggelar razia kembali terhadap pasangan muda-mudi yang sering berlibur ke kawasan wiosata Kreueng Simpo, terutama pada hari-hari libur.(cb03)

Aceh Selatan Bentuk Forum Pala BANDA ACEH (Waspada): Pemerintah Kab. Aceh Selatan bekerjasama dengan United Nations Development Programme (UNDP) Indonesia, melalui program stabilisasi reintegrasi dan perdamaian membentuk Forum Pala Aceh. Pembentukan forum tersebut merupakan upaya reintegrasi ekonomi terutama dalam mengembangkan tanaman palayangterpuruk,setelahditinggalkanpetanidiAcehSelatan saat konflik berkecamuk di bumi Serambi Mekkah. “Pembentukan forum ini menjadi titik awal mengembalikan kejayaan petani pala di Kabupaten Aceh Selatan dan perekonomian masyarakat pasca konflik,” ungkap Siti Ruhanawati, Koordinator Program Stabilisasi Reintegrasi dan Perdamaian UNDP, kepada pers, Jumat (17/ 2) di Banda Aceh. Siti mengungkapkan hasil survei menyebutkan petani pala menelantarkan kebunnya ketika konflik, sehingga produktivitas pala menurun. Banyak tanaman mati, padahal sebagian besar petani menggantungkan hidup dari pala. Pengurus Forum Pala Aceh tersebut, masing-masing Ketua Dr. Mustafril, peneliti yang juga Wakil Direktur Politeknik Aceh Selatan, Wakil Ketua, H. Ichwan Idham dari kalangan pengusaha serta Sekretaris, Ir. Syarifah Lismadia Habib, dari unsur pemerintah.(b04)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *

Berangkat (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta


11:35 JT 397 Medan/Jakarta 20:00 JT 307 Jakarta

06:40 12:15

12:55 SJ011 Medan/Jakarta


12:20 AK 306 Kuala Lumpur *


FY 3401 Penang ** 14:10 FY 3400 Penang “” * Setiap Senin, Rabu, Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

12:45 14:30

Waspada/M Jakfar Achmad

SOSIALISASI JKA: Kadis Kesehatan Aceh Utara, Nurdin, M.Kes (tengah/kiri, didampingi petugas), saat mensosialisasikan program JKA disaksikan Wabup Aceh Utara, Syarifuddin, SE (tengah/kanan), usai pembukaan acara NAE IV/2010, Sabtu (18/12) malam.

Alasan Sakit Tersangka Korupsi Gagal Diperiksa LHOKSEUMAWE (Waspada): Tersangka kasus korupsi dana Rintisan Sekolah Bertaraf Internasional (RSBI) SMPN 1 Lhokseumawe, Zul gagal diperiksa penyidik Kejari Lhokseumawe karena alasan sakit. Informasi dari Kejari Lhokseumawe, kemarin, tersangka sudah dua kali gagal diperiksa karena alasan sakit. “Tadi pagi datang surat yang menyebutkan Zul sedang diopname di Rumah Sakit Sakinah

Lhokseumawe. Ini yang kedua tersangka gagal kita periksa. Beberapa waktu lalu juga sudah kita panggil, tapi yang datang surat keterangan sakit,” jelas Kajari Lhokseumawe Tomo, SH melalui Kasi Pidana Khusus, Syahril, SH. Sejak kasus dugaan korupsi itu ditingkatkan ke penyidikan, awal Mei 2010, pihaknya baru sekali memeriksa tersangka. Pemeriksaan pertama belum sampai ke pokok perkara. Kemu-

Pertamina Diminta Tindak Pangkalan Nakal PANTONLABU, Aceh Utara (Waspada): Elemen sipil minta Pertamina memantau langsung sekaligus menindak tegas pemilik pangkalan minyak tanah bersubsidi nakal yang kerap menjual minyak tanah kepada masyarakat melebihi harga eceran tertinggi atau HET. “Sudah jadi rahasia umum, beberapa pemilik pangkalan minyak tanah bersubsidi sering menjual minyak tanah bersubsidi dengan harga sesuka mereka. Tidak sedikit pula oknum pemilik pangkalan menimbun minyak subsidi, lalu menjual lagi ke pihak ke tiga dengan harga non

subsidi. Ini merugikan masyarakat kecil,” kata Razali, Sekjen LSM Atjeh Futures, Jumat (17/12). Sesuai laporan yang masuk ke Atjeh Futures, lanjut Razali, warga kerap mengeluh dengan kondisi miris tersebut. “Contoh kasus terjadi di Desa Sama Kuroek, Kec. Tanah Jambo Aye, Aceh Utara, baru-baru ini. Sejumlah warga mengaku membeli minyak tanah bersubsidi hingga Rp4 ribu per liter. Padahal, harga normal hanya berkisar antara Rp3200-Rp3500 per liter.”(cmus)

dian dipanggil lagi untuk pemeriksaan menyangkut pokok perkara, tapi tersangka tidak datang. “Informasi yang kami peroleh, Kamis kemarin, tersangka terlihat sehat-sehat saja, bahkan sempat datang ke salah satu bank,” ungkap Syahril. Penyidik telah memeriksa ulang sejumlah saksi setelah temuan data baru tentang dana RSBI SMPN 1 Lhokseumawe bersumber dari APBN 2008 dan 2009. Termasuk data yang disita di Kemendiknas di Jakarta, akhir Oktober lalu. “Kalau tersangka sudah diperiksa terkait pokok perkara, baru kami lakukan evaluasi untuk selanjutnya diambilkesimpulanapakahadapenambahan tersangka atau tidak,” katanya. Seperti diberitakan sebelumnya, Jaksa menjerat mantan Kepala SMP Negeri-1 Lhokseumawe ini sebagai tersangka kasus dugaan korupsi dana RSBI tahun 2008 dan 2009 dengan UU Pemberantasan Tindak Pidana Korupsi pasal 2, pasal 3, dan pasal 9. SMPN itu memperoleh dana RSBI tahun 2008 dari APBN Rp300 juta, APBA Rp240 juta, dan APBK Rp160 juta. Tahun 2009 dari APBN Rp300 juta dan APBK Lhokseumawe Rp60 juta.(b17)

