Issuu on Google+

Berastagi 20-32 C

R. Prapat 25-340C

Parapat 20-33 0C

P. Siantar 17-280C

Sibolga 22-32 0C



Hujan guntur

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Senin Medan 24-340C

BMKG Polonia

SENIN, Pon, 1 November 2010/24 Zulqaidah 1431 H

No: 23314 Tahun Ke-64

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman (A1-8, B1-8, C1-12)

Harga Eceran: Rp2.500,-

Merapi Meletus Lagi 5 Kali


SUASANA pemukiman penduduk di Pulau Pagai Utara, Kepulauan Mentawai, Minggu (31/10). Pemukiman ini dilanda gempa dan tsunami beberapa hari yang lalu.

SBY Persilakan Negara Sahabat Bantu Mentawai HANOI (Antara): Presiden Susilo Bambang Yudhoyono mempersilakan negara sahabat untuk terlibat dalam proses rekonstruksi pascabencana namun tidak untuk proses tanggap darurat. “Bantuan untuk rekonstruksi itu saya persilahkan, tapi untuk tanggap darurat,

Lanjut ke hal A2 kol. 1


SEJUMLAH korban selamat bencana tsunami Mentawai mendapat perawatan di Puskesmas Sikakap, Mentawai, Sumatera Barat, Sabtu (30/10).

BOYOLALI (Antara): Pos Pengamatan Gunung Merapi di Jrakah, Boyolali, Jawa Tengah, mencatat gunung berapi di perbatasan wilayah Jawa Tengah dan Yogyakarta ini telah meletus sekitar empat hingga lima kali pada Minggu (31/10) sore. “Letusan terjadi pada rentang waktu antara pukul 14:28 hingga 15:17,” kata Pos Pengamatan Gunung Merapi di Jrakah, Boyolali, Purwono. Namun, lanjut dia, dari pos ini tidak diketahui ke arah mana material Merapi yang disemburkan tersebut. Ia menuturkan, saat letusan pertama sempat dilaporkan arah letusan ke Selatan. “Setelah itu tidak diketahui karena puncak Merapi tertutup kabut tebal,” katanya. Petugas pos pengungsian Samiran, Kec. Selo terus mengevakuasi para penduduk yang berada di kawasan rawan letusan Merapi. Sejumlah desa di lereng Merapi, seperti Sumber, Bakalan, serta Stabelan, terus dievakuasi. Selain itu, dilaporkan kawasan Kec. Cepogo diguyur abu vulkanik atau hujan abu.


WARGA panik menyelamatkan diri setelah terjadi erupsi Merapi disertai awan panas di Samiran, Selo, Boyolali, Jateng, Minggu (31/10). Empat hingga lima kali letusan antara 14:28-15:17 menimbulkan kepanikan warga.

Warga Kampung Bawah Trauma PERCUT SEITUAN (Waspada): Pasca bentrok dua kelompok penggarap di Dusun III A, Jalan Selambo, Desa Amplas, Kecamatan Percut Seituan Jumat (29/10) hingga Sabtu (30/10) warga Kampung Bawah mengaku trauma.

Pantauan Waspada di Kampung Bawah, Minggu (31/10) beberapa anggota kepolisian masih berjaga-jaga di sekitar lokasi kejadian dan rumah-rumah warga terlihat sepi karena para wanita dan

anak-anak masih mengungsi di Masjid Al Barokah dan para pria mengungsi di ruangan majelis yang biasa dijadikan tempat wirid yang berada di tengah pemukiman warga. Awaluddin Limbong, 32,

warga Kampung Bawah (Kampung Melayu), Dusun III A, Desa Amplas, Kec.Percut Seituan mengaku masih trauma atas penyerangan yang dilakukan warga Kampung Atas. “Sejak Jumat (29/10) kemarin

kami mengungsi di sini karena masih takut untuk pulang. Yang lainnya ada yang tidak bisa pulang lagi karena rumahnya dibakar oleh warga Kampung Atas,” ujar Awaluddin. Khairul Anwar, 38, warga

yang sama mengaku tidak tahu akan bermukim dimana lagi karena rumahnya hanya tinggal puing-puing saja karena musnah dibakar oleh kelompok Kampung Atas. “Setelah suasana kondusif saya

tidak tahu mau tinggal dimana lagi karena rumah yang selama ini saya dan keluarga tempati sudah musnah terbakar,” ratapnya.

Lanjut ke hal A2 kol. 6

Polisi Periksa 32 Saksi Kasus Bentrok Selambo MEDAN (Waspada): Suasana di lahan garapan Selambo Dusun III-A Desa Amplas, Kec. Percut Seituan, pasca penyerangan yang dilakukan kelompok Kampung Atas terhadap warga Kampung Bawah (Kampung Melayu), Minggu (31/10) sekira pukul 14:00, terlihat normal. Satu regu petugas Polsekta Percut Seituan terlihat mengawasi lahan yang sudah lama menjadi sengketa. Di bagian lain, warga Kampung Melayu yang rumahnya dibakar oleh kelompok penye-


JEMBATAN di perbatasan Desa Lueng Sa dan Desa Matang Guru, Kec. Madat Aceh Timur, ambruk saat dilintasi sebuah truk bermuatan sekitar 950 batang bibit sawit, Minggu (31/10) dinihari.

Jembatan Matang Guru Ambruk,Lima Desa Terisolir, 1 Truk Masuk Ke Sungai MADAT, Aceh Timur (Waspada): Jembatan tua berleger besi di perbatasan Desa Lueng Sa dan Desa Matang Guru Kec. Madat Aceh Timur, ambruk saat dilintasi satu unit truk colt bermuatan 950 batang bibit sawit, Minggu (31/10) sekira pukul 01:00. Tak ada korban jiwa, namun truk colt BL 9577 AA itu

beserta bibit sawit di dalamnya dipastikan rusak, karena kecebur dalam sungai. Selain itu, 5 desa di seberang jembatan, yakni Desa Matang Guru, Pante Bayam, Menasah Hasan, Lueng Dua dan Desa Meunasah Tingkeum, terisolir lantaran sebagian jembatan hancur total. Sopir truk, Ilyas, 36, asal

Desa Peudawa Rayeuk, Kec. Peudawa, Aceh Timur, saat ditemui Waspada di lokasi kejadian menjelaskan, insiden itu terjadi amat cepat. Bahkan, ia yang saat itu seorang diri dalam mobil, tidak sempat melompat sebelum truknya terjun bebas ke sungai.

Lanjut ke hal A2 kol. 2

Golkar Larang Kadernya Ke LN MAKASSAR (Antara): Ketua Umum Partai Golongan Karya (Golkar), Aburizal Bakrie, di bandar udara (Bandara) Sultan Hasanuddin, Minggu (31/10), menandatangani instruksi yang melarang seluruh kadernya di semua tingkatan ke luar negeri. “Keberangkatan ke luar negeri hanya dapat dilakukan atas izin dari Dewan Pimpinan Pusat, ada sanksi organisasi bagi yang melanggar,” katanya. Bagi yang sudah terlanjur ke luar negeri, lanjutnya, diminta untuk mempersingkat kunjungannya. “Alasan ins-

Pencurian sepeda motor, pencurian dengan penganiayaan berat, mendominasi kasus tindak pidana di Polresta Medan Januari-September 2010.


14 Korban kapal kargo Olimpia Baru yang tenggelam di Tanjung Siapi-api masih mengalami trauma sehingga belum bisa memberikan keterangan. C1

Wakil Gubernur Aceh Muhammad Nazar memperkirakan pembangunan Baitul Asyi (rumoh Aceh) di Makkah akan tuntas tiga tahun lagi. C10

Waspada/Andi Aria Tirtayasa

PULUHAN warga Kampung Melayu (Kampung bawah), Minggu (31/10) berkumpul di kantor Yayasan Sosial Pendidikan Al Baroqah (YASPA) Di Dusun III-A Desa Amplas.

Rencana Utama Keterhubungan Nasional Selesai Akhir 2010 HANOI (Antara): Presiden Susilo Bambang Yudhoyono mengatakan bahwa rencana utama keterhubungan nasional Indonesia akan telah siap pada akhir 2010. “Sebelum tahun baru 2011 akan kita sampaikan master plan ekonomi,master plan yang lebih konkit sehingga kita

bisa menjelaskan konektivitas seperti apa, peran daerah seperti apa sehingga keterhubungan domestik dan kawasan menjadi tanggung jawab bersama,” kata Presiden dalam konferensi pers di Hotel Grand Plaza Hanoi, Minggu (31/10) pagi, sebelum kembali ke Jakarta.

Musim Haji Peluang Emas

Pencurian Marak

Rumoh Aceh Di Makkah Rampung Tiga Tahun Lagi

truksi ini karena negara dalam kondisi sulit keuangan dan tengah dilanda bencana alam,” jelasnya. Ia mengemukakan, tahun ini partai berlambang pohon beringin tersebut belum memberikan izin ke luar negeri. “Berapa lama kita lihat apakah 2011 nanti sudah dibolehkan. Untuk tahun ini yang jelas tdak ada izin kecuali untuk hak urgensi dan penting untuk hadir,” ujarnya. Instruksi ini juga berlaku untuk keberangkatan ke luar negeri dengan biaya sendiri, dan tetap harus ada ijin dari partai.

Cerita Dua PRT:


Korban Kapal Tenggelam Trauma

rang, mengungsi ke Masjid Al Baroqah. Sebagian lagi warga menginap di kantor Yayasan Sosial Pendidikan Al Baroqah (YASPA) di Dusun III-A. Mereka masih trauma akibat penyerangan yang dilakukan kelompok Kampung Atas, apalagi ratusan penyerang bersenjata parang, kelewang dan golok, terlebih dahulu membabati tanaman milik warga dan kemudian menyerang siapa saja yang berada di areal garapan tersebut. Lanjut ke hal A2 kol. 6


NURLAILI, 59, jamah haji asal Indonesia membaca daftar nama sambil berdoa di posisi lurus dengan multajam di Masjjidil Haram, Mekkah, Arab Saudi, Minggu (31/10).

Jamaah Kloter 16 Protes MEDAN (Waspada) : Jamaah calon haji kloter 16 asal Medan, seorang diantaranya bernama Yudhi Asta Avifa nomor manifest 446 mengaku sangat kecewa dengan kondisi kamar di maktab mereka. Yudi yang mengirim pesan melalui SMS, Minggu (31/10) menuliskan, maktabnya di Makkah berada di Bakhutman 811. Di tempat ini ada beberapa kamar khususnya di 506,

Lanjut ke hal A2 kol. 3

MUSIM Haji 2010 masih sekitar dua minggu lagi dari sekarang, banyak warga Saudi dan warga asing bergegas menuju Makkah dan kota-kota suci lainnya untuk bekerja. Sementara sebagiannya berangkat dengan sepengatuan sponsor mereka, yang lainnya pergi tanpa izin, ketika Haji merupakan saatnya membuat pendapatan bertambah 10 kali lipat dari apa yang mereka hasilkan dari pekerjaan mereka yang biasanya. Lyly Pramana, seorang pembantu rumahtangga (PRT) yang lari dari majikannya, mengatakan, bekerja di Makkah selama musim Haji merupakan satu peluang emas untuk memperoleh banyak uang.

Lanjut ke hal A2 kol. 3

PAMUSUK dan isterinya Djuriah.

Waspada/Anum Saskia

Alhamdulillah, Terkabul Ke Haji Bersama Isteri MEDAN (Waspada) : Duduk berduaan sembari melihat para Calhaj hilir mudik di depan penginapan di lingkungan Asrama Haji Medan, ternyata memberikan kebahagiaan tersendiri bagi pasangan Pamusuk Dongoran,75 dan Djuriah, 63 asal Aekaru Padang Lawas yang tercatat sebagai calon jamaah haji kloter 17. Kakek-nenek ini nampak sangat akrab, sang kakek yang tadinya memegang tongkat, karena kakinya yang sakit ketika dibawa berjalan, seolah mampu menahan sakit. Lanjut ke hal A2 kol. 3

Menurut Presiden, Indonesia telah aktif membangun kerjasama dengan kawasan terutama ASEAN dalam hal mewujudkan keterhubungan kawasan sebagaimana citacita ASEAN. ‘Tapi kedepannya keterhubungan secara fisik tidak cukup, ...kita akan membangun keterhubungan yang juga tidak hanya fisik,”katanya. Kepala Negara mengatakan ada sedikitnya 15 proyek keterhubungan di kawasan ASEAN, untuk Indonesia antar alain lain meliputi proyek pembangunan jalan kereta api, jalan raya dan energi listrik. Sementara itu para pemimpin ASEAN mengadopsi rencana utama Keterhubungan ASEAN dalam pertemuan puncak ke-17 ASEAN, Kamis (28/10). Menurut Perdana Menteri Vietnam Nguyen Tan Dung

Lanjut ke hal A2 kol. 1

erampang Seramp ang - Boleh ke luar negeri, pakai uang sendiri - He...he...he...

Medan 24-34 C

P.Sidimpuan 20-320C

R.Prapat 25-34 0C

Penyabungan 20-33 0C

Berastagi 17-280C

Sibolga 23-320C Hujan guntur


WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca 0

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

SENIN, Pon, 1 November 2010/24 Zulqaidah 1431 H z No: 23314 * Tahun Ke-64

Terbit 28 Halaman (A1-8, B1-8, C1-12) z zHarga Eceran: Rp 2.500,-

Jembatan Matang Guru Ambruk

Pasca Bentrok Di Selambo

Polisi Periksa 32 Saksi

5 Desa Terisolir, 1 Truk Kecebur Ke Sungai

MADAT, Aceh Timur (Waspada): Jembatan tua berleger besi di perbatasan Desa Lueng Sa dan Desa Matang Guru Kec. Madat Aceh Timur, ambruk saat dilintasi satu unit truk colt bermuatan 950 batang bibit sawit, Minggu (31/10) sekira pukul 01:00 WIB. Tak ada korban jiwa, namun truk colt BL 9577 AA itu beserta bibit sawit di dalamnya dipastikan rusak, karena kecebur dalam sungai. Selain itu, 5 desa di seberang jembatan, yakni Desa Matang Guru, Pante Bayam, Menasah Hasan, Lueng Dua dan Desa Meunasah Tingkeum, terisolir lantaran sebagian jembatan hancur total. Sopir truk, Ilyas, 36, asal Desa Peudawa Rayeuk, Kec. Peudawa, Aceh Timur, saat ditemui Waspada di lokasi kejadian menjelaskan, insiden itu terjadi amat cepat. Bahkan, ia yang saat itu seorang diri dalam mobil, tidak sempat melompat sebelum truknya terjun bebas ke sungai. “Sebelumnya tidak ada reaksi mencurigakan. Malahan, mobil hampir sampai di bantaran seberang. Dalam tempo singkat, tiba-tiba terdengar suara seperti besi patah, lalu mobil langsung kecebur ke sungai. Untungnya, saya bisa cepat keluar lewat pintu kanan,” kata Ilyas. Ilyas menambahkan, bibit sawit yang dibawanya merupakan bantuan Dinas Perkebunan dan Kehutanan untuk masyarakat Desa Meunasah Tingkeum, Madat. “Bibit itu saya ambil kawasan Paya Gajah Peureulak. Berat totalnya masih dalam batas normal, yakni sekitar 8 ton.

Lanjut ke hal A2 kol 3


AMBRUK: Jembatan tua berleger besi di perbatasan Desa Lueng Sa dan Desa Matang Guru, Kec. Madat Aceh Timur, ambruk saat dilintasi sebuah truk bermuatan sekitar 950 batang bibit sawit, Minggu (31/10) dinihari. Tidak ada korban jiwa dalam musibah ini, namun lima desa di seberang sungai terisolir.

MEDAN (Waspada): Suasana di lahan garapan Selambo Dusun III-A Desa Amplas, Kecamatan Percut Seituan, pasca penyerangan yang dilakukan kelompok Kampung Atas terhadap warga Kampung Melayu, Minggu (31/10) sekira pk 14:00, terlihat normal. Satu regu petugas Polsekta Percut Seituan terlihat mengawasi lahan yang sudah lama menjadi sengketa antar sesama kelompok penggarap tersebut. Di bagian lain, warga Kampung Melayu yang rumahnya dibakar oleh kelompok penyerang, terlihat mengungsi ke dalam Masjid Al Baroqah. Sebagian lagi warga menginap di kantor Yayasan Sosial Pendidikan Al Baroqah (YASPA) di Dusun III-A. Mereka terlihat masih trauma akibat penyerangan yang dilakukan oleh kelompok Kampung Atas tersebut, apalagi ratusan penyerang bersenjatakan parang, kelewang dan golok, terlebih dahulu membabati tanaman milik warga dan kemudian menyerang siapa saja yang berada di areal garapan tersebut. Warga Kampung Melayu juga terpaksa mendirikan dapur umum, sekaligus menyediakan masakan bagi seluruh warga yang menjadi korban termasuk pemilik dan keluarga dari tujuh rumah yang musnah dibakar oleh kelompok penyerang. Mereka juga kecewa dengan sikap petugas Polsekta Percut Seituan yang dinilai tidak tegas dalam menangani kasus di areal tanah garapan tersebut. Sabarudin Sagala, 55, warga Kampung Melayu mengatakan, setelah peristiwa penyerangan tersebut, mereka seperti mendapat musibah

Lanjut ke hal A2 kol 3

Amien: Bencana Ini Azab Pemindahan Penduduk Bak Dialami Kaum Luth Mentawai Dipertimbangkan YOGYAKARTA (Waspada): Ketua Majelis Pertimbangan Partai Amanat Nasional Amien Rais berpendapat, bencana yang silih-berganti di Indonesia adalah azab dari Tuhan. Menurut Guru Besar Hubungan Internasional Universitas Gadjah Mada itu, orang Indonesia harus introspeksi.

JAKARTA (Antara): Pemerintah mempertimbangkan untuk memindahkan penduduk Kepulauan Mentawai dari pesisir barat yang lebih rawan terkena tsunami ke pesisir timur yang lebih aman.

Menteri Koordinator Politik, Hukum dan Keamanan (Polhukam) Djoko Suyanto di Bandara Halim Perdanakusuma, Jakarta, Minggu (31/10) mengatakan, pemindahan pemukiman penduduk bukanlah persoalan sederhana. Karena itu, menurut Djoko Suyanto, tidak mudah memindahkan masyarakat pesisir yang terbiasa hidup sebagai nelayan ke daerah berbeda dengan tempat hidupnya. “Yang perlu dipikirkan

“Ini teguran dan jeweran dari Tuhan,” kata Amien usai melantik Dewan Pimpinan Wilayah PAN Daerah Istimewa Yogyakarta, Minggu (31/10). “Saat ini, bangsa kita banyak sekali ketidakadilan, kemerosotan moral, bahkan di pengadilan pun sulit mencari keadilan dan kebenaran,” katanya. Amien Rais

Lanjut ke hal A2 kol 2

Terkait Kasus Korupsi Dana Inbup Rp 4,1 M

45 Mantan Anggota DPRK Aceh Timur Akan Ke Pengadilan LANGSA (Waspada): Mantan Bupati Aceh Timur Drs Azman Usmanuddin yang kini sedang menjalani masa tahanan di LP Langsa dalam kasus penyalahgunaan dana Instruksi Bupati (Inbup) pada tahun 2002-2003 senilai Rp4,1 miliar, dilaporkan akan segera menyeret 45 mantan anggota DPRK Aceh Timur periode 1999-2004 ke pengadilan. Para mantan anggota DPRK Aceh Timur itu dianggap telah memberikan keterangan palsu di pengadilan,

saat dirinya (Azman) menjalani persidangan atas kasus tersebut. Di persidangan Azman terdahulu, para mantan anggota Dewan yang dimintai keterangannya sebagai saksi, di hadapan majelis hakim mengaku tidak pernah menerima menerima aliran dana Inbup tahun 2002-2003 saat Azman Usmanuddin menjabat sebagai Bupati Aceh Timur. Namun faktanya, seluruh anggota DPRK Aceh Timur

Lanjut ke hal A2 kol 6

Politisi Jangan Kisruhkan Sumut Pasca Panahanan Syamsul


PENGUNGSI MENTAWAI. Sejumlah warga korban gempa tsunami berada di dalam tenda pengungsian di Desa Montei Baru Baru, Kepulauan Mentawai, Sumatera Barat, Sabtu (30/10). Sebanyak 22.595 warga Kepulauan Mentawai hingga kini masih mengungsi pascagempa berkekuatan 7,2 skala Richter disertai tsunami yang melanda kawasan itu pada 25 Oktober 2010, sebagian besar mereka mengungsi ke tempat tinggi karena diyakini aman dari terjangan tsunami.

Merapi Tiga Kali Meletus Disertai Awan Panas SLEMAN (Antara): Gunung Merapi Minggu (31/10) kembali mengeluarkan letusan dengan tiga kali menyemburkan awan panas. “Sepanjang siang hingga malam hari ini telah tiga kali Gunung Merapi mengeluarkan awan panas secara ekplosif yang semuanya mengarah ke selatan,” kata Kepala Badan Geologi, Kementerian ESDM

Sukhyar di Kantor Balai Penyelidikan dan Pengembangan Teknologi Kegunungapian (BPPTk) Yogyakarta, Minggu. Menurut dia, letusan pertama terjadi pada pukul 14:28 WIB yang diawali dengan gempa vulkanik dengan durasi awan panas sekitar empat menit, kemudian pada

Lanjut ke hal A2 kol 1

JAKARTA (Antara): Kalangan politisi di Sumatera Utara diharapkan tidak mengeluarkan pernyataan dan melakukan tindakan yang dapat mengkisruhkan kondisi daerah yang kondusif pascapenahanan Gubernur Syamsul Arifin. “Situasi Sumut sangat kondusif, jadi jangan dipanaspanasi,” kata pengurus harian DPD PDI Perjuangan Sumut Baskami Ginting usai menjenguk Gubernur Syamsul Arifin di Rutan Salemba, Jakarta, Minggu (31/10). Selama ini, kata Baskami, roda pemerintahan di Sumut sangat kondusif karena kekompakan dan kesolidan “Trio Pemprov Sumut” yakni Gubernur Syamsul Arifin, Wagub Gatot Pudjo Nugroho dan Sekretaris Daerah RE Nainggolan. Kondusivitas itu semakin baik karena dalam dua tahun lebih kepemimpinan Gubernur Syamsul Arifin dan wakilnya Gatot Pudjo Nugroho perekonomian Sumut mengalami peningkatan. Namun sayangnya, ada indikasi untuk mengganggu kondusivitas itu melalui pernyataan sejumlah pihak yang dinilai kontraproduktif. Lanjut ke hal A2 kol 3


MERAPI MASIH BERBAHAYA. Asap sulfatara terus membumbung dari puncak Gunung Merapi diabadikan dari Pos Pengamatan Gunung Merapi Babadan, Dukun, Magelang, Jateng, Minggu (31/10). Hingga saat ini Gunung Merapi terus menyemburkan aktivitasnya berupa awan panas, guguran lava dan kegempaan yang tidak menunjukkan penurunan sehingga masih membahayakan dan tetap pada status “Awas”.

mungkin kalau yang sekarang di pesisir barat pindahnya ke pesisir timur,” tuturnya. Masalah pemindahan tersebut, kata dia, akan dibahas pemerintah provinsi bersama dengan instansi terkait seperti Kementerian Lingkungan Hidup dan Kementer ian Kehutanan. Djoko yang berada di Bandara Halim untuk menyambut kedatangan Presiden Susilo Bambang Yudhoyono dari Hanoi, Vietnam, mengatakan,

Kepala Negara belum memberikan instruksi baru terkait penanganan bencana tsunami di Kepulauan Mentawai. “Tetap seperti yang kemar in, jadi diteruskan saja program-program rehabilitasi terutama,” ujarnya. Djoko mengakui ditribusi bantuan ke Kepulauan Mentawai tersendat-sendat karena kendala cuaca. Menurut dia, semua kapal penyalur bantuan bisa

Lanjut ke hal A2 kol 6

Letusan Krakatau Ratusan Kali LAMPUNG (Antara): Aktivitas Gunung Anak Krakatau (GAK) di perairan Selat Sunda masih berstatus waspada meski letusan gunung itu diperkirakan mencapai ratusan kali sepanjang Minggu (31/10). Kepala Pos Pengamatan Gunung Anak Krakatau (GAK) di Desa Hargopancuran Kecamatan Rajabasa, Andi Suardi, mengatakan di Rajabasa, Minggu, dari pukul 00:01 WIB sampai 12:25 WIB Minggu siang, intensitas letusan tercatat sebanyak 66 kali.

“Sampai nanti malam letusan dipastikan mencapai ratusan kali,” terang dia. Sementara, lanjut dia, gempa vulkanik dalam mulai Minggu pagi hingga siang, mencapai 32 kali, gempa vulkanik dangkal 45 kali dan gempa tremor 26 kali serta hembusan 40 kali. “Ketinggian semburan pasir dan abu vulkanik mencapai diatas 500 meter,” kata dia. Lalu, lanjut dia, dengan

Lanjut ke hal A2 kol 1

Aneh, Bayi Kembar Tapi Beda Ras SHIRLEY WALES sudah tahu akan memiliki anak kembar sejak masa kehamilan. Tapi, sama sekali tak terbayang di benaknya bahwa dua buah hatinya itu terlahir dengan dua ras berbeda. Bayi laki-lakinya bernama Leo menuruni gennya Shirley Wales bersama anak yang seorang Grenadian: kembarnya. kulit gelap, mata coklat, dan rambut ikal coklat. Sedangkan bayi perempuannya, Hope, menuruni gen mantan suaminya: kulit putih, mata biru, dan rambut pirang. Lewat operasi caecar di Dewsbury District Hospital, West Yorkshire, dua bayi itu lahir sehat dan selamat. “Saya tahu akan punya anak kembar dampit, tapi saya syok ketika perawat memberi tahu mereka punya warna kulit berbeda,” ujar Wales. Meski demikian, Wales menganggap bayi kembarnya sebagai sebuah anugerah. Ia menyapa dua bayinya yang sudah berusia 14 bulan dengan panggilan Leo the Lion dan Happy Hope. “Kalau saya cuma menggendong Hope, orang pasti akan mengira itu keponakan saya,” katanya. Kelahiran bayi kembar itu menyita perhatian media dan orang-orang di sekitarnya. Tak kurang 100 orang datang berkunjung di dua hari awal pascapersalinan. Di dunia medis kasus semacam itu memang mungkin terjadi. Bahkan, di sejumlah negara ada kasus yang lebih mencengangkan yakni bayi kembar beda ayah. Setidaknya kasus ini terjadi di Texas, Turki, dan China. (VIVAnews)


POHON KELAPA CABANG TUJUH: Pohon kelapa bercabang tujuh di temukan d i D e s a S e i Te m p u r u n g , Kecamatan Sei Kepayang Timur, Asahan, dengan kondisi sudah mati dimakan usia. Pohon kepala seperti itu diperkirakan banyak tumbuh di daerah pedalaman Asahan, namun sayang pertumbuhan dan keberadaannya kurang diperhatikan. Foto direkam, pekan lalu.

Serampang - Ngeri juga pendapat Pak Amien .... - He.... he....he....

Berita Utama


WASPADA Senin 1 November 2010

Pajak Daerah Mahal Di Tobasa

Gempa 4,8 SR Guncang Jayapura JAYAPURA (Antara): Badan Meteorologi, Klimatologi, dan Geofisika (BMKG) wilayah V Jayapura menginformasikan bahwa terjadi gempa berkekuatan 4,8 Skala Richter di darat dengan pusat 86 kilometer sebelah Barat Jayapura, Papua. Gempa yang terjadi Minggu malam pukul 20.50 Waktu Indonesia Timur (WIT) itu, berada pada kedalaman 14 kilometer dan berlokasi di 2,82 Lintang Selatan (LS) -139,99 Bujur Timur (BT). Hingga berita ini diturunkan, belum ada laporan dari instansi berwenang kerusakan atau korban jiwa.

Waspada/Sukri Falah Harahap


DOA UNTUK KELUARGA. Nurlaili ,59, jamah haji asal Indonesia membaca daftar nama seluruh anak dan cucunya serta doa untuk mereka masing-masing di posisi lurus dengan multajam di Masjidil Haram, Makkah, Minggu (31/10). Nurlaili yang datang sejak dini hari ke masjid itu tidak dapat mendekati Ka’bah karena penuhnya jamaah yang beribadah.

Merapi Kembali ....

pukul 15:16 WIB kembali terjadi awan panas letusan dengan durasi lima menit disertai dentuman dan gemuruh yang terdengar dari Pos PGM Babadan, Magelang dan Selo, Boyolali. “Arah awan panas menuju Kali Gendol yang terpantau dari Kaliurang dan getaran terasa di Babadan dan Selo,” katanya. Ia mengatakan, awan panas ketiga terjadi pada pukul 15:23 WIB dengan intensitas sedang dan bedurasi tiga menit menuju Kali Lamat, Senowo, Krasak dan Gendol. “Luncuran terjauh mengarah ke Kali Gendol,” katanya. Sukhyar mengatakan, pengamatan dari Pos PGM Jrakah, Boyolali awan panas meluncur ke Kali Api sejauh 1,5 kilometer dan Kali Senowo sejauh dua kilometer. “Fenomena Merapi ini sebenarnya merupakan guguran lava yang ada di puncak dan turun ke lembah,” katanya. Ia mengatakan, karena kawah Merapi terbuka ke sisi selatan maka alirannya ke Sungai Gendol dan tidak jauh maksimal empat kilometer. “Kemungkinan letusan dan dentuman seperti ini masih ada .Energi di dalam masih besar dan yang terjadi hari ini hanya jeda-jeda saja,” katanya.

Letusan Krakatau ....

banyaknya jumah letusan yang terpantau dari pos yang berjarak 40 kilometer itu, Gunung Anak Krakatau masih berstatus waspada seperti hari sebelumnya. Dengan kondisi itu, imbau dia, nelayan saat melaut malam hari diminta tidak berlayar terlalu dekat ke GAK itu karena berbahaya. “Jarak aman minimal empat kilometer, bahkan kalau bisa lebih dari jarak tersebut untuk antisipasi,” terang dia. Dia mengatakan, peningkatan aktivitas ini merupakan gejala alam karena merupakan gunung berapi aktif dan pe-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, BxB. 2. Rf1, Gd3+. 3. Rg1, Gd4+. 4. Rh1, Ge4+mat. (Jika 3. Re1, Bg2+. 4. Rd1, Bg1+mat).

Jawaban TTS: TTS Topik








Jawaban Sudoku: 2 5 7 9 6 4 1 3 8

3 9 1 8 7 5 6 4 2

6 4 8 3 2 1 9 5 7

1 8 9 4 5 2 3 7 6

7 3 4 1 8 6 2 9 5

5 2 6 7 3 9 8 1 4

9 7 2 6 4 3 5 8 1

4 6 3 5 1 8 7 2 9

8 1 5 2 9 7 4 6 3

MENANGIS: Pemberangkatan 152 calon haji asal Tapanuli Selatan dari Masjid Raya Sri Alam Dunia Sipirok, Jumat (29/ 10) malam, penuh keharuan dan isak tangis.Wakil Bupati Tapsel, Aldinz Rapolo Siregar bersama unsur Muspida Plus melepas para calon tamu Allah ini menuju Asrama Haji Pangkalan Mahsyur Medan sebelum ke tanah suci.

Presiden Minta Masyarakat Di Lokasi Merapi Taati Pemerintah HANOI (Antara): Presiden Susilo Bambang Yudhoyono meminta warga masyarakat di lokasi bencana, terutama di sekitar lokasi meletusnya Gunung Merapi untuk menaati apa yang disampaikan pe-

merintah demi keselamatan mereka. “Saya tekankan agar masyarakat menaati apa yang disampaikan pemerintah, demi keselamatan mereka sendiri,”kata Presiden dalam

konferensi pers di Hotel Grand Plaza Hanoi, Minggu (31/10), sebelum kembali ke Jakarta. Presiden mengatakan sekalipun situasi di sekitar Merapi relatif telah tenang , warga hendaknya masih be-

rada di penampungan. “Kalau perlu sedikit dipaksa, dalam arti jangan ada di tempat itu (lokasi bencana) karena memang membahayakan jiwa,” katanya. Menurut Presiden, pada

Deponir Bibit-Chandra Keputusan TTerbaik erbaik JAKARTA (Waspada): Menteri Hukum dan Hak Asasi Manusia (Menkumham), Patrialis Akbar menilai keputusan Kejaksaan Agung untuk mendeponir kasus dua pimpinan Komisi Pemberantasan Korupsi (KPK) Bibit Samad Rianto dan Chandra M Hamzah sudah dipertimbangkan matang. “Itu keputusan terbaik bagi perkembangan institusi itu (Kejaksaan Agung),” kata Patrialis di sela acara ‘Sepeda Gembira Cerdas Hukum’ memperingati Hari Dharma Karyadika di Lembaga Pemasyarakatan (LP), Cipinang, Jakarta Timur, Minggu (31/1). (VIVAnews) ningkatan aktivitas dapat terjadi sewaktu-waktu tanpa terduga sebelumnya. Sementara itu, sejumlah warga di kawasan pantai Kecamatan Punduh Pedada, Kabupaten Pesawaran, Provinsi Lampung tetap tenang meski mereka mulai waspada, karena tempat tinggal mereka berdekatan dengan Gunung Anak Krakatau. “Warga di sini umumnya masih tenang-tenang saja, tetapi mulai waspada setelah Gunung Krakatau diberitakan mulai aktif lagi,” kata warga Desa Kampung Baru, Punduh Pedada, Ny. Yayuk. Dia mengakui bahwa belakangan ini banyak mendengarkan dan melihat berita dari radio dan televisi seputar aktifnya Gunung Anak Krakatau, menyusul letusan Merapi. Kepala Urusan (Kaur) Pembangunan Desa Kampung Baru, Hanapi, juga membenakan bahwa aktivitas warga di kawasan pantai itu masih normal, meski ramai diberitakan Krakatau aktif, dan mengeluarkan sembutran asap ratusan kali setiap harinya. Namun demikian, warga di sana mengharapkan agar kondisi Krakatau itu tidak lebih buruk, karena banyak warga di sana yang rumahnya di kawasan pantai.

Amien: Bencana ....

“Menurut saya, dari semua teologi, berpendapat sama. Jadi ini seperti bentuk azab, karena bangsa kita sudah terlalu banyak melakukan pembangkangan, seperti kaum Nabi Luth,” ujar Amien menambahkan. Untuk diketahui, dalam Islam dikenal kisah Kaum Nabi Luth yang gemar melakukan perbuatan seks sesama jenis. Kaum ini pun dibinasakan Tuhan, seperti disebutkan dalam Al-Quran, dengan hujan batu. “Untuk itu kita harus rendah hati dan melakukan koreksi serta perbaikan diri,” kata Amien Rais singkat. Kurang 24 jam setelah sebuah tsunami menghantam Kepulauan Mentawai pada Senin 25 Oktober 2010, Gunung Merapi di Jawa Tengah meletus. Tsunami sampai siang ini telah merenggut 449 nyawa, sementara erupsi Gunung Merapi telah menewaskan 37 orang. (VIVAnews)

Waspada/Sarmin Harahap

POSKO: HMI Cabang Madina, Sabtu (30/10) membuka posko bencana alam letusan gunung merapi Sleman Yogyakarta, Tsunami Mentawai Sumatera Barat, dan banjir Wasior Papua.

Politisi Jangan ....

“Mamre” GBKP Pusat itu. Mantan anggota DPRD Sumut itu mengharapkan Wagub Gatot Pudjo Nugroho dan Sekretaris Daerah RE Nainggolan tetap mengoordinasikan program pembangunan provinsi itu dengan Gubernur Syamsul Arifin. Hal itu diperlukan karena sesuai amanat undang-undang, Syamsul Arifin masih Gubernur Sumut sebelum ada putusan berkekuatan hukum tetap dari pengadilan. Kalangan politisi dan pemerhati politik juga diharapkan tidak memberikan pernyataan yang dapat membingungkan masyarakat, khususnya dalam membahas ke-

pemimpinan di Sumut terkait penahanan Gubernur Syamsul Arifin. “Suka atau tidak suka, Syamsul Arifin sampai saat ini masih gubernur dan ‘bapak’ Sumut sehingga semua harus mendukung beliau dan segala kebijakannya,” kata Baskami. Kemudian, kata dia, masyarakat juga diharapkan tidak terpancing dan wacana yang dimunculkan kalangan politisi dan pemerhati politik di Sumut juga tentang dukung mendukung atau membicarakan pihak yang berkuasa dan berwenang dalam menetapkan kebijakan pembangunan di Sumut pascapenahanan Syamsul Arifin.

Polisi Periksa ....

dikembalikan kepada keluarganya. “Namun, saat kampung kami diserang dan kami dianiaya oleh seratus lebih penyerang, kami yang menjadi korban penyerangan. Tetapi, kelompok penyerang pula yang mengadukan kami. Ini kan aneh. Polisi harus profesional menangani kasus ini. Mana keadilan bagi warga Kampung Melayu,” tutur Sabarudin Sagala. Sementara itu, Kapolsekta Percut Seituan AKP M Simanjuntak yang dikonfirmasi Waspada, Minggu mengatakan, ke-32 warga Kampung Melayu akan dimintai keterangannya berdasarkan pengaduan dari dua korban luka bacok masing-masing Aman Sianipar dan Haposan Sapta Purba. “Surat panggilan kepada 32 warga Kampung Melayu itu sudah disampaikan kepada yang bersangkutan,” jelas AKP M Simanjuntak. Menurut AKP Simanjuntak, pasca bentrokan situasi di areal lahan garapan Selambo

sudah mulai kondusif. Warga sudah beraktivitas kembali seperti biasa. “Satu regu polisi masih berjaga di areal sengketa untuk mencegah jangan ada lagi bentrokan,” tambahnya. Korban Masih Dirawat Aman Sianipar, 34, salah seorang korban bentrok antar warga penggarap dilahan PTPN II masih keadaan kritis, Minggu (31/10) siang, di Ruang ICU RSU dr. Pirngadi Medan. Dia telah menghabiskan lima kantong darah. Pada bentrok di Jl. Selambo Percut Sei Tuan, Sabtu (30/ 10) itu, Aman, warga Kampung Toba Selambo Percut Sei Tuan, mengalami luka bacok di bagian kepala, leher, lutut dan pinggang, hingga mengeluarkan banyak darah. “Sudah sadar, tapi belum bisa ngomong. Dari tadi malam saya yang menjaga di sini,” ujar ayah kandungnya Gabariel Sianipar, 69, Minggu (31/10). Sedangkan Roni Haposan, yang juga terkena luka bacok sudah diperbolehkan pulang. (cat/cmai)

“Jembatan itu juga sudah rusak berat. Hanya kendaraan roda dua yang bisa lewat, itupun mesti ekstra hati-hati. Itu sebabnya, kami minta pemerintah segera mencari solusi, minimal dengan sistim tanggap darurat, supaya desa kami tidak lagi terkurung,” pinta Zulkarnain. Pada kesempatan sama, Kepala Desa Matang Guru Adnan Bahri Thaleb, menyebutkan, jembatan Matang Guru sebenarnya sudah lama rusak parah dan sudah beberapa kali direhab dengan material seadanya. Terakhir, sekitar delapan bulan lalu Pemkab Aceh Timur juga memplot dana senilai Rp200

juta untuk merehab jembatan yang memiliki panjang sekitar 120 meter itu. Sayangnya, tetap tidak bertahan lama karena material yang digunakan rata-rata bermutu rendah. Pantauan Waspada, tak jauh dari jembatan yang ambruk itu sudah dibangun pondasi jembatan baru. Namun menurut warga, proyek itu sudah hampir setahun lebih terbengkalai tanpa diketahui sebab pasti. “Kabarnya ini proyek provinsi, tapi kami tak tahu berapa anggarannya dan mengapa pembangunannya bisa terhenti seperti ini,” tandas Kepala Desa Matang Guru, Adnan Bahri Thaleb. (cmus)

Khawatirnya, pernyataan itu dapat “mengotak-kotakkan” berbagai kalangan masyarakat, baik politisi maupun jajaran satuan kerja perangkat daerah (SKPD) Pemprov Sumut. Padahal, kata Baskami, sebelum mengalami penahanan, Gubernur Syamsul Arifin telah rutin melakukan “safari” untuk menenangkan masyarakat jika terjadi hal-hal yang tidak diinginkan. “Jangan coreng upaya yang telah dilakukan Syamsul Arifin selaku Gubernur. Jangan sampai masyarakat, SKPD dan politisi terkotak-kotak,” kata Ketua Bidang Dana dan Usaha

beruntun. Bak kata pepatah; sudah jatuh tertimpa tangga pula. Sudah diserang dan diancam akan dibunuh, malah mereka yang dilaporkan kepada petugas kepolisian. “Ada 32 orang warga Kampung Melayu yang akan diperiksa di Polsekta Percut Seituan. Besok kami akan menjalani pemeriksaan karena ada pihak penyerang yang menderita lukaluka dan mengadu ke Polsekta Percut Seituan,” ujar Sabaruddin Sagala kepada Waspada, di areal tanah garapan, Minggu (31/10). Menurut Sabarudin Sagala, sebelumnya mereka sudah pernah membuat pengaduan ke Polsekta Percut Seituan karena ada salah seorang warga dari kelompok penyerang yang tertangkap basah membabati tanaman milik warga Kampung Melayu. Kemudian, warga tersebut dibawa ke kantor Polsekta Percut Seituan namun oleh petugas pengaduan tersebut tidak diterima sehingga pelaku pembabat tanaman warga

Jembatan ....

Saya rasa, leger besi jembatan ini sudah kropos dimakan usia, makanya ambruk,” imbuhnya. Zulkarnain, Tuha Peut Desa Matang Guru, yang ditemui terpisah mengatakan, ambruknya jembatan Matang Guru membuat puluhan ribu warga dari lima desa di seberang jembatan terisolir. Sebab, satu-satunya jembatan alternatif yang berada di perbatasan Desa Meunasah Tingkeum dan Desa Seuneubok Pidie, Kec. Tanah Jambo Aye, A c e h Ut a r a , j u g a s u d a h ambruk akibat dilindas truk bertonase tinggi, beberapa waktu lalu.

BALIGE(Waspada): Pajakpajak daerah yang dibebankan bagi perusahaan untuk pemasangan-pemasangan reklame perusahaan berupa baliho, spanduk dan umbul-umbul dinilai terlalu mahal di Kab. Tobasa jika dibandingkan dengan Kab.Samosir, Kab. Taput maupun Kab. Humbahas. “Peraturan Daerah (Perda) Pemkab Tobasa yang diterapkan untuk pengutipan retribusi pajak reklame cukup memberatkan perusahaan sehingga untuk memperkecil pengeluaran perusahaan, maka pemasangan reklame lebih banyak di daerah Kab. Taput, Kab.Samosir dan Kab. Humbahas” kata M.Nasution, salah seorang manajer perusahaan rokok kepada Waspada

di Balige, Sabtu (30/10). Tar if pajaknya mahal dengan hitungan pajak reklame baliho per meter Rp25 ribu, umbul-umbul dan spanduk per meter Rp12.500 selama satu bulan kata Nasution, untuk hitungan per harinya tidak ada sehingga kalaupun hanya target kita terpasang satu minggu sewaktu membuat even, maka tetap membayar satu bulan juga. Sebenarnya dilihat dari perbandingan kondisi daerah, Kab.Tobasa dengan kabupaten-kabupaten tetangganya cukup lumayan roda perekonomiannya sehingga target utama pemasangan reklame namun disebabkan tarif pajak daerahnya maka terpaksa dialihkan keluar daerah, kata Nasution. (a33)

Disnak Madina Perlu Perketat Pengawasan Ternak PANYABUNGAN (Waspada): Dinas Peternakan Kabupaten Mandailing Natal perlu memperketat pengawasan lalu lintas ternak sapi untuk mengantisipasi adanya pasokan sapi sakit dari luar daerah menjelang Hari Raya Idul Adha 1431 H/2010 M yang jatuh pada 16 November mendatang. “Pengawasan perlu diperketat guna mengantisipasi masuknya sapi yang tidak layak konsumsi dan mengandung virus yang berbahaya bagi kesehatan manusia,” kata Wakil Sekretaris DPC PPP Madina Lokot Husda Lubis kepada Waspada, Minggu ( 31/10). Dikatakan, salah satu penyakit ternak besar yang perlu diwaspadai adalah antraks, karena apabila ternak yang terjangkit virus antraks dikonsumsi, cacing pita, sapi gila dan penyakit berbahaya lainnya, karena virus dapat menu-

lari manusia. Berkaitan dengan hal itu, lanjutnya, Dinas Peternakan Madina bersama dengan instansi terkait harus terus memantau di lokasi yang menjadi lalu-lalang atau pintu masuk ternak sapi. Selain itu,Lokot mengatakan, Dinas Peternakan Madina juga perlu juga menurunkan petugas kesehatan hewan disebar ke beberapa titik penjualan hewan kurban.”Meski selama ini berdasarkan pemeriksaan dan pengamatan petugas di lapangan memang belum ditemukan ternak yang mengandung penyakit menular, namun pada Hari Raya Idul Adha 1431 H/2010 M ini pengawasan harus lebih ditingkatkan lagi agar hewan qurban yang akan disembelih masyarakat memenuhi syarat, aman, sehat, utuh dan halal atau tidak,” ungkapnya. (a24)

Pemindahan ....

luka-luka dari sejumlah desa sudah dievakuasi ke pengungsian di Sikakap untuk mendapatkan pertolongan pengobatan. Rumah warga yang rusak akibat gempa dan tsunami sebanyak 517 unit kondisi rusak berat, 204 unit rumah rusak ringan. Sarana pendidikan yang rusak yakni, 4 unit rusak berat, 1 unit rusak sedang. Selain itu empat unit Rumah Dinas rusak berat. Dua unit Resort juga rusak berat yakni Resort Marcaroni dan Katei, 1 unit kapal pesiar terbakar, 1 unit kapal pesiar rusak ringan. Fasilitas umum yang rusak ketika terjadi gempa disusul tsunami yakni jembatan 7 unit, antara lain jalan P2D rusak sepanjang 8 km. Bantuan dari para donatur yang berada di Posko gempa dan tsunami BPBD Sumbar telah distribusikan meskipun cuaca buruk. “Jika gelombang besar disertai angin kencang, pendistrubusian bantuan dihentikan sementara waktu, namun dapat dilanjutkan jika tidak ada lagi angin kencang dan gelombang tinggi,” kata Ade Edwar. Pendistribusian bantuan dari para donatur tidak saja melalui kapal yang diberangkatkan dari Pelabuhan Teluk Bayur, Padang, namun juga dilakukan dengan helikopter. Tim SAR masih melakukan pencarian terhadap warga yang hilang maupun korban tewas akibat terjadi gempa dan tsunami. Bantuan Terus Disalurkan Sejumlah besar bantuan berupa makanan dan barangbarang kebutuhan lainnya bagi korban gempa Mentawai terus disalurkan dengan helikopter dan speed boat kendati cuaca masih ekstrim disertai hujan lebat dan gelombang

pasang yang cukup tinggi. “Kita terus memasok kebutuhan korban yang selamat dari gempa disertai tsunami di Kepulauan Mentawai. Jika terjadi perubahan cuaca, berhenti sejenak dan distribusi kebutuhan korban gempa Mentawai terus dilanjutkan,” kata Wakil Keamanan Laut (Kamla) di Sikakap, Kopral Satu (TNI AL) Raemul dihubungi dari Padang, Minggu. Menurut Raemul, bantuan didistribusikan oleh relawan dengan heli milik TNI Angkatan Udara (AU), Angkatan Darat (AD) dan Kepolisian Daerah Sumbar, sedangkan speed boat di datang dari Padang. Sambil mendistribusikan bantuan, katanya, relawan dan sejumlah petugas kemanusian itu tetap melakukan pendataan sambil melakukan penyisiran terhadap korban yang selamat tetapi belum tersentuh bantuan. “Semua bantuan yang didistribusikan berjalan dengan lancar kendati petugas dan relawan tetap dihadang oleh cuaca yang ekstrim terutama gelombang laut,” katanya. Gelombang laut cukup tinggi, katanya, terutama berada di daerah barat daya akan tetapi bantuan secara bertahap terus didistribusikan agar tidak bertumpuk karena bantuan lainnya kini juga banyak yang sedang dibongkar. Bantuan yang dibongkar itu ditumpuk di Posko Satkorlak Penangulangan Bencana (PB) Mentawai di Kecamatan Sikakap. Sementara itu berdasarkan data Badan Meteorologi dan Klimatologi Geofisika (BMKG) Maritim Teluk Bayur Padang, Sumatera Barat, memperkirakan tinggi gelombang laut akan mencapai empat meter di Perairan Mentawai. Gelombang laut tinggi tersebut diperkirakan akan berlansung selama empat hari.

45 Mantan ....

melalui berbagai proses administrasi, sebanyak 45 anggota DPRK Aceh Timur periode 1999-2004 masing-masing menerima kucuran dana itu senilai Rp50 juta yang dibuktikan dengan tanda terima. Anehnya, ketika kasus penyalahgunaan dana Inbup yang menyeret Azman Usmanuddin sebagai terdakwa, para mantan anggora Dewan itu malah ‘buang badan’ dengan memberikan keterangan palsu di persidangan. Mereka di hadapan majelis hakim mengaku tidak pernah menerima aliran dana Inbup dari Azman Usmanuddin. Mantan anggota DPRK Aceh Timur yang memberikan keterangan palsu di persidangan saat itu diantaranya, Khairuddin M Daan, HM Nur Daud (Nuraida), Rusli Nya’an, Rahmadi Yahya, H Zulkifli UA,

Zubir Alibasyah, Heldiansyah Z Mard, Ghazali Usman, HT Yusni, HM Yunus Nurdin dan beberapa mantan anggota Dewan lainnya, “meskipun tidak semua diantara mereka yang memberikan keterangan di Pengadilan karena berhalangan tetap,” kata Reynhard SH. Dikatakannya, atas keterangan palsu yang diberikan itu, pihaknya akan segera menyeret para mantan anggota Dewan itu ke Pengadilan. “Kita sedang siapkan materi pidana untuk para mantan anggota Dewan itu dan akan segera kita masukkan ke Pengadilan Negeri Langsa. Mereka (Mantan anggota Dewan) kita jerat dengan pasal 242 KUHPidana tentang memberikan keterangan palsu di atas sumpah, dengan ancaman hukuman 9 tahun penjara,” demikian Reynhard. (ts)

Minggu pagi ia telah melakukan komunikasi dengan Wakil presiden Boediono dan mendapat laporan jika situasi tanggap darurat sedang berlangsung. Gunung Merapi yang terletak di perbatasan Jawa Tengah dan Yogyakarta meletus pada Selasa (26/10) dan mengakibatkan 33 orang meninggal. Sebelumnya beberapa kali petugas pengawas gunung berapi telah mengingatkan agar seluruh warga di sekitar Gunung Merapi mengungsi ke pos-pos penampungan. Namun ada sejumlah orang yang bertahan di rumahnya masing-masing. berlayar bergantung pada cuaca dan ketinggian ombak di laut. Bahkan, menurut dia, KRI yang dikerahkan untuk membawa barang bantuan pun mempunyai batasan untuk berlayar. “Kalau KRI bisa lebih besarlah ombak yang bisa ditangani. Kita kan tidak ingin bantuan yang seperti kemarin punya PLN terbalik. Jadi bantuan kendalanya di situ,” tuturnya. Pada Senin (1/11), kata Djoko, Presiden akan memimpin rapat kabinet terbatas di yang salah satu agendanya adalah penanganan bencana di Kepulauan Mentawai. 449 Tewas 96 Hilang Jumlah korban tewas akibat gempa dengan kekuatan 7,2 SR disusul tsunami di Kabupaten Kepuluan Mentawai, Sumatera Barat, bertambah menjadi 449 jiwa. “Sebelumnya korban tewas berhasil ditemukan 413 orang, namun pada Minggu (31/10) sekitar pukul 12:25 WIB bertambah menjadi 449 orang,” kata Kabid Penanggulangan Bencana Badan Penanggul a n g a n B e n c a n a D a e ra h (BPBD) Sumbar, Ade Edwar di Padang, Minggu (31/10). Sedangkan warga yang belum ditemukan Tim SAR akibat gempa dan tsunami tersebut 96 orang. Dia menyatakan, data korban tewas yang dihimpun oleh BPBD Mentawai selanjutnya dilaporkan kepada BPBD Sumbar. “Setiap satu jam BPBD Mentawai member ikan laporan pada BPBD Sumbar mengenai data korban tewas dan warga hilang,” katanya. Korban yang mengalami luka-luka ketika terjadi gempa dan tsunami yakni, 270 orang mengalami luka berat, 142 orang luka ringan. Korban yang mengalami periode 1999-2004 itu menerima aliran dana masingmasing senilai Rp50 juta yang dibuktikan dengan tanda terima. Ku a s a h u k u m A z m a n Usmanuddin dari Acheh Legal Consult (ALC) Reynhard SH kepada Waspada, Minggu (31/10) mengatakan, pihaknya telah menyiapkan 5 pengacara menyeret para mantan anggota DPRK Aceh Timur itu yang telah memberikan keterangan palsu di persidangan, sehingga memberatkan kliennya. Menurut Reynhard SH, berdasarkan fakta yang ada, pada tahun 2002 Bupati Aceh Timur Azman Usmanuddin memberikan dana senilai Rp2.250.000 yang bersumber dari dana Inbup untuk keperluan pengadaan sarana mobilitas anggota Dewan. Setelah

Berita Utama


WASPADA Senin 1 November, 2010

Menag: Kemajemukan Bukan Persoalan Mudah

Waspada/Basita Bukit

TONGARIODJO Angkasa didampingi Kapolres Karo, AKBP Ig Agung Prasetyoko, SH.MH, Kombes Pol Ricky F Wakanno Ginting, Ketua DPRD Karo (non aktif) Siti Aminah Br Peranginangin, SE, Wakapolres Karo dan panitia lainnya, foto bersama di depan pagoda.

Nelayan Belawan Tewas Di Perairan Batubara BELAWAN (Waspada): Seorang nelayan Belawan, Suryadi, 53, warga Jalan Pulau Irian Lingkungan 11 Kelurahan Belawan Bahari, tewas setelah tersenggol batu besar yang jatuh dari atas Pulau Salah Nama, kawasan perairan Kabupaten Batubara, Sabtu (30/10). Keterangan di rumah duka menyebutkan, korban yang akrab di panggil Adi Bacok itu berangkat melaut dengan menggunakan KM United dari Dermaga PT Laut di kawasan Pela-

buhan Perikanan Samudera Belawan (PPSB) dan bekerja sebagai kuwanca atau juru masak. Lima hari melaut di tengah ombak membesar, nahkoda KM United bermarga Hasibuan memutuskan untuk berlindung sambil menambat kapal di Pulau Salah Nama. Satu hari berada di pulau itu, ombak laut kembali normal sehingga korban dan teman- temannya berniat meninggalkan pulau untuk kembali melaut. “Kata kawannya, korban

SBY Persilakan ...

atasi semua itu dengan sumber daya sendiri. Walaupun saling membantu antar negara itu biasa,Indonesia baru-baru ini juga memberikan bantuan bagi Pakistan guna mengatasi bencana banjir. Lebih lanjut Kepala Negara berharap agar nantinya bantuan-bantuan yang diterima dapat dikelola dengan baik. Pada Senin (25/10) Mentawai digoncang gempa dan tsunami setinggi lebih dari tiga meter yang mengakibatkan sedikitnya 400an orang meninggal dan puluhan yang lain masih hilang.

Indonesia akan selesaikan sendiri,” kata Presiden dalam konferensi pers di Hotel Grand Plaza Hanoi, Minggu (31/10) pagi, sebelum kembali ke Jakarta. Menurut Presiden, khusus untuk bencana gempa bumi dan tsunami di Mentawai, Sumatra Barat memang ada sejumlah negara sahabat yang menawarkan bantuan, antara lain Uni Eropa,Thailand dan Australia. Namun, kata Presiden, kebijakan Pemerintah Indonesia adalah sedapat mungkin meng-

Rencana Utama ... adopsi rencana utama Keterhubungan ASEAN itu akan menghubungkan kawasan Asia Tenggara dengan lebih baik, dalam hal fisik, intitusional dan hubungan antarindividu.” ASEAN perlu untuk memainkan peran uniknya sebagai faktor penting guna menghubungkan dan mengharmoniskan berbagai kelompok kepentingan, sebagai hub yang menghubungkan berbagai kerja sama dan kerangka kerja,” katanya. Keterhubungan ASEAN di bidang fisik akan meliputi pembangunan infrastruktur di sektor angkutan darat, laut dan udara, energi, pembangunan pipa gas lintas ASEAN dan zona ekonomi khusus. Sedangkan keterhubungan ASEAN di bidang institusional terkait dengan sejumlah kerja sama

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport.

Jembatan Matang Guru ...

Jawaban Problem Catur: 1. ......, BxB. 2. Rf1, Gd3+. 3. Rg1, Gd4+. 4. Rh1, Ge4+mat. (Jika 3. Re1, Bg2+. 4. Rd1, Bg1+mat).

Jawaban TTS: TTS Topik








Jawaban Sudoku:

2 5 7 9 6 4 1 3 8

3 9 1 8 7 5 6 4 2

6 4 8 3 2 1 9 5 7

1 8 9 4 5 2 3 7 6

7 3 4 1 8 6 2 9 5

5 2 6 7 3 9 8 1 4

9 7 2 6 4 3 5 8 1

4 6 3 5 1 8 7 2 9

ekonomi antar-ASEAN, termasuk kebijakan ASEAN single window dan integrasi kepabeanan. Kemudian Keterhubungan ASEAN di bidang hubungan antar individu merupakan upaya untuk meningkatkan kerjasama di bidang budaya, pendidikan dan pariwisata. Konsep Keterhubungan ASEAN pertama kali dibahas dalam pertemuan para pemimpin ASEAN pada 2009. Keterhubungan itu nantinya diharapkan mempersempit kesenjangan, meningkatkan daya saing, mendorong perdagangan intra kawasan, menarik investasi dan pada akhirnya meningkatkan kesejahteraan rakyat ASEAN. Sejumlah mitra wicara ASEAN telah menyatakan kesediaannya untuk memberikan komitmen bantuan yang dibutuhkan guna mewujudkan Keterhubungan ASEAN. Salah satunya adalah Jepang yang berkomitmen menyediakan pendanaan sebesar 200 miliar dolar AS untuk rencana Keterhubungan ASEAN.

8 1 5 2 9 7 4 6 3

“Sebelumnya tidak ada reaksi mencurigakan. Malahan, mobil hampir sampai di bantaran seberang. Dalam tempo singkat, tiba-tiba terdengar suara seperti besi patah, lalu mobil langsung kecebur ke sungai. Untungnya, saya bisa cepat keluar lewat pintu kanan,” kata Ilyas. Ilyas menambahkan, bibit sawit yang dibawanya merupakan bantuan Dinas Perkebunan dan Kehutanan untuk masyarakat Desa Meunasah Tingkeum, Madat. “Bibit itu saya ambil kawasan Paya Gajah Peureulak. Berat totalnya masih dalam batas normal, yakni sekitar 8 ton. Saya rasa, leger besi jembatan ini sudah kropos dimakan usia, makanya ambruk,” imbuhnya. Kepala Desa Matang Guru Adnan Bahri Thaleb, menyebutkan, jembatan Matang Guru sebenarnya sudah lama rusak parah dan sudah beberapa kali direhab dengan material seadanya. Terakhir, sekitar delapan bulan lalu Pemkab Aceh Timur juga memplot dana senilai Rp200 juta untuk merehab jembatan yang memiliki panjang sekitar 120 meter itu. Sayangnya, tetap tidak bertahan lama karena material yang digunakan rata-rata bermutu rendah. Pantauan Waspada, tak jauh dari jembatan yang ambruk itu sudah dibangun pondasi jembatan baru. Namun menurut warga, proyek itu sudah hampir setahun lebih terbengkalai tanpa diketahui sebab pasti. “Kabarnya ini proyek provinsi, tapi kami tak tahu berapa anggarannya dan mengapa pembangunannya bisa terhenti seperti ini,” tandas Kepala Desa Matang Guru, Adnan Bahri Thaleb. (cmus)

turun dari kapal untuk membuka tali tambat. Namun saat bersamaan batu sebesar lemari jatuh dariataspulaudanmengenaipipi sebelah kanan,” kataWakil Ketua Himpunan Nelayan Seluruh Indonesia (HNSI) Sumut Pendi Pohan, Minggu (31/10). Melihat hal itu, ABK lainnya berusaha memberikan petolongan namun nyawa korban tidak terselamatkan dan meninggal 15 menit setelah kejadian. Jenazah dibawa ke rumah duka, Minggu (31/10) pagi sekitar pukul 06.00 setelah dibawa ke RSU Dr Pirngadi untuk diotopsi. Menyikapi hal itu, Pendi Pohan meminta pengusaha bertanggungjawab untuk memikirkan kebutuhan hidup keluarga yang ditinggalkan korban. “Selama ini nyawa nelayan hanya dihargai sebatas uang duka, sedangkan keluarga yang ditinggalkan dilupakan pengusaha,” katanya. (cre)

Musim Haji ... “Kami masuk Makkah melalui jalanan jorok yang tidak dipantau dengan baik oleh polisi,” kata Pramana. “Teman saya menganjurkan pada saya agar berhenti saja dari pekerjaan lama saya dan pergi bekerja di Makkah. Saya minta pada istri sponsor saya untuk meninggalkan pekerjaan saya selama satu bulan, namun dia menolak. Dia juga menolak untuk meningkatkan gaji saya yang hanya 800 riyal Saudi. Saya kemudian memutuskan minggat ke Makkah untuk bekerja sebagai tukang masak,” katanya. Pramana dan satu kelompok temannya menyewa satu

Alhamdulillah, Terkabul ... “Beginilah kalau dekat dengan isteri. Biar sakit bisa saya tahankan. Senang rasanya menjalani hari-hari tua begini,” kata Dongoran yang menikmati angin semilir Sabtu sore lalu bersama isterinya yang kurang mahir berbahasa Indonesia. Kakek 32 cucu ini menyebutkan, selama puluhan tahun dia mencoba membuat tabungan khusus agar bisa menunaikan ibadah haji. Namun hingga usianya 70 tahun, tetap saja uang yang ditabung belum cukup. Akhirnya, diapun berdiskusi dengan isterinya, bagaimana caranya agar bisa berangkat haji sebelum ajal menjemput mereka berdua. “Istri saya rela saya berang-

BERASTAGI (Waspada): Mengelola kemajemukan bukan persoalah yang mudah. Di satu sisi, umat beragama sebagai salah satu komponen bangsa akan berusaha memelihara identitas dan memperjuangkan aspirasnya. Mereka juga dituntut untuk memberi andil dalam rangka memelihara kerukunan dan keutuhan bangsa. Dalam kaitan itulah, diperlukan kearifan dan kedewasaan di kalangan umat beragama untuk memelihara keseimbangan antara kepentingan kelompok dan kepentingan nasional. Karena itu, Kementerian Agama dalam menjalankan tugas dan fungsinya telah menetapkan visi “Terwujudnya masyarakat Indonesia yang taat beragama, maju, sejahtera, dan cerdas serta saling menghormati antara sesame pemeluk agama dalam kehidupan bermasyarakat, berbangsa dan bernegara dalam wadah Negara Kesatuan Republik Indonesia”. Hal ini dikatakan Menteri Agama RI, H Suryadharma Ali dalam kata sambutannya pada acara pemberkahan (acara doa akbar-red) replika pagoda Shwedagon di Taman Alam Lumbini, Desa Tongkoh, Kecamatan Dolatrayat, Tanah Karo, yang dihadiri ribuan anggota Sangha dan Bhikhu dari 20 negara, Sabtu (30/10). Ribuan para Sangha yang

hadir dalam pemberkahan di antaranya dari Indonesia, Amerika Serikat, Malaysia, Thailand, Myanmar, Kamboja, Laos, Vietnam, Singapura, Sri Lanka, Bangladesh, Australia, India, Tibet, China, Inggris, Jepang, Korea, Taiwan dan Jamaika. Terbesar kedua Disebutkan, pembangunan replika pagoda Shwedagon yang merupakan terbesar kedua di dunia ini memiliki nilai stragtegis, untuk dapat memberikan kemajuan masyarakat di Sumatera Utara dan khususnya di Tanah Karo. Terlebih dibangun di wilayah daerah tujuan wisata Berastagi sehingga menjadi kebanggaan tersendiri,yang kelak diharapkan menjadi bagian wisata religi, baik wisatawan domestik mau pun wisatawan mancanegara. Peresmian jembatan Usai acara session pertama, Maha Saddhamajotika Dhaja, Tongariodjo Angkasa , SE.MBA. MM selaku Panitia Pemberkatan Replika Pagoda Shwedagon meresmikan jembatan gantung di taman alam Lumbini di areal seluas sekira 8 hektare. Acara berlangsung dua hari sampai hari ini, Minggu (31/10). Sedangkan peresmian replika Pagoda Sgwedagon, menurut Tongariodjo Angkasa, menurut rencana akan diresmikan Presiden RI,yang akan dijadwalkan kemudian. (c06)

Gelombang Laut Tiga Meter MEDAN (Waspada): Kondisi cuaca di Sumatera Utara dan Aceh mulai bergejolak. Pasalnya, pusat tekanan rendah yang semakin dekat dengan Sumut menyebabkan muncul hujan berhari-hari. Hal ini akan berimbas pada tinggi gelombang laut di kawasan Selat Malaka. Saat ini tinggi gelombang laut mencapai 1 hingga 2 meter. Sementara di Lautan Hindia 2 hingga

3 meter khususnya wilayah Pantai Barat, tentunya mengancam nelayan mencari ikan. Bahkan, operasional kapal dan feri untuk mengangkut penumpang sedikit terganggu. “Sebaiknya, nelayan harus berhati-hati,” kata Firman, S. Com, Kepala Data dan informasi (Datin) BMKG Wilayah I Stasiun Bandara Polonia Medan kepada Waspada, Minggu (31/10). (m32)

kamar kecil di Makkah dengan harga 400 riyal Saudi satu bulan dan merencanakan untuk memasak makanan bagi para jamaah. “Tahun lalu, lima dari teman saya berkumpul di satu apartemen di distrik Aziziya, Makkah. Mereka memasakkan makanan Indonesia dan Arab Saudi, menyediakan katering untuk para jamaah Asia Tenggara. Mereka memperoleh 15.000 riyal Saudi dalam sebulan, bukankah jauh lebih baik daripada mereka bekerja jadi PRT. Masing-masing memperoleh keuntungan bersih 3.000 riyal. Mereka meneruskan pekerjaannya kembali setelah musim Haji sampai semua jamaah meninggalkan Makkah,” tambahnya.

Sujatmi Ramelan, seorang PRT Indonesia lainnya yang bekerja pada satu keluarga Arab Saudi, mengatakan dia telah meninggalkan pekerjaannya dan berangkat menuju Makkah. “Di Makkkah, saya melakukan pekerjaan yang sama, namun saya memperoleh hasil lebih tinggi lagi. Banyak wanita Saudi mencari pekerjaan PRT pada musim Haji. Tugas saya mencakup menyuci pakaian, memasak dan menjaga anak. Saya memperoleh sekitar 4.000 riyal di Makkah selama musim Haji. Saya butuh waktu tiga bulan baru dapat mengumpulkan sebanyak itu di Jeddah,” katanya. (ant/m07)

kat lebih dahulu, karena uang yang kami miliki terbatas. Tapi saya pikir-pikir, saat ini usia kami sudah tua. Tidak ada lagi yang menyulitkan, karena anak-anak sudah membangun keluarga sendiri. Sayapun berinisiatif agar kami pergi bersama. Mengandalkan uang tabungan saja tidak cukup, maka kami sepakat menjual sedikit ladang yang kami miliki untuk berangkat ke tanah suci. Alhamdulillah, setelah tanah itu terjual, kami sama-sama membayar pelunasan pemberangkatan haji untuk tahun 2010 ini. Syukurnya kami bisa berangkat bersama. Meskipun kaki saya sedikit sakit dan diberi obat oleh dokter, tapi saya merasa tenang dan nyaman berangkat dengan isteri saya,”

ujarnya sambil terus memandangi isterinya. Dongoran berpesan kepada orang tua muslim, agar menanamkan niat pada anak-anaknya untuk berangkat haji satu hari nanti. Caranya, kata bapak 8 anak ini, membuat tabungan khusus untuk haji. Dari usia 7 tahun yang sudah dianjurkan shalat, hendaknya dianjurkan juga buat tabungan haji. Insyaallah belum berusia 50 tahun akan berangkat haji. “Sepertinya lebih mudah berangkat di usia muda, saya perhatikan beberapa jamaah yang usianya 50 atau 40 tahun, mereka masih sehat dan kuat berjalan. Ibadah haji ini lebih banyak mengandalkan fisik karena banyak berjalan,” papar Dongoran. (m36)

Jamaah Kloter 16 ... kondisinya memprihatinkan selain AC kamar itu tidak berfungsi dengan baik, juga satu kamar ditempati lima orang, sehingga mereka merasa kurang nyaman. Meski sudah diganti 3 kali, tapi AC tersebut belum juga bisa digunakan secara optimal. Yudhi menyebutkan dengan kondisi kamar yang seperti itu, mereka tidak bisa istirahat dan merasa sangat kelelahan dan mengganggu suasana ibadah mereka. 5.445 Calhaj Sumut Humas PPIH Drs HM Sazli bersama Wiznul Hadrin S.Sos, kemarin sore menyebutkan, hingga Minggu malam sudah Calhaj asal Sumut yang tiba di Makkah sebanyak 5.445 orang, yakni kloter 1 sampai kloter 8 dari Madinah dan kloter 14 sampai 17 yang langsung berangkat dari Medan menuju Makkah dari bandara King Abdul Aziz Jedah. Sedangkan 5 kloter lagi, sejumlah 2.264 Calhaj masih berada di Madinah yakni kloter 9 sampai 13, mereka berangsur-angsur ke Makkah setelah salat arbain dan ziarah. “Jadi menghadapi prosesi haji wukuf di Arafah tanggal 9 Zulhijjah, mabit atau bermalam di muzdhalifah serta melontar jumrah di Mina 10 sampai dengan 13 Dzulhijjah. Menurut dr Chairul Rajab Nasution selaku tim kesehatan PPIH di Saudi Arabia telah ada 2.000 petugas kesehatan dan 38 ambulance di kawasan Armina. Deperkirakan jumlah jamaah yang disafari wukufkan dengan ambulance 100 s/d 150 orang,”kata Sazli di humas PPIH Embarkasi Medan. Kloter 17 Dilepas Wabup Dan DPD-RI Sementara itu, Minggu pagi di Aula Asrama Haji, Calhaj kloter 17 resmi dilepas Wakil Bupati Tapsel, H Aldin Rapolo Siregar. Hadir pula anggota DPD-RI, Prof Darmayanti Lubis dan H Rahmat Shah, Ketua PPIH Embarkasi Medan Drs H Syariful Mahya Bandar MAP, Sekretaris Drs H Abd Rahman MA, Humas Drs HM Sazli dan Wiznul HadrinS.Sos. Dalam arahannya Darmayanti Lubis mengingatkan agar para Calhaj menjaga kesehatan dan tidak boros tenaga, karena puncak ibadah haji masih lama sedangkan cuaca di Arab Saudi semakin dingin. Dia berharap para Calhaj mempunyai stamina yang prima, di samping itu harus tetap kompak dan menjaga nama baik Indonesia, khususnya Sumatera Utara. Hal lain yang disampaikan Darmayanti Lubis, prihal banyaknya jamaah perempuan setiap tahun, sudah selayaknya mempunyai petugas haji perempuan. “DPD akan bahas masalah ini dan akan segera menyampaikan kepada pejabat berwenang, saatnya petugtas haji perempuan disiapkan dari setiap embarkasi yang ada di Indonesia, karena

Waspada/Andi Nasution

PASCA bentrok dua kelompok penggarap di Dusun III A, Jalan Selambo, Desa Amplas, Kecamatan Percut Seituan, Jumat (29/10) hingga Sabtu (30/10) kemarin menyebabkan warga Kampung Bawah trauma. Terlihat lokasi pemukiman warga Kampung Melayu (Bawah) masih sepi dikarenakan para penghuni rumah mengungsi di Masjid Al-Barokah yang berada di sekitar pemukiman. Minggu (31/10).

