Page 1

Harus Diboikot JAKARTA (Waspada): Pengacara senior Adnan Buyung Nasution meminta media khususnya televisi untuk tidak lagi mengundang Juru Bicara Front Pembela Islam (FPI), Munarman sebagai narasumber. Orang tempramental seperti Munarman tidak layak diberi kesempatan tampil di muka publik, kata Buyung di kantor LBH Jakarta, Minggu (30/6). Buyung mengaku pernah memberhentikan Munarman dari LBH Jakarta saat ia memimpin. Alasannya, perilaku yang bersangkutan tidak dapat dipertanggungjawabkan secara hukum. (vvn) Berita terkait di halaman A8.

SENIN, Legi, 1 Juli 2013/22 Sya’ban 1434 H

WASPADA Demi Kebenaran Dan Keadilan

www.waspadamedan.com

No: 24270 Tahun Ke-67

Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-12, B1-12)

Pramono Edhie Berpeluang Gantikan SBY JAKARTA (Waspada): Mantan Kepala Staf Angkatan Darat Jenderal (Purn) Pramono Edhie Wibowo akhirnya resmi bergabung ke Partai Demokrat. Nama Pramono sebelumnya sempat digadang-gadang dalam Konvensi Partai Demokrat Maret 2012 lalu sebagai calon ketua umum menggantikan Anas Urbaningrum yang telah dinonaktifkan. Wacana menjadikan Pramono Edhie sebagai Ketua Umum akhirnya hilang begitu saja begitu kakak iparnya, Susilo Bambang Yudhoyono, maju sebagai kandidat terkuat dan akhirnya terpilih secara aklamasi. Setelah pensiun dari TNI, Pramono Edhie akhirnya terjun ke dunia politik. Mungkinkah Pramono diproyeksikan sebagai pengganti SBY? Anggota Dewan Pembina Partai Demokrat Suaidi Marasabessy tak meragukan kemampuan Pramono. Menurutnya, Pramono sudah pernah menjadi KSAD, maka memungkinkan untuk maju sebagai Ketua Umum di kemudian hari. “Setiap kader pasti punya kemampuan, termasuk beliau. Jadi KSAD aja bisa, apalagi jadi ketua umum. Kan nggak semua ketua umum bisa jadi KSAD,” ujar Suaidi di sela-sela acara Front Pemuda Muslim Maluku (FPMM) di Taman Mini Indonesia Indah, Minggu (30/6). Suaidi menuturkan, lingkungan kerja TNI dengan partai politik memang sangat berbeda. Namun, Pramono dinilai punya kelebihan karena menjadi KSAD. Sebagai personel TNI AD, kata Suaidi, Pramono sudah memiliki pengetahuan kehidupan berpolitik, berbangsa, dan bernegara. Lanjut ke hal A2 kol. 3

Harian Umum Nasional Terbit Sejak 11 Januari 1947

Harga Eceran: 2.500,-

Bus Kontra Truk, 5 Orang Tewas

Waspada/M.Ishak

BUS Putra Pelangi BL 7521 AA ringsek setelah terjadi laga kambing dengan Truk Colt Diesel BK 9691 PI di Jalinsum Banda Aceh - Medan di kawasan Alue Nireh ,Desa Seuneubok Jalan, Kec. Peureulak Timur, Kab. Aceh Timur, Minggu (30/6) sore.

PEUREULAK (Waspada): Tabrakan antara bus angkutan umum Putra Pelangi BL 7521 AA yang datang dari Medan menuju Banda Aceh dan truk Colt Diesel BK 9691 PI yang datang dari Banda Aceh ke Medan terjadi di Jalinsum Banda Aceh- Medan kawasan Alue Nireh Desa Seuneubok Jalan, Kec. Peureulak Tikur, Kab. Aceh Timur, Minggu (30/6) sore. Informasi Waspada peroleh, dalam peristiwa itu lima orang meninggal dunia dan belasan lainnya menderita lukaluka . Nama-nama korban meninggal dunia yakni Najriah, 54, warga Kampung Mutia Langsa, Basir,46, warga Lhokseumawe, Pipih Hidayah Putri, 10, warga Lhokseumawe, Marnis, 40, warga Medan, Sugiono, 45, warga Tanjungpura, Langkat. Korban luka-luka, Marhaban Rusli sopir bus Putra Pelangi, Putri Raihana, 1, warga Lhokseumawe, Saribanun, 1, warga Lhokseumawe, Syamsul Bahri, 55, warga Krukuh, Sofyan M Amin, 49, warga Bireuen, N Katijah, 52, warga Pulo Ara, Risfan Dana, 26,warga Buketrata, Mualat, 32, warga Langsa, Salman, 52, warga Aceh Tenggara. Kedua kendaraan yang terlibat laga kambing itu, menurut saksi mata, ketika bus mencoba mendahului sepedamotor yang melaju dari arah yang sama, namun tanpa diduga muncul colt diesel bermuatan hasil pertambakan dan menyambar bagian depan bus.