NAE IV/2010 di Aceh Utara, menjadi media komunikasi yang menyampaikan informasi terhadap pelayanan kesehatan rakyat di Aceh. Hal tersebut diakui Ketua Umum NAE (North Aceh Expo/pameran bergengsi ini), Wakil Bupati (Wabup) Aceh Utara, Syarifuddin, SE ketika meninjau stand Dinas Kesehatan Aceh Utara, usai pembukaan acara pameran di lokasi Jalan Line Pipa, Kec. Kuta Makmur, Aceh Utara, Sabtu (18/12) malam. Kepala Dinas (Kadis) Kesehatan, Nurdin, M.Kes menangani langsung pelayanan informasi program Pemerintah daerah (Pemda) Aceh, tentang Jaminan Kesehatan Aceh (JKA), dalam rangka menyentuh pelayanan kesehatan bagi setiap pribadi rakyat Aceh. Program JKA mulai digulir Pemda Aceh, sejak Juni 2010, dengan mengalokasi dana APBA-TA/2010. “Kehadiran program ini merupakan suatu dispensasi pengobatan gratis bagi seluruh rakyat Aceh, baik yang mampu maupun rakyat tak mampu, kecuali PNS, TNI/Polri yang masih aktif dan rakyat Aceh lainnya yang sudah memiliki fasilitas Jamkesmas,” jelas Kadis Kesehatan Aceh Utara. Menjawab pertanyaan pengunjung tentang kartu JKA, kata Kadis, untuk sementara dibenarkan hanya menunjukkan KTP dan kartu keluarga (KK). Secara bertahap seluruh kabupaten/kota di Aceh, semua KK akan dibekali kartu JKA, ujarnya seraya menjelaskan berbagai kemudahan berobat akan ditangani Pemda Aceh, terhadap semua jenis penyakit yang diderita rakyat, baik yang menuntut operasi berat/ringan, dengan mendapat pelayanan cuma-cuma (gratis). “Program JKA terhitung Juni 2010, sampai dengan tiga tahun ke depan. Secara kedinasan kami telah mensosialisasikan kepada masyarakat, lewat pemerintah kecamatan, kerjasama dengan Puskesmas setempat,” pungkas Nurdin. Punya Prospek Sementara menurut Syarifuddin (Wabup Aceh Utara), walaupun event ini di level kabupaten, namun telah mengangkat sebagian besar tugas pokok dan fungsi (Tupoksi) atau tanggungjawab Provinsi Aceh, terhadap pelayanan informasi daerah Aceh keseluruhan. pemilihan lokasi di Aceh Utara, karena kabupaten ini memiliki berbagai jenis komoditi yang mempunyai reputasi gemilang di luar negeri, seperti pinang, udang dan kepiting, disamping komoditi unggulan lainnya, yakni: handycraft, kunyit, jahe, kelapa sawit, ikan, coklat, karet dan kopra yang punya prospek bisnis cukup baik. Ketua Umum NAE IV/2010, Aceh Utara itu juga menguraikan kilas balik NAE III/2009. “Hasil pelaksanaan NAE tahun lalu, telah terjadi transaksi ekspor terhadap komoditi coklat dan kelapa senilai US $ 1.2 juta, dengan negara tujuan ekspor Malaysia dan Thailand. Dampak ganda lainnya dari pelaksanaan aktivitas tersebut telah terjadi kenaikan harga terhadap ke dua jenis komoditi dimaksud. Kita harapkan, setelah pelaksanaan NAE IV/2010 ini, realisasi nilai ekspor ke dua jenis komoditi tadi akan semakin meningkat yang disusul dengan produk-produk komoditi lainnya,” jelasnya menjawab Waspada di sela-sela kunjungan stand pameran. Dikatakan, negara-negara tujuan ekspor masih didominasi oleh negara tujuan utama, yaitu Malaysia dan Philipina, selain itu India, Srilanka, Korea, Singapore, Bangladesh, Uni Emirat Arab, Thailand, Vietnam, Saudi Arabia, China dan Amerika Serikat. “Marilah bersama-sama kita bersatu membuktikan diri, bahwa produk barang dan jasa kita mampu membuat lompatan-lompatan spesifik yang dibutuhkan di pasar domestik maupun pasar luar negeri,” pintanya.*** M. Jakfar Achmad

Guru Dilatih Penggunaan TIK BANDA ACEH (Waspada): Para guru dan ibu di Banda Aceh dan Aceh Besar akan dilatih penggunaan teknologi informasi dan komunikasi (TIK) sebagai bagian untuk meningkatkan kualitas pendidikan. Karena TIK merupakan sarana penting dalam meningkatkan kualitas pendidikan. Aceh IT Center (AITC), sebuah lembaga dalam pelatihan TIK, berinisiatif melaksanakan pelatihan tersebut dengan alasan akses para guru dalam ke teknologi ini sangat terbatas. “Terbatasnya aksesibilitas para guru ke teknologi ini menjadi kendala yang perlu segera diatasi,” cetusnya. Menurutnya, para siswa dan murid di Aceh sudah cukup familiar dengan TIK sementara para guru masih banyak yang belum punya akses ke komputer. “Hal ini disadari semua pihak termasuk para guru,” sebut Iskandarsyah, Jumat (17/12) di Banda Aceh.(b04)

Pariwara Aceh Ladang Subur Bagi Investor SEMAKIN kondusifnya kondisi keamanan Aceh telah berpengaruh besar terhadap kegairahan iklim investasi di Aceh. Harus diakui kondisi yang aman, nyaman dan damai menjadi prasarat utama sebuah daerah menjadi incaran para pemilik capital besar yang mau mengembangkan usaha dan bisnisnya di lokasi baru atau negara lain. Aceh, yang berada paling ujung pulau Sumatera ini kini telah menjadi ladang subur bagi kalangan investor mengembangkan bisnisnya. Baik bisnis di sektor perkebunan, pertanian, perikanan dan berbagai bidang lainnya, terutama bidang pertambangan. PT Lhong Setia Mining (LSM), untuk menyebutkan sekedar contoh salah satu investasi yang sangat meng-untung-

kan. Perusahaan ini telah mengekspor biji besi ke Chi-na hampir setahun lalu. Perusahaan pertambangan lain, seperti PT Pinang Sejati Utama di Manggamat, Aceh Selatan. Dilaporkan juga telah mulai ekspor di negeri tirai bambu itu. Belum termasuk sejumlah perusahaan lainnya, seperti di Samahani, Aceh Besar yang segera direalisir membangun pabrik pengelola padi dengan kafasitas 9 ton perjam. Perusahaan yang komit membangun pabrik ini datang dari Negara Korea. Sebenarnya, bila dilihat dari Data Badan Investasi dan Promosi Aceh sampai Agustus 2010 menyebutkan ada 71 perusahaan investasi sudah mendapat surat persetujuan untuk menanamkan modalnya di provinsi ini. Tidak kurang dari 10 negara besar di dunia sudah berkomit-

men menanamkan investasinya di Aceh. Di antaranya Malaysia, Korea, China dan India, serta beberapa negara di Eropa. Nilai investasi itu mencapai 1,908 miliar dolar AS. Para investor ini tadinya sempat menyinggung soal ketersediaan listrik yang minim. Namun kendala terbatasnya energy listrik di Aceh, mulai terjawab dengan telah dilakukan proses lelang geothermal (panas bumi) di Jaboi, Sabang dan Seulawah Agam, Aceh Besar. Data dari Badan Kementerian Energi Sumber Daya Mineral menyebutkan, potensi panas bumi Jaboi memiliki cadangan terduga 50 MW telah dilelang pada akhir 2008 dengan pemenang lelang Konsorsium PT Bukaka Teknik Utama, PT Dian Sakti Energi, dan PT Global Energi Aliansi.

Sementara untuk Seulawah Agam, dilaporkan menyimpan potensi cadangan terduga panas bumi sebesar 160 MW. Eksplorasi potensi panas bumi di WKP Seulawah Agam dilaporkan sudah dilakukan proses tender. Gubernur IrwandiYusuf, dalam setiap kesempatan menyatakan, menggaet investor merupakan usaha yang ditempuh pemerintah Aceh guna mengejar ketertinggalan daerah. Karena konflik telah memperburuk sendi-sendi perekonomian masyarakat di Aceh. Membangun dengan mengandalkan anggaran pemerintah, menurut orang nomor satu di Aceh itu, tentu membutuhkan waktu lama. Dan ini pun, diakuinya, belum tentu mampu membangkitkan perekonomian masyarakat yang

telah lama terpuruk. “Banyak potensi investasi yang bisa dikembangkan. Potensi ini semakin diminati investor. Apalagi, kondisi di Provinsi Aceh, semakin kondusif,” ungkap Gubernur IrwandiYusuf pada Aceh International Business Summit 2010 di Banda Aceh. Bahkan, kata Irwandi, untuk mempercepat masalah perizinan yang dibutuhkan pihak investor, jika tidak ada halangan Pemerintah Aceh akan mendapat kewenangan mengeluarkan perizinan kerjasama dengan pihak luar negeri. Sehingga proses kerjasamanya bisa langsung dilakukan PemerintahAcehataupengusaha di Aceh dengan para investor asing.“PembangunandiAcehharus didukung semua pihak, termasuk masyarakat internasional,” harap Irwandi Yusuf. (**)