Warga Kampung ... Sabaruddin Sagala, 55, juga warga yang sama menuturkan awal terjadinya bentrok dipicu oleh perusakan tanaman milik warga Kampung Bawah oleh Kampung Atas pada Kamis (28/10) malam. “Tanaman warga Kampung Bawah antara lain ubi, jagung, pepaya dirusak warga Kampung Atas. Mendengar kabar itu sebagian warga Kampung Bawah lantas menuju ke lokasi untuk memastikan kabar perusakan itu. Dan benar saja belasan warga Kampung Atas sedang merusak tanaman milik kami,” tutur Sabaruddin. Malam itu, lanjut Sabaruddin, kami berhasil menangkap Aman Siahaan, warga Kampung Atas pelaku perusakan dan mengamankannya ke Mapolsek Percut Seituan. Namun di Mapolsek Percut Seituan warga diarahkan membawanya ke Mapolresta yang juga menolak pengaduan warga. “Karena tak ditanggapi, malam itu juga warga mengizinkan Aman pulang setelah terlebih dahulu membuat surat perjanjian tidak akan merusak tanaman warga Kampung Bawah lagi,” jelas Sabaruddin. Dilanjutkan Sabaruddin, Jumat (29/10) sekira pukul 14:00 ratusan warga Kampung Atas kembali mendatangi warga

Polisi Periksa 32 ... Warga Kampung Melayu juga terpaksa mendirikan dapur umum, sekaligus menyediakan masakan bagi seluruh warga yang menjadi korban termasuk pemilik dan keluarga dari tujuh rumah yang musnah dibakar oleh kelompok penyerang. Mereka juga kecewa dengan sikap petugas Polsekta Percut Seituan yang dinilai tidak tegas dalam menangani kasus di areal tanah garapan tersebut. Sabarudin Sagala, 55, warga Kampung Melayu mengatakan, setelah peristiwa penyerangan tersebut, mereka seperti mendapat musibah beruntun. Bak kata pepatah; sudah jatuh tertimpa tangga pula. Sudah diserang dan diancam akan dibunuh, malah mereka yang dilaporkan kepada petugas kepolisian. “Ada 32 orang warga Kampung Melayu yang akan diperiksa di Polsekta Percut Seituan. Besok kami akan menjalani pemeriksaan karena ada pihak penyerang yang menderita lukaluka dan mengadu ke Polsekta Percut Seituan,” ujar Sabaruddin Sagala kepadaWaspada, di areal tanah garapan, Minggu (31/10). Menurut Sabarudin Sagala,

setiap tahun jumlah jamaah perempuan mengalami peningkatan. Untuk Medan saja, tahun ini ada 1.437 Calhaj perempuan, sedangkan Calhaj laki-laki hanya 1032 orang,”kata Darmayanti. Dia juga mengingatkan agar lebih mengutamakan ibadah daripada berbelanja, karena tujuan utama ke sana untuk menunaikan rukun Islam kelima dan menuju haji yang mabrur. Sedangkan Rahmat Shah, berharap para petugas yang telah ditunjuk oleh pemerintah mendampingi jamaah, agar melaksanakan tugas dengan baik. Meski pada dasarnya mereka bertugas, tetapi tetap bisa melaksanakan ibadah dengan sempurna. Wakil Bupati Tapanuliselatan, H. Aldin Rapolo Siregar mengingatkan para jamaah agar memperbanyak amal daripada memperbanyak berbelanja. “Orang Tapsel sudah terkenal banyak belanja saat berada di tanah suci, berulang kali saya mengimbau agar mereka sekedarlah membeli oleh-oleh untuk keluarga,” Kata Rapolo, yang menyebutkan kebiasaan berbelanja itu terlihat saat mereka kembali ke tanah air dari tanah suci berbagai macam oleh-oleh dari tanah suci mereka bawa ke tanah air, dari gantungan termos, ceret kuning dan lainnya dikiri kanan bahunya bahkan di atas kepalanya lagi masih banyak jinjingan yang membuat mereka menjadi melarat. “Saya kira oleh-oleh dibawa dari tanah suci bagus, namun alangkah baiknya membeli sekedarnya saja,” kata Siregar yang didampingi Wabup Paluta Riskon Harahap bersama Sekretaris PPIH Embarkasi Medan Drs H. Abd Rahmah Harahap, MA. Dia juga mengakui, Calhaj Kloter 17 ini banyak jamaah berusia lanjut, sehingga peranan petugas haji Karom maupun Karu sangat besar membantu para jamaah. “Antara jamaah juga harus saling membantu sehingga tercapai cita-cita menjadi haji mabrur yaitu haji ditunggu banyak orang,” ujarnya. Bahkan kata dia, jamaah Risti dari Tapsel ini pada musim haji 2010 mencapai 65 persen akibat lama mereka menunggu baru dapat giliran berangkat ke tanah suci, ujar Rapolo Siregar yang dibenarkan Kakandepag Tapsel Drs H. Hasyim Hasibuan. Diakuinya, jamaah Risti ini setiap tahun lebih meningkat jika dibandingkan musim haji tahun-tahun sebelumnya. Demikian juga jamaah calon haji (Calhaj) daerah penghasil sawit itu mengalami peningkatan antara lain pada musim haji 2010 Calhaj Ta[sel 152 orang, Paluta 320 orang dan Palas 515 jamaah dan ratusan jamaah daftar tunggu untuk empat tahun ke depan. Sebagai contoh, kata dia, 452 Cahaj Kloter 17 yaitu usia antara 61 hingga 80 tahun kalangan wanita 106 orang dan pria 75 orang. “Setiap Kloter jamaah kalangan wanita lebih meningkat, ke

Kampung Bawah yang melakukan penjagaan di sekitar areal tanaman dan tanpa basa-basi warga Kampung Atas menyerang warga Kampung secara membabi buta yang menyebabkan lima warga Kampung Bawah mengalami luka lembam akibat dipukul dengan balok kayu dan batu. Kemudian, Sabtu (30/10) sekira pukul 12:00 warga Kampung Atas kembali menyerang warga Kampung Bawah serta membakar tujuh unit rumah warga Kampung Bawah masing-masing milik Khairul Anwar, 38, Darto Arjadi, 41, Haris, 41, Junaidi, 34, Adi Susilo, 40, Suherman, 40 dan Ridho, 32. Kecewa Warga Kampung Bawah kecewa dengan pemberitaan media terkait bentrokan, terutama pemberitaan Minggu (31/10) yang menyebutkan warga Kampung Atas dihuni salah satu etnis.“Warga Kampung Atas mayoritas dihuni salah satu etnis. Kalau Kampung Bawah mayoritas dihuni etnis lain,” tegas Awaluddin Limbong. Selain itu, pada pemberitaan juga mengatakan, Jumat (29/10) pagi, warga Kampung Bawah melakukan pengamanan di areal yang tanaman dirusak oleh sekelompok warga dari salah satu etnis. “Itu tidak benar. Yang merusak warga Kampung

Atas dan kami warga Kampung Bawah selaku korban perusakan,” bantah Awaluddin. Minta Keadilan Warga Kampung Bawah juga meminta pihak berwajib dapat menegakkan keadilan yang seadil-adilnya. “Saya heran kenapa kepala keluarga yang ada di Kampung Bawah dipanggil Mapolsek Percut Seituan sebagai saksi atas laporan Roni Parulian Purba dengan nomor surat No. SP.Gil/1146U/X/2010/ Reskrim untuk dimintai keterangan sebagai saksi dalam perkara tindak pidana penganiayaan secara bersama-sama,” sebut Awaluddin. Diungkapkan Awaluddin, jika bentrok itu dikatakan sebagai tindak pidana penganiayaan secara bersama-sama, maka yang harus dimintai keterangan warga Kampung Atas. “Kami merasa bahwa kami yang dianiaya secara bersama-sama. Karena pada Jumat (29/10) siang kemarin, ratusan warga Kampung Atas mendatangi dan menyerang Kampung Bawah secara membabi buta sehingga menyebabkan empat warga mengalami luka lembam. Kami sebagai warga yang diserang berharap pihak yang berwajib dapat menegakkan keadilan seadiladilnya,” harap Awaluddin sembari menunjukkan luka lembam ditubuhnya. (csn)

sebelumnya mereka sudah pernah membuat pengaduan ke Polsekta Percut Seituan karena ada salah seorang warga dari kelompok penyerang yang tertangkap basah membabati tanaman milik warga Kampung Melayu. Kemudian, warga tersebut dibawa ke kantor Polsekta Percut Seituan namun oleh petugas pengaduan tersebut tidak diterima sehingga pelaku pembabat tanaman warga dikembalikan kepada keluarganya. “Namun, saat kampung kami diserang dan kami dianiaya oleh seratus lebih penyerang, kami yang menjadi korban penyerangan. Tetapi, kelompok penyerang pula yang mengadukan kami. Ini kan aneh. Polisi harus profesional menangani kasus ini. Mana keadilan bagi warga Kampung Melayu,” tutur Sabarudin Sagala. Sementara itu, Kapolsekta Percut Seituan AKP M Simanjuntak yang dikonfirmasi Waspada, Minggu mengatakan, ke32 warga Kampung Melayu akan dimintai keterangannya berdasarkan pengaduan dari dua korban luka bacok masing-masing Aman Sianipar dan Haposan Sapta Purba. “Surat panggilan kepada 32 warga Kampung

Melayu itu sudah disampaikan kepada yang bersangkutan,” jelas AKP M Simanjuntak. Menurut AKP Simanjuntak, pasca bentrokan situasi di areal lahan garapan Selambo sudah mulai kondusif. Warga sudah beraktivitas kembali seperti biasa. “Satu regu polisi masih berjaga di areal sengketa untuk mencegah jangan ada lagi bentrokan,” tambahnya. Korban Masih Dirawat Aman Sianipar, 34, salah seorang korban bentrok antar warga penggarap dilahan PTPN II masih keadaan kritis, Minggu (31/10) siang, di Ruang ICU RSU dr.PirngadiMedan.Diatelahmenghabiskan lima kantong darah. Pada bentrok di Jl. Selambo Percut Sei Tuan, Sabtu (30/ 10) itu, Aman, warga Kampung Toba Selambo Percut Sei Tuan, mengalami luka bacok di bagian kepala, leher, lutut dan pinggang, hingga mengeluarkan banyak darah. “Sudah sadar, tapi belum bisa ngomong. Dari tadi malam saya yang menjaga di sini,” ujar ayah kandungnya Gabariel Sianipar, 69, Minggu (31/10). Sedangkan Roni Haposan, yang juga terkena luka bacok sudah diperbolehkan pulang. (cat/cmai)

Waspada/Abdullah Dadeh

BEBERAPA jamaah usia lanjut ada yang menggunakan tongkat penyangga, dipapah saat turun ambulan oleh Amat, petugas Imigrasi Polonia Medan (kanan) maupun petugas kesehatan haji Medan. depan sebaiknya ada perimbangan setidaknya Kepala rombongan (Karom) dan Kepala regu (Karu) ditugaskan juga dari kalangan wanita,” ujar Siregar. Dalam rombongan itu pria termuda Mustopa Wahab Harahap bin KH. Wahab, 23, dan Putri Nata Harahap binti Hairum Harahap, 21. Sementara Calhaj tertua Hatembalan Oloan Harahap bin Mangaraja Oloan, 86 dan Dewana Lelo Daulay binti Bgd Lelo Daulay, 86. Tiga jamaah Kloter 17 ditunda berangkat dua orang sakit sebelum masuk asrama dan setelah masuk asrama haji Medan dan seorang pendamping. Mereka yang tertunda antara lain Nur Asli Pasaribu binti Marajo Pasaribu, 51, Nur Baek Siregar binti Mangaraja Induk Siregar, 51 dan Hamdan bin Malim Sholeh Harahap, 52. Suasana pemberangkatan jamaah Kloter 17 terlihat sejumlah Calhaj usia lanjut menggunakan tongkat, ada yang dipapah saat akan naik pesawat haji, bahkan ada juga yang digendong petugas Garuda saat akan naik ke pesawat Corsair chateran Garuda Indonesia. (m32/m36/h10)

Luar Negeri

WASPADA Senin 1 November 2010

Pengebom Bunuhdiri Renggut 30 Jiwa Di Utara Baghdad BAGHDAD, Irak (AP): Seorang pengebom bunuhdiri yang mengenakan rompi bahan peledak telah mengaktifkan bomnya yang menyebabkan sekurang-kurangnya 30 orang tewas di satu kota di utara Baghdad — yang berpenduduk mayoritas Syiah. Serangan itu mengakhiri masa tenang selama beberapa minggu di ibukota Irak tersebut, demikian menurut walikota kota itu. Selain korban tewas, 65 orang lainnya mengalami lukaluka, demikian disampaikan oleh pejabat pemerintah setempat. Muthana al-Timimi, kepala komite keamanan Dewan Provinsi Diyala, mengatakan bahwa kemungkinan bakal ada serangan kedua oleh pelaku bom bunuh diri di rumah sakit tempat para korban dirawat. Ledakan di kota Balad Ruz itu menunjukkan situasi keamanan di Irak masih belum sepe-

nuhnya aman pada saat negara itu memasuki masa delapan bulan tanpa pemerintahan baru sejak pemilihan Maret lalu. Pengebom bunuhdiri meledakkan dirinya di dalam satu kafe populer di kota Balad Ruz, 70 km di timurlaut Baghdad pada saat masyarakat berkumpul bermain domino dan minum-minum teh, kata Walikota Mohammed Maaruf. Kawasan di mana terjadi ledakan itu merupakan daerah

Dua Korea Lakukan Reuni Bagi Keluarga Yang Terpisah SEOUL, Korea Selatan (AP): Ratusan anggota keluarga Korea yang telah terpisah lebih dari setengah abad akibat Perang Korea Sabtu (30/10) saling berpelukan dalam tangisan ketika mereka melakukan reuni. Reuni tersebut dilakukan sehari setelah pasukan kedua Korea saling tembak di Zona Demiliterisasi yang membagi dua Semenanjung Korea. “Saya pikir kamu telah mati. Ibu amat kehilanganmu,” kata Lee Min-gwan, 61, dari Korea Selatan (Korsel) mengatakan pada ayahnya Ri Jongp-ryol, 90, demikian menurut laporan dari pool pemberitaan oleh para wartawan setempat. “Saya tidak melupakanmu seharipun selama 60 tahun ini,” kata Ri kepada putranya, yang berusia 100 hari ketika mereka berpisah selama perang. Media asing tidak diizinkan meliput acara reuni tersebut. Lee termasuk di antara 436 warga Korsel yang melakukan perjalanan dengan bus ke kawasan wisata Pegunungan Berlian, Korut, Sabtu untuk ikut ambil bagian dalam reuni tiga hari bagi kira-kira 100 keluarga Korut. Acara itu merupakan yang pertama dalam dua bagian reuni. Rabu lalu, kira-kira 200 warga Korut mulai pertemuan tiga hari dengan keluarganya di Korut di daerah yang sama. Jutaan keluarga Korea terpisah setelah Semenanjung Korea terpisah tahun 1945 dan Perang Korea 1950-1953. Reuni itu merupakan pertemuan yang amat emosional bagi keluarga Korea, karena kebanyakan peserta dalam program reuni tersebut adalah warga jompo dan mereka yang amat bersemangat untuk melihat orang yang disayanginya sebelum mati. Lebih dari 20.800 anggota keluarga telah ambil bagian dalam reuni sejak dilakukan pertama kalinya pada KTT Korea tahun 2000. (m07)

Perahu Pengangkut Peziarah Terbalik Di India, 18 Tewas CALCUTTA, India (AP): Polisi India mengatakan, satu perahu yang mengangkut para peziarah terbalik di sungai dekat Teluk Benggali. Sedikitnya 18 orang tenggelam dan puluhan orang lainnya masih dinyatakan hilang Wakil Direktur Polisi Benggali Barat Surajit Kar Purkavastha mengatakan Minggu (31/10), lebih 100 orang berada di perahu itu ketika terbalik akibat gelombang yang ditimbulkan kapal yang lewat dekat pulau Ghoramara. Kapasitas perahu itu cuma 60 orang. Orang-orang perahu setempat berhasil menyelamatkan 40 orang serta menemukan 18 jenazah lainnya sebelum usaha penyelamatan dihentikan karena hari sudah gelap. Para nelayan dan personil AL India melakukan pencarian ulang untuk menemukan orang-orang yang hilang. Minggu, para peziarah dalam perjalanan pulang ke kota Kakdwip setelah berdoa di Hijli di Midnapur.(m18)

AS Minta China Desak Korut Kembali Ke Perundingan Nuklir HANOI, Vietnam (Antara/AFP): Menlu Amerika Serikat (AS) Hillary Clinton mendesak Menlu China Yang Jiechi agar menggunakan pengaruh pemerintahnya untuk mendesak Korea Utara kembali ke pembicaraan perlucutan senjata nuklir. Dalam pembicaraan di sela Pertemuan Puncak Asia Timur di Hanoi, Sabtu (30/10), Hillary Clinton juga minta Yang untuk membuat China mendesak Korea Utara (Korut) agar melancarkan jalan bagi pertemuan puncak Kelompok 20 di Korea Selatan (Korsel) dan meningkatkan hubungan dengan Seoul, kata seorang pejabat senior Deplu AS pada wartawan. “Kami telah sampaikan hari ini perlunya bagi China untuk mendesakkan tekanan dan pengaruh pada Korut, pertama dari semuanya, untuk menunjukkan tanggungjawab menjelang (pertemuan puncak) G20 dan melakukan langkah-langkah secukupnya agar mereka dapat membangun kembali kepercayaan dan hubungan dengan Korea Selatan dan juga kembali ke pembicaraan enam pihak itu,” kata pejabat tersebut. Korut mengatakan bulan ini bahwa negara itu siap untuk memulai lagi pembicaraan enam pihak mengenai program nuklirnya, tapi tidak memberikan indikasi mengenai apakah negara itu telah melepaskan syarat-syaratnya yang mencakup pencabutan sanksi dan pembicaraan terpisah dengan Washington.

Saudi Ingin Bantu Irak Bentuk Pemerintah Baru RIYADH, Arab Saudi (Antara/AFP): Raja Arab Saudi Abdullah mengundang para pemimpin politik Irak untuk bertemu di Riyadh dalam usaha menyelesaikan jalan buntu pembentukan pemerintah baru, yang menimbulkan reaksi negatif di Baghdad. Raja itu menyeru para pemimpin Irak bertemu di Riyadh setelah Idul Adha “di bawah naungan Liga Arab dalam usaha mencari satu solusi masalah pembentukan pemerintah baru, yang terlalu lama tertunda.” Undangan itu tidak menetapkan tanggal khusus, hanya mengatakan perundingan itu sebaiknya diselenggarakan setelah Idul Adha, yang jatuh pada 16 November, dan setelah ibadah haji di Mekah 14-18 November. “Semua orang tahu anda berada di persimpangan jalan, dan anda harus melakukan segala yang mungkin usaha untuk menyatukan diri anda sendiri... mengatasi pertikaian-pertikaian anda dan menghentikan sektariasme yang buruk,” kata raja itu dalam sebuah pernyataan yang disiarkan kantor berita resmi SPA Sabtu (30/10). “Kami... menjamin anda tentang kesediaan penuh kami untuk membantu dan mendukung anda dalam penyelesaian apapun yang Anda sepakati untuk memulihkan keamanan dan perdamaian di tanah Mesopotamia,” katanya. Di Baghdad, seorang anggota parlemen yang dekat dengan PM Nuri al Maliki, yang sedang berusaha mempertahankan jabatannya, mencemoohkan undangan itu. “Prakarsa Arab Saudi itu tidak positif, dan negara itu tidak punya peran karena bukan sebuah negara netral dalam beberapa tahun belakangan ini; negara itu selelu memiliki sikap negatif terhadap (Maliki) dan blok Negara Hukumnya,” kata Samial Askari. “Seharusnya undangan ini datang dari negara-negara lain, seperti Jordania, Suriah atau bahkan Turki, itu akan akan memiliki peluang lebih baik untuk diterima.”

yang kebanyakan dihuni oleh masyarakat Faili Kurdi, satu kelompok kecil etnis Kurdi yang merupakan pengikut Syiah. Kebanyakan korban tewas dalam ledakan itu adalah warga Syiah. Meski belum ada kelompok yang menyatakan bertanggungjawab atas serangan itu, namun karena sasaran ledakan kaum Syiah maka biasanya aksi itu selalu dilakukan oleh pemberontak Sunni yang berusaha untuk menimbulkan kerusuhan

sekte. Ledakan tersebut merupakan serangan bom bunuhdiri yang pertama terbesar di Irak sejak awal September, ketika faksi-faksi politik terus gontokgontokan mempersoalkan berbagai posisi dan kekuasaan hampir delapan bulan setelah pemilihan umum di negara itu. Serangkaian serangan bom kecil dan pembunuhan telah berlanjut setiap harinya menyusul berakhirnya operasi formal

perang AS pada 31 Agustus, 7 1/2 tahun setelah invasi pimpinan AS yang memicu perang sekte di Irak. “Saya berada dekat cafe dan tiba-tiba satu ledakan besar terjadi di dalamnya dan timbullah kekacauan di sekitar tempat itu,” kata Sadeq Abbas, seorang pria Kurdi berusia 41 tahun dari Balad Ruz, yang terletak dipertengahan jalan ke perbatasan Iran dari kota rawan Baquba. (m07)

Dua Pengacara HAM China Dilarang Pergi Ke AS BEIJING, China (Antara/ AFP): Dua pengacara terkemuka hak asasi manusia China dilarang terbang ke Amerika Serikat untuk menemui para pakar hukum, kata seorang pembela itu dan satu kelompok aktivis, di tengah tindakan keras terhadap para aktivis. Li Subin dan Jiang Tianyong, Sabtu dicegah pihak bea cukai di bandara Beijing dan Shanghai ketika sedang bersiap-siap bertolak ke Amerika Serikat, kata kelompok hak asasi manusia Kristen yang berpusat di AS ChinaAid di laman internetnya. Li mengemukakan kepada AFP, Minggu (31/10) bahwa pihak bea cukai mengatakan “markas besar keamanan negara Beijing ‘tidak mengizinkan dia pergi, tanpa merinci lebih jauh.’ Dia akan ke Amerika Serikat untuk menemui para anggota kehakiman dan masyarakat hukum, katanya. Telefon Jiang dimatikan. ChinaAid mengatakan di laman internetnya bahwa kedua pengacara itu diundang untuk pertukaran akademik di AS dengan pakar-pakar hukum AS dan mengamati pemlihan tengah masa jabatan di negara itu, Selasa. Bob Fu, kepala ChinaAid dan mantan pemimpin mahasiswa dalam protes demokrasi di Tianmen tahun 1989 yang secara kejam ditumpas tentara,

dapat berbicara dengan dua pengacara itu setelah mereka dilarang meninggalkan China. “Tampaknya satuan keamanan domestik tahu rencana mereka sebelum mereka pergi ke bandara,” katanya di laman internet itu. Para aktivis , juru kampanye hak sipil dan pakar di China berada dalam pengawasan ketat

sejak pembangkang Liu Xiabo— dipenjarakan karena dituduh melakukan kegiatan subversi- dianugerahi hadiah Nobel Perdamaian pada 8 Oktober. Polisi telah menempatkan puluhan aktivis dalam tahanan, tahanan rumah atau pengawasan yang meningkat sejak itu, termasuk istri pemenang hadiah Nobel Perdamaian itu Liu Xia.

Sekjen PBB Bahas Myanmar Dengan China BEIJING, China (Antara/AFP): Sekjen Perserikatan Bangsa Bangsa (PBB) Ban Ki-moon, dalam kunjungan ke China, mengadakan pembicaraan dengan Menteri Luar Negeri Yang Jiechi mengenai situasi di Myanmar menjelang negara yang sering dikritik itu menyelenggarakan pemilu pekan depan. Ban bertemu Yang di Shanghai Sabtu pada hari pertamanya di China sebelum menghadiri penutupanWorld Expo, Minggu (31/ 10). “Selain membahas perlucutan senjata nuklir dan non-proliferasi, mereka juga membahas situasi di Semenanjung Korea, Myanmar dan Sudan,” kata seorang juru bicara PBB dalam pernyataan yang diemailkan ke AFP, tanpa memberikan detil selanjutnya. Pemimpin PBB telah menyerukan agar lebih mendesak Myanmar membebaskan pemimpin oposisi Aung San Suu Kyi dan lain-lain menjelang pemilu pertama negara itu dalam dua dasawarsa terakhir, pada 7 November. Negara-negara Barat dan para aktivis telah mengecam pemilu itu tidak demokratis, jika Suu Kyi masih ditahan, dan partai-partai pro-demokrasi menuduh larangan-larangan masih dikenakan oleh rezim tangan besi militer, dan hampir dipastikan akan dimenangkan oleh rezim berkuasa. China adalah salah satu sekutu terdekat Myanmar dan sejak lama membantu melalui hubungan perdagangan, penjualan senjata, dan membelanya dari sanksi-sanksi PBB berkaitan dengan pelanggaran-pelanggaran hak asasi manusia (HAM), selaku anggota Dewan Keamanan PBB yang memiliki hak veto.

A3 Pengebom Bunuhdiri Cederai 15 Orang Di Istanbul ISTANBUL, Turki (Antara/Reuters): Seorang yang diperkirakan pengebom bunuhdiri mencederai setidaknya 15 orang di Taman Taksim di tengah kota Istambul, Minggu (31/10), kata media Turki. Di antara 15 orang yang cedera itu, enam adalah polisi dan sembilan warga sipil dan peneyrang tampaknya adalah pria, kata komandan polisi Istambul Huseyin Capkin. Tidak jelas apakah pengebom itu seorang pengebom bunuhdiri. Pada saat itu ada enam warga dan sembilan polisi cedera. Tidak ada yang tewas,” katanya mengacu pada korban-korban itu. Dua dari yang cedera itu berada dalam kondisi serius, katanya. Capkin mengatakan serangan itu ditujukan pada polisi tetapi tidak jelas siapa yang berada dibelakang serangan itu. Pemberontak PKK (Partai Pekerja Kurdistan) serta kelompoklainnyapadamasalalume-

ledakan bom-bom di Istambul. Gerilyawan al Qaida berada dibelakang serangan-serangan bom di Istambul tahun 2003 yang menewaskan 57 orang dan mencederai ratusan orang lainnya. Gambar-gambar televisi menunjukkan pasukan keamanan mengarahkan dinas-dinas darurat menuju lokasi ledakan itu.Taman

Taksim ditutup. Taman itu adalah satu lokasi yang menrik bagi para wisatawan dan pusat angkutan, yang dikelilingi restoran-restoran, dan di tengah Istambul modern. Di lokasi itu terdapat Monumen Republik yang dibangun tahun 1928 untuk memperingati terbentuknya Republik Turki.

Seorang Ahli Bom Inggris Tewas Di Afghanistan LONDON,Inggeris(Antara/AFP):SeorangInggrisahlipembuangan bom tewas akibat luka tembak ketika ia mencoba mengambil sebuah barang yang dicurigai bom di kawasan selatan Afghanistan, demikian dikatakan oleh pihak Departemen Keamanan Inggris. Tentara dari RegimenTeknik 101 (Pembuangan Bom yang berbasis di kota London), meninggal dunia di distrik Nahr-e Saraj yang terletak di Provinsi Helmand selatan Sabtu (30/10). “Dia adalah bagian dari tim yang bertanggungjawab atas pembersihan ranjau darat demi keselamatan pasukan sekutu dan tentara Afghan ... ketika dia tertembak dalam aksi baku-tembak kecil,” kata jurubicara Regimen Kelmand Letnan Kol. David Eastman. Hingga kini total 342 tentara Inggris telah meninggal di Afghanistan, dengan beragam sebab sejak operasi invasi digelar tahun 2001. Inggris mengirimsekitar9.5000tentarakeAfghanistan,kebanyakandiHelmand.



WASPADA Senin 1 November 2010

Ariel Siap Hadapi Sidang Perdana

XL Rangkul Band Indie Sumatera

Secara psikologis, Ariel sudah siap melaju ke meja persidangan. Ia cukup kuat menghadapi kasusnya Violin Iskandar Wijaya dan pianis DR Christine Utomo saat beraksi dalam konser Duo Recital Biola dan Piano di Auditorium Irama Music Studio, Jumat malam.(Ist)

Konser Iskandar Wijaya Christine Utomo Memukau Penonton Penampilan dua jam lebih dua musisi andal kaliber internasional Iskandar Wijaya dan Christine Utomo dalam demo konser Duo Recital Biola dan Piano di Auditorium Irama Music Jl Perniagaan Medan, Jumat malam, mampu memukau para penikmat musik di daerah ini. Pada konser itu Christine memiliki talenta memainkan jarijemarinya dengan lincah di atas tuts piano berkolaborasi dengan violin Iskandar Wijaya yang menggesek senar biola menghasilkan harmonisasialunanmusikindahdalamalunanklasikmaupunkemasan modern. Sekitar dua jam keduanya tampil di hadapan penonton Medan, menyuguhkan beberapa lagu ciptaan komponis dunia WA Mozart, Cesar Frank, F Chopin, karya Pablo de Saraste Ziguennerweisen, dan Carmen Fantasy. ‘’Kolaborasi indah ditampilkan kedua seniman itu dengan sangat apik, spenonton terbuai dengan permainan mereka yang mengagumkan,” ujar seorang penonton. Usai tampil dalam konser bertajuk Duo Recital ini, Iskandar Wijaya merupakan cucu dari konduktor terkenal Indonesia Udin Wijaya mengaku senang bisa tampil di Medan. Meskipun pernah tampil dalam berbagai konser di mancanegara, seperti Jerman, Spanyol, Belgia, Austria, Gedung Kesenian Jakarta dan lainnya namun apresiasi penonton Medan ini cukup tinggi terhadap lagu-lagu klasik, katanya sembari memuji penampilan DR Christine Utomo yang makin tangguh sebagai pianis. ‘’Saya berharap di lain kesempatan bisa berkolaborasi dan tampil berdua lagi dengan dia. Christine memiliki performance hebat,” kata Iskandar. Di akhir acara keduanya menerima karangan bunga dari pendiri Irama Music Studio dan juga pendiri organisasi Le Beau Dussek Piano Society Lindawaty Angkasa Hon, LCM.(m03)

lantaran derasnya dukungan dari sahabat dan fansnya. “Ariel siap. Ada semangat karena banyak yang mengunjunginya,” kata Capung ‘Java Jive’, sahabat Ariel. Meski sudah sepekan Nazriel Irham alias Ariel ‘Peterpan’ menghuni Rumah Tahanan Kebon Waru, Bandung, Jawa Barat. Ia menanti jadwal sidang perdana atas kasus video porno yang membelitnya. “Kemarin dicek, berkas Ariel belum sampai di Pengadilan Bandung,” kata Aga Khan, kuasa hukum Ariel di Bandung, Minggu, (31/10). Meski demikian, bukan

Ariel/ant berarti Ariel siap mengakui semua tuntutan jaksa. Soal pengakuan atas adegan porno bersama Luna Maya dan Cut Tari bukan bagian dari materi sidang. “Mengaku atau tidak itu hak privasi Ariel, bukan masuk materi perkara,” ucap Aga Khan. Ariel terjerat sejumlah pasal antara lain Pasal 29 UU No 44 tahun 2008 tentang Pornografi, Pasal 27 ayat 1

UU No 11 tahun 2008 tentang Informasi dan Transaksi Elektronik (ITE), dan Pasal 5 ayat 3 huruf b UU Darurat No 1 tahun 1951. Menurut Kepala Biro Penerangan Masyarakat Polri, Brigjen Pol I Ketut Untung Yoga Ana, ancaman hukuman untuk Pasal 29 UU Pornografi adalah 6 bulan sampai 12 tahun. Untuk UU ITE, 5 tahun.(vvn)

Band-band indie di wilayah Sumatera mulai dilirik operator selular XL yang merangkul mereka dalam satu album kompilasi bertajuk ‘Jong Sumatranenbond’. Acara launching album dimeriahkan penampilan Jimmy Lever dan Leg To Decay turut mengisi track di album kompilasi ini di Band indie Jimmy Lever turut menyemarakkan launching album Jong Merdeka Walk Sumatranenbond Jumat (29/10) malam sekalian persembahan XL Bagi Sumatranenbond memang mengambil Negeri di program pencanangan Soempah semangatnya Sumpah Pemuda, apalagi Pemoeda Semangat Juara Rp1 perSMS. seluruh pengisi album ini band-band indie Menurut Wulli Marwanto-Promo hasil seleksi dari Pulau Sumatera. Manager Sumatera PT XL Axiata,tbK saat Disebutkannya, untuk mendapatkan menyaksikan launching album tersebut album kompilasi ini cukup melakukan Jumat (29/10) malam menyebutkan, reload pulsa Rp25.000,- di XL Center sepuluh band ini berhasil lolos seleksi Medan dan P.Siantar. Sementara lagu-lagu dalam program Anthems of Indiespired di album ini juga bisa didownload, karena 2010. mereka diikat kerjasama RBT. Dari sepuluh grup band indie ini, Sementara acara kampanye tarif Rp1 tercatat dua grup berasal dari Sumatera per SMS digelar konvoi betor keliling kota Utara masing-masing Jimmy Lever dan Medan diiringi marching band dan aksi Leg To Decay. cheer leaders serta kumpulan tarian Sementara seleksi band-band tersebut tradisional Sumatera Utara sudah dilakukan sejak tahun 2009 melalui dipersembahankan Medan Harmony roadshow di beberapa kota di Sumatera dilepas Francky Rinaldo Pakpahan-General atas kerjasama dengan Pura-Pura Record. Manager Sales Northerm Sumatera. Label album mengambil tema Jong (m09)

Alunan Angklung Bohemian Rhapsody Pukau Publik Inggris LAGU “Bohemian Rhapsody”, karya kelompok musik legendaris Queen dibawakan dengan apik kelompok musik angklung pimpinan Daeng Oktafiandi Udjo berhasil memukau lebih dari 200 undangan memenuhi Conway Hall, Red Lion Square, di pusat Kota London, Rabu (27/10) malam. “Sangat bagus dan menakjubkan,” ujar Diccon Pullen dari Royal Asiatic Society, usai pementasan pagelaran budaya bertajuk “The Heritage of Indonesia” diadakan KBRI London bekerja sama dengan Masyarakat Pecinta Seni Budaya Cinta Nusantara (Citra) binaan Letjen TNI (Purn) Agum Gumelar. Lesley Pollen mengatakan, dirinya tidak pernah membayangkan penampilan dengan alat musik angklung yang begitu indah. Pecinta kain Indonesia itu juga mengakui semua orang sangat menikmati pertunjukan dan merupakan malam yang sangat berkesan. “Anda perlu ruangan yang lebih besar,” ujar mantan Dubes Inggris untuk Indonesia, Charles Humprey, yang datang bersama istri dan berencana akan berlibur ke Indonesia selama sebulan ke Bali, Flores dan Maluku. Charles Humpresy mengakui bahwa ia bersedia membantu mengadakan acara serupa di tempat yang lebih luas dalam upaya mempromosikan Indonesia di Inggris. Dikatakannya, kelompok musik Citra ini berhasil membawa Indonesia ke London dengan beragam kesenian yang mereka tampilkan dari berbagai Indonesia. Sebelum konser musik angklung dibawakan hanya delapan personel dari kelompok Daeng Udjo, para penari Citra Nusantara menampilkan Tari Rapai Geleng, tari tradisional asal Aceh Selatan, yang ditampilkan dengan gerakan yang lincah dan gemuruh dengan diiringi alat musik rebana.(ant)

07.30 Si Doel Anak Sekolahan 09.00 Dahsyat 11.00 Silet 12.00 Seputar Indonesia Siang 12.30 Sergap 13.00 Aksi Anak Bangsa 14.15 Kuis TakTik BOOM 15.00 Kabar Kabari 16.00 Minta Tolong 17.00 Seputar Indonesia 17.30 Si Kecil Berhati Besar 18.00 Putri Yang Ditukar 20.00 Kemilau Cinta Kamila 22.30 Mega Sinema Cewek Global Warming 00.30 BOM : The Blood Rules 01.00 Seputar Indonesia Malam


07.15 SCTV Musik Inbox 09.00 Halo Selebriti 10.00 SCTV FTV Pagi 12.00 Liputan 6 Siang 12.30 SCTV FTV Siang 14.30 Status Selebritis 15.00 Uya Emang Kuya 16.00 Cinta Juga KUya 17.00 Liputan 6 Petang 18.00 Islam KTP 19.00 Taxi 20.30 Cinta Fitri 22.00 SCTV Sinema 00.30 Liputan 6 Malam

07:00 Disney Club 07.30 Cerita Pagi 08:30 Cerita Pagi 10.00 Cerita Siang 11:00 Sidik 12:00 Layar Kemilau 13:30 Cerita Sore 14:30 Starlite 16.00 Viking 16:30 Lintas - 5 18:30 Animasi Spesial 19.00 Upin & Ipin 21.00 Layar Sinema 22:30 Sinema Pilihan 00:00 Lintas Malam

08:30 Sinema Pagi 10:30 DRTV 11:00 Piss Man 11:30 Topik Siang 12:00 Klik! 13:00 Sinema Siang 16.30 Seleb Ngamen 17.00 Wayang On Stage 18:30 Super Family 19:30 Super Deal 2 Milyar 21:00 Penghuni Terakhir 22:00 Topik Kita 23:00 World Most Amazing Video III 00:00 Topik Malam

07.00 Dive Olly Dive 07:30 FTV Pagi 09.30 FTV Drama 11:30 Patroli 12:00 Happy Song 14:00 KiSS Sore 15:00 Fokus 15:30 Kartun 17:00 Arti Sahabat 18:00 Superboy 19:00 1 Lawan 100 20:30 Take A Celebrity Outb 23.00 Sinema Asia

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07.05 Editorial Media Indonesia 08.05 Rachael Ray Show 09.05 Indonesia This Morning 09.30 Breaking News 10.30 Metro Xin Wen 11.05 Menu And Venue 13.05 Zero to Hero 14.05 Sport Club 16.05 Discover Indonesia 17.05 Metro Hari Ini 18.05 Metro Hari Ini 20.05 Suara Anda 20.30 Genta Demokrasi 21.05 Top Nine News 21.30 Sentilan Sentilun 22.05 Economic Challenges 23.05 Metro Realitas 23.30 Metro Sports

07.30 Rangking 1 08.30 Derings 10.00 Suami Suami Takut Istri 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Online (Olga & Jeng Kellin) 14.30 Jail Fresh 16.00 Kejar Tayang 17.00 Reportase Sore 18.00 Jika Aku Menjadi 18.45 Sketsa 19.15 Gong Show 20.00 Realigi 21.00 Bioskop TRANS TV 23.00 Bioskop TRANS TV 01.30 Reportase Malam

06.30 Apa Kabar Indonesia 11.00 Nuansa 1000 Pulau 11.30 Kabar Keadilan 12.00 Kabar Siang 13.30 KAbar Haji 14.30 Jendela Usaha 15.00 Kabar Pasar 16.00 Menyingkap Tabir 17.00 Renungan Hari Ini 17.30 Kabar Petang 20.00 Jakarta Lawyer 20.30 Apa Kabar Indonesia Malam 22.30 Telusur 23.00 Auto Expert 23.30 Kabar Arena

08:00 The Backyardigans 08:30 Dora The Explorer 10:30 Bukan Sinetron 12:00 Abdel & Temon Bukan Superstar 13:00 Global Siang 13:30 Spongebob Squarepants 14:00 Marvo the wonder chicken 14:30 Tak and The Power of Juju 15:00 Petualangan Panji 15:30 Berita Global 17:00 Kapten Tsubasa 20.00 Big Movies 21.00 Mendadak Alim 00.00 Global Malam 01.30 MTV Insomnia

07:30 Selebriti Pagi 08:00 CAWAN 09:00 Inspirasi Dorce 10:00 Rahasia 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Ayo Menyanyi 14:00 Kuas Ajaib 15:30 Jejak Petualang 16:00 Redaksi Sore 18:00 Wara Wiri 18.30 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata



WASPADA Senin 1 November 2010


Barca Bukan Saingan Sevilla

14 Penonton Tewas Ditembak Kelompok Pria Berkerudung

MADRID (Waspada): Barcelona terus naik mendekati puncak klasemen La Liga Primera, setelah membantai 10 pemain Sevilla 5-0, Sabtu (Minggu WIB) di Camp Nou. AFP

Kejutan Brest PARIS (Waspada): Kejutan kembali mewarnai Ligue 1 Prancis musim ini. Tim promosi Stade Brest memimpin klasemen pasca memukul SaintEtienne 2-0 di Stadion Francis le Ble, Sabtu (Minggu WIB). Brest baru bisa mengendalikan permainan di babak kedua saat tendangan silang Bruno Grougi dengan sempurna ditanduk Mario Licka. Romain Poyet (foto) memastikan keunggulan tuan rumah saat sontekannya menembus jala Etienne untuk kali kedua. Sedangkan laga Olympique Marseille dengan Stade Rennes, terpaksa ditunda karena kondisi lapangan yang menggenang akibat hujan lebat mengguyur Stade Velodrome. Di Stade Gerland, tensi yang menekan pelatih Claude Puel mulai berkurang setelah Olympique Lyon menang tipis 2-1 atas Sochaux. Gol pembuka kemenangan Lyon dicetak Michel Bastos menit 31, memaksimalkan umpan Yoann Gourcuff. Sochaux sempat menyeimbangkan keadaan menit 66 melalui striker asal Nigeria, Ideye Brown. Bastos yang mengalami cedera digantikan oleh Alexandre

Hasil Sabtu (Minggu WIB) Auxerre vs OGL Nice Caen vs AS Nancy St Lorient vs Arles Lyon vs Sochaux Toulouse vs Lens Brest vs St-Etienne Marseille vs Rennes

2-0 2-3 2-0 2-1 1-1 2-0 tunda

Klasemen Ligue 1 Prancis Brest Rennes Marseille St-Etienne Toulouse Montpellier Paris SG Lyon Auxerre Lille Lorient Bordeaux Caen Nancy Sochaux Valenciennes Nice Lens Monaco Arles-Avignon

11 10 10 11 11 10 10 11 11 10 11 10 11 11 11 10 11 11 10 11

6 5 5 5 5 5 4 4 3 3 4 4 3 4 4 3 3 2 1 0

3 4 3 3 3 2 3 3 5 5 2 2 5 2 1 4 4 4 6 2

2 1 2 3 3 3 3 4 3 2 5 4 3 5 6 3 4 5 3 9

11- 4 12- 5 18-11 15-12 14-11 10- 9 15- 9 13-14 16-13 13-11 11-11 9- 9 11-12 13-18 18-16 11-10 9-14 9-18 7- 9 4-23

21 19 18 18 18 17 15 15 14 14 14 14 14 14 13 13 13 10 9 2

Lacazette, yang kemudian memastikan kemenangan tuan rumah hanya tiga menit setelah memasuki lapangan. (h01/bb/afp)

“Kami sama sekali bukan saingan mereka. Barca mendominasi di segala aspek,” tutur pelatih Sevilla Grogorio Manzano. “Ketika kami berpikir semua tim berada di level sama, Barcelona kembali membuat perubahan. Laga kali ini benar-benar sulit,” ujarnya lagi dalam Soccerway, Minggu (31/10). David Villa yang mandul dalam sebulan terakhir, seperti menemukan kembali ketajamannya. Apalagi, Sevilla terpaksa tempur dengan 10 pemain sejak akhir babak pertama karena Abdoulay Konko diusir wasit. “Tidak perlu diragukan lagi, Barca benar-benar tim juara. Jika anda tidak bertahan sebagai tim, duel bakal berjalan sulit dan anda hanya akan memuluskan jalan mereka. Barca tim super, tidak ada keraguan soal itu,” puji Manzano. Villa dan Lionel Messi menyumbang dua gol, Daniel Alves menambahinya dengan satu angka lagi.Villa pun secara khusus menuai pujian dari Presiden Barca Sandro Rosell. Pep Guardiola mengatakan gol akan datang dan itu benar terjadi. David Villa selalu bermain bagus,” ujar Rosell kepada AS. “Keinginan utamanya bukanlah mencetak gol, melainkan ingin membantu tim. Kami sangat senang bisa menang di depan puluhan ribu fans,” tam-

SAN PEDRO SULA (Antara/AFP): Kelompok pria bersenjata menggunakan kerudung, Sabtu (Minggu WIB), membantai hingga tewas 14 penonton dalam sebuah pertandingan amatir di San Pedro Sula, kota terbesar kedua di Honduras. “Terdapat 14 korban tewas di lapangan kompleks perumahan Felipe Zelaya, sejumlah pria secara tiba-tiba melepaskan tembakan ke arah penonton. 10 Di antaranya meninggal di tempat,” ungkap Leonel Sauceda, pejabat polisi setempat. Empat korban penembakan lainnya dilarikan ke Rumah Sakit Mario Catarino, tapi meninggal tidak lama setelah sampai di rumah sakit. Juan Lopez, juru bicara polisi San Pedro Sula mengatakan, lima sampai delapan pria kerudung untuk menutup wajah mereka, tiba-tiba muncul dan secara brutal melepaskan tembakan ke arah penonton.


Bintang Barcelona Lionel Messi (kanan) tak terhadang pemain Sevilla Manuel Ortiz (tengah) dan Mauhamadou Dabo di Camp Nou, Minggu (31/10) dinihari WIB. bah Rosell. Messi mencetak gol keenamnya di liga musim ini menit keempat, lantasVilla menjawab kritik dengan melesakkan gol kedua yang sensasional. Mantan pemain Sevilla, Alves, menyarangkan gol ketiga pada awal babak kedua. Messi mencetak gol keempat El Catalan danVilla melengkapi pesta dengan mencetak gol kelima tuan rumah di menit akhir. Mourinho cemerlang Dalam duel lainnya, Sabtu (Minggu WIB), Valencia yang kalah berturut-turut dari Barcelona dan Real Mallorca, hanya bermain 1-1 ketika menjamu Real Zaragoza yang belum pernah menang musim ini. Gelandang Zaragoza Maurizio Lanzaro jadi pahlawan sekaligus pecundang di Stadion

Jadikan Olahraga Kebutuhan Hidup Senam Pagi Bersama Bogasari MEDAN (Waspada): Guyuran hujan gerimis tak menyurutkan ratusan warga kota Medan untuk mengikuti kegiatan senam pagi bersama Bogasari yang digelar di pelataran parkir Deli Plaza Medan, Minggu (31/10). Peserta yang terdiri anakanak, remaja, dewasa dan orangtua itu tampak bersemangat mengikuti gerakan instruktur senam dengan diiringi musik. Mereka sepertinya tak begitu menghiraukan cuaca yang kurang bersahabat. Apalagi pihak Bogasari akan memilih 10 peserta terbaik untuk selanjutnya mendapat hadiah. “Antusiasme warga mengikuti kegiatan ini membuktikan mereka telah menyadari betapa pentingnya berolahraga, terutama dalam menjaga kebugaran tubuh, sehinga tetap sehat dan terhindar dari berbagai macam penyakit,” ujar Effendi Lie, Costumer Relation Manajer Bogasari Sumut, Riau, Sumbar dan Aceh. Dikatakan, sudah seharusnya masyarakat menjadikan olahraga sebagai kebutuhan hidup untuk menjaga kebugaran tubuh. “Kegiatan senam pagi ini merupakan upaya kita untuk mengajak dan memotivasi masyarakat agar gemar berolahraga,” kata Effendi, didampingi Ketua Panpel Rudianto Pangaribuan. Dijelaskan, selain berolahraga rutin, sarapan pagi juga bagian dari pola hidup sehat. “Ya, sarapan itu sangat penting

TI Medan UKT MEDAN (Waspada): Pengurus Cabang Taekwondo Indonesia (Pengcab TI) Medan akan menggelar ujian kenaikan tingkat (UKT) di Gelanggang Remaja Jl. Sutomo Medan pada 14 November mendatang. “UKT merupakan program tiga kali setahun TI Medan dalam meningkatkan jenjang atlet, sekaligus sebagai ajang evaluasi kemampuan atlet,” ujar Ketua Pengcab TI Medan Bobby Octavianus Zulkarnaen SE, Minggu (31/10). Dikatakan, TI Medan berupaya maksimal mendukung seluruh unit/dojang taekwondo di Medan dalam melakukan pembinaan atlet. “Harapan kita prestasi taekwondo kota Medan dan Sumut dapat terus meningkat,” katanya. Bagi para atlet calon peserta UKT sudah dapat mendaftar di Sektretariat TI Medan Jl. Gaharu No 74 Medan atau dapat menghubungi contact person 0614575257. Peserta wajib melampirkan surat ijin atau rekomen dari unit/dojang. Pendaftaran ditutup pada 6 November. (m42)

dan tidak harus nasi, yang penting mengandung karbohidrat dan protein yang cukup seperti roti,” tambahnya. Usai senam, para peserta langsung sarapan dengan mem-

beli menu di stand UKM mitra Bogasari. Ada 23 stand yang menyajikan berbagai jenis makanan mulai dari roti hingga kue-kue tradisional yang cukup menggugah selera.

Kegiatan juga dimeriahkan dengan hiburan dan lucky draw menyediakan berbagai hadiah menarik, seperti televisi, Hp dan satu unit sepeda motor. (m42)

Waspada/Khairul Umri Batubara

Warga kota Medan mengikuti senam pagi bersama Bogasari di pelataran parkir Deli Plaza Medan, Minggu (31/10).

Mestalla. Lanzaro membawa Zaragoza memimpin menit kedua, namun kemudian membatalkan keunggulan itu dengan gol bunuh dirinya menit 42-og. Di Stadion Rico Perez, pemimpin klasemen Real Madrid menghentikan kejutan tim promosi Hercules dengan skor 3-1. Gol cepat David Trezeguet menit ketiga sempat mengejutkan Los Galacticos. El Real berusaha bangkit dengan terus menyerang Hercules, namun baru berhasil memecahkan kebuntuan menit 52 lewat gol Angel Di Maria. Menit 82 Los Blancos binaah Jose Mourinho gantian memimpin berkat gol Cristiano Ronaldo, memanfaatkan bola rebound hasil tendangan Karim Benzema. Empat menit kemudian, Ronaldo kembali merobek jala Hercules untuk memantapkan kemenangan tim tamu, setelah mendapat umpan matang dari Benzema. “Kami bereaksi atas apa yang dikatakan Mourinho saat istirahat. Saya tidak akan mengungkapkan apa yang dikatakannya, tetapi itu benar-benar

Klasemen Liga Primera Real Madrid Barcelona Villarreal Valencia Espanyol Sevilla Getafe Atl Madrid Mallorca Ath Bilbao Sociedad Osasuna Hercules Levante S Gijon Almeria Malaga Santander Zaragoza Deportivo

9 9 8 9 8 9 8 8 8 8 8 8 9 8 8 8 8 8 9 8

7 7 6 5 5 4 4 4 3 3 3 2 2 2 2 1 2 2 0 0

2 1 1 2 0 2 1 1 2 1 1 3 3 2 2 4 1 1 4 4

0 1 1 2 3 3 3 3 3 4 4 3 4 4 4 3 5 5 5 4

25- 5 19- 6 16- 6 14- 9 8-10 14-16 14-10 12- 9 7- 8 14-14 10-11 7- 6 9-12 8-14 8-14 6- 7 13-19 5-14 7-15 3-14

23 22 19 17 15 14 13 13 11 10 10 9 9 8 8 7 7 7 4 4

cemerlang,” jelas kiper Real Iker Casillas. “Jose pelatih dengan ide-ide cemerlang, sehingga sangat membantu kami. Dia lah bapak dari keluarga besar Real Madrid,” puji Ronaldo, seperti dikutip dari Goal. “Saya senang bekerja di bawah asuhannya. Saya yakin, dia sangat menikmati harinya di sini,” katanya menambahkan. (h01/as/afp/goal/ap)



WASPADA Senin 1 November 2010

Saling Tuding Gol Kontroversial Nani


Winger MU Luis Nani salto merayakan golnya ke gawang Spurs di Old Trafford, Manchester, Minggu (31/10) dinihari WIB.

LONDON (Waspada): Manajer Manchester United (MU) Sir Alex Ferguson dan pelatih Tottenham Hotspur Harry Redknapp, saling tuding atas gol kontroversial Luis Nani. Nani mencetak gol menit 84, setelah kiper Spurs Heurelho Gomes melepas bola dari tangannya dan menaruh di kotak penalti dalam laga Liga Premier, Sabtu (Minggu WIB) di Stadion Old Trafford. Gomes sepertinya menganggap timnya mendapatkan freekick, justru setelah Younis Kaboul menjatuhkan Nani. Winger Portugal itu langsung bangkit dan dengan cepat menendang bola ke gawang Spurs untuk memenangkan MU 2-0. Ferguson menuding, kiper Brazil itu seharusnya mengerti aturan. “Itu memang hal ganjil, tak seorang pun tahu siapa yang salah. Dalam semenit, kiper memegang bola lalu sudah melihatnya di jala gawang,” papar Ferguson dalam ESPN, Minggu (31/10). “Nani sempat melihat ke wasit dan wasit bilang play on. Tak ada yang bisa dilakukannya selain menembak bola ke gawang,” ujarnya lagi.

Wasit Mark Clattenburg sempat berkonsultasi dengan hakim garis yang mengangkat bendera. Tapi dia akhirnya mengesahkan gol itu diwarnai protes para pemain Spurs. “Anda bisa saja menyalahkan wasit dan hakim garis. Tapi sebenarnya kiper Spurs layak jadi kambing hitam. Seharusnya, dia lebih tahu peraturan,” kecam Ferguson. “Dia kiper berpengalaman. Saya pikir, dia telah bertindak sembrono. Seharusnya, Nani juga mendapatkan penalti,” katanya menambahkan. Gol pembuka kemenangan Setan Merah dicetak Nemanja Vidic menit 30. Namun gol kedua MU yang paling menyakitkan bagi Spurs. “Seharusnya itu handball, karena Nani sempat menyentuh bola sebelum jatuh. Dia seharusnya juga mendapat kartu kuning,” protes Redknapp. “Wasit tak melihat handball itu sehingga bilang play on. Asistennya melihat dan mengangkat bendera, tapi wasit (Clattenburg) mengesahkan gol itu.

“Padahal, Gomes menyangka mendapat free-kick akibat handball Nani. Jika anda melihat kepada (Darren) Fletcher, dia memanggil Nani agar segera bangkit dari lapangan dan kembali ke belakang untuk bertahan,” tambah Redknapp. Menurut 101 Great Goals, Spurs juga pernah mengalami gol kontroversial sejenis saat bertemu Red Devils. Pada April 2009, Spurs sudah unggul dua gol sampai turun minum. Spurs saat itu berpeluang menggagalkan United meraih trofi Liga Premier, tapi wasit Howard Webb memutuskan Heurelho Gomes telah melanggar Michael Carrick. Akhirnya, MU bisa membalas dan membalikkan keadaan. Bahkan Setan Merah kemudian unggul telak 5-2 lewat gol-gol Cristiano Ronaldo, Wayne Rooney dan Dimitar Berbatov di Old Trafford. Insiden nyaris serupa terjadi saat Spurs seharusnya mendapat hadiah penalti, karena kiper MU Roy Carroll menjatuhkan Pedro Mendes pada 4 Januari 2005. Hadiah itu luput, sehingga duel di Old Trafford berkesudahan 0-0. (h01/okz/espn/rtr)

Nyonya Tua Seperti Punya Tujuh Nyawa ROMA (Waspada): Juventus kembali ke jalur scudetto seusai menaklukkan raksasa AC Milan dalam laga Liga Seri A, Sabtu (Minggu WIB) di Stadion San Siro. “Juventus seperti punya tujuh nyawa. Kini kami punya kepercayaan dan harus bekerja keras seperti ini,” ujar alenatorre Juve Luigi Del Neri. “Saya melihat tim yang tak kenal lelah memenangkan perebutan bola. Ini spirit yang kami butuhkan sepanjang musim,” katanya lagi dalam Sky Sports Italia, Minggu (31/10). Del Neri merasa Lo Spirito seperti Si Nyonya Tua di masa jayanya telah bangkit kembali. Striker veteran Alessandro Del Piero dan tandemnya Fabio Quagliarella, yang mencetak gol kemenangan tim tamu di Milano.

“Tim sangat tahu bagaimana melakukan respon. Kami harus meneruskannya, kami menang dengan cara ekselen,” puji Del Neri. Milan baru bisa memperkecil kekalahan pada menit terakhir lewat gol Zlatan Ibrahimovic. “Mereka juga punya pemain bagus di depan. Tapi pemain kami bisa menghentikannya,” tutur Del Neri. Ucapan sang bos didukung gelandang andalannya asal Brazil, Felipe Melo. “Ini merupakan tim Juventus yang baru. Kami telah berada di jalur yang tepat,” ucap Melo. “Setiap pemain di tim, kini

memiliki mental untuk bisa memenangi kompetisi. Kami sadar, Inter dan Milan memiliki sesuatu yang lebih dari kami, tapi kami berada di jalur yang benar,” ujarnya lagi. Del Piero malah memecahkan rekor sebagai topskor Nyonya Tua sepanjang masa melalui golnya menit 66. Itu merupakan gol ke-179 Pinturicchio, sehingga kapten berusia 35 tahun itu mengungguli torehan legenda Bianconeri, Giampiero Boniperti (178 gol). “Apakah seluruh rekor telah dipecahkan? Yah, anda harus terus berusaha dan memasang target baru untuk diri anda,” tekad Del Piero melalui Football-Italia. Pinturicchio sempat mengejutkan publik dengan komentarnya sebelum kick-off yang menyebut, “Ini bisa jadi

pertandingan terakhir saya di San Siro.” Kontrak Del Piero akan berakhir Juni 2011 dan belum ada kepastian mengenai perpanjangannya. “Tapi saya hanya bergurau. Saya berhubungan baik dengan semua orang di klub, masih ada waktu untuk memikirkan kontrak,” dalihnya. Atas kekalahan itu, Presiden Milan Silvio Berlusconi terlihat kesal tapi tidak mau mengomentarinya. “Ketika anda menang, anda bicara. Tapi ketika anda kalah, maka anda lebih baik diam seperti halnya kami malam ini,” jelas Berlusconi. “Milan sudah bermain apik dan kami menciptakan banyak peluang, tapi kami buruk di babak pertama. Inilah sepakbola dan kami mesti menerimanya,” tutur pelatih Massimiliano Allegri. (h01/vvn/sky/goal)

Gunners Mulai Matang LONDON (Antara/AFP): Arsitek Arsenal Arsene Wenger mengatakan, kemenangan 1-0 atasWest Ham United membuktikan timnya mulai matang dan siap merebut gelar Liga Premier. Gol Alex Song menit 88 melalui sundulan pada Sabtu di Emirates Stadium, membuat The Gunners terus menjaga jarak dengan Chelsea di puncak klasemen sementara. “Sungguh melegakan karena gol terjadi hanya ketika pertandingan tersisa dua menit lagi. Kami ternyata sudah tampil cerdas,” ujar Wenger, Minggu (31/ 10). “Kami harus tampil lebih cerdas, sabar dan tidak membuat kesalahan di barisan belakang menghadapi West Ham yang merupakan tim dengan

pemain yang penuh semangat dan terorganisir rapi. “Kami selalu menampilkan permainan kami dan bisa dikatakan bahwa kami sekarang sudah matang. Anda bisa lihat itu cara kami mengatasi masalah ketika strategi yang kami terapkan ternyata tidak berjalan dengan baik,” katanya lagi. Mengenai peluang London Reds memperebutkan gelar juara, Wenger berujar: “Saya yakin kami punya peluang bagus, tapi kmi ingin memperlihatkan konsistensi kami terlebih dulu. Kami akan berjalan langkah demi langkah.”

“Perjalanan masih panjang, tapi saya yakin kami juga punya peluang. Kami ingin memperlihatkan bahwa kami bisa mengatasi setiap pertandingan dengan aspek yang berbeda,” tambahnya. Wenger mengakui bahwa dia masih khawatir dengan ce-

dera Cesc Fabregas, meski sang kapten bisa bermain selama 90 menit saat menjamu The Hammers. “Pada babak kedua, saya sebenarnya ragu-ragu untuk menariknya keluar, tapi ternyata semakin lama semakin bagus,” jelasnya.

Alex Song (2 kanan) mencetak gol kemenangan Arsenal ke gawang West Ham di Emirates Stadium. -AP-

Panpel Siap Gelar Pertandingan PSSB BIREUEN (Waspada): Pihak Panitia Pelaksana (Panpel) pertandingan PSSB Bireuen dalam kompetisi Divisi Utama musim 2010/2011 di Stadion Cot Gapu dan berkomitmen menekan angka pengeluaran dana pada setiap pertandingan demi membantu krisis dana. Hal itu dikatakan Ketua Panpel PSSB, Muzakar A Gani, kepada Waspada di ruang kerjanya, Sabtu (30/10). Menurutnya, genderang perang kom-

petisi Divisi Utama di segera ditabuh dan karena itu pihaknya sudah siap bertempur bersama pengurus yang telah dibentuk. “Kita sudah siap dan mohon juga kepada para pecinta PSSB serta masyarakat ikut mensukseskan setiap pertandingan. Kita yakin masyarakat Bireuen sangat memegang teguh komitmennya untuk menjadi tuan rumah yang baik dan ini telah dibuktikan selama ini,” katanya. Kecuali itu, kata Muzakkar,

pihaknya sudah bertekad menekan angka pengeluaran dana hingga nantinya dapat membantu PSSB yang masih krisis dana. “Jika tidak ditekan pada jumlah tertentu, dikhawatirkan penggunaan uang tidak efisien. Pada kompetisi musim ini, Panpel menetapkan angka pengeluaran maksimal Rp15 juta untuk sekali pertandingan di kandang,” katanya. Keputusan tersebut merupakan hasil rapat bersama an-

tara pengurus PSSB, Panpel dan Yayasan PSSB. Mengenai jumlah tiket yang akan dicetak setiap pertandingan, Muzakkar belum menentukannya karena akan dibahas atau dimusyawarahkan kembali dengan pengurus. “Masalah harga dan jumlah tiket yang akan kita cetak segera dimusyawarahkan lagi dalam waktu dekat,” kata mantan Sekretaris PSSB itu. (amh)

STIK-P, Freestyler Ikut Peduli Mentawai Disalurkan Melalui Peduli Umat Waspada MEDAN (Waspada): Guna menunjukkan kepedulian terhadap korban bencana tsunami di Mentawai, Sumatera Barat, mahasiswa Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan bekerjasama dengan komunitas Three Sixty Degree Freestyle Soccer menggelar aksi penggalangan

dana di Bundaran SIB, Jl Gatot Subroto Medan, Minggu (31/10). Di saat pengendara menanti lampu hijau, para freestyler menampilkan berbagai atraksi menarik sehingga membuat para pengendara sepeda motor maupun mobil yang juga berlalu lalang merasa terhibur dan ikut menyumbang.

Desy Yusman Mendrova selaku Koordinator Pelaksana Kegiatan mengatakan kegiatan penggalangan dana seperti itu menandakan adanya kepedulian mahasiswa terhadap saudara-saudara yang sedang tertimpa musibah di Mentawai. Dikatakan mahasiswa ilmu Jurnalistik STIK-P itu, tujuan

Waspada/Khairil Umri Batubara

Komunitas Three Sixty Degree Freestyle Soccer dan BEM STIK-P Medan menggelar aksi penggalangan dana korban bencana Mentawai di Bundaran SIB, Jl Gatot Subroto Medan, Minggu (31/10).

kegiatan tersebut adalah ikut peduli meringankan beban para korban sekaligus menunjukkan eksistensi Badan Eksekutif Mahasiswa (BEM) STIK-P di Kota Medan dengan menggelar aksi penggalangan dana yang sedikit berbeda. Kepada wartawan, Desy juga mengatakan bahwa sejak Rabu (27/10) hingga Sabtu (30/10) lalu juga dilakukan aksi penggalangan dana di depan kampus STIK-P yang terletak di Jl SM Raja. “Setelah dana terkumpul semua, kami berencana menyalurkannya melalui Lembaga Peduli UmatWaspada dan lainnya yang mempunyai legalitas terpercaya agar sumbangan tersebut sampai kepada para korban yang membutuhkan,” jelas Desy. Ditemui usai kegiatan tersebut, salah seorang freestyler Muhammad Abbas mengatakan alasannya bekerjasama dalam kegiatan amal itu adalah turut prihatin dengan bencana Mentawai dan secara tidak langsung ingin membantu para korban. Abbas juga berharap kegiatan ini juga menjadi ajang menjalin tali persaudaraan terhadap sesama. (Arianda Tanjung)

Alessandro Del Piero (kanan) dan kawan-kawa merayakan sukses Juve di San Siro, Milan.



WASPADA Senin 1 November 2010


Stadion Pidie Jaya Tanpa Perencanaan Matang MEUREUDU (Waspada) : Pelaksanaan pembangunan stadion sepakbola di Kabupaten Pidie Jaya dinilai banyak pihak terjadi pemborosan dana karena dilakukan tanpa perencanaan matang. H Yusri Abdullah SH kepada Waspada di Meureudu, Minggu (31/10) mengatakan, sangat menyesali cara dan pola kerja kontraktor di lapangan yang mengerjakan pembangunan Stadion Pidie Jaya, sehingga membawa dampak dan imbas terhadap masyarakat karena dirugikan proses pembangunan tersebut. Menurut Yusri, semua itu terjadi tidak lain adalah akibat perencanaan yang tidak matang hingga terjadi pemborosan

dana alias pekerjaan tumpang tindih di mana satu pekerjaan yang sudah selesai dikerjakan kembali (buet-buet soet-red). Yusri mencontohkan pekerjaan yang sudah ditimbun dan diratakan hingga digali kembali mencapai kedalaman 2 meter. Padahal, untuk meratakan stadion itu sudah selesai dilaksanakan dengan anggaran tahun 2009. Alhasil, Pansus IV DPRK Pidie Jaya terkejutnya saat meninjau ke lapangan melihat kontraktor sedang menggali kembali landasan stadion dengan anggaran tahun 2010. Masalah kekurangan dan kelemahan terjadi terhadap pembangunan stadion, menurut Yusri, Pansus IV DPRK telah

SURABAYA (Antara): Pebalap Polygon Sweet Nice (PSN) Surabaya, Rosta Patria, menjadi yang tercepat etape VII dari Madiun menuju Surabaya pada Speedy Tour d’Indonesia (TDI) 2010, Minggu (31/10).

Kejurnas Tinju Amatir Senior Elite 2010


Petinju Aceh Taufik didampingi M Taufan Paransa (Papua) dan Daniel Seum (Papua Barat), pose bersama Sekum KONI Aceh Muhammad Saleh usai penyerahan medali.

(1-2-1), Jateng (1-1-1), Aceh (1-0-3), Kepri, Bali (1-0-1), DKI (0-2-0), Kaltim, Maluku (0-1-0), Jabar, Kalbar, Papua Barat (0-0-3), Riau (0-0-2), Sumut, Sumbar dan NTT (0-0-1). Penutupan resmi dilakukan Gubernur Aceh yang diwakili Kadispora Drs Hasan Bari MM. Sebelumnya, Ketua Umum KONI Aceh diwakili Sekum Muhammad Saleh memimpin hening cipta untuk mendoakan para korban bencana di Wasior (Papua Barat), Merapi (DIY) dan Mentawai (Sumbar). Juga diserahkan piala petinju terbaik yang diraih Julio Bria (Bali) dan Junike Rotti (Sulut), petinju harapan Bogi Andriano (Jatim) dan Tina Pantury (Maluku) serta petinju favorit putra/putri Taufik (Aceh) dan Norbertha Tajum (Papua). (b07)

Hasil Kejurnas Tinju Amatir Senior Elite 2010 44 kg putri: Murni (DKI), Nurcahya (Papua), Leni Indriyani (Kalbar), Maya (Jabar) 46 kg: Junike Rotti (Sulut), Apriliani Tombek (DKI), Esther Ronsumbre (Papua), Melbeth Seran (Kaltim) 48 kg: Tina Pentury (Maluku), Amelia Lontoh (Kaltim), Beatrix Sugoro (DKI), Rumiris Simarmata (Sumut) 51 kg: Irene Sasihiang (DKI), Indri Sambaimana (Sulut), Feny Benamen (Maluku), Warni Halawa (Riau) 54 kg: Norbertha Tajum (Papua), Mei Ohoilulin (Maluku), Novela Pariaribo (Papua Barat), Vernonica Nicolas (DKI) 57 kg: Jenny Wahyuni (Bali), Imaculata M (NTT), Marlyn Itlay (Papua), Erna Rahareng (Maluku) 60 kg: Esther Kalayukin (Maluku), Magdalena Kambayong (Papua), Dolince Sanadai (Papua Barat), Jocelyn Obusca Erzon (Kepri) 64 kg: Nelce Baransano (Papua Barat), Frida Larantokan (Papua), Yuniari Mabel (Sumsel), Maduma Simbolon (Sumut) 69 kg: Siti Aisyah (Sumut), Agnes Datunsolang (Kaltim), Dian Haryati (Aceh), Dina Ramela (Papua) 45 kg putra: Johan Sigalingging (Kepri), Hendra (Kaltim), Very Nanlohy (Maluku), Fadli Idrus (Aceh) 48 kg: Bogi Andriano (Jatim), Musa Cahyadi (Jateng), Rahmat Taubat (Sumbar), Ruben Son Djo (Jabar) 51 kg: Julio Bria (Bali), Rodiv Mandak (DKI), Devis Firmansyah (Jabar), Hertoni Hutabarat (Riau) 54 kg: Rafly Langi (Sulut), Adrianus Salamissi (Maluku), Andhika (Aceh), Supriadi (Kepri) 57 kg: Mathius Mandiangan (Sulut), Panser Pattinama (Maluku), Zeth Touwelly (Kalbar), Deddy I Prakoso (Jateng) 60 kg: John T. Renwarin (Papua), Arif Tatibun (Banten), Sam Puadi (Papua Barat), Jeheskiel Lona (NTT) 64 kg: Vinky Montolalu (Sulut), Anto Siringo-ringo (Jambi), Markus Uberi (Papua Barat), Afdan Bachtila (Aceh) 69 kg: Taufik (Aceh), M Taufan Paransa (Papua), Denny Hutasoit (Sumut), Daniel Seum (Papua Barat) 75 kg: Khristian Toar Sompotan (Sulut), Markus Awom (Papua), Kristianus Nongsedo (Kaltim), Jefry Asaribab (Kalbar) 81 kg: Wilis B Riripoy (Jateng), Kristianto (DKI), Erilza (Kalbar), Yusthinus (Papua) 91 kg: Timotius (Jatim), Stevie Binalay (Lampung), Irwan (Jabar), M Yunus Pane (Riau)

Pengembangan Olahraga Daerah Terkendala Dana BLANGPIDIE (Waspada): Masih banyaknya potensi olahraga yang ada di daerah belum tersentuh dan dikembangkan akibat kemampuan manajemen serta finansial yang kurang memadai, sehingga membuat pengembangan olahraga sulit dilakukan. Untuk itu, setiap pengurus olahraga diharapkan memiliki kreativitas serta kemampuan menjalankan organisasi sehingga tidak sampai potensi yang ada menghilang “tampa jejak’. Pemaparan tersebut dikemukakan Camat Manggeng H Eddy Sumarjan SE MM ketika melantik Pengurus Persatuan Sepakbola Kecamatan Manggeng (PSKM) Kabupaten Aceh Barat Daya (Abdya) periode 2010-2012 di Gedung Seni Budaya AA Manggeng, Jl TR Iskandar Desa Seunelop, Kecamatan Manggeng, Sabtu (30/10). Para pengurus PSKM yang dikukuhkan di

menyatakan pembangunan Stadion Pidie Jaya TA 2009 dan 2010 dilakukan melalui dana Otonomi khusus (Otsus) serta berdasarkan perencanaan yang sangat matang. Bahkan Bupati menyebutkan untuk tahun 2010 harus dilakukan galian dan penimbunan/perataan tanah seluas 75.000 meter kubik, sehingga total anggaran yang akan dihabiskan Rp2,550 miliar. Namun, karena anggaran 2010 hanya tersedia Rp2,050 miliar, pekerjaannya difokuskan untuk galian dan penimbunan/ perataan seluas 52.000 meter kubik. (b21)

Rosta Tercepat Etape VII TDI

Taufik Emas, Sulut Juara Umum Putra BANDA ACEH (Waspada): Taufik menjadi satu-satunya penyumbang medali emas bagi Aceh di Kejurnas Tinju Amatir Senior Elite 2010 bertajuk “Piala Gubernur Aceh”, setelah mengalahkan petinju Papua M Taufan Paransa di GOR KONI Aceh, Sabtu (30/10) malam. Pertarungan antara Taufik dan Taufan berlangsung ketat. Kedua petinju ini tampak bermain begitu hati-hati, sehingga sampai ronde ketiga berakhir kedudukan sama kuat 1-1. Setelah dilakukan penghitungan akumulasi pukulan, skor tetap imbang 11-11. Untuk menentukan pemenang, ketua wasit/ hakim Hans Watuna dari PP Pertina melakukan voting di mana Taufik akhirnya mendapat tiga suara dan Taufan Paransa hanya dua. Tak pelak, GOR KONI Aceh pun bergemuruh dengan sorakan pengunjung menyambut kemenangan Taufik. Tak lama kemudian, terjadi insiden kecil antara kubu Papua dan Sulut akibat didiskualifikasinya petinju Papua Markus Awom ketika bertanding dengan Toar Sompotan. Kubu Papua yang kecewa dengan keputusan wasit mendatangi kubu Sulut, karena menilai petinju Sulut itu curang. Sukses besar diraih kontingen Sulut yang berhasil keluar sebagai juara umum di kelompok Elite Putra, setelah empat petinjunya meraih medali emas. Keempat petinju Sulut itu adalah Rafly Langi (54 kg), Mathius Mandiangan (57 kg), Vinky Montolalu (64 kg) dan Khristian Toar Sompotan (75 kg). Sebagai juara umum di kelompok Elite Putra, Sulut meraih 4 emas disusul Jatim (2-0-0), Papua

menyampaikannya dalam laporan Pansus pada rapat Paripurna I masa Persidangan III tentang perhitungan Anggaran Pendapatan Belanja Kabupaten (APBK) Pidie Jaya Tahun Anggaran 2009. Dalam laporan itu disebutkan, pihaknya meragukan kapasitas konsultan perencanaan stadion tersebut. Pekerjaan tersebut pun telah merugikan beberapa pemilik tanah sawah yang lokasinya tidak berjauhan dengan stadion, sehingga menyebabkan limbah tanah langsiran menutupi atau tertimbun tanah sawah penduduk lain. Menanggapi itu, Bupati Pidie Jaya Drs HM Gade Salam

antaranya Ketua Umum Usmadi SPd, Ketua I Nasruddin, Sekretaris Umum T Cut Rahman, Sekretaris I Yasir Arafat, Sekretaris II Mawardi serta Bendahara Jasmin. Usmadi menyatakan terima kasih atas kepercayaan dan amanah yang dipercayakan kepada pihaknya sembari berharap seluruh pengurus memiliki integritas dan loyalitas pada organisasi. Menurutnya, kepemimpinan PSKM bersifat kolektif, kolegial secara manejerial untuk menata dan menjalankan roda organisasi dan tanggung jawab itu tidak tertumpu hanya pada pimpinan, akan tetapi tanggung jawab bersama. Turut hadir dalam acara pengukuhan tersebut antara lain Danramil Manggeng Kapten Inf Iriaman, Kapolsek Manggeng Aiptu Ali Kosasih, Ketua P2MKR, Kapus Manggeng Salman SKM dan undangan lainnya. (sdp)

Problem Catur Hitam melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2.


Pebalap asal Yogyakarta ini mampu membukukan catatan waktu 03.42.13 disusul pebalap Power Move Srilanka, Martin Mueller. Posisi tiga direbut Fatahilah Abdulah dari Pengprov ISSI Yogyakarta dengan membukukan waktu yang sama. “Kemenangan ini hasil kerja keras dari awal lomba. Saya juga juga sempat memimpin tiga kali. Tapi upaya untuk menang terjadi satu kilometer dan saya bisa menang,” kata Rosta Patria usai perlombaan. Menurut dia, angin kencang di Nganjuk hingga Kertosono membuat tenaga terkuras. Namun dengan kerja keras dan kerja sama tim akhir bisa lepas dari rombongan besar dan mampu menjadi yang tercepat. Setelah dilepas di Alun-Alun Madiun, peserta langsung melesat memimpin rombongan. Jalanan datar membuat semangat mengayuh sepeda lebih tinggi, terutama bagi pembalap spesialis sprint. Salah satu kendala yang dihadapi pembakap dijalur ini adalah banyaknya lintasan rel kereta api. Hari Fitrianto dari Polygon Sweet Nice (PSN) Surabaya menjadi korban dilintasan. Pembalab yang mengenakan kaos merah putih itu sempat terjatuh saat melintasi rel kawasan tersebut, namun masih tetap melanjutkan perlombaan. Khusus pengaman jalur, aparat keaman bekerja sigap.


Pebalap Polygon Sweet Nice (PSN) Surabaya, Rosta Patria. meluapkan kegembiraan usai mencapai garis finish pada etape VII Speedy Tour d’Indonesia 2010 di Surabaya, Jawa Timur, Minggu (31/10). Terbukti jalur yang akan dilintasi pembalap steril dari kendaraan. Animo masyarakat tinggi di sepanjang jalur yang dilintasi balapan. Sepanjang jalan Kabupetn Nganjuk-memasuki Jombang banyak warga antusias mengibarkan bendera menyambut rombongan pembalap yang telah start dari tanggal 24 Oktober 2010. Pada titik sprint di depan The Legend Water Park Baron Kertosono pembalap dari tujuh (7) Eleven Filipina, Sherwin F

Carrera dan posisi berikutnya direbut pembalap Malaysia National Team yaitu Mohd Zamri dan Ahmad Fallanie. Untuk titik sprint kedua di Alun-Alun Mojoagung, giliran pembalap tujuh (7) Eleven lainnya Mark John Laxer Galedo. Selanjutnya diposisi dua direbut pembalap Malaysia National Team, Mohd Sahrul Mat Amin dan Imam Suparman dari DKI Jakarta. Hingga memasuki KM 123, empat (4 ) tepatnya di depan Rumah Sakit Citra Medika pem-

balap tujuh (7) Eleven Filipina Jonipher B Ravina memimpin sekitar 50 meter didepan rombongan besar yang salah satu pembalapnya Hari Fitrianto dari PSN Surabaya. Memasuki Krian Sidoarjo pembalap dalam rombongan besar berusaha menambah kecepatannya karena sekitar 20 Km memasuki garis finis di Taman Bungkul Surabaya.Teriknya matahari tidak mengendurkan semangat untuk menjadi yang tercepat. Meski sebelumnya cuaca

panas, menjelang masuk Kota Surabaya atau kurang lebih tiga kilometer menjelang finis, kondisi jalan berubah karena sebelumnya diguyur hujan yang cukup deras. Hingga mendekati garis finis pembalap tetap dalam rombongan besar. Akhirnya Rosta menjadi yang tercepat di kota asal timnya. Setelah menyelesaikan etapeVI, Senin (1/11), seluruh pembalap akan menjalani etape VII dari Surabaya menuju Jember dengan jarak tempuh 192,1 Km.

Harapkan Ulangi Kejayaan Bulutangkis Golkar Cup 2010 Di Palas

Waspada/Idaham Butar butar

Ketua Koorda Golkar Sumut, HM Sahrul Pasaribu, memukul gong tanda dibukanya Turnamen Bulutangkis Golkar Cup 2010 di Sibuhuan, Kabupaten Padang Lawas, Sabtu (30/10).



1. Kepanjangan Jupe, dikenal sebagai penyanyi dan pemeran iklan kondom. 6. Bentuk tubuh menggairahkan. 9. Kepanjangan Depe, dikenal sebagai penyanyi dangdut. 10. ____ de cologne, minyak wangi kelonyo. 11. Kotak dari karton. 12. Bangunan peninggalan kerajaan Mataram dari wangsa Syailendra di dekat Magelang, Jawa Tengah. 14. Suku penduduk asli benua Australia. 15. Huruf ke-3 abjad Arab. 17. Warga Indonesia menyebutnya kalimantan. 18. Kepanjangan VCR adalah Video Cassette _______. 21. Bersifat hati-hati dalam pengeluaran uang, penggunaan barang, bahasa dan waktu. 24. Binatang mitologi dan legenda drakula. 25. Pendiam, lamban, sayu, muram. 27. Pilih: Watonga, Wotanga atau Watanga adalah nama kota di Oklahoma, AS, dikenal sebagai tempat kelahiran Clarence Nash yang disewa untuk mengisi suara filem kartun Donald Duck selama 50 tahun. 29. Singkatan ilmu pengetahuan dan teknologi.

SIBUHUAN (Waspada): Cabang bulutangkis pernah jaya di Indonesia dan bahkan beberapa dekade mengukir nama di dunia internasional. Untuk itu, Turnamen Golkar Cup 2010 ini diharapkan mampu meraih kembali prestasi kejayaan bulutangkis nasional. Demikian Ketua DPD Golkar Kabupaten Padang Lawas H Ali Sutan Harahap SE pada pembukaan turnamen bulutangkis di Sibuhuan, Kecamatan Barumun, Kabupaten Padang Lawas, Sabtu (30/10).

Ali Sutan, juga Wakil Bupati, menyampaikan melalui kegiatan turnamen yang diselenggarakan itu dapat melahirkan pebulutangkis handal, sehingga ke depan bisa meraih kembali prestasi dan kejayaan bulutangkis di tanah air. HM Sahrul Pasaribu selaku Ketua Koordinator Partai Golkar menyampaikan apresiasi atas pelaksanaan turnamen sebagai salah satu program partai meningkatkan kebersamaan serta persatuan dan kesatuan. Untuk itu dihimbau kepada

30. Rasa cuka dan mangga muda.



1. Uji materi undang-undang (bahasa Inggris populer). 2. Penegakan hukum (Inggris populer). 3. Alat pengeras suara (Inggris populer). 4. Pengiriman barang dagangan ke luar negeri. 5. Obat untuk menghilangkan rasa sadar. 6. Surat Keputusan. 7. Bergetarnya urat-urat pada kelopak mata yang dianggap sebagai pertanda sesuatu. 8. Dalam keadaan berbelit atau bertaut. 13. Minyak zaitun (Inggris). 15. Tiga serangkai. 16. Tetap pada pendirian, taat asas. 17. Burung dari Nias. 19. Pangkalan bongkar muat barang dan penumpang. 20. Nyata (Inggris, masuk kamus Indonesia). 22. ______ Kruschev, mantan presiden Uni Soviet, nyaris perang nuklir dengan AS tahun 60an. 23. Pohon, kayunya dibuat arang, buahnya dibuat asinan. 26. Berilmu dalam hal agama Islam. 28. Poros tempat roda berputar.

seluruh peserta turnamen bermain dengan maksimal, menjunjung sportivitas seraya berkompetisi dengan baik sekaligus menjaga nilai-nilai persatuan dan kesatuan. Ketua Panitia Turnamen Darman Hasibuan mengatakan berlangsungnya turnamen tidak terlepas dari dukungan semua pihak termasuk Bupati Padang Lawas Basyrah Lubis, kader Golkar Kabupaten Padang Lawas bersama simpatisan dan pengurus PBSI setempat. (a32)

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan hari ini: sangat mudah (*), bisa diselesaikan dalam waktu tak sampai empat menit. Jawabannya lihat di halaman A2 kolom 1.



8 9 7 8 3 4 7 2 5 5 1 2 1 3 4 7 7 8 9

3 4 1 8 6 2 9

9 8 2 6 6 5 7 6 5 3 4 1 9 3 8 8 4 2 1 1 3 ve203




Senin 1 November 2010

Gelar Kedelapan Lorenzo ESTORIL, Portugal (Waspada): Juara dunia MotoGP Jorge Lorenzo (foto) berjaya merebut kemenangan pada MotoGP Portugal di Sirkuit Estoril, Minggu (31/10) malam, setelah tak tertandingi para pesaingnya. Lorenzo berhasil memenangkan duel dengan rekan satu tim di Fiat Yamaha sekaligus rival kuatnya, Valentino Rossi, guna memenangkan balapan sebanyak 28 putaran dengan catatan waktu 46 menit 17,962 detik. Rossi duduk di tempat kedua setelah waktunya terpaut 8,629 detik. Podium terakhir diisi andalan Repsol Honda, Andrea Dovizioso, yang me-

menangkan duel dengan Marco Simoncello menjelang garis finish dan menyelesaikan balapan 26 detik di belakang Lorenzo. Lorenzo melewati The Doctor selepas balapan memasuki paruh kedua, di mana Rossi sebelumnya memimpin lomba pasca melewati Lorenzo dan Casey Stoner (Ducati) di lap-lap awal. Stoner kemudian terjatuh

hingga membuat balapan menjadi milik Lorenzo dan Rossi. Namun persaingan antar rekan satu tim ini juga tak berlangsung lama, karena Lorenzo kemudian melesat cukup jauh di akhir-akhir balapan. Hasil di Estoril merupakan gelar kedelapan bagi Lorenzo musim ini atau pertama sejak 15 Agustus lalu usai kemenangan di MotoGP Ceko ketika merebut kemenangan ketujuh dari 10 seri. Poin maksimal di sini juga semakin mengukuhkan posisi Lorenzo di puncak klasemen kejuaraan dunia dengan koleksi 358 angka. Rossi sendiri mengumpulkan 217 ang-

ka dan naik ke urutan ketiga menggeser Stoner (205). Sementara itu, rider Repsol Honda Dani Pedrosa duduk di tempat kedua dengan nilai 236. Nicky Hayden finish kelima dan naik satu tingkat ke urutan keenam sama dengan nilai Ben Spies dari tim Tech 3 Yamaha (163). Spies sendiri gagal mengikuti lomba karena terjatuh saat hendak menuju grid. Kali ini, hanya 13 dari 16 rider yang berhasil menyelesaikan lomba, setelah Aleix Espargaro terjatuh dan pembalap veteran Carlos Checa yang kembali ke MotoGP mengganti tempat Mika Kalio masuk pit. (ap/h09)

Hasil MotoGP Portugal: Jorge Lorenzo Valentino Rossi Andrea Dovizioso Marco Simoncelli Nicky Hayden Randy de Puniet Colin Edwards Dani Pedrosa Marco Melandri Hector Barbera Alvaro Bautista Hiroshi Aoyama Loris Capirossi

(Spanyol/Fiat Yamaha) (Italia/Fiat Yamaha) (Italia/Repsol Honda) (Italia/Honda Gresini) (AS/Ducati Marlboro) (Prancis/LCR Honda) (AS/Yamaha Tech 3) (Spanyol/Repsol Honda) (Italia/Honda Gresini) (Spanyol/Aspar Ducati) (Spanyol/Rizla Suzuki) (Jepang/Interwetten Honda) (Italia/Rizla Suzuki)

46:17,962 46:26,591 46:44,437 46:44,496 46:45,116 46:46,259 46:48,071 47:02,909 47:31,611 47:35,683 47:35,987 47:50,987 47:57,714

Pasang Iklan HP. 081370328259 Email:

Wozniacki Tinggal Hadapi Clijsters

Guard Chicago Bulls, Derrick Rose (putih), menggagalkan tembakan Ben Gordon dari Detroit Pistons dalam laga NBA di United Center, Chicago, Minggu (31/10). - AP-

Rose Mengamuk, Pistons Merana CHICAGO, AS (Waspada): Yel-yel “MVP! MVP!” ditujukan kepada Derrick Rose tatkala memimpin Chicago Bulls bangkit dari defisit yang cukup jauh saat menjamu Detroit Pistons dalam lanjutan kompetisi NBA di United Center, Minggu (31/10). Pasalnya, Rose mengamuk dengan mendulang 39 angka untuk membantu Bulls meraih kemenangan dramatis 101-91 atas Pistons. Di awal kuarter ketiga, Bulls terpaut 21 poin dan masih tertinggal 86-73 di tiga menit tersisa kuarter akhir. Tampil di kandang untuk pertama kali musim ini, Rose mengambil alih offense Bulls yang kemudian mencetak 19 poin berbanding dua. Pada waktu tersisa itu, Rose menambah delapan poin. “Saya hanya tampil sebaik mungkin dan memanfaatkan setiap peluang yang diberikan rekan-rekan. Lagipula lawan banyak lengah menjaga saya hingga banyak peluang untuk melakukan medium shot maupun drive ke basket,” tutur Rose usai pertandingan. Selain Rose, Bulls turut mendapat kontribusi dari Joakim Noah yang mengoleksi 15 angka 17 rebound dan Taj Gibson 11 poin. Hasil ini juga menjadi torehan positif bagi pelatih baru Tom Thibodeau pasca kekalahan dari Oklahoma City Thunders di laga pembuka. Di New Orleans, tuan rumah Hornets menyempurnakan tiga pertandingan awalnya dengan menundukkan San Antonio Spurs 99-90. Hal serupa juga dialami Atlanta Hawks dan Portland Trailblazers. Chris Paul memimpin Hornets dengan 25 poin, tujuh rebound dan lima assist. David West menambahkan 18 angka, sedangkan Marcus Thornton menoreh 17 poin. Manu Ginobili menjadi top skor Spurs dengan 23 angka. Saat ini, Hornets merupakan satu dari tiga tim yang selalu menang dalam tiga pertandingan. Dua lainnya adalah Hawks dan Blazers. Hawks sendiri menaklukkan Washington Wizards 99-95 dan Blazers menggilas New York Knicks 100-95.

Di laga lain, Sacramento Kings menang atas Cleveland Cavaliers 107-104, Indiana Pacers menumbangkan Philadelphia 76ers 99-86, Memphis Grizzlies mengungguli Minnesota T’wolves 109-89, Denver Nuggets mengalahkan Houston Rockets 107-94 dan Milwaukee Bucks menang 9888 atas Charlotte Bobcats. (m33/ap)

DOHA (Waspada): Petenis Denmark Caroline Wozniacki melenggang ke final Kejuaraan Tur WTA di Doha usai kemenangan atas petenis Rusia Vera Zvonareva di semifinal, Minggu (31/10). Dalam duel berdurasi 1 jam 24 menit itu, Wozniacki yang sudah memastikan status ratu tenis dunia 2010 mendulang kemenangan 7-5, 6-0. Dengan demikian, dara muda Denmark itu akan bertemu unggulan ketiga Kim Clijsters (Belgia) di partai puncak turnamen berhadiah 4,55 juta dolar AS (sekitar Rp40,6 miliar) ini. Bagi Zvonareva, kekalahan ini terasa cukup menyesakkan. Selalu menang dalam tiga laga di fase penyisihan grup, termasuk mengalahkan Clijsters, petenis nomor dua dunia ini pun memastikan diri sebagai juara grup. Melawan salah satu rival beratnya itu, Wozniacki bermain agresif di awal pertandingan. Pemain berusia 20 tahun ini pun langsung unggul 3-0 setelah melakukan break di game kedua. Setelah itu, Zvonareva bangkit seperti

yang dilakukannya ketika melawan Clijsters. Wozniacki sempat frustasi dan membanting raket pada game kesembilan, namun beruntung tidak patah semangat. Dengan menjaga momentum yang ada di pihaknya, Wozniacki praktis sulit dibendung Zvonareva. Kemenangan ini juga menjadi ajang balas dendam Wozniacki karena Zvonareva pernah menghalangi usahanya menembus final AS Terbuka lalu. Kala itu, Zvonareva menang 6-4, 6-3 untuk meraih tiket final sebelum dikalahkan Clijsters. Kini, rekor pertemuan keduanya menjadi 4-3 untuk Wozniacki. Sementara itu, Clijsters lolos ke partai puncak setelah menang straight set 7-6 (3), 61 atas petenis Australia yang mengalahkan Wozniacki di penyisihan grup, yakni Samantha Stosur. Pencapaian tersebut pun terasa melegakan bagi Clijsters. Dalam perjalanan menuju Stadion Khalifa, mobil yang membawa Clijsters dan manajernya ditabrak oleh pengendara lain. (m33/rtr)



Kim Clijsters (kiri) dan Caroline Wozniacki kembali beradu di final.

Medan Metropolitan

WASPADA Senin 1 November 2010


Pencurian Marak Terjadi 49 Kali Setiap Bulan Di Wilayah Polsekta Percut MEDAN (Waspada): Pencurian sepeda motor atau curanmor, pencurian dengan pemberatan dan penganiayaan berat, mendominasi kasus tindak pidana di Polresta Medan selama JanuariSeptember 2010. Untuk curanmor sedikitnya ada 1.901 kasus dengan penyelesaian tindak pidana (PTP) hanya 100 kasus. Selain itu, pencurian dengan pemberatan mencapai 1.400 dengan PTP hanya 715 kasus dan pencurian dengan penganiayaan berat mencapai 1.267 kasus dengan PTP hanya 696 kasus. Kapolresta Medan Kombes Pol Tagam Sinaga melalui Kasubag Humas AKP Edward T kepada wartawan mengatakan, untuk menekan angka kriminal tersebut, pihaknya terus menggiatkan patroli di jam-jam yang dianggap rawan. Untuk kasus curanmor, lanjutnya, diharapkan kepada pemilik kenderaan memasang kunci tambahan Waspada/Andi Aria Tirtayasa

Petugas Dinas Pemadam dan Pencegah Kebakaran Pemko Medan sedang memadamkan sisa-sisa api yang terlihat di antara puing-puing rumah yang terbakar di Jalan Gereja, Kel. Harjosari II, Kec. Medan Amplas, Minggu (31/10).

Polisi Sita Kompor Minyak Tanah MEDAN (Waspada): Satu rumah semi permanen yang berlokasi di Jalan Gereja, Kel. Harjosari II, Kec. Medan Amplas, Minggu (31/10) sekira pukul 14:30, musnah terbakar. Dalam kabakaran itu tidak ada korban jiwa, namun pemilik rumah Niko Ginting, 44, mengalami kerugian puluhan juta rupiah. Saksi mata di lokasi kebakaran menyebutkan, saat api mulai menyilat dinding rumah, penghuninya tidak ada karena Niko Ginting sedang mengikuti

kebaktian di gereja yang tidak jauh dari rumahnya. Warga yang bermukim di belakang rumah korban pertama sekali melihat api sudah membakar dinding rumah yang terbuat dari papan tersebut. Kemudian, mereka berusaha memadamkan api sebisanya. Tak lama kemudian, mobil Dinas Pencegah dan Pemadam Kebakaran Pemko Medan tiba di lokasi. Petugas pemadam sempat kewalahan menyemprotkan api karena rumah korban berada di antara pemuki-

man padat dengan jalan setepak. Kanit Reskrim Polsekta Patumbak Iptu P Samosir yang dikonfirmasi di lokasi kebakaran belum bisa menyimpulkan asal api atau penyebab kebakaran tersebut. “Bisa jadi karena arus pendek (korslet) atau karena kompor. Karena terlihat kompor minyak tanah terbakar dan kondisinya rusak,” jelas Iptu P Samosir. Untuk penyelidikan, tambah Iptu P Samosir, pihaknya menyita satu kompor minyak tanah untuk diselidiki sekaligus

memintai keterangan dari pemilik rumah tersebut. Salah seorang tetangga Ginting menyebutkan, setiap hari rumah tersebut kosong karena penghuninya berjualan di depan rumah keluarganya yang lain di Jalan Gereja. “Pak Ginting hanya tidur saja di rumah itu. Makan pun di kios rokoknya, kalau malam baru dia pulang ke rumahnya,” sebut seorang ibu seraya menyebutkan, kobaran api tak sampai setengah jam namun sudah meratakan bangunan rumah tersebut. (cat)

DPP Pastikan Musda Demokrat Di Medan Sanksi Bagi Setiap Pembangkangan MEDAN (Waspada): Dewan Pimpinan Pusat Partai Demokrat memastikan Musyawarah Daerah II Partai Demokrat Sumatera Utara akan dilaksanakan di Medan pada 3-5 November 2010. “Sudah ditetapkan di Medan dan itu keputusan ketua umum (Ketua Umum DPP PD Anas Urbaningrum),” ujar pengurus Divisi Pembinaan Organisasi Dewan Pimpinan Pusat (DPP) Partai Demokrat (PD) AP Pulungan ketika dihubungi melalui telepon dari Medan, Minggu (31/10). Hal itu dikemukakannya menyusul pemasangan sejumlah spanduk yang menyebutkan Musyawarah Daerah (Musda) II PD Sumut akan digelar di

Parapat, Kabupaten Simalungun, bukan di Kota Medan. Kemunculan spanduk-spanduk tersebut bahkan juga diikuti dengan pencopotan benderabendara partai itu dari sejumlah kawasan strategis di Kota Medan. Menurut Pulungan, DPP sudah memutuskan Musda II PD Sumut akan dilangsungkan di Kota Medan pada 3-5 November 2010, bukan di Parapat. “Kalau ada yang berkehendak di luar itu, berarti merupakan pembangkangan dan tentu akan ada sanksi tegas untuk tindakan semacam itu,” ujarnya. Panitia Musda II PD Sumut sebelumnya menginformasikan, musda akan dilangsung-

kan 3-5 November 2010 di Medan, sebagaimana disampaikan ketua panitia pengarah musda H Mutawalli Ginting didampingi ketua panitia pelaksana Tengku Dirkhansyah Abu Subhan Ali di Medan, Kamis (28/10). “Musda juga akan dihadiri ketua umum (Anas Urbaningrum) dan sekjen (Sekretaris Jenderal DPP Partai Demokrat Edhie BaskoroYuhoyono),” ujar Mutawalli Ginting. Namun demikian, belakangan muncul spanduk-spanduk yang menyebutkan Musda II PD Sumut akan dilangsungkan di Parapat, bukan di Kota Medan, sementara benderabendera partai yang sebelumnya terpasang di sejumlah kawasan strategis dicopoti pihak

tertentu. Menanggapi hal itu, AP Pulungan menegaskan, Ketua Umum DPP PD Anas Urbaningrum telah memutuskan musda digelar di Medan. “Ketua umum adalah mandataris partai dan apa yang beliau putuskan itulah yang harus dilaksanakan. Kalau ada yang di luar itu, berarti membangkang dan pasti akan ada sanksi tegas dari DPP,” ujarnya. AP Pulungan juga memastikan DPP PD tidak menolerir aksi pembangkangan dalam bentuk apa pun. “Apa yang kini terjadi menunjukkan ada sesuatu yang tidak beras di PD Sumut, dan DPP tentu tidak akan tinggal diam,” tegasnya.(h11)

Seorang Pria Terobos Landasan Pacu Polonia MEDAN (Waspada): Akibat menerobos area runway (landasan pacu) Bandara Polonia Medan, seorang pria ditangkap patroli Sekuriti Angkasa Pura II. Pria itu berjalan kaki menyeberang landasan dari Taman Rekreasi Dirgantara milik TNI AU yang berada di dekat Apron Kelapa Sawit Lanud Medan, di Jalan Adi Sucipto, Kemarin. Informasi diperoleh wartawan dari beberapa sumber di Bandara Polonia, Jumat (29/10), pria itu diketahui Saliman, penduduk Desa Bunbun Alas Kecamatan Leuser, Aceh Tenggara, terlihat dari kejauhan berjalan melintasi landasan pacu dari arah Pangkalan Udara TNI AU menuju ke arah Gedung Terminal Bandara Polonia. Yahya Tarigan, petugas Sekuriti PT Angkasa Pura II yang saat itu melakukan tugas patroli di area runway dengan mobil, mengamankan pria itu dan membawanya ke area parkir pesawat bandara. Kepala Pos Polisi Bandara Aiptu Saut Sihombing membenarkan peristiwa itu. Pria tersebut sempat dibawa petugas Sekuriti ke Kantor Pos Polisi Bandara untuk pendataan identitas. Namun kemudian yang bersangkutan dibawa kembali oleh sekuriti. Sementara itu, pelaksana Humas PT Angkasa Pura II Bandara Polonia Firdaus yang dikonfirmasi wartawan membenarkan peristiwa itu, namun belum mengetahui persis proses penangkapannya. (m32)

BPN Diusulkan Lebur Ke Pemda MEDAN (Waspada): Permasalahan pertanahan secara nasional telah memasuki babak sangat krusial. Untuk itu perlu solusi yang tuntas dan segera. Hal itu dikemukakan anggota DPD RI Rahmat Shah melalui siaran pers yang diterima Waspada, baru-baru ini. Menurut Rahmat, dalam sidang Pleno Komite I ke-10 DPD RI di Jakarta, Kamis (20/ 10), membahas laporan pelaksanaan tugas masing anggota Komite I melalui kunjungan kerja dan pembahasan Rencana Agenda Komite I, menyimpulkan permasalahan tersebut. ‘’Hal itu perlu solusi yang tuntas dan segera,’’ ujarnya. Disebutkan, sidang dipimpin Ketua Komite I DPD RI Dani Anwar dan diikuti 21 anggota DPD RI dari seluruh provinsi di Indonesia, telah menyimpulkan butir-butir terkait permasalahan pertanahan di Indonesia. Menurut Rahmat, seluruh anggota Komite I meminta BPN dibubarkan dan dilebur ke dalam pemerintahan daerah, namun wacana tersebut belum mendapat kesepakatan. Dikemukakan pula, yang paling serius adalah Komite I menyuarakan dalam Sidang Paripurna DPD RI agar DPD RI merekomendasikan kepada Presiden untuk melakukan evaluasi kepemimpinan yang ada di BPN. Presiden SBY pada Peringatan Hari Agraria ke 50 pada 20 Oktober 2010 di Istana Bogor, menegaskan, distribusi tanah selama ini belum adil. Untuk itu disampaikan kepada jajaran BPN, di antaranya agar semua jajaran BPN langsung menjemput bola dalam memberikan pelayanan dan upaya mengatasi persoalan. (m34)

Saleh Daulay Ketum PP Pemuda Muhammadiyah


Fajrul, Penggemar Matematika Genggam Kesuksesan SUATU kebahagiaan tersendiri bagi Fajrul Hukmi Poetra beserta keluarga dan sanak saudara, setelah menjalani prosesi wisuda. Apalagi sosok pemuda yang menggemari pelajaran matematika ini mampu menyelesaikan pendidikan S1-nya kurang dari 4 tahun. Fajrul yang merupakan alumni Fakultas Matematika dan Ilmu Pengetahuan Alam (FMIPA) USU ini, ketika ditemui seusai wisuda di Biro Rektor USU mengaku, sejak dari SD sangat menyukai pelajaran matematika hingga sarjana. Bahkan, lulusan USU yang menyelesaikan pendidikan sarjananya sejak Juni 2010 lalu, kini sudah mengikuti pendidikan S2 Program Studi Matematika Pascasarjana USU. Selain itu, putra pertama pasangan Mukhsini Moenir, BA, SH, MH dan Eka Kesuma Dwiyana yang baru diwisuda sarjana Senin (25/10), mengaku dengan kesukaannya terhadap mata pelajaran tersebut dibarengi prestasi yang sangat membanggakan, dengan memperoleh beasiswa sejak di bangku SMA hingga menamatkan kuliahnya. “Sejak dari SMA, alhamdulillah saya tidak pernah membayar uang SPP hingga tamat menjadi sarjana,” ujar Poetra didampingi sang ayah dan tiga adik serta kekasihnya seusai wisuda di Auditorium USU. Keberhasilan dan prestasi yang diraihnya selama ini, tidak terlepas dari peran seorang ayah, sehingga rasa kasih yang dalam kepada ayahnya selaku singel parents, juga sebagai tekad dan kemandirian Poetra untuk bisa membahagiakan ayahnya melalui prestasi akademik. Pria kelahiran 14 Maret 1988

dan jangan sembarangan parkir sepeda motor. “Dari data seluruh Polsekta yang masuk, kasus curanmor yang paling tinggi terjadi di wilayah Polsekta Percut Sei Tuan, karena bisa mencapai 49 kasus dalam satu bulan,” katanya, kemarin. Sementara itu, data jumlah tindak pidana (JTP) yang ditangani Polresta Medan sejak Januari-sebanyak 8.524 perkara. Sedangkan penyelesaian tindak pidana (PTP) sebanyak 4.061 perkara. Dari jumlah perkara ini, kasus curanmor menjadi rangking pertama, disusul kasus pencurian berat, JTP pembakaran 13 perkara dan PTP berjumlah 3 perkara, JTP kebakaran


Fajrul Hukmi Poetra (memakai toga) foto bersama dengan sang ayah dan tiga adiknya serta seorang kekasih, usai mengikuti prosesi wisuda di Auditorium USU, Senin (25/10) lalu. ini, berhasil meraih Indeks Prestasi Kumulatif (IPK) 3,22. Prestasi yang pantas diacungi jempol karena berhasil menamatkan kuliahnya dalam waktu relatif singkat, padahal program studi yang dipilihnya dengan jurusan matematika pada kosentrasi/bidang computer itu bukan hal yang gampang. Terbukti, dalam satu angkatannya, hanya 20 orang yang diwisuda pada Oktober 2010 ini. Pada skripsi yang berjudul “Aplikasi Penggunaan Algoritma Tabu Search Pada Pencarian Jalur Terpendek” telah mengantarkannya sebagai salah seorang alumni USU berprestasi. Dalam skripsinya menyatakan, antara lain tentang merancang suatu aplikasi komputer yang menggunakan sebuah algoritma tertentu, sehingga mempersingkat waktu, jarak dan biaya terhadap suatu masalah yang berhubungan dengan

perjalanan dan pergerakan antar objek ataupun titik kendala. Di sela- sela kesibukannya sebagai mahasiswa S-2 Matematika USU, Poetra juga masih aktif bekerja sebagai programmer, pengajar matematika serta komputer di beberapa lembaga pendidikan. Pria yang berpenampilan sederhana dan ramah ini mengaku merasa tertarik dengan matematika dan fokus ketika duduk di bangku sekolah dasar kelas 5. Sementara banyak teman-temannya tidak suka dengan pelajaran tersebut, sehingga wajar jika keberadaannya selalu dianggap sebagai “pencerah” bagi mereka yang membutuhkan bantuannya. Ketika masih di sekolah dasar, Poetra sempat merasa kehilangan ibunya, karena ada masalah keluarga, sehingga dengan kemandiriannya sebagai anak tertua dari empat

bersaudara, dia hidup hanya dengan seorang ayah dan ketiga adiknya dan bertekad harus berprestasi untuk membahagiakan sang ayah. Dengan motto,” Hidup Dengan Niat Baik, Berusaha Disertai Doa”, putra Mukhsini Moenir BA, SH, MH yang merupakan dosen dan Kepala LPPM dan Humas STIE Harapan, serta dosen Fakultas Hukum UMSU ini, sejak tahun ke 2 kuliah sudah mengajar les privat dan tahun ke 3 mengajar di lembaga pendidikan M2C di Medan. Kini cucu seorang militer yang sejak kanak-kanak sudah diterapkan disiplin, melanjutkan lagi pendidikan ke S2 dengan biaya sendiri dan bertekad semuanya itu sebagai bentuk ungkapan terimakasih kepada sang ayah yang gigih dan semangat mendidik anakanaknya hingga berhasil. * Sugiarto

MEDAN (Waspada): Saleh Partaonan Daulay akhirnya terpilih menjadi Ketua Umum Pimpinan Pusat (PP) Pemuda Muhammadiyah periode 2010-2014, dengan kemenangan telak pada Muktamar Luar Biasa (MLB) Pemuda Muhammadiyah yang digelar Sabtu (30/10) di Wisma Haji Jakarta Pusat. Saleh yang diusung Pemuda Muhamadiyah Sumut mengumpulkan 279 suara peserta muktamar dan menyingkirkan calon lainnya. “Saingannya, Gunawan memperoleh 73 suara, Ahmad Rofiq 48 suara, Piet Hizbullah Khaidir 31 suara dan Panjtja Nurwahidin hanya memperoleh satu suara. Kemenangan Saleh berkat dukungan penuh dari Sumut serta solidnya koalisi yang dibangun di sejumlah wilayah, seperti koalisi Sumatera, koalisi Kalimantan, koalisi Sulawesi dan Papua,” kata Ketua PW Pemuda Muhammadiyah Sumut, Anang Anas Azhar dihubungi wartawan via telefon di Jakarta, Minggu (31/10). Anang mengatakan, MLB Pemuda Muhammadiyah merupakan lanjutan dari muktamar 18-23 Mei lalu yang ditunda karena peserta tidak mencapai kesepakatan mengenai mekanisme pemilihan ketua umum. Selain memilih ketua umum, peserta muktamar juga memilih 12 formatur. Bersama formatur, ketua umum terpilih akan akan menyusun komposisi kepengurusan organisasi kepemudaan underbouw Muhammadiyah itu untuk empat tahun ke depan. “Mereka; Muhammad Ihsan memperoleh 214 suara, Amiruddin 212 suara, Edi Satria 207, Anang Anas Azhar 202 suara, Ramadani 201 suara, Panca Nurwahidin 201 suara, Dahnil Anizar Simanjuntak 196 suara, Zulkarnaen Nasution 196 suara, Haris Jumadi 191 suara, Sunawan 183 suara, Piet Hizbullah Khaidir 170 suara dan Saijo 164 suara.” (m11)

berjumlah 23 perkara dan PTP 6 perkara, JTP kejahatan mata uang berjumlah 3 perkara dan PTP 2 perkara, JTP pemalsuan surat berjumlah 38 perkara dan PTP 5 perkara kemudian JTP pemerkosaan berjumlah 20 perkara dan PTP 6 perkara. Selain itu, JTP kejahatan susila 199 perkara dan PTP 161 perkara, JTP perjudian sebanyak 388 dan PTP 409 perkara, JTP larikan wanita dibawah umur 53 perkara dan PTP 19 perkara, JTP pembunuhan 16 perkara dan PTP 15 perkara, JTP penganiayaan berat 1.267 perkara dan PTP 696 perkara. Lalu, JTP penganiayaan ringan 188 perkara dan PTP 46 perkara, JTP pencurian dengan kekerasan 268 perkara dan PTP 184 perkara, JTP pencurian berat 1400 perkara dan PTP 715 perkara, JTP pencurian biasa 419 perkara dan PTP 254 perkara, JTP pencurian bermotor berjumlah 1.901 perkara dan PTP 100 perkara.

Kemudian, JTP pemerasan atau pengancaman 85 perkara dan PTP 57 perkara, JTP penghinaan 89 perkara dan PTP 50 perkara, JTP penculikan 10 perkara dan PTP 9 perkara, JTP penggelapan 506 dan PTP 242 perkara, JTP penipuan 475 perkara dan PTP 210 perkara, JTP pengrusakan 149 perkara dan PTP 51 perkara. Selanjutnya, JTP narkoba 672 perkara dan PTP sebanyak 671 perkara, JPT penyalahgunaan senjata api (senpi) berjumlah 1 perkara dan PTP sebanyak 1 perkara, JTP sengketa tanah 2 perkara dan PTP kosong, JTP perasaan tidak senang 149 perkara dan PTP sebanyak 55 perkara, JTP kekerasan dalam rumah tangga (KDRT) berjumlah 189 perkara dan PTP sebanyak 66 perkara, JTP penemuan mayat 11 perkara dan PTP 4 perkara. Yang terakhir JTP senjata tajam (sajam) berjumlah 10 perkara dan PTP sebanyak 8 perkara. (m39)

Guru Besar FH USU Bismar Nasution

Tarik Semua Harta Koruptor MEDAN (Waspada): Menjatuhi hukuman penjara bagi koruptor ternyata tidak mendatangkan efek jera bagi calon koruptor lainnya. Sedangkan menjatuhi mati bagi koruptor masih menjadi debatable. Karena itu hukuman yang pas bagi koruptor adalah menarik semua harta kekayaannya hingga tinggal celana kolor. “Miskinkan saja koruptor itu, biarkan saja mantan koruptor itu mengemis-ngemis di lampu merah sana,” kata Prof. Dr. Bismar Nasution, SH, MH Guru Besar Fakultas Hukum USU pada Diskusi Hukum yang digelar Pascasarjan Universitas Medan Area (UMA), di kampus Jalan Sei Serayu Medan kemarin. Bismar menjelaskan, menarik semua kekayaan terhadap koruptor itu ada dasar hukumnya di dunia ini. Tapi sayang Indonsia tidak mau meng-gunakannya. “Selama ini seorang koruptor setelah menjalani hukuman penjara, lalu pulang ke rumahnya masih memiliki kekayaan dengan rumah mewah dan mobil mewah sehingga tidak menimbulkan efek jera,” kata pakar Hukum Bisnis itu pada diskusi yang dibuka Direktur Pascasarajana, Drs. H

Heri Kusmanto, MA. Pada kesempatan itu Bismar juga mengemukakan bahwa dalam pemberantasan korupsi di negeri ini tidak terlepas dari peran hati nurani berbagai kalangan untuk menerapkannya. Seperti lembaga legislatif, eksekutif dan yudikatif. Artinya lembaga legislatif mampu menjalankan fungsi kontrolnya secara efektif. Sedangkan lembaga yudikatif bekerja tanpa campur tangan pihak lain, bersih dan profesional. Lembaga eksekutif atau birokrasi bekerja secara profesional dan memiliki integritas yang tinggi. Selama ini ternyata Partai Politik (Parpol) belum memberi dukungan kuat bagi pemberantasan korupsi yang terjadi di tanah air. Bahkan Parpol tak segan-segan ikut membacking anggotanya yang terlibat korupsi. Akibatnya pengusutan korupsi mengalami hambatan. “Mestinya Parpol memberi dukungan agar pemberantasa korupsi dapat berjalan dengan baik, bukan mendukung pelaku korupsi,” kata Kepala PPATK, Dr. Yunus Husein, SH, LLM selaku pembicara pada diskusi yang dipandu Dr. Mirza Nasution, SH. (m41)

Tarmizi Terpilih Kembali Menjadi Rektor UNHAM MEDAN (Waspada): Tarmizi (foto) terpilih kembali menjadi rektor Universitas Amir Hamzah Medan (UNHAM) periode 2010-2014 , Sabtu (30/ 10). Kandidat doktor dari Universitas Sumatera Utara ini, terpilih secara aklamasi dalam rapat senat pemberian pertimbangan calon rektor dihadiri 18 dari 23 anggota senat. Sidang rapat pemilihan dipimpin OK Saidin didampingi Sekretaris Senat Try Koryati tersebut dihadiri Ketua Yayasan Amir Hamzah OK Chairuddin. Seusai pemilihan, Tarmizi mengatakan kepercayaan yang diberikan kepada dirinya adalah amanah yang harus dijalankan dengan rasa tanggung jawab. Untuk itu, Tarmizi pada periode kedua memimpin, menargetkan penambahan 50 persen mahasiswa dari yang tercatat sekarang 2.600 mahasiswa dengan tujuh program studi yang sebagian besar sudah terakreditasi. Tahun mendatang, lanjutnya, seluruh program studi di UNHAM sudah terakreditasi dan yang sudah terakreditasi akan ditingkatkan grade-nya. Katanya, cukup berdasar untuk menambah jumlah mahasiswa. Menurut Tarmizi, ada program studi yang bisa

memacu minat masyarakat untuk menimba ilmu di UNHAM. “Saya yakin itu.” Apalagi, UNHAM segera membuka Program Pascasarjana Ilmu Hukum dan Manajemen. Usulannya sudah masuk Dikti. “Sarana gedung dan perlengkapan sudah dipersiapkan. Mudah-mudahan usulan itu disetujui,” ujarnya. Tarmizi mengatakan program-program pengembangan UNHAM harus dilakukan dengan berbagai terobosan, salah satunya memperbaiki dan meningkatkan SDM untuk menyahuti ketentuan regulasi pendidikan tinggi, dimana lulusan UNHAM harus berjiwa kewirausahaan atau entrepreneurship. Hal itu tentunya harus didorong dengan mengubah kurikulum sesuai kebutuhan pasar. (m15)

Medan Metropolitan

B2 Transaksi Ganja Digerebek MEDAN ( Waspada): Petugas Polsekta Medan Kota menangkap Agus Saim Pasaribu alias Agus, 26, warga Jalan Karya Bakti Medan, Kamis (28/10) malam, atas dugaan mengedarkan ganja. Dia ditangkap di Jalan Masjid Taufik Gang Samudra. Polisi juga menyita barang bukti 52 amplop ganja kering. Keterangan di kepolisian, tersangka sudah lama diamati polisi sebagai pengedar ganja di berbagai lokasi. Sebelum penangkapan, polisi kembali menerima informasi bahwa Agus hendak bertransaksi ganja dengan seorang calon pembeli di Jalan Masjid Taufik. Kapolsekta Medan Kota AKP Sandi Sinurat didampingi Kanit Reskrim Iptu S. Simaremare mengatakan, berdasarkan penyidikan, tersangka mengaku membeli ganja seharga Rp4.000 dan dijual Rp5.000 per amplop. (m11)

PNS Edarkan Sabu-sabu MEDAN (Waspada): Penghasilan sebagai Pegawai Negeri Sipil (PNS) tidak membuat Hendriono, 38, merasa cukup.Warga Dusun Nangka Desa Melati II, Kecamatan Perbaungan, Kabupaten Serdangbedagai itu nekat mengedarkan sabu-sabu untuk menambah penghasilannya. Akibatnya dia ditangkap petugas Direktorat Narkoba Polda Sumut bersama seorang temannya, Aswandi, 36, warga Komplek Perkebunan Adolina, Perbaungan dengan barang bukti 10 gram sabu-sabu, kemarin. Direktur Narkoba Polda Sumut Kombes Pol. Jhon Turman Panjaitan, Jumat (29/10) mengatakan, kedua tersangka sudah dua pekan menjadi target operasi polisi. “Dua minggu lalu kita dapat informasi bisnis narkoba dilakukan kedua tersangka. Setelah ditindaklanjuti, kemarin mereka kita tangkap,” katanya. Kedua tersangka ditangkap petugas yang menyamar sebagai pembeli dari sebuah rumah di Jalan Besar Melati II, Perbaungan, Sergai. Dari kedua tersangka ditemukan barang bukti 10 gram sabu-sabu. Kini petugas tengah memburu seseorang lagi yang disebut-sebut sebagai bandar sabu-sabu itu. “Identitasnya sudah ada di kita, tapi belum bisa diekspos karena takutnya dia kabur semakin jauh,” kata Panjaitan. Hendriono, PNS di sebuah Puskesmas Kecamatan Perbaungan mengaku nekat mengedarkan barang haram itu karena ingin menambah penghasilan. Sedangkan Aswandi berprofesi sebagai tukang service HP mengaku masuk dalam jaringan pengedar sabu-sabu sekitar satu bulan dengan komisi penjualan bervariasi, tergantung hasil penjualan sabu-sabu.(m11)

Sambut HUT Ke-65

Brimob Gelar Anjangsana Dan Bakti Sosial MEDAN (Waspada): Brimob Poldasu bekerjasama dengan Bankom Teratai Manggala melakukan anjangsana dan bakti sosial. Gebrakan ini dilakukan dalam rangka menyambut HUT Brimob ke-65 pada 14 November 2010 dipusatkan di Pematangsiantar. Demikian disampaikan Kepala Satuan Brimob Polda Sumatera Utara Kombes Pol Drs Verdianto I Bitticaca melalui Wakasubden Gegana AKP Adam Malik Lubis kepada Waspada, Kamis (28/10). Lubis yang juga selaku perwira penghubung (Pabung) mengatakan, pihaknya telah melakukan kegiatan olahraga selama sepekan. Sabtu (30/10), bakti sosial diadakan di Masjid Agung dan Gereja GPIB di Jalan Diponegoro, Masjid Al Jihad Jalan Abdullah Lubis, Pasar Peringgan Jalan DI Panjaitan, Pasar Sore Jalan Letjen Djamin Ginting/Padangbulan. Selasa (2/11) mengadakan donor dari di Sat Brimob Poldasu di Jalan KHWahid Hasyim Medan dan juga dilakukan Detasemen A di Binjai dan Detasemen B di Tebingtinggi. Kamis (4/11) memberikan bantuan ke panti asuhan berupa beras 400 kg, mie instan 100 kotak, gula 100 kg, roti kaleng, telur 2.000 butir, minyak makan 30 kg, sarden 100 kaleng dan sabun mandi 200 kotak. Menurutnya, Brimob juga membuat program pekan disiplin untuk melakukan zero pelanggaran disiplin dan tindak pidana. Program itu dilakukan untuk mendukung penciteraan Polri ke depan sesuai dengan program yang disampaikan oleh pimpinan Polri. (m31)

Polresta Lepas Delapan Pemain Judi Polisi: Sepeser Pun Kami Tidak Ada Terima MEDAN (Waspada): Polresta Medan melepaskan delapan dari sepuluh pemain judi yang ditangkap dari tempat permainan berbagai jenis judi di antaranya togel, sam kwan, dadu, jekpot dan leng di Jalan Pinang Baris Gang Petisah Pasar 5 Sunggal, tepat di belakang Makro Sunggal. Kasat Reskrim Polresta Medan Kompol Fadilla melalui Wakasat Reskrim AKP Ruruh Wicaksono, SIK saat dikonfirmasi, Sabtu (30/10) malam, membenarkan. Menurutnya, dari sepuluh orang yang sempat diboyong ke Mapolresta Medan, seorang di antaranya anggota TNI berinisial P berpangkat Kopral Kepala (Kopka) dan sejumlah barang bukti berupa, mangkuk dadu, kartu joker, dam, mesin jekpot dan sejumlah uang tunai turut diamankan. Sementara, alasan pelepasan delapan orang, kata Ruruh, karena kedelapan orang itu sudah tua, ada yang mengalami penyakit jantung dan hanya bermain kartu saja. “Seorang tersangka sampai saat ini masih ditahan karena bermain judi togel. Barang bukti yang disita satu unit HP yang di dalamnya tertulis nomornomor judi togel (toto gelap). Sedangkan dua orang dari 8

yang telah dilepas statusnya wajib lapor,” jelas Ruruh. Sementara Kanit Judi Sila AKP Aron Siahaan saat ditanya wartawan mengatakan, pemulangan kedelapan orang yang sempat diboyong ke komando dan diperiksa itu karena tidak memenuhi unsur untuk ditahan dan ada yang mengalami penyakit jantung dan sudah tua dilihat dari fisiknya yakni Lin Keng Seng. Pemulangan kedelapan orang itu tidak ada didasari karena uang. “Ke delapan orang itu dipulangkan pada dasarnya karena memang tidak memenuhi unsur untuk dilakukan penahanan. Sepeserpun tidak ada kita terima dari mereka,” tegas Aron Siahaan. Sebelumnya, penggerebekan markas perjudian di Kota Medan ini dipimpin langsung oleh Waka Sat Reskrim Polresta Medan AKP Ruruh Wicaksono, SIK dan Kanit Judi Sila AKP Aron

Siahaan dengan mengerahkan sedikitnya 35 personel yang terdiri dari Satuan Reskrim, Propam dan Samapta Polresta Medan, Rabu (27/10) pukul 14:30. Kedelapan orang yang sempat diamankan yakni, Ririn, 45, warga Jalan Pinang Baris Medan, Ratna, 42, warga Jalan Pinang Baris Gang Keluarga Medan, Anto, 38, warga Jalan Sual Medan Sunggal, Alex Ginting, 45, warga Pasar I Asam Kumbang Medan. Lin Keng Seng, 60, warga Jalan Toba Medan Kelurahan Petisah Tengah, Akio, 45, warga Jalan Karya Sari Medan, Asiang, 46, warga Jalan Pinang Baris Medan dan yang terakhir yakni Sari, 28, juga warga Jalan Pinang Baris Medan. Awalnya polisi mendapat informasi dari masyarakat yang sangat resah dengan aktifitas perjudian di kawasan Jalan Pinang Baris Gang Petisah Pasar 5 Medan Sunggal. Informasi tersebut langsung ditindak lanjuti, ternyata benar warung-warung kopi dilokasi tersebut dijadikan tempat permainan berbagai jenis judi. Dengan kekuatan 35 personel lokasi perjudian itu digrebek dan pelaku diboyong ke Polresta Medan.(m39)


Ketua Bidang Pengkajian Pemerhati Lingkungan Waspada Green Club Prof DR Ir Abdul Rauf MP memberikan pengarahan sekaligus mempraktekkan cara membuat lubang resapan air kepada para lurah, kepling dan warga Lingkungan 6, Kelurahan Medan Amplas, disaksikan Kaban Lingkungan Kota Medan Ir Purnama Dewi MM, yang juga Wakil Ketua Umum Waspada Green Club.

Safari Bersih Hijau Waspada Green Club

Waspada/Ismanto Ismail

MAKO BRIMOB: Petugas Brimob Poldasu menjaga di depan pintu masuk Mako Brimob Poldasu Jalan KH Wahid Hasyim Medan. Beberapa hari lagi, Brimob akan menyambut HUT ke-65.

Dirayu Pakai Sabu, Dihukum Penjara JIMMY Afandy, 32, pasrah dijatuhi hukuman satu tahun empat bulan penjara. Raut wajahnya menggambarkan ia tidak sependapat dengan putusan majelis hakim itu. Namun, ia tak bisa berbuat apa-apa, selain memperlihatkan rasa kecewa mendalam. “Saya terima pak hakim,” kata Jimmy dengan suara parau, saat mejelis hakim dipimpin Kawit Riyanto mempertayakan sikapnya atas putusan itu. Hakim juga mempersilakan terpidana banding kalau tidak terima hukuman tersebut. Warga Jalan Hos Cokrominoto Gg Nata Wijaya Kel, Sei Kera Hulu, Medan sebenarnya masih beruntung karena vonis hakim lebih ringan dari tuntutan jaksa penuntut umum selama dua tahun pernjara. “Bagi saya hukuman 1 tahun empat bulan ini berat, sebab saya baru kali ini mengonsumsi sabu-sabu. Itu pun karena dibujuk kawan,” katanya di persidangan seraya berujar sabu-sabu itu saya jadikan sebagai obat stres. Itu pun, kata Jimmy, bukan datang dari dirinya melainkan terbujuk rayuan dari seorang temannya. “Kalau kalau gunakan sabu-sabu rasa stres akan hilang,” ulangnya meniru ucapan kawannya. Jimmy mengaku kalau belakangan ini pikirannya sering stres, sebab kakinya terkena rematik tak kunjung sembuh yang terkesan dijadikan mengkambinghitamkan penyakitnya. Jimmy ditangkap Satuan Narakoba Polresta Medan 22 Juni 2010 di Jalan Sei Kera Gang Aren Kecamatan Medan Timur. Saat ditangkap, Jimmy kedapatan membuang satu bungkus plastik ke halaman orang lain. Curiga dengan benda itu, polisi memeriksanya. Dugaan polisi benar, sebab isi plastik yang dibuang terpidana adalah bungkus rokok berisikan sabu-sabu. “Aku jera pakai sabu-sabu setelah keluar kucoba menjauhi semua sejenis narkoba. Aku tidak menduga hidup ku jadi begini,” katanya. Jimmy kepada polisi mengatakan, sabu-sabu diperoleh dari Gundul (DPO) warga Jalan Sukaria Kecamatan Medan Perjuangan. “Saya beli Rp150 ribu untuk dipakai sendiri. Ketua Majelis Hakim Kawit Riyanto, SH dalam amar putusannya, Jimmy terbukti dan bersalah secara sah dan menyakinkan melanggar pasal 127ayat 1 huruf a UU Nomor 35 tahun 2009 tentang psikotropika golongan II seberat 0,05 gram. Menurut hakim, yang memberatkan Jimmy perbutannya bertentangan dengan program pemerintah yang sedang giatgiatnya memberantas peredaran narkoba. Sedangkan meringankan hukumannya, ia mengakui perbuatannya dan menyesalinya. Disamping itu, Jimmy belum pernah dihukum. * M. Ferdinan Sembiring

WASPADA Senin 1 November 2010

MEDAN (Waspada): Sejumlah Pengurus inti Waspada Green Club menghadiri sekaligus memberikan pengarahan dalam acara temu warga yang digelar setiap minggu pagi. Acara yang terbungkus dalam Program Safari Bersih Hijau ini, Minggu (31/10) pagi, langsung dilakukan para pengurus yang juga para pakar lingkungan seperti Prof DR Ir Abdul Rauf MP Guru Besar Ilmu

Tanah Fakultas Pertanian USU, Ir Purnama Dewi MM yang juga Kepala Badan Lingkungan Hidup Kota Medan, Dewi Budiati Teruna Said praktisi dan motivator penanggulangan sampah rumah tangga, serta Marwan Harahap Direktur Exekutif Yayasan Hayati Indonesia, Zul Nasution yang lama berkecimpung di Mahasiswa Pecinta Lingkungan (MAPALA). Dalam kesempatan itu para

pakar mengajarkan cara mudah penanggulangan lingkungan yang dapat dilakukan setiap kelompok masyarakat. Selain memberikan pengarahan Waspada green club juga akan berusaha memberikan bantuan berupa tanaman serta sarana alat kebersihan lainnya kepada masyarakat di tiap kelurahan. Rencananya Safari Bersih Hijau ini akan digelar setiap hari minggu di tiap kelurahan.(rel)

Waspada/Surya Efendi

UJI EMISI KENDARAAN: Sejumlah petugas mengecek emisi (gas buang) satu unit mobil yang melintas di Jalan SM Raja depan Makam Pahlawan Medan, Jumat (29/10). Uji emisi yang sudah berlangsung 3 hari ini guna menguji kelayakan dan mengurangi polusi kenderaan.


“Baru Kali Ini Kami Ditangkap Polisi” DUA lokasi judi dadu guncang dan toto gelap mendadak digerebek petugas Polsekta Patumbak dari dua lokasi terpisah, Jumat (29/ 10). Selain meringkus tersangka MS ,39, warga Jalan Penen Gang SMA Masehi Kecamatan Talunkenas, JS ,40, warga Talunkenas dan Suk,41, warga Jalan Garu III Kelurahan Harjosari Medan Amplas, polisi menyita dua dadu dan uang tunai Rp 206 ribu plus 2 lembar kupon berisi nomor togel, 1 pulpen sebagai barang bukti. Informasi yang diperoleh di kepolisian, Jumat (29/10), menyebutkan, sekira pukul14:00, kedua tersangka MS dan JS ditangkap di Jalan Besar Patumbak-Talunkenas persis di Dusun VI Desa Patumbak 1 ketika sedang sibuk mengocok dadu guncang di pinggir jalan raya. Setelah para pecandu dadu guncang memasang taruhannya, tersangka MS meng-guncang dadu yang berada dalam mangkok dan kemudian menjatuhkannya ke atas lapak plastik yang sengaja diletakkan di pinggir jalan raya. Tanpa disadari kedua tersangka, ternyata praktik judi tersebut sudah dipantau petugas Reskrim Polsekta Patumbak. Begitu hendak mengumpulkan uang taruhan, kedua tersangka disergap, termasuk tiga orang pecandu dadu

guncang tersebut. Polisi menyita ratusan ribu uang taruhan dan dua dadu gundang beserta mangkuk yang digunakan sebagai alat permainan judi tersebut. “Baru beberapa bulan kami menggelar dadu guncang dan baru kali ini ditangkap polisi,” ujar MS kepada petugas. Menurut tersangka MS, mereka menggelar dadu guncang pada setiap pekan (pasar) di desa-desa di Kecamatan Patumbak. Sementara itu, Kanit Reskrim Polsekta Patumbak Iptu P Samosir menjelaskan, kedua bandar dadu guncang tersebut sudah sering beroperasi di dusun-dusun di Kecamatan Patumbak namun selalu lolos dari incaran. Namun, kali ini kedua tersangka harus menyerah. “Kedua bandarnya sudah diamankan, sedangkan tiga pemainnya wajib lapor karena kena pasal Bis,” jelas Kanit Reskrim Poslekta Patumbak Iptu P Samosir. Sedangkan tersangka Suk, ditangkap ketika sedang merekap nomor-nomor togel di satu rumah di Jalan Garu II, sekira pk 21:00. “Dari rumah tersebut, kami menyita 2 lembar kupon togel dan selembar kupon togel plus uang Rp206 ribu,” jelas Kanit Reskrim Polsekta Patumbak Iptu P Samosir. (cat)

10 Anggota Geng Motor Ditangkap MEDAN (Waspada): Sepuluh orang diduga tergabung dalam kelompok geng motor dan sembilan unit sepeda motor terjaring razia polisi dari wilayah Sunggal, Sabtu (30/10) malam. Dari pelaku disita barang bukti satu pisau sangkur dan batu bata. Kapolresta Medan Kombes Pol Tagam Sinaga, Minggu (31/10), mengatakan, mereka yang terjaring ini masih dalam pemeriksaan di Mapolsekta Medan Sunggal. Mantan Kasat Tipikor Poldasu ini menjelaskan, selain itu Polsekta Delitua juga menjaring tiga unit sepeda motor. Seorang pelaku berhasil terjaring dan dua orang lainnya melarikan diri. “Dari tersangka disita satu double stick,” katanya. Sampai saat ini, lanjutnya, keseluruh pelaku yang terjaring masih diamankan di Mapolsekta Sunggal dan Delitua untuk diintrogasi.