Well come to investor… PEMERINTAH Aceh terus berupaya menarik minat investor menanamkan modalnya di bumi Serambi Mekkah. Potensi pertanian, perkebunan, pertambangan, energi, kelautan, peternakan, pariwisata dan infrastruktur berpeluang dikembangkan. Sehingga potensi itu bisa bermanfaat optimal bagi kemakmuran sekitar 4,6 juta jiwa penduduk yang berdomisili di provinsi ujung Pulau Andalas, Sumatera ini. Pasca konflik dan bencana tsunami, Aceh sangat membutuhkan investasi besar. Berbagai langkah dan kebijakan ditempuh Pemerintah Aceh, guna menggaet investor ini. Regulasi dan kemudahan investasi diberikan agar para investor dari dalam negeri maupun internasional bersedia menanamkan modalnya di Aceh. Usaha lain yang dilakukan Pemerintah Aceh adalah dengan berbagai promosi dan pameran potensi daerah. Bersama Kamar Dagang dan Industri (KADIN) Aceh menggelar Aceh International Business Summit 2010, di Jakarta dan Aceh. Pertemuan bertaraf internasional yang dilaksanakan akhir tahun 2010 itu, sebagai tindak lanjut kunjungan Gubernur

Aceh Irwandi Yusuf dan Ketua KADIN Daerah Aceh ke Amerika Serikat pada September 2007 lalu. Forum ini sangat bermanfaat untuk mendekatkan sumber daya manusia (SDM) di Aceh dengan lapangan kerja. Selain memacu peningkatan jumlah dan kualitas SDM di Aceh yang siap menyambut peluang kerja diberbagai sector. “Pertemuan di Jakarta merupakan ‘Gateway to Investment in Aceh’ dan di Banda Aceh bentuk aksi yang lebih nyata mempertemukan pengusaha dalam satu meja,” sebut Anwar Muhammad, Kepala Badan Promosi dan Investasi Aceh. Kegiatan ini diprakarsai KADIN Aceh didukung Pemerintah Aceh, Bainprom Aceh, BPKS, American Indonesian Chamber of Commerce (AICC), Aceh Business Club (ABC), dan Aceh Business Working Group (ABWG). Summit itu bertujuan mengeksplorasi lebih jauh peluang-peluang bisnis dan investasi di Aceh. Sekaligus mengajak pengusaha-pengusaha asing terlibat penuh dalam forum, di mana peluang-peluang akan terbuka dengan diskusi bersama. Tantangan dan kendala

yang terjadi diharapkan dapat dibicarakan dan dicarikan solusinya dalam summit ini. “Summit ini gerbang menghidupkan kembali perdagangan dan investasi di Aceh,” sebut Firmandez, Ketua KADIN Aceh. Kondisi Aceh yang kondusif sebenarnya tidak menjadi halangan bagi investor untuk menanamkan modalnya di Aceh. Industri skala kecil, menengah dan besar terbuka bagi investor di bumi yang melaksanakan Syariat Islam secara kaffah ini. Dengan iklim investasi yang sehat tentu akan memberi dampak positif bagi masyarakat. Lapangan kerja terbuka lebar sehingga mampu menekan angka pengangguran, usaha kecil dan menengah (UKM) juga akan berkembang. Kepastian hukum dan kemudahan itu sangat dibutuhkan para investor. Aceh yang diberkahi potensi sumber daya yang sangat besar dibutuhkan kepastian hukum agar investor mau datang ke Aceh, tandas Wayne Forest. Ketua Kamar Dagang dan Industri (KADIN) Amerika Serikat yang hadir pada Aceh International Business Summit 2010 di Banda Aceh, mengatakan dengan kepastian hukum yang

baik, Aceh pasti bisa bermain di tingkat internasional. Masyarakat Aceh dikenal ‘kosmopolit’ yang menerima siapa saja bangsa didunia ini. Terbukti ketika bencana tsunami melanda, pada 26 Desember 2004 lalu, berbagai suku bangsa bahu membahu membangun Aceh dari kehancuran. Kosmopolitan (baca; sikap terbuka) Aceh hari ini harus ditunjukkan dan dibuktikan masyarakat Aceh kepada para investor. Karena Aceh tidak bisa membangun perekonomian masyarakatnya dengan mengandalkan anggaran pembangunan daerah (APBA). “Pemerintah Aceh sudah bekerja keras menyusun regulasi memudahkan investor lokal dan asing masuk ke Aceh,” ungkap Iskandarsyah Bakri, anggota Tim Ekonomi Pemerintah Aceh terkait Aceh International Business Summit 2010 itu. Kondisi Aceh juga sangat mendukung karena relatif aman untuk investasi jangka panjang. Apalagi Aceh dijadikan Logistic Hub Regional dengan sistem perdagangan yang berkelanjutan (sustainable), tutur Iskandarsyah. Nah, apalagi, well come to investor (**)


PERBAIKAN EKONOMI: Keamanan dan invetasi saling berkaitan, Gubernur Aceh Irwandi Yusuf dan juru damai Aceh Marthy Ahtisaari berbicara tentang perbaikan ekonomi di Aceh.


Laporan Khusus Aceh Timur Meretas Hari Esok


Senin 20 Desember 2010

Pengantar: Memasuki tahun ke-empat kepemimpinan Bupati Muslim Hasballah merasa masih banyak yang belum terselesaikan, namun tak sedikit pekerjaan— pembangunan telah dihasilkannya bersama. Untuk mengetahui lebih lanjut tentang sejauh mana pekerjaan—pembangunan di Aceh Timur, berikut reportase wartawan Waspada Agusni AH :

TAK MUNGKIN waktu bisa ’dibelenggu’ terus bertahan tanpa gerak menuju masa hingga akhirnya terhenti pada satu titik kulminasi, bagai halnya sebuah jabatan di pundak seorang kom-

batan Gerakan Aceh Merdeka (GAM) yang kini sebagai Bupati Aceh Timur, ini dalam sisa kepemimpinannya kian menunjukkan geliat dan semangat membangun. Semua itu sebagai

bagian atas apa yang menjadi komitmennya baik semasa memanggul senjata maupun ketika mendeklarasikan diri pada saat pencalonannya sebagai kepala daerah pada Pilkadasung 2006 lalu. Di paro kepemimpinan Muslim Hasballah Bupati Aceh Timur, bersama wakilnya Nasruddin Abubakar terus menunjukkan kinerja yang berarti. Kendati harus diakui bahwa semua yang dijalankan selama ini tak sedikit kekurangannya, namun upaya mensejahterakan segenap warga tetap menjadi skala prioritas dan berkelanjutan. Muslim Hasballah bersiteguh, kukuh pada pendirian, dan senantiasa concern akan janjinya membangun daerah Aceh Timur ini.“Insya Allah sisa waktu dikepemimpinan saya ini akan terus memperbaiki dan membangun segala sesuatu demi ke-

pentingan segenap masyarakat Aceh Timur tercinta,” seru lelaki berperakan Arab-India, ini dalam satu kesempatan, Ahad pekan lalu. Menyimak ucapannya yang padat makna, memberi asumsi beragam untuk sebuah nilai dalam positif bagi kemajuan Aceh Timur ke depan, ia rela “bermandian keringat” hingga larut malam keluar—masuk pedalaman dan kawasan terisolir hanya untuk mencari berbagai potensi alam guna eksplorasi“selaras” bagi kepentingan masyarakat di sana. Eksplorasi selaras, adalah penggalian potensi dengan cara-cara yang baik dan benar, tanpa merusak atau menghancurkan sehingga keseimbangan alam tetap terjaga. Kepentingan masyarakat luas dengan implementasi yang ada merupakan satu keutuhan mendasar dalam setiap laku.