Kombes Tagam mengatakan, pihaknya akan terus melakukan razia di jajaran hukum Polresta Medan guna menciptakan situasi yang aman, tentram, tertib serta nyaman khususnya di jalan raya. “Perbuatan para geng motor sudah sangat meresahkan para pengguna jalan raya selama ini. Oleh karenanya perlu untuk diamankan sebagai efek jera kedepannya,” kata mantan Kapolsekta Medan Sunggal ini. Medan Baru Sementara itu seorang warga, Kawal Tayudea, 17, penduduk Jalan Djamin Ginting Gg. Senina kritis dibabakbelurkan 30gengmotor, sekira pukul 02:00. Saksi mata mengatakan, korban dianiaya ketika sedang duduk di sebuah toko, tiba-tiba geng motor tersebut memukuli Kawal hingga babakbelur dan warga membawanya ke rumah sakit. (m39/m31)

Bandar Togel Sudah Disebut, Polisi Tidak Mau Menangkap RAZIA perjudian toto gelap di jajaran Polresta Medan masih terbatas pada tingkat bawah dan belum menyentuh di tingkat atas. Polisi cuma berhasil meringkus para juru tulis yang notabene mengharapkan komisi atau persenan dari omset yang diperolehnya setiap hari. Sementara, bandar togel yang identitas sebenarnya sudah diketahui aparat kepolisian, sepertinya enggan disentuh. Sengaja dibiarkan atau demi kepentingan tertentu? Kenyataannya memang begitu. Selama ini pelaku bisnis ilegal tersebut sudah banyak

yang ditangkapi. Namun, mereka yang ditangkap hanya sebatas juru tulis alias jurtul yang cuma mengharapkan komisi 10 hingga 20 persen dari omset penjualan setiap buka nomor togel. Masih ingat dengan penggerebekan bandar togel A Cu? Wanita Tionghoa yang pernah digerebek petugas Reskrim Polsekta Medan Timur ini, cuma mendapat vonis 4 bulan penjara oleh majelis hakim Pengadilan Negeri Medan pada 2009 lalu. Sementara, para jurtul minimal divonis 5 bulan penjara, itu pun kalau berkasnya ‘diurus’. Bila

Jurtul togel memperlihatkan kupon togel yang akan direkap

kasusnya jalan sendiri, tanpa ada bantuan oknum-oknum tertentu, bahkan jurtul tersebut bisa divonis 1 tahun penjara. Sejumlah mantan juru tulis togel yang masih menggeluti nomor tebakan togel mengaku harus siap menanggung risiko bila harus berurusan dengan aparat kepolisian. Harus siap ditangkap dan menjadi penghuni sel. “Yang penting kami harus pandai-pandai dan jeli. Kalau ada orang yang mencurigakan, kami tak mau melayaninya dan segera menghindar,” kata pria berinisial D jurtul togel d i k a w a s a n Pu l o Bra y a n

Waspada/Andi Aria Tirtayasa

Bengkel. Sementara Udin Harahap dan Saragih, kini tak lagi menggeluti judi togel. Setelah divonis 5 bulan penjara oleh Pengadilan Negeri Medan, Harahap dan Saragih benar-benar tobat. Artinya, kedua pria ini kembali berprofesi semula, yakni berdagang di Pasar Kampung Durian dan buruh kasar di Pelabuhan Belawan. Saragih mengaku, jadi jurtul togel hanya sebagai kegiatan sampingan. Awalnya, istri Saragih sudah berkali-kali melarangnya agar tidak terlibat terlalu jauh dengan perjudian karena akan berurusan dengan aparat penegak hukum. Namun, Saragih mengabaikan “warning” dari sang istri. Sebulan kemudian, barulah Saragih teringat larangan sang istri, manakala dirinya diringkus petugas Reskrim Polsekta Medan Timur. Saragih menyebutkan, setelah berada dalam sel, barulah dirinya menyadari perbuatannya itu melanggar hukum. “Di dalam penjara, aku teringat wajah anakku yang masih berusia 2 tahun, sementara daganganku tak bisa dijual di pajak pagi karena aku berada dalam sel sedangkan istriku tak memiliki jiwa dagang,” tutur Saragih. Disubsidi oleh bandar Selama dalam sel, Saragih hanya disubsidi sekali saja oleh bandar togel. Sedangkan biaya urus perkara di Kejaksaan Negeri Medan ditanggung sendiri. “Kami yang bekerja untuk bandar togel namun jerih payah kami tak dihargai. Selama dalam sel, mereka tak peduli lagi sama kami yang pernah menjadi jurtulnya,” jelas Saragih sembari menambahkan, selain dirinya,

banyak juga jurtul yang senasib dengan dirinya berada dalam satu sel. Menurut Saragih, setelah dirinya bebas dari Lembaga Pemasyarakatan Tanjunggusta, semua yang berbau judi dijauhinya. Begitulah sistem polisi memberantas perjudian togel. Bandar seolah dipelihara, juru tulis yang ditangkapi. Hal itu sama dengan bukan memberantas judi, maka judi bisa hidup lagi. Menurut Saragih, dirinya harys berutang untuk mengurus nasibnya di kejaksaan agar tidak dipenjara terlalu lama. Sedangkan Harahap juga bersikap sama seperti Saragih. Keduanya sama-sama meninggalkan bisnis ilegal yang diharamkan oleh negara dan agama itu. Harahap juga heran melihat sikap petugas kepolisian karena hanya menangkap para jurtul yang notabene kelas teri namun sang bandar tidak juga ditangkap. “Padahal, saat kami diperiksa, sudah dijelaskan uang setoran judi diserahkan kepada si A, bandarnya. Namun hingga dirinya selesai menjalani hukuman, sang bandar santaisantai saja, bahkan terus menerima setoran uang togel. Harahap mengibaratkan dirinya yang cuma seorang jurtul laksana ikan teri sedangkan bandar togel kelas ikan kakap. “Yang dirazia cuma kelas teri, sementara kelas kakapnya tak ditangkap,” sesal Harahap. Kedekatan bandar dengan polisi Udin Harahap memang memaklumi mengapa bandar togel selalu luput dari jeratan hukum karena kedekatan bandar tersebut dengan oknumoknum polisi. Bahkan, sang

bandar acap mendapat bocoran dan mengetahui kalau polisi akan melakukan razia di wilayah operasionalnya.“Biasanya kalau bandar sudah mendapat ‘bocoran’ akan ada razia polisi, maka pengiriman rekap-rekap togel dipercepat,” kata Harahap. Sementara itu, ketika kepolisian berbicara memberantas judi sangat begitu tegas. Tetapi nyatanya praktik judi masih terjadi di mana-mana. Misalnya, Kapolsekta Medan Timur AKP Patar Silalahi mengaku tak mau berkompromi dengan pelaku-pelaku judi di wilayah hukumnya. Katanya, beberapa lokasi yang dicurigai sebagai tempat perjudian sudah digerebek. Ada juga terdengar selentingan ‘orang-orang tertentu’ berusaha mendekati namun tidak kita tolerir. “Segala bentuk judi akan disikat. Tak hanya jurtul, kalau ada bandarnya pun kita tangkap,” tegasnya didampingi Kanit Reskrim Iptu Nimrot Simanjuntak, Sabtu (30/ 10) kepada Waspada. Bahkan di wilayah Kecamatan Pancurbatu, para bandar togel, kata kepolisian di sana, sudah kucar-kacir dan keluar dari Pancurbatu karena jurtuljurtulnya sudah diringkus. Setelah jurtul ditangkap dan diinterogasi siapa bandarnya, sang bandar togel segera dilacak. Namun, bandar togel keburu melarikan diri karena sudah mendapat informasi kalau jurtulnya telah tertangkap, kata Kanit Reskrim Polsekta Pancurbatu AKP Faidir Chan. Menurut mantan jurtul togel di Kecamatan Medan Denai, kalau polisi menargetkan pemberantasan judi seperti teroris, tidak ada alasan bandarnya bisa kabur. (cat)

Medan Metropolitan

WASPADA Senin 1 November 2010


Ada ‘Permainan’ Pemberian Izin Hotel City Internasional Diminta Tutup MEDAN (Waspada): Permohonan perubahan fungsi dari apartemen menjadi hotel yang diajukan pengelola Hotel City Internasional ditolak Dinas Tata Ruang dan Tata Banguna (TRTB) Kota Medan. Sebelumnya, Kepala Badan Perencanaan Pembangunan Daerah Syaiful Bahri juga menyatakan menolak. Pasalnya, kawasan itu untuk pemukiman. Pengelola juga diminta menutup sementara hotel dalam waktu dekat ini. “Kawasan itu untuk pemukiman bukan hotel. Keputusan ini setelah dilakukan kajian dan tinjau lapangan. Kami juga minta fungsi bangunan dikembalikan semula ruko,” tegas Kadis TRTB Kota Medan Qamarul Fattah, kemarin. Dijelaskan, bangunan itu berada di kawasan padat pemukiman. Bahkan, masih banyak rumah warga mengelilingi bangunan tersebut sehingga

tidak layak dibangun hotel. “Kami minta Dinas Kebudayaan dan Pariwisata mencabut izinnya sementara karena sudah tidak dibenarkan beroperasi,” ucapnya. Dia menambahkan, apabila pengelola tetap bersikukuh meminta izin hotel tidak akan bisa. Mengajukan permohonan perubahan peruntukan tidak semudah itu. Harus dibahas dan kajian apakah memungkinkan atau tidak. “Semua akan diperhatikan, AMDAL, lahan parkir, IPAL dan lainnya. Pembahasan harus dilakukan DPRD Medan untuk mengeluarkan rekomendasi. Apabila setuju baru disahkan Walikota Medan. Jadi, harus

IKOHI Tolak Gelar Pahlawan Soeharto MEDAN (Waspada): Ikatan keluarga Korban Orang Hilang (IKOHI) Sumut menolak rencana pemberian gelar Pahlawan kepada mantan Presiden RI Soeharto. Pemberian gelar tersebut, dinilai IKOHI Sumut adalah rencana ngawur. “Wacana dan rencana menjadikan Soeharto untuk mendapat gelar pahlawan nasional adalah sebuah langkah ngawur,” kata Ketua IKOHI Sumut Suwardi, Jumat (22/10). Menurutnya, Soeharto telah melakukan pelanggaran HAM pada masa kekuasaannya dan menyisakan jutaan korban. “Dimulai dari korban tagedi kemanusiaan 65, Tanjung Priok, Lampung, Talang Sari, Tri Sakti Semanggi adalah potret buruk HAM pada saat itu. Sampai dengan saat ini tidak pernah terselesaikan.” Dikatakan Suwardi, kondisi psikologis korban saat ini sangat memprihatinkan dan tidak pernah mendapat keadilan. Dengan adanya wacana pemberian gelar, lanjutnya, maka akan memperparah kondisi psikologis korban dan keluarganya. Maka dari itu, IKOHI Sumut menolak secara tegas Soeharto mendapatkan gelar pahlawan, seharusnya, katanya, Negara harus menyelesaikan peristiwa pelanggaran HAM pada masa lalu dengan memberikan hak reparasi kepada para korban dan keluarga korban. “Jangan beri ruang kepada pelanggar HAM untuk mendapat gelar pahlawan,” pesannya. (cmai)

PKMW KAHMI Akan Gelar Pelantikan MEDAN (Waspada): Pimpinan Kolektif Majelis Wilayah Korps Alumni Mahasiswa Islam (PKMW KAHMI) Sumatera Utara akan menggelar pelantikan pengurus periode 2010-2015, di Convention Hall Balai Hotel Tiara Medan, Jumat (12/11) mendatang. Ketua Harian PKMW KAHMI Sumut Rusdi Lubis didampingi unsur PKMW Murlan Tamba, Husni Nasution, Tambah Karokaro, Hafcin Suheiry, Ansari Tarigan, ketua panitia pelantikan Asrul Kidam, bidang perlengkapan Zahir Syah mengatakan hal itu kepada wartawan di Sekretariat PMW KAHMI Sumut Jalan DI Panjaitan Medan, Jumat (22/10). PKMW KAHMI Sumut terdiri dari Rusdi Lubis, Ir.H.Murlan Tamba, Hafcin Suheiry, H.Fadli Nurzal, Reden H. Muhammad Syafii, H.Husni Nasution, Ir.Tambah Karo-karo, Rafriandy, Jose Anwar Dalimunthe, Zahrin Piliang, Usman Hasibuan sepakat untuk menggelar acara yang diperkirakan dihadiri sekitar 400an peserta. “Pelantikan ini menindaklanjuti hasil Musyawarah Wilayah (Muswil) KAHMI Sumut di Hotel Madani Medan pada Mei 2010 lalu, sehingga terbentuk tim mediasi secara maraton. Ini salah satu wujud syukur karena alumni KAHMI dapat menyatukan persepsi demi untuk kemajuan KAHMI yang memiliki personil dari berbagai displin ilmu,” kata Asrul Kidam yang juga Wakil Sekum PKMW KAHMI Sumut. (m25)

ditutup dulu pengoperasian hotel itu,” pungkasnya. Pihaknya akan terus mendesak apabila tidak juga dilakukan pencabutan izin sementara. Pasalnya, sudah melanggar ketentuan. “Kami terus mendesak sampai ditutup sementara,” tandasnya. Qamarul memaparkan, bangunan ini awalnya ruko dan kemudian mengurus perubahan fungsi bangunan menjadi apartemen. Belakangan diketa-

hui dibangun hotel. Namun, dia tidak tahu apa alasan Dinas Kebudayaan dan Pariwisata Kota Medan mengeluarkan izinnya. “Izin dikeluarkan sebelum saya menjabat. Makanya, saya tidak bisa jawab kenapa izin bisa dikeluarkan. Pastinya ini tidak ada koordinasi,” tambahnya. Tidak adanya koordinasi dibangun antar Satuan Kerja Perangkat Daerah (SKPD) menyebabkan, persoalan ini baru

diketahui belakang hari dan telah beroperasi berapa tahun. Bahkan, PBB nya sudah sesuai hotel bukan ruko lagi. Secara terpisah, Kepala Seksi Akomodasi Dinas Kebudayaan dan Pariwisata Kota Medan Chaidir terkesan membela pihak Hotel City Internasional. Mereka belum bisa mencabut izinnya karena belum ada surat tertulis dari Walikota Medan. Mereka juga belum melakukan pembahasan. (h10)

TRTB Biarkan Bangunan Menyalahi Izin MEDAN (Waspada): Dinas Tata Ruang dan Tata Bangunan (TRTB) Kota Medan belum juga melakukan pembongkaran bangunan menyalahi izin, salah satunya di Jalan Sisingamangaraja. Padahal sebelumnya mereka telah berjanji akan melakukan pembongkaran terhadap seluruh bangunan yang menyalahi izin. Pemilik bangunan di lokasi itu hanya mengantongi Surat Izin Mendirikan Bangunan (SIMB) tiga unit, tapi yang dibangun tujuh unit dan melanggar roilen sembilan meter. Diduga bangunan ini dibeking salah satu pejabat Dinas TRTB. Namun, hal ini dibantah Kadis TRTB Kota Medan Qamarul Fattah. “Tidak ada anggota saya membeking bangunan. Kita akan minta tim pengawas untuk melakukan penertiban. Kami akan tindak bangunan tersebut,” kata Qamarul, kemarin.

Qamarul menambahkan, penyimpangan ini tidak ada ‘permainan’ di dalamnya. Pihaknya akan menanyakan bagian pengawasan kenapa sampai begini. “Ini kesalahan di lapangan. Saya akan pertanyakan itu kenapa sampai terjadi,” ucapnya, Ketika ditanya kapan dibongkar, Qamarul menjawab penertiban bangunan liar tidak bisa dilakukan dalam waktu dekat ini. Alasannya, banyak jadwal pembongkaran dalam minggu ini. Kemungkinan pembongkaran dilakukan minggu depan. “Bukan ditunda, tapi harus disesuaikan jadwal. Dalam minggu ini kegiatan kami padat. Mungkin minggu depanlah dibongkar. Tapi tetap kami tindak,” pungkasnya. Dia menjelaskan, tidak hanya bangunan itu saja, bangunan liar lainnya masih dikerjakan di beberapa kawasan

Waspada/Surya Efendi

DAPAT MELIHAT KEMBALI: Rahma dan Suriatik didampingi dokter spesialis mata (duduk), Ketua PWI Sumut, Kadis Kesehatan Kota Medan dan Dirut Operasional Sumatera Eyes Hospital berbicara setelah melakukan operasi katarak dan dapat melihat kembali secara normal di Sumatera Eye Hospital Jl. Iskandar Muda Medan, Minggu (31/10).

apabila ditemukan juga segera ditindak. Begitu juga gang kebakaran yang ditutup warga dengan menempatkan genset. Sementara itu, Kabid Pengendalian dan Pemanfaataan Ruang Dinas TRTB Kota Medan Ahmad Basaruddin selaku orang yang bertanggung jawab di bidang pengawasan tidak banyak berkomentar. Dia hanya mengatakan nanti dulu. Ahmad Basaruddin enggan memberikan keterangan kenapa lepas dari pengawasan dan belum menindak bangunan yang bermasalah. Bangunan menyalahi izin juga terdapat di sejumlah property di Jalan Karya Kasih, Karya Wisata dan Karya Bakti. Misalnya di Karya Kasih, papan SIMB-nya tertera satu unit tetapi dibangun tiga unit masingmasing berlantai II. Hingga mendekati rampung, petugas TRTB tidak pernah menyentuhnya. (h10)

Suara Legislatif

Rakyat Sumut Di Pedesaan Masih Lapar SEBAGAI lulusan Akuntansi Fakultas Ekonomi Universitas Sumatera Utara (FE-USU), tentunya sangat mudah bagi T. Dirkhansyah (foto) untuk menelaah draf APBD Sumut. Ternyata, menurutnya, aloka-\si anggaran Pemprovsu tidak memberikan porsi yang ideal untuk menurunkan angka kemiskinan di pedesaan (pro poor). “Artinya rakyat Sumut di pedesaan saat ini masih dalam kondisi lapar,” kata anggota Komisi B Bidang Perekonomian D P R D Su m u t i t u k e p a d a Waspada di ruang kerjanya di gedung dewan Jalan Imam Bonjol Medan, kemarin. Anggota Fraksi Demokrat DPRD Sumut itu mencontohkan, dari Rp4,3 triliun RAPBD Sumut 2011 yang telah disepakati, ternyata alokasi belanja langsung untuk Dinas Pertanian saja hanya sebesar Rp58,6 miliar atau hanya 1,3 persen dari APBD. Untuk Badan Ketahanan Pangan, tambah mantan Direktur Center Analysis for Social and Economics Studies (CASES), Pemprovsu hanya menganggarkan Rp19,7 miliar atau hanya 0,4 persen. Serta anggaran untuk Badan Penyuluhan Pertanian Perikanan dan Kehutanan Rp14,9

miliar atau 0,3 persen. “Jumlah itu juga tidak semuanya untuk petani, tapi ada juga untuk belanja pegawai di instansi-instansi tadi,” kata mantan Ketua Umum Himpunan Mahasiswa Islam (HMI) Komisariat FE USU itu. Selain alokasi yang kecil, mantan atlit renang Sumut yang juga Ketua Persatuan Renang Indonesia Medan (PRIM) itu juga mengaku miris melihat besaran porsi yang sangat tidak seimbang dalam anggaran di ketiga instansi tersebut. Dia mencontohkan alokasi anggaran di Dinas Pertanian Sumut yang hanya mengalokasikan Rp600 juta untuk program pengembangan SDM petani dan petugas, namun menganggarkan Rp7,04 miliar item penambahan penghasilan berdasarkan beban kerja. “Padahal item itukan sifatnya hanya bonus lembur. Dari situ saja sudah bisa kita lihat bagaimana sebenarnya kondisi petani di Sumut,” sindir suami Ika Hardiana Lubis ini. Karena itu, kurangnya perhatian dan dukungan anggaran dari Pemprovsu itu, katanya, tidak heran jika kemudian kondisi petani di Sumut sangat memprihatinkan. Padahal Sumut sendiri dalam beberapa tahun terakhir selalu surplus beras. * Hasanul Hidayat

Indahnya Keakraban Di Batalyon Kaveleri 6


Ketua STIE Harapan yang baru Kersna Minan (dua kanan) didampingi istri foto bersama dengan ketua lama Azhar Maksum (kiri).

Kersna Minan Ketua STIE Harapan MEDAN (Waspada): Kersna Minan dilantik sebagai Ketua Sekolah Tinggi Ilmu Ekonomi (STIE) Harapan periode 20102014 menggantikan Azhar Maksum yang sudah dua periode memimpin perguruan tinggi tersebut. Kersna Minan dilantik oleh Ketua-IIIYaspendhar H.Awaludin Sibarani.Pelantikan sekaligus serah terima jabatan itu dilaksanakan di kampus Jl. Imam Bonjol Medan, Sabtu (30/10). Acara tersebut dihadiri Badan Pengawas: H.Azmi Yuli, Dr. Tapi Rondang Ni Bulan, H.Hermasyur. Pengurus Harian: Ketua III, H.Awaludin Sibarani, Sekretaris I: H.Sarifudin Alinafiah. Sekretaris-II, H.Syaiful Nahar,Nst. Bendahara-I : H.Ramadhan. Bendahara-II, H.Edy Zulfikar, para dosen, BEM Harapan dan undangan lainnya. Azhar Maksum dalam sambutannya sangat legowo dengan penyerahan jabatan Ketua STIE Harapan karena proses pemilihan ketua dilakukan secara demokratis dan transparan. Pihaknya mengucapkan selamat kepada Ketua STIE Harapan yang baru, semoga dengan kepemimpinannya STIE Harapan dapat lebih maju lagi ke depan. Azhar Maksum menitipkan pesan kepada ketua yang baru, di antaranya, agar meningkatkan fasilitas belajar-mengajar, meningkatkan kualitas jumlah dosen tetap agar STIE Harapan tidak tergantung dengan perguruan tinggi lain. Selanjutnya wacana STIE Harapan untuk menjadi universitas dapat segera diwujudkan. Sementara itu, Kersna Minan mengatakan, untuk mencapai visi STIE Harapan akan dilakukan restrukturisasi agar mutu lulusan dan organisasi yang sehat dan baik, peningkatan kualitas dosen dan menjalin hubungan kerjasama yang lebih luas lagi dengan lingkungan eksternal. Pada kesempatan itu, PengurusYayasan Perguruan Harapan, Awaludin Sibarani berharap, mudah-mudahan dengan dilantiknya ketua yang baru, dapat melaksanakan apa yang selama ini dinilai baik dan terus ditingkatkan serta mampu memanfaatkan/mengkoordinir seluruh SDM yang ada. (m41)

SUASANA kegembiraan dan kekeluargaan tampak jelas di Lapangan Batalyon Kavaleri 6/Serbu Asam Kumbang, Jumat (22/10) pagi. Di lapangan ini, masyarakat sipil, TNI, Polri, instansi pemerintahan, organisasi serta media cetak dan elektronik bersatu padu. Bermain dan berolahraga penuh canda mereka lakukan di lapangan tersebut. Ada yang bermain bola kaki, futsal, bola voly, tenis meja dan senam aerobik. Bahkan ada juga yang bermain catur dan dam batu. Ada juga yang berjoget, mendengar lagu “keong racun”. Makanan dan minuman juga tersaji di sana yang diberikan secara cuma-cuma bagi mereka yang datang. Tidak ada atribut atau embel-embel seperti pangkat yang melekat. Sampai-sampai tidak ada satu pun masyarakat yang

tahu, mana komandan Yonkav 6/Serbu, pejabat dan anggota DPRD, semua menyatu dan bersatu padu dalam suasana kekeluargaan. Ternyata, acara olahraga bersama ini merupakan inisiatif Komandan Batalyon Kavaleri 6/Serbu Letkol. Kav. Rayen Obersyl. Tak ada tujuan lain pada acara ini, selain mengakrabkan instansi pemerintahan, TNI, Polri, organisasiorganisasi dan masyarakat sipil. “Ini acara silaturahmi serta untuk mengakrabkan saja, dan ke depan acara seperti olahraga bersama ini dilakukan di instansi-instansi lainnya untuk tiga bulan ke depan, kalau tidak ada yang buat, kita lagi yang buat,” canda Komandan tersebut. Rayen mengatakan, kegiatan yang sangat positif ini merupakan salah satu upaya pem-

binaan teritorial terbatas dengan mengamalkan delapan wajib TNI sehingga, kemanunggalan TNI, Polri, instansi pemerintahan sipil dan masyarakat semakin kuat dan kokoh untuk menjaga keutuhan NKRI. “Juga demi terciptanya stabilitas keamanan kota Medan.” Terselenggaranya acara ini, lanjut Rayen, juga tak terlepas dari peran serta dan dukungan masyarakat sehingga kegiatan olahraga bersama ini dapat berjalan aman, tertib, dan lancar. Sementara itu, Ibu Esti, 45, warga Kec. Medan Selayang mengaku sangat senang dengan adanya acara ini.“Maunya acara ini setiap minggu,” katanya sembari tersenyum dan mengatakan, mudah-mudahan kekompakan seperti ini terus terjalin di Medan. * Mursal AI

Waspada/Mursal AI

BERSATU: Sejumlah masyarakat, TNI, Polri maupun instansti pemerintahan bersatu dan duduk bersama dalam bermain catur di Lapangan Yonkav 6/Serbu Asam Kumbang, Jumat (22/10) pagi.

Pemerintah Belum Mampu Atasi Kesehatan Masyarakat Miskin MEDAN (Waspada): Hingga saat ini, pemerintah belum mampu sepenuhnya mengatasi berbagai masalah sosial terutama di bidang kesehatan yang terkait dengan masyarakat miskin. Dengan adanya pola kemitraan antara Sumatera Eye Hospital (SEH) dengan PWI Cabang Sumut, diharapkan menjadi inspirasi dan motivasi bagi pihak lain agar ikut peduli dan mendukung program pemerintah Demikian dikatakan Walikota Medan diwakili Kepala Dinas Kesehatan Kota Medan dr. Edwin Effendi, MSc pada acara peringatan Hari Penglihatan se Dunia yang dipusatkan di halaman gedung Sumatera Eye Hospital Jl. Iskandar Muda Medan, Minggu (31/10). Karena itu, lanjut Edwin, melalui program corporate social responsibility (CSR) diharapkan peran serta pihak swasta untuk mendukung upaya pemerintah dalam menanggulangi masalah sosial terutama di bidang kesehatan yang terkait masyarakat miskin. Sementara itu, Ketua PWI Cabang Sumut Drs. Muhammad Syahrir mengatakan, berdasarkan data 90 persen kebutaan terjadi di negara berkembang. Namun kebutaan ini dapat dicegah dan diobati. “Saat ini 2/3 dari 314 juta masyarakat Indonesia mengalami kebutaan akibat penyakit katarak. Kebutaan bukan hanya dikarenakan faktor kesehatan, tapi juga dikarenakan faktor sosial,” ujarnya. Pada kesempatan itu, Syahrir menyampaikan apresiasi tinggi kepada Sumatera Eye Hospital (SEH) yang menunjukkan kepedulian sosial berupa operasi katarak gratis bagi warga kurang mampu bekerjasama dengan PWI Cabang Sumut. Menurut Syahrir, kerjasama yang terjalin antara PWI Cabang Sumut dengan Sumatera Eye Hospital merupakan sinergi yang sangat positif. “Ke depan kerjasama seperti ini perlu

terus dibina sehingga fungsi sosial yang diemban PWI Cabang Sumut dan Sumatera Eye Hospital terus berlanjut guna memberi kemanfaatan lebih luas bagi masyarakat,” imbuhnya. Sebelumnya, Direktur Operasional Sumatera Eye Hospital DrYulizar SpM yang juga ketua panitia bakti sosial mengatakan, pelaksanaan operasi katarak gratis memang dilakukan secara terjadwal sebagai bentuk kepedulian pihaknya kepada masyarakat yang kurang mampu. “Jika beberapa waktu lalu menyentuh para veteran atau pejuang kemerdekaan, kali ini dilakukan dengan keluarga besar PWI Cabang Sumut. Mudah-mudahan dengan kemajuan dan perkembangan Sumatera Eye Hospital, lebih banyak lagi warga kurang mampu yang dapat terbantu,” jelasnya. Peringatan Hari Penglihatan se Dunia (World Sight Day) tersebut diwarnai live show (siaran langsung) operasi menggunakan teknologi fakoemulsifikasi (tanpa suntik, tanpa jahit, tanpa rasa sakit dan langsung pulang) dari ruang operasi Sumatera Eye Hospital bagi peserta operasi mata katarak gratis. 13 Orang yang merupakan anggota keluarga PWI Sumut mendapatkan operasi katarak gratis. Hanya dalam waktu 10 hingga 15 menit, pelaksanaan operasi katarak dapat dituntaskan tim dokter Sumatera Eye Hospital dipimpin dr Gede Pardianto, SpM. Keluarga PWI Cabang Sumut di antaranya Rahma Harahap dan Suriatik, dua dari 20 pasien yang ditangani usai dioperasi menyampaikan rasa bahagia. “Syukur alhamdulillah sekarang saya sudah dapat melihat normal seperti sediakala,” ucap Rahma dengan suara haru. Hadir pada acara itu Direktur Utama Sumatera Eye Hospital Dr Imsyah Satari SpM, Wakil Ketua Perdami (Persatuan Dokter Mata Indonesia) Cabang Sumut dan NAD Dr Syaiful Bahri SpM, unsur Pengurus PWI Sumut, wartawan dan undangan. (h03)

Media Berperan Menjaga Bahasa Indonesia MEDAN (Waspda): Bahasa Indonesia masih tetap diandalkan untuk menjaga keutuhan Negara Kesatuan Republik Indonesia. Maka untuk itu, Bahasa Indonesia perlu dijaga. Sebab kejatuhan bahasa berimplikasi bangsa akan kehilangan segalanya. “Kejatuhan politik kita hanya kehilangan penguasa. Kalau kejatuhan ekonomi kita hanya kehilangan material. Akan tetapi, kalau kejatuhan bahasa, maka kita akan kehilangan segalanya,” kata Ketua Himpunan Pembina Bahasa Indonesia (HPBI) Sumut Khairil Ansari saat Sarasehan Bahasa Indonesia menyambut Bulan Bahasa yang diadakan Serikat Pekerja Surat Kabar (SPS) Sumut dan HPBI Medan di Amaliun Food Court Medan, Sabtu (30/10). Khairil mengatakan, media sangat berperan menjaga Bahasa Indonesia, sebab media massa setiap hari mengunjungi masyarakat Indonesia. Oleh karena itu, media massa memiliki fungsi sangat strategis dalam usaha merawat bahasa Indonesia ini. “Jika bahasa Indonesia yang digunakan adalah bahasa Indonesia yang benar, berarti secara tidak langsung masyarakat telah diarahkan untuk menggunakan Bahasa Indonesia yang benar pula. Sebaliknya, apabila bahasa yang digunakan media massa tidak sesuai

dengan kaidah,maka akan merusak penggunaan bahasa Indonesia pula.” Sementara itu, budayawan yang juga dosen di sejumlah perguruan tinggi Shafwan Hadi Umri mengemukakan, agar pemakaian bahasa asing didalam media massa harys ditempatkan dibawah bahasa Indonesia. “Seharusnya menerjemahkannya dengan kata dan istilah Indonesia.” Sementara itu, Mutsyuhito Solin yang juga narasumber pada acara tersebut menuturkan, jika Pers Nasional rusak, berarti Bahasa Indonesia juga rusak, oleh karena itu menjaga pers nasional juga menjaga kelestarian bahasa Indonesia. “Pers nasional harus menjadi ujung tombak dalam mengedepankan penggunaan bahasa Indonesia yang baik dan benar. Karena selain untuk menjaga keutuhan NKRI, juga ujung tombak dalam mengedepankan sosial budaya dan pendidikan.” Menurutnya, Pers yang menggunakan bahasa Indonesia yang baik maka pers tersebut dinamakan pers yang mampu menjaga bahasa Indonesia, tapi jika pers mencampuradukkannya dengan bahasa asing, maka pers tersebut tidak dapat dikatakan menjaga bahasa Indonesia. “Tetapi justru merusak bahasa Indonesia,” imbuhnya. (cmai)

Pendidikan Kewarganegaraan Belum Masukkan Konten Demokrasi Lokal MEDAN (Waspada): Pelajaran Pendidikan Kewarganegaraan (PKn) di Indonesia dinilai belum seideal konsepnya. PKn belum mampu mengakamodir kebutuhan siswa akan kompetensi atau pengetahuan terhadap demokrasi lokal. Banyak siswa belum memiliki pemahaman, baik tentang demokrasi di daerahnya sendiri. Direktur Eksekutif Yayasan KKSP (Pusat Pendidikan dan Informasi Hak Anak) Muhammad Jailani mengatakan, hal itu disebabkan karena materi demokrasi lokal yang semestinya menjadi bagian dari materi pelajaran PKn tidak menjadi prioritas yang harus diberikan pada siswa. Itu makanya tidak termaktub di dalam kurikulum pelajaran. “Dari sejumlah studi pustaka terhadap buku-buku pelajaran Pkn, tidak ditemukan materi demokrasi lokal. Materi demokrasi yang diajarkan kepada siswa bersifat umum dan levelnya masih bersifat umum, seperti hak asasi manusia dan politik nasional,” kata dia di sela workshop Modul Pendidikan Demokrasi Lokal di Hotel Garuda Plaza, Medan, Kamis (28/10). Disebutkannya, demokrasi lokal merupakan pengetahuan, mestinya menjadi bagian dari pelajaran siswa. Dalam konteks Otonomi Daerah (Otda) sebagaimana disebutkan dalam Penjelasan UU No. 32/2004, tidak saja meli-

batkan orang dewasa, tetapi juga melibatkan anak-anak yang pada hakekatnya memiliki hak suara dan suatu saat akan menerima tongkat estafet kepemimpinan negeri ini. Demokrasi lokal KKSP menyelenggarakan workshop Modul Pendidikan Demokrasi Lokal sejak Rabu (27/ 10), bekerjasama dengan Friedrich Ebert Stiftung (FES). Kegiatan terbagi dalam dua workshop secara bersamaan di Hotel Garuda Plaza, yakni Modul Pelatihan Pendidikan Demokrasi Lokal Bagi Guru PKn dan Modul Pelatihan Pendidikan Demokrasi Lokal Bagi Rekan Sebaya. Workshop ini merupakan forum membuat modul untuk materi demokrasi lokal dalam materi ajar Pendidikan Kewarganegaraan. Seterusnya akan disosialisasikan ke berbagai pihak, dan sebagai bahan training bagi guru. Pemateri workshop di antaranya, Philipp Kauppert dari FES menyampaikan, pada masa sekolah di Jerman, dia dan kawan-kawan sekolahnya mendapat kesempatan mengetahui secara langsung struktur pemerintahan di daerahnya di Bavaria, dan berdiskusi dengan anggota dewan maupun pejabat pemerintahan daerah itu.”Pengalaman seperti ini sangat penting bagi kami, sehingga dapat mengetahui seperti apa pemerintahan di daerah kami sendiri,” katanya.(m11)



WASPADA Senin 1 Nopember 2010

Merajut Persatuan Dalam Kebinekaan Oleh Bachtiar Sonar Siregar, SE, MBA Kekeliruan untuk selalu membela kelompok yang nyatanyata bersalah, melalui tekanan-tekanan pengikutnya kepada petugas penegak hukum


‘Deponeering’ Pelajaran Buat KPK Dan Kejagung


ua pimpinan KPK, Chandra M. Hamzah dan Bibit Samad Rianto, boleh merasa lega setelah kasusnya ditutup oleh Plt. Jaksa Agung Darmono yang mengambil jalan pintas ‘’deponeering’’. Wajar saja kalau kubu KPK menyambut gembira putusan itu. Begitu pula dengan Menkum dan HAM Patrialis Akbar. Deponeering merupakan putusan tepat, terbaik, katanya kemarin. Namun begitu banyak pihak menyatakan tidak sependapat dengan putusan yang dinilai kontroversial itu, mengapa? Banyak pihak melihat kasus Bibit – Chandra penuh rekayasa, namun banyak pula yang meyakininya, membuat kita prihatin. Pro dan kontra pun terjadi. Harusnya dimajukan saja ke pengadilan untuk mengetahui hasil akhirnya, mengingat semua orang sama di mata hukum. Hal itu sesuai dengan putusan Pengadilan Negeri Jakarta Selatan dan Pengadilan Tinggi Jakarta yang memenangkan gugatan Anggodo terkait praperadilan SKPP Bibit dan Chandra. Kesannya negatif, Kejagung mengangkangi putusan pengadilan. Kalau memang tidak mau dimajukan ke pengadilan Jaksa Agung harusnya menggunakan haknya untuk men’deponeering’ kasus dua pimpinan KPK itu tanpa harus ‘’gila-gilaan’’ membuat SKPP. Setelah dua putusan pengadilan (PN dan PT) memutuskan harus maju ke persidangan, pihak Kejagung masih belum kapok dan masih ingin mengajukan Peninjauan Kembali (PA), namun karena tidak bisa menampilkan bukti-bukti baru dan takut dikalahkan lagi, maka putusan deponeering diambil Plt. Jaksa Agung Darmono, Jumat (29/10). Apakah setelah putusan ‘’deponeering’’ lalu aman? Jawabnya: tidak! Tampaknya, lagi-lagi Kejaksaaan Agung membuat masalah dan bisa berbuntut panjang mengingat putusan deponeering diputuskan oleh Plt. Jaksa Agung. Dalam perundangan hanya Jaksa Agung definitif yang berhak mengabaikan perkara demi kepentingan umum dengan mengambil jalan deponeering. Jadi, bukan Plt. Jaksa Agung. Hal itu dibenarkan pakar hukum dan anggota DPR. Kalau melihat Intisari Keppres yang dikeluarkan Presiden, seorang Plt sama dengan Jaksa Agung definiNamun, undang-undang kejaksaan meMeskipun dibolehkan, tif. nyatakan, hak deponeering dimiliki Jaksa putusan deponeering bisa Agung, bukan pelaksana tugas. Mana yang kuat? jadi boomerang buat pe- lebih Justru itu, tidak hanya Anggodo yang negakan hukum. kecewa dengan putusan deponeering kasus Bibit dan Chandra. Komisi-III DPR diperkirakan akan melakukan ‘’gugatan’’ terhadap putusan Plt. Jaksa Agung mendeponeering kasus Bibit dan Chandra. Penerbitan deponeering oleh Darmono menunjukkan bahwa kejaksaan tidak mematuhi putusan praperadilan SKPP yang sudah diputuskan Pengadilan Tinggi DKI Jakarta agar perkara Bibit-Chandra dibawa ke pengadilan. Hemat kita, putusan deponeering itu sangat tepat diambil Jaksa Agung Hendarman Supandji tahun lalu saat masyarakat ramai-ramai menentang upaya pengkriminalisasian KPK. Kasus ‘’cicak’’ versus ‘’buaya’’ sedang hangat-hangatnya. Pada Oktober 2009 Bibit dan Chandra sempat ditahan di Mabes Polri. 2 November 2009 terjadi aksi besar-besaran turun ke jalan oleh ‘’sejuta’’ komunitas facebooker sehingga Bibit dan Chandra langsung dibebaskan oleh petinggi Kapolri. Momentum berikut yang diabaikan Kejagung adalah saat Presiden Susilo Bambang Yudhoyono memberi keterangan pers setelah Adnan Buyung dkk dari Tim-8 menyimpulkan tidak punya bukti kuat menyatakan Bibit dan Chandra menerima suap. Presiden SBY memerintahkan penyelesaian skandal Bibit- Chandra melalui jalur di luar pengadilan (out of court settlement) tapi juga diabaikan begitu saja. Justru itu, kontroversial deponeering kasus Bibit dan Chandra menjadi pelajaran berharga sekaligus dapat dinilai memalukan buat institusi Kejagung, Polri, dan juga KPK sehingga ke depannya harus lebih peduli terhadap upaya pemberantasan korupsi tanpa pilih kasih, termasuk kasus di internal kejaksaan dan kehakiman. Semua lembaga penegak hukum harus peka terhadap kasus hukum dan korupsi dan menjalankan tugasnya dengan penuh tanggung jawab. Bukan bekerja atas ‘’orderan’’ dan berdasarkan siapa yang ‘’membayar’’ tapi tegakkan hukum walaupun banyak tekanan dan cobaan. Hukum harus tegak walaupun langit akan runtuh. Tak pelak lagi kasus Anggodo dan Bibit – Chandra merupakan salah satu kasus menghebohkan dalam dunia penegakan hukum di tanah air dalam setahun belakangan ini. Sayang kasusnya akhirnya dideponeering. Kalau saja terbukti maka ketiga lembaga penegakan hukum kita yang disebut ‘’trias politica’’ sudah terkontaminasi dengan mafia hukum dan mafia peradilan. Sungguh memalukan! Putusan deponeering memang terbaik dari sejumlah alternatif lainnya yang juga berisiko lebih buruk, termasuk kalau Kejagung mengajukan PK ke MA, hasilnya diperkirakan tetap saja kalah. Sebab, argumentasinya tidak berdasarkan hukum tapi berdasarkan tekanan sosiologis sejuta ‘’facebookers’’. Apalagi tekanan sosiologis itu sekarang tidak kelihatan lagi maka semakin jelas akan ditolak. Akan jauh lebih bagus jika Kejagung merelakan kasus Bibit dan Chandra disidangkan saja, segera ke meja hijau. Tokh kalau tidak terbukti, kedua pimpinan KPK itu pasti akan dibebaskan juga. Memang perlu banyak waktu, namun publik akan semakin percaya pada KPK dan semakin tahu ‘’borok-borok’’nya Kejagung dan Polri yang jauh sebelumnya sudah menyatakan kasusnya Bibit dan Chandra lengkap (P21).+

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN  Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817.  Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385  Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109  Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan hitam-putih Rp. 33.000,Halaman depan berwarna Rp. 90.000,Ukuran kolom: 40,5 mm E-mail Iklan:


ekerjaan yang harus menjadi prioritas bangsa ini adalah, membangun rasa kebersamaan di tengah kemajemukan bangsa ini. Kita sebagai bangsa yang cerdas harus mampu memaknai pluralitas bangsa ini ke dalam satu ikatan nasionalisme yang kental. Karena hanya dengan semangat nasionalisme ini kita bisa terhindar dari ancaman disintegrasi bangsa, yang dapat mengganggu keutuhan NKRI. Merajut kembali persatuan dan kesatuan bangsa di tengah pluralnya bangsa ini bukanlah pekerjaan rumah yang gampang. Semua ini tidak terlepas dari permasalahan kemiskinan dan kesenjangan sosial di tengah bangsa ini. Berbicara dalam konteks idealisme tanpa kita mampu menyentuh permasalahan mendasar bangsa ini, tentu apapun yang kita kemukakan tidak akan terlalu efektif. Adapun perasaan kekecewaan masyarakat yang masih merasa tertinggal ini, adalah masalah rasa keadilan. Apakah itu rasa keadilan terhadap kesempatan mengikuti pendidikan, masalah pelayanan kesehatan, dan tidak kalah masalah perlindungan hukum. Akumulasi kekecewaan masyarakat inilah yang memicu kenapa begitu gampang kita menjadi pemarah. Semua itu tercermin dalam bentrokan fisik yang akhir-akhir ini banyak terjadi seperti masalah Tarakan, Bekasi, Jl. Ampera Jakarta, Menteng Jakarta dan di lain tempat. Primordialisme Dalam semangat membangun kebersamaan ini sudah seharusnya kita melupakan symbol primordialisme seperti, masalah suku, etnis, golongan bahkan agama. Kalau kita bicara suku, maka kita sebenarnya suku apa? Sementara mungkin nenek kita keturunan Indo. Ibu kita mungkin dari Suku Sunda, bapak mungkin suku Jawa. Apakah saya

masih tepat untuk mengaku dari salah satu suku dari campuran suku gadogado seperti ini. Jadi benarlah ada spesifik makanan di Indonesia ini yang namanya “Gado-Gado” dan sungguh enak. Inilah mungkin nama makanan yang tercetus atau lahir sebagai cerminan kebinekaan anak-anak bangsa ini, untuk kita lebih menyadari pelangi itu indah. Kalau kita bicara suku pendatang dan suku asli daerah, sementara antara suku pendatang dan daerah asli sudah saling berkeluarga satu dengan yang lain, apakah masih pas kita mengatakan suku pendatang? Sebagai contoh di Sumatera Utara untuk Medan itu kalau statistik mengatakan suku Jawa lebih banyak jumlahnya dari suku Batak, atau Melayu, dan satu dengan yang lain sudah saling berkeluarga oleh ikatan perkawinan. Apakah masih kita katakan suku Jawa pendatang di Medan, sementara mereka juga anak bangsa negeri pertiwi tercinta ini. Dulunya mereka juga ikut berjuang untuk kemerdekaan bangsa ini. Jangan sampai anak tiri yang sebenarnya datang dari luar Indonesia menjadi anak kandung negeri ini yang bisa menjabat menteri dan lain-lain. Sementara anak-anak kandung negeri ini malah jadi anak tiri. Dalam arti kata setiap ada promosi untuk jabatan penting selalu menjadi pertimbangan bahwa dia bukan putra daerah, bukan suku A, dan berbagai primordialisme lainnya. Inilah faktor pemicu konflik horizontal dan vertikal di tengah bangsa ini. Karena dalam memandang orang lain kita tidak menilai apa kemampuan dan pengabdiannya kepada bangsa dan negara. Tetapi kita lebih menilai asalusul dari mana dia, sama atau tidak dengan kita. Pemahaman seperti ini yang harus kita lupakan, untuk kita mampu merajut persatuan dan kesatuan bangsa

ditengah kebhinekaan bangsa ini. Memelihara konflik Bangsa kita terperangkap kepada konflik yang berkepanjangan, karena kita salah dalam memaknai kebhinekaan bangsa ini. Kejahatan-kejahatan atau perbuatan tindak pidana yang dilakukan oleh seseorag yang mengatasnamakan kelompok-kelompok masyarakat yang bertikai, telah mampu menyandera bangsa ini seolah-olah itu peperangan antar suku, antar gang, preman antar kampung, bahkan antar agama. Anak-anak bangsa ini harus cerdas dan tegas untuk tidak terperangkap kepada benturan-benturan antar kelompok masyarakat. Dalam kehidupan sosial masyarakat ini, salah faham, perkelahian itu bisa terjadi, jangankan antar kelompok yang berbeda, sedangkan dalam kehidupan sekeluarga sekandung hal itu bisa terjadi. “Tetapi yang perlu menjadi catatan kita, apabila dalam perkelahian tersebut terjadi kekerasan dan mengakibatkan korban jiwa, maka siapapun diantara kita yang berada dalam konflik itu harus berjiwa besar untuk tidak membela yang salah hanya untuk alasan membela teman (jiwa korsa)” Kita semua harus membiarkan ini masuk dalam ranah hukum tindakan pidana/ kriminmal. Tidak ada upayaupaya damai antara tokoh/pemuka agama! Sehingga orang yang bersalah tidak mendapat hukuman sementara sudah terjadi korban jiwa/materi. Mungkin inilah kekeliruan yang kita lakukan selama ini dimana masingmasing ingin membenarkan kelompoknya, sehingga tidak merelakan setiap pelaku untuk bertanggungjawab atas perbuatannya. Kalau kita terus dalam pemahaman yang keliru seperti ini maka sulit rasanya kita akan menciptakan suasana damai. Karena setiap biang kerok permasalahan selalu punya asumsi bahwa akan mendapatkan pembelaan oleh kelompoknya dan juga pemahaman bahwa setiap kerusakan massal seolah-olah sah-sah saja seseorang berbuat kekerasan. Kekeliruan untuk selalu membela

kelompok yang nyata-nyata bersalah, melalui tekanan-tekanan pengikutnya kepada petugas penegak hukum— mengatasnamakan kelompok masyarakat, ormas, orsospol maupun organisasi kemasyarakatan lainnya—harus segera kita lupakan dalam setiap penyelesaian pertikaian masyarakat. Saya rasa 2 atau 3 orang mereka-mereka yang bersalah harus kita relakan menjalani proses hukum. Maka itu artinya konflik horizontal di tengah masyarakat dan bangsa ini bisa kita minimalisir. Terlalu mahal harga yang harus kita bayar dalam kehidupan masyarakat kita, apabila kita tidak mampu menyelesaikan permasalahan bangsa yang selalu mengedepankan symbol primordialisme. Ketegasan aparat Pada akhirnya ketegasan aparat penegak hukum dalam hal ini kepolisian, tentu merupakan kata “kunci” untuk penyelesaian setiap permasalahan bangsa ini. Polisi juga harus kita kuatkan, sehingga pereka tidak tersandra oleh perbuatan oknumoknum polisi dengan perbuatan yang tidak terpuji. Sehingga masyarakat memberikan stigma negatif kepada polisi dengan menjeneralisasikan bahwa polisi tidak bisa diandalkan. Dalam segala kelemahan yang dimiliki oleh kepolisian kita saat ini, tetapi mereka atau badan inilah yang memiliki otoritas untuk menjamin ketertiban masyarakat, sehingga masyarakat juga harus memberikan “trust” kepada polisi, agar polisi yang mau berubah tidak terus dalam kegamangan, karena terus dihujat masyarakat. Semua kita menyadari bahwa polisi yang kita miliki tidak sesempurna harapan kita. Tetapi sebagai anak-anak bangsa yang menginginkan perubahan, mari kita juga berikan kesempatan kepada Polri untuk berubah. Berikan trust kepada Polri untuk melakukan penegakan hukum, terhadap permasalahan bangsa ini. Semoga Polri benar-benar menjadi Bayangkara Bangsa dan Negara. Penulis adalah Pemerhati Masalah Sosial Politik

Mentawai Terkoyak Gempa Oleh M. Anwar Siregar Mentawai dua kali mengalami gempa besar tahun 1797 berkekuatan 8.3 SR dan 8.5 SR tahun 1833. Diprediksi masih akan melepaskan energi gempa lebih keras daripada tahun ini


erak bumi terbentuk oleh batuan-batuan yang bergerak di atas suatu litosfera itu telah mengalami proses daur ulang, dan batuan baru yang akan membentuk permukaan bumi juga rentan mengalami penghancuran. Terbentuk suatu lapisan yang diskontinuitas dan memudahkan energi seismik bergerak cepat ke lapisan batuan yang tidak homogen dan meneruskan penghancuran yang jauh dari pusat terjadinya gempa. Seiring dengan diterimanya anomali magnetik bumi yang ditunjukkan dengan lajur-lajur sejajar yang simetris dengan magnetisasi yang sama di dasar laut pada kedua sisi \\o “Mid-oceanic ridge” mid-oceanic ridge, tektonik lempeng menjadi diterima secara luas. Pemahaman terhadap pembentukan daur ulang batuan-batuan di litosfera pada kedua sisi mid oceanic ridge membuka tabir misteri proses terjadinya gempa bumi. Kemajuan Iptek kebumian yang pesat, terutama dalam teknik pencitraan seismik dan kemampuan ahli kebumian membedah tubuh dalam bumi seperti seorang dokter yang membedah tubuh manusia melalui USG. Ahli kegempaan bumi juga menggunakan teknik ini dengan teknik geotomografi yang dikembangkan pertama kali ahli geofisika Indonesia Sri Widiantoro yang dapat mengamati lekuk gerak lempeng di dalam dan sekitar \\o “Zona WadatiBenioff (halaman belum tersedia)” zona Wadati-Benioff dan beragam observasi geologis. Ini untuk memperkuatkan tektonik lempeng sebagai teori yang memiliki kemampuan yang luar biasa dalam segi penjelasan dan prediksi. Relaksasi bumi Indonesia Tekanan yang kuat dari berbagai arah kawasan yang melingkupi wilayah Indonesia oleh empat lempeng raksasa. Hal ini telah mengompres wilayah Indonesia untuk menghasilkan gelombang seismik transversal pada pertemuan lempeng. Karena gempa paling merusak di Indonesia rata-rata disebabkan gelombang transversal dengan model pergerakan tumbukan yang difaktorkan perbedaan kondisi tatanan geologi antara lain; 1.Terjadi perbedaan kesenjangan

seismik antara di Kepulauan Mentawai dengan Nias-Simeulue. Kepulauan Maluku-Sulawesi dengan Kepulauan Biak-Papua, 2.Perbedaan pergerakan blok-blok patahan di tiap titik lemah yang ada dipermukaan bumi Indonesia yaitu blok gempa di Pantai Barat Sumatera cenderung ke arah Baratlaut dan memotong ke arah Tenggara ke daratan Sumatera. Blok gempa di patahan Laut Jawa bagian Utara dan Selatan bergerak ke Timur Laut lalu ke arah Baratdaya dan blok patahan naik di Nusa Tenggara hingga ke Laut Arafuru bergerak ke Timur ke Utara atau Timur ke Tenggara dan tertekan akibat ada penekanan dari Lempeng Eurasia yang bergerak ke Selatan dan Lempeng Philipina ke Tenggara ke arah Utara blok patahan pulau burung Irianjaya Barat. Lempeng Pasifik menekan blok patahan Sorong-Rassikin di daratan Papua dan pulau-pulau kecil Pasifik ke arah Barat untuk mengompreskan wilayah Indonesia di batas pertemuaan Lempeng Australia di Laut Patahan Banda/Maluku yang bergerak ke Utara lalu memotong ke arah BaratBaratdaya di Pantai Barat Sumatera. Patahan di Utara Sulawesi di Lempeng Sangihe menekan dengan bergerak ke Timur parit Halmahera sehingga ada pemekaran laut di blok patahan Sulawesi dengan menekan daratan Sulawesi Barat-Gorontalo dengan mendorong tekanan energi pengompresan lagi ke Teluk Tomini Sulawesi Tengah ke Laut Maluku. Bisa dibayangkan bagaimana gerak relaksasi bumi itu bergerak menekan bumi ruang Indonesia di segala arah di zona patahan tersebut di atas. Seperti gelombang yang memancar dengan datang bertubi-tubi untuk saling mendesak zona patahan yang ada di bumi Indonesia. Satu blok patahan mengalami perumukan maka akan ada gerak gelombang sebagai gerak relaksasi bumi untuk mencari keseimbangan, jika pergerakan lempeng terjadi di Samudera

Pasifik maka akan kita rasakan ada pendesakan kiri kanan di antara pendesakan ataupun pemisahan dalam tubuh lempeng. Maka energi gerak gelombang gempa bumi dari batuan akan memerlukan ruang ke zona lainnya, sehingga akan ada pembalikan energi ke zona yang rentan kesenjangan energi (seismik gap) ke wilayah Samudera lain. Misalnya Samudera Hindia, maka wilayah Indonesia akan merasakan suatu goncangan yang kuat, difaktorkan zona subduksi yang terdekat saling terpicu, berakhir pada kehancuran dan keremukan batuan yang menghimpun suatu tata ruang. Hal inilah menyebabkan relaksasi bumi belum berhenti di Pantai Barat Sumatera terutama di Provinsi Sumatera Barat. Terjadilah gempa kuat disertai tsunami ke daratan pantai Kepulauan Mentawai dengan pusat gempa di sebelah baratdaya pulau Pagai Selatan dengan kekuatan 7.2 Skala Richter dengan kedalaman 10 kilometer. Gempa yang cukup dangkal dan tidak mengherankan menghasilkan tsunami dan menewaskan lebih 120 jiwa. Kondisi geologi Kondisi geologi gempa di sekitar pulau Mentawai pasca gempa Sumatera Barat pada tahun 2007 dan 2009 masih terus melakukan penyesuaian dan deformasi kekuatan patahan di Mentawai juga masih dalam keadaan tidak stabil sejak terjadi gempa dahsyat Aceh-Andaman pada tahun 2004. Ini diperlihatkan intensitas pelepasan kekuatan energi seismik semakin meningkat. Tahun 2006 energi seismik yang dilepaskan sebesar 5.1 Skala Richter (SR), tahun 2007 ketika terjadi gempa Bengkulu, patahan Mentawai melepaskan energi ketegangan dengan kekuatan 5.3 SR. Tahun 2008 terjadi pelepasan energi gempa mencapai 5.5 SR dan tahun 2009 zona seismik melepaskan energi gempa 5.8 SR serta tahun 2010 dengan kekuatan 7.2 SR. Kondisi tatanan geologi tektonik Kepulauan Mentawai berada di daerah pertemuan dua lempeng yakni Lempeng Samudera Indo-Australia dan Lempeng Sunda. Lempeng Indo-Australia menabrak dan menunjam ke bawah Lempeng Benua Sunda dengan kecepatan relatif sebesar 7 cm per tahun. Penunjaman kebawah dari lempeng samudera dikarenakan oleh struktur

batuan yang lebih padat dibandingkan dengan lempeng benua. Bidang pertemuan dari dua lempeng ini disebut sebagai subduction interface (zona subduksi pertemuan perbatasan antar dua lempeng). Dalam sejarahnya, Mentawai dua kali mengalami gempa besar pada tahun 1797 berkekuatan 8.3 SR di Pulau Sipora dan gempa dengan kekuatan 8.5 SR tahun 1833 di Pulau Pagai. Diprediksi masih akan melepaskan energi gempa lebih keras daripada tahun ini karena kondisi anomali lempengan bumi masih melepaskan relaksasi ketegangan dan menjadikan Sumatera Barat masih terkoyak gempa. Khususnya Mentawai masih melepaskan energi gempa yang sangat mematikan disebabkan oleh beberapa faktor kondisi geologi. 1. Anomali medan stress di perbatasan pertemuan antar lempeng masih dalam kondisi labil, sehingga mengakibatkan terjadi pergeseran koordinat pulau-pulau oleh dampak pecahan

(Bersambung ke hal B 5)

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik

SUDUT BATUAH * Papan reklame di Medan semrawut - Walaupun semrawut tetap aman * Pemerintah masih mengkaji asuransi bencana - Sementara bencana tak bisa dikaji * Menkeu: Privatisasi BUMN untungkan pemerintah - Kita ini mana pernah rugi, untung terus, he...he...he


D Wak


Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Plt. Redaktur Opini: Dedi Sahputra. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba, H. Halim Hasan, Diurna Wantana (Sumatera Utara), T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), Nurkarim Nehe, Bustami Chie Pit, Sapriadi (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Balyan Kadir Nasution, Mohot Lubis, Sukri Falah Harahap (Padang Sidimpuan), Sori Parlah Harahap (Gunung Tua), Idaham Butarbutar, Syarif Ali Usman (Sibuhuan), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

 Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 


WASPADA Senin 1 Nopember 2010

Isu Tentang Soeharto

Modal Sosial SBY-Boediono

Oleh Rosihan Anwar


Oleh Prof Usman Pelly, PhD

ERS luarnegeri juga memberikan perhatian kepada isu yang diberitakan dalam pers Indonesia yaitu isu tentang Soeharto, soal usulan agar mantan presiden itu dianugerahi

gelar Pahlawan Nasional oleh pemerintah. Wartawan Aubrey Belford menulis dari Jakarta dalam suratkabar versi global The New York Times yaitu International Herald Tribune (22 Oktober 2010) tentang: “Diktator Indonesia memperoleh dukungan dalam pencalonan untuk Pahlawan Nasional”. Intro beritanya mengatakan: “Bagi jutaan orang, Soeharto, orang kuat militer yang memerintah Indonesia selama 32 tahun adalah seorang tyrant (orang yang lalim), seorang pencuri dan seorang pembunuh”. Akan tetapi, tulis Aubrey Belford, lebih 12 tahun dari lengsernya kekuasaannya dalam sebuah kebangkitan rakyat skala besar, dan dua tahun setelah meninggal dunia, tidak dihukum pada usia 86 tahun, suatu upaya sedang berjalan untuk menentukan kembali warisannya: sebagai Pahlawan Nasional. Media massa Indonesia dipenuhi dengan perdebatan sengit sejak hal itu timbul pada awal bulan Oktober 2010 bahwasanya nama Soeharto berhasil dimasukkan ke dalam sebuah daftar tiap tahunan dari Kementerian Sosial RI untuk ditambahkan kepada kumpulan resmi para pahlawan nasional dari Indonesia. Gerakan itu yang pada awalnya dilakukan oleh Bupati Karanganyer di Jawa Tengah di mana berada kuburan Soeharto telah membikin marah kalangan tokoh reformasi politik dan banyak orang biasa Indonesia yang melihat pemerintahan Soeharto sebagai suatu masa korupsi yang tidak terkendalikan dan zaman penindasan. Akan tetapi bagi banyak orang lain, termasuk ribuan orang Indonesia yang ikut bersembahyang Jumat memperingati 1000 hari meninggalnya Soeharto, gerakan tadi mengimbau nostalgia atau rindu dendam kembali ke suatu zaman ketertiban dan stabilitas yang kontras atau bertentangan dengan demokrasi morat-marit (messy democracy) sekarang ini. Semua ini meninggalkan sebuah bom politik kepada presiden Indonesia pertama yang langsung dipilih rakyat dalam suatu pemilu yaitu Susilo Bambang Yudhoyono yang harus memeriksa daftar singkat Kementerian Sosial tadi, sebelum diteruskan kepada sebuah komite pakar-pakar, kemudian menganugerahkan gelar Pahlawan Nasional tanggal 10 November 2010. “Ini adalah suatu penghinaan terhadap akal waras dan perikemnausiaan kata Fadjroel Rachman, seorang aktivis terkemuka yang pernah dipenjarakan selama tiga tahun oleh pemerintah Soeharto (ketika Fadjroel masih mahasiswa di ITB Bandung). “Tujuan reformasi adalah penggulingan, lengsernya Soeharto sebagai diktator, sebagai koruptor dan sebagai pelanggar hak-hak azasi manusia (HAM).” kata Fadjroel Rachman sambil merujuk kepada demo protes yang dipimpin oleh para mahasiswa tahun 1998, yang dipicu oleh krisis moneter dan ekonomi Asia, yang memaksakan mundurnya Presiden Soeharto dan program menyusul bagai reformasi demokratis. “Kami mendesak Susilo BambangYudhoyono tidak menjadikan Soeharto Pahlawan Nasional, atau kami harus menamakan SBY pengkhianat bagi reformasi” kata Fadjroel Rachman. SBY seorang mantan jenderal yang naik pangkat selama rezim Orde Baru Soeharto, sesuai benar dengan gaya publiknya yang berdiam diri, sampai sekarang belum belum mengindikasikan ke arah mana dia bersikap memihak. Presiden SBY melihat popularitasnya, meskipun masih tinggi telah merosot secara steady atau tetap, semenjak dia dipilih kembali untuk masa jabatan kedua tahun lalu. Protes-protes keras di seantero negeri dewasa ini, ketika diperingati satu tahun kabinet SBY-Boediono telah dikritik untuk sebagian lantaran kurangnya kemajuan mengenai reformasi yang dijanjikan di bidang seperti korupsi dalam lembaga-lembaga pemerintah. Memberi anugerah Pahlawan Nasional kepada Soeharto yang dipercaya telah menjarah bermilyar-milyar uang dari Negara, dan telah memenjarakan serta menghabisi jumlah besar lawan-lawannya, tidak akan meningkatkan kredensial reformasi Presiden SBY. Akan tetapi usulan menyatakan Soeharto sebagai Pahlawan Nasional mempunyai dukungan kuat. Minggu ini rapimnas partai Golkar, bekas kendaraan politik Soeharto dan kini merupakan anggota kunci koalisi dalam kabinet SBY, memberikan dukungannya kepada gerakan menjadikan Soeharto pahlawan. Sepanjang lintasan sistim partai politik Indonesia, elit bisnis dan lembaga-lembaga Negara, suatu generasi mantan loyalis yang setia kepada Soeharto, masih punya pengaruh dan kekuasaan. Komite yang bakal mengambil putusan final mengenai anugerah Pahlawan Nasional masih didominasi oleh bekas pejabat-pejabat zaman Soeharto. Menurut Akbar Tanjung seorang politisi senior dari partai Golkar, Soeharto layak untuk dihormati karena “telah menyelamatkan Indonesia sebagai suatu bangsa dan negara (nasion) dari kehancuran, sengketa dan krisis” dengan merebut kekuasaan menyusul adanya konon percobaan kudeta oleh golongan komunis pada tahun 1966. Paling tidak setengah juta orang yang dicurigai sebagai komunis telah dibantai dan dibunuh secara besar-besar di masa pasca G-30-S/PKI itu. (+++)

Dedi Sahputra


Wedhus Gembel Aku adalah lidah, kedua mata, sahabat karib,keridhaan dan kemarahanmu. Menyingkirlah jika dirimu tidak termasuk yang diseru. Jalaluddin Rumi menulis syair itu mungkin saja sedang bermetafora. Seruan itu bagi pemilik hati di dalam dada yang terjebak fana. Tuhan telah menyeru mereka, bahwa denganNya mereka mendengar dan melihat. Syair memang selalu begitu, tidak linier, multidimensi, dan kaya metafora. Maka kalau Anda selalu menggunakan logika linier untuk menerjemahkan setiap ucapan itu, Anda akan cepat terpeleset menafsirkannya. Tapi, pun Mbah Maridjan seperti itu. ”Kebutuhan orang itu, ya, ’rasa kekurangan’ itu. Meski diberi sebanyak apapun, manusia akan merasa kekurangan karena kekurangan itulah kebutuhan manusia,” kata abdi dalem keraton gelar Mas Penewu Suraksohargo itu. Merapi itu, bukan musuh. Wedhus gembel itu datang untuk membersihkan, menyuburkan, katanya suatu ketika. Seperti tsunami, lahar panas itu, juga wedhus gembel membersihkan apapun di sekitarnya, setiap yang dilaluinya; menyiraminya dan menaburinya dengan benihbenih baru. Ia juga menghentikan setiap pertengkaran, setiap kecurangan, setiap ketidaksenonohan dan setiap keangkaramurkaan. Orang yang diseru Rumi adalah orang yang melihat ini dengan kejelasan pandangan dan ketajaman hati. Mereka mendengar lautan dan gununggunung itu bertasbih. Tusabbihu lahus samaawaatussab’u wal ardu wa man fiihinn. Maka alur berpikir mereka tidak menggunakan rute ”jalan umum”, yang biasa dilintasi orang ramai. Ghuraba’. Si mbah yang semakin popular setelah kematiannya ini berpendapat bahwa setiap orang bertanggungjawab terhadap keselamatan dirinya sendiri. ”Kalau sudah merasa harus mengungsi, mengungsi saja. Jangan mengikuti orang bodoh yang tak pernah sekolah seperti saya ini,” katanya. Dia sendiri tetap berdiam, menyambut wedhus gembel dengan suka cita. *** Selain Almarhum Mbah Maridjan, satu lagi yang popular sejak peristiwa merapi itu adalah wedhus gembel. Ini adalah sebutan dari masyarakat Sleman terhadap awan putih kehitaman yang berarak-arak tebal menyerupai bulu wedhus atau kambing biribiri. Di Merapi, guguran lava menimbulkan awan panas yang terjadi setelah munculnya kubah lava. Tipe erupsi khas Merapi adalah

efusif, yaitu pembentukan kubah yang tidak stabil karena terdesak magma hingga akhirnya runtuh berupa guguran lava pijar dan awan panas. Dalam volume yang besar, material yang gugur itu berubah menjadi rock avalanche, ya., wedhus gembel itu. Ini awan panas yang bisa mencapai suhu lebih dari 700 derajat Celsius. Kecepatan luncuran wedhus gembel dari udara ke bumi bisa mencapai lebih dari 100 kilometer per jam. Maka sebelum dia datang, Anda harus menjauh untuk bisa selamat. Berdiam di tempat sama artinya bunuh diri. Sesakti apapun Anda, kulit Anda tidak lebih kuat dari wedhus gembel. Sekencang apapun Anda bisa berlari, tak akan menandingi kecepatan hujaman awan panas tersebut. *** Sejarah orang-orang besar selalu begitu. Mereka melihat yang tidak dilihat oleh orang kebanyakan. Mereka mendengar yang tidak didengar oleh orang kebanyakan. Mereka juga memiliki persepsi yang tidak selalu sama dengan orang kebanyakan pada suatu objek yang sama sebangun. Sayyid Qutb harus dihukum gantung untuk sebuah perjuangan dakwah yang dia yakini. Seperti Ibrahim as yang harus dibakar demi mengemban tugas kenabian. Ini suka cita para pejuang hebat meski seketika orang menyebutnya pengorbanan. Orang-orang hebat ini selalu saja menghadapi dan menghasilkan orang-orang yang berbeda. Ketika Haji Omar Said (HOS) Cokroaminoto menjadi mentor bagi Soekarno, Kartosuwiryo, dan Untung, kita kemudian menghadapi kenyataan berbeda. Pribadi Soekarno menjadi seorang nasionalis, Kartosuwiryo menjadi Muslim yang memiliki pandangan Islam yang sangat “kuat” dengan mendirikan NII, sedangkan Untung bergabung dan menjadi pentolan komunis. Mungkin begitu juga dengan Mbah Maridjan. Tidak sepenuhnya orang bisa mempersepsikan apa yang dia rasakan. Hingga 32 orang itu harus ikut menjadi korban wedhus gembel. Ternyata, untuk menjadi orang besar, tidak cukup bisa mendengar dan melihat saja tetapi juga harus punya toleransi, kebesaran hati, tidak egosentris yang ingin menikmati kebahagiaan itu sendirian saja bersama wedhus gembel.(vol.222)

Kolom foliopini dapat juga diakses melalui


Istilah ”kena-getah” dalam pencitraan SBY tidak dapat terhindarkan, seperti dalam peristiwa Bank Century, Cicak Buaya atau seperti isu illegal logging Papua


dalah Robert D.Putnam, seorang sosiolog kondang dari Harvard University (1963) yang pertama kali menemukan wacana yang memukau ekonom, politisi dan negarawan. Bahwa Modal Sosial (Social-Capital)merupakanprasyaratjatuh bangunnya sebuah komunitas atau negara-bangsa. Menurut Prof. Putnam, komponen utamayangdianggapsebagaimodalsosial itu adalah (1) jaringan sosial (social networking), (2) moral sosial (social morality), dan (3) kepercayaan masyarakat (social trust). Ketiga komponen ini secara fungsional satu sama lain saling berkaitan dan sinergetik dalam menghasilkan sebuah kinerja (perfomansi). Kuatnya jejaring sosial sebuah kelompok masyarakat akan menghasilkan tingkat moral yang tinggi (kepatuhan terhadap hukum) dan pada gilirannya akan menghasilkan tingkat kepercayaan (ligitimasi) yang kuat antar warga dan kelompok. Ambillah contoh yang sederhana, dalam masyarakat paguyuban Batak dikenal jejaring sosial ”Dalihan Natolu” (tiga tungku sepenjerangan). Kalau jaringan sosial kekeluargaan ini berjalan dengan baik, hula-hula (mora) menyayangi boru, sebaliknya boru menghormati hula-hula (mora)nya. Begitu juga hubungan antara dongan-sabutuha (kahanggi) dengan hula-hula (mora) dan boru baik, maka tidak ada kerja (horja) yang akan terbengkalai. Jejaringkerjayangrapihmenimbulkan ketaatan pada aturan dan hukum yang dibina. Inilah yang akan menmpilkan moral (rasa malu dan risih terhadap diri sendiri dan orang lain) kalau tidak berprestasi dalam kehidupan kelompok, dan karena itu pula akan tumbuh rasa saling mempercayai (trust). Dalam bidang ekonomi dan pembangunan, ketiga komponen ini merupakan modal atau kapital yang paling menentukan, apakah usaha dagang seseorang atau sekelompok orang akan berjaya atau jatuh tersungkur. Dapat dilihat umpamanya bisnis orang-orang keturunanTionghoadiIndonesiaataudiluarnegeri.Mereka sangatmemperhatikanketigamodalsosial ini,baikbisnisyangmasihdikelolakeluarga atau yang telah ”go-public.” Mereka dapat bertahan dan berkembang dengan pesat karena menghandalkan ketiga modal sosial ini. Oleh karena itu World Bank, sejak pertengahan tahun 1980 telah mempergunakan modal sosial ini sebagai prasyarat (indikator) untuk mempertimbangkan apakahsebuahkelompokmasyarakatatau negara pemohon bantuan dana (keuangan) akan dibantu atau tidak. Bagi World Bank, masyarakat atau negara yang tidak memiliki modal sosial yang tinggi, tidak akan pernah dipertimbangkan.