“Karena perbuatan adalah hasil gerak pikir, oleh karena itu segala sesuatu memberikan hasil output pembangunan Aceh Timur selama ini adalah hasil karya bersama pula,” tambah Tgk. Muslim seraya menunjukkan, bahwa hasil yang dicapai pihaknya selama ini merupakan kerja bersama atas keterlibatan para pihak membuatnya selalu merasa perlu untuk berdampingan dengan siapa pun juga. “Alhamdulillah kerjasama yang baik telah memberi dampak luas bagi kemajuan daerah ini,” tukasnya seraya menandaskan, untuk melaksanakan kerja besar seperti membangun sebuah daerah itu sangat dibutuhkan adanya keterlibatan para pihak. Segenap elemen masyarakat, tak terkecuali TNI/Polri merupakan satu komponen berenergi tinggi, sehingga segala yang diinginkan pastinya akan

tercapai sedianya memberikan hasil maksimal. Karenanya Muslim Hasballah tak pernah ragu melibatkan para pihak baik dalam tahapan konsepsi pembangunan maupun pada tatanan pelaksanaan secara fisik di lapangan. “Kan semakin banyak melibatkan pemikiran dan tenaga semakin bagus juga hasilnya,” serunya dalam nada tanya. Dia melihat, bahwa kehidupan ini memang selalu memerlukan pihak lain, karena berjalan atau membangun sesuatu secara sendiri hanya memberi hasil yang sedikit juga, kalau memang tidak dikatakan nihil sama sekali. “Untuk itu, kami selalu membuka diri menerima setiap masukan dan aspirasi masyarakat luas guna terbangunnya Aceh Timur ke arah yang lebih jaya,” demikian Muslim Hasballah. ***.

Membangun Ekonomi Pesisir Lewat Pemanfaatan Tambak

Waspada/Agusni AH

Bupati Aceh Timur Muslim Hasballah saat menampung aspirasi masyarakat ketika berada di lapangan, belum lama ini.

Investasi Korsel, PLTA Di Aceh Timur DAEWOO ENGINERING Korea Midland Power salah satu perusahaan swasta asal Negeri Gingseng, Korea Selatan berencana dalam waktu dekat atau awal 2011 akan membangun dua unit bendungan di Desa Tampur Kecamatan Simpang Jernih Kabupaten Aceh Timur. Bendungan tersebut rencananya dipergunakan untuk Pembangkit Listrik Tenaga Air (PLTA) yang ditabal Tampur I dan Tampur II. Dari dua PLTA tersebut diharapkan dapat menghasilkan listrik sebesar 554 Mega Watt, dimana untuk Tampur I memberikan daya 428 Mega Watt dan Tampur II menghasilkan 126 Mega Watt. Ir. Fauzi A. Rifai, MM, Presiden Director PT. Nusantara Powerindo yang bakal bergandengan dan

bekerjasama Daewoo Enginering- Korea Midland Power untuk menbangun PLTA tersebut pada acara silaturrahmi dengan Bupati Aceh Timur, Muslim Hasballah dan para unsure Muspika serta masyarakat Kecamatan Simpang Jernih di Aula Pendopo Bupati Aceh Timur, di Langsa pada Rabu (13/12), memberi sinyalemen positif bagi terlaksananya program pengadaan arus listrik dimaksud. “Sebanyak 554 MW daya arus listrik ini akan mampu memenuhi kebutuhan listrik untuk seluruh Aceh bahkan sampai ke Sumatra Utara jelasnya, jika program ini terlaksana dengan baik Insya Allah sebagian Indonesia akan tercukupi tidak sebagaimana selama ini kita dirundung kegelapan,” sela Muslim Hasballah kepada

Waspada. Ia menukaskan, dimana debit air yang dibutuhkan dalam jumlah besar sehingga kawasan Tampur Kecamatan Simpang Jernih yang terletak di pedalaman Aceh Timur itu menjadi lokasi potensial untuk pembangunan PLTA ini. Pihak Daewoo Enginering-Korea Midland Power mengatakan, sangat mengharapkan adanya dukungan penuh Pemerintah Daerah Aceh Timur ini guna percepatan proyek raksasa itu. Investor ini sepertinya sangat memahami akan persoalan selama ini Aceh khusnya dan Indonesia umumnya yang terbelit dengan minimnya daya arus listrik. Sebagaimana teruraikan dalam pertemuan silaturrahmi itu, dimana masyarakat Aceh sangat

Waspada/Agusni AH

Salah seorang pejabat saat penandatanganan yang dilakukannya di hadapan Bupati Muslim Hasballah, belum lama ini.

membutuhkan penambahan arus listrik yang jumlahnya masih sangat kekurangan. ���Kami sangat memahami kebutuhan masyarakat Aceh saat ini akan minimnya arus listrik, karenanya kami mencoba berinvestasi di daerah ini. Semoga memberi keuntungan bagi semua kita,” sergah Mr. Lee Sung Dong dari Daewoo Enginering-Korea Midland Power. Ia mejelaskan, sebelum proyek fisik pembangunan bendungan PLTA dibangun, terlebih dahulu pihaknya akan membangun atau meningkatkan dan membuka akses jalan menuju lokasi pembangunan. Dengan dibangun atau dibukanya jalan tersebut akan memudahkan akses lebih lanjut sehingga segala infrastruktur lainnya dapat berdaya guna. Diharapkan pembangunan bendungan itu juga dapat bermanfaat bagi masyarakat dalam meningkatkan perekonomian hidup nantinya. “Kami akan berupaya keras membangun dua bendungan guna operasionalisasinya PLTA nanti, dan kami pastikan proyek ini akan mengutamakan kesejahteraan warga, terutama masyarakat sekitar lokasi PLTA,” tambahnya. Dua proyek bendungan ini diharapkan selain bisa menjadi pemanfaatan air bersih juga sebagai irigasi yang nantinya sarana ini akan bisa dilakukan pengairan guna pertanian dan persahawan masyarakat dalam bercocok tanam. Begitu pun, pihak investor itu berjanji memberi bea siswa sebagai bentuk memajukan dunia pendidikan di sana. ***.

DALAM RANGKA menciptakan finansial yang baik bagi segenap masyarakat pesisir, Pemerintah Kabupaten (Pemkab) Aceh Timur lewat dinas terkait coba menerabas potensi pertambakan yang selama ini “terkapar” tanpa adanya pemberdayaan. Disadari warga pesisir ini acap “tersuruk” dari setiap operasionalisasi pertambakan menyusul pembudidayaan ala tradisional itu tak memberi hasil yang prima, hal ini dikarenakan benur udang yang diserang virus mematikan belum ada obatnya. Walau kemudian pemeliharaan nener—ikan bandeng menjadi alternatif lain guna mempertahankan hidup para petani tambak di sana. Karenanya pada Kamis, 15 Desember 2010, Dinas Perikanan Dan Kelautan Aceh Timur menyerahkan bibit dan nener Poly Cultur campuran nener bandeng dan bibit udang windu kepada para petani tambak di

Desa Meunasah Tingkeum Kecamatan Madat, Aceh Timur. Sebanyak 42 kelompok tani tambak yang telah dibentuk itu diharapkan mampu memberi pendapatan dan keuntungan nantinya, sehingga budidaya dengan modal ini akan berkelanjutan. Penyerahan benur udang dan nener bandeng dilakukan Setdakab Aceh Timur, Sayaifannur, SH, MM dan diterima secara simbolis salahseorang anggota kelompok tani tambak “Burung Camar”, Tgk H. Umar, memberikan satu nilai lain akan keberpihakan pemerintah setempat terhadap masyarakat petani tambak di sana. “Wirausaha perikanan budidaya tambak ini adalah program meningkatkan produksi dan produktivitas usaha perikanan budidaya dengan penumbuhan jiwa kewirausahaan,” ungkap Setdakab Aceh Timur, Sayaifannur, SH, MM pada pe-

nyerahan bantuan nener dan benur itu. Syaifannur mengatakan, ini merupakan visi Kementrian Kelautan Dan Perikanan tahun 2015 untuk menjadikan Indonesia sebagai produksi ikan terbesar di Dunia. Untuk itu perlu dilakukan langkah-langkah nyata dalam peningkatan produktivitas dan daya saing berbasis program pemberdayaan masyarakat pembudidayaan. Pada hakikatnya akan terjadinya peningkatan kemandirian usaha masyarakat itu sendiri. Pembudidayaan ikan, peningkatan kualitas SDM dalam mengelola dan memafaatkan sumber daya alam, serta memperkuat kelembagaan usaha masyarakat pembudiyaan ikan. Syaifannur mengetengahkan, bahwa program tersebut bertujuan untuk mengoptimalkan pemanfaatan potensi sumber daya perikanan masyarakat pesisir. “Saya menyadari bahwa

bantuan benih udang dan ikan, serta pupuk ini memang belum sesuai harapan para petani tambak, tetapi bantuan yang kecil ini jika dimanfaatkan dengan sebenar-benarnya sesuai pengalaman bapak-bapak di lapangan dan dipadukan dengan ilmu dari petugas teknis lapangandariDinasKelautandan Perikanan, tentunya akan memberi hasil optimal,” tandasnya. Kepala Dinas Perikanan Dan Kelautan Aceh Timur, T. Dahlan, SE, MAP, dalam laporannya menyebutkan program Pengembangan Wirausaha Pemula Perikanan Budidaya dalam wilayah Aceh Timur diberikan kepada 42 kelompok tani, dengan jumlah bantuan berupa 470.000 ekor bibit bandeng, 705. 000 benur udang windu, pupuk urea 18.800 Kg, Pupuk TSP 9400 Kg, 47 Kg Brestan dan 188 Kg obat-obatan.DenganjumlahanggaranRp619jutadenganluasareal tambak produktif 3000 Ha. ***

Wakil Bupati Aceh Timur Nasruddin Abubakar saat meninjau daerah pesisir Idi, belum lama ini.

Waspada/Agunsi AH

Waspada/Agusni AH

Wakil Bupati Nasruddin Abubakar (kiri) ketika serahterima nota anggaran dengan pimpinan DPRK Aceh Timur di aula dewan setempat.

Perempuan Maju, Aceh Timur Bangkit DIPASTIKAN Aceh Timur bangkit dari segala keterpurukan karena adanya perjuangan kaum perempuan, tanpa mereka mustahil daerah itu berjaya. Bagaimana pun, perempuan tetap menjadi penyangga mulai tingkat komunitas rumahtangga hingga gerak roda organisasi pemerintah, dominasi perempuan merupakan titik denyut berjalannya kehidupan ini. Ilustrasi di atas dapat diisbatkan dengan apa yang berlaku di organisasi Dharma Wanita Persatuan Aceh Timur. Kendati harus diakui kodratullah bahwa perempuan sebagai tempat

pembenihan keturunan dengan proses mengandung dan melahirkan anak sedianya bertanggungjawab memelihara dan mengantar generasi ke masa depan, namun bukan berarti kaum lelaki lepas tangan dari tanggung jawab dimaksud. Tetapi kedua belah pihak harus menjalankan tugas dalam kehidupan keluarga dan masyarakat secara bekerjasama dan terpadu untuk mewujudkan manusia yang berkualitas. Begitupun perempuan harus berpikiran maju, dengan cara menuntut ilmu sebagaimana halnya yang dijalankan kaum laki-laki.

“Namun, jangan pernah lupa akan fungsi dan tugas kaum perempuan sebagai pengayom biduk keluarga atau rumahtangga,” ucap Bupati Aceh Timur Muslim Hasballah dalam sambutannya yang diwakili Asisten III Abdul Munir, SE, M.AP selaku pembina Dharma Wanita pada acara peringatan HUT XI Dharma Wanita Persatuan Kabupaten Aceh Timur, 16 Desember 2010 di Aula Dharma Wanita setempat di Langsa, (16/12). Disebutkan, bupati selalu mendukung kegiatan– kegiatan dan program– program Dharma Wanita

Persatuan Kabupaten Aceh Timur. “Kami selaku Pembina Dharma Wanita Persatuan selalu mendukung ibu-ibu dalam melaksanakan berbagai programnya demi kemajuan kaum perempuan di daerah ini. Semoga dapat tercapai segala yang dilakukan karena dengan cara ini ibu– ibu juga membantu pemerintah dalam menuju masyarakat sejahtera,” paparnya. Dengan telah memasuki usia XI ini Dharma Wanita Persatuan Kabupaten Aceh Timur ini diharapkan dapat meningkatkan pengabdiannya kepada masyarakat,

bangsa dan negara. Ketua Dharma Wanita Persatuan Pusat, Ny. Nilla F Moelek dalam sambutannya dibacakan Ketua DWP Aceh Timur, Ny. Retno Andayani Syaifannur menukaskan, bahwa tugas bangsa di masa depan adalah membangun masyarakat sejahtera, hingga kaum Ibu mempunyai kewajiban dan tanggungjawab di bidangnya. “Kiranya Dharma Wanita Persatuan bisa bersinergi dengan mitra kerja dan menjadi inspirasi pembaharuan sehingga Aceh Timur akan kembali bangkit,” harap isteri Setdakab Syaifannur, itu. ***.

Waspada/Agusni AH

Sekretaris Daerah Kabupaten Aceh Timur Syaifannur, SH, MM saat menyerahkan bibit nener— bandeng dan benur udang untuk 42 kelompok tani tambak di Desa Meunasah Tingkeum Kecamatan Madat, Rabu (15/12).



WASPADA Senin 20 Desember 2010

Pengoplos Beras Raskin Digerebek Polisi TAKENGEN (Waspada): Satuan Intel dan Reskrim Polres Aceh Tengah, menggerebek lokasi oplosan beras raskin. Seorang tersangka yang sedang mengaduk beras raskin dengan beras berkualitas, ditangkap tangan. Waspada/Muhammad Rapyan

ANAK LOBSTER: Panglima Laot Simeulue, Riswan dan Rahmad memperhatikan seekor anak lobster dari sekian banyak yang dikumpulkan bersama lobster besar dari Keramba ‘Susi Air’ di sekitar pelabuhan Ujung Sarang. Sabtu (18/12).