Karena mengucurkan uang (dana) kepada masyarakat atau negara yang tidak memiliki modal sosial yang tinggi, tidak ada gunanya, sama saja dengan membuang uang ke laut. Kecuali kalau proyek itu memang ditujukan untuk mengembalikan modal sosial yang telah rapuh atau lemah, karena berbagai peristiwa. Seperti Jepang setelah perang dunia kedua, Aceh dan Nias di Indonesia setelah tragedi tsunami.Perangdanmusibahsepertitsunami itutelahmenggoyahkansendi-sendimodal sosialyangada,sebabituperludanakhusus untuk rehabilitasi modal sosial mereka. Pemerintahan SBY-Boediono Adalah menarik untuk mencermati kinerja pemerintahan setahun priode kedua (KIB II) bagi Presiden SBY yang sekarang bergandengan dengan Budiono sebagai Wakil Presiden, dengan memakai tolok ukur modal sosial di atas. Litbang Kompas Senin dan Rabu tgl 18dan20Oktober 2010 yang lalu, berturut-turut menurunkanulasan mengenai kinerja pemerintahan SBY-Boediono, yang terus dirundung masalah, terutama dalam bidang Ekonomi, Politik Keamanan, Hukum dan Kesejahteraan Rakyat. Politik pencitraan SBY pada KIB I yang lalu,didukungolehmodalsosialyangtinggi, tetapi sekarang terasa hampa, karena ditengarai tidak didukung lagi oleh modal sosial yang kuat dari jajaran pemerintahannya, baik dipusat maupun di daerah. Citra politik SBY itu tidak hanya terpancar dari diri seorang presiden secara individual, tetapi adalah akumulasi sinergetik dari kenerja pemerintahan yang dipimpinnya secara keseluruhan. Rakyat ingin agar sukses KIB I itu diulang kembali oleh SBY. Sebab itu, dalam Pemilu dan Pilpres 2009 yang lalu, mereka juga tidak hirau kemana perginya nanti seorang Jusuf Kalla, Bakrie, Megawati, Golkar, atau PDI.Yang penting Demokrat/ SBY menang. Sebab itu, suara rakyat tumpah ruah kepada Demokrat dan SBY (bahkansemuayangbernomor39dijoblos, walaupunitunomorseorangcalonanggota DPD dari Sumatra Utara, bukan nomor Demokrat). Pada waktu KIB II mulai diluncurkan (Juli 2009) tingkat kepercayaan masyarakat masih mencapai titik tertinggi (83%), tetapi setahun kemudian tingkat ligitimasi itu turun drastis (51-56%). Menurut Bambang Setiawan dari Kompas (20 Oktober 2010), penurunan ini seiring dengan merosotnya citra SBY yang pernah mencapai 94,3%

(Juli 2009) menjadi 67,8% (Oktober 2010). Penurunan citra pribadi presiden SBY telah berimbas pada ”menurunnya kepuasan terhadap kepemimpinannya dalam kabinet dan preferensi pilihan publik terhadapnya.” Tiga bulan yang lalu kepuasan terhadap kepemimpinannya masih berkisar 62,3% sekarang tinggal 44,3%, jika pemilu tahun yang lalu SBY masih mampu meraih 82,6%, tetapi kalau hari ini dilansungkan pemilu itu SBY (Demokrat) diprediksikan hanya akan kebagian 34,2%. Kontek modal sosial Modal sosial yang telah dimiliki oleh SBY sebagai buah sukses pada KIB I (20042009) kelihatannya tidak berlanjut pada KIB II. Jejaring sosial yang terbentuk dalam kabinet,antaraSBY-JKdenganparamenteri dan pejabat tinggi negara (sipil, kepolisian dan militer) serta tokoh-tokoh partai politik baik di lembaga legeslatif yang cukup baik. BegitujugaantaraPresidendanparagubernur di daerah kelihatannya agak berantakan. Sekarang orang sehari-hari dapat menonton kekacauan jejaring sosial antara presiden dan anggota kabinet yang cukup merisaukan.Bahkanmenuaidampak yang memalukan. Ambilah contoh hubungan komunikasi simbolik antara PresidendanJaksa Agung dalam menyelamatkanCitraBPK dalam kasus Bibit-Chandra. Presiden telah mengisaratkan agar dilakukan ”diponering,” yang merupakan hak (diskresi) Jaksa Agung.Tetapi apa yang terjadi, Jaksa Agung memilih alternatif lain yang menyebabkan Anggodo dapat dengan mudah mendepak Bibit-Chandra kembali sebagai tersangka ”abused power” dan pemerasan. Kemarin sewaktu presiden mengunjungi Wasior Papua Barat, daerah yang didera bencana dahsyat, Menteri Kehutanan dengan bersemangat mengatakan bahwa bencana itu disebabkan oleh penebangan liar (illegal logging). Tetapi hampir dalam waktu yang bersamaan, dengan segala keteguhan hati, Presiden SBY membantah telak keterangan Menteri Kehutannya itu. Sang menteri merasa kelimpungan sendiri dan buru-buru meralat hipotesa tunggalnya tadi. Begitu juga miskomunikasi terjadi antara pusat dan daerah-daerah otonomi. Seperti dinyatakan oleh Mendagri, ribuan Perda (Peraturan Daerah) sekarang harus direvisi atau dibatalkan. Karena Perdaperda itu telah menabrak undang-undang atau peraturan pemerintah pusat yang hirakinyalebihtinggi.Semuainimenunjukkan betapa lemahnya jejaring sosial yang dililiki SBY. Sebagai modal sosial pertama yangpentinguntukmenumbuhkanmodal sosial kedua yaitu sosial morality. Orang sekarang nampaknya tidak merasa malu atau risih kalau digiring kepengadilan, apakah dia seorang pejabat, politisi, penegak hukum, pakar hukum,

artis atau ulama/pendeta. Mungkin pula suatu kebetulan, banyak orang-orang seperti ini sangat dekat dengan kehidupan SBY pribadi. Dalam budaya Timur yang religius, sukar orang tidak mengaitkan tragedi orang dekat SBY yang melakukan tindakan tercela tersebut dengan Citra SBY sendiri. Istilah ”kena-getah” dalam pencitraan SBY tidak dapat terhindarkan, seperti dalamperistiwaBankCentury,CicakBuaya atau seperti isu illegal logging Papua yang dikait-kaitkan dengan orang dalam SBY. Secara moral SBY tidak dapat mengelak, apalagi dalam peristiwa-peristiwa seperti itu SBY ragu-ragu untuk bertindak tegas. Dalam budaya Jepang umpamanya, kalau terjadi peristiwa seperti yang dialami oleh Jaksa Agung atau Menteri Kehutanan tersebut,sebagaikonsekuensimoral,kedua orangituminimaltelahsegeramengajukan permohonan berhenti atau harakiri (bunuh-diri). Karena itu, di negara sakura, bunuhdirisebagaikonsekuensipertanggungjawaban moral seseorang, disebut ”honorable-death” (mati terhormat). TetapidalamkasusSBYiniyangterjadi, seperti orang-orang panjat pinang dalam perayaan 17 Agustus, satu sama lain melorotkan menarik pemanjat yang di atasnya. Maka dalam keadaan di mana jejaring sosial yang lemah dan moral sosial yang rendah, bagaimana SBY dapat mengharapkan”trust”(kepercayaanatauligitimasi) rakyat yang tinggi untuk dirinya dan pemerintahan yang dipimpinnya. Bagaimana empat tahun ke depan, bagaimana mengemblikan modal sosial yang telah berantakan itu? Apa yang harus dilakukan? Pertama adalah memperbaiki jejaring sosial, antar pribadi dan lembaga, baik dipusat maupun di daerah. Jangan ada kontradiksipernyataandanperbuatan,semua harus konsisten, umpamanya kepada kebijakan ”main stream” pro-pertumbuhan (pro-growth), pro-pemberantasan kemiskinan(pro-poor),danpropenciptaan lapangan kerja (pro-job). Kalau ada menteri atau pejabat sipil atau militer yang tidak setuju dengan kebijakan ”mainstream” yang telah digariskanpresiden,sebaiknyaangkatkakiatau mundursaja,tidakperluberdalihlupaatau salah faham. Rakyat tidak butuh pembelaan(apologi)sepertiitu.DanPresidenharus tega untuk segera menindaknya. Memang ada usaha SBY untuk merangkul kekuatan PDI atau yang masih berada diluar kabinet. Namun, kalau kabinet terlalu gemuk, hal ini menyulitkan kontrol dan koordinasi. Rasanya lebih penting membangun komunikasi yang sehatantarapemerintahdanoposisisecara elegan dan rasional. Dari jejaring yang kukuh dan sehat ini akan lahir kembali ketaatan kepada peraturan dan hukum, sehingga moral sosial (social morality) dapat tampil pada setiap orang atau kelompok. Dari sinilah ”trust” (ligitimasi) dapat dibina kembali, dan citra politik akan dapat berkembang dengan wajar. Insya Allah! Penulis adalah Antropolog Unimed


ress release Kejaksaan Tinggi Sumatera Utara (Kejatisu) dua pekan lalu menyatakan sedang menjadwal melakukan eksekusi fisik atas putusan MA No 2642 K-PID/ 2006 tanggal 12 Februari 2007 atas nama DL Sitorus. Ada belasan ribu masyarakat adat Padang Lawas yang terkait langsung dengan objek perkara yang akan dieksekusi fisik tersebut. Padahal putusan MA No 2642 tersebut telah tuntas dieksekusi. Yakni, hukuman pokok penjara 8 tahun, denda Rp 5 miliar telah selesai dijalani, dan barang bukti perkebunan kelapa sawit seluas 47 ribu hektar, telah dieksekusi Kejatisu pada 26 Agustus 2009 dan telah diserahkan kepada Departemen Kehutanan (Dephut) — (sesuai bunyi amar putusan) — melalui Kepala Dinas Kehutanan Sumut. Barang bukti (objek perkara) tersebut selanjutnya telah menjadi urusan Dephut. Sampai di sini, eksekusi putusan MA No 2642 sudah tuntas dan tugas Kejatisu selaku eksekutor pun selesai. Sesuai hukum, apabila eksekusi telah dilaksanakan maka eksekusi tidak bisa dilakukan kedua kalinya untuk satu objek perkara. Karena pada prinsipnya, eksekusi harus dilaksanakan riil dan tuntas. Lalu mengapa dijadwal lagi eksekusi berupa eksekusi fisik? Jika pihak Kejatisu “memaksakan” dilaksanakan eksekusi kedua kalinya berupa eksekusi fisik, maka hal itu lebih kepada proses “kekuasaan”, bukan demi hukum.“Jika hal itu yang terjadi, maka sampai titik darah penghabisan

kami akan pertahankan tanah adat kami ini, “ kata Raja Asli Hasibuan, salah seorang tokoh adat Padang Lawas dari Luhat (komunitas) Ujung Batu. Raja Asli salah satu Raja dari 8 Raja di 8 Luhat di Padang Lawas tersebut. Masyarakat adat telah menggugat perdata Kejaksaan atas pelaksanaan eksekusi 26 Agustus 2009. Dan sampai kini gugatan masih di periksa di PN Sidimpuan. Sebelumnya, gugatan perdata mereka terhadap Kejaksaan atas pelaksanaan eksekusi Letak Sita terhadap objek perkara tersebut pada 22 November 2005 (untuk kelengkapan berkas pidana an DL Sitorus) dikabulkan pada 19 Desember 2007. PN Sidimpuan menyatakan eksekusi Letak Sita itu tidak sah dan tidak berdasar hukum. Masyarakat adat adalah pemilik satu-satunya yang berhak atas objek perkara tersebut. Putusan PN tersebut diperkuat oleh PT Medan pada 19 Agustus 2008 dan di tingkat MA masih diperiksa. Perlawanan hukum lain terhadap eksekusi putusan MA No 2642 pada 26 Agustus 2009, muncul dari Koperasi Perkebunan Kelapa Sawit Bukit Harapan (KPKS) selaku pengelola lahan objek perkara tersebut. Berdasarkan Putusan MA TUN No 134K/TUN/2007 tanggal 19 Juni 2007, KPKS dinyatakan sah sebagai pengelola lahan tersebut berdasarkan Izin Menhut Nomor 1680 tertanggal 26 September 2002 sampai 2027. Ketua PTUN Jakarta, Yodi Martono Wahyunadi SH, MH, selaku pengawas

pelaksanaan putusan TUN yang inkracht telah dua kali melayangkan surat kepada Menhut (30 Juni 2010, 19 Agustus 2010) menegaskan bahwa KPKS telah memperoleh kekuatan hukum tetap atas objek perkara berdasarkan Izin Menhut No 1680 tanggal 26 September 2002. Untuk itu, Ketua PTUN meminta Menhut melaksanakan putusan TUN tersebut. Bahwa putusan TUN yang inckracht memiliki kekuatan mengikat yang bersifat hukum publik dan karena itu berlaku juga bagi pihak-pihak diluar yang bersengketa (asas Erga Omnes), sehingga Menhut tetap tunduk dan terikat untuk menghargai Izin prinsip pengelolaan perkebunan yang telah diberikan kepada KPKS sampai dengan tahun 2027. Untuk itu Menhut tidak bisa lain harus konsekuen dan konsisten pada Surat No 1680/ Menhut-III/2002 tersebut. Asas kepastian hukum tidak memperbolehkan suatu Badan/Pejabat TUN menarik kembali atau mengubah ketetapan (beschiking) untuk kerugian pihak yang berkepentingan, apalagi menghilangkan hak yang telah diperolehnya secara sah menurut hukum. KPKS telah memiliki hak pengelolaan terlebih dahulu sebelum adanya putusan pidana DL Sitorus. Bahkan hak itu telah diuji di PTUN sampai tingkat PK dan inckracht. Dengan demikian, Kejatisu telah keliru dalam menerapkan eksekusi terhadap objek perkara pada eksekusi 26 Agustus 2009. Bahwa objek perkara yang dieksekusi ketika itu adalah lahan yang dikelola KPKS secara sah sesuai Izin Menhut dan dimiliki masyarakat adat berSHM. Jika kekeliruan eksekusi itu diulang kembali dengan label eksekusi fisik, maka kekeliruan menjadi berlipat. Karena pada prinsipnya, eksekusi tidak boleh dilakukan dua kali. Dengan fakta-fakta: bahwa objek perkara putusan MA No 2642 milik masyarakat adat,


transfer medan stress energi ke Pagai Selatan. 2. Energi yang dilepaskan sebenarnya masih tersimpan besar. Kondisi ini mengingatkan pada kejadian gempa Aceh-Andaman pada tahun 2004. Sebelum terjadi bencana besar itu ada gempagempa pendahuluan yang cukup kuat di mulai pada gempa Bengkulu tahun 2000, lalu 2002 di Simeulue dan puncaknya tahun 2004 gempa Aceh. Energi

gempa Bengkulu telah melepaskan energi yang kuat sebanyak 3 kali kejadian gempa setelah gempa Aceh, sedangkan gempa Mentawai baru sepotong-sepotong, dan mungkin energi di Pagai Selatan ini sedang mendorong ke utara dimana juga terdapat patahan gempa, diperkirakan masih ada energi yang lebih dahsyat sebelum tahun 2033 atau sekitar 23 tahun lagi. Mentawai kini telah terkoyak, Suma-

Oleh Sarluhut Napitupulu Sesuai hukum, apabila eksekusi telah dilaksanakan maka eksekusi tidak bisa dilakukan kedua kalinya untuk satu objek perkara


(Lanjutan dari hal B 4) lempengan Aceh-Andaman yang menggeserkan kerak bumi sejauh 40 cm. Dalam sepuluh tahun dan merupakan salah satu sumber utama akan penyebab bencana gempa-gempa dalam enam tahun terakhir dengan fokus pendahuluan pada gempa Bengkulu dengan

diperkuat dengan bukti SHM, kemudian hak pengelolaan objek perkara adalah KPKS sesuai izin Menhut sampai tahun 2027, maka kita semua tidak mau melihat adanya benturan-benturan di lapangan yang bersifat fisik, yang dapat menimbulkan gejolak sosial dan terganggunya kondusifitas di Sumut. Kita juga tidak mau terjadi frustasi hukum di pihak rakyat akibat tidak adanya kepastian dan perlindungan hukum terhadap hak-hak mereka. Sekarang ini, masyarakat sensitif dan frustasi hukum akibat terkuaknya skandal mafia hukum yang melibatkan aparat kepolisian, kejaksaan dan hakim. Dalam konteks ini, masyarakat adat Padang Lawas hanya tahu bahwa kasus pidana DL Sitorus sudah selesai. Tapi jika putusan ini digunakan untuk merampas hak adat mereka dan mata pencaharian masyarakat adat Padang Lawas, dan perampasan tersebut bertujuan diberikan kepada pihak ketiga, baik Inhutani maupun swasta, maka kebijakan itu potensial menimbulkan konflik sosial. Maka, sikap aparat penegak hukum yang mengabaikan putusan TUN, mengabaikan SHM dan hak-hak perdata masyarakat adat yang sudah dikuatkan olehputusanPerdata,menegaskanbahwa sikap itu tak menghargai dirinya sendiri. Karena putusan TUN, buku tanah SHM danbukti-buktilainnya, bukankahproduk dari aparat penegak hukum sendiri ? Kedudukan putusan Pidana dan putusan PTUN sama-sama putusan yang bersifathukumpublik,mengikatbagisiapa saja. Dalam hal ini, proses Pidana sudah dijalani dan sudah selesai di eksekusi. Sementara putusan PTUN itu sampai kini belum “dieksekusi”. Untuk itu, demi kepastian hukum, semua pihak haruslah tunduk kepada putusan publik yang telah berkekuatan hukum tetap.

tera Barat berkabung lagi, dan dipastikan dimasa mendatang deformasi siklus gempa di Pantai Barat Sumatera akan berlangsung cepat dan akan selalu ada gempa beruntun berlangsung. Kita sudah harus mempersiapkan diri, teknologi dini dan tata ruang yang berketahanan bencana serta berbasis masyarakat.

Penulis adalah Sekretaris Lembaga Peduli Hutan Indonesia

Penulis adalah Geolog, Pemerhati Masalah Lingkungan dan Geosfer

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM 4 CM


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

GEBYAR PENUH PROMO DAIHATSU Xenia DP 9 Jt-an, New Terios DP 13 Jt-an, Pick Up DP 7 Jt-an, Luxio DP 8 Jt-an. Ready Stock, Data bisa dicepat, Proses Cepat & Service Memuaskan. Hub. IRNANDA 0813 7580 2895 / 061.6995 0232 “BAWA PULANG DAIHATSU BARU ANDA SEKARANG !!! Xenia Hanya DP 11 Jt-an Angsuran 2 Jt-an Terios DP 15 Jt-an ansuran 4 Jt-an Grand Max Pick Up, DP 7 Jt-an angsuran 2 Jt-an, dll. Proses Mudah dan dijemput 24 jam stand by. Pemesanan Hub. MANDA ASTRA- DAIHATSU. SM. Raja Medan. HP. 0812 6316 330 / (061) 6647 0080

New Xenia VVTI...........DP 10 Jt-an New Terios.....................DP 13 Jt-an New Gran Max MB......DP 11 Jt-an Hub. TIAN 0852 6187 0877 / 77399677 # DAIHATSU 100% BARU #

Xenia...DP mulai 12 Jt-an......Angs. 3Jt-an Terios....DP mulai 14Jt-an......Angs. 4 Jt-an Luxio....DP Mulai 11 Jt-an......Angs. 4 Jt-an Hub. JOSUA. 0812 6311 0820 / 061-77004944


Silver Balik DP 30Jt. Angsrn: 3.460.000Jt Sisa Cicilan 37 bln. Mobil Msh Baru. Peminat Hub. HP. 0812 605 7140 0882 6151 2546

FORD Everest 4x4 Thn. 2005 Biru met, BK Mdn, Pajak baru. Ban Baru, Original. Hub. 0815 3182 818 HONDA Civic Wonder 86 Merah Maron, Original 25 Jt Hyundai/Cakra 97 Hitam. Mobil cantik 45 Jt. Hub. 0812 650 7716

HONDA Civic Wonder ‘84 Merah. 22 Jt Komp. TNI-AU. Kr. Sari I No. 98. HP. 0852 6134 0601 - 0812 6335 8191

HONDA Odyssey A/T Thn. 97. Hitam. BK Mdn Mutasi. Hub. 0813 7508 8798 HONDA Accord VTIL M/T Thn. 99 Coklat muda met, BK Mdn. Hub. 0812 6594 2789 HONDA Green Civic ‘88 Lengkap, warna hijau metalic. BR, Baru, Harga 28Jt/Nego. Kijang Pick Up 96/97, BK Ranto. Harga 50Jt/Nego. Hub. 0811 645684

HONDA Genio Warna Hijau, Thn. 1992 Dijual. Telp. 0813 7638 1744 HONDA Jazz Thn. ‘04. Warna hitam metalik IDSI. Mobil mulus. Hrg. 125 Nego. Hub. 061.7629 8075 sangat mulus HYUNDAI Atoz Thn. 04, Manual warna merah metalik. Hrg. 77 Jt Nego. Mobil sangat mulus. Hub. 08788889151

ISUZU Panther LS A/T Thn. 2001. Coklat met, BK Mdn Rp. 99 Jt. Hub. 9132 7433 ISUZU Panther Hi-Sporty ‘97 Hijau Solid. DP 23 Jt. Angs. 2,1Jt. Suzuki Esteem 1,6 ‘96. AC, PS, PW, CL, Jok. SM. Kulit. DP 13 Jt. Angs. 1,3Jt. Hub. 76700976 - 0813 7676 2198

MITSUBISHI Kuda Diamond Diesel Thn. 2003 Merah Maron Met BK Rp. 107 Jt. Hub. 7786 3981 MITSUBISHI Colt Diesel Truck Th. ‘05 PS.120. Bak Tinggi Mobil sehat, siap pakai Rp. 155Jt. 0813 9682 8808

Rp. 36.000 Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000

OPEL BLAZER MONTERA Thn. 2001 Silver, BK Mdn Rp. 59Jt. Hub. 0816 3113953 SUZUKI Carry 1997 DIJUAL 1,3 Realvan. Silver. Hub. 0813 7644 6612

SUZUKI Baleno Thn. ‘01. Warna biru metalik. Hrg. 83Jt Nego. Mobil sangat mulus. Hub. 7752 6833 TOYOTA Kijang Kapsul SX, Th. 98. W. biru, BK Medan asli, AC, Tape, V. Racing, mulus. H. 81Jt/damai. Hub. 0813 7007 5355


AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. DP 21 Jt-an. Hub. 0813 7512 7297 - (061) 7795 1428

TOYOTA Soluna XLi 2002 BK Mdn asli, Silver, AC, TP, CD, MP3, Jok kulit, mulus, VS, BR, PS, DP 20 Jt. Angs. 2,3xxRb. Hub. 061.76700976 - 0813 7676 2198 TOYOTA Kijang Krista 1,8cc Thn. 97 Akhir. BK Mdn. W. biru, Silver, AC DB, Tape, CD Remote, CL, BR, Spion miror, Velg Racing, Import mulus, original body kaleng BU. Hub. HP. 0813 9795 1579 Mdn.

JUAL CEPAT . T OYOTA Fortuner 2.7 GLUX 2006. Silver metalic. Kondisi baik, mulus. Hub. 0811 625455 TOYOTA Kijang Capsul SGX Thn. 2000. Komplit. VR 16 Ban Baru, Tape/Radio-CD. MP. 3. Kondisi siap pakai. Hrg. Nego. Hub. 0 6 1 6611563. HP. 0813 6142 4249

TOYOTA Kijang Krista Thn. ‘00, Diesel warna Biru mica. Mobil sangat mulus. Hrg. Rp. 125Jt Nego. Hub. 0812 65373580 # TOYOTA BARU #

Ready: Avanza, Innova, Fortuner, Rush, Yaris, Vios. Bersedia Tukar Tambah dengan mobil lama Anda. Proses Cepat Data Diambil. Hub.: TOMMY 0813 7043 7766 - (061) 7650 4588

TOYOTA Corolla Altis (G) M/T Thn. 2002. Hitam, BK Mdn Rp. 127Jt. Hub. 91144382 TOYOTA Avanza Th. 2004 G. W. Silver. Mbl BK Mdn Mulus. HP. 061.77756099 - 0813 6212 2339 TOYOTA Starlet Capsul 1,3 Thn. ‘93 SEG. Merah Maron, BK Asli Mdn, BR, VR, AC, DVD, PW, CL. Hub. 0815 3015 781 / 0812 6065 020




Jaminan Apa Saja, Sertifikat Tanah. Spd. Motor, Take Over Mobil. Hub. 061-8222774, HP. 0816 314 1807

DANA EXPRESS SHM, SK Camat 1 Hari Clear 0813 6229 0001 0812 6095 5531 (Henrik) BUTUH DANA CEPAT

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633

7 CM 8 CM

Rp. 91.000 Rp. 104.000

9 CM Rp. 126.000 10 CM Rp. 140.000


11 CM Rp. 165.000 12 CM Rp. 180.000

Pelanggan Terhormat

RENTAL MOBIL AVP/ARENA/LUXIO + SUPIR = Rp. 265.000,AVANZA/XENIA/LGX + SUPIR = Rp.290.000,INNOVA/YARIS + SUPIR = Rp. 335.000,NEW ALL CRV/FORTUNER + SUPIR = Rp. 450.000,SEDAN KALOS (MEWAH)/VIOS + SUPIR = Rp. 345.000,HUB. 207 JAYA GROUP - MEDAN HP.: 0852 6222 3760 (Yanti)/0812 6404 5050 (S. Simanjuntak) Note: * Tersedia Mobil Lain, dan Bersedia Dalam/ Luar Kota (Termurah) * Tersedia Paket Lengkap (Mobil + BBM + Supir + Bonus + Nego)

Sebaiknya berjual beli secara langsung bertemu Hindari bertransaksi melalui ATM

RENTAL MOBIL MURAH Rp. 250.000/Hari Mobil: Avanza, Xenia. HP. 061.66477734, 0813 9779 1077 Maaf TP.




- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954



ADHIKA COMP COMP.. M. Idris 23. 4150371-77426432 10 SET INTEL PIV DUO CORE 1,8GHZ Hanya 2.800.000 10 SET AMD ATLON X2 Hanya 2.850.000

Ram 1 gb, Casing USB, Hd 160gb, Key, Mou, Headset, LCD 15,6” ACER BONUS: Instalasi Jaringan, Games Online - Offline, Billing, Switch





AC 1/2/1Pk: 1,3Jt, 1 1/2 Pk: 2 Jt, 1 Pk Baru: 2,3Jt, Kulkas 1 Pt: 600rb, 2Pt 900rd, 2 Pt. Jumbo: 1,8Jt. Kulkas Box 6 Rak Show case: 1,7Jt 5 Rak Freezer: 1,2Jt. M. Cuci 1 Tb, 2 Tb: 900rb. TV 14”/21” 300rb /d 700rb 29”, 1,2Jt. 21” LCD Monitor 1.7Jt. LCD Sony Projection = 5,5Jt. 32” LCD 32” Sharp Acuos=3,3Jt. PS 1: 400rb, PS 2: 800rb, PS HD: 1,4Jt. dll. Handicam Sony, JVC, Mini DV: 1,5Jt, DVD: 2Jt, Camera 5 Mp s/d 10 Mp: 500rb s/d 1,3Jt. Laptop P3: 1,5Jt. P4=2JT. Projector Toshiba=3Jt. Fax: 500rb, Printer: 450rb , Tape, Ampli, Speaker, dll. (Jual/Beli) Hub. UD. Senang Hati: 4517509 -77073637 Jl. Sekip 67 A




WASPADA Tempat Iklan Anda





- Mengeluarkan Aura (Cahaya Wajah) - Memperindah Wajah - Memutihkan Kulit Wajah - Mengencangkan kulit - Mengatasi jerawat/ flek-flek hitam - Mengatasi penyakit kulit - Menggunakan Cream Sarang Burung Walet



Bireun/ Aceh Jl. Asrama Putri No. 16 Kp. Baru (0644) 324922


TRANSFER DVD-VCD Dari VHS, Mini DV, Hi-8, Betamax, Laserdisc, Kaset Tape. Shooting & Foto Resepsi, Ultah, Candid, Pre-Wed, Profile Kharisma Studio Jl. Mahkamah Tel. 7364845-77112200


HILANG/TERCECER TERCECER 1 (Satu) Buah BPKB No. Pol. BK 1756 SA a/n. SAHYAN ARITONANG, SH. Komplek Palm Mas I No. 12 Medan. TERCECER BPKB Spd. Motor Yamaha BK 2006 HS a/n. ASRIZA PULUNGAN Jl. Pukat II No. 47 Banten Timur Mdn Tembung. No. Rangka: MH 33 KA 0081 K464354. No. Mesin: 3 KA-438494


- BPKB & STNK Soluna BK 1997 BN a.n. TAN TING ENG - BPKB & STNK Panther PU BK 9912 BP an. ZAM ZAMI MR - BPKB & STNK T120SS PU BK 9518 CA an. MAD KUSNI - BPKB & STNK Carry PU BK 9982 BT An. IBNU FAISAL - BPKB Katana BK 821 LK an. MOHAMAD HEKKI - BPKB Rocky BK 219 EN an. OCI SOCI HOA - BPKB Starlet BK 1846 AK an. ANDRINI FEBRIANA - BPKB Jimny BK 1917 AK an. ASWIN RIANTO - BPKB Jeep Mercy BK 212 KJ an. AKP. HENRY SINAGA. Disekitar Jl. SM. Raja Sp. Limun - Amplas Medan Hub. 0812 659 1310


Telah hilang surat tanah atas nama Ny. AB. Hutapea Tianna br. Simanjuntak, yang terletak di Jl. Ngalengko Lr. Toba No. 13 Lingkungan II Kelurahan Sidorame Barat II Kec. Medan Perjuangan, yang TELAH DIBELI oleh Sihar Hutagaol. Bagi yang menemukan harap hubungi Sihar Hutagaol Jl. Ngalengko Lr. Toba No. 39 Lingkungan II Kelurahan Sidorame Barat II Kec. Medan Perjuangan HP. 0813 6125 7889. Akan diberikan IMBALAN yang sepantasnya dan tidak akan dituntut.







AC, KULKAS, MESIN CUCI B. Pasang, Instalasi, Cuci, Spare Part 061.76764660 “ 0812 6557 521


1 . UNTUK PRIA : Alat vital loyo, pendek, kecil/tidak berfungsi/impoten total. Kurang kuat keras, plekcur (ejakulasi dini), letoy, tidak tahan lama, bahkan disepelekan pasangan jangan kuatir. Ingin joss, datang dan buktikan disini.




SINSHE Ahli penyakit dalam dan penyakit lever

CHONG I MIN Toko obat “Makmur Raya” Jl. Surabaya No. 75 Toko Obat “BOGOR” Jl. Bogor No. 69 Jam 09.00 - 12.00 17.00 - 18.00 WIB

WASIR/ AMBEIEN Garansi 10 Hari Sembuh Tanpa Operasi Hubungi Spesialist Wasir


Jl. Brigjend. Katamso No. 683C Medan ( ± 50m dari Simpang Pelangi) HP. 0852.9751.4253 - 0812.6050.0881

2. UNTUK TERAPI WANITA (Berdarah Seperti Perawan) : Mengembalikan keperawanan (virgin), hasil bisa dicek ke dokter, menghilangkan keputihan, becek, bau tidak sedap, ingin mencengkram/wangi, buktikan disini (Bergaransi) Mengatasi penyakit yang secara medis tidak dapat disembukan antara lain : · Kelainan sex, homo sex, lesbi,gysex · Gangguan jiwa/mental. Kegelisahan, gila Kurang percaya diri, stress berat, suka marah · Suka cemas, kecanduan narkoba, dll JL. SM. RAJA Samping UISU masuk JL. SEMPURNA 300M NO. 49 MEDAN DIBUKA DISIANTAR: Jl. Medan No. 35 Depan Bakso Deli 2 HP. 0812.6827.7999



Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333



Banda Aceh: Jl. Kuta Alam No. 18 Dpn RS Kesdam





- Merapatkan vagina untuk keharmonisan suami-istri - Mengatasi keputihan - Mengobati infeksi rahim/ kanker rahim/ kista

- Melancarkan saluran pernafasan PERAWATAN TUBUH m e m b u a n g l e n d i r- l e n d i r y a n g -Melangsingkan Badan mengandung virus dan membersihkan nicotin, Memerdukan suara -Menaikkan Berat Badan -Mengencangkan Payudara - Keharmonisan Suami/ Istri - Sinusitis MEMPERINDAH WAJAH - Alergi / Asma BUKA SETIAP HARI - Memancungkan Hidung - Penghasihan DARI JAM 09.00 S/D - Membentuk Dagu - Pelaris 20.00 WIB - Membentuk Bibir DENGAN IZIN ALLAH, KAMI INSYA ALLAH SIAP MENGOBATI?: Amandel, Polip tanpa operasi, Kanker payudara, Ginjal, Masalah keturunan, refleksi kaki / badan. Nomor Izin Dinkes: 448/3327/VI/2004 Buka Praktek di Medan: Jl. Puri Ujung No. 206 Simp. Ismaliyah

Kejari : No.B.78/N.4.3/DSP.4/12/2008


Kami Sediakan Lembu Qurban dengan kwalitas terbaik dan harga bersaing. Hubungi alamat kami: Jalan Setia Budi No. 240. Telp. (061) 8214513. HP. 0821.6523.0248

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HUBUNGI: JL. TITIPAPAN GG. PERTAHANAN NO. 10 SEI SIKAMBING MEDAN TELP. 457.6116 - 451.2319 HP. 0813.6137.2321 - 0819.3335.4444

Lebih Jelas hubungi kami di 061- 457 6602 Terimakasih

JUAL Timbangan Mobil, Timb. Ternak, Timb. Mas. Laboratory. Hub. Telp. 0852 70000 408 - 061.76487701 Harga Terjangkau.


IKLAN KHUSUS 6x1,5 kolom Rp. 120.000


Senin, 1 November 2010


ASLI BANTEN MELAYANI KELUHAN PRIA & WANITA, seperti: 1. Lemah syahwat, impoten, ejakulasi dini, kurang gairah, ereksi, mati rasa, mati total, mandul, dll, metode pengobatan Ramuan khusus & Do’a di patenkan pengobatan yg benar² alami tanpa bedah, pakum/ silikon yg dewasa ini ber resiko tinggi, bebas pantangan ras agama Pengasihan, pelaris, cepat dapat jodoh Alamat praktek: Jl. SM. Raja masuk Jl. Amaliun masuk Jl. Laksana No. 69, Izin Kejari B22/DSP.101/2009 HP. 0821.6656.4532

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda





Ciri2 Ambeyen: Disekeliling Dubur Ada Benjolan Seperti Daging Tumbuh/Jerawat, Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur Seperti Luka, Solusinya Datang dan Berobatlah ke


Jl. Prof. H.M. Yamin S.H No. 251 A Simpang Pahlawan Tel.(061) 4563067 Cabang I

Jl. Bunga Harum (Benteng) No. 26 Suka Jadi Telp. 0761-45368 -HP. 0812 6568 700 Pekan Baru Telp. (0761) 45368 HP. 0812.656.8700 Cabang II: Komp. Perhub. Laut Jl. Baruna II/II Telp. 0765 36906 HP. 0852 6201 0594, 0812 60311 695 Dumai

SPECIALIST MATA TANPA OPERASI Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll

Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan sampai tuntas, Insya Allah Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar web: ffaridar aridar aridara


Mengobati segala macam penyakit Medis, Non Medis, serta penyakit kronis seperti: Stroke, hipertensi, kanker, gula, asam urat, tumor, mangenitis, hepatitis, lever, dll Juga menawarkan Terapi Totok: - Khusus penderita ketergantungan obat/ Narkoba - Khusus masalah pria/ wanita (vitalitas) - Pelangsing, menurunkan berat badan 5 s/d 8 Kg selama 2 bln Sudah Terbukti dan berada d seluruh Sumatera dan Jawa Alamat Praktek: Jl. Pasar III Krakatau Gg. Mulia No. 14B Glugur Darat Medan HP. 0821.6020.9118 IZIN DINKES NO. 440/ 7664/VII/06 IZIN KEJATISU NO. B-224/DSP.5/12/04

PRAKTEK MULAI DARI JAM: 07.00 WIB s/d 14.00 WIB (setiap hari kerja, kecuali hari libur) Dapat dipanggil kerumah, diluar jam praktek

Ingin Promosikan Produk Anda


WASPADA Media yang Tepat untuk Iklan Anda


Mobil PROTON EXORA SUPREME Type 1,6 L A/T High Line

Hub. 0813 7616 7637 BUNGA O % atau



Hubungi Dealer



JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN


Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481

Pengobatan Alat Vital H. Suhendar

Pengobatan Alat Vital H. Suhendar

Besar dan panjang di tempat Tidak ada hasil, Mahar kembali Ditangani secara profesional Alami bukan suntik, menggunakan metode terapi dan ramuan tradisional, Paling aman tidak ada efek samping

Untuk keluhan dan pengaduan silahkan hubungi langsung:

H. Suhendar sudah di kenal sebagai pakar kejantanan yang sudah berpengalaman, sanggup mengatasi keluhan alat vital khusus pria, memperbesar, memperpanjang (garansi), meningkatkan kekerasan, tambah kuat dan tahan lama dalam berhubungan

Mahar Rp. 500 ribu


Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

Klinik H. Suhendar di bawah kontrol dan pengawasan langsung H. SUHENDAR Diberitahukan kepada masyarakat untuk berhatihati terhadap pengobatan sejenis yang mengakungaku kerabat atau saudara, soal cara boleh sama tapi keahlian yang membedakan

H. SUHENDAR HP. 0812.131.6364 Jl. Tempuling No. 43 B - Serdang (masuk Gg. Sado) Medan Telp. (061) 663.4220 Saksikan !!! Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu Malam Minggu Pukul 20.00 WIB



Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663 NB. MOBIL BISA MASUK/ GARASI PAKEM. B-346/DSP.5/11/2008

Ekonomi & Bisnis

WASPADA Senin 1 November 2010


Pembayaran PBB Rumit MEDAN (Waspada): Masyarakat wajib pajak mengeluhkan sistem pembayaran Pajak Bumi Dan Bangunan (PBB) di Kantor Pelayanan Pajak Pratama Medan-Belawan. Salah seorang wajib pajak yang minta nama tidak disebutkan menjelaskan, Jumat (29/ 10), keluhannya ini berawal dari niatnya akan melunasi pembayaran PBB yang belum pernah dibayar sejak surat tanahnya diterbitkan beberapa tahun lalu. Berbekal surat asli tanah seluas 10.000 m2 yang berada di Belawan, dia mendaftarkan permohonan pembayaran PBB di kantor Pelayanan Pajak Pratama Medan –Belawan di Jalan Tanjung Mulia dengan surat tanda terima September 2010. Beberapa hari kemudian,

pemilik tanah ini kembali mendatangi petugas pajak yang ternyata menjelaskan, PBBnya belum bisa dibayar, sebelum surat tanah ini dileges Lurah dan Camat setempat. Selain itu petugas pajak juga mewajibkan pemilik tanah harus membuat surat silang sengketa, serta dilakukan pemeriksaan petugas pajak di lokasi. Mendengar ini pemilik tanah sempat bertanya kepada petugas kenapa rumit seperti ini proses pembayaran PBB, kita sudah taat akan membayar PBB malah harus melalui beberapa proses. Padahal biasanya pembayaran pajak ini sangat gampang dan dapat dititipkan kepada pihak lain. Karena ingin kewajibannya dalam membayar PBB selesai persyaratan itu dilakukannya walau petugas Kelurahan dan Kecamatan merasa heran karena biasanya proses pembayaran PBB tidak ada seperti ini, kecuali akan mengurus Sertifikat Hak Milik di Kantor Pertanahan.

Akibat adanya persyarakat yang tidak dimengerti ini, pemilik tanah hingga Kamis siang belum berhasil membayar PBBnya. Kepala Kantor Pelayanan Pajak Pratama Medan-Belawan ketika dihubungi tidak berhasil, karena menurut petugas Satpam yang mengaku bernama Adi menjelaskan Kantor Pelayanan Pajak Pratama tidak mempunyai wewenang untuk menerima wartawan. Petugas itu menyarankan Waspada mengkonfirmasi ke kantor Kanwil Ditjen Pajak Sumut. Adil S mantan anggota DPRD Medan ketika dimintai keterangannya tentang masalah ini sangat menyayangkan proses pembayaran pajak di Kantor Pelayan Pajak Pramata Medan-Belawan ini, karena pembayaran PBB tidak menentukan kepemilikan hak atas tanah sehingga siapa saja bisa membayarnya atau pihak lain yang menempati tanah dan bangunan itu. (m35)

ZTE Target Pasarkan 20 Ribu Mini WiFi Router MEDAN (Waspada) : PT ZTE Indonesia, tak khawatir menghadapi persaingan ponsel plus perangkat koneksi internet (modem) yang kian sesak. Produsen modem lokal merek ZTE ini, bahkan mematok target penjualan untuk ponsel Mini WiFi Router sekira 20 ribu unit tahun ini. PR Corporate and Branding Manager, Natalia Sutanto di Medan Fair, Minggu (31/10) berharap memberikan kontribusi penjualan sekira 10 persen terhadap total target Nasional. “Target kami sampai akhir Desember sekira 20 ribu unit untuk produk MiniWiFi Router,” katanya saat bersamaan diluncurkannya ponsel modem CDMA ZTE S620 (Smile TXT) meski hal tersebut masih tergantung dengan operator seluler di Indonesia. Produk Mini WiFi Router ZTE MF 30, lanjutnya, produk WiFi yang dapat mengkoneksikan lima perangkat secara bersamaan ke internet melalui jaringan WiFi, hanya dengan jarak 50 meter. “Dengan didukung teknologi High Speed Downlink Package Acces (HSDPA), kece-

patan dari mini wifi router ZTE MF 30 sangat tinggi yaitu 7,2 Mbps, sehingga menjadikan mini wifi ini lebih unggul dan cukup diminati masyarakat,” ujarnya. Harga normal, lanjut Natalia, dikenakan pada ponsel modem CDMA ZTE S620 (Smile TXT) Rp550.000, namun selama even ZTE Citizen Mobile Journalism berlangsung, hanya dikenakan Rp495.000, Sedangkan Mini Wifi Router ZTE MF30 harga normalnya Rp1.299.000 namun selama even berlangsung hanya dikenakan Rp999.000. ZTE Citizen Journalism Sementara itu, ZTE Indonesia, pada bersamaan acara peluncuran varian terbaru dari ZTE, industri handphone berasal dari China itu juga menggelar ZTE Citizen Journalism. Dimana kegiatan berlanjut ke malmal di kota-kota besar lainnya. “Tujuannya tidak lain untuk meningkatkan antusiasme pengguna mobile internet terutama melalui ponsel ZTE untuk berbagai informasi, berita maupun cerita mengenai kejadian disekitar mereka,” ujar Natalia. (m38)

Pemerintah Coba Redam Inflasi


BANTUAN SIDO MUNCUL: PT Sido Muncul melalui produk unggulannya Kuku Bima Energi, Tolak ANgin dan Kuku Bima Kopi Ginseng memberikan bantuan musibah kebakaran yang menimpa warga Jl. Bandengan Selatan Rt. 001 Rw. 01 Pejagalan Jakarta Utara. Bantuan tersebut diberikan secara simboliS oleh Direktur Utama PT Sido Muncul Irwan Hidayat diterima oleh Lurah Pejagalan Joni selanjutnya dibagikan kepada warga sejumlah 155 KK.


Kami sebuah Sekolah Islam Modern di Tapanuli Selatan, membutuhkan beberapa orang guru bidang studi sbb: 1. B. Indonesia 2. B. Inggris 3. Biologi 4. Kimia 5. Akuntansi 6. Sosiologi 7. PAI Kualifikasi: - Pendidikan Strata Satu (S-1) - Bersedia Ikut Tes - Bersedia Tinggal di Lokasi Fasilitas: - Tempat tinggal disediakan - Kompensasi min Rp. 2.000.000 Kirimkan surat lamaran lengkap ditujukan kepada:

Ketua Yayasan Pendidikan Haji Ihutan Ritonga Jl. Sei Musi No. 11 Medan Selambat-lambatnya satu minggu setelah iklan ini diterbitkan (0812.6571.0525 - 0812.6410.373)



Aplikasi Window XP/ Internet................ 200 Rb (2 minggu) Komputer Aplikasi Perkantoran Lengkap 350 Rb (1 bulan) Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Merakit Komputer/ Lengkap................... 400 Rb (6 hari) Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) Desain Grafis + iNTERNET....................... 600 Rb (1 bulan) WEB Programing......................................500 Rb (10 hari)

Daftar langsung belajar, Waktu Bebas, Tanpa batas usia Jl. Sei Batang Hari Ujung 170 Medan Telp. 844.2158 - 844.2159 WEBSITE:




Ustadz ABU SANGKAN Sabtu-Minggu, 11-12 Desember 2010

Tempat Pelaksanaan :

RAZ PLAZA CONVENTION HALL Jln. Dr. Mansyur No. 164 Medan Tempat Pendaftaran :

Sekretariat SCSU (081281318288) Dr.Hj.Ettylamurti ( 08126006719) Dwi Wanto, ST ( 08126341947) Masjid Agung (081260304600) TB.Sembilan Wali ( 061-4527285) Madinah Syariah ( 061-77798910) Raz Plaza Hall (081263818076)

Penyelenggara : Yayasan Shalat Center Sumatera Utara Sekretariat : Jln. Adam Malik No. 62 Medan



PERUSAHAAN BAKINDO MENTARI JAYA Yang beralamat Jl. Prof. HM. Yamin Gg. Belimbing No. 2D Medan Membutuhkan karyawan tetap dengan gaji per bulan 1 juta bersih 1. Pimpinan cabang : 2 orang 2. Sekretaris : 2 orang 3. Komputer (Program) : 1 orang 4. Lapangan : 50 orang 5. Koki : 1 orang 6. CS : 1 orang NB. Buka tanggal 1 Nov 2010 Tutup Tanggal 06 Nov 2010 Pak Joko 0812.6099.2580 Semua posisi diseleksi


- B. INGGRIS - B. INDONESIA - KOMPUTER - IPA & MM Syarat: * Mahasiswa/ Tamatan D3/ S1

RUMAH PERMANEN DIJUAL L. 8½ x 13m di Jl. Suka Eka No. 38 Medan Johor, Full keramik Lokasi strategis, STM Ujung Hub. 0812.601.8581, TP


LT. 32x36m² (SHM), Medan, LB. 12x22m², RT 3, KT 7, KM 3, Garasi 4x11m² Jl. Swadaya No. 123A Psr. 7 Marindal Dalam, Kec. Medan Amplas Hub. 0815.301.5781


: Jl. Laksana 130-131 Telp. (061) 735.6625 (depan Ramayana Aksara Medan) P. SIANTAR : Jl. A. Yani 10 Telp. (0622) 703.0999 (samping Radio BOSS FM)

Jl. Jalak IX No. 250 Perumnas Mandala depan Mesjid & Madrasah, Lengkap, PAM + PLN, Uk. Tanah 6x14m, SHM, Maaf khusus muslim, Bagi yg serius hub. Ibu Lina (061) 7760.9925, Maaf Tanpa perantara

Dibutuhkan Tkg pangkas, Yg berpengalaman Penghasilan menarik Hub. (061) 7771.5106



Alamat Jamin Ginting No. 670 Padang Bulan Pangkas HP. 0813.6084.5333 atau Pagar Dawan Electronik Waktu Tarigan

Type 50, LT. 6x18, 2 KT, 1 KM, Taman, Pagar klg Jl. Denai Ujung/ Jl. Datuk Kabu Gg. Bukori (Aspal), Utk Muslim Hub. 0812.6307.2300

KESEMPATAN KERJA Sebagai Profesional muda


Dibutuhkan tenaga kerja, P/W 17 - 35 thn, untuk di tempatkan di perusahaan swasta cabang di Medan (Non Sales, Ada Shift), Persyaratan: - Pend. SLTP, SMu/ sederajat - Bekas lamaran diantar langsung - Syarat lain bisa nyusul setelah interview Penghasilan: Rp. 1.800.000/ bln INFO HUB: BPK. JEFRY SIMBOLON, SE HP. 0812.6045.8433 Atau datang langsung ke alamat kantor: Jl. Brig. Zein Hamid No. 221C dekat Komplek Seroja Indah daerah Jl.mau ke Delitua Medan



KENANGA CITI HOTEL My Residence in Medan

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106


Distributor Chemical - Mesin Laundry Kiloan Jl. Sekip No. 64 Medan HP. 0812.813.18288




kue dengan kreasi iklan tersebut, ternyata memberikan efek yang besar terhadap penjualan. Berbagai lapisan masyarakat langsung mampir dan mencoba. Baik dari kalangan guru, mahasiswa, pegawai, dosen hingga guru besar. Alhasil, pesanan kue kotak pun terus mengalir hingga sekarang. Seperti dari sekolah-sekolah, instansi swasta, pemerintah maupun BUMN. Baik untuk keperluan meeting seminar maupun resepsi. Untuk dapat memperoleh pelanggan, lanjutnya, iklan yang kreatif saja tidak cukup. Tetapi juga harus diikuti dengan produk kue yang benar-benar lezat, bermutu dan beragam. “Untuk urusan mutu dan cita rasa, istri saya yang punya keahlian. Dia memang rewel dan paling pantang pakai penyedap, pengawet dan pemanis buatan,” papar Wanmoh. Melihat besarnya sambutan pasar terhadap kue buatan istrinya tersebut, Wanmoh mengaku, dalam waktu kurang dari satu tahun sejak usahanya dibangun, dia terpaksa tiga kali mela-

kukan pemindahan dan perluasan dapur, untuk mengimbangi jumlah pesanan pelanggan.“Untuk dapur yang terakhir, kami siap menerima pesanan berapapun,” imbuhnya bersemangat. Ayah dua anak ini juga mengakui, untuk memulai usahanya tersebut memang tak mudah. Tetap mengalami sejumlah hambatan. “Sebelum toko kue dibuka pertama kali, saya terlebih dulu menghitung jumlah pohon dan tiang listrik di sepanjang Jalan Dokter Mansur Medan, untuk ditempeli iklan mirip Pilkada. Tujuannya, agar orangorang tahu, saya jualan kue. Hasilnya? Alhamdulillah. Saya langsung ditelefon. Bukan oleh pelanggan, tapi badan perizinan,” tuturnya seraya tertawa. Saat ini, tambahnya, dia mulai bisa sedikit tersenyum. Karena usaha yang dibangun, mulai berjalan sesuai dengan yang diharapkan. Namun ke depan, tetap harus berpikir lebih kreatif dan merambah pasar yang lebih luas lagi. “Karena kue senantiasa membutuhkan kreasi,” tandasnya.(m13)





MENJUAL PECI TEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 340/Jl. Serdang Buka Sampai Jam 11 Malam Depan Gg. Sado Medan

JUAL ALAT MUSIK Keyboard Techniks KN-2400 & KN-2600 Hub. 0813 97 111000


Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun


Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243







Komp. Taman Permata Surya D-41 Jl. Eka Surya Titi Kuning Type 56, 14x7, 2 KT, 2 KM, SHM Hub. 0812.6081.8228, TP



6x10m²: Rp. 12 Jt-an, Gratis biaya surat, Siap bangun, 30m dari Jln Aspal, Lok Jl. Karya P. Psr. V Sunggal Diski Hub. 0813.6112.2791 - 7707.2611

Kami perusahaan di bidang kontraktor butuh tenaga kerja yang berpengalaman di bidang:

Jl. A.H. Nasution 15E Medan Telp. (061) 785.3560 Contact person Siti (0852.7090.2204)

SEDIKITNYA ada 23 stand jajanan pasar yang meramaikan acara Pameran Sehat Bersama Bogasari, di Pelataran Parkir Deli Plaza, Minggu (31/10). Namun ada yang terlihat unik dan memancing perhatian, stand kue Jedah yang menjajakan aneka macam kue basah dan roti. Di areal depan stand ini, berderet gambar menyerupai tiga pasangan calon walikota dan wakil walikota Medan yang telah didisain sedemikian rupa, dengan pesan seragam: Pilih Kue Jedah! Diikuti plesetan berbagai jargon yang pernah dipopulerkan saat menjadi calon walikota Rahudman, Sofyan Tan dan Sigit Pramono beberapa bulan lau. “Ini bagian dari strategi promosi. Karena kami mulai membuka dagangan kue, tepat begitu Pilkada Medan selesai,” ujar Wanmoh, pemilik stand kue Jedah, kemarin. Apakah dia tukang kue atau pebisnis kue, yang pasti kreatifitasnya memancing konsumen untuk datang. Wanmoh mengaku, saat pertama kali membuka toko




TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Jl. Danau Poso No. 21 BINJAI, P. 67,5m² & L: 17,5m², Tembok keliling, SHM, Perkarangan luas, Harga 450 Jt/nett Hub. 0821.6060.4911


Batching plant (operator) Stone crusher (operator) Batching plant (chief laboratory) Excavator (operator) Wheel loader (operator) Driver dump truck (30 orang) Mixer truck (5 orang) Truck crane (Operator) Rock drill (1 team) Civil Engineer Mekanik: a. batching plant c. crusher plant c. wheel leader d. excavator e. dump truck f. generator g. mixer truck Serahkan surat lamaran beserta CV, fotocopy KTP, fotocopy ijazah SMA, fotocopy SIM B1 umum, Surat Rekomendasi pengalaman kerja. Dikirim ke:


Wanmoh Tukang Kue Yang Diselimuti Kreativitas


Jl. Rachmadsyah No. 176 (d/h Jl. Japaris) simp Jl. Laksana 80m dari BCA (Kode: Marketing)

Lamaran diantar langsung ke: Pusat Pendidikan Bahasa dan Komputer GEMILANG EDUCATION CENTRE



Jl. Eka Warni Seroja No. 6, Tanah 8x27m², Sertifikat, KT 3, KM 2, Garasi mobil, Harga Rp. 550 Jt/nego Hub. 0813.7694.9191

Media yang Tepat untuk Iklan Anda

1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11.


Rumah di Hook, LT. 151m² Komp. Rajawali Blok IV No. 1 Hub. 0812.7518.5789



Loetan di Jakarta kemarin. Namun, Syahrial tidak menyebutkan prediksi inflasi 2010. Terkait bencana tsunami di Mentawai dan meletusnya Gunung Merapi di Jawa Tengah, ujar dia, sedikit banyak hal itu akan berpengaruh terhadap permintaan barang yang dapat mendorong laju inflasi. Ekonom Danareksa Research Institute (DRI) Purbaya Yudhi Sadewa menuturkan, laju inflasi bulan Oktober 2010 diprediksi berada pada kisaran 0,2 persen. (okz)


Ingin Promosikan Produk Anda Harian



JAKARTA (Waspada): Pemerintah akan berusaha keras mengendalikan laju inflasi agar tidak terlalu jauh dari prediksi awal. Meski Bank Indonesia (BI) memperkirakan laju inflasi hingga akhir tahun melebihi enam persen, hal itu masih bisa dikontrol. “Kita berusaha menahan laju inflasi dengan mengamankan stok dan distribusi barangbarang kebutuhan masyarakat,” ujar Sekretaris Menteri PPN/ Sestama Bappenas Syahrial

Waspada/Armin Nasution

TAWARKAN KUE: Wanmoh (kiri) saat menawarkan kue Jedah kepada pembeli, pekan lalu.




Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

KOST MUSLIM PRIA Baru, Lengkap, AC/ Non AC Jl. Gajah Mada depan Bumbu Desa 0852.6210.3756/ 0812.6077.405

DISEWAKAN Rumah, Ring Roat, Gg. Dame No. 8, 6 Km Tdr, Keramik, Sewa 17 Jt, Jl. Sunggal No. 264, 2 KM, Harga sewa 12 Jt HP. 0852.7539.1494


Khusus Muslim, LT. 6,20x16m,LB. 6x12m, 3 KT, 2 KM, Full keramik Gypsum, Star Roof, SHM, PLN 900, PDAM, Minimalis, Con Block Jl. Brigjend. A. Manaf Lubis/ Gaperta (dekat Panglong Amin) Jl. Masjid Ar-Rahman 250 Jt/nego Hub. 0813.6177.9580 - 0812.6326.962


3 TKT COCOK UNTUK USAHA INTI KOTA, DP 100 JT Dijual 4 pintu ruko Jl. Senam No. 1 Simp Jl. Halat (samping Sekolah Negeri), LB. 4x16m, LT. 4x29m, Row depan 10m, Row belakang 3m, Fas. SHM, PLN, PDAM, Pintu plat besi, Cocok utk usaha, Perhotelan, Fotocopy, Praktek dokter, Kost²an, hospital, warnet, kantor NB:300meter dari Jl. Juanda dan Bandara Polonia, bisa bantu KPR, KPR per bulan 5 Jt, Harga 529 Jt, Sisa 2 unit, Full keramik, Siap huni ± 80 Jt Hub: 7772.2123 / 7759.8123 HP. 081.165.1123

Letak di Jl. AR. Hakim Gg. Ganefo No. 73A Medan (Sp. Bromo), SHM, Luas 222m2

Berminat Hub. 0813.6103.9152 Peminat banyak akan dilelang TANAH


9,5x22m, di Tj. Sari Psr. I Gg. DW/ Anyelir 14 Lok Strategis, Hrg nego Hub. 0852.7713.2232/ 0813.7717.1527


9x22m, Sertifikat Hak Milik Jl. Bajak IIH depan Villa Mutiara Hub. 0815.3108.739 0813.9673.6996

TANAH DIJUAL 6,7x20m, SHM Hrg 70 Jt, Jl. Bajak 2 Gg. Langsat, sblh Villa Gading Mas Hub. 0812.6307.2300






Harga Ter Murah


Model Terbaru

Jl. Karya No.68 Sei Agul Medan Telp. 061-663 9308, 7700 9000 HP. 0813 70900 400, 0852 6144 8000 0816 301 761


PELUANG BISNIS 1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & Ro Rp. 22 Jt s/d 38Jt 2. Air Pegunungan 6700 s/d 7000 Liter Rp. 230.000 / Tangki Menyediakan Mesin RO dan Yamaha Hubungi:




WC TUMP TUMPAAT, Sal. AIR, K. Mandi Tel. 081361718158, 0813 6230 2458 NARO SERVICE Jl. Sisingamangaraja


Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410




845.8996 0812.631.6631

Pemasangan Depot Air Minum Isi Ulang Standart DEPKES

Bergaransi/ Setia Luhur 160 F


15 Jt - 35 Jt (Nego)

Air Mineral dan Sistem RO Jual alat-alat Depot Isi Ulang

RINALDI, S.Pd.I (061) 685.0456 HP. 0813.6214.3160

WC WC 0812 60444275 WC Ada Garansi




Jl. Brayan Medan

8442246 WC 08126427 1725

Tumpat Sedot


Jl. Yos Sudarso Km. 15,5 No. 121 Medan





Hub. 8219951 Jl. Setia Budi No. 2

Ekonomi & Bisnis


Pengamat & Praktisi Manajemen

Inspirasi Bisnis

Cahyo Pramono

Berbagi DALAM keyakinan saya, ada sejumlah hak orang lain dalam harta kita. Yang itu wajib hukumnya untuk disalurkan kepada yang berhak. Jika kita tidak menyalurkannya, maka kita adalah maling atau perampok yang memaksa menggunakan harta yang bukan hak kita. Ketika seseorang tidak menyalurkan hak orang lain yang ada padanya, mungkin saja terjadi karena yang bersangkutan tidak tahu, tetapi mungkin saja terjadi karena sifat pelit yang melekat padanya. Sifat pelit ini sepertinya diciptakan adalah perasaan khawatir yang berlebihan. Rasa khawatir akan menjadi miskin, papa dan akan menjadi susah. Sepertinya semua orang takut dan khawatir menjadi susah. Rasa khawatir menjadi miskin yang berlebihan akan membentuk upaya proteksi dengan berperilaku kikir. Jika perasaan khawatir menjadi miskin itu terus berkembang, maka otak akan memprogram mekanisme berfikir bahwa dirinya selalu kekurangan harta dan pada saat yang bersamaan otak mencatatkan dirinya sebagai orang yang benar-benar kekurangan. Dan miskin yang sebenar-benarlah yang terjadi. Saya amati dari orang-orang yang terlalu merasa miskin, biasanya memang benar-benar miskin secara jelas. Walaupun bekerja jungkir balik mencari harta siang dan malam, tetap saja rezekinya seret dan pas-pasan, bahkan selalu kurang. Yang paling sial adalah pada saat kita merasa khawatir menjadi miskin tetapi kita lupa ada Tuhan yang mengatur semua rezeki kita. Ketakutan menjadi miskin yang berlebihan akan membawa kita kepada sebuah kondisi dimana kita tidak yakin Tuhan akan membantu kita. Bagi saya inilah tingkat bahaya yang sangat mengkhawatirkan. Merasa khawatir menjadi miskin tetapi lupa Tuhan selalu ada untuk kita dan memberi rezeki bahkan jauh-jauh hari sudah disiapkan sebelum kita lahir ke dunia ini. Saat ‘lupa’ itulah yang saya definisikan sebagai tindakan yang tidak beriman. Tindakan itu tidak ada hubungannya dengan aktif dan tidaknya ibadah kita, terkadang ketika kita sudah menjalankan rukun Islam dan Iman, tetap saja tidak merubah paradigma berfikir tentang harta ini. Kita lupa usaha yang kita lakukan dalam mengumpulkan harta tidak terpisah dari keputusan Tuhan untuk memberikannya kepada kita. Logika Ajakan ini saya arahkan kepada sidang pembaca khususnya praktisi bisnis. Dalam logika sederhana kita yang dangkal harta itu terkumpul karena usaha keras, manajemen keuangan yang benar dan kekuatan dalam bersaing. Yang terlihat dalam fikiran kita adalah modal, sumber daya, pasar, harga, kompetisi, pemasaran dan manajemen internal. Itu saja! Kita kadang lupa ada pemberi rejeki yang sangat berkuasa mengatur. Kita terlanjur percaya kaidah ekonomi modern dimana kekayaan muncul dari pengeluaran yang sedikit dan penerimaan yang banyak. Tapi kita lupa logika kekayaan Tuhan sedikit berbeda. Dalam keyakinan saya, kita akan menjadi kaya ketika kita memberi lebih banyak dengan iklas dan syukur sehingga kita akan menerima lebih banyak lagi. Ketika kita sudah menjadi lebih ‘logis’ untuk bisa dan berani

memberi lebih banyak, berikutnya ada ‘logika’ lanjutan. Kepada siapa kita harus memberikannya? Fikiran ‘kemanusiaan’ kita akan mengarah kepada hal-hal atau orang yang berhubungan dengan kita. Kepada jalan yang biasa kita lewati, kepada pegawai yang kita selalu perintah, kepada saudara karena ‘pantas-pantas’nya dan kepada siapapun yang berhubungan langsung dengan kita. Padahal Tuhan mengajari kita Dia tidak memilih siapa pun yang menerima anugrahNya. Artinya menjadi logis jika suatu saat kita terpanggil untuk memberi kepada orang atau sesuatu yang tidak berhubungan sama sekali dengan kita. Godaan kemanusiaan kita akan bermain disaat itu. Kita merasa kadang panggilan itu bukan urusan kita. Contoh sederhanannya adalah ketika ada panggilan memperbaiki jalan, kita akan bereaksi cepat, bahwa itu kan bukan jalan pribadi kita, itu jalan kan dipakai bukan hanya oleh kita, itu jalan kan tanggungjawab pemerintah dan masih banyak lagi alasan ‘logis’ yang kita rekayasa untuk menghalalkan diri kita menolak panggilan itu. Persis ketika warga Mentawai dan merapi menghadapi bencana, kadang fikiran kemanusiaan kita mengangap tak perlu kita membantu hanya karena kita tidak mengenal mereka, tidak ada saudara di sana, atau tidak ada hubungannya dengan kita. Kita merasa itu adalah tanggungjawab pemerintah dan lembaga donor lainnya. Dan anehnya, kita hanya duduk menonton penderitaan itu di televisi sambil bergunjing dengan kawankawan lainnya. Ketika kita terpaksa harus berbagi dengan mereka, masih lagi ‘logika’ kemanusiaan kita bermain, kita akan memberikan bukan yang terbaik, bukan yang istimewa, tetapi yang bekasbekas dan yang tidak kita sukai. Semua itu karena kita khawatir kita akan menjadi miskin jika mengikuti perintah agama untuk berbagi kepada sesama. Dan dikala itulah keimanan kita diuji kelasnya. Menjawab panggilan Tulisan ini adalah ajakan kepada sidang pembaca untuk berbisnis dengan suka cita tanpa takut menjadi miskin. Kemudian dengan keyakinan penuh bahwa berjuang dan membelanjakan harta di jalan Tuhan dengan iklas, pasti akan mendapat tambahan berkah yang berlipat ganda. Kini adalah waktu yang tepat untuk menjawab panggilan semesta. Saudara-saudara kita yang di Mentawai, merapi dan banyak lagi pojok-pojok bumi ini yang sedang menderita saat ini. Mereka tidak berdaya dan mereka merintih memohon balas kasih Tuhan. DanTuhan mengetuk pintu hati anda untuk menjadi tangan dan kakiNya. Bayangkanlah kalau kita yang menjadi korban di sana. Sanak saudara hilang dan meninggal. Tidak ada tempat untuk berteduh dan tidak ada air minum yang bersih apalagi makanan yang layak. Baju yang tersisa hanyalah yang menempel di badan. Jangankan cerita masa depan, cerita hari ini saja menjadi perkara yang berat dan luar biasa keras. Para pembaca yang budiman, saya ingin mengajak anda untuk ikut berbagi dengan mereka-mereka yang sedang menderita. Karena setahu saya hidup ini berputar bergantian. Karena setahu saya ada masa-nya kita harus dibantu orang lain. Konsultasi & Pelatihan;

Pertumbuhan Kredit BRI Semester I Di Bawah Target JAKARTA (Waspada): Pertumbuhan kredit Bank Rakyat Indonesia (BRI) Tbk, per September 2010 masih dibawah target industri perbankan dan Rencana Bisnis Bank (RBB) BRI untuk tahun 2010. Hal ini dikarenakan manjemen ingin tetap menjaga non performing loan (NPL) dengan tidak terlalu jor-joran mengucurkan kredit. “Meski demikian BRI tetap berupaya mengejar target pertumbuhan kredit dengan mencairkan porsi kredit ‘nganggur’ atau undisbursed loan agar kredit dapat mencapai 20 persen di akhir 2010,” demikian

diungkapkan Direktur BRI Sulaiman Arif Ariyanto dalam paparan kinerja Triwulan III2010 di Jakarta, akhir pekan lalu. Menurutnya, pencapaian kredit BRI baru menyampai 18,9 persen dikarenakan adanya konsolidasi di internal untuk komit menjaga NPL tetap aman. “Memang target kita 20 persen sampai akhir tahun ini. Tapi karena sampai triwulan ini BRI sedang melakukan konsolidasi guna perbaikan NPL, maka kredit kita hanya tumbuh sampai 18,9 persen,” jelas Sulaiman. Sehingga pertumbuhan kredit BRI menjadi lebih rendah

dari target industri perbankan yang dipatok 22 persen-24 persen oleh Bank Indonesia. “NPL tetap ditekan hingga menjadi 4,28 persen. Kedepan kita optimis kredit akan tumbuh melalui pencairan undisbursed loan,” tutur Sulaiman. Portofolio kredit BRI per September 2010 mencapai Rp36,46 triliun atau meningkat dari Rp192,23 triliun di September 2009 menjadi Rp228,69 triliun pada September 2010. Namun rasio undisbursed loan BRI memang cukup tinggi namun hal tersebut akan dicairkan seluruhnya sampai akhir

Direktur BCA, Dhalia M. Ariotedjo dalam rilisnya di Jakarta, akhir pekan lalu. Perjanjian kredit pembiayaan tersebut ditandatangani oleh Direktur BCA, Dhalia M. Ariotedjo, dan Chairman of Growth Steel Group, Fajar Suhendra, disaksikan langsung oleh Direktur BCA Anthony Brent Elam, Direktur Operasi PLN Indonesia Barat Harry Jaya Pahlawan dan General Manager PLN Wilayah Sumatera Utara Denny Pranoto. PLTU yang dikembangkan GSI ini menggunakan campuran dari berbagai alternatif pasokan bahan bakar antara

lain cangkang kelapa sawit sebagai bahan baku utama, janjang kosong kelapa sawit, serpihan kayu dan serbuk gergaji. Listrik yang dihasilkan dari PLTU tersebut digunakan oleh GSI dan sisanya akan dijual kepada PLN (excess power) sebagai pasokan listrik yang dibutuhkan masyarakat. Dengan skema pembiayaan dari BCA ini, dimungkinkan bagi GSI untuk melakukan ekspansi sesuai rencananya dengan membangun 2 PLTU biomass lainnya. GSI merupakan pabrik baja yang berdiri sejak tahun 1969 di Medan, dimana untuk opera-

sebagainya semestinya melemah. Begitu pun saat harga BBM naik, maka semestinya harga karet ikut menguat, pun ketika harga obligasi naik maka harga saham jadi melemah,” ujarnya. Demikian pula, lanjutnya, terkait dengan indikator ekonomi sebagai acuan trading para investor atau trader. Bila data nonfarm payrolls-nya buruk semestinya dolar Amerika melemah, begitu pun bila data ekonomi Jobless Claim-nya buruk, maka dolar Amerika juga akan melemah. Namun faktanya, pergerakan harga tidak bergerak s e s u a i d e n g a n s t a n d a rd pengetahuannya. Ada harga semestinya berbanding lurus menurut standar pengetahuannya, tetapi menjadi berbanding terbalik. “Begitupun, jika ada harga berbanding terbalik malahan

berbanding lurus. Kondisi inilah yang membuat banyak investor stress, bingung bahkan ada yang putus asa. Karena ketika berusaha menjawab mengapa harus berfluktuasi dengan mengacu pada standar pengetahuannya akhirnya trader, investor, atau pelaku pasar selalu menjadi objek,” lanjutnya. Selama ini trader, investor atau pelaku pasar, lanjut Zulfikar, mempelajari atau diajari oleh para trainer di perdagangan berjangka - sebenarnya tidak lebih sedang dididik untuk menjadi dosen, konsultan, dan pakar ekonomi saja. “Banyak orang yang pintar dari sisi ilmu pengetahuan makro ekonominya, tetapi jika diminta pendapatnya tentang jual atau beli, mereka selalu ragu-ragu. Sandarannya selalu berita indikator ekonominya keluar, baru berani masuk pasar,” ujarnya.

BANDUNG (Waspada): Kementerian BUMN menyebutkan telah mengirim surat rekomendasi resmi kepada Otorita Asahan terkait pengambilalihan PT Inalum. Menurut Sekretaris Kementerian BUMN Mahmuddin Yasin, surat rekomendasi tersebut berisikan usulan dari Kementerian BUMN untuk mengambil alih kepemilikan saham perusahaan aluminium asal Jepang yaitu Nippon Asahan Alumina di Inalum. Dengan demikian, pemerintah Indonesia resmi menguasai Inalum sepenuhnya. “Suratnya sudah ditandatangani Menteri BUMN untuk diserahkan ke Otorita Asahan. Tadi sore sudah saya kirim suratnya ke Otorita Asahan. Kita bertekad ambil alih. Setelah kita ambil, baru kita pikirkan selanjutnya,” ungkap

Yasin pada acara Media Workshop Kementerian BUMN, Jakarta, Jumat (30/10) malam, di Bandung. Meski dokumen audit perusahaan belum diterima secara lengkap oleh auditor perusahaan, yakni Earnst & Young, Yasin mengaku tidak terlalu mempermasalahkan hal tersebut. Menurutnya, pada perundingan pertama dengan pihak Jepang nanti pihaknya akan menggunakan data yang telah ada. “Kita gunakan data awal. Pokoknya tekad kita jelas akan mengambil alih,” tegasnya. Ikut Holding Kementerian BUMN menegaskan setiap BUMN perkebunan, mulai dari PT Perkebunan Nusantara I-XIV dan PT Rajawali Nusantara Indonesia (RNI) mesti mengikuti kebijakan pemerintah akan membentuk induk usaha (holding) BUMN perkebunan. Menurut Deputi Bidang Restrukturisasi dan Perencanaan Strategis Kementerian BUMN Pandu Achiran Djayanto, kewenangan perseroan

untuk menolak atau mengikuti kebijakan tersebut ada pada Rapat Umum Pemegang Saham (RUPS). Seperti diketahui, pemerintah merupakan pemegang saham mayoritas, bahkan masih 100 persen, di setiap BUMN perkebunan tersebut. “Tentunya kewenangan perusahaan ada pada RUPS. Jadi, mau tidak mau, suka tidak suka, harus ikut keputusan RUPS. Jadi, RUPS yang berbicara,” ungkap Pandu pada acara Media Workshop Kementerian BUMN, Jakarta, Jumat (30/10) malam, di Bandung. Seperti diketahui, tahun ini Kementerian BUMN menargetkan bakal merampungkan holding BUMN perkebunan berdasarkan empat sektor komoditas, yakni gula, kelapa sawit, karet, dan aneka tanaman. Dengan dibentuk per komoditas tersebut, maka secara otomatis tidak ada lagi namanya PT PN I-XIV dan PT RNI, yang ada badan usaha di tingkat subholding (per komoditas). Sementara terkait rencana pelaksanaan penawaran saham perdana kepada publik (initial

public offering/ IPO) tiga BUMN perkebunan, antara lain PT PN III, PT PN IV, dan PT PN VII menurutnya bakal tetap berjalan pada 2011 mendatang, setelah holding BUMN perkebunan terbentuk. “Holding itu tidak menghambat IPO, justru memberi kesempatan bagi investor untuk tetap berinvestasi, karena operasionalnya kan masih ada,” ujarnya. Menurutnya pelaksanaan IPO itu nantinya juga bakal membuat BUMN perkebunan semakin kompetitif. “Ini untuk berkompetisi, mana terbaik itulah yang akan dipilih investor. Ini juga bisa memicu masingmasing perusahaan berlomba m e n j a d i y a n g t e r b a i k ,” tukasnya. Adapun rencana pelaksanaan IPO tersebut mulanya ditargetkan pada tahun ini, namun karena masih terkendala dengan rencana pembentukan holding BUMN perkebunan, maka rencana IPO ini pun harus tertunda usai badan usaha holding BUMN perkebunan ini terbentuk.(okz)

Pendapatan Pelabuhan Belawan Lampaui Target MEDAN (Waspada): Pemberlakuan kontribusi pelayanan jasa bongkar muat sebesar Rp 2.500/ton/M3/ekor/unit di Pelabuhan Belawan mulai berlaku 18 Oktober 2010 akan memastikan penambahan pendapatan di BUMN ini. Diyakini pendapatan Pelabuhan Belawan dari pengelolaan operasional kepelabuhan itu akan melebihi target karena September lalu saja melampaui target,yakni sudah mencapai 35,65 persen atau Rp 53,259 miliar dari target dibebankan manajemen PT Pelabuhan Indonesia I (Persero) atas Pelindo I Cabang Belawan sebesar Rp 34,269 miliar, ujar Asisten

Manajer Hukum dan Humas Pelindo I Cabang Belawan Azmi SH Sabtu (30/10). Memang kata Azmi pendapatan itu belum dipotong biaya operasi dan pajak, namun hingga akhir tahun pendapatan Pelindo Belawan diperkirakan bakal melampaui target ditetapkan perusahaan. Pendapatan ini akan semakin membaik, jelas Azmi diperkuat dengan diberlakukannya kutipan kontribusi bongkar muat sebesar Rp 2.500/ton/M3/ ekor/unit di Pelabuhan Belawan diberlakukan sejak 18 Oktober 2010. “Harapan kita pendapatan Pelindo Belawan meningkat tajam pasca diberlakukannya

kontribusi bongkar muat di Pelabuhan Belawan. Menurutnya, pendapatan Pelindo I Cabang Belawan paling signifikan berasal dari pelayanan jasa kapal pandu/ tunda, jasa dermaga, jasa penumpukan dan jasa lainnya yang merupakan usaha andalan selama ini. Sedangkan pemberlakukan kontribusi ini dilaksanakan setelah Juli 2010 DPW Gafeksi/ INFA dan DPW APBMI Sumut mengadakan kesepakatan kerja bersama (KKB) dengan Pelindo I Cabang Belawan tentang pemberlakuan kontribusi pelayanan jasa bongkar muat di Pelabuhan

Belawan mulai 11 Oktober 2010. Namun ternyata, beberapa anggota Gafeksi/INFA dan APBMI Sumut melakukan protes dengan menolak diberlakukannya kutipan memberatkan pengusaha itu, solusinya pemberlakuan kutipan kontribusi diundur seminggu yakni menjadi 18 Oktober 2010. Menanggapi ini, Azmi sebagai juru bicara Pelabuhan Belawan menegaskan hingga saat ini PT Pelabuhan Indonesia I Cabang Belawan tetap memberlakukan kontribusi itu karena hasilnya untuk meningkatkan pelayanan kepada pengguna jasa.(m35)

Waspada/Armin Nasution

MURAH: Idil Darwan, Head of Medan Branch (kanan) saat memberikan pengarahan tentang murahnya IM3 Indosat, akhir pekan lalu. sionalnya sangat membutuhkan pasokan listrik dalam jumlah besar. Sebagai bentuk kepeduliannya terhadap lingkungan, setelah sebelumnya BCA menyumbangkan 2.000 pohon untuk menghijaukan kembali area hutan lindung Gunung Rinjani di Nusa Tenggara Barat, kini BCA pun sangat mendukung proyek ramah lingkungan GSI. Dukungan yang diberikan BCA berupa fasilitas pembiayaan yang akan digunakan untuk kegiatan operasional dan pengembangan proyek PLTU Biomass Cangkang GSI. (j03)

Squash Games Theory, Teknik Trading Bursa Berjangka MEDAN (Waspada) : Jika secara umum sistem trading berusaha untuk mencari penyebab mengapa harga berfluktuasi, yang pada akhirnya para trader, investor, dan pelaku pasar selalu mengacu pada ilmu pengetahuan makro ekonomi atau kerap disebut kapitalisme global, maka tidak halnya dengan sistem trading Squash Games Theory (SGT). Penemu SGT, Zulfikar MS dalam acara peluncuran buku Pocket Trading Squash Games Theory dan Grand Opening PT Millenium Penata Futures cabang S Parman Medan, kemarin menyatakan, ketika semua orang berusaha mencari jawaban mengapa harga berfluktuasi, maka ada standar ilmu pengetahuan ekonominya. “Misalnya jika dolar Amerika bergerak naik, maka mata uang utama dunia launnya seperti euro, poindsterling dan

Ambil Inalum, Menteri BUMN Kirim Surat Ke Asahan

tahun 2010. Selain pencairan undisbursed loan, BRI tetap fokus untuk melakukan pembiayaan di sektor Kredit Usaha Rakyat (KUR). Program KUR BRI merupakan yang terbesar kontribusinya dibandingkan bank lain dimana mencapai 72,4 persen. “Sampai triwulan III-2010 penyaluran KUR telah mencapai Rp18,7 triliun kepada 3,2 juta debitur. Hal ini akan menaikkan posisi outstanding KUR sampai 2010 sebesar Rp6,58 triliun dengan total nasabah 1.268.227 orang,” papar Sulaiman.(j03)

BCA Biayai Proyek Listrik Cangkang Kelapa Sawit Sumut J A K A RTA ( Wa s p a d a ) : Sebagai bagian dari komitmen untuk pengembangan energi terbarukan (renewable energy) dan ramah lingkungan di Indonesia, PT Bank Central Asia Tbk, mendukung pembiayaan proyek energi Pembangkit Listrik Tenaga Uap (PLTU) berbahan bakar cangkang kelapa sawit senilai Rp150 miliar. “Pembiayaan tersebut diberikan kepada PT Growth Sumatra Industry (GSI) di Medan, Sumatera Utara. PLTU biomass dengan bahan bakar 2 x 15 MW ini akan mengurangi emisi gas rumah kaca sekitar 65.000 ton CO2 per tahun,” kata

WASPADA Senin 1 November 2010

Bahkan, lanjutnya kembali, ketika data ekonomunya keluar atau dirilis, mereka semakin tidak berani masuk pasar; beli atau jual. Sementara SGT, menjawab bagaimana harga berfluktuasi, bukan mengapa harga berfluktuasi. Ini berarti keputusan tradingnya tidak pada mengapa harga berfluktuasi atau acuan fundamental ekonomi. “Tetapi acuan trading berdasarkan siklus ekonominya. Bila dalam fundamental (pengetahuan) standard ekonomi ada pertumbuhan dan inflansi, maka dalam siklus ekonomi yang ada hanya pertumbuhan dan ledakan krisis. Artinya sistem trading SGT hanya mengacu pada siklus ekonomi dari sistem kapitalisme global, bukan pada content knowlegdenya atau fundamental ekonomi yang menyebabkan harga berfluktuasi,” ujarnya kembali. (m38)

IM3 Cukup Rp24 Per Menit Sepanjang Hari MEDAN (Waspada): Upaya Indosat untuk terus mempertahankan dominasinya sebagai operator dengan tarif termurah terus digencarkan. Kali ini perusahaan tersebut menawarkan tarif yang mereka klaim lebih murah dari yang sudah ada. Bahkan tarif murah tersebut untuk menyasar segmen anak muda. Memahami kebutuhan anak muda untuk selalu terhubung dengan teman dan sahabat serta selalu terkoneksi dengan aplikasi social network, Indosat meluncurkan program Mu24H itu IM3 untuk memenuhi kebutuhan ini. Dengan kartu perdana Rp2.400, pelanggan dapat menikmati berbagai keuntungan antara lain tarif nelpon Rp24 per menit sepanjang hari, gratis SMS sampai dengan 240 per hari dan gratis online hingga 24 MB. “Upaya kami untuk terus berinovasi menghadirkan beragam program yang mengikuti trend dan kebutuhan pelanggan, khususnya kalangan muda pengguna kartu IM3 untuk dapat selalu berkomunikasi dan terkoneksi dengan teman-temannya melalui program Mu24h itu IM3”, demikianWasis Sulaiman, Head of Region Northern Sumatera, Minggu (31/ 10). Pelanggan yang melakukan aktivasi kartu perdana IM3 24 akan langsung dapat menikmati beragam keuntungan, mulai dari mendapatkan pulsa per-

dana senilai Rp2.400 dengan masa aktif 15 hari, tarif nelpon murah hanya Rp24 per menit sepanjang hari, SMS gratis hingga 240 SMS per hari dan gratis online sampai dengan 24 MB. Fasilitas gratis online sampai dengan 24 MB ini, kata dia, dapat diperoleh secara bertahap yaitu pada hari ke-31, pelanggan mendapatkan gratis online sebesar 3 MB, hari ke-61 sebesar 5 MB, hari ke-91 sebesar 7 MB dan hari ke-121 sebesar 9 MB. Selain memperoleh berbagai keuntungan itu, pelanggan Indosat juga dapat mengikuti program senyum setia Indosat yang juga memiliki beragam keuntungan. Seperti mendapatkan SMS gratis hingga 100 SMS per hari dan tarif nelpon Rp100 per menit setelah berlangganan selama minimum 4 bulan, katanya. Untuk itu, tambah Wasis, pelanggan dapat menghubungi *777*1*6# untuk pendaftaran dan mengetahui info lebih lanjut program senyum setia Indosat. “Kami berharap dengan program Mu24H itu IM3, semakin memudahkan pelanggan dapat berkomunikasi dengan teman–temannya baik yang berlokasi di Indonesia maupun di luar negeri. Selain itu pelanggan juga dapat lebih mudah dan leluasa memilih paket layanan yang diinginkan sekaligus menikmati berbagai manfaat dari masing-masing paket yang ada “, demikian

ditambahkan Idil Darwan, Head of Medan Branch. Didukung jaringan Dengan program IM3 Mu24H itu tentu saja Indosat akan mengharapkan bertambahnya pelanggan. Dan pelanggan eksis pun tetap mendapatkan benefit dari semua penawaran. Atas dasar itulah agar pelanggan tetap terpuaskan Indosat tetap menjaga performa jaringannya tana hambatan. Bahkan beberapa waktu lalu saja ketika ada beberapa event dan hari besar keagamaan saja jaringan tidak sampai terganggu. “Kami berupaya mengantisipasi kemungkinan kenaikan trafik dengan meningkatkan kualitas dan kapasitas jaringan, baik untuk voice, SMS maupun data ketika pelanggan terus bertambah. Bahkan kita juga dilengkapi dengan Command Center di Jakarta, serta didukung SDM yang siap siaga memastikan bahwa jaringan tetap melayani pelanggan dengan baik dimana pun mereka berada,” kata Idil Darwan. Dia menegaskan lonjakan trafik Indosat saat ini mengalami lonjakan karena akumulasi pelanggan. Bahkan di beberapa hari besar misalnya trafik SMS menjadi 532,91 juta atau naik menjadi 142,09 persen dibanding hari biasa. Trafik suara dan data pun di periode tersebut meningkat lebih dari 130 persen untuk

suara dan lebih dari 119 persen untuk data dibanding trafik hari biasa. Me n u r u t n y a , t i n g k a t keberhasilan pengiriman SMS antar pelanggan Indosat pun mencapai lebih dari 90 persen dan antar operator dan 94,31 persen. “Penjelasan ini sebenarnya untuk menjelaskan kalau kita serius mengelola jaringan. Walaupun pelanggan kita bertambah jaringan tetap kita utamakan,” tuturnya. Sebab jangan sampai ketika ada tarif murah seperti IM3 Rp24 menit sepanjang hari ini, lalu pelanggan bertambah mereka kesulitan berkomunikasi. “Yang seperti itu kita cegah. Jangan sampai pelanggan kecewa. Kita ingin murah pun tapi berkualitas,” ujar Idil Darwan. “Tetap melayani pelanggan dengan layanan yang prima dan didukung performansi jaringan yang handal, telah menjadi komitmen kami dimana pun dan kapan pun mereka berkomunikasi. Performansi layanan yang prima ini akan tetap terus menemani pelanggan untuk dapat berkomunikasi dengan nyaman,” tambahnya. Intinya, kata dia, semua program tarif murah yang diluncurkan Indosat tetap dicover oleh jaringan “Jadi semua sudah dipersiapkan sehingga komitmen kita memberi yang terbaik kepada pelanggan bisa tercapai,” ujarnya.(m13)

Sumatera Utara

Senin 1 November 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:11 12:24 12:12 12:19 12:18 12:15 12:12 12:07 12:14 12:14

‘Ashar 15:31 15:45 15:31 15:39 15:38 15:34 15:31 15:27 15:34 15:34

Magrib 18:12 18:24 18:13 18:18 18:18 18:18 18:13 18:09 18:15 18:14



Shubuh Syuruq


19:22 19:33 19:22 19:28 19:28 19:28 19:23 19:18 19:25 19:24

04:42 04:57 04:43 04:51 04:50 04:44 04:42 04:38 04:45 04:46

04:52 05:07 04:53 05:01 05:00 04:54 04:52 04:48 04:55 04:56

L.Seumawe 12:17 L. Pakam 12:10 Sei Rampah12:09 Meulaboh 12:21 P.Sidimpuan12:09 P. Siantar 12:09 Balige 12:09 R. Prapat 12:06 Sabang 12:24 Pandan 12:11

06:08 06:23 06:09 06:17 06:16 06:10 06:08 06:04 06:11 06:11

Zhuhur ‘Ashar 15:37 15:30 15:29 15:41 15:27 15:29 15:29 15:25 15:45 15:29




Shubuh Syuruq


18:17 18:11 18:10 18:22 18:12 18:11 18:12 18:09 18:23 18:13

19:26 19:21 19:20 19:31 19:21 19:21 19:21 19:18 19:33 19:23

04:50 05:41 04:41 04:53 04:38 04:40 04:39 04:36 04:57 04:40

05:00 04:51 04:51 05:03 04:48 04:50 04:49 04:46 05:07 04:50

Sibolga 12:11 Sidikalang 12:12 Sigli 12:22 Singkil 12:15 Stabat 12:12 Takengon 12:18 T.Balai 12:07 Tapaktuan 12:17 Tarutung 12:10 T.Tinggi 12:09

06:16 06:07 06:06 06:19 06:04 06:06 06:05 06:02 06:23 06:06

Zhuhur ‘Ashar 15:29 15:31 15:42 15:34 15:31 15:38 15:26 15:36 15:29 15:29





Shubuh Syuruq


18:13 18:14 18:21 18:17 18:12 18:18 18:08 18:18 18:12 18:10

19:23 19:22 19:31 19:26 19:22 19:28 19:18 19:28 19:22 19:20

04:40 04:42 04:54 04:45 04:43 04:50 04:37 04:48 04:40 04:40

04:50 04:52 05:04 04:55 04:53 05:00 04:47 04:58 04:50 04:50

Panyabungan 12:07 Teluk Dalam12:14 Salak 12:12 Limapuluh 12:08 Parapat 12:10 GunungTua 12:07 Sibuhuan 12:07 Lhoksukon 12:17 D.Sanggul 12:11 Kotapinang 12:05 AekKanopan 12:07

06:06 06:08 06:20 06:10 06:09 06:16 06:03 06:14 06:05 06:06

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur ‘Ashar 15:26 15:32 15:31 15:27 15:29 15:26 15:25 15:37 15:30 15:24 15:26




Shubuh Syuruq

18:11 18:18 18:14 18:09 18:12 18:10 18:10 18:16 18:13 18:08 18:09

19:20 19:28 19:24 19:19 19:21 19:19 19:20 19:26 19:22 19:17 19:18

04:36 04:43 04:43 04:39 04:40 04:36 04:36 04:49 04:41 04:35 04:37

04:46 04:53 04:53 04:49 04:50 04:46 04:46 04:59 04:51 04:45 04:47

Satu Bulan 64 Penjudi Di Asahan Diamankan

Warga Portal Jalan Gunung Karang

KISARAN (Waspada): Polres Asahan selama Oktober 2010 mengamankan 48 kasus judi dengan 62 tersangka. Demikian Kapolres Asahan, AKBP J Didik Dwi Priantono, melalui Kasat Reskrim, AKP Yoris MY kepada Waspada, Minggu (31/10). Menurutnya, para tersangka diamankan karena tertangkap tangan menjual dan membeli toto gelap (togel), dan sebagian lagi bermain kartu yang akan diproses sesuai dengan hukum yang berlaku. “Dari tangan para tersangka ditemukan sejumlah note book berisi angkaangka togel, pulpen, telefon genggam dan uang yang diduga hasil dari perjudian,” ungkap Yoris. Pengamanan itu, kataYoris, merupakan kerja keras polsek jajaran Polres Asahan yang bekerja sama dengan masyarakat sekitar, dan hubungan itu harus ditingkatkan, sehingga tindakan kriminal dapat ditekansedinimungkin.“Barangsiapamelihatperjudianatautindakan kriminal lainnya, saya harap segera laporkan dengan pihak yang berwajib atau mengirim pesan ke No 081375582000, agar bisa diberi tindakan sesuai dengan hukum yang berlaku,” ungkapYoris. (csap)

BINJAI (Waspada): Warga Jalan Gunung Karang, Kelurahan Binjai Estate, Kec. Binjai Selatan, Kota Binjai, Minggu ( 31/10) bergotongroyong memasang portal. Pemuka masyarakat mengaku, pemasangan portal murni bertujuan menjaga perawatan JalanGunungKarang.’’Kamitidak melarang Jalan Gunung Karang dilintasitruk,namunharuspunya batas, sehingga tidak merusak jalan,’’ kata warga. Warga Jalan Gunung Karang memasang portal terbuat dari kayu pohon pinang yang tingginya ditentukan, tidak bisa dilintasi truk bermuatan yang tinggi. Pemasangan portal diakui tokoh masyarakat tidakpunyatendesius . “Ini murni menjaga perawatan jalan dan ketentraman masyarakat”ujarnya singkat. Pemasangan portal sebelumnyajugadilakukanmasyarakat Jalan Gunung Jayawijaya, sebab jalan di lokasi itu sudah mulai rusak. Pemasangan portal juga dilakukan masyarakat di jalan memasuki SMP Negeri 8 dengan bambu.(a03)

Judi Togel Di Langkat Kian Marak P.BRANDAN (Waspada): Bisnis judi toto gelap (togel) di Kab. Langkat cendrung semakin marak bak seperti pasar bebas. Praktik bisnis patologis ini berkembang luas karena lemahnya penegakan supremasi hukum. Penelusuran Waspada, peredaran kupon haram itu bukan hanya terbatas di wilayah perkotaan, tapi sudah merambah hingga ke perkampungan, bahkan ekspansi sampai ke pulau terpencil. Komunitas yang menggandrungi permainan adu peruntungan ini umumnya masyarakat stratafikasi menengah ke bawah, seperti kalangan nelayan, petani, buruh, sopir angkot dan para penarik beca. Sebagian dari hasil keringat masyarakat kelas bawah yang teropsesi untuk mendapatkan keuntungan berlipat dari pembelian kupon berhadiah ini habis disedot para bandar judi togel. Selamaini,wargaberanggapan,penangkapanyangdilakukanpolisi masihsebatasjurutulis(jurtul).Sedangkanparacukongnyaristaktersentuh. Kalaupun ada jumlahnya dapat dihitung dengan jari. Untuk memutus mata rantai bisnis judi togel, sejumlah pemuka masyarakat di Langkat mendesak Kapolres agar bertindak tegas. Pasca penangkapan “ratu” togel di Pangkalansusu beberapa pekan lalu, warga meminta Polres Langkat juga menangkap para “raja” togel yang kini terkesan bebas mengembangkan sayap bisnis haramnya.(a02)

Siswa SMA Tewas Di Kolam Renang Stabat STABAT (Waspada): Pandu Pegantara Bangun, 17, siswa kelas 1 SMA Negeri Stabat warga Kp Baru Tapos Kwalabegumit Stabat, ditemukan tewas di kolam renang Dendang Tirta Stabat, Jumat (29/10). Keterangan diperoleh Waspada, pada hari yang naas itu korban bersama sejumlah siswa lainnya disuruh berenang oleh guru dan hasilnya akan dinilai. Saat itu korban terlambat datang , diduga, tanpa diawasi guru dan pihak pengaman kolam renang, korban langsung masuk ke dalam kolam. Baru beberapa menit di dalam kolam, korban terlihat merapat ke dinding kolam. Yang membuat heboh, korban sudah tidak sadarkan diri dengan mulut mengeluarkan buih. Beberapa rekan korban yang melihat kejadian itu langsung memberikan pertolongan dengan mengangkat korban dari kolam renang tersebut kemudian membawanya ke Klinik Surya Stabat. Belum sempat mendapatkan perawatan, korban akhirnya tewas. Salah seorang perawat mengemukakan tidak ditemukan bekas benturan di tubuh korban, tetapi dari mulutnya mengeluarkan buih seperti orang keracunan. Ines, 19, kakak korban begitu mengetahui adiknya tewas di kolam renang menjerit histeris. “Adikku ini pintar kok berenang dan tidak memiliki penyakit,” ujar Ines yang heran mengapa adiknya tewas di kolam renang tersebut, padahal mereka ke kolam itu diawasi sejumlah gurunya. Aparat Kepolisian Sektor Stabat, ketika menjenguk korban di Klinik Surya terlihat sibuk mengambil data dengan mencatat sejumlah nama saksi dan teman korban untuk penyelidikan selanjutnya.(a01)

Razia Pekat Di Tanjungmorawa TANJUNGMORAWA (Waspada): Muspika Tanjungmorawa, Kabupaten Deliserdang yang dipimpin Camat Tanjungmorawa Hasbi merazia tempat-tempat yang diduga digunakan sebagai tempat berbuat mesum. Sabtu (30/10) malam. Camat Tanjungmorawa Hasbi mengatakan, razia dilakukan dalam rangka menciptakan situasi dan suasana yang kondusif serta merupakan kegiatan rutin. Diungkapkan Hasbi, saat ini angka penderita HIV/AIDS di Kecamatan Tanjungmorawa merupakan yang tertinggi di Kabupaten Deliserdang yang mencapai 112 orang. “Saya prihatin melihat jumlah penderita HIV AIDS di Tanjungmorawa dan juga banyaknya pelajar maupun remaja yang terlibat dalam pergaulan bebas. Diharapkan kepada para orangtua agar proaktif dalam membina anak-anaknya,” sebut Hasbi. KapolsekTanjungmorawa Malto S Datuan menyebutkan, mereka yang terjaring razia dibawa ke Mapolsek Tanjungmorawa untuk didata dan diberikan pembinaan. “Setelah orangtua maupun keluarga terdekat mereka datang menjemput mereka diperbolehkan pulang kerumah masing-masing,” kata Malto. Razia yang dilakukan di bawah guyuran hujan itu berada di tiga tempat yakni Kafe Walet yang berada di Desa Wonosari, Halay Inn yang berada di perbatasan Medan-Tanjungmorawa dan penginapan Sibulan di DesaWonosari. Dari ketiga tempat tersebut diamankan 14 pasangan bukan pasangan suami istri (Pasutri). Dua pasangan masih berstatus sebagai pelajar dan satu pasangan sesama jenis wanita yakni Ma, 17, warga Jalan Helvetia, Medan dan Su, 17, warga Galang, Kecamatan Pagar Merbau, Deliserdang. (csn)

PT SIT Buang Limbah Ke Sungai MEDAN (Waspada): Front Komunitas Indonesia Satu (FKI 1) Sergai bersama staf kantor Dinas Lingkungan Hidup Sergai, Radius Tambunan dan P Sihite menemukan dan terbukti perusahaan pengolahan tapioka PT SIT membuang lagi limbah ke sungai Rampah yang mengancam kehidupan warga yang hidup di sepanjang sungai tersebut. “Kami menemukan pembuangan limbah beracun itu tanggal 28 Oktober 2010 sekira pukul 17:30 yang mereka buang secara sengaja, “ kata M Nur BN ketua FKI 1 Sergai didampingi Seketarisnya Azis Tanjung kepada wartawan di Medan Minggu (31/10). Ditegaskannya, penemuan ini diharapkan bisa menjadi dasar untuk menangkap kembali pimpinan PT SIT berinisial AS alias Ahong yang sebelumnya sempat ditangguhkan penahananya oleh PNTebing Tinggi Deli dengan jaminan Rp 100 juta dengan catatan apabila Ahong membuang lagi limbah maka dia akan ditangkap lagi. “Kita mau lihat apakah PN bisa serius menangani ini, “ kata Nur FKI 1 Sergai, kata Nur akan terus memantau kasus ini dan terus berjuang agar pelaku pembuang limbah ke Sungai bisa mempertanggungjawabkan perbuatanya. “Bukti keseriusan, kami akan menyurati Ketua PN Tebingtinggi Deli dengan Nomor 644/FKI 1/ SB/X/2010,” katanya. Inti dari surat tersebut kata Nur, meminta PN Tebingtinggi Deli untuk menangkap kembali terdakwa AS alias Ahong sekaligus membatalkan penangguhan penahanannya sebab sudah terbukti AS melakukan kembali membuang limbah. (m39)

06:02 06:09 06:08 06:05 06:06 06:02 06:02 06:15 06:06 06:01 06:03

Waspada/Rasudin Sihotang

CUACA BURUK: Ratusan nelayan enggan malaut akibat cuaca buruk disertai angin kencang dan gelombang tinggi di perairan Selat Malaka, Minggu (31/ 10). Sehari sebelumnya, ombak setinggi tiga meter menghantam sebuah kapal kargo yang akhirnya tenggelam di perairan Tanjung Siapi-api, Sabtu (30/10) sekira pukul 03:00. Foto direkam, Minggu (31/10).

Korban Kapal Tenggelam Trauma TANJUNGBALAI (Waspada) : 14 korban kapal kargo Olimpia Baru yang tenggelam di Tanjung Siapi-api masih mengalami trauma sehingga belum bisa memberikan keterangan. Demikian Kepala Kantor

Administrasi Pelabuhan (Ad-pel) Tanjungbalai Asahan Aro-sokhi Nazara, dikonfirmasiWas-pada melalui Pelaksana Harian Juliansah didampingi staf M Fasi Minggu (31/10). Menurut Juliansah, kondisi psikologis 14 Anak buah kapal (ABK) masih labil dan belum bersedia menjelaskan seputar peristiwa itu. “ Petugas akan meme-riksa mereka Senin (1/11)untuk

mengetahui secara pasti kronologis terjadinya kecelakaan,” ucap Juliansah. Dikatakan,seluruhawakkapal yang berhasil diselamatkan yakni, Sugianto sebagai nakhoda, Kasim Marpaung, Ahmad Jaiz, Bastian Panjaitan, Junaidi Sirait, Muliadi, Hasan Basri sebagai anak buah. Kemudian Hendra Siswanto, Amrul,RikaAprianto,Pandapotan Sitorus, Syamsul Bahri, Ivan ci ciong dan Riswanto Sirait juga

anakbuah,semuanyawargaKota Tanjungbalai. Sebelumnya, sebuah kapal kargo Olimpia Baru tenggelam akibat dihantam ombak di perairanTanjung Siapi-api kawasan Selat Malaka, Sabtu (30/10) sekira pukul 03:00. 14 awak kapal termasuk nakhoda berhasil menyelamatkan diri dengan terjun kelaut dan ditolong oleh kapal penangkap ikan yang melintas di lokasi kejadian

(Waspada, Minggu 31/10). KapaldinakhodaiSugianto warga Kota Tanjungbalai, berlayar dari Portklang Malaysia tujuan pelabuhan Teluknibung, Tanjungbalai. Sesampainya di perairan Tanjung Siapi-api, tiba-tiba cuaca memburuk disertai angin kencang dan ombak setinggi 2-3 meter menenggelamkan kapal berikut isinya. (a37/crs)

Terhambatnya Pemungutan Suara Ulang Tanggungjawab Walikota TANJUNGBALAI (Waspada): Terhambatnya pemungutan suara ulang di 17 Keluarahan, Kota Tanjungbalai merupakan tanggungjawab Walikota. Demikian Sekretaris Fraksi PDI Perjuangan Hakim Tjao Kian LiekepadaWaspada,Minggu(31/ 10). Menurut Hakim, kewenangan untuk merealisasikan anggaran dana penyelenggaraan pemilihan umum berada di ta-

ngan kepala daerah dan tidak perlu menunggu izin prinsip dari DPRD. Dikatakan Hakim, jika dikaji ketentauan pengelolaan keuangan daerah, tak satupun klausul yang mengatur tentang izin prinsip DPRD, sehingga apabila Walikota menganggap pemungutan suara ulang 17 Kelurahan dalam keadaan mendesak dan harus segera dilaksanakan, maka

Pemko dapat mendahulukan anggarannya untuk kemudian diajukan dalam PAPBD. Lebih lanjut dikatakan Hakim, ketentuan tersebut diatur dalam pasal 162 ayat 6 huruf b Permendagri No. 13 Tahun 2006, mengamanatkan bahwa segala kegiatan dituangkan dalam rencana kerja dan anggaran satuan perangkat kepala daerah (RKA SKPD), kemudian disusun dalam

dokumen pelaksanaan anggaran satuan perangkat kepala daerah (DPA SKPD), dan pelaksanaan anggarannya diatur dengan peraturan Walikota. “Meskibelumtercoverdalam PAPBD, harusnya walikota tidak perluraguuntukmenganggarkan dana KPU sepanjang kebutuhan mendesak dan tidak dapat ditunda,” ucap Hakim. Ditambahkan, sesuai dengan

amar keputusan MK Nomor 166/PHPU.D-VIII/2010 yang memerintahkan KPU untuk melaporkan hasil pemungutan ulang selambatnya 60 hari setelah keputusan, maka dirinya menganggap saat ini pemungutan suara ulang 17 kelurahan dalam keadaan mendesak mengingat waktuyangdiberikanMKsemakin singkat. (a37/crs)

Keterbatasan Kesehatan Tak Halangi Janda Veteran Berhaji SERATUSAN calon haji dan hajjah(Calhaj)tampakmemasuki aula Pangeran Bedagai kompleks kantor Bupati Serdang Bedagai dalam rangka pelepasan keberangkatan para tamu Allah itu oleh Bupati Sergai yang diwakili olehWabup H Soekirman, Ketua DPRD Sergai H Azmi Y Sitorus dan Ketua MUI Sergai menuju Asrama Haji Pangkalan Mahsyur di Medan, Minggu (31/10) di Sei Rampah Ketika hampir seluruh Calhaj memasuki ruangan, pandangan Waspada mengarah kepada seorang Calhaj yang berjalan menggunakan alat bantu tongkat besi berkaki tiga dengan panjang sekitar satu meter yang tampak sedikit kesulitan, dibantu seorang keluarga menuju kursi yang telah disediakan. Buru-buru Waspada menyambangi sang ibu yang setelah berkenalan ternyata bernama Nasiah br Lubis binti Abdullah Lubis, 70, warga Dusun III, Gang Seroja Kec.Perbaungan yang berstatus janda dari seorang veteran (alm) Ismail MS Nasution yang meninggal sekira 25 tahun yang silam. Selanjutnya ibu 7 anak itu kepadaWaspadamembukakisah bahwadirinyasudahlamaberniat menunaikan ibadah haji, setelah menabung bertahun-tahun dari uang pensiunan suami. Dia bekerja sebagai seorang tukang kusukkhususwanitayangkinisudah ditinggalkannya, sembari mengurusi anak-anak akhirnya bisa mendaftarkan diri pada tahun 2007.

“Tetapipadaawaltahun2008, cobaan itu datang, ketika saat itu saya sedang berjalan tiba-tiba terjatuh yang akhirnya untuk berjalan harus menggunakan tongkat ini. Tanpa alat ini akan mengganggu keseimbangan bahagian kaki, bahkan bisa terjatuh,” jelas IbuNasiahsembarimenunjukkan tongkat dengan 3 kaki miliknya. Namunsemuainitidakmenjadikanpenghalangsemangatdan kerinduanuntukmenunaikanrukun Islam yang ke lima ini dan tetap yakin bahwa dalam menjalani rukun haji nantinya akan diberikan kemudahan oleh Allah SWT, selain itu juga ada salah seorang kerabat yang juga berangkat bersamanya, imbuh nenek 13 cucu itu. “ Saat ini saya tinggal di tanah warisan orang tua di Desa Sei Jenggi bersama anak ke 5, Aslamiah nasution, 32, dan menantunya Supian Effendi Lubis,32, dan keberangkatan ke tanah suci ini. Selain menjalankan rukun Islam juga benar-benar niat yang tulus untuk beribadah, terlebih di usia senja ini, sedangkan untuk biaya hidup sudah cukup dari uang pensiun suami sekitar Rp896 ribu,” ujar ibu Nasiah mengakhiri. Dilepas Wabup Diiringi adzan dan suasana haru, 172 calhaj asal Sergai yang tergabung dalam kloter 18 embarkasi Polonia Medan, Minggu pagi (31/10) secara bersama dilepas Wakil Bupati Sergai Ir H Soekirman dan Ketua DPRD Sergai H Azmi Yuli Sitorus, SH. MSP. Calhaj diberangkatkan de-

ngan menggunakan beberapa unit bus terdiri dari 73 laki-laki, 99 perempuan dan menurut data dari kantor Kementerian Agama Sergai jamaah calhaj asal Sergai terdaftar sebanyak 173 orang. Namun jumlah itu berkurang karena seorang calhaj perempuan atasnama Ngatiyem warga Desa Sei Bamban , Kecamatan Sei Bamban tidak dapat berangkat karena meninggal dunia sebelumnya. Wakil Bupati Sergai H Soekirman sesaat menjelang pelepasan calhaj itu dalam sambutannya mengharapkan kepada para tamu Allah itu untuk senantiasa menyampaikan rasa syukur dengan memanfaatkan rahmat yang diterima sebaik mungkin. “Laksanakan semua ibadah sesuai aturan dan prioritasnya mulai rukun, wajib dan sunat sebagaimana tuntunan Nabi Muhammad SAW,” ajakWabup Soekirmankepadaparajemaah.Selain itudiharapkanagarjamaahcalhaj mulai persiapan keberangkatan menuju tanah Suci hingga pelaksanaan ibadah dan sampai kembali ke Kabupaten Sergai dapat menjaga kesehatan, berusaha memelihara perilaku, perbanyak sabar dan paling utama membulatkan tekad dengan niat berangkat haji adalah semata-mata kerena Allah SWT, ucap H. Soekirman. Seluruh jamaah calhaj yang akan berangkat ke tanah suci Makah diharapkan Soekirman tidak lupa mendoakan pemerintahan dan masyarakat Kabupaten Sergai, sehingga terhindar dari segala

Waspada/Edi Saputra

ALAT BANTU: Walaupun harus menggunakan alat bantu tongkat, Nasiah br Lubis,70, (paling kanan) Calhaj asal Dusun III Desa Sei Jenggi Kec.Perbaungan tampak tetap bersemangat ketika berada dalam bus menuju Asrama Haji, Pangkalan Mahsyur Medan, Minggu (31/10). macam bencana maupun kesulitan yang dapat merugikan, baik moril maupun materil serta kendala-kendala dalam memperjuangkan kesejahteraan masyarakat di “tanah bertuah negeri beradat” Kabupaten Sergai. Menurutnya, pada musim haji tahun 2010 ini jamaah calhaj asal Kabupaten Sergai masuk kelompok terbang 18 embarkasi Polonia Medan bergabung dengan jamaah calhaj asal Kota Tanjungbalai,KabupatenAsahan, Batubara dan Kota Medan.

Sesuai rencana calhaj Sergai pada hari Senin (1/11) sekira pukul 12:30 akan berangkat dari bandara Polonia Medan menuju tanah Suci dan tiba di Jeddah/ Madina pada pukul 17:00. Tahun mendatang sebut H. Soekirman, jumlah jamaah calhaj asalKabupatenSergaidiharapkan semakin bertambah dari musim haji tahun-tahun sebelumnya seiring dengan meningkatnya tingkat kesejahteraan masyarakat Kabupaten Sergai. Edi Saputra

Mantan Sekdako Binjai Siapkan Pengacara BINJAI (Waspada): Terkait penebaran selebaran yang dilakukan GA, oknum yang mengaku Direktur Eksekutif LSMWC, mantanSekdakoBinjaiDrsHAliSyafril Tanjung,MAPmenyiapkanbeberapa pengacara. Sebelumnya mantan Sekda ini telah melaporkan oknum mengaku Direktur Eksekutif LSM WC yang berintial GA ini ke Polresta Binjai Selasa (5/10) lalu. Polisi telah memproses kasus pencemaran nama baik ini dengan memintai keterangan Staf KonsultanWalikota Binjai Hatta Daulay dan Kadis Keuangan Pemko Binjai Erlina Pulungan sebagai saksi,ujar Kasat Reskrim Polresta Binjai AKP Roni Bonic, Sabtu (30/10) via telefon selularnya. Menurut Ali Syafril, pemakaian mobil dinas Toyota Kijang InnovamilikPemkoBinjamelalui suratresmiyangdisetujuiWalikota saat itu Ali Umri dan Walikota saatiniHMIdaham.Bahkankatanya, surat penarikan mobil tersebut belum ada. Menurut mantan Sekda ini, pemakaianmobildinasituadalah resmi dan malah saya saat ini masih tercatat sebagai anggota penelitian pengembangan (Litbang) Pemko Binjai dan juga sebagai Ketua PMI Kota Binjai. (a04)

Pembangunan Jembatan Di Desa Plawi Utara Rampung P.BRANDAN (Waspada): Pembangunanjembatanbajadari Austria dikerjakan PT Gunung Mega Jaya diJalan Lingkar, Desa Plawi Utara dan Securai Utara sudah rampung. Demikian Direktur PT Gunung Mega Jaya Ir M Situmorang kepada wartawan, Sabtu (29/10). Dikatakan,pembangunanrangka bajajembatanlingkarukuran50x7 meter berasal dari pagu dana APBD Langkat 2010 sebesar Rp.4.953.371.060 dengan kontrak kerja, dari 20 Agustus hingga 17 Desember.“Namunpertengahan Novemberjembatansudahdapat diperguunakan,” ungkapnya. Humas LSM Perjuangan dan Keadilan Langkat M Sofiyan Rokan, SPd di tempat terpisah mengatakan, atas nama wargaTeluk AruberterimakasihkepadaBupati Langkat Ngogesa Sitepu dan PT GunungMegaJayaMedanselaku kontraktor jembatan yang selama ini arus lalulintas didaerah sekitar sangat padat dan sering macet. Dengan rampungnya jembatan tersebut dapat mengurangi kemacetan. Ketua GAMMI Babalan Aminullah Ok mengatakan, PU Langkat sangat tepat memilih kontraktor yang mengerjakan jembatan lingkar ini yang profesional sehingga pekerjaan tepat waktu. Dia meminta warga sekitarnyamenjagadanmerawatjembatan sehingga arus perekonomian rakyat dapat lancar. (c02)


Sumatera Utara

Fit And Proper Test Jangan Sekedar Formalitas SEIRAMPAH (Waspada): Setelah tahun 2005 lalu Pemerintah Kab. Serdang Bedagai dibawah kepemimpinan ErrySoekirman, kembali melaksanakan fit and propertest 200 pejabat di lingkungan Pemkab, yang baru-baru ini.

Hal itu diselenggarakan di kantor Gubsu, di Medan yang dimaksudkanuntukmengujikompetensi, keahlian dan pemahaman para

pejabat sesuai bidangnya masing-masing. Selain itu upaya itu juga sebagai bentuk komitmen ErrySoekirman dalam melanjutkan visi pembangunan di berbagai bidang. “Kita sangat mendukung danmengapresiasisetinggi-tingginya langkah Erry-Soekirman itu. Sebagai pemimpin, idealnya memang mereka harus didukung pejabat-pejabat yang ahli di bidangnya masing-masing,’’ demikian ungkap aktivis OS Institute Rustam Efendi, SH, Rabu (27/10) kepada Waspada di Sei Rampah. Namun, kata dia, perlu di-

ingatkan, pelaksanaan fit and propertest itu jangan formalitas semata. Dimana kebijakan itu dibuat hanya sebatas ingin mengambil legitimasi publik. “Kita semua mengharapkan hasilnya dijadikan tolok ukur dan standar uji dalam menempatkan pejabat disamping sisi loyalitas dan dedikasi selama ini,’’ ujar pria jebolan Fakultas Hukum Universitas Andalas (Unand) Padang, Sumatera Barat ini. Serdang Bedagai dalam melanjutkan program pembangunan, sangat membutuhkan pejabat -pejabat yang punya kompetensidankeahliandibidangnya

masing-masing, harap Rustam mengakhiri. Sekretaris Daerah Kab. Sergai Drs H Haris Fadillah, MSi mengatakan, fit and propertest merupakan salah satu acuan atau tolok ukur mengevaluasi pejabat sehingga menghasilkan orang yang tepat dengan jabatan tepat the right man in the right job, jelasnya kepada Waspada. Disamping itu fit and propertest ini juga untuk menilai seseorang dapat bekerja sama dan melakukan koordinasi dengan SKPD lainnya, dan disinilah pimpinan menilai disamping segi kepintaran, kerjasama, loyalitas serta disiplin, papar Haris. (ces)

WASPADA Senin 1 November 2010

Polres Simalungun Adakan Kesepakatan Kerjasama Pengamanan Perkebunan P. SIANTAR (Waspada): Polres Simalungun dalam waktu dekat akan mengadakan kesepakatan kerjasama pengamanan dan penyelamatan objek vital perkebunan negara maupun swasta di wilayahhukumPolresSimalungun. “Maksud dan tujuan kesepakatan kerjasama itu guna memberikan gambaran mengenai kerjasama pelaksanaan pengamanan untuk menjamin kelan-

caran operasioanl dan memberikan rasa aman bagi karyawan perkebunan BUMN maupun swasta,” sebut Kapolres Simalungun AKBP Drs Marzuki, MM melalui Kasubbag Humas Iptu Sulaiman Simanjuntak di Mapolres, Rabu (27/10). Simanjuntak, kesepakatan kerjasama itu sebagai pedoman bagi para pihak dalam pengamanan kelancaran operasional

dan memberikan rasa aman bagi karyawan perkebunan BUMN danswastadimasing-masingunit kebun. Mengenai ruang lingkup kesepakatan kerjasama itu, Sulaiman menyebutkan berupa pengamanan terhadap kegiatan operasional perkebunan BUMN danswastadimasing-masingunit kebun dari setiap ancaman maupun gangguan dari pihak-pihak

tertentu seperti sabotase, pencurian aset/material, kerusuhan massa dan lainnya dengan cara mengoptimalkan koordinasi pengamanansertalokasilingkungan perkebunan BUMN dan swasta di masing-masing unit kebun serta pengamanan terhadap kantor karyawan/personil dan karyawan perkebunan BUMN danswastadimasing-masingunit kebun.(a14)

WASPADA Senin 1 November 2010

Proyek Miliaran Rupiah Di Batubara Tanpa Plank BATUBARA (Waspada): Pembangunan turap penahan tanah antara Desa Mesjidlama ke Limalaras/Ujungkubu bernilai miliaran rupiah yang sedang dikerjakan menimbulkan tanda tanya, karena tidak ada plank proyek. Samsul, salah seorang warga Tanjungtiram, Rabu (27/10) mengungkapkan, proyek pembangunan turap kiri dan kanan badan jalan di Bagandalam sampai Limalaras menimbulkan kecurigaan karena kurang transparan sebab tidak ada plank proyek. Karenaitu,katanya,tidakjelasberapabesarvolumepembangunan, seperti panjang, ketinggian turap, asal dana dan besarnya biaya. Bangunan turap di lokasi lewat jembatan Limalaras terdapat pada beberapa titik, sudah retak dan renggang. Diduga campuran semen dan pasir tidak sesuai sehingga mudah retak. Sementara, warga lain, Samsul mengatakan, kalau proyek tanpa plank sehingga tidak diketahui kontraktornya, bisa saja disebut proyek siluman. Disebutkan, Rabu (27/10) terlihat beberapa petugas Dinas PU mengukur turap yang sudah dikerjakan, lalu ada warga datang melaporkan bangunan turap asal jadi.(a30)

Mobil Dinas Pimpinan DPRD L.Batu Harus Dikembalikan RANTAUPRAPAT (Waspada): Keberadaan mobil dinas di DPRD Labuhanbatu hingga kini ternyata masih dikuasai orang yang tidak berhak. Hal itu berdasarkan Peraturan Nomor 11 Menteri Dalam Negeri tentang Perubahan Atas Peraturan Nomor 7 tentang standarisasi sarana dan prasarana kerja pemerintah daerah terkai penggunaan mobil dinas bagi aparatur pemerintah. Salah satu poinnya tertera, bagi Ketua DPRD kabupaten dan diberi fasilitas mobil jenis sedan atau minibus yang berkapasitas/ isi silinder 2.500 cc. Sedangkan untuk wakil ketua DPRD kabupaten 1 unit sedan atau minibus 2.200 cc. Sementara itu 2 unit mobil dinas pimpinan yang harus berada di Sekretariat DPRD, malah dipakai oleh orang lain dan 2 mobil dinas lainnya dipakai mantan anggota dewan yang sudah pensiun. Menanggapi hal itu, Fuad Siregar selaku Sekretaris DPRD Labuhanbatu menjelaskan, sesuai perubahan yang ditetapkan oleh Mendagri, meskinya mobil dinas pimpinan tetap diberikan satu unit danuntukmobil yang diberikankepadawakilKetuaDPRDdisesuaikan jenisnya agar mobil itu dapat dipakai. (c01)

Wabup Ajak Pertahankan Persatuan Dan Kesatuan RANTAUPRAPAT (Waspada):Wakil Bupati Labuhanbatu Suhari Pane, SIP mengajak Pemuda Pancasila turut mempertahankan persatuan dan kesatuan agar tidak mudah dipecah belah. Hal itu dikemukakannya saat menghadiri HUT Ke-51 PP di Sekretariat MPC PP Labuhanbatu, Kamis (28/10). Hadir segenap komponen dan pengurus PP Labuhabatu, yakni Daiman Rambe selaku ketua, Sofyan ST (Sekretaris), Akhyar (Ketua PP R.Utara), Konong (Ketua Koti), Haris Tambunan (Ketua LPPH PP), Nining Ketua Srikandi, Ketua dan Sekretaris KNPI L.Batu,Pengurus OKP lain serta Direktur Asuransi Wana Green Life Situmeang dan Ayong selaku mitra. Sebelumnya, segenap pengurus PP melakukan ziarah ke makam para senior dan pendahulu PP L.Batu di antaranya almarhum Sofyan Nasution dan almarhum Khairuddin Nasri Dalimunte serta memberikan tali asih pada ahli warisnya.(a26)

Alumni SMEAN Rantauprapat Angkatan 70-90 Gelar Reuni Akbar RANTAUPRAPAT (Waspada): Alumni SMEA Negeri Rantauprapat yang kini berubah namanya menjadi SMKN 1 Rantauprapat angkatan 1970-1990akanmelaksanakanreuniakbar,Sabtu13Novembermendatang di Aula sekolah tersebut di Jalan Ahmad Yani Rantauprapat. Ketua Panitia Reuni H Rakkir Dalimunthe kepada wartawan, Rabu (27/10) di Rantauprapat mengatakan, selain bernostalgia untuk ajangtemukangen,jugaakandihiasiberbagaikegiatandankomunikasi sesama alumni yang sudah puluhan tahun tidak bertemu, sekaligus pembentukkan ikatan alumni. Menurutnya, selain dihadiri seluruh alumni pihaknya juga akan menghadirkan kepala sekolah pertama sejak berdirinya SMEA Rantauprapat (Bapak I Panjaitan-red), seluruh mantan guru dan pegawai sekolah sampai pada penjual makanan di kantin sekolah itu. “Mereka semua sengaja diundang sesuai dengan permintaan alumni, karena seluruh alumni memiliki kenangan tersendiri dengan mereka,” jelas Rakkir yang didampingi Sekretaris Panitia H Mukhtar. Ditambahkan, semua alumni SMEA Rantauprapat sejak alumni 1970hingga1990yangtersebardiseluruhpelosoknusantaradiharapkan turut serta memeriahkan kegiatan ini dengan kehadirannya. Bagi para alumni yang belum menerima undangan dapat menghubungi sekretariat panitia SMK Negeri 1 Rantauprapat atau melalui email : atau dapat menghubungi langsung H Rakkir Dalimunthe ke nomor 081375301253, Usman 085270741642, Maimunnah 085276228421, Irianum Panjaitan 081362418166. (a27)

Bupati Bentuk Tim Penelusuran LIMAPULUH (Waspada): Bupati Batubara OK Arya Zulkarnain SH,MM membentuk tim khusus menelusuri kericuhan pelaksanaan proyek pemotongan sungai Labuhanruku, Kec. Talawi semilai Rp 430 juta bersumber APBD 2010 yang sampai sekarang tertunda karena intervensi pihak ketiga serta aparat kecamatan. ‘’Kitaharapkantimkususdibentukbupatinantimenyelusuridugaan keterlibatan oknum tertentu maupun orang dalam sendiri sehingga berbuntut ricuh tertundanya proyek,’’tukas tokoh masyarakat/Pemuda Ramadhan serta Jhon Adek kepada Waspada, Rabu (27/10). Menurutnya, bila ditelusuri dari awal, Pemkab Batubara secara tegas mengalokasikan dana proyek untuk pemotongan sungai sebagaimana direncanakan dalam mengantisipasi banjir pasang laut yang menghantam pemukiman penduduk. Belakangan, proyek pemotongan terancam batal, namun akan dialihkan kepada normalisasi atau pendalaman alur sungai dengan dalih pemilik lahan yang terkena proyek tidak bersedia memberikan lahannya. Selainitu,adapihakyangsebelumnyamenyanggupimenyelesaikan masalah itu asalkan diberi fee atau imbalan oleh rekanan yang mengerjakannya. Padahal, status lahan di sekitar proyek dipertanyakan karena di pinggir sungai (Daerah Aliran Sungai atau DAS) serta dalam kawasan hutan yang saat ini telah beralih fungsi menjadi perkebunan kelapa sawit.(a11)

Lembaga Pendidikan Aset Daerah TANJUNGBALAI (Waspada) : Lembaga pendidikan merupakan aset daerah yang paling berharga, sebab memiliki peran penting dalam membentuk sumber daya manusia (SDM) berkualitas. Demikian papar praktisi pendidikan Tuah Manurung selaku nara sumber dalam seminar dan lokakarya serta diskusi ilmiah tentang berbagai isu pendidikan di aula Kantor Camat Teluknibung, Kota Tanjungbalai, (26/10). MenurutTuah, menjaga aset penting tersebut perlu ada sinerjitas tiga komponen penunjang pendidikan. Di antaranya, pemerintah, pengelola sekolah dan masyarakat. Dikatakannya, kerjasama dan dukungan dari ketiga unsur menjadi satu kesatuan yang menjadi tolak ukur serta tidak dapat dipisahkan satu dengan lainnya. Dikakatakan Tuah, pemerintah sebagai lembaga yang menaungi pendidikandiharapkanmemberikanperhatianpenuhkepadasekolahsekolah, terutama terkait biaya operasional sekolah, agar roda pendidikan terselenggara dengan baik. Ditambahkannya, pemerintah hendaknya memberikan perlakuan yang sama antara sekolah di perkotaan dengan perdesaan. Disamping itu, sebagai pengelola sekolah, kepala sekolah dan tenaga pendidik dituntut memiliki kemampuan manajemen yang baik dan ditunjang sumber daya manusia bermutu, agar lembaga tersebut dapat melahirkan pelajar berprestasi. Tidak kalah penting, kataTuah, partisipasi dan peran serta masyarakat dalam memberikan kritik serta saran membangun dibutuhkan guna, menciptakan kontrol langsung terhadap sekolah.(crs)

Sumatera Utara


Rumput Laut Primadona Baru Di Batubara LIMAPULUH(Waspada): Kelompok masyarakat (Pokmas) Beringin Jaya, Kab. Batubara bertekad mengalakkan budidaya rumput laut di perairan Desa Kuala Tanjung, Kec. Seisuka, guna menambah penghasilan. ‘’Proposal kegiatan ini telah disusunmaupundiajukankepada

pemerintah pusat melalui Kementerian Kelautan dan Perikanan RI DR. Fadel Muhammad dengan harapan untuk mengalokasikan bantuan dana APBN Tahun 2011,’’tukas Ketua Pokmas Beringin Berjaya, Parlin Panjaitan kepada Waspada, Selasa (26/10). Pertemuan itu berlangsung setelah penutupan Rapat PimpinanNasional(Rapimnas)Partai Golkar 19 Oktober 2010, di Ruang Serbaguna Timor Hotel Borobudur Jakarta. Termasukaudiensimenemui Direktur Jenderal Perikanan Bu-

didaya DR.Ir Madel Soedjana mendukung penuh rencana budidaya rumput laut. Apa lagi dikaitkan dibangunnya Kawasan Ekonomi Khusus (KEK) di Seisuka dan Medang Deras yang didukung dengan potensi daerah serta sarana prasarana dimilikki sehingga budidaya rumput laut merupakan usaha menjanjikan bagi masyarakat pesisir. BatubaralayakdibangunKEK sebagaimana digagas Bupati OK Arya Zulkarnain, SH,MM maupun disampaikan ke menteri.

Wakil Ketua Depicab Soksi dan Wakil Sekretaris DPD Partai Golkar Batubara ini mengatakan pertemuan dihadiri Ir. AliWongso Halomoan Sinaga anggota Fraksi Golkar dan Komisi-V DPR RI. Hasil studi kelayakan awal program KEK di Batubara telah selesai dilakukan dengan melakukan peninjauan langsung kelapangan oleh tim dipimpin Prof. MosesdariITSdanditindaklanjuti penanda tanganan kerja sama denganPemkabBatubara30September 2010 di Surabaya.(a11)

Waspada/Iwan Has

AUDIENSI: Ketua Pokmas Beringin Jaya Kab Batubara Parlin Panjaitan bersama Dirjen Perikanan Budidaya Madel Soedjana saat audiensi Selasa (26/10).

Sumatera Utara C4 Hama Serang Ratusan Ha Padi Di T. Mengkudu

WASPADA Senin 1 November 2010

T.MENGKUDU (Waspada): Berbagai jenis hama menyerang ratusan hektare tanaman padi berusia sebulan di Kec.Teluk Mengkudu, Kab.Serdang Bedagai. Hama itu antara lain ulat gulung, kepindingbatu(lembing), nyamuk hijau serta kepik hitam, akibatnya daun menjadi jarang danmerahdanpertumbuhannya lambat. Petani, Masran , 40, dan Suparlan, 40, warga Dusun VI Cengal, Desa Pematang Setrak, Kec.Teluk Mengkudu, Rabu (27/ 10) mengatakan, serangan hama sejak sepekan belakangan ini, padahal ketika musim tanam sebelumnya, serangan serentak berbagai jenis hama seperti ini belum pernah terjadi. Biasanya, imbuh petani lain, jika tanaman padi telah berusia sebulan, antisipasinya menyemprotkan pestisida yang disarankan penyuluh pertanian, namun jika kondisi ini berlanjut, para petani akan melakukan penanaman ulang walaupun harus merugi seperti di Desa Pematang Tatal, Kec.Perbaungan. Diakuimereka,merasasangat kewalahan dengan serangan hama yang cukup bervariasi tersebut yang tidak mengetahui secarapastipenyebabnya,apakah perubahan iklim yang semakin tidak menentu atau efek samping

Waspada/Edi Saputra

RUSAK: Seorang petani menunjukkan tanaman padi yang rusak karena serangan berbagai jenis hama di Desa Pematang Setrak, Kec.Teluk Mengkudu. Foto direkam, Rabu (27/10). penggunaan insektisida yang berlebihan. Ketua Kelompok Tani Mawar, Wagimin Unggul ,50, mengatakan telah meyampaikan kasus itu pada Penyuluh Pertanian Lapangan (PPL) dan juga Dinas Pertanian. “Setelah petugas datang dan memberikan obat obatan untuk mencegah sekaligus membasmi hama itu, memang ada perubahan, namun serangan hama bertambah dari jenis yang satu ke jenis yang lain,” keluhWagimin kepada Wartawan. Kepala Dinas Pertanian dan Peternakan Sergai Ir Mega Hadi

mengatakan, telah mengirim petugas mendampingi para petani untuk mengatasi hama dan terjadinya serangan hama itu disebabkan kelembaban yang tinggi. Namun biasanya jika usia tanaman padi memasuki 1,8 bulan dengan sendirinya akan tahan terhadap serangan hama itu, terangnya. Khusus mengatasi serangan hama lembing, para petani diimbau menggunakan perangkap lampu di sawah, sehingga keesokan harinya akan berkumpul di sekitar lampu sehingga memusnahkannya akan lebih mudah, katanya. (ces)

26 Anggota DPRD Palas Tukar Informasi Ke Pulau Jawa SIBUHUAN (Waspada): 26 Anggota DPRD Kab. Padanglawas kembali melakukan perjalanan ke Pulau Jawa, di antaranya Komisi A, B dan komisi C DPRD Kab. Padanglawas, sedang Ketua DPRD menyusul kemudian, sementara tiga anggota DPRD sedang melaksanakan ibadah haji ke Mekkah. Kabag Umum dan Risalah PersidanganDPRDPadanglawas, Agustin Ritonga kepada wartawan, Rabu (27/10), DPRD yang melakukan tukar informasi itu seperti Komisi A ke Kota Bogor Provinsi Jawa Barat, Komisi B ke

Kab. Sukabumi Provinsi Jawa Tengah dan Komisi C ke Kota Tangerang Provinsi DKI Jakarta dan berangkat secara bergilir sejak 22 Oktober hingga 31 Oktober, namun keberangkatan mereka secara bergantian selama 4 hari setiap komisi. Untuk komisi A akan berangkat, Kamis (28/10) besok ke daerah yang sudah ditentukan, namun tetap menunggu kepulangan Komisi B terlebih dahulu, katanya. SementaraSekwanDPRDPadanglawas Mardiah LumbanTobing mengatakan, perjalan dan

tugas luar DPRD itu sesuai Daftar Penggunaan Anggran (DPA) dengan anggaran setiap anggota DPRD mendapat SPJ sebesar Rp11,5 juta per anggota DPRD untuk kebutuhan makan, penginapandanongkosselamadiPulau Jawa. Pengamatan Waspada, pada pukul 11:00, Rabu (27/10) kantor DPRD Kab. Padanglawas terlihat sepi yang ada hanya Ketua DPRD PalasHMRidhoHarahap,na-mun sesuai jadwal Kamis malam akan berangkat juga mengikuti tukar informasi ke Pulau Jawa.(a32)

Semua Pihak Harus Perhatikan Kualitas Fisik Bangunan PANYABUNGAN(Waspada): Dugaan kuat terjadinya pengurangan mutu dan kualitas terhadap pembangunan fisik yang di tenderkan setiap instansi pemerintahyangsaatinitahappekerjaan harus menjadi sorotan bagi setiap masyarakat,LSM,pers,kepolisian, kejaksaandanlembagapemerhati Ketua DPP Himpunan Pemuda Mandailing (HIPMA) M SuheryLubis,S.FilkepadaWaspada, Kamis (28/10) di Panyabungan. Suhery menambahkan, berbagaiupayapembangunansarana

infrastur telah dilakukan pemerintah untuk kepentingan rakyat, mulai dari dana DAK/DAU, APBD, APBN. Dana ini seharusnya jangan di gerogoti segelintir orang dengan memanfaatkan kekuasaan serta kedekatan jaringan untuk kepetingan pribadi atau golongan dengan mengabaikan mutu dan kualitas setiap proyek. “Belakangan ini, pembangunan fisik itu banyak terlihat tidak beres, mulai dari pengurangan mutu dan kualitas bangunan,” katanya.

Dikatakannya, konsultan, PPTK dan pengawas harus bertanggungjawab terhadap kelayakan ketahanan setiap pembangunan fisik yang terjadi di lapangan. Sebab para kontraktor sepertinya lepas tangan setelah PHO, hal ini ditambah dengan masa perawatan selama enam bulantidakada.Begitujugadengan konsultan yang melakukan perencanaan setiap pekerjaan fisik harus memberikan daya tahan dankekuatanpembangunanfisik dalam jangka panjang. (cpin)

3 Pengangguran Main Judi Tidak Ditahan P. SIANTAR (Waspada): Tiga orang pria pengangguran, HS, 39, warga Parluasan, U, 38, warga Jalan Karya Bakti dan WHP, 35, warga Jalan Agus Salim, Kelurahan Serbelawan, Kecamatan Dolok Batunanggar, Kabupaten Simalungun diduga bermain judi leng, tidak ditahan Polsek Serbelawan, Polres Simalungun. Keterangan dihimpun menyebutkan HS, U dan WHP ditangkap pihak Polsek Serbelawan saat bermain judi leng menggunakan kartu joker di dalam rumah milik saksiTety br Nasution, Gang Al Wasliyah, Kelurahan

Serbelawan, Kecamatan Dolok Batunanggar pada Selasa (26/10) pukul 12:00. Pihak Polsek Serbelawan melakukan penangkapan sesudah mendapat informasi di dalam rumah saksi Tety br Nasution sedangberlangsungpermainanjudi jenis leng menggunakan kartu joker. Informasi itu tidak disiasiakan dan segera ditindaklanjuti dengan melakukan penyelidikan. Ternyata, informasi masyarakat itu benar hingga personil Polsek Serbelawan melakukan penggrebekan dan menangkap HS, U dan WHP serta menyita

barang bukti dari mereka terdiri 108 lembar kartu joker dan uang tunai Rp 21.000. Ketiganya diboyong bersama barang bukti ke MapolsekSerbelawandandilepas sesudah diproses. “Ketiganya tidak ditahan denganalasanyangtidakjelasdari pihak Polsek Serbelawan, namun tetap diproses,” sebut Kapolres Simalungun AKBP Drs Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas Iptu Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK di Mapolres, Rabu (27/10).(a14)

Waspada/Andi Nasution

HAMBURKAN APBD: Rehab berat pada rumah dinas Camat Tanjungmorawa,diketahui menghabiskan dana APBD Pemkab Deliserdang tahun 2010 senilai Rp288 juta lebih. Sehingga menimbulkan kesan di mata masyarakat bahwa rehab tersebut hanya untuk menghamburkan dana APBD karena sebelumnya kondisi rumah dinas tersebut masih layak digunakan. Proyek tersebut dikerjakan CV Sadewa. Foto direkam belum lama ini.

Bersambung ke hal. C5

Sumatera Utara

WASPADA Senin 1 November 2010


Inspektorat: Kinerja Kadis Kesehatan Labusel Semakin Buruk

Sambungan dari hal. C4

Kadiskes Merasa Dizolimi KOTAPINANG (Waspada) : Hasil pemeriksaan Inspektorat Kab.Labuhanbatu selatan (Labusel) menunjukkan, kinerja Kepala Dinas Kesehatan Labusel semakin buruk, bahkan dinilai tidak mampu memimpin dinasnya.

Puskesmas Perlayuan Gelar Khitanan Massal Gratis RANTAUPRAPAT (Waspada): Baru sebulan menjabat dan baru beberapa hari serah terima jabatan sebagai Kepala Puskesmas Perlayuan, Kelurahan, Pulo Padang, Kecamatan Rantau Utara, Kabupaten Labuhanbatu, dr Syahfitri Aryani Hasibuan langsung menggelar khitanan massal gratis, Selasa (26/10) di puskesmas setempat. Syahfitri Aryani Hasibuan mengatakan, bakti sosial yang dilaksanakanPuskesmasPerlayuan yang dipimpinnya itu adalah untuk mengimplementasikan program Dinas Kesehatan yang dipimpin Plh. Dr Alwi Mujahid Hasibuan, MKes mengemban amanatvisidanmisiBupati-WakilBupati L.Batu dr H Tigor Panusunan Siregar SpPD-Suhari Pane, SIP. Sebagaimana diketahui, kata Syahfitri,visipemerintahanTigorSuhari adalah “Mewujudkan

L.Batu Mandiri 2015 Menuju L.Batu Sejahtera 2020. Adapun salah satu misi untuk mewujudkan visi mulia itu tercakup dalam misi: meningkatkan pelayanan kesehatan yang bermutu, terjangkau dan berkeadilan serta memberdayakan masyarakat dan keluarga untuk mendorong tumbuhnya paradigma hidup sehat, termasuk pengobatan gratis, bagi keluarga yang kurang mampu. Di sisi lain Syahfitri yang bersuamikan dr Julham Alandi itu mengungkapkan, jumlah anak yang disunat sebanyak 30 orang yang berasal dari keluarga kurang mampu dari Kelurahan Padang Matinggi,AekPaingtermasukdari Pulo Padang. Selain disunat, anak-anak tersebut juga mendapat bingkisan kain sarung dari kepala Puskesmas Pulo Padang tersebut.

Sementara salah satu orang tua dari yang dikhitan, Syamsul Anwar, pada kesempatan itu menyampaikan salut dan terima kasih kepada dr Syahfitri Aryani Hasibuan sebagai Kapuskesmas Perlayuan. Sebab, baru sebulan dilantik dan serahterima jabatannya pun baru beberapa hari saja, sudah memiliki kemauan kuat dansanggupmelaksanakansunat massal gratis. “Kami mendoakan semoga dr Syahfitri tetap memiliki tekad kuat dalam memberikan pelayanan kesehatan khususnya pelayanan kesehatan gratis seperti khitanan massal ini kepada warga sebagaimana visi dan misi bupati dan wakil bupati,” katanya Turut hadir, unsur Dinas Kesehatan L.Batu, Camat Rantau Utara, unsur Kelurahan Padang Matingi, Aek Paing dan Pulo Padang. (a27)

Waspada/Armansyah Abdi

KHITANAN MASSAL: Kepala Puskesmas Perlayuan, Kel. Pulo Padang, Kec. Rantau Utara, L.Batu dr Syahfitri Aryani Hsb (duduk di kiri bangku depan) sesaat sebelum khitanan massal.