Panglima Laot Simeulue Tinjau Keramba ‘Susi Air’ SIMEULUE (Waspada): Panglima Laot Kabupaten Simeulue, Riswan Panter, Sabtu (8/ 12) sore ditemani salah seorang anggota DPRK setempat mengunjungi keramba tempat pengumpulan Lobster milik Susi Pudji Astuti atau yang lebih dikenal dengan ‘Susi Air’ di Ujung Sarang, Kecamatan Teluk Dalam, Simeulue. Dalam kunjungan itu Riswan kepada wakil rakyat yang menemaninya menyatakan untuk melihat dari dekat aktifitas pengumpulan hasil laut, khususnya Lobster yang dilakukan perusahaan ‘Susi Air’ dari nelayan. Juga untuk menginput informasi seputar plus minus dari kehadiran keramba dan juga aktifitas pembelian hasil laut—lobster, oleh ‘Susi Air’ terhadap ekonomi nelayan dan masyarakat setempat secara umum. Dia juga berdialog dengan para pekerja keramba seputar volume tangkapan rata-rata yang terkumpul dikeramba itu serta harga

pembelian perusahaan dari nelayan. Dia mengutarakan kepada staf perusahaan ‘Susi Air’ soal rencana Kenduri Laout Kabupaten Simeulue sekaligus memperingati tragedi tsunami. Sementara anggota DPRK Simeulue, Rahmad, SH menyatakan peninjauan itu bukanlah tugas dari lembaga melainkan sebatas untuk menemani Panglima Laout Simeulue yang mengajaknya. “Diajak, pikir-pikir sekaligus melihat prasarana jalan ke sana dan menyelami lebih dekat denyut kehidupan di desa saat ini,” jelas Rahmad. Dia berharap kehadiran mereka sesuai misi awal ‘Susi Air’ sebagaimana dijelaskan Susi Pudji Astuti, tidak hanya menjadi penampung lobster tetapi bisa menjadi soko guru peningkatan ekonomi nelayan Simeulue, melalui sistem pembinaan nelayan secara terpadu dan kontinu.(cmr)

Bupati Agara Sampaikan Nota Keuangan Perubahan APBK 2010 KUTACANE (Waspada): Bupati H. Hasanuddin. B melaluiWakil Bupati H. Syamsul Bahri, Kamis (16/12) di gedung DPRK menyampaikan nota Keuangan Perubahan APBK Aceh Tenggara tahun 2010. Berdasarkan nota keuangan yang dibacakan Wakil Bupati pada sidang Pleno tentang Rancangan Perubahan APBK 2010 dipimpin Wakil Ketua DPRK Drs. H. Syahbuddin. BP, Ketua Fraksi, Komisi dan anggota DPRK tersebut, Pendapatan Asli Daerah meningkat Rp1.980. 000.000, sebelum perubahan, tercatat Rp8.075. 880.800 , namun setelah perubahan meningkat menjadi Rp10.055.880.800. Rinciannya, untuk Pajak Daerah sebelum perubahan Rp2.200.130.500, setelah perubahan Rp2.300.130.500, Retribusi Daerah Rp3.427. 270.300 setelah perubahan Rp3.727.270.300, Hasil Perusahaan Milik Daerah dan Hasil pengelolaan daerah yang dipisahkan tercatat Rp750.000.000, setelah perubahan Rp1.500. 000.000 dan lain-lain pendapatan asli daerah

yang sah tercatat Rp1.698.480.000, setelah perubahan Rp2.528.480.000. Sedangkan untuk Perimbangan sebelumnya Rp368.593.770.773 meningkat menjadi Rp430.168.320.707. Rinciannya Bagi Hasil Pajak/Bagi hasil Bukan Pajak Rp32.809.415.773 menjadi Rp2.300.130.500, Dana Alokasi Umum Rp302.145.355.000 dan DAK Rp.33. 693.000.00 tidak mengalami perubahan. Dari Lain-lain pendapatan yang sah pada APBK tahun 2010, kata Wabup, tercatat Rp10.239.348.427, namun pada Rancangan perubahan APBK meningkat menjadi Rp115.748.609.363. Rinciannya, Pendapatan Hibah sebelum dan sesudah perubahan tetap Rp1.000.000.000. Bagi Hasil pajak Provinsi dan pemerintah daerah lainnya Rp9.239.348.427 menjadi Rp21.027.281.432, ditambah dana p e n ye s u a i a n d a n o t o n o m i k h u s u s Rp78.721.327.931, dan dana bantuan keuangan dari provinsi atau pemerintah daerah lainnya Rp15.000.000.000.(b27)

23 Karung beras bulog dengan ukuran 50 kilogram dan 40 karung beras merek berkualitas disita. Aksi penggebekan, Sabtu (18/12) sekitar pukul 07.30 di salah satu gudang beras milik tersangka Zulkifli, Belang Kolak 2, Kecamatan Bebesen, Aceh Tengah. Informasi yang dihimpun, saat digerebek tersangka sedang melakukan aksinya mencampur beras dolog raskin dengan beras berkualitas dari berbagai merek. Ada beras yang sudah dicampur, ada juga yang masih mau dicampur tersangka. “Kami akan melakukan

pengembangan lebih dalam tentang kasus ini. Siapa saja jaringan tersangka, berapa banyak sudah beras oplosan itu yang beredar di masyarakat, sudah berapa lama proses itu dilakukan tersangka,” sebut Kapolres Aceh Tengah AKBP Edwin Rachmat Adikusumo, kepada Waspada, Minggu (19/12). Barang Bukti (BB) yang disita, terindikasi tersangka telah mencampur beras raskin dengan beras merk lain. Beras tersebut dijual di pasar dengan label beras merk yang sudah cukup dikenal. Beras yang telah dicampur dan telah dijahit dalam karung dengan merek terkenal, saat disita mencapai 28 karung dengan ukuran 15 kilogram. Sementara beras bulog raskin yang belum dicampur ada 23 karung dengan ukuran 50 kilogram. Demikan juga dengan beras berkualitas didapati ada 40 karung ukuran 15 kilogram. Selain itu menurut Kapolres, BB lainnya didapat 1 unit mesin jahit, timbangan dan karung kosong. Ratusan karung kosong

dengan lebel beras berkualitas itu diamankan. Demikian dengan karung kosong berlabel bulog, jumlahnya mencapai 300 eks juga turut disita. Menurut Edwin, cara percampuran beras berkualitas dengan beras bulog raskin itu perbandingannya 50 persen. “Saat ditangkap tersangka mengaku beras bulog yang telah dicampurnya mencapai 1700 kilogram. Beras yang seharusnya dijual murah itu, justru dijual tersangka dengan harga tinggi di pasaran.” Pengakuan tersangka kepada penyidik, aksi mencampur beras itu sudah dilakukannya sejak delapan bulan lalu. Namun berapa rincian kilogram beras yang sudah dicampur tersangka belum didapat angka pasti. Selain tersangka, pihak penyidik juga meminta keterangan beberapa saksi yang mengetahui kasus tersebut. Tersangka digiring ke Mapolres Aceh Tengah untuk mempertanggungjawabkan perbuatannya.(b18/Cir)

WALHI Nilai Raqan Pengelolaan Lingkungan Masih Copi-paste BANDA ACEH (Waspada): Rancangan Qanun tentang Perlindungan dan Pengelolaan Lingkungan Hidup (Raqan Pengelolaan Lingkungan) ternyata masih memakai sistem kopipaste dari Undang-Undang No.32 tahun 2009 tentang hal yang sama. Hal ini mengakibatkan penyusuan Raqan menjadi tidak konstektual dan tidak memuat isu-isu lingkungan secara komprehensif. WALHI Aceh menyampaikan hal tersebut dalam Rapat Dengar Pendapat Umum (RPDU) yang berlangsung di aula Serba Guna Sekretariat DPRA, Jumat (17/12) di Banda Aceh. Acara dihadiri masyarakat kalangan akademisi, LSM, tokoh masyarakat dan pemerintahan membahas Raqan Pengelolaan Lingkungan terdiri dari 21 Bab

dan 54 pasal. Dibanding UU No.32 tahun 2009 yang bernama sama, namun lebih banyak bagian yaitu 27 Bab dan 127 pasal. Raqan Pengelolaan Lingkungan tidak secara komprehensif memuat persoalan-persoalan lingkungan seperti kelautan, pesisir, kehutanan, tambang dan sebagainya. Sedangkan dalam Raqan lebih banyak memuat persoalan tentang limbah semata. Padahal secara sederhana yang dimaksudkan dengan lingkungan hidup adalah segala sesuatu yang berada di luar manusia. Selain menilai Raqan tersebut tidak komprehensif,WALHI Aceh juga memberi masukan terhadap aturan yan diharapkan dapat melindungi lingkungan hidup di Aceh.