Aniaya Hingga Tewas, Divonis 3 Tahun Penjara RANTAUPRAPAT (Waspada): Pelaku penganiayaan terhadap Abdun Lumbangaol hingga meninggal dunia, Naek Munte alias Naek, divonis bersalah dan dijatuhi hukuman pidana penjara hanya 3 tahun, Rabu (27/10) di Pengadilan Negeri (PN) Rantauprapat. Hukuman pidana terhadap Naek jauh lebih ringan dari tuntutan Jaksa selama 10 tahun. Majelis hakim yang diketuai Elyta Ras Ginting SH LLM dalam sidang pembacaan putusan, menyebutkan, terdakwa Naek hanya ikut memukul korban yang kemudian ditemukan tewas di semaksemak tepi jalan perkebunan Brusel PT Smart, Desa Perkebunan Brusel, Kecamatan Marbau, Kabupaten Labuhanbatu Utara (Labura), Kamis 3 Juni 2010 sekira pukul 00:30. Naek, 19, warga Dusun III Bulutolang, Desa Aektapa, Kec. Marbau, dalam sidang didampingi penasihat hukumnya, dinyatakan terbukti bersalah sebagaimana didakwakan Jaksa penuntut umum (JPU) pada dakwaan Pertama melanggar pasal 170 ayat 2 huruf ke-3 KUHPidana. Terdakwa melakukan penganiayaan dengan kekerasan terhadap korban Abdun Lumban Gaol, bersama AAB alia Al (berkas perkara terpisah) dan PH alias Domu (anggota TNI AD Denpom I/4 Padang), hari Kamis 3 Juni 2010 sekira pukul 00:30 di Desa Perkebunan Brusel, Kec. Marbau, Labura, tepatnya di areal perkebunan Buresl PT Smart. Majelis hakim dipimpin Dedy SH sebelumnya menjatuhkan hukuman pidana penjara bagi Al Azhari Batubara, 16, yang didakwa ikut melakukan penganiyaan terhadap korban Abdun Lumbangaol JPU. Denny Trisnasari, SH dalam sidang menyatakan banding atas putusan majelis hakim terhadap para terdakwa. Sebelumnya, korban bersama saksi Luhut Marbun, Luster Lubis alias Leteng, Nongab Panggabean, Dingot Sagala, Sumihar dan Togar Sirait,beradadilokasikafemiliksaksiItoMulyaaliasGitokdiarealperkebunan Brusel, untuk menjumpai Awal (terdakwa berkas terpisah). Penganiayaan terhadap korban karena pertengkaran mulut antara saksi korban dengan Awaluddin, lalu terdakwa dan AAB alias Al memukul korban secara bergantian dan PH alias Domu mengeluarkan pisau miliknya kemudian menusuk tubuh korban tepat mengenai lengan kanan hingga tembus hingga korban terjatuh dan meninggal dunia. Menurut JPU Denny, huku-man setimpal terhadap Naek adalah pidana penjara selama 10 tahun, dan terhadap terdakwa Al yang masoih tergolong anak, selama 5 tahun sesuai tuntutan. Atas putusan itu, JPU menyatakan banding. (a27)

Hal ini diungkapkan Kepala Inspektorat Kab.Labusel M Mahruzar, SH saat dengar pendapat dengan Anggota DPRD Kab.Labusel dari Komisi A, B, C serta KomisiE,Kamis(28/10)digedung DPRD Labusel Jalan Bedagai, Kotapinang. Menurut Kepala Inspektorat Labusel, Kadis Kesehatan Labusel dr Hj Mastiana Harahap, M.Kes. MH diperiksa Inspektorat berdasarkan telaahan staf yang bersumberdarisejumlahpengaduan masyarakat Labusel di antaranya, adanya kutipan uang Rp600 ribu per orang terhadap CPNS saat memeriksakan kesehatan, padahal kutipan itu tidak mempunyai dasar hukum. Kemudian realisasi keuanganDinasKesehatanLabusel sangat kecil seperti anggaran di tahun 2009, untuk pos belanja langsung sebesar Rp14,5 miliar, realisasi hanya Rp9,6 M. Diperparah lagi tahun 2010 ini pos belanja langsung ada Rp13,3 M, sementara realisasinya sampai saat ini hanya Rp.1,8 M, pada hal tahun anggaran 2010 berahir Desember, ungkapnya. Kepala Inspektorat melanjutkan, kemudian seperti program peningkatan gizi masyarakat, ini malahan realisasinya nol persen berarti program peningkatan gizi masyarakat di Labusel jalan di tempat. Secara umum realisasi program belanja langsung pada Dinas Kesehatan Labusel masih empatbelaspersen,padahalakhir tahun anggaran sudah dekat pertengahanDesember2010,tegasnya. Kepala Inspektorat melanjutkan lagi, adanya temuan seorang PNS tenaga medis pada Dinas Kesehatan selama satu tahuntigabulantidakmasukkantor (absen) terhitung April 2009 hingga tahun 2010. Terhadap PNS dimaksud tidak pernah diberikan teguran oleh Kadis Kesehatan selaku atasannya. Selain itu Kadis Kesehatan dinilai kurangnya pembinaan atasan terhadap bawahan. Sementara terhadap PNS yang absen dimaksud sudah diberikan hukuman sesuai dengan PP.30 tentang Disiplin Pegawai

Negeri Sipil. Berdasarkan hasil pemeriksaanInspektoratterhadap KadisKesehatanLabuseldiusulkan jugadijatuhihukumanPP.30yakni berupa teguran tertulis, tegasnya. H Zainal Harahap, salah seorang Pimpinan DPRD Labusel menyoroti tentang keberadaan sejumlah tenaga magang di Puskesmas Kotapinang.Tenaga magang ini sudah bertugas lamanya bervariasiantara3hingga6tahun, kenapa mereka ini tidak ditampung honornya di APBD, kenapa tenaga magang itu tidak dijadikan tenaga honorer. Anehnya, kata H Zainal, kenapa orang lain justru belakangan masuk tetapi sudah dijadikanlangsungsebagaitenaga honorer, katanya. Anggota DPRD lainnya juga menyoroti berbagai persoalan seperti dilontarkan Pajariah Siregar mengatakan, PNS yang dipimpin Kadis Kesehatan Labusel mayoritas tidak respek dengan Kadisnya. Pajariah minta kepada Kadis kalau tidak bisa membawa bukti jangan sembarang tuding. Sedangkan Hefrin Harahap menyebutkan ada PNS dari SKM (Sarjana Kesehatan Masyarakat) dipindahkan pada Dinas Ketahanan Pangan kemudian ada lagi seorang dokter ditempatkan di Dinas Pasar Kab.Labusel. Sementara Hasraruddin Nur Daulay minta jangan saling menjelekkan antara Kadis Kesehatan dengan staf, demikian pula sebaliknya, karena jelas asumsi masyarakat nanti kurang simpati terhadap pelayanan kesehatan.’’ Seharusnyakitasalingasah,saling asuh dan asih,’’ katanya. Merasa Dizolimi KadisKesehatanyangjugahadir beserta sejumlah staf saat pertemuanitumengatakan,dirinyamerasa dizolimi oleh stafnya sendiri. Kadis menyatakan tidak pernah menerima uang suap, dia sudah berbuat maksimal untuk kepen-

tingan masyarakat, katanya. Menyangkut soal mutasi tenaga medis dipindahkan ke instansi lain, Kadis Kesehatan tidak mengetahui dan tidak pernah dikoordinasikan kepadanya, tibatiba sudah pindah tanpa sepengetahuanny. Menyangkut hasil pemeriksaan Inspektorat Kab Labusel,KadisKesehatanmengatakan,’’ terserah saja tapi yakinlah Tuhan Maha Melihat, Maha Mendengar.’’. Enam poin kesimpulan diambil saat pertemuan itu dan akanmerekomendasikankepada Pj.Bupati Labusel yakni penempatan aparatur harus sesuai dengan disiplin ilmu pengetahuan yang bersangkutan. Kemudian perhatikan tenaga magang yang lama untuk diprioritaskan menjadi tenaga honorer, kalau masih dibutuhkan tambahan lagi barulah diadakan penambahan baru. Selain itu DPRD minta kepada Inspektorat agar pro aktif memperhatikan lima belas program yang tidak dilaksanakan pada Dinas Kesehatan Labusel. Kesimpulan lainnya, DPRD minta kepada Inspektur agar melakukan pemeriksaan di lingkunganDinasKesehatansecaramenyeluruh termasuk adanya dugaankutipanterhadaptenagahonor, juga CPNS, penyisipan CPNS dan PTT (Pegawai Tidak Tetap). Selanjutnya masalah Dinas Kesehatan ini Pimpinan DPRD akan melakukan koordinasi dengan Inspektorat maupuun Pj Bupati, kemudian kesimpulan terakhir apabila ada temuan KKN supaya di teruskan ke ranah hukum. Dalam pertemuan itu juga tampak hadir Asisten III Setdakab Toga Mahaji, sejumlah anggota DPRDlainSimonSilalahi,BaniIsroil, Ahmad Hidayat Ritonga, Arifin Munthe, Hj Meika Rianti Siregar, SitiSahronaHarahap,HariMaryono dan Panggar Nasution. (c05)

Warga Minta Camat Putera Daerah Berprestasi SEI.BALAI (Waspada) Warga di tiga kecamatan (Tanjungtiram, Talawi, Sei.Balai) Kab.Batubara mengharapkan mutasi jajaran Pemkab Batubara, Jumat (29/10) termasuk menempatkan putera daerah menjadi camat dapat meningkatkan prestasi dalam memberikan pelayanan dan pembangunan daerah pedesaan “Kami tak mau mendengar keluhan masyarakat dalam mengurus surat-surat diperlukan di kantor camat. Paling serius memberikan pelayanan pendistribusian KTP dan KK harus transparan, jangan terjadi keributan menambah beban warga” harap salah seorang warga Desa Kuala Sikasim Sei.Balai, Minggu (31/10). Warga berharap harga KTP sesuai dengan Perda Rp 20.000,atau ditambah Rp10.000,- untuk administrasi di desa dan kecamatan jadi Rp 30.000, dan tidak mencekik leher mencapai Rp 70.000 hingga Rp 100.000 per KTP. (a30)


Sumatera Utara

WASPADA Senin 1 November 2010

Masyarakat Desak Pemilu Kada Karo Diulang KABANJAHE (Waspada) : Ratusan massa pendukung sejumlah pasangan calon yang tidak merasa puas dengan pelaksanaan Pemilukada Karo 27 Oktober lalu, mendatangi PPK Kecamatan Kabanjahe, Jumat (29/10). Mereka mendesak KPUD Karo hentikan penghitungan suara dan Pemilu Kada Karo 2010 diulang. Mereka menyebutkan terjadisejumlahkecuranganpada Pilkada 27 Oktober lalu.. Di antaranya,ditemukannya di rumah Ketua PPS N.Sembiring, sebanyak 2459 formulir C6 yang tidak dibagikan kepada pemilih untuk 15 TPS di Kelurahan Lau Cimba Kabanjahe. Sejumlah warga Kelurahan gung Negeri Kabanjahe tidak dapat menggunakan hak pilihnya karena tidak mendapat formulir C6 meski dia terdaftardiDPTdanmemilikiKTP. Juga ditemukannyaseorangpemilih didugamelakukanprak-tikmoney politikdiTPS2kelura-hanPadang MasKabanjahedandiamankannya

seorang pria melakukan pencoblosan ganda di salah satu TPS Kecamatan Kabanjahe. Ratusan massa pendukung sejumlah calon yang tidak memperoleh suara secara siknifikan pada Pemilukada tersebut, secara serentakmemasukihalamankantor PPK Kecamatan Kabanjahe yang kebetulan bersebelahan dengan gedung DPRD Karo Jalan Veteran Kabanjahe. Massa berusaha menerobos barisan pengamanan yang terdiri dari polisi dan anggota Linmas yang sejak pagi sudah bersiapsiap di pintu masuk kantor itu. Aksi saling dorong antara massa dengan barisan petugas yang berlapis sempat terjadi. Namun hal itu dapat atasi setelah petugas meminta perwakilan masyarakat untuk menyaksikan perhitungan suara di tingkat PPK Kabanjahe. Suasana di ruang tempat perhitungansuarasempatmemanas, ketika para perwakilan warga memintapenghitungansuaradihentikan. Namun Ketua PPK Kabanjahe Tenang Ginting segera mengambil waktu untuk istiraahat makan siang sampai pukul 13:50. Menyikapi itu para perwakilan yang berjumlah sekitar 12 orang

sempat berang. “Jangan nanti gara-gara kecurangan itu terjadi di Tanah Karo pertumpahan darah, jangan bela yang tidak benar, bukti kecurangan sudah ada di tangan kami, ribuan formulir C6 tidak diberikan kepada pemilih, kecurangan itu terjadi hampir seluruhTPSdiKabupatenkaroini, “teriakseorangperwakilanmassa. Selanjutnya, perwakilanratusan warga menuju gedung DPRD Karo untuk menyampaikan aspirasinya. Mereka diterima Frans DanteGinting,RendraGaulleGinting SH, Ir Thomas Sitepu dan anggota dewan lainnya. Di ruang paripurna dewan perwakilan massa menyampaikan buruknya kinerja KPUD Karo dalam menyelenggarakanPemiluKadadan buruknyakinerjaPanwasludalam mengawasi pelaksanaan Pemilukada Karo, karena banyak ditemukan kecurangan. Frans Dante mengatakan pihaknyaakanmemanggilKPUD Karo dan Panwaslu Karo untuk dimintai penjelasannya. Frans Dante Ginting mengimbau masyarakat dalam menyampaikan aspirasinyasecaradamai.“Jangan melakukan anarkis karena yang rugi kita sendiri,”harapnya. (c06)

Anggota DPR RI Minta Ketua DPRD P.Siantar Dahulukan Kepentingan Rakyat P.SIANTAR (Waspada): AnggotaDPRRIEdiRamliSitanggang, SH asal Partai Demokrat (PD) meminta Ketua DPRD Kota Pematangsiantar Marulitua Hutapea, SE yang juga berasal dari PD harus mendahulukan kepentingan rakyat. “Sebaik terpilih sebagai anggotalegislatif,sudahmenjadiwakil rakyat dan harus mendahulukan kepentingan rakyat dan bukan kepentingan pribadi atau partai,” tegas anggota DPR RI yang saat ini duduk di Komisi III DPR RI saat berbincang-bincang dengan sejumlahwartawandilobiSiantar Hotel,KotaPematangsiantar,Sabtu (30/1)sehubunganMarulituaHutapeatidakmaumembahasPAPBD Pematangsiantar tahun 2010. Seperti diberitakan, Ketua DPRD Pematangsiantar Marulitua Hutapea, SE akhir-akhir ini menyatakan tidak akan membahas PAPBD Pematangsiantar

tahun 2010 dengan alasan hasil Pilkada Pematangsiantar cacat administrasi, karena KPUD tidak mau lagi menyerahkan berkas hasil Pilkada yang dikatakan Marulitua belum lengkap diserahkan KPUD ke DPRD. Padahal, sesuai hasil keputusanMahkamahKonstitusi(MK) RI, hasil Pilkada Pematangsiantar tidak ada masalah dan gugatan tiga pasangan calon yang kalah dalamPilkadatahun2010itutidak diterima MK RI dan pasangan Walikota Hulman Sitorus, SE dan Wakil Walikota Drs. Koni Ismail Siregar sudah dilantik Presiden RI diwakili Gubsu. Menurut Ketua Biro Departemen Pencegahan dan Penegakan Hukum DPP PD dan Korwil Sumut III PD, yang menentukan Pilkada itu cacat administrasi ada tempatnyayaknidiPTUN.“Orang yang merasa dicurangi ada tempatnya guna membuktikan apa-

kah benar dicurangi atau tidak.” “Namun, soal PAPBD tidak bisamenunggusampaiadakeputusan hukum. Kita harus jernih melihat setiap permasalahan dan harus tetap mengendepankan kepentingan masyarakat,” tegas Edi Ramli. Mengenai berbagai masukan tentang sikap Marulitua Hutapea, Edi Ramli menyatakan akan menyampaikan kepada Organisasi, Kaderisasi dan Keanggotaan (OKK) DPP PD. Tentang suksesi DPC PD Pematangsiantar yang akan dilaksanakansesudahMusdaDPDPD Sumut, Edi Ramli menyatakan siap mencalonkan diri sebagai Ketua DPC PD Pematangsiantar guna memperbaiki PD Pematangsiantar “Kenapa tidak. Pematangsiantar ini tanah kelahiran saya. Apalagi para kader membutuhkan, saya siap mengorbankan tenaga, pikiran dan materi.”(a14)

Bupati Tobasa Diminta Berlakukan Fit And Proper Test BALIGE(Waspada): Bupati Tobasa Kasmin Pandapotan Simanjuntak diminta memberlakukan sistem fit and proper test untuk pengangkatan pejabat bukan hanya berdasarkan politis atas jasa-jasanya sewaktu pelaksanaan pemilihan kepala daerah (pemilu kada). Pengangkatan para pejabat yangtelahdilakukanBupatiTobasa belum lama ini dinilai kalangan masyarakat lebih dominan unsur politisnyaketimbangberdasarkan Sumber Daya Manusia (SDM), khususnyapengangkatankepalakepala sekolah jika hanya murni berdasarkan politis tentu sangat

sensitif yang berakibat menimbulkan gejolak-gejolak di lingkungan sekolah. “Para pelajar dan orangtua sudah cukup kritis dalam menilai guru dan kepala sekolah yang benar-benar mempunyai kemanpuan, sehingga kalau Bupati Tobasamemaksakanwewenangnya untuk penempatan kepala sekolah tentu mengganggu proses belajar mengajar di sekolah itu,” kata seorang masyarakat R.Siagian kepada Waspada di Balige, Sabtu (30/10). Gejolakdilingkungansekolah tingkat SMA/SMK terdengar kabar sudah terjadi di Balige dan

kemungkinanbesarinformasinya akan menyusul di Habinsaran akibat pemberhentian kepala sekolah kata Siagian, padahal mantan kepala sekolah dinilai berkualitas sehingga dicintai para guru dan pelajar serta mampu menyedot dana dari pusat melalui program blockgrand pendidikan. Menyinggungpelaksanaanfit andpropertest,Salahseorangmasyarkat M.Pardede mengatakan bukan hal yang baru lagi untuk PemkabTobasakarenasemasakepemimpinanBupatiTobasaSahala Tampubolonsistemfitandproper testsudahpernahdilakukandalam pengangkatanpejabatdaerah.(a33)

Walikota P.Siantar Mulai Lakukan Pergeseran Jabatan P. SIANTAR (Waspada):Walikota Pematangsiantar Hulman Sitorus,SEyangbarudilantikGubsu H. Syamsul Arifin, SE bersama Wakil Walikota Drs. Koni Ismail Siregar 23 September 2010 mulai melakukan pergeseran jabatan dilingkunganPemkosepertiyang dilaksanakan di ruang data Pemko, Jumat (29/10) sore, sebanyak 20 pejabat eselon III dan IV dilantik Wakil Walikota. Kepala Badan Kepegawaian, Pendidikan dan Pelatihan (BKPP) Marihot Situmorang, SH dalam laporannya menyebutkan pengambilan sumpah/janji jabatan dan pelantikan itu sesuai SKWalikota Nomor 820/1180/X/WkTahun 2010 tanggal 27 Oktober 2010 tentang pengangkatan, pemindahan dan pemberhentian pejabatstrukturaldilingkunganPemko. Menurut Marihot, pelantikan itu guna mengisi jabatan kosong dan penyegaran terdiri pejabat eselon III 18 orang dan pejabat eselon IV dua orang. Para pejabat yang dilantik terdiri Drs. Legianto Pardamean Manurung sebagai Pj Camat Siantar Barat, Hasudungan Hutajulu, SH sebagai Pj Kakan Satpol PP, Drs Suriyatno sebagai Kakan Perpustakaan, Arsip dan Dokumentasi, Jhon Pieter Sitorus, S.Sos sebagai Pj Kabag Umum dan

Perlengkapan Setda, Baren Alijoyo Purba, SH sebagai Pj Wadir III Bidang Umum, SDM dan Keuangan RSUD Dr. Djasamen Saragih. Kemudian, Drs Daniel Hamonangan Siregar sebagai Pj Kabag Humas dan Protokoler Setda, Piter Nadeak sebagai Kabag Perekonomian Setda, Drs Kalbiner Lumbantungkup, Msi sebagai Kabag Keuangan dan Asset Setda, Drs Mansur Sinaga sebagai Sekretaris Disdik, drg Rumondang Sinaga, MARS sebagai Wadir II Bidang Penunjang Medis, Pendidikan dan Akreditasi RSUD Dr. Djasamen Saragih, Drs Yusmar Saragih sebagai Pj Sekretaris Dinsosnaker, Delinar Sihombing,SEsebagaiKabidSarana dan Prasarana Dinas PU, Marsoni Simalango sebagai Pj Kabid Teknik Sarana dan Prasarana Dishubkominfo. Selanjutnya, Robert Sitanggang, SSTP sebagai Pj Sekcam Siantar Barat, Esron Saragi, SH sebagai Kabid Hubungan Organisasi, Persyaratan dan PengawasanTenaga Kerja Dinsosnaker, Jonson Tampubolon sebagai Kabid Pendidikan Dasar Disdik, JonsonSitinjak,SPdsebagaiKabid Perencanaan dan Informasi Disdik, Allen Lamretta Sidabalok Pj Kabid Pendidikan dan Akre-

ditasiRSUDDr.DjasamenSaragih, Charlina Wastuti Tampubolon sebagai Pj Kepala UPTD Pendidikan Kecamatan Siantar Utara dan Poltak Maraden Gumirang Tambunan, SPd sebagai Kepala UPTD Pendidikan Kecamatan Siantar Timur. Wakil Walikota dalam pidatonyamenyebutkanarahkebijaksanaan aparatur negara dititikberatkan kepada peningkatan kualitas SDA hingga dapat meningkatkan mutu, profesionalisme, pengabdian, kesetiaan dan pengembangan wawasan serta dapat hidup bersaing dan memiliki citra serta wibawa di tengah-tengah masyarakat. Khusus kepada Camat, Wakil Walikota meminta agar meningkatkan kegiatan kebersihan agar sesuaivisidanmisiPematang-siantar mantap, maju dan jaya terutama kebersihan di salah satu pasar tradisional di Siantar Barat yakni Pasar Horas dan Pedagang Kaki Lima (PKL), pemerataan petugas kebersihan yang belum optimal. “Kecamatan Siantar Barat merupakan inti kota , karena itu, Camat agar melaksanakan seoptimalmungkin denganpotensi yang ada, mengatur jadwal kerja petugas kebersihan, membina dan memperhatikan PKL,” minta Wakil Walikota. (a14)

Bersambung ke hal. C7

WASPADA Senin 1 November 2010

Sambungan dari hal. C6

Sumatera Utara


Tender DAK Madina Diduga Formalitas PANYABUNGAN (Waspada): Pelaksanaan tender dana DAK Pendidikan Tahun 2010 Madina dengan anggaran 31 Miliar, diduga kuat hanya formalitas. Berdasarkan keterangan sumbur, masing-masing paket proyek telah ada pemiliknya. Alasannya, pihak kontraktor disinyalir sudah lebih dulu menyetor uang senilai 10 persen dari pagu danapaketproyekkepadaok-num pejabat di Diknas Madina. Karenanya tidak heran, seorang kontraktordidugabisamendapatkan2-5paketproyek.Dengankata lain,banyaksetoranbanyakpaket. Itu dijelaskan salah seorang kontraktor, A Lubis kepada Waspada, Minggu (31/10) di Panyabungan. Katanya, dari 5 paket proyek didaftar, 4 orang kontraktor telah mendatanginya denganalasanpaketyangdidaftar adalah paket proyek miliknya yang diarahkan oknum pejabat teras Diknas Madina. “Abang mundur sajalah, kerugian Abang nanti kuganti. Karena paket pro-

yekyangabangdaftaritupunyaku, “ucapALubismenirukanucapan seorang kontraktor yang menyuruhnya mundur. Sumber Waspada di lapangan, khabarnya panitia tender dana DAK Pendidikan sudah mulai kewalahan menghadapi pihak kontraktor. Karena setiap paket proyek banyak yang mendaftar, hal itu menyulitkan panitia untuk memenangkan proyek diduga arahan. Sekretaris LSM LIPPAD, Henri Pulungan menilai, selain lelang hanya formalitas, pelaksanaan proyek dana DAK Diknas Madina tahun ini diduga akan menuai banyak permasalahan mengingat waktu masa tender hingga pelaksanaan tergolong sangat singkat. Tipissekaliharapanpekerjaan proyek DAK Madina berjumlah 78 paket akan siap bulan Desember. Karena berdasarkan Kepres 80 tahun 1999, peroses lelang saja memakan waktu paling minim 35 hari ditambah lagi masa sanggah. “ Jika pekerjaan itu tidak siap, uang akan kembali ke kas daerah karena dana DAK itu anggran sisa mati,” ucap Henri.

Sebelumnya, pimpinan DPRD Madina menilai Diknas Madina telah melecehkan DPRD karena melaksanakan tender sebelum P-APBD disahkan. Menyikapi itu, panitia anggran sebanyak 22 orang termasuk di antaranya hadir Ketua DPRD Madina, As Imran Khaitamy. Inti rapat tersebut untuk membatalkan tender. Namun, belakangan Ketua DPRD Madina, As Imran Khaitamy Daulay, SH Kamis (28/10), lewat SMS mengatakan, tender itu dilaksanakan atas dasar ijin prinsiptelahkeluar.Jikaijinprinsip tidakdikeluarkan,uangnya(dana) akan kembali ke pusat. Pertanyaannya, kalau memang dalihnya untuk menyelamatkan anggaran tidak kembali ke pusat, mengapa tidak jauh hari saja ijin prinsip dikeluarkan supaya pelaksanaan tender hingga pelaksanaan dilapangan berjalan dengan tenang dan tidak terburu-buru. Pihak Diknas Madina yang dikonfirmasi melalui Bagian Humasy sejak Kamis (28/10), sampai berita ini dikirimkan, Minggu (31/ 10) tidak ada memberikan jawaban resmi. (csh)

200 Lebih Pelajar Ikuti Perkemahan Saka Wira Kartika PANYABUNGAN (Waspada): Sebanyak 285 orang anggota pramuka dari berbagai SLTA, 26 orangpendampingserta62orang pelatih dari TNI, mengikuti pelatihan perkemahan pramuka Saka Wira Kartika gelombang II Komando Distrik Militer ( Kodim) 0212/TS di kawasan perbukitan Kecamatan Siabu Kabupaten Mandailing Natal , 27-28 Oktober 2010 lalu. Kegiatan dibuka Pj.Bupati MadinaAspanSofiandandihadiri Ketua DPRD MAdina As Imran Khaitamy Daulay,SH, Dandim

0212/TS, Letkol Inf Edi Hartono, Kapolres AKBP Hirbak Wahyu Setiawan Sik, Ketua PN Panyabungan, Irwan Efendi Nasution SH, Kasdim Mayor Kav Sudrajat Dirgahayu, dan sejumlah Kepala SKPD,Muspika serta pengurus dan Majelis Pembina Cabang Pramuka Kabupaten Madina. Aspan berharap agar perkemahan pramuka saka wira kartika itu dapat mendidik anak bangsa di Madina berkpribadian luhur serta memiliki jiwa bela Negara yang handal.

Koordinator Latihan, Kapten Inf Pardamean melaporkan, peserta latihan perkemahan terdiri dari siswa SMA/SMK dan MA yang berjumlah 285 orang, dan pendamping sebanyak 26 orang serta pelatih dari TNI sebanyak 62 orang, menjelaskan, nantinya,latihanperkemahaniniakan melewatilerengBukitBari-sanyang ada di wilayah Kelu-ra-han Siabu, Kecamatan Siabu. Dan dalam latihan peserta akan dikenalkan dengan kondisi alam atau pioner atau siasat yang dilakukan apabila tersesat di dalam hutan. (a24)

Mantan Kepsek SMAN I Salak Dituding Lakukan Pungli SALAK (Waspada): Mantan kepala sekolah (kepsek) SMAN I Salak, Kabupaten Pakpak Bharat berinisial Drs MJB disebut-sebut dianya semasa menjabat telah melakukanpungli(pungutanliar) terhadap para siswa sekolah dimaksud. Adapunpungliyangtelahdilakukan oleh kepsek SMAN tersebut, yaitu berupa pengumpulan uang kotak abadi siswa yang dipimpin langsung kepsek dengan modus,ketikaapelpagiparasiswa/ siswi dianjurkan harus berbaris dan berjalan satu persatu seraya melewati kotak itu sembari me-

masukkansejumlahuangdengan dibawahpengawalansalahseorang oknum guru lainnya berinisial LS. Dan, pemotongan sejumlah uang yang merupakan hadiah dari juara ketika para siswa mengikuti even-even perlombaan, dan siswa/siswi hanya mendapat 50persendarijumlahhadiahyang diterimanya,selebihnyadiberikan kepada LS. Akan tetapi, anehnya, uang yang telah dikumpulkan itu hingga sekarang ini tidak pernah diketahui sama sekali rimbanya oleh para siswa. Hal ini berdasarkan keterangan yang diterima Waspada,

Kamis (28/10) dari salah seorang sumber yang namanya minta untuk tidak disebutkan di Salak. Sementara itu, Drs MJB yang kini menjabat sebagai Kapala Bidang (kabid) Pendidikan Menengah pada Dinas Pendidikan Pemkab Pakpak Bharat ketika ditemui wartawan saat itu juga di ruang kerjanya mengatakan, program itu (uang kotak abadi siswa/siswi-red) merupakan hasil rapatpihakKomiteSekolahSMAN I Salak dengan para orang tua murid dengan membentuk kepanitian yang langsung ditangani oleh OSIS.(c08)

Sumatera Utara


WASPADA Senin 1 November 2010

HMI Madina Buka Posko Bencana PANYABUNGAN(Waspada): Himpunan Mahasiswa Islam (HMI) Cabang Madina (Mandailing Natal) membuka posko penerimaan bantuan untuk tiga bencana yang melanda Indone-

Waspada/Sukri Falah Harahap

PATAH: Petugas dari PT PLNCabang Padangsidimpuan mengganti tiang listrik yang patah karena tertimpa pohon, Jumat (29/10), dalam 7 jam listrik kembali normal.

5 Tiang Listrik Patah Ditimpa Pohon Pinus PARGARUTAN, Tapsel (Waspada): Sebatang pohon pinus yang ditebang warga, Jumat (29/10), menimpa kabel listrik di pinggir Jalan Lintas Sumatera (Jalinsum) Kelurahan Pasar Pargarutan, Kec. Angkola Timur, Kab. Tapanuli Selatan,dan mengakibatkan listrik padam sekira 7 jam. Sebanyak 5 tiang listrik milik PT PLN mengalami patah di bagian tengah. Hal ini karena beban yang terlalu berat dan tiba-tiba, sehinnga kabel yang ditimpa pohonitumenariktiangtempatpencantolannya hingga patah.

Pohonpinusdenganpanjang sekira 15 meter dan tumbuh di pinggir Jalinsum itu tumbang karena ditebang warga. Pasalnya, pohon itu mengganggu proses pembangunanrumahmiliksalah seorang warga. Lurah Pasar Pargarutan Abdul Rosib Harahap mengatakan,pohonpinusmenimpakabel listrik itu terjadi pada pukul 11:40. Ada warga yang menebang pohon pinus karena mengganggu prosespembangunanrumahnya. Tapi saat pohon akan tumbang, angin berhembus kencang. Sehingga pohon tumbangnya ke arah badan jalan dan menimpa kaber listrik. Padahal sebelum ditebang, pohon itu telah diikat dengan tujuan tumbangnya mengarah ke tempat yang lebih lapang dan bukan ke badan jalan.

“Kita menduga, karena angin kencang pohon yang ditebang itu malah tumbang ke jalan raya dan menimpakabellistrik.Sejakkejadian, listrikmatidiKelurahanPasarPargarutan dan sekitarnya,” kata Lurah. Ditegaskan, tidak ada korban jiwa ataupun kerugian materi dari warganya akibat kejadian itu. Namunaruslalulintasmenjadimacet dan diatur personil PolresTapsel. Terpisah, Humas PLN CabangPadangsidimpuan,Untung, membenarkan5tianglistrikputus di Kelurahan Pasar Pargarutan. Hal itu dikarenakan kabel yang tertimpa pohon. Menurut Untung, pihaknya sudah memperbaikinya dan berupaya secepat mungkin agar listrik dapat hidup kembali. “Ada 5 tiang yang patah, kita sudah memperbaikinya,”kata dia.(a20)

Penanganan Banjir Bandang Muara Batanggadis Harus Transparan PANYABUNGAN(Waspada): Penanganan bencana banjir bandang yang melanda tujuh desa di Kecamatan Muara Batang Gadis Kabupaten Mandailing Natal, harus transparan dan peruntukannya sesuai dengan kepentingan bencana. “Bencana banjir bandang yang melanda beberapa desa di Muara Batang Gadis sudah berlangsung setahun lebih, namun hingga kini penanggulangan pembangunannya belum juga terwujud,”ujarIrWildanNasution, salah satu anggota DPRD Madina asal daerah itu kepada Waspada, Minggu ( 31/10). Hal itu disampaikanWildan menyusuladanyarencanapemerintah untuk memulai penanggulangan pembangunan lokasi banjir yang rencananya dilaksanakanakhirtahuninidengandana bantuan diperoleh dari dana pemerintah pusat puluhan miliar rupiah yang sasarannya sejumlah sarana infrastruktur di desa-desa terkena bencana banjir bandang itu. Wildanyangjugaketua Fraksi Partai Golkar Plus menjelaskan, wargakawasanSiulangAling,berharap agar pemerintah segera merealisasikan relokasi dan rehablitasi kawasan banjir terjadi 15 September 2009 lalu. Penanganannya tidak bisa dibiarkan berlarut-larut, sebab material bekas banjir bandang masih banyak terdapat di depan rumah-

rumah penduduk. Katadia,untukmerehabilitasi dan rekonstruksi kawasan bencana banjir, beberapa waktu lalu Pemprovsu telah mengusulkan dana ratusan miliaran rupiah ke pemerintah pusat yang meliputi rencana aksi pemulihan aspekaspek kehidupan masyarakat terkena banjir, pembangunan perumahan, pemukiman yang dihantam bencana dan infrastruktur. Kemudian usulan dana yang akan mendukung pemulihan dan percepatan pembangunan di kawasan bencana dan sekitarnya, terdiri dari pemulihan aspek-aspek kehidupan masyarakat yakni kesehatan (pembangunan pos kesehatan desa dan pengadaan peralatannya). Menurutnya, dalam proses rehabilitasi dan rekonstruksi wilayah dan kehidupan masyarakat kawasanbencanabanjirbandang melanda beberapa desa di kecamatan Muara Batang Gadis akan dilaksanakan atas dasar berbagai prinsip, kebijakan serta stategi. Tentangprinsip-prinsipdasar rehab dan rekon yang akan dilaksanakan lanjutWildan Nasution harusberorientasikepadamasyarakat dan partisipatif, pembangunan berkelanjutan dan mengutamakan keseimbangan aspekkelayakanekonomi,holistik, terpadu, efisien, transparan, akuntabeldanadanyamonitoring serta evaluasi.

“Pembangunankembalimasyarakat, ekonomi, perumahan dan pemukiman, infrastruktur sertapemerintahanharusdengan cara memfungsikan kembali sistem dan pelayanan pemerintahan desa, merancang kembali dan membuat pusat-pusat kegiatan baru,” ungkapnya. Selain itu lanjut politisi Partai Golkar itu, dalam upaya rehabilitasi dan rekonstruksi kawasan bencana perlu dilaksanakan berdasarkan berbagai strategi yakni strategi penataan ruang dan pertanahan, strategi lingkungan hidup dan sumber daya alam. “Aksi pasca bencana rehabilitasi dan rekonstruksi banjir bandang di Kecamatan Muara Batang Gadis harus transparan dan peruntukkannya sesuai kepentingan bencana. Artinya,para kalanganyangmengerjakanrehab dan rekon harus profesional, sehingga pembangunannya benarbenar bisa mengurangi beban penderitaan warga bukan membuat warga semakin merana,” ujarnya. Seperti diberitakan sebelumnya,desa-desa yang tertimpa bencana di Muara Batang Gadis meliputi DesaLubuk Kapundung I , Lubuk Kapundung II , Hutarimbaru , Ranto Panjang,Tagilang Julu , Desa Aek Godang , Desa Panunggulan,DesaKiloJulu.Bencana memakan korban tewas sebanyak sepuluh orang. (a24)

Defisit Anggaran Madina Terus Disorot PANYABUNGAN(Waspada): Defisit anggaran yang terjadi di tubuh Pemkab Madina yang diperkirakan mencapai Rp 19 miliar lebih terus mendapat sorotan dari berbagai kalangan di daerah itu. Umumnya mereka meminta agar anggaran yang defisit itu dianalisa dan dikaji secara mendalam sehingga jelas kemana saja peruntukannya. “Defisitanggaransepertiyang terjadi di tubuh Pemkab Madina tidak barang baru dan tabu lagi,t api jelas peruntukannya atau di sektor mana saja yang defisit itu ,” kata Ketua Fraksi Partai Golkar Madina Ir Wildan Nasution kepada Waspada, Minggu ( 31/ 10). Menurutnya, rumah tangga kita saja berutang,tetapi jelas peruntukan dan jumlah utang itu, konon di tubuh Pemkab Madina, perlu secara transparan dimana saja yang defisit tersebut, kalau karena penggajian PNS dan biaya pembangunan, itu sah-sah sajatetapijelasjumlahnyaberapa.

Wildan mengatakan, terkait defisit anggaran itu itu bisa saja terjadi karena pemasukan anggaran yang sudah direncanakan tidak terealisasi karena beberapa hal. Karenanya perlu dikaji kembali kenapa anggaran itu tidak masuk padahal sudah ada perencanaan dari awal. Hal yang sama juga disampaikan koordinator AMP2M ( Aliansi Mahasiswa dan Pemuda Peduli Mandailing Natal bersama Satuan Mahasiswa Pemuda Pancasila (Satma PP) Tan Gozali, yang intinya meminta pejabat terkait mempertanggung jawabkan defisit yang terjadi sekaligus mendesak Pj Bupati Aspan Sofian dan DPRD segera membentuk tim auditor defisit anggaran itu. Tan Gozali Nasution didampingi koordinator lapangan yakni Iswadi Batubara, M Rifai Lubis, Samsul Borotan dan Khoirul Asri berharapagarAspanSofian harus tegas menyikapi terjadinya defisit yang menurut mereka tidak masuk akal.

“Kalau memang belum ada penyelesaian, kami meminta Pj Bupati bersama DPRD membentuk tim auditor. Jumlah defisit anggaranterjadiditubuhPemkab Madinaitutidaklogikadandiduga ada penyalahgunaan anggaran yang harus dipertanggungjawabkan secara transparan kepada publik,” katanya. Sementara Pj Bupati Madina AspanSofyanmengatakan,defisit yang terjadi pada Rancangan Perubahan APBDTA 2010, adalah disebabkan kesalahan pada estimasibelanjagajiPNSyangtidak sesuai dengan kebutuhan real. Artinya, anggaran gaji PNS PemkabMadinayangditampung pada Rancangan P-APBD TA 2010 hanya sebesar Rp 252.612. 632.048,86,sedangkankebutuhan untuk anggaran gaji PNS tahun 2010 adalah sebesar Rp 283.573. 435.156,72.”Keadaan ini mengakibatkan anggaran gaji tersebut mengalami defisit sebesar Rp 30.960.803.107,86 ,” ungkapnya. (a24)

sia baru-baru ini Posko bencana dipusatkan disekretariat PC HMI Madina, Kelurahan Dalan Lidang, Kecamatan Panyabungan sejak 30 Oktober-14 November 2010

mendatang. Itu dijelaskan Ketua PC HMI Madina, Muhammad Ali Aman Hasibuan pada Waspada, Minggu (31/10) di Panyabungan. Katanya, selain mahasiswa

melakukan aksi turun ke jalanjalanprotokol,penggalanganbantuan untuk bencana banjir dan letusan gunung merapi juga diadakan ke kantor-kantor pemerintah dan pusat pasar di

Panyabungan. Jumlah bantuan yang terkumpul keseluruhan, nantinya dibagi rata untuk disalurkan ketiga lokasi bencana alam lewat rekening dompet peduli kemanusiaan. (csh)

WASPADA Senin 1 November 2010


Sumatera Utara

Penggunaan Sepeda Dikampanyekan Di Labuhanbatu

Bukti Tambahan Pengadaan Lahan Kantor Ke Kejatisu LIMAPULUH(Waspada): Lintas Elemen Masyarakat Batubara (LEM-BB)kembalimemasukkanbuktibaruatasdugaanpenyimpangan anggaran dalam pengadaan lahan perkantoran Pemkab Batubara di Desa Perupuk, Kec. limapuluh, Kab. Batubara ke Kejaksaan Tinggi Sumut. Juru bicara LEM-BB Arsyad Nainggolan dalam siaran persnya Minggu (31/10) menyatakan, dalam kasus dugaan penyimpangan pengadaan lahan ini LEM-BB hanya membantu aparat penegak hukum yang membutuhkan data maupun keterangan untuk melengkapi unsur melawan hukumnya di Kejatisu. “ LEM-BB telah membawa tiga orang pemilik tanah yang menjual lahannya kepada Pemkab Batubara untuk diambil keterangaannya oleh jaksa Pidsus di Kejatisu baru - baru ini. Kepada ketiganya jaksa mengajukan 29 pernyataan terkait lahan dan bangunan tujuh kantor di Perupuk,” ujar Arsyad. (a31)

Pemuda Di DS Diminta Siap Hadapi Krisis LUBUKPAKAM(Waspada):MenyambutperingatanHariSumpah Pemuda Ke-82 tahun 2010, Kamis (28/10), unsur kepemudaan di Kabupaten Deliserdang terdiri dari KNPI, OKP dan Ormas melaksanakan dialog kepemimpinan di Balairung Pemkab Deliserdang di Lubukpakam, Selasa (26/10). Bupati Deliserdang H Amri Tambunan dalam sambutan tertulis disampaikan Kaban Kesbang H Eddy Azwar di hadapan ratusan pemuda mengatakan, dialog pemuda merupakan wujud dari kepedulian pemerintah untuk senantiasa membina dan meningkatkan kualitas sumber daya manusia di kalangan pemuda yang diharapkan mampu meneruskan cita-cita kepemimpinan bangsa ke depan. “Karena kepada segenap jajaran pemuda di daerah ini diharapkan senantiasa melihat tantangan yang dihadapi di masa mendatang dengan membuat program yang menyentuh langsung kepada pembinaan generasi muda,” kata bupati. Selain itu kepada seluruh peserta dialog diminta untuk selalu memperkokoh rasa persatuan dan kesatuan bangsa guna mempertahankan stabilitas nasional yang sudah diwujudkan selama ini bagi kesinambungan pembangunan bangsa dan negara sejalan dengan makna yang terkandung dalam Sumpah Pemuda yang dicetuskan 82 tahun silam. Kaban Kesbang Pemkab Langkat Eddy Azwar menjelaskan beberapa tantangan yang sedang dihadapi pemuda di antaranya krisis ideologi, politik, hukum, kepemimpinan nasional, konstitusi, kebangsaan/nasionalisme, alam, lapangan kerja, sosial, ekonomi dan krisis budaya. “Karenanya kepada seluruh pemuda diajak untuk berperan dalam mengisi pembangunan seperti yang dicita-citakan pendahulu kita,” ujarnya(a05)

Jalan Ke Istana Limalaras Dilebarkan LIMALARAS (Waspada): Pembenahan ruas jalan di desa dan kecamatan se Kab. Batubara bernilai puluhan miliar sedang dilaksanakan Pemkab Batubara, termasuk pelebaran ruas jalan menuju ke Istana Limalaras Tanjungtiram. Pelebaran juga berlangsung ke jalan desa Simpangdolok - Kedai Sianam - Perupuk Kec.Limapuluh,Tanjungtiram - Limalaras -Ujungkubu, Kec. Tanjungtiram. Seperti pembangunan pelebaran jalan/ pembuatanturapdari BagandalammenujuIstanaLimalarassepanjang 2000 meter dana DPPD Kab. Batubara TA. 2010 sebesar Rp 1,9 miliar dilaksanakan CV Karya Hariyadi. Menurut pelaksana lapangan Syafrizal, Minggu (31/10) pelebaran ruas jalanTanjungtiram -Ujungkubu 2000 meter dengan pembuatan turap, tanah timbun menjadikan lebar jalan 10 meter. Diakui, pihaknya sudah 2 kali memindahkan plang proyek sekitar Bagandalam tetapi hilang tidak diketahui sebabnya. Begitu juga kerusakan turap akibat getaran truk mengangkut material bangunan makin ramai melintas sudah diperbaiki dan disebutkan asal dana DPPD Batubara 2010 Rp 1,9 miliar Saleh penarik betor, mengatakan terima kasihnya atas pelebaran ruas jalan Tanjungtiram menuju Istana Limalaras sehingg tidak sempit lagi, arus lalulintas sudah lancar serta memudahkan membawa pengunjung wisatawan menyaksikan cagar budaya Istana Niat Limalaras peninggalan masa lalu.(a30)

Tak Sanggup Bayar Cicilan Truk Nekad Bunuh Diri PEMATANGSIANTAR (Waspada): Hanya gara-gara tidak mampu membayar cicilan mobil truk Colt Diesel yang dibelinya, Heriadi, 23, warga Huta Lima, Nagori Bangun Dasmariah, Kecamatan Pane, Kabupaten Simalungun nekad membunuh dirinya sendiri dengan meminum racun serangga. Keterangan dihimpun menyebutkan, korban diduga mengakhiri hidupnya dengan meminum racun serangga di dalam rumahnya di Huta Lima, Nagori Bangun Dasmariah, Kecamatan Pane pada Kamis(8/10)pukul21:30dantewasmeskisempatmendapatperawatan di RST Kota Pematangsiantar, Jumat (29/10) pagi. Tindakan nekad yang dilakukan korban terjadi ketika istri dan anak korban sudah tidur. Korban yang sudah sering mengeluh akibat tidak mampu lagi membayar cicilan mobil truk miliknya, mulai berpikir mengakhiri hidupnya. Kapolres Simalungun AKBP Marzuki saat dikonfirmasi melalui Kasubbag Humas Iptu Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu di Mapolres, Jumat (29/10) menyebutkan, kejadian itu nonpidana dan dugaan sementara korban meninggal akibat bunuh diri. (a14)

Warga Parbuluan Dilaporkan Diculik SIDIKALANG (Waspada): Menghilang secara misterius sejak Kamis (28/10), Saut Saudara Sianturi,32, warga Desa Lae Hole I Kecamatan Parbuluan Kabupaten Dairi, dilaporkan diculik orang tak dikenal. Laporan pengaduan penculikan telah disampaikan keluarga Saut ke Polres Dairi, akhir pekan lalu. Informasi diperoleh menyebutkan, Saut diduga diculik pada Kamis sekira pukul 08:00 di Jalan Dolok Sanggul-Lae Hole Desa Lae Hole Kecamatan Parbuluan. Beberapa saat sebelum penculikan, Saut diketahui mengendarai sepeda motor Honda Supra 125 menuju ke arah Sidikalang. Sepeda motor itu sendiri disebut warga ditinggal begitu saja di pinggir jalan. Keluarga Saut sejak Kamis sibuk mencari namun tidak kunjung ada titik terang. HP-nya juga selalu tidak aktif. Pada Jumat, keluarga Saut akhirnya mendatangi Polres Dairi melaporkan Sianturi diculik orang. Kapolres Dairi AKBP Yustan Alpiani SIK dihubungi wartawan melalui Kaurbin Ops Reskrim Iptu B Manurung SH, Sabtu siang membenarkan. “Iya, kemarin keluarganya sudah membuat LP. Kita masih selidiki, apakah benar penculikan dan apa motifnya,” ujar Kaurbin Ops Res. (a28)

Judi Togel Dan KIM Di Dairi Marak SIDIKALANG (Waspada): Pihak Kepolisian Daerah Sumatera Utara dan Kepolisian Resort Kota Medan dalam sepekan ini lagi gencar-gencarnya membrantas penyakit masyarakat yaitu, judi Togel (toto gelap) dan KIM ataupun judi lainnya. Namun, lain halnya yang terjadi di Kabupaten Dairi. Berdasarkan pantauan Waspada selama ini di daerah perkotaan Sidikalang, judi hingga kini terlihat tumbuh subur bak diibaratkan seperti jamur. Penjual terlihat secara terang-terangan menjual kupon Togel dan KIM kepada para pembeli. Beredarnya judi tersebut juga meluas hingga ke pelosok penjuru pedesaan seperti halnya di Kecamatan Tigalingga. Kapolres Dairi AKBP Yustan Alpiani, SIk kepada Waspada via sms telefon selularnya menyebutkan, dirinya segera akan mengecek dan menindak lanjuti atas persoalan itu. Sedangkan, Direktur Eksekutif LSM ICD (Independen Community Development) Kabupaten DairiPakpak Bharat Eben P Manik melalui telefon selularnya kepada Waspada mengharapkan polisi memberantas judi Togel dan KIM ataupun penyakit masyarakat lainnya agar tidak tebang pilih. (c08)


WISUDA: Proses pelaksanaan wisuda wisuda 42 sarjana dan 58 ahli madya STMIK Kaputama di Balai Putri Azzahrah Binjai, baru-baru ini.

Lulusan PT Harus Mampu Hadapi Persaingan 100 Mahasiswa STMIK Kaputama Diwisuda BINJAI (Waspada): Setiap lulusan perguruan tinggi harus mampu menghadapi persaingan global yang penuh dengan tantangan dan tuntutan dunia kerja. Karenanya, para wisudawan/ ti Sekolah Tinggi Manajemen Informatika dan Komputer (STMIK) Kaputama Binjai harus mampu menghadapi persaingan yang semakin ketat ini. Demikian ditegaskan Ketua Yayasan Pendidikan Teknologi Informasi Mutiara (YPTIM) Drs. IrwantoTampubolon pada acara wisuda 42 sarjana dan 58 ahli madyaSTMIKKaputamadiBalaiPutri Azzahrah Binjai, baru-baru ini. Karena itu, Irwanto meminta seluruh wisudawan/ti terus meningkatkan kemampuan terutama di bidang Bahasa Inggeris dan softkill lainnya dalam menghadapi persaingan global. Dalam

hal ini, Yayasan PTIM yang menaungi STMIK Kaputama berkomitmen untuk terus membenahi fasilitas kampus. KetuaSTMIKKaputamaDevi Yendrianof, S.Kom.MSi mengatakan, pada September 2010 STMIK Kaputama telah memenangkan Hibah PHP-PTS tahun 2010 dari Dikti. Dalam hal ini, STMIK Kaputama satu-satunya Perguruan Tinggi Swasta di Kota Binjaiyangberhasilmendapatkan dana hibah. Ini merupakan hasil kerja keras seluruh sivitas akademika. Ketua STMIK Kaputama juga menyampaikan, STMIK Kaputama selalu membutuhkan dukungan semua pihak baik mahasiswa, orangtua, alumni, pemerintahdaerahdanswasta,untuktetap memberi masukan dan sa-ling bertukar pikiran, membina kerja sama yang berguna bagi instansi danmasyarakat,sebagaiwujudTri Dharma Perguruan Tinggi. Pelaksana Sekretaris Kopertis Wilayah I Drs. Sederhana Sembiring, MM mengingatkan pentingnya jabatan akademis bagi para

dosenPTS.“DiKementerianPendidikan Nasional banyak sekali kesempatanuntukmendapatkan beasiswa bagi dosen dan mahasiswa, dana penelitian, dana kewirausahaan dan sebagainya,” ujarnya. Parlindungan Purba, SH. MM, selaku PembinaYPTIM berpesanagarparawisudawandapat terus memberikan kontribusi positif bagi kemajuan bangsa dan negara. Bahkan diharapakan dapat menyelesaikan permasalahan dan mampu menciptakan lapangan kerja yang baru. Parlindungan menyatakan, pihak yayasan memiliki komitmen yang tinggi untuk kemajuan STMIK Kaputama. Terbukti, semua program studi yang ada di STMIK Kaputama sudah Terakreditasi BAN-PT dan gedung baru perkuliahan dengan fasilitas modern berlantai tiga sedang dibangun diharapkan pada pertengahan 2011 dapat digunakan. Anggota DPRD Kota Binjai Petrus mengatakan, pihak Pemerintah Daerah Kota Binjai dan DPRD selalu mendukung sepe-

nuhnyasemuaprogramkerjadan kemajuan STMIK Kaputama. Pada wisuda kali ini, Pembantu Ketua I STMIK Kaputama Lina Arliana, SE., MM mengumumkan wisudawan terbaik untuk masing-masing program studi yaitu Magdalena Simanjuntak (Sistem Informasi – S1) dengan IPK 3,33; Raden Arie S. Wijaya (Teknik Informatika – S1) dengan IPK 3,24; Elli Budi Hartini (Manajemen Informatika – D3) dengan IPK 3,44; Nurmi Safitri (Komputerisasi Akuntansi – D3) denganIPK3,35danHusnulKhair (Teknik Informatika – D3) dengan IPK 3,50. Bahkan, dari 100 wisudawan yang dilantik, sekitar 70 orang (70 persen) telah diterima bekerja diinstansipemerintahdanswasta di Binjai, Langkat, Medan dan sekitarnya. Dari 70 orangtersebut sekitar 50 persen diterima bekerja setelah kuliah 2 – 4 semester di STMIK Kaputama, hal ini berarti STMIK Kaputama telah berhasil mendidikmahasiswanyasehingga dapat diterima di perusahaan/ intansi.(m26)

Ribuan Warga Langkat Doakan Gubsu Dan Korban Bencana P.BRANDAN (Waspada): Ribuan kaum muslimin dari berbagai pelosok dusun di Kabupaten Langkat, Sabtu (30/10) hingga Minggu(31/10)mengikutizikirdan doa istighasah untuk Gubsu H SyamsulArifin,SEsertamendoakan korban bencana di Kepulauan Mentawai,SumbardanPulauJawa. Kegiatan dilaksanakan di Masjid Amaliah, Kecamatan Stabat, Masjid Raya Azizi, KecamatanTanjungpura, Masjid Raya Ar-Riyadus Sholihin, Kecamatan Gebang dan Masjid Ubudiyah,

Kecamatan Babalan, P. Brandan. Ketua Fraksi Gabungan DPRD Sumut HYan Syahrin, SE, mantan ketua DPRD Langkat H Syafruddin Basyir, para jamaah dari sejumlah masjid disetiap kecamatan, kelompok perwiridan yasin kaum ibu dan bapak dan warga sekitar. “Pemandu zikir Ketua MUI Langkat Al-Ustadz H Saleh Hamid di Kecamatan Stabat, AlUstaz H Usman Tambusai dan Ustadz Syamsul Bahri di Masjid Azizi, Tanjungpura, Khalifah

Ham-dan di Masjid Raya Gebang, dan Al-Ustadz M Daud Rawi dan Ustadz Drs M Zein di Masjid Ubudiyah, Pangkalan Brandan,” ujar ketua panitia Ustadz Drs H Khaidir Siagian didampingi Ustadz Abdul Wahab, SAg. Dalam taushiahnya menyebutkan, hari ini Allah SWT penguasa alam semesta sedang memperlihatkan kepada seluruh umat manusia sebagian kecil dari tanda-tanda kebesaran dan kuasanya tanpa terkecuali karena itu dalam kesempatan ini mari

kita berzikir dan berdoa kepada Allah SWT agar H Syamsul Arifin, SE dan saudara-saudara yang kita yang tertimpa musibah kiranya tabah,” tegas para Ustadz. Ketua panitia penyelenggara Ustadz Drs H Khadir Siagian didampingi para ustadz dan tokoh Agama se Teluk Aru kepada wartawan menyatakan, kegiatan untuk memohon kepada Allah SWT agar H Syamsul Arifin, SE dan korban bencana alam di Mentawai Sumbar dan Pulau Jawa kiranya tabah. (c02)

Bocah 4 Tahun Luka Bakar RAWANGPANCAARGA, Asahan (Waspada): Akibat ketumpahan lampu minyak tanah, bocah perempuan berumur empat tahun mengalami luka bakar, Sabtu (30/10) sekitar pukul 19.00. Informasi dihimpun Waspada, korban, Prida Jesika Rani, putri kedua pasangan Sari,27, dan Zainul,48, warga DusunVIII, Desa Pondok Bungur/Kampung Bunga, Kecamatan Rawang Panca Arga, Asahan, tinggal bersama neneknya, Boina,48, mengalami luka bakar 60 persen dari tubuhnya termasuk di bagian wajah. Kejadian itu bermula saat neneknya mengisi minyak tanah ke dalam lampu sedang menyala, tanpadisadariminyakitutumpah danmengenaibajucucunyayang duduk di sebelah lampu, seketika itu juga api menyambar dan membakar korban. Nenek itu panik dan bergegas mengambil air untuk memadamkan api sambil berteriak minta tolong, akhirnya dengan

bantuan warga api itu bisa dipadamkan. Untuk tidak lanjut, korban langsung dibawa ke RSUD H Abdul Manan Simatupang (HAMS)Kisaran,untukmendapat perawatan intensif. “Saya gugup, melihat cucu saya sudah terbakar berteriak minta tolong, sehingga mengambilairdanberusahauntukmemadamkannya sampai tangan saya ikut terbakar. Alhamdulillah dengan bantuan warga api itu bisa dipadamkan,”ungkapnenekkorban Boina, ditemui Waspada di Ruangan Anak RSUD HAMS Kisaran, Minggu (31/10). Menurutnya, lampu minah yang membakar cucunya, bisanya diletakkan di kamar mandi untuk penghematan pemakaian listrik. Sewaktu kejadian, hanya dia dan cucunya di rumah, sedangkanyanglainnyapergikeluar termasuk kedua orang tua korban. “Semoga saja cucu saya cepat sembuh,” ungkap Boina didampingi ibu korban, Sari.

purna, Rabu (29/10). ‘’Untuk PAD mengalami penurunansebesarRp1.679.365.310 atau sebesar 9,3 persen dari anggaran direncanakan perlu terus dilakukan langkah-langkah yang lebih kongkrit dan terpadu dalam rangka menaikkan PAD yang signifikan pada tahun kedepan,’’sebut F Andil dan F Partai Golkar sebagaimana dibacakan, H Sabaruddin, LC dan Suharto. Menurutnya ada yang menjadi titik fokus perhatian antara lain kekurang siapan pemerintah dan sudah saatnya mengubah paradigma birokrasi kepada keahlian seseorang dalam menen-

dimulai dulu oleh pejabat kita, dari Wakil Bupati,” ujar Taufik. Setelah Wabup, kalau bisa dilanjutkan pejabat lainnya untuk menggunakan sepeda setiap hari Jumat, apakah Ketua DPRD atau Sekretaris Daerah, ujar Taufik sambil menjelaskan, KOR saat ini berjumlah 27 orang dan telah dideklarasikan pada 17 Oktober lalu bertepatan Peringatan Hari Jadi Pemerintahan Kabupaten L.Batu ke 65. Tatang Hidayat menambahkan, selain kampanye sepeda sehat, KOR juga akan melakukan penggalangandanauntukkorban bencana alam yang melanda bagian lain negeri ini, seperti Mentawai, Sumatera Barat dan akan menerjunkan anggotanya ke pulauyangditerjangtsunamitersebut guna mengantar dana yang terhimpun nantinya. Setelah tiba di kantor bupati, KOR yang menyampaikan maksud kerja sama penggalangan dana untuk korban bencana di Mentawai kepada Sekdakab H Hasban Ritonga, SH dan Asisten PemerintahanDrsKarlosSiahaan, MSi,mendapatresponcukuppositif. Pada kesempatan itu, KOR menyematkan pita hitam tanda berkabung ke baju di bagian dada Wabup. Sekdakab, Asisten Pemerintahan, Kepala Satpol PP dan Kabag Humas Infokom Pemkab L.Batu Poppar Simanjuntak dan Drs Sugeng juga disematkan dengan pita yang sama. (a27)

PD MABMI P.Siantar-Simalungun Adakan Doa Bersama P. SIANTAR (Waspada): Pengurus Pimpinan Daerah (PD) Majelis Adat Budaya Melayu Indonesia (MABMI) Kota PematangsiantardanKabupatenSimalungun periode 2010-2014 di bawah kepemimpinan Ketua Umum H Iwan Zulhami, SH. MAP dan Sekretarisnya Iptu Muhammad Syafi’i, SE mengadakan pembacaan Surat Yasin 41 dan doa bersama selama tiga hari berturut-turut kepada Dato Seri H Syamsul Arifin, SE sebagai Ketua Umum PB MABMI. “Agar beliau dapat menghadapi permasalahan dan terlepas dari beban fitnah serta diberikan kekuatan dan kesehatan,” sebut Ketua PD MABMI Pematangsiantar-Simalungun H Iwan Zulhami, SH. MAP didampingi Sekretaris Iptu Muhammad Syafi’I di Pematangsiantar, Jumat (29/10). Iwan Zulhami menyebutkan pembacaan Surat Yasin 41 dan doa bersama itu diadakan selama tiga hari berturut-turut yang

dimulai Selasa (26/10) hingga Kamis(28/10)malamyangdiadakan di rumah dinas Kepala Kemenag, Jalan KKO, Pematangsiantar. Doa bersama itu, lanjut Iwan Zulhami, dipimpin Ustadz Drs Amnar Lubis serta dihadiri ratusananggotadansimpatisanwarga Melayu yang berdomisili di Pematangsiantar dan Simalungun. “Kami sangat berterimakasih kepada Dirut PDAM Tirtauli H. Badri Kalimantan, SE, MM selaku salahseoranganggotaPDMABMI Pematangsiantar-Simalungun yang memberikan bantuannya hinggadoabersamaitudapatberlangsung,termasuk kepadaKetua Bidang Humas dan Pengabdian Masyarakat PD MABMI Ir Rizal,” sebut Iwan Zulhami. Melalui doa bersama ini, harap Iwan Zulhami, Gubsu tetap diberikan ketabahan dan terlepas dari masalah yang dihadapinya. “Kita sangat menyayangi Dato Seri H. Syamsul Arfin, SE yang selama ini sangat merakyat dan disenangi rakyat.” (a14)

Dikecam Oknum Yang Gelar Syukuran Penahanan Syamsul Arifin BINJAI (Waspada): Tokoh masyarakat Kota Binjai Azharuddin Harahap prihatin dan menyesalkan sikap segelintir oknum elemen masyarakat Kota Binjai danLangkat melakukansyukuran denganpenahananGubernurSumatera Utara H.Syamsul Arifin,SEolehKomisiPemberantasan Korupsi (KPK). Menurut Azharuddin Harahap kepada wartawan, Minggu (31/10) oknum yang melakukan syukuranitutidakmencerminkan prilaku seorang manusia beragama.Walau kita tidak suka atau senangkepadaGubsuH.Syamsul Arifin, tidak seharusnya me-

lakukan syukuran yang euforia sesamaumatberagamatidakusah saling hujat. ‘’Mari kita mengintrospeksi diri apa yang sudah kita lakukan terhadap seseorang yang sedang tertimpa musibah,’’ katanya. Menurut Azharuddin Harahap, sosok H.Syamsul Arifin,SE merupakan tokoh yang dermawan dan suka menolong. Sehingga masyarakat prihatin atas musibah yang dialaminya .” Terlalu naïf oknum-oknum yang menggelar syukuran sambil memotong lembu atas musibah yang dialami H Syamsul Arifin, SE.”ujar Zahar. (a03)

Pengangkatan Ketua Komite Sekolah SMP N 2 Sorkam Barat Salahi Aturan


MEMBERI OBAT : Boina dibantu anaknya Sari terlihat sedang memberi obat kepada cucunya, Jesika Prida Rani,4, yang mengalami luka bakar akibat lampu minyak tanah, api bukan saja melukai 60 persen tubuhnya, namun bagian wajah ikut terbakar. Foto direkam, Minggu (31/10). Petugas Kesehatan RSUD HAMS Kisaran, ditemui Waspada, mengatakan, korban mengalami luka bakar yang

diperkirakan 60 persen dari tubuhnya, dan hingga saat ini masih menjalani perawatan intensif. (csap)

Soal PAD Rendah Hingga Proyek Jadi Sorotan Di Batubara BANYAK masalah serius di KabBatubarabelumterpecahkan danmerupakanhalmengejutkan, dari hasil pembahasan dengan tim anggaran eksekutif menyatakan penerimaan dari sektor pajak dan retribusi daerah masih rendah. ‘’Inisalahsatumasalahserius, karena menurunnya partisipasi masyarakat untuk memenuhi kewajibannya,’’tukas juru bicara dari FPPP DPRD Kab. Batubara AhmadBadripadapendapatakhir fraksi terhadap laporan badan anggaran DPRD Kab. Batubara tentang Rancangan Perubahan APBD 2010 dalam sidang pari-

R. PRAPAT (Waspada):Wakil Bupati Labuhanbatu Suhari Pane bersama Komunitas Ontel Rantauprapar (KOR) mengampanyekan penggunaan transportasi yang sehat, non bahan bakar dan ramah lingkungan alias sepeda, Jumat (29/10) di Rantauprapat. Kampanye sepeda sehat itu dimulai dari rumah dinasWabup, dimana Suhari bersama rombongan KOR dengan rute Jalan WR Supratman-Imam BonjolSiringo-ringo-SeiTawar-Binaraga dan selanjutnya finis di kantor bupati Jalan SM Raja Rantauprapat. Setiap rute yang dilintasi,WabupdanKORmenyempatkandiri melihat jalan yang rusak, jembatan yang perlu direhabilitasi dan duikeryangambroldanmeminta instansi terkait segera memperbaiki kerusakan yang ada. Sebelum mulai mengayuh sepeda ontel, Suhari kepada wartawandirumahdinasnyamengatakan, penggunaan sepeda, apapun jenisnya, sebenarnya sangat dianjurkan.Banyakmanfaatyang diperoleh dari kereta angin tersebut, yakni ada aspek olah raganya yang tentunya membuat badan lebih bugar, ramah lingkungan dan hemat biaya. KetuaKORTaufikdidampingi aktivis Tatang Hidayat M Si, memaparkan, sebenarnya kampanya pemanfaat sepeda akan dimulai November atau Desember 2010. “Tetapi sebelum itu

tukan penempatan jabatan. Rendahnya tingkat partisipasi ini juga perlu diteliti ulang apakah Perda diberlakukan memberatkan.’’Kami berkeyakinan salah satu dari kedua faktor ini menjadi penyebab menurunnya sektor penerimaan daerah,’’ujar Ahmad Badri. Tuntaskan Di sisi lain PPP menekankan untuk dapat manfaatkan waktu yang singkat menuntaskan pekerjaan-pekerjaan besar sebagaimana diproyeksikan dalam APBD 2010.Salah satunya masalah proyek yang sudah dikerjakan

berkisar 20 persen. Meskipun diakui masih ada waktu untuk merampungkan, kalau pengawasan tidak optimal dilakukan oleh masing-masing penanggungjawabkegiatanmaka pelaksanaannyadilapanganakan mengalami nasib yang sama seperti tahun sebelumnya. Banyaknya luncuran yang tumpang tindih dari satu tahun ketahunberikutnyasangatmembebaniperjalananAPBDdanjelas berdampak menurunnya kepercayaan masyarakat terhadap kinerja Pemkab Batubara tentunya berimbas ke dewan.(a11)

SORKAM BARAT,Tapteng (Waspada) : Pengangkatan ketua komite sekolah SMP N 2 Sorkam Barat mendapat protes dari orangtua siswa karena menyalahi aturan lampiran Kepmen Pendidikan Nasional nomor 044/U/ 2002 tertanggal 2 April 2002 tentang acuan pembentukan komite sekolah Bab IV pasal 1 huruf a. transparan, akuntabel dan demokratis. Demikian salah seorang orangtua siswa Abdul Azis Hutauruk kepada Waspada, Sabtu (30/10) menyikapi atas pengangkatan ketua komite sekolah tanpa melakukan musyawarah bersama orangtua siswa yang diduga sengaja dikondisikan. Dijelaskan, pada awalnya 23 September lalu sudah dilakukan musyawarah dihadiri ratusan orangtuasiswa,ketuadewanpendidikan Tapteng, kepsek SMP N 2 Sorkam Barat dan Camat Sorkam dengan agenda pemberhentian pengurus komite sekolah sekaligus pemilihan ketua komite sekolah. Saat itu 3 kandidat calon yang muncul masing-masing Birman Sinambela, Mangimbur Simanungkalit dan Hikmansyah Tanjung pada akhirnya hasil rapat pemilihan dimenangkan Birman Sinambela dan disetjui seluruh peserta dan undangan, kata Azis yang juga mantan ketua PK KNPI Sorkam Barat ini. Azis mengakui, sebagai komitmen bersama untuk membuat program ke depan kemu-

dian ketua komite Sekolah merangkul semua elemen masyarakat dan orangtua siswa dengan unsur pengurus komite sekolah yakni ketua Birman Sinambela, sekretaris Mangimbur Simanungkalit dan bendahara Hikmansyah Tanjung. Menurut Azis yang juga anggota komite sekolah yang terpilih, sejakterpilihnyapenguruskomite sekolah telah melakukan beberapa kali musyawarah me-nyangkut program kerja kedepan dihadiri2orangdewanguruyakni wakil kempsek br Sarumpaet dan Gulo dengan agenda agar pihak sekolah secepatnya mengeluarkan SK Kepengurusan Komite Sekolahdanpenyerahaninventaris daripenguruskomitelamakepada penguruskomitesekolahyangbaru, bahkanmenurutAzissaatituwakil kepsekmenjanjikanadanyabantuan uang Rp 3 juta dari kepsek Janes Pardede kepada komite untuk pembuatan pagar sekolah. Namun ironisnya pada rapat, Rabu (27/10) disampaikan salah satu peserta yang bukan orangtua siswamenyampaikankepadapeserta rapat Hapridal Pasaribu menjadi Ketua Komite Sekolah SMPN 2 Sorkam Barat, sehingga mendapatproteskerasdariorangtua siswa, sedangkan oknum kepsek hanya bersikap diam. Secara terpisah kepala SMP N 2 Sorkam Barat Drs Janes Pardede saat dikonfirmasi Waspada, Minggu(31/10)seputarpersoalan melalui pesan singkat tidak ada balasan. (a34)



WASPADA Senin 1 November 2010

Bakar Anak Kandung Didakwa UU KDRT

Aksi Illegal Logging Masih Menggila BIREUEN (Waspada): Aktivitas penebangan liar (illegal logging) di sejumlah kawasan hutan di Kabupaten Bireuen diduga masih terus menggila di sejumlah lokasi atau tempat. Buktinya, belum lama ini pihak terkait masih menemukan sejumlah kayu batang kayu ilegal di sejumlah lokasi. Kabid Kehutanan Dinas Pertanian Bireuen, Dailami S.Hut kepada wartawan belum lama ini mengatakan, hingga kini masih ada dugaan terjadinya aktivitas penambangan hutan di wilayah Bireuen dan dibuktikan dengan serangkaian aksi penangkapan oleh polisi dan hasil temuan petugas jagawana (Polhut) setempat. “Sejak Mei 2010 lalu, kami telah mengakumulasi sedikitnya 10 kubik kayu temuan. Sementara kayu tangkapan pihak kepolisian secara keseluruhan diperkirakan 22 kubik atau sekitar 17.16 ton, dan jumlah itu termasuk dua kasus tangkapan awalnya yang telah BAP-nya serta sudah dilimpahkan ke Pengadilan,” sebutnya yang mengakui masih terjadinya aksi pengrusakan hutan di Bireuen akibat minimnya fasilitas dan biaya operasional.(amh)

Pengangguran Kian Bertambah Di Bireuen BIREUEN (Waspada): Angka pengangguran di Bireuen hingga akhir Oktober 2010 meningkat tajam dibandingkan beberapa bulan sebelumnya. Hal itu terlihat dengan membludaknya angka pencari kerja di sejumlah. Bahkan kabarnya pencari kerja sekarang ini mencapai 5.256 orang. Kabid Tenaga Kerja Dinas Sosial, Kependudukan, Pencatatan Sipil, Transmigrasi dan Penangulangan Bencana Bireuen, Abdul Karim SE.Ak Jumat (29/10) mengatakan, sejak tahun 2008 pemohon Ak/1 (kartu kuning) mencapai 1.570 orang. “Tahun 2009 pencari kerja mencapai 2.479, JanuariSeptember 2010, angka pencari kerja di Bireuen mencapai 1.207 orang. Usaha untuk mencari lapangan kerja hingga kini tidak pernah kendor ketika menjelang penerimaan pegawai negeri sipil dengan berbagai jenjang pendidikan seperti saat ini mereka melamar untuk calon Pegawai Negeri Sipil (CPNS) Kementerian Agama,” sebutnya. Sedangkan angka pertumbuhan penduduk Bireuen hingga Oktober 2010 mencapai 389.024 jiwa, sekitar 1.510 jiwa diantaranya telah tertampung menjadi karyawan/ karyawati swasta serta CPNS/PNS, selebihnya masih menganggur.(amh)

Kwarda Aceh Bahas Pelaksanaan Perkemahan Wirakarya Nasional 2010 BANDA ACEH (Waspada): Ketua Kwartir Daerah (Kwarda) Pramuka Aceh melakukan rapat koordinasi dengan dinas, badan lembaga terkait menjelang pelaksanaan Perkemahan Wirakarya Nasional di laksanakan di Seulawah Scout Camp, Saree, Aceh Besar, pada 29 November - 6 Desember 2010. Nazar yang jugaWagub Aceh itu, memimpin langsung rapat koordinasi itu sebagai bagian persiapan pelaksanaan Perkemahan Wirakarya Nasional 2010 yang diikuti sekitar 10.000 peserta dari seluruh provinsi di Indonesia, Kamis (28/10) lalu di gedung serba guna Setda Aceh, Banda Aceh. “Kita hanya punya waktu 30 hari lagi kedepan untuk mempersiapkan Perkemahan Wirakarya Nasional ini, Insya Allah akan dibuka Presiden Soesilo Bambang Yudhoyono dan ditutup oleh Wakil Presiden Boediono pada 6 Desember 2010 nanti,” ungkap Nazar pada rapat koordinasi tersebut. Perkemahan Wirakarya (PW) tersebut adalah pertemuan Pramuka Penegak dan Pramuka Pandega berbentuk perkemahan besar, dalam rangka mengadakan integrasi dengan masyarakat dan ikut serta dalam kegiatan pembangunan masyarakat.(b04)

Kesadaran Masyarakat Terhadap UU Lalulintas Masih Kurang BIREUEN (Waspada): Sampai sekarang kesadaran masyarakat Bireuen untuk patuh ataupun taat kepada Undang-Undang Lalulintas atau peraturan lalin masih kurang, sehingga laklantas kerap terjadi, bahkan tidak sedikit nyawa warga telah hilang di jalan akibat kecelakaan itu. Demikian Kapolres Bireuen, memlalui Kasat Lantas AKP Suhardiman kepada Waspada, Kamis (28/10) terkait perkembangan kesadaran warga terhadap lalulintas. “Saya lihat masyarakat sekarang kurang mematuhi peraturan lalulintas, seperti menerobos rambu-rambu lalulintas, dan tidak menggunakan helm atau hal lain yang dapat mencelakainya di jalan raya,” katanya. Menurutnya, sebenarnya penyebab terjadinya kecelakaan akibat pengendara tidak mematuhi lalulintas. Padahal pihaknya selalu mensosialisasikan UU nomor 22 tahun 2009 tentang peraturan lalulintas, namun masyarakat seakan tak memperdulikannya, sehingga banyak kecelakaan lalulintas terjadi di wilayah kerjanya.(amh)

Masa Panen Harga Beras Mulai Turun BIREUEN (Waspada) : Memasuki masa panen padi, harga beras di Bireuen dan sekitarnya mulai beranjak turun. Pengaatan Waspada di Bireuen harga beras lokal kualitas baik cap Panah sebelumnya sudah melonjak Rp 100 ribu per karung ukuran 15 kg turun Rp2.000 per karung menjadi Rp98 ribu per karung. “Beras lokal kualitas nomor dua dari harga Rp92 ribu per karung ukuran 15 kg turun menjadi Rp90 ribu per karung,” ujar Nurdin seorang pedagang bahan kebutuhan pokok di jalan jati Bireuen Jumat (29/10). Sementara harga gabah kering memasuki masa panen kali ini masih stabil. H. Mahyiddin, salah satu pedagang gabah di Bireuen mengatakan, harga gabah kering yang dibeli dari petani Rp3.300 per kg. Gabah kering yang dibeli dari petani dijual lagi kepada pedagang diperkirakan puluhan ton gabah kering musim panen kali ini lebih banyak diangkut dijual ke Medan. Dikatakan, para pedagang cendrung menjual gabah ke Medan lantaran harga beli di Medan jauh lebih tinggi dibandingkan pasaran harga gabah di Bireuen. Beberapa pengusaha industri kilang padi di Bireuen yang dihubungi Waspada mengatakan, mereka membeli gabah dari petani Rp 3.200 – Rp 3.300 per kg. Gabah petani lebih banyak dibeli oleh agen-agen pedagang di desa dan kecamatan kemudian diangkut dijual ke Medan. (b16)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *


Berangkat (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta


11:35 JT 397 Medan/Jakarta 20:00 JT 307 Jakarta

06:40 12:15

12:55 SJ011 Medan/Jakarta


12:20 AK 306 Kuala Lumpur *

FY 3401 Penang ** 14:10 FY 3400 Penang “” * Setiap Senin, Rabu, Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

12:45 14:30

Waspada/Muhammad Riza

IKAN KERLING: Dua bocah Tangse, Pidie memburu ikan keureuling (sejenis ikan jurung-red) di dalam Daerah Aliran Sungai (DAS) Tangse.

Rumoh Aceh Di Makkah Rampung Tiga Tahun BANDA ACEH (Waspada): Wakil Gubernur Aceh Muhammad Nazar memperkirakan, pembangunan Baitul Asyi (rumoh Aceh) di Makkah akan tuntas tiga tahun lagi. Tahun 2013, rakyat Aceh yang berhaji bisa menginap di sana. Menurut dia, jika pemondokan itu kelar, bisa saja calon jamaah haji asal Aceh yang berangkat ke tanah suci membayar ongkos pesawatnya saja. “Jika pembangunan rumah Aceh selesai, bisa saja hal itu kita wacanakan,” ujar dia kepada wartawan, Minggu (31/10). Nazar menyampaikn itu usai tepung tawar (peusijuk) dalam rangka melaksanakan ibadah haji oleh Tgk Tengku H

Usman Ali (Abu Kuta Krueng) pemimpin Pondok Pesantren Shalafiyah Darul Munawwarah Kuta Krueng, Pidie Jaya. Sudah menjadi kebiasaan masyarakat tanah rencong, setiap calon haji yang hendak ke tanah suci, ditepung tawari lebih dulu untuk mendoakan kesehatan dan keselamatannya. Wagub Aceh ini melanjutkan, pembangunan pemondokan yang dilakukan pihak Nazir Wakaf Baitul Asyi di Mekkah di perkirakan akan rampung tiga tahun mendatang yakni sekitar 2013. “Asrama itu bisa menampung sekitar 4.000-5.000 jamaah haji Aceh. Letaknya di kawasan Al Aziziah Junubiyah, Mekkah,” jelas dia. Seperti diketahui, Baitul Asyi adalah harta wakaf oleh Habib Bugak seorang ulama Aceh keturuan Arab pada tahun 1800 Masehi di kawasan Qusyasyiah, Makkah. Ia mewakafkan sebidang tanah dan rumah

untuk masyarakat Aceh sebagai tempat pemondokan saat menunaikan rukun Islam kelima itu. Dari hasil pengelolaan wakaf tersebut oleh Nazir, dana keuntungan tersebut digunakan sebagai pembangunan asrama dan dibagi bagi setiap calhaj Aceh yang melaksanakan ibadah di Tanah Suci pada musim haji. Nazar dan keluargnya tahun ini menunaikan ibadah haji. Dia berangkat melalui dengan fasilitas haji plus. “Insya Allah, saya akan melihat perkembangan pembangunannya,” sebut dia. Kordinator Humas PPIH Embarkasi Banda Aceh, Juniazi Yahya, S.Ag kepada Waspada, kemarin menyebutkan seluruh jamaah Aceh yang terdiri 13 kloter sudah memadatikotaMakkah.“Darilaporanyang kami terima, Alhamdulillah, mereka semuanya sehat-sehat saja,” kata dia. (b05)

Persentase Guru S1 Kecil KUTACANE (Waspada): Meski kebutuhan sekolah terhadap guru tenaga pendidik sekolah dasar mencukupi, namun persentase guru yang sudah menyelesaikan pendidikan Strata 1 masih rendah. Demikian Kadis Dikpora Aceh Tenggara (Agara), H. Ali Basrah S.Pd.MM kepada Waspada di ruang kerjanya, Sabtu (30/10) menyikapi kedatangan Tim Koordinasi Pembangunan Pendidikan Aceh (TK-PPA) bersama MPD Aceh ke beberepa sekolah di bumi sepakat segenep, pekan lalu. Berdasarkan data yang dimiliki Dinas Dikpora Agara, saat ini tercatat sebanyak 2600 guru SD di seluruh Aceh Tenggara, namun dari jumlah itu, baru 30 persen yang menyelesaikan pendidikan Strata 1, sedangkan 70 persen lagi belum

menyandang S1. Rendahnya persentase guru SD yang sudah menyelesaikan pendidikan S1, jelas akan menjadi problema di masa mendatang. Masalahnya, bila sampai akhir 2015 guru SD belum menyelesaikan pendidikan S1, semua tunjangan yang mereka peroleh selama ini akan dihentikan. Diakui Kadisdikpora, terbatasnya perguruan tinggi di Aceh yang diizinkan menyelanggarakan program S1 (Akta IV), jadi kendala minimya guru SD mengikuti program S1, masalahnya hanya Unsyiah dan Al Muslim Bireuen yang memiliki izin tersebut. Sementara jarak dan rentang kendali Aceh Tenggara dengan perguruan tinggi dan universitas di Bireuen dan Banda Aceh jauh, akibatnya biaya yang dikeluarkan guru menempuh program S1 terutama

untuk guru SMP dan SMA sederajat tinggi. Karena itu agar kompetensi dan sertifikasi guru tercapai dan tuntutan undang-undang agar guru profesionalitas segera terwujud, sudah selayaknya dibuat kebijakan agar guru di Agara, diizinkan menempuh program S1 di universitas terdekat dengan Agara. Sedangkan untuk mempercepat tercapainya profesionalisme guru sebagai tenaga pendidik, sertifikasi dan kompetensi, materi testing penerimaan guru juga dibedakan dengan CPNS biasa dan ada kekhususan soal, sementara guru yang sudah diangkat juga diwajibkan mengikuti Diklat selama beberapa bulan,“ ujar Ali Basrah mengakhiri keterangannya.(b27)

Remaja Matang Kuli Korban Balap Liar LHOKSEUMAWE (Waspada): Kerumunan remaja di kawasan Mon Geudong, Kota Lhokseumawe tiba-tiba bubar setelah terjadi kecelakaan yang mengakibat Muzakir, 19, terpaksa dilarikan ke rumah sakit, Minggu (31/10) dini hari. Kerumunan ABG di sekitar jembatan Cunda, diduga aksi balapan liar yang selama ini meresahkan pengguna jalan raya. Menurut informasi petugas kepolisian, kecelakaan terjadi ketika Jupiter BL 4188 QG melaju dengan kencang dari arah kota. Ketika tiba di kawasan jembatan Cunda, tiba-tiba sepeda motor yang dikendaraai Muzakir menabrak pengendara Supra. Pengendara Supra tidak

mengalami luka serius, namun Muzakir harus dilarikan ke rumah sakit akibat terhempas ke badan jalan. Saat kejadian, Muzakir diduga sedang kebut-kebutan dengan rekannya yang juga menggunakan sepeda motor jenis yang sama. “Pengendara Jupiter sudah teridentifikasi identitasnya, bernama Muzakkir. Tetapi pemilik Supra dan pengendara Jupiter lawan tanding Muzakkir ini masih sedang dilakukan pengembangan lebih lanjut. Ini kasus tabrak lari,” jelas Kasat Lantas Polres Lhokseumawe, AKP Aji Purwanto melalui Kanit Laka Lantas, Aiptu Suardi.

Barang bukti saat ini telah diamankan di Pos Lantas Cunda. Muzakir remaja Keude Matang Kuli, Aceh Utara. Kecelakaan yang terjadi sekitar pukul 01.30 itu diduga aksi balapan liar yang selama ini meresahkan warga pengguna jalan. Kasat Lantas juga menegaskan, pihaknya dalam waktu dekat ini akan segera melakukan penertiban di sejumlah titik balapan liar di daerah itu. “Kepada seluruh orang tua dan masyarakat agar dapat bersama-sama mengawasi remaja yang keluyuran pada malam hari agar terhindar dari musibah ini,” imbuhnya.(b17)

5 November, Pengurus PWI Aceh Dilantik BANDA ACEH (Waspada): Ketua Umum Persatuan Wartawan Indonesia (PWI) Pusat Margiono akan melantik Pengurus PWI Cabang Aceh masa bakti 2010-2015 di Anjong Monmata, Banda Aceh, 5 November mendatang. Kepastian pelantikan tersebut disampaikan Ketua PWI Cabang Aceh periode 2010-2015 Tarmilin Usman, SE, M.Si di Gedung Sekretariat PWI Aceh, Simpang Lima, Banda Aceh, pekan lalu. Sebelumnya, dalam rapat perdana pengurus PWI Aceh periode 2010-2015 yang dihadiri Adnan NS selaku Ketua Dewan Kehormatan Daerah, Tarmilin Usman yang terpilih memimpin PWI Aceh pada Konfercab X PWI Aceh yang berlangsung di Hotel Grand Nanggroe Banda Aceh, 25-26 September lalu, secara resmi mengumumkan komposisi kepengurusan dan personalia Pengurus PWI Cabang Aceh masa bakti 2010-2015 sebagaimana dituang dalam Surat Keputusan PWI Pusat. Pengurus PWI Pusat dalam Surat Keputusan Nomor: 153-PGS/PP-PWI/ 2010 tanggal 19 Oktober 2010 menetapkan, Ketua PWI Aceh terpilih Tarmilin Usman, SE, M.SI, Wakil Ketua Bidang Organisasi Muhammad Shaleh, Wakil

Ketua Bidang Pembelaan Wartawan M. Nasir Nurdin, Wakil Ketua Bidang Pendidikan T. Maimun Umar dan Wakil Ketua Bidang Kesejahteraan H. T. Anwar Ibrahim. Sekretaris Iskandarsyah, Wakil Sekretaris I Muhammad Saman, S.Ag, Wakil Sekretaris II Al Masri. Bendahara Azhari, SE dan Wakil Bendahara Muhammad Zairin. Kepengurusan PWI Cabang Aceh itu juga dilengkapi SeksiWartawan Olah Raga, Seksi Wartawan Politik dan Keamanan, Seksi Wartawan Media Cetak, Seksi Wartawan Media Televisi, SeksiWartawan Media Radio, SeksiWartawan Kesejahteraan, Seksi Wartawan Pendidikan Seksi Keagamaan dan Seksi Wartawan Hukum. Selain itu, kepengurusan PWI Cabang Aceh masa bakti 2010-2015 juga ditambah dengan dua direkturyakni Direktur Lembaga Pendidikan dan Pelatihan Iranda Novandi dan Direktur Lembaga Bantuan Hukum dan Advokasi T. Mansursyah, SH. Sedangkan Penasehat H. Syamsul Kahar dan H Harun Keuchiek Leumik. Selain Pengurus Cabang dan Penasehat, dalam Surat Keputusan Nomor 154PGS/PP-PWI/2010 tanggal yang sama, Pengurus PWI Pusat juga menetapkan Dewan Kehormatan Daerah yang terdiri dari

H Adnan NS, S.Sos, ketua merangkap anggota, Drs. H. A. Dahlan TH, sekretaris merangkap anggota, Barlian AW, Ismail M. Syah dan Drs. Burhanuddin Usman, masing-masing sebagai anggota. Pelantikan yang dimulai pukul 20.15 WIB itu, Ketua Ikatan KeluargaWartawan Indonesia (IKWI) Pusat Ny Margiono juga dijadwalkan akan melantik Pengurus IKWI Cabang Aceh masa bakti 2010-2015 yang dipimpin Ny Harbiah A Gani.. Persiapan Pelantikan Sementara Ketua Panitia Pelantikan Pengurus PWI Cabang Aceh Saidulkarnain Ishak didampingi Sekretaris Panitia Muhammad Zairin menyebutkan, pada pelantikan pengurus PWI Cabang Aceh nanti panitia pelantikan turut mengundang Gubernur Aceh Irwandi Yusuf dan unsur Muspida Aceh serta para pejabat setempat. “Persiapan acara pelantikan sudah dilakukan dan semuanya sudah tidak ada masalah, mudah-mudahan semua berjalan lancar dan sesuai jadwal,” kata Saidul. Saidulkarnain juga menambahkan, satu hari sebelam acara pelantikan, bertempat di Gedung PWI Aceh berlangsung kenduri anak yatim. (b04)

LHOKSEUMAWE (Waspada): Karena perbuatannya membakar anak kandungnya yang masih bocah dengan minyak tanah, Mahyeddin Abubakar, 45, nelayan Desa Ujong Blang, Kecamatan Banda Sakti, Kota Lhokseumawe didakwa melanggar Undang-Undang Kekerasan Dalam Rumah Tangga (KDRT) dan Pelindungan Anak. Dakwaan itu dibacakan Jaksa Penuntut Umum (JPU), dalam sidang perdana Kamis (28/10) di Pengadilan Negeri Lhokseumawe. Akibat perbuatan ayahnya itu, Muhammad Amrul, 12, kiritis luka bakar serius. Penyebabnya hanya lantaran mengambil uang tanpa izin Rp20.000 dari hasil penjualan ikan tangkapan ayahnya Senin (5/ 7) lalu, sekitar pukul 15:30. Sidang dibuka Ketua Majelis Hakim Sadri SH didampingi dua anggota majelis Toni Irfan dan M Jamil SH, berlangsung dari pukul 11:30 -12:30, dihadiri JPU, Sekaring Dyah Ika Wulan SH. Dalam materi dakwaannya, JPU terdakwa didakwa melanggar pasal 44 ayat (1) jo ayat ayat 2, undang-undang nomor 23 tahun 2004 tentang penghapusan kekerasan dalam rumah tangga (KDRT). JPU juga mendakwakan pasal 44 ayat (1), kedua Primair, pasal 80 ayat (1) jo ayat 4, undang-undang nomor 23 tahun 2002 tentang perlindungan anak. Usai mendengar materi dakwaan, majelis hakim melanjutkan sidang kembali dengan agenda pemeriksaan saksi. Yakni, Safwan, dan Nursiah, tetangga terdakwa. Dalam keterangannya, terdakwa kesal karena anaknya mengambil Rp20.000, uang dari hasil jual ikan tangkapannya tanpa izin. Buntutnya, dia menyiram minyak tanah ke tubuh ananya dan membakarnya, namun saat itu juga yang terdakwa memadamkan api hingga membawa korban ke rumah sakit. Usai mendengar keterangan saksi, majelis hakim menunda sidang, Kamis, (4/11) mendatang dengan agenda pemeriksaan terdakwa. (b15)

DPRK Sorot Kinerja Puskesmas Sawang LHOKSUKON, Aceh Utara (Waspada): Kalangan DPRK Aceh Utara menyorot kinerja Puskesmas Sawang. Dewan menilai pelayanan di Puskesmas itu buruk. Pasalnya, petugas medis rata-rata masuk pukul 9:00 dan pulang pukul 12:00. Selain itu, Kepala Puskemas juga dilaporkan hanya masuk tiga kali dalam sepekan. “Setelah menerima keluhan dari masyarakat, saya langsung turun ke Puskesmas itu. Pegawainya ada 88 orang dan 18 lainnya berstatus honor daerah. Tapi, banyak yang tidak disiplin masuk kerja. Akibatnya, pelayanan terhadap masyarakat tidak maksimal,”beber anggota DPRK Aceh Utara, Tantawi, Rabu (27/10). Selain masalah Sumber Daya Manusia (SDM), sambung Tantawi, beberapa jenis obat penting seperti obat anti sakit, anti biotik, bius, paracetamol, juga tidak tersedia di Puskesmas itu. Bahkan persediaan oksigen juga kosong. “Padahal, Puskesmas itu memiliki ruang rawat inap. Bagaimana mungkin, oksigen saja tidak ada. Ini sangat memprihatinkan,” imbuh Tantawi. Terkait temuan tersebut, Tantawi mengaku sudah memanggil Kadis Kesehatan Aceh Utara, M Nurdin. “Kadis bilang obat ada, tapi saya temukan di lapangan beberapa jenis obat tidak ada. Ini harus segera ditindak. Apalagi, sesuai laporan warga, pelayanan buruk seperti itu sudah terjadi sejak satu setengah tahun terakhir,” tandas Tantawi. Kepala Puskesmas Sawang, Yanti, yang dikonfirmasi wartawan secara terpisah, membantah dirinya jarang masuk kantor. “Tidak benar itu. Saya selalu masuk kantor, kecuali ada rapat di kantor dinas. Begitu juga, soal stok obat-obatan, tidak pernah langka, apalagi sampai kosong,”katanya. Kendati demikian, Yanti mengakui beberapa pegawainya memang tidak disiplin masuk kerja. “Tapi hanya beberapa pegawai saja dan mereka sudah kita tegur,” tegas Yanti. Sementara Kadis Kesehatan Aceh Utara, M Nurdin, mengatakan, pihaknya juga sudah memanggil dan menegur Kepala Puskesmas Sawang. “Saya sudah panggil dia. Saya bilang, stok obat di gudang cukup banyak, kok bisa terjadi kelangkaan obat di Sawang. Kemudian, terkait pegawai tidak disiplin, harus ditindak tegas,” sebut Nurdin sembari berjanji akan segera turun ke Sawang guna memastikan kebenaran temuan anggota DPRK Aceh Utara itu.(cmus)

BBI Cubo Tak Terurus MEUREUDU (Waspada): Kondisi Balai Benih Ikan (BBI) Cuboe Luengputu, Kecamatan Bandar Baru, Kabupaten Pidie Jaya, sangat mengkhawatirkan karena lokasi pembenihan ikan itu tak terurus, ditambah lagi kebersihan dan pemeliharaan ikan tidak serius. Padahal lokasi BBI Cubo sangat rawan predator ikan air tawar yang perlu penanganan, pengelolaan, dan pemeliharaan yang ekstra serius, ungkap warga setempat kepada Waspada, Minggu (31/10). Menurut warga setempat, soal kondisi dan sistem pengelolaan BBI Cubo dinilai masih amburadul itu, telah mendapat kunjungan dan tanggapan langsung dari Tim Panitia Khusus (Pansus) VII DPRK Pidie Jaya beberapa waktu lalu. Sementara Pansus VII DPRK Pidie Jaya melaporkan BBI Cubo, selain itu masih ditemukan tiga kolam lainnya belum difungsikan sama sekali, sehingga dikhawatirkan menjadi kolam tua yang dipenuhi semak belukar, ungkap Azwar Aswah selaku pelapor Pansus VII. Oleh karenanya PansusVII DPRK Pidie Jaya mengharapkan kepada Dinas Kelautan dan Perikanan (DKP) setempat agar mekanisme pengelolaan BBI Cubo ditinjau ulang, bahkan sebaiknya di kontrakkan saja pengelolaannya kepada pihak ketiga (swasta-red) yang lebih professional, di mana hasilnya nanti akan menjadi pemasukan ke sektor Pendapatan Asli Daerah (PAD). Menanggapi laporan Pansus DPRK itu, Bupati Pidie Jaya, Drs. H. M. Gade Salam mengatakan, pengelolaan BBI Cubo masih dalam tahapan peningkatan dan penyempurnaan sarana serta prasarana, seperti belum tersedianya daya tenaga listrik sesuai kebutuhan. Begitu juga tenaga yang tersedia di BBI Cubo hanya 1 PNS dan 4 Tenaga Harian Lepas (THL). Menyangkut hasil produksi ikan air tawar dari beberapa kali pemeliharaan telah dilakukan, belum maksimal. Di samping juga masih kurangnya tenaga ahli budidaya ikan air tawar. Begitu pun dengan tiga kolam yang belum difungsikan telah ditumbuhi semak belukar dikarenakan belum layak untuk digunakan.(b21)

Provinsi Belum Rela Proyek Otsus Dikelola Kabupaten SIGLI (Waspada): Meski pelaksanaan sejumlah proyek Otonomi khsusus (Otsus) diperuntukkan untuk daerah Kabupaten Pidie. Namun, pihak pemerintah provinsi tidak sepenuh hati memberikan proyek itu. Buktiknya sekira 50 persen proyeknya ditender di provinsi. Demikian sumber Waspada di Kantor Badan Perencanaan Pembangunan Daerah (Bappeda) Kabupaten Pidie, Sabtu (30/10). Disebutkan, sekitar 50 persen atau senilai Rp64,6 miliar proyek yang dibiayai dana Otsus Rp124,8 miliar di Kabupaten Pidie, ditender di provinsi. “Ini menunjukkan belum relanya pihak provinsi memberi kewenangan kabupaten mengelola program pusat itu,” sebutnya. Sebelumnya, Sekretaris Bappeda Kabupaten Pidie, M. Adam, ST, MM juga mengakui sekira 50 proyek Otsus yang deperuntukkan untuk Pidie, yakni 50 persen diantaranya ditender di tingkat provinsi. “Proyek Otsus 2010 sudah ditender seluruhnya termasuk sebagian besar di antaranya ditender di provinsi, namun pengerjaan juga melibatkan SKPK di daerah,“ ujar Adam kepada wartawan. MenurutSekretaisBappedaPidieitu,untuktahun2010jumlahprogram Otsus-Migas yang ditender di Pidie, sebanyak 74 paket senilai Rp64.644.375.338 dari total Otsus Pidie Rp124.815.859.190. Selebihnya penggunaan dana itu dikelola di provinsi menurut masing-masing dinas. Menurut M. Adam, semua proyek sudah dalam pengerjaan, dan diperkirakan akhir tahun 2010 ini akan rampung. Salah satu tender di provinsi adalah pengadaan tujuh unit bus sekolah untuk Kabupaten Pidie, namun belum diketahui hasilnya. Dia merincikan, dari 74 paket pekerjaan bersumber dari dana Otsus 2010 itu paling banyak terserap dana adalah Dinas Bina Marga dan Cipta Karya (BMCK) senilai Rp25,9 miliar, dengan 9 paket pekerjaan. Disusul Dinas Kesehatan Rp15,35 miliar dengan 13 paket, lalu Dinas Pendidikan Rp12,24 miliar, dengan 26 paket pekerjaan. Sedangkan di beberapa SKPK lainnya kisaran dana Otsus antara Rp.1 miliar ke bawah. Paling kecil adalah Dinas Pemuda dan Olahraga hanya senilai Rp268.8 juta dengan satu paket pekerjaan, lalu Dinas Pertanian Rp300 juta juga satu paket. Sedangkan Dinas Perindagkop Rp5,01 miliar, dan Dinas Kehutanan dan Perkebunan (Dishutbun) Rp1,6 miliar.(b21)


WASPADA Senin 1 November 2010

C11 PD Pelajar Islam Indonesia Se-Aceh Hadiri Rapinwil Di Lhokseumawe

Drs Bachtiar Akop MPd Rektor Unsam Langsa

LHOKSEUMAWE (Waspada): Sejumlah perngurus Pelajar Islam Indonesia (PII) dari 13 Pengurus Daerah (PD) kabupaten/kota se-Provinsi Aceh ikuti Rapat Pimpinan Wilayah (Rapinwil) di Lhokseuamwe, Minggu (31/10). Ketua Panitia Pelaksana Rapilwil PII Aceh, Jamaluddin kepada Waspada kemarin menjelaskan, kegiatan itu untuk melatih kader mempersiapkan generasi pemimpin. “Ketika pelajar tidak mempunyai karakteristik untuk menanamkan nilai-nilai Islam dalam bersikap dan bertidak, kemungkinan realisasi Syariat Islam tidak berjalan secara maksimal,” jelas Jamaluddin. Kegiatan berlangsung di Gedung Juang PII Lhokseumawe itu juga menjadi wahana sosialisasi program kerja PW PII kepada eselon-eselon Pengurus Daerah kabupaten/kota. Pada pembukaan Rapilwil, tambah Jamal, Walikota Lhokseumawe melalui asistennya meminta PII harus mampu menyesuaikan diri dengan perkembangan zaman. Selain itu juga harus mampu membendung budaya yang tak sesuai dengan norma masyarakat. “PII harus bisa menangani isu-isu aktual yang berkembang saat ini,” ujarnya.(b17)

LANGSA (Waspada) : Drs Bachtiar Akop MPd terpilih sebagai Rektor Universitas Samudera (Unsam) Langsa periode 2010-2014, melalui rapat Senat yang berlangsung selama sehari penuh, Sabtu (30/10), di Kampus Meurandeh Langsa. Bachtiar Akop mengungguli rival dekatnya Drs M Nur Daud M.Si yang kini masih menjabat sebagai Pembantu Rektor IV Bidang Perencanaan. Ketua Panitia Pemilihan Rektor Unsam Langsa Iskandar SE M.Si mengatakan, pelaksanaan pemilihan Rektor Unsam berjalan baik dan sesuai Tata Tertib (Tatib), diikuti 52 peserta yang mempunyai hak suara. Terdiri atas unsur pimpinan, dosen, serta lembaga dalam perguruan tinggi tersebut. Dalam pemilihan itu, Drs Bachtiar Akop MPd memperoleh 30 suara mengungguli M Nur Daud yang hanya meraih 19 suara. Sedangkan 3 suara lainnya dinyatakan abstain. “Direncanakan pelantikan Rektor Unsam yang baru ini akan digelar 15 November mendatang seiring berakhirnya masa jabatan Rektor lama yang dijabat Ir Bachtiar Harun MS,” demikian Iskandar.(ts)

PNS Diingatkan Tingkatkan Disiplin SUBULUSSALAM (Waspada): Segenap Pegawai Negeri Sipil (PNS) di lingkungan Pemko Subulussalam diingatkan untuk meningkatkan disiplin, memahami tugas pokok dan fungsi (tupoksi) masing-masing selaku abdi negara sekaligus pelayan masyarakat secara luas. WakilWalikota Subulussalam H. Affan Alfian Bintang, belum lama ini saat menyaksikan apel rutin pagi di Setdako Subulussalam kepada Waspada, Senin (25/10) mengatakan, disiplin boleh jadi dimulai dari kepedulian jajaran PNS di sana dalam mengikuti apel pagi, saat akan beraktivitas di kantor maupun apel petang, atau saat akan meninggalkan kantor. Affan pun berharap, para Kepala SKPK (baca: dinas/badan/ kantor) dalam lingkungan Pemko Subulussalam tidak mengabaikan anjuran apel pagi dan petang di setiap SKPK sehingga program meningkatkan disiplin para PNS, tenaga honorer maupun bhakti (baca aparatur) bisa terwujud di daerah ini. Selain itu, bolos, mangkir, tidak berada di kantor saat jam tugas maupun sejumlah bentuk indisipliner para aparatur pemerintah semakin hari dapat lebih diperkecil.(b33)

Fraksi Baru Di DPRK Abdya Akan Terbentuk BLANGPIDIE (Waspada): Keluarnya Afdal Jihad, S.Ag (PKPI) dan Muhammad Nasir (PDP) dari Fraksi Gabungan Pelangi di DPRK Aceh Barat Daya (Abdya), kini terbuka peluang terbentuknya fraksi baru di parlemen Abdya, jika sebelumnya di DPRK Abdya hanya memiliki dua fraksi, yaitu Fraksi Gabungan Pelangi (F-GP) dan Fraksi Partai Aceh (F-PA), maka tidak tertutup kemungkinan akan adanya fraksi baru yang kini semakin santer dibicarakan beberapa petinggi partai politik di sana. Samsul Bahri, anggota DPRK Abdya yang juga ketua Partai Bulan Bintang (PBB) kepada Waspada Kamis (28/10) membenarkan adanya peluang terhadap pembentukan fraksi baru tersebut. Begitupun menurutnya, butuh proses dan komunikasi yang lebih jauh dengan beberapa pihak terkait, seperti ketua partai serta beberapa anggota DPRK Abdya lainnya. “Memang pasca keluarnya Afdal Jihad dan Muhammad Nasir dari Fraksi Gabungan Pelangi arah ke situ (pembentukan fraksi baru) terbuka besar, jika selama ini hanya ada dua fraksi di DPRK maka tentu menjadi sesuatu yang menarik apabila ada fraksi baru di sana, namun masih dibutuhkan komunikasi politik lebih lanjut dengan para pimpinan partai serta anggota (DPRK) yang lain, karena ini menyangkut masalah visi, misi serta komitmen kebersamaan,” ujar Samsul Bahri, yang juga ketua BKD DPRK Abdya. Sementara Ketua DPD PAN Abdya, H. Said Samsul Bahri, melalui sambungan telefon kepada Waspada menyampaikan arah pembentukan fraksi baru di tubuh DPRK Abdya, dinilainya sesuatu yang mungkin terjadi, namun pembentukan fraksi baru itu diharapkan lebih didasari kepentingan umum . Terkait ‘pecahnya’ F-GP di DPRK Abdya dan adanya desasdesus pembentukan Fraksi baru, Irfan Faisal, SH yang juga pengamat kebijakan publik di Abdya, menuturkan dinamika politik di kabupaten itu dinilainya amat dinamis, apalagi menjelang rapat Paripurna Pertanggungjawaban Bupati Abdya yang hingga kini masih belum terlihat titik temu. “Sesuai UUPA sudah terlihat jelas di pasal 36, sehingga kemungkinan pembentukan fraksi baru di DPRK jelas memiliki peluang besar, namun dibutuhkan komunikasi lebih lanjut dari para pimpinan parpol,” ulas Irfan Faisal. Sedangkan Afdal Jihad,S.Ag dan juga Muhammad Nasir yang dihubungi Waspada terkait kabar akan adanya rencana pembentukan fraksi baru di DPRK Abdya pasca mereka hengkang dari F-GP menyatakan belum memikirkan ke arah itu. Kini yang paling utama bagi mereka menurut Afdal hanya keluar dari F-GP. “Yang paling penting bagi kami saat ini hanyalah keluar dari Fraksi Gabungan Pelangi, tentang kedepannya termasuk pembentukan fraksi baru masih belum kita fokuskan ke arah itu, yang utama adalah keluar dari Fraksi Gabungan, itu aja,” tegas Afdal Jihad, S.Ag. (sdp)

Polisi Sayang Anak TAKENGON (Waspada): Masyarakat di seputar kota Takengon, Aceh Tengah dikejutkan dengan raungan sirine poreder Lantas Aceh Tengah. Iringan sepuluh mobil polisi plus sepeda motor patroli, membuat pengguna jalan protokol, terpaksa minggir. Lazimnya pejabat penting sedang lewat. Namun pagi menjelang siang itu, Selasa (27/10) bukan pejabat penting yang dikawal poreder. Tetapi calon jenderal dengan uniform polisi, lengkap dengan pangkat dibahunya. Mulai dari brigadir sampai AKBP dan komjen. Kasat Lantas Polres Aceh Tengah, Iptu Agung Tri Adiyanto mengerahkan personel lantas untuk mengawal calon ‘jenderal’ itu. Para calon jenderal ini keliling kota Takengon. 28 Anak Taman Kanak-Kanak (TK) Bhayangkari Polres Aceh Tengah melakukan pawai dalam sosialisasi Polisi Sayang Anak. Murid TK ini berjalan-jalan keliling kota sambil menyanyikan lagu tentang lalulintas. Menurut Indrawati, kepala TK Bhayangkari, kegiatan tersebut selain menambah rasa percaya diri para murid, juga merupakan sosialisasi bahwa murid TK Bhayangkari sudah mengenal rambu-rambu lalulintas. Agung, menyebutkan, pihaknya selaku Lantas di Aceh Tengah memang memiliki program polisi sayang anak. Sejak kecil kita sudah membiasakan murid TK untuk disiplin berlalu lintas. Diharapkan ketika mereka dewasa menjadi panutan dalam berlalu lintas, sebut Kasat Lantas. (b18)

Waspada/Bahtiar Gayo

IRINGAN PAWAI: Murid TK Bhayangkari dikawal, ketika aksi keliling kota Takengon program polisi sayang anak.

Puluhan Tahun Jalan Rusak Dibiarkan Waspada/Muhammad Hanafiah

RUMAH KAPAL: Satu unit rumah antik milik warga , tampak terlihat seperti kapal terdapat di kawasan Simpang Kapal,Kecamatan Manyak Payed,Kabupaten Aceh Tamiang. Foto direkam Waspada ketika berkunjung ke daerah tersebut, Minggu ( 31/10).

Lagi CD ‘Sifat Shalat Nabi’ Ditemukan BIREUEN (Waspada): Setelah sejumlah jenis buku, compact disc (CD) yang diduga berisi pesan pendangkalan akidah, terakhir ditemukan anggota Kodim 0111 Bireuen, giliran CD diduga berisi tata cara melaksanakan shalat berbeda dengan cara umat muslim mengerjakannya ditemukan di sebuah desa di Kecamatan Kutablang yang diduga diedarkan seorang oknum perangkat desa setempat. Informasinya dua keping CD disebut-sebut telah diamankan anggota pos polisi kecamatan setempat lalu diserahkan ke pihak Polres. Informasi yang diperoleh Waspada pekan lalu, CD itu berisi ‘pengajaran’ cara berwudhu, tayamum dan cara mengerjakan shalat itu telah beberapa hari belakangan ini beredar

di tengah masyarakat atau nyaris bersamaan terungkapnya aliran sesat Millata Abraham di Desa Matang Sagoe, Peusangan. Namun, saat itu warga sempat segan melaporkan karena takut dikatakan memfitnah orang lain seperti yang pernah terjadi atau yang telah dilaporkan ke pihak Polres belum lama ini. Menurut salah seorang warga yang menolak disebutkan namanya sambil memperlihatkan CD putih yang ditulis tinta hitam di atasnya sifat shalat nabi, kaset yang berisikan pengajaran tentang cara berwudhu, tayamum dan cara melaksanakan shalat itu, tidak begitu jauh perbedaannya dengan kebiasaan warga laksanakannya, namun ada beberapa hal yang dinilai agak janggal seperti cara

berwudhu, bertayamum, dan cara melaksanakan shalat. Oleh sebab itu, warga resah dan bingung dengan beredar kaset ‘Sifat Shalat Nabi’ itu, selain isinya berbeda dengan yang pernah mereka belajar, juga diedarkan kesannya sembunyi oleh seorang oknum tokoh masyarakat desa itu. “Kami memohon kepada pihak berkompeten, khususnya MPU dan pihak penegak hukum untuk mengusut tuntas kasus ini, supaya tidak menimbulkan keresahan di tengah masyarakat karena pengajaran dalam CD itu berbeda,” katanya. Dan yang paling tidak menyenangkan lagi, lanjutnya, pihak yang dilaporkan telah membalikkan fakta dan mengatakan telah memfitnahnya, padahal kasus ini benar terjadi

dan warga desa siap menjadi saksi bila diperlukan, karena oknum tokoh masyarakat itu juga telah lebih dahulu memfitnah pelapor. “Padahal oknum ituketakutandanlangsungmembuat laporan telah difitnah saat itu, makanya kasus ini harus tuntas supaya tidak terjadi hal-hal yang tak diinginkan,” tegasnya. Sementara Kapolres Bireuen, AKBP H Raden Dadik Junaidi, yang dikonfirmasi Waspada Minggu (31/10), membenarkan pihaknya telah menyita dua CD itu dan kini sedang dikembangkannya. “Anggota Pos PolisiKutablangtelahmenyitadua CD itu dan sekarang sedang kita selidiki apakah itu benar seperti dikatakan warga atau tidak serta kita kembangkannya, namun masyarakat kita harapkan tenang dan bersabar,” katanya.(amh)

Juara MTQ Lhokseumawe Jangan Kejar Iming-iming LHOKSEUMAWE,(Waspada): Para juara Musabaqah Tilawatil Quran (MTQ) Lhokseumawe, tidak boleh mengejar bonus melalui kabupaten/kota lain pada pelaksanaan MTQ tingkat Provinsi Aceh, tahun 2011. “Saudara-saudara tidak dibenarkan mewakili kabupaten/ kota lain, tanpa persetujuan (izin) tertulis dari Pemko Lhokseumawe. Ini seringkali terjadi di Aceh, para juara I di satu daerah mengikuti MTQ tingkat provinsi atas nama daerah lain, dengan iming-iming bonus atau lain-lainnya sehingga merugikan daerah asalnya,” kata wakil Walikota Lhokseumawe, Suaidi Yahya dalam sambutannya pada acara penutupan MTQ tingkat kota Lhokseumawe ke 30, Sabtu (30/10) malam. Pada MTQ ke 30 tingkat kota Lhokseumawe, kali ini kafilah Kec Muara Dua, Pemko Lhokseumawe, keluar sebagai juara umu. Juara II diraih Kec. Muara Satu dan Kec Banda Sakti (Pusat kota Lhokseumawe), berada di urutan III, serta Kec Blang Mangat menempati posisi IV dari empat wilayah kecamatan di Pemko ini. Keterangan selengkapnya, dari sembilan cabang yang dimusabaqahkan, juara umum (Kec Muara Dua) mengumpul nilai 103. Prestasi yang diraih 13 juara I putra-putri, 10 juara II dan delapan personel untuk juara III, sebut ketua Panitia pelaksana MTQDrs H MursyidYahya dalam laporan penutupan acara.

Cabang-cabang yang diperlombakan, menurut ketua panitia (Kadis Syariat Islam) kota Lhokseumawe, Mursyid Yahya, antaranya Tartil Quran, Hifzhil Quran, Qiraah Sab’ah, Syarhil, Fahmil, Khattil, Tafsir, Cacat Netra dan Cabang M2KQ. Dalam sambutannya sebelum menutup acara, wakil Walikota Lhokseumawe, juga me-

minta para peserta, baik yang berhasil jadi juara maupun yang tidak. Kendati kegiatan serimonial MTQ telah berakhir, tapi semangat, minat membaca, mengkaji, memahami, dan mendalami nilai-nilai yang terkandung dalam Al Quranulkarim jangan diabaikan, karena itu merupakan amal yang tidak boleh berakhir pada setiap

ruang dan waktu. “Saya sangat mengharapkan, para juara MTQ kota Lhokseumawe yang sudah menyandang predikat juara ini, mampu pula menjadi duta daerah Pemko Lhokseumawe, untuk meraih prestasi juara pada berbagai cabang MTQ tingkat provinsi Aceh, nantinya,” demikian wakil Walikota Lhokseumawe.(b10)

Ketua Persit Kodim 0110/Abdya Kunjungi Lokasi TMMD BLANGPIDIE (Waspada) : Ketua Persit Candra Kirana Kodim 0110/ Aceh Barat Daya (Abdya), Ny Yuningsi E.Dwi Karyono AS, bersama rombongan Sabtu (30/10), mengunjungi Dusun Drien Likiet, Desa Blang Makmur, Kec. Kuala Batee, Aceh Barat Daya (Abdya) yang menjadi lokasi TMMD ke-85 Wilayah Korem 01/TU. Kedatangan Ketua Persit Candra Kirana Kodim 0110/ Aceh Barat Daya (Abdya), Ny Yuningsi E.Dwi Karyono AS beserta rombongan itu disambut langsung oleh Komandan Kompi Senapan –E Lettu Inf Khusnun Dwi Putranto selaku koordinator pelaksana kegiatan TMMD ke-85 di Desa Blang Makmur tersebut. Dalam kunjungan itu, Ny Yuningsi E.Dwi Karyono AS, berharap kepada para prajurit TNI yang sedang melaksanakan tugas TMMD ke-85 di kawasan itu untuk terus menjalin kerjasama dan kekompakan dengan masyarakat yang terlibat dalam kegiatan tersebut, sehingga program TMMD yang diharapkan dapat membantu pemerintah daerah dan masyarakat dalam rangka percepatan pembangunan di daerah itu bisa berjalan dengan baik dan sukses. Kunjungan yang berlangsung selama beberapa jam itu turut didampingi, Dandim 0110 Abdya, Letkol Arm E.Dwi Karyono.AS selaku penanggungjawab program TMMD ke-85 di Abdya, Dan Subdenpom IM/2-4 Blangpidie, Lettu CPM Obet Santoso, serta beberapa staf Kodim 0110/Abdya lainnya. “Pekerjaannya sudah rampung 100 persen, dan direncanakan penutupannya pada 2 November 2010 ini,” jelas Komandan Kompi Senapan –E Lettu Inf Khusnun Dwi Putranto. Sementara Dandim 0110 Abdya, Letkol Arm E. Dwi Karyono AS selaku penanggungjawab program TMMD ke-85 di Abdya mengakui berkat kebersamaan dan kemanunggalan TNI dengan rakyat semua tantangan dan kendala yang dihadapi di lokasi medan yang sangat berat tersebut dapat diatasi dengan baik. “Alhamdulilah kita bisa melakukannya dengan baik, semua ini tidak terlepas dari kebersamaan yang telah terbangun dengan baik antara kita dengan masyarakat, sebab pada hakikatnya kita ingin dan berusaha agar bisa membantu pemerintah dan masyarakat agar lebih maju dan sejahtera,” tutur Letkol Arm E. Dwi Karyono AS.(sdp)

Penegak Hukum Dituntut Serius Tangani Kasus Dugaan Pemalsuan Tandatangan Waspada/M Jakfar Achmad

PIALA BERGILIR : Wakil Walikota Lhokseumawe, Suaidi Yahya (kiri) menyerahkan piala bergilir Walikota Lhokseumawe, kepada Kec Muara Dua (juara umum) yang diterima camat setempat, Ediyandra, S Sos (kanan), didamping Kadis Syariat Islam setempat (paling kanan), selaku ketua panitia MTQ ke 30 kota ini.

Meninggal Dunia Tak Lapor Wajib Bayar Denda KUALASIMPANG (Waspada): Masyarakat Aceh Tamiang yang meninggal dunia tidak melapor sesuai batas waktu yang telah ditentukan Pemkab Aceh Tamiang, maka wajib membayar denda atau masuk penjara jika tidak mau membayar denda kepada Dinas Kependudukan dan Catatan Sipil untuk kas daerah itu. “Jika terlambat melaporkan peristiwa kependudukan seperti kelahiran, kematian, perkawinan dan pindah sesuai batas waktu yang diatur dalam Qanun (Per-da) akan dikenakan wajib bayar denda senilai Rp25.000 per peristiwa atau bisa juga

BLANGPIDIE (Waspada): Kondisi badan jalan Gampong Suka Damai, Kecamatan Manggeng sangat membutuhkan perhatian Pemkab Aceh Barat Daya (Abdya). Pasalnya, jalan yang menjadi urat nadi perekonomian rakyat di Kec. Manggeng itu kondisinya amat memprihatinkan. Menurut warga sekitar, kerusakan badan jalan sudah berlangsung belasan tahun, namun hingga kini kondisinya belum juga diperbaiki. “Sebenarnya daerah ini kawasan sentra perekonomian bagi masyarakat Manggeng. Dari gampong inilah sayur-sayuran, sirih dan hasil rempah lainnya dipasok ke pasar Kota Blangpidie dan Pasar Manggeng. Namun, sudah belasan tahun kondisi kerusakan badan jalan ini belum juga diperbaiki,” kata tokoh muda Manggeng, TM Daud Yuska, yang juga Direktur Eksekutif Garda Madina Institute, kepada Waspada, Minggu (24/10). Dikatakannya, permohonan perbaikan badan jalan yang menghubungkan Gampong Suka Damai dengan Gampong Lhok Batee Itam Manggeng itu menurut warga sudah beberapa kali diusulkan, namun hingga kini belum ditindaklanjuti dinas terkait. “Akibatnya, masyarakat sekitar nyaris tidak bisa melewati kendaraan roda empat mereka. Sebab jalan yang sudah lama rusak ini sudah sulit dilintasi kendaraan roda dua maupun empat,” kata TM Daud Yuska. Keuchik Gampong Suka Damai, Hamdani membenarkan kerusakan badan jalan itu. Selain sulit dilewati, kerusakan badan jalan itu juga sudah mengancam keselamatan pengendara jika tidak berhati-hati. “Anehnya kami tiap bulan harus memeriksa baut kendaraan. Sebab goncangan akibat melewati badan jalan berlubang ini sangat memungkinkan jatuhnya baut kendaraan yang berujung pada kecelakaan,” katanya. Camat Manggeng, H Eddy Sumarjan SE MM, yang dikonfirmasi Waspada via telefon selularnya mengaku telah mengusulkan program perbaikan badan jalan itu pada anggaran 2010. Namun dia sendiri tidak mengetahui kendala belum juga terealisasi.(sdp)

dipidanakan masuk penjara karena sudah ada aturannya,” ungkap Kadis Kependudukan dan Pencatatan Sipil Aceh Tamiang, Drs. Ansharuddin didampingi Kabid Pendaftaran Penduduk, Drs Razali ketika ditanya Waspada soal administrasi kependudukan dan pencatatan sipil di Kabupaten Bumi Muda Sedia itu, Jumat ( 29/10). Menurut Ansharuddin dan Razali, Pihak Pemkab Aceh Tamiang menerapkan aturan ’Wajib Bayar’ denda terhadap hal itu sesuai UU Nomor 23 Tahun 2006 Tentang Administrasi Kependudukan dan turunan dari UU itu juga telah diberlaku-

kan Pemkab Aceh Tamiang berdasarkan Qanun (Perda) Nomor 6 Tahun 2008 Tentang Administrasi Kependudukan yang meliputi kelahiran, kematian, perkawinan dan pindah serta Kartu Tanda Penduduk (KTP) yang sudah habis masa berlakunya. Ansharuddin menerangkan, selama ini yang paling banyak denda yaitu warga yang terlambat melaporkan tentang kelahiran anaknya. “Sedangkan keterlambatan melaporkan peristiwa kependudukan meskipun ada juga terlmbat, tetapi yang paling dominan tentang kelahiran,”

ungkap Ansharuddin. Menurut Ansharuddin, terhitung Januari –Oktober 2010 realisasi pendapatan dari denda dan retribusi kependudukan senilai Rp300 juta dari target keseluruhannya untuk tahun 2010 senilai Rp590 juta. Hasil itu, kata Ansharuddin, terasa berkurang karena tingkat kesadaran masyarakat mengurus administrasi kependudukan sudah semakin baik dan juga sebagai indikator semakin berkurangnya jumlah denda yang diperoleh Dinas Kependudukan dan Capil Kab.Aceh Tamiang.(b24)

BLANGPIDIE (Waspada): Masyarakat Ujung Tanah, Kecamatan Setia, Kabupaten Aceh Barat Daya (Abdya) menuntut aparat penegak hukum agar lebih serius menangani kasus dugaan pemalsuan tandatangan yang dilakukan oknum keuchik setempat. Pasalnya, kasus yang sudah berlarut larut hingga satu tahun tiga bulan itu hingga kini belum juga sampai ke meja hijau. “Kini sudah berdampak pada melemahnya pelayanan publik serta rentan munculnya sikap kontra produktif terhadap penegakan hukum yang sedang gencar di Abdya,” kata Kordinator Jaringan Komunitas Masyarakat Adat (JKMA) Abdya, Hendrik melalui siaran persnya yang diterima Waspada, Sabtu (30/10). Menurut Hendrik, masyarakat Ujung Tanah, merasa dirugikan dengan ulah oknum keuchik yang diduga telah melakukan penyimpangan tersebut. Dicontohkannya seperti kasus yang menimpa Zulkar Edi yang semula dijanjikan akan dibantu dengan dana PPG dan diperuntukkan untuk masyarakat petani, namun kini bukannya dana bantuan yang diterima, tapi justu fitnah yang dia terima. “Lain lagi kasus yang menimpa Tgk Cam, salah seorang guru pengajian dan majelis ta’lim yang sekarang sudah mendapat cemoohan dari masyarakat dengan tuduhan sudah menghabiskan dana Majelis Taklim sebanyak empat juta rupiah. Padahal beliau sama sekali tidak pernah menerima uang bantuan itu,” tulis Hendrik dalam siaran pers itu. Hendrik juga melaporkan situasi masyarakat di Desa Ujong Tanah sekarang sudah pada fase yang memprihatinkan, fitnah merajalela bahkan cenderung anarkis. Bahkan sempat muncul isu ada pihak yang sudah menerima bantuan dari dana PPG tersebut. (sdp)



WASPADA Senin 1 November 2010

Hubungan Manyak Payed– Banda Mulia Terancam Putus KUALASIMPANG (Waspada): Hubungan transportasi darat dari Desa Meunasah Paya, Kecamatan Manyak Payed, menuju Desa Teulaga Meuku, Kec. Banda Mulia, terancam putus dan diperkirakan tidak lama lagi akan ambruk. Pantauan Waspada Minggu (31/10), tampak badan jalan di ujung jembatan Meunasah –Lubuk Gayo longsor akibat abrasi terkikis air asin di alur paluh sungai di bawah jembatan tersebut. Selain itu, meskipun lantai jembatan masih terlihat agak bagus, namun jembatan itu kondisinya amat memprihatinkan karena sudah miring dan terancam patah. Menurut warga di sana, Hanafayah menyebutkan, meskipun kondisi lantai jembatan masih terlihat agak bagus, namun sudah ada juga yang patah akibat kayunya dimakan usia. Selain itu, longsor pada bagian badan jalan di ujung pondasi jembatan menyebakan badan jalan terancam putus dan kondisi jembatan juga sudah miring terancam putus ambruk. “Warga pengemudi roda empat dan truk sudah tak berani lagi melintasi jembatan ini. Akibatnya, hasil bumi terpaksa diangkut menempuh jalan memutar dari arah Banda Mulia. Jangankan kendaraan berisi muatan hasil bumi, yang kosong tanpa muatan takut melin-

tasi jembatan ini. Demikian juga pengendara sepeda motor,” ungkap warga Manyak Payed itu yang menyebutkan kondisi itu sudah berulangkali disampaikan kepada pihak terkait, namun belum juga terealisasi hingga kini. Camat Manyak Payed, Bustamam membenarkan kondisi memprihatinkan jembatan Meunasah Paya itu. “Selain jembatan rusak berat, badan jalan dan jembatan lainnya di Manyak Payed juga sudah banyak yang rusak dan perlu segera dibangun. Saya sudah laporkan semua jembatan dan badan jalan yang rusak di daerah ini kepada instansi terkait,” kata Bustamam. Kadis Pekerjaan Umum (PU) Aceh Tamiang, Ir. Zulkifli, MM ketika dikonfirmasi melalui telefon mengatakan, pihaknya sudah menerima laporan tentang kondisi jembatan yang sudah miring dan badan jalannya longsor di ujung jembatan Meunasah Paya tersebut. “Kami juga sedang merencanakan membangun jembatan di daerah itu, namun tergantung anggaran. Harapannya jembatan ini bisa dibangun dengan menggunakan anggaran yang bersumber dari APBN, makanya masyarakat juga perlu bersabar sampai tersedianya anggaran untuk membangun jembatan ini,” terang Zulkifli.(b24)

Partisipasi Wali Murid Terhadap Pendidikan Rendah KUTACANE (Waspada): Kesadaran dan partisipasi wali murid menyediakan buku paket yang dibutuhkan siswa masih rendah, kendati buku paket itu untuk peningkatan mutu pendidikan. Demikian Kadis Pendidikan Pemuda dan Olah Raga (Disdikpora) Aceh Tenggara (Agara), H. Ali Basrah S.Pd.MM, di hadapan Ketua Tim Koordinasi Pembangunan Pendidikan Aceh (TK-PPA), Ketua MPD Aceh Drs. Anas Adam, Bupati H. Hasanuddin, Ketua DPRK HM. Salim Fakhri SE.MM, Sekdakab Drs. H. Hasanuddin Darjo dan anggota DPRK lainnya, di Oproom Pemkab Agara, Jumat (29/10). Menurut Ali Basrah, buku paket faktor yang mempengaruhi peningkatan ilmu dan pengetahuan siswa serta mutu pendidikan di setiap sekolah, namun sayangnya akibat masih rendah dan kurangnya partisipasi orangtua wali murid, siswa masih banyak yang kekurangan buku paket.

Rendahnya partisipasi orang tua wali murid itu, didasarkan pada hasil survei UNICEF beberapatahunlalu.“Inijelasberpengaruhterhadap dunia pendidikan di AcehTenggara,” tegasnya menambahkan di satu sisi, guru tidak boleh menjual buku karena terbentur Permendiknas. Namun di sisi lain, bila diserahkan pada wali murid, buku paket yang diperintahkan pihak sekolah untuk dibeli melalui brosur sebagai bahan mata pelajaran, buku itu jarang dibeli dan disediakan siswa maupun wali murid. Alasan itu, urai Ali Basrah, agar mutu pendidikan terus meningkat, sudah selayaknya pihak Dinas Pendidikan Aceh membuat pemetaan pendidikan di setiap kabupaten /kota di Aceh. Besarnya dana pendidikan di Aceh per tahun yang diperkirakan senilai Rp1 triliun, jelas membantu perkembangan pendidikan di Aceh secara keseluruhan, sebab itu penggunaannya juga harus disesuaikan dengan kebutuhan daerah.(b27)

Lagi, Bandar Bersama 2,5 Kg Ganja Diamankan IDI RAYEUK, Aceh Timur (Waspada): Setelah sehari sebelumnya polisi mengamankan dua mafia ganja bersama 4 Kilogram barang bukti (BB), Operasi Khusus (Opsus) personel Satuan Narkoba bekerjasama dengan anggota Polsek Idi Rayeuk, Jumat (29/10) sekira pukul 17:00, kembali meringkus seorang pemida yang diduga sebagai bandar ganja di wilayah Idi. Bersama tersangka polisi ikut menemukan 5 Kg ganja kering siap edar. Tersangka yang kini sedang mendekam di balik jeruji besi menunggu proses hukum berinisial, Z alias A Bin Ya, 36, warga Gampong Seuneubok Teungoh, Kecamatan Darul Ihsan, Kab. Aceh Timur. Penangkapan tersangka berawal dari informasi masyarakat, selama ini rumah tersangka Z kerap didatangi orangorang dari luar desa setempat, bahkan lalu lalang suara sepeda motor ke rumah tersangka juga terdengar siang dan malam hingga tengah malam. Kapolres Aceh Timur, AKBP Drs Ridwan Usman didampingi Kasat Narkoba, Iptu Agus

Sunandar, kepada Waspada, Sabtu (30/10) mengungkapkan, tersangka yang telah menjadi Target Operasi (TO) Polres Aceh Timur, ditangkap saat tersangka Z nongkrong disalah satu kios di pusat Kecamatan Darul Ihsan— Keude Dua. Tersangka yang tidak melawan, dibawa menjauh dari keramaian untuk diinterogasi. AKBP Rudwan Usman menyebutkan, awalnya tersangka Z tidak mengakui pekerjaannya yang selama ini melanggar hukum. Namun, setelah didesak sejumlah petugas, Z mengakui selama ini sebagai bandar (agen— red) narkoba jenis ganja. “Bahkan, tersangka Jd menyerahkan 2,5 Kg ganja kering yang selama ini menjadi stok (simpan—red) di rumah tersangka Z, untuk diedarkan dan dijual ke pelanggan,” kata Ridwan Usman. Untuk memepertanggungjawabkan pekerjaannya yang telah melawan negara, lanjut Kapolres Ridwan Usman, tersangka Jd kini diamankan, guna pengusutan selanjutnya.(cmad)

Waspada/Muhammad Hanafiah

TERANCAM PUTUS: Kondisi jembatan Meunasah Paya, Kecamatan Manyak Payed yang sudah miring dan badan jalan di ujung jembatan ini juga sudah longsor, Minggu (31/10).

BPKEL Minta 900 Ha Kebun Diserahkan Ke Hukum Polisi Periksa 3 Pemilik Lahan Dan 4 Pengawas Kebun IDI RAYEUK, Aceh Timur (Waspada): Terkait alihfungsi 900 hektar hutan leuser menjadi perkebunan di Kecamatan Bandar Dua, Kabupaten Aceh Tamiang, Badan Pengelola Kawasan Ekosistem Leuser (BPKEL) Aceh, meminta dua perusahaan dan enam pengusaha yang diduga terlibat di dalamnya segera menyerahkannya ke hukum. Hal itu dianggap lebih baik sebelum aparat penegak hukum memaksa pemilik kebun keluar dan tinggalkan lahan illegalnya yang telah dijadikan kebun sawit dan karet. Kendati demikian, pihaknya akan terus

menjalankan Tupoksi sesuai dengan Undang-Undang yang mengatur tentang kehutanan dan alam. Demikian Staf Khusus Konservasi BPKEL Aceh, Bagus Irawan, menjawab Waspada Minggu (31/10). Menurut dia, hutan di ujung timur Provinsi Aceh, khususnya di Aceh Tamiang, dinilai amat parah kerusakannya. Selain banyak lokasi yang telah dijadikan perkebunan dan pertanian biasa, ratusan titik hutan di beberapa kecamatan di sana gundul akibat penebangan secara illegal. Soal 900 hektar lebih KEL yang telah dialihfungsikan oleh

sejumlah pengusaha dalam dan luar Aceh, pihaknya mengakui, jajaran Polres Aceh Tamiang, selaku mitra kerja BPKEL diakui telah memanggil tiga pemilik lahan. Pemilik lahan yang dipanggil yakni, T, Ad, dan S. “Selain itu, empat pengawas kebun dari instansi terkait juga dipanggil,” ungkap Bagus Irawan. Menurut Irawan, pemeriksaan polisi guna dimintai keterangan sebagai saksi sekaligus status HGU yang digunakan pengusaha tersebut. “Semua yang terlibat dalam 900 hektar lebih KEL yang dialihfungsikan menjadi perkebunan, akan diperiksa. Jika melanggar keten-

jenis beco, langsung ngacir. “Saat kejadian itu saya sedang tertidur di belakang sopir, saya terkejut mendengar ada suara tabrakan, begitu saya lihat mobil terperosok ke kebun sawit,” kata Udin, 43, kernet truk Trado. Informasi terakhir yang diperoleh menyebutkan, berkat bantuan Polntas Panton Labu, truk trado ditemukan dan ditahan di perbatasan Aceh Tumur - Aceh Utara. Kini sudah diamankan oleh lantas Pos Julok. “Tidak ada korban jiwa dalam musibah itu, dan kasus ini sudah dalam penanganan pihak kita,” ujar Kapolres Aceh Timur, AKBP Ridwan Usman melalui Kasat Lantas Polres Aceh Timur, Iptu Hangga Utama.(cmad) Waspada/Muhammad H. Ishak

GAMBA TANYO > Neu poto keujadian meunarek ngon kamera HP 3,2 mega piksel, kirem ngon MMS keu 08192110147. Na imbalan pulsa 20 ribee keu poto nyang di peuteubit.


Sebuah mobil pengangkut tiang listrik untuk daerah pedalaman Pante Labu terperosok di Gampong Pasi Tinggi, Kec. Pante Bidari, Aceh Utara. Foto diabadikan belum lama ini. Pengirim Ayub, Pante Bidari, 0852600238xx

bangan hutan sementara itu, Staf Konservasi BPKEL, Bagus juga mengakui, akibat perambahan hutan di Aceh Tamiang dan Aceh Timur serta di beberapa kabupaten lain di Aceh, konflik satwa sulit dihindarkan. Sehingga apapun program yang yang dicanangkan tidak akan membuahkan hasil yang memuaskan masyarakat. Salah satu cara dan langkah yang paling mendasar yang harus dilakukan, sambung Bagus Irawan, adalah mengembalikan hutan ke fungsinya. “Hutan adalah hutan. Jangan mengalihfungsikan hutan menjadi perkebunan,” katanya seraya menandaskan, konflik satwa terjadi akibat ulah tangan sejumlah pengusaha yang menciptakan kebun darihutanyangdilindungi.(cmad)

Mansurdin Komandan Upacara Sumpah Pemuda Aceh Singkil

Dihantam Truk Trado, Intercooler Masuk Parit BAGOK, Aceh Timur (Waspada): Kecelakaan tengah malam kembali terjadi di lintasan jalan negara Desa Teupin Pukat, Kecamatan Nurussalam, Kab. Aceh Timur, Jumat (29/10) sekira pukul 02:00. Kali ini, dua truk besar terjadi tabrakan. Truk intercooler BK 8370 BG mengangkut 15 ton tepung sagu dari Meulaboh menuju Medan, dihantam truk trado. Akibatnya, truk Interkuler ringsek dan mengalami pecah ban depan hingga masuk parit. Menurut informasi seorang penumpang interculer, anehnya setelah terjadi tabrakan mobil yang ditumpanginya langsung nyerosok ke kebun sawit ke kanan jalan. Sementara truk trado BK 8559 CB yang membawa alat berat

tuan, maka akan diproses secara hukum,” sebutnya. Kata Irawan, pemeriksaan sejumlah pemilik kebun dimulai sejak Kamis (28/10) atau dua hari pasca operasi terpadu yang dilancarkan BPKEL bersama polisi dan personel Polhut, Selasa (26/10). Hingga Sabtu (30/10) lalu polisi masih terus memanggil sejumlah saksi selaku pemilik kebun. Ketika disinggung efek terparah akibat pengalihan KEL menjadi perkebunan, Bagus menegaskan, secara ilmu alam akan mengurangi populasi KEL. Selain itu, habitat satwa liar seperti gajah dan harimau ikut berkurang, “sehingga konflik satwa dengan manusia sulit dihindarkan,” katanya. Konflik satwa akibat pene-

TERGENANG: Murid SD melintasi pinggiran jalan Medan - Banda Aceh, persisnya di Kuta Binjei, Kecamatan Julok, Kab. Aceh Timur, yang di genangi air. Pasalnya, sejumlah sudut pinggiran jalan disana banyak yang berlubang dan membahayakan terhadap pengguna jalan, khususnya angkutan umum. Warga mengharapkan perhatian pemerintah. Foto diambil pekan lalu.

Kasus Perampokan BRI Lhoknibong Belum Terungkap IDI RAYEUK, Aceh Timur (Waspada): Meski BRI Unit Pante Bidari—Lhoknibong, Kabupaten Aceh Timur, telah aktif sepekan pasca perampokan, namun hingga kini dua pelaku yang berhasil kabur saat kejadian dengan menggunakan sepeda motor Yamaha Jenis Meo bersama sepucuk senjata api (senpi), belum berhasil ditangkap. Namun demikian penyelidikan dan pengembangan terus dilakukan jajaran Markas Polres Aceh Timur. Bahkan, personel polisi dari Mapolsek Pante Bidari, ikut membantu mengejar di sejumlah titik yang diduga tempat persembunyian kawanan bersenjata api yang terlibat dalam aksi perampokan Bank Rakyat Indonesia (BRI) di Aceh Timur. Demikian Kapolsek Pante Bidari, Ipda Masri Aswara menjawab Waspada, Minggu (31/ 10). Menurutnya, tahapan penyelidikan kasus perampo-

kan Bank di wilayah hukumnya ditangani pihak Polres. Diketahuinya, petugas sudah mengantongi sejumlah nama yang terlibat dalam kasus tersebut. Bahkan, selang beberapa hari pasca perampokan, polisi telah memintai keterangan sejumlah saksi. Sebagaimana diwartakan sebelumnya, perampokan BRI Pante Bidari di pusat Kota Lhoknibong, melibatkan empat pelaku dengan sepucuk senjata api jenis AK-47. Setelah dua pelaku berhasil dilumpuhkan petugas penjaga Bank, dua lainnya kabur. Kedua pemuda yang ditembak dan meninggal dunia di lokasi adalah warga Aceh Utara. Kapolres Aceh Timur, AKBP Drs Ridwan Usman secara terpisah mengungkapkan, hasil penyelidikan sementara, dua pelaku yang kabur diduga kuat warga Aceh Utara. Sehingga pihaknya dalam mengejar pelaku yang diduga memiliki jaringan hingga ke beberapa wilayah lain,

pihak Mapolres Aceh Timur terus berkoordinasi dengan Mapolres Aceh Utara dan Polresta Lhokseumawe. “Polisi komit tangkap pelaku, bahkan hingga kini kita terus melakukan pengembangan di lapangan,” ujar AKBP Ridwan Usman seraya menadaskan, dalam mengungkapkan kasus perampokan BRI Lhoknibong, yang terjadi beberapa waktu lalu, pihaknya berjanji serius mengungkapkannya. Sebagaimana diwartakan Waspada edisi, Rabu (20/10), perampokan BRI Lhoknibong, dilakukan empat pelaku yang menggunakan sepucuk senjata api (senpi) jenis AK-47, Selasa (19/10) sekira pukul 10:30 Wib. Dalam aksinya, petugas penjaga bank berhasil melumpuhkan dua pelaku, namun dua lainnya berhasil kabur. Pihak Bank mengakui, tidak ada uang yang berhasil dilarikan, namun Rp20. 050.000 sebagai barang bukti (BB) disita sementara.(cmad)

SINGKIL (Waspada) : Koresponden Waspada penugasan wilayah Kabupaten Aceh Singkil Mansurdin (foto) dipercaya sebagai Komandan Upacara pada peringatan Hari Sumpah pemuda ke -82 tingkat kabupaten, Kamis (28/10) di halaman kantor bupati setempat. Sedangkan Kajari Aceh SingkilYuswadi SH.MH bertindak selaku inspektur upacara dengan perwira ucapara Sadri Ondang Jaya S.Pd, guru SMP Negeri 1 Singkil Utara. Selain wartawan dan guru, petugas peringatan hari sumpah pemuda yang dimotori Disbudparpora dan KNPI Aceh Singkil juga mekibatkan Pemuda dan unsur PNS, masing–masing Agusman dari KNPI sebagai pembaca teks Pembukaan UUD 1945 dan Tarti Kurniawati PNS Dinas Pertanian dan Tanaman Pangan sebagai pembaca Keputusan Kongres Pemuda 1928. Menteri Pemuda dan Olahraga RI Andi Mallarangeng dalam amanat tertulisnya yang dibacakan Kajari Singkil Yuswadi SH.MH selaku inspektur upacara mengajak seluruh pemuda Indonesia terus berikhtiar dan berjuang menguatkan pembentukan karakter bangsa di segala bidang pengabdian. Upacara peringatan Hari Sumpah Pemuda ke-82 di Kabupaten Aceh Singkil yang ditandai pengibaran bendera Merah Putih oleh Siswa –siswi dari SMU Negeri No. 1 Singkil dihadiri Bupati H. Makmursyah Putra, Wakapolres Kompol Boy Heriyanto S.Ik, ketua Mahkamah Syariah Drs. Khairil Jamal, Kapten Muktar AG mewakili Dandim 0109/Singkil, Ketua MPU Ust. H. Rasyiduddin, SH, Sekda Drs. H.M. Yakub KS.MM ketua PKK Hj. Sriaton Manik, S.Pd, Ketua Darma Wanita Hj. Sukma Azaji, SH para asisten, kepala SKPD dan PNS di jajaran Pemkab Aceh Singkil. Selain itu juga hadir ketua AMPI Aceh Singkil Nasir Selasa dan Ketua FKPPI Aceh Singkil serta sejumlah wartawan.(cb02)

Pansus DPRA Tinjau Realisasi Proyek APBA Di Bireuen BIREUEN (Waspada): Sedikitnya 10 anggota tim pansus bentukan Dewan Perwakilan Rakyat Aceh (DPRA) yang diketuai Ibnu Rusydi mulai Senin hingga Rabu (27/10) besok turun ke Bireuen untuk meninjau sejumlah proyek tahun 2009 yang dibiayai APBA, sekaligus melihat realisasi kemajuan di lapangan dan rencana anggaran tahun depan. 10 Anggota tim itu adalah Anwar Idris, Firmandez, Adli Calok, Burhani, Husen Banta, Tgk Yahya, Tgk Muhibuddin Waly dan Tgk Ilham Leube dan diketuai Ibnu Rusydi. Ketua Pansus IV Ibnu Rusdi didampingi anggotanya kepada Waspada, Selasa (26/10) yang ditemui di Hotel Meuligoe Residence mengatakan, pihaknya turun ke Bireuen meninjau realisasi proyekproyek yang dibiayai dengan APBA di Bireuen. ”Kita dengar kabar sebagian proyek kabarnya sudah selesai dikerjakan dan ada juga kabarnya yang belum rampung dikerjakan, tentu memerlukan tinjauan lapangan melihat kebenaran akabar itu,” katanya. Didampingi Firmandez, Syamsul Bahri dan sejumlah anggota pansus lainnya, Ibnu Rusyidi mengatakan, dalam meninjau proyekproyek itu ada juga didampingi pejabat terkait. Dalam kunjungan itu mereka merangkum juga masukan dari masyarakat tentang berbagai persoalan di Bireuen. Menjawab Waspada, kabarnya banyak proyek yang dibiayai provinsi di Bireuen, umumnya tak rampung dikerjakan dan yang lebih banyak tak rampung disebut-sebut adalah sarana fisik pendidikan, Firmandez saat itu tidak membantahnya, namun katanya, selama ini kemungkinan antara pihak provinsi kurang terjalin koordinasi dan komunikasi. Namun diharapkan hal ini tidak terjadi lagi ke depan.(amh)

Waspada, Senin 1 November 2010