Beberapa masukan untuk Raqan Pengelolaan Lingkungan tersebut, salah satunya Pasal 1 point (9), tidak disebutkan secara spesifik apa yang dimaksud limbah B3 (Bahan Berbahaya dan Beracun). Seharusnya ada definisi spesifik tentang hal ini sesuai peraturan pemerintah yang ada. Jika tidak, maka akan ada multitafsir terhadap apa saja yang dimaksud dengan limbah B3. Sedangkan pada pasal 3 point (j) disebutkan tujuan perlindungan dan pengelolaan lingkungan hidup salah satunya adalah untuk mengantisipasi isu lingkungan hidup global. WALHI Aceh berpendapat persoalan pengelolaan lingkungan bukan karena merespon isu global tetapi memang kebutuhan dasar kita sendiri.(gto)

Dandim 0110 Abdya: Ketentraman Di Daerah Dapat Dipertahankan BLANGPIDIE (Waspada): Kondisi keamanan dan ketentraman di kabupaten Aceh Barat Daya (Abdya) yang saat ini sangat kondusif, diharapkan dapat terus dipertahankan sehingga masyarakat dapat melakukan setiap aktifitas tanpa merasakan tekanan maupun ketakutan. Dengan demikian segala sektor kehidupan akan berjalan dengan baik, seperti perekonomian, pembangunan dan bidang lainnya dapat dinikmati masyarakat. Kondisi tersebut menurut Komandan Kodim 0110 Aceh Barat Daya (Abdya) Letkol Arm E.Dwi Karyono.AS hanya dapat terbentuk apabila individu atau pribadi yang ada di setiap lingkungan masyarakat memiliki dasar tuntunan agama yang kuat, sehingga munculnya gejolak di lingkungan akan tereleminasi sejak dini, soliditas di masyarakat juga akan semakin kuat dan sulit untuk dipengaruhi untuk melakukan hal-hal yang bertentangan dengan ajaran agama, sesuai kaidah yang telah dituntun dalam Al-qur’an dan Al-hadist.

“Jika seluruh pribadi memiliki tuntunan agama yang kuat, Insyaallah tidak akan pernah ada gejolak apapun di daerah, karena pada prinsipnya, ketentraman di daerah itu terbentuk dari kepribadian yang memiliki tuntunan agama,” ujar Dandim 0110 Abdya Letkol Arm E.Dwi Karyono,AS saat menyampaikan sambutannya di acara penutupan kegiatan Arba’in, Kamis (16/12) di Pesantren Pusat Komuniti Islam Yayasan Al-Insaniyah (PUSKI YAI), Kecamatan Lembah Sabil, Abdya. Sebelumnya, pimpinan PUSKIYAI Tgk.H. Farmadi,ZA menyampaikan apresiasi atas dukungan yang sangat luarbiasa yang telah diberikan oleh keluarga besar Kodim 0110 Abdya beserta Polres Abdya terhadap pelaksanaan acara Arba’in yang diikuti oleh para peserta ‘usia emas’ tersebut, sebab selama ini menurut penilaianTgk.H.Farmadi,ZA perhatian terhadap para orang tua khususnya yang telah lansia dinilai masih sangat minim dan terkesan jauh dari pemberdayaan yang layak.(sdp)

GAMBA GEUTANYO > Neu poto keujadian meunarek ngon kamera HP 3,2 mega piksel, kirem ngon MMS keu 08192110147. Peugot nama dan alamat jih. Na imbalan pulsa 20 ribee keu poto nyang di peuteubit.

Masyarakat antre minyak tanah di pangkalan depan kantor PBB Langsa (Gp. Jawa Muka). Harga di luaran berkisar Rp4.500 sampai Rp5.000 seliter, sedangkan di pangkalan sekitar Rp3.500 tetapi terpaksa ngantre. Foto diambil Jumat (17/12). Pengirim Andi Suhendra, Tualang Teungoh, 0831880440xx

Objek Wisata Pantai Balek Tak Terurus MEUREUDU (Waspada): Objek wisata lokal di kawasan Desa Balek, Kecamatan Meureudu, Kabupaten Pidie Jaya kondisinya tak terurus, terlantar dan memprihatinkan bahkan terkesan sangat kotor dan jorok. Pantauan, Rabu (15/12), banyak terlihat kotoran sampah di sepanjang pantai. Sementara bangunan tambahan yang dibangun warga seperti café alias restoran terlihat tidak teratur. Kurangnya perawatan lokasi makin terlihat dari segi kurangnya kepedulian instansi terkait yang hanya memfokuskan perhatian ke lokasi wisata Pantai Kuthang di Kecamatan Trienggadeng, menjadi target Pemkab Pidie Jaya. Sementara pantai wisata Balek hanya tumbuh dan berkembang sendiri secara alami. Namun banyak dikunjungi warga. Di lokasi objek wisata Pantai Kuthang, Trienggadeng, meski dijadikan target pengembangannya oleh pemerintah, dinilai sulit berkembang karena warga enggan berkunjung disebabkan pantai dan lautnya yang terlalu dalam. Kondisi itu sangat berbeda dengan lokasi wisata pantai Balek, Meureudu yang memiliki laut dan pantai sangat landai disertai ombak tak terlalu besar.(b21)

Jumlah Pengangguran Meningkat BIREUEN (Waspada): Ketua Dewan Penasehat Gerakan Pemuda Ansor Kabupaten Bireuen, Said Fajri, SH memperkirakan jumlah angka pengangguran di Kabupaten Bireuen dari tahun ke tahun semakin meningkat. Demikian disampaikan, Kamis (16/12) di Bireuen. Dia menyebutkan, meningkatnya angka pengangguran di Bireuen antara lain disebabkan pertumbuhan lapangan pekerjaan yang tidak sesuai dengan pertambahan angkatan kerja. “Kalau dikaji kembali, terhambatnya pertumbuhan lapangan kerja ini juga akibat dari berbagai faktor,” ucapnya. Jika kondisi ini tidak disikapi pemerintah, Said Fajri mengkhawatirkan, fenomena akan menjadi “bom waktu” yang sewaktu-waktu akan membuat masyarakat pengganggur untuk berbuat yang mangarah anarkis. “Secara nomatif tidak ada orang ingin berbuat jahat, karena pada hakikatnya manusia ingin hidup tenang. Namun, ketika kebutuhan tidak terpenuhi, sehingga tak jarang juga orang berbuat tindak kriminal seperti mencuri, menjual narkoba, dan sebagainya,” terang Said.(cb03)

BRI- BLH Tanam 200 Pohon Di Idi IDI, Aceh Timur (Waspada): Dalam rangka memperingati hari ulang tahun ke 115, BRI Cabang Idi bekerjasama dengan Badan Lingkungan Hidup (BLH) Aceh Timur menanam 200 batang pohon untuk penghijauan di kota Idi, pusat Kab. Aceh Timur. Penanaman perdana dilakukan secara simbolis oleh Pimpinan BRI Idi, Muchlis, disaksikan Kepala BLH Kebersihan dan Pemadam Kebakaran Aceh Timur, Saiful Azhar, SH, di median jalan nasional, depan Terminal Idi, Jumat (17/12) pagi. “Pohon yang kita tanam jenis Trambesi. Ini bagian dari partisipasi keluarga besar BRI untuk menciptakan lingkungan sejuk dan sehat bagi kita semua. Dengan adanya penghijauan secara perlahan seperti ini, suatu saat, suasana kota Idi pasti akan indah dan asri,’’kata Muchlis. Kepala BLH Kebersihan dan Pemadam Kebakaran Aceh Timur, Saiful Azhar menyatakan sangat mendukung dan menyambut baik langkah penghijauan yang dilakukan BRI. Dia berharap, lembaga dan instansi lain juga melakukan langkah serupa.(cmus/ cmad)

BUMN Tanam 1 Miliar Pohon

Waspada / H. Rusli Ismail

JUALAN DI TANGGA : Para pedagang sayur terpaksa menggelar dagangannya di tangga Pasar Seutui, Kota Banda Aceh untuk menyambung hidup. Tak ada tempat lain bagi mereka untuk mencari rezeki, diperburuk lagi dengan parkir kendaraan roda dua di pinggir kiri dan kanan jalan masuk ke pasar ikan dan sayur sehingga suasananya menjadi tambah semakin sempit dan semraut.Sedangkan lantai dua dari Pasar itu yang diperuntukkan untuk pedagang sayur kondisinya sangat memprihatinkan karena tergenang air menyusul atapnya sejak lama sudah bocor. Namun, puluhan pedagang yang terdiri dari nyak-nyak (perempuan-red) tetap tabah berjualan di sana yang setiap saat harus berhimpitan. Pada foto hanya tampak sebagian pedagang saja. Foto diabadikan minggu lalu.

Pemerintah Tipu Korban Konflik BANDA ACEH (Waspada): Aceh Judicial Monitoring Insdtitute (AJMI) menyatakan Pemerintah Aceh, dalam hal ini eksekutif dan legislatif Aceh, telah bersekongkol melakukan penipuan terhadap pemenuhan hakhak masyarakat korban konflik. Pernyataan ini disampaikan atas dasar pengkhianatan oleh eksekutif dan legislatif Aceh terhadap kesepakatan yang telah dibangun bersama dengan masyarakat korban konflik pada 15 Oktober 2010, menyangkut pemenuhan tuntutan masyarakat untuk memasukkan dana diyat tahun 2010 ke APBA-P 2010. Pada pertemuan tersebut, ahli waris korban konflik Aceh

didampingi AJMI, eksekutif diwakili Asisten II Said Mustafa dan Karo Isra Bukhari, Kadis Sosial M. Nasir Mahmud, BRA diwakili Direktur Komplain Linggadinsyah, serta Hasbi Abdullah, Tgk. Adnan Beuransyah danTgk. Darmuda mewakili DPRA. Pertemuan melahirkan kesepakatan bersama bahwa BRDA akan mengusulkan kembali anggaran Diyat 2010 untuk korban konflik Aceh ke dalam APBA-P 2010 melalui Dinas Sosial, untuk dibahas pada rapat pembahasan di DPRA dan menjadikan persoalan masyarakat korban konflik Aceh sebagai skala prioritas terhadap pembangunan Aceh.

Kasus Narkoba Paling Menonjol


Waspada / H. Rusli Ismail

KOTOR DAN JOROK: Kondisi objek wis ata pantai di Desa Balek, Kecamatan Meureudu, Kabupaten Pidie Jaya dipenuhi sampah sehingga kotor dan jorok. Foto direkam tiga hari lalu.

BIREUEN (Waspada): Dari 237 perkara pidana yang masuk dan diadili di Pengadilan Negeri Bireuen hingga pertengahan Desember 2010, kasus narkoba mencapai 144 perkara paling menonjol dibanding perkara pidana lainnya. Perkara pidana yang masuk PN Bireuen tahun 2010 meningkat dibanding tahun 2009 yang hanya 228 perkara. Ketua PN Bireuen Sapruddin, SH menjelaskan di ruang kerjanya Kamis (16/12), 225 perkara pidana termasuk sisa 51 perkara pidana bulan November 2010 yang diadili PN Bireuen sudah diputus sisanya 12 perkara dalam proses peradilan. Sementara kasus tindak pidana korupsi 6 perkara, 5 perkara sudah diputus dan satu perkara lagi yaitu kasus dugaan korupsi mantan bendahara Disdik Bireuen Fauzan bin A Rahman masih dalam proses. (b16)

Namun, sebut Pj. Direktur AJMI, Agusta Muktar, kesepakatan tersebut ternyata telah dicederai oleh para eksekutif yang tidak mengajukannya dalam APBA-P 2010, serta legislatif yang tidak menegur dan mempertanyakan tidak adanya poin kesepakatan tersebut dalam pembahasan APBA-P kepada eksekutif. Menurut dia, penipuan ini sudah terlihat dari tindaklanjut terhadap hasil kesepakatan, yang dilakukan AJMI dengan melakukan audiensi dengan Badan Reintegrasi Damai Aceh (BRDA) pada 23 November 2010 diterima Linggadinsyah (Direktur Komplain). Dalam audiensi, kata Agusta, Linggadinsyah mengatakan pihak BRA telah mengusulkan anggaran dana diyat 2010 sebesar Rp60 miliar untuk masyarakat korban konflik Aceh melalui Dinas Sosial untuk diusulkan kepada DPRA dan dibahas dalam APBA-P 2010. “Dana ini diprioritaskan bagi masyarakat korban konflik yang baru sekali mendapat dana diyat Rp3 juta, dan masyarakat yang baru menerima dua kali untuk jumlah Rp6 juta, untuk disamaratakan menjadi tiga kali Rp9 juta.(b07)

ACEH UTARA (Waspada): Untuk mencegah bencana abrasi dan pemanasan global, pada tahun 2010 Badan Usaha Milik Negara (BUMN) mencanangkan program penanaman 1 miliar pohon untuk seluruh Indonesia. Khusus untuk Provinsi Aceh, jumlah pohon yang akan ditanam 60 ribu batang tersebar di tiga lokasi. Ke tiga lokasi itu yakni Kabupaten Aceh Utara 20 ribu batang, langsung ditangani PT. Pupuk Iskandar Muda (PIM), Kabupaten Aceh Timur 20 ribu batang, ditangani oleh PTPN1 dan Aceh Besar 20 ribu batang, ditangani oleh BRI dan PLN. Jenis pohon yang ditanam manggrov dan Tranbesi. Liza Mustafa Abubakar, Ketua Umum Ikatan Isteri Pemimpin Badan Usaha Milik Negara (IIP-BUMN) menyebutkan, secara nasional jumlah pohon yang ditanam 1 miliar batang. Di Kabupaten Aceh Utara pohon manggrov sebanyak 20 ribu batang akan ditanam di Gampong Lancok, Kec. Syamtalira Bayu. Gampong tersebut pada tahun 2004 luluh lantak diterjang tsunami. “Semoga dengan penanaman pohon manggrov, resiko bencana alam dapat diminimalisir. Pohon ini mampu mengikat air dan Co2,” ujar isteri Mentri BUMN Mustafa Abubakar.(cmun)

Waspada/Maimun Asnawi

MENANAM POHON: Liza Mustafa Abubakar, Ketua Umum IIP BUMN, Kamis (16/12) menanam pohon manggrov di lokasi perumahan PT. PIM.

Waspada, Senin 20 Desember 2010