Lanjut ke hal A2 kol. 1

Buyung: Jangan Pilih 36 Caleg Dinilai ICW Tidak Berkomitmen Memberantas Korupsi

JAKARTA (Antara): Pengacara senior dan aktivis Hak Asasi Manusia Adnan Buyung Nasution mengimbau masyarakat untuk tidak memilih 36 calon anggota legislatif (caleg) yang tidak berkomitmen memberantas korupsi lansiran Indonesia Corruption Watch (ICW). Akibat lansiran ICW tersebut, beberapa caleg yang disebut namanya merasa tidak senang dan bahkan akan melaporkan ICW ke polisi.

ADNAN Buyung Nasution.

“Orang-orang yang seperti itu memang jangan terpilih lagi. Juga mereka yang memiliki track record (rekam jejak) tidak

propemberantasan korupsi jangan dipilih lagi,” kata Adnan di Jakarta, Minggu (30/6). ICW merilis 36 nama caleg

DPR dari sembilan parpol peserta Pemilu 2014 yang dinilai tidak berkomitmen memberantas korupsi di Indonesia. Adnan mengapresiasi langkah ICW yang berani mengumumkan nama-nama yang diragukan memiliki sikap antikorupsi karena terlibat kasus korupsi dan tidak mendukung penegakan antikorupsi. “Kita harus bela ICW. Dengan cara begitu, itu merupakan bentuk pengawasan. Ja-

ngan sampai (anggota dewan) sekarang berpikir otoriter dan menyengsarakan rakyat dengan membuat UU yang malah menjerat rakyat,” tegasnya. Rangkuman nama caleg ICW itu adalah instrumen yang dapat digunakan masyarakat untuk menyaring sebelum menjatuhkan pilihannya pada hari pemungutan suara 9 April tahun depan. Adnan mengaku siap pasang badan jika nama-nama caleg itu memasalahkan dan

menggugat ICW ke pengadilan atas tuduhan pencemaran nama baik. “Kalau mereka tersinggung, silakan menuntut. Saya akan bantu siapapun LSM yang dituntut atas rilis ini,” tegasnya. Dari 36 nama caleg pada daftar calon sementara (DCS) yang dirilis ICW, terdapat 10 caleg Partai Demokrat, sembilan caleg Partai Golkar, lima dari PDI Perjuangan, empat PKS, tiga Gerindra, dua PPP dan masing-masing satu dari,

Hanura, PKB dan PBB. Sebagai Masukan Sementara anggota Komisi XI DPR, Zulkieflimansyah menganggap daftar yang dikeluarkan oleh ICW tentang anggota calon anggota legislatif yang diragukan komitmennya dalam memberantas korupsi sebagai masukan. “Saya agak terkejut ketika nama saya disebut sebagai salah satu legislator yang bermasalah, yang tidak mendukung pemberantasan korupsi,” kata

Zulkieflimansyah di Jakarta, Minggu (30/6). “Walaupun sayang nama saya disebut oleh ICW, buat saya apa yang dilakukan oleh ICW ini sebagai sebuah langkah maju. Mudah-mudahan ke depan infonya lebih baik dan akurat,” tambah politisi Partai Keadilan Sejahtera itu. Menurut dia, lembaga semacam ICW diperlukan untuk mengawasi kiprah dan

Lanjut ke hal A2 kol. 3

Soal Asap, Mantan PM Singapura Puji SBY SINGAPURA (Waspada): Mantan Perdana Menteri Singapura Goh Chok Tong mengatakan Presiden Susilo Bambang Yudhoyono telah memperlihatkan kepemimpinan yang kuat dalam menanggulangi kabut asap yang disebut Goh sebagai krisis trans nasional. Dalam pernyataan yang ditulis di Facebook-nya Minggu (30/6) pagi, Goh memuji kemampuan Indonesia dalam menangani kabut asap dan berterima kasih kepada Presiden Susilo Bambang Yudhoyono. “Sahabat saya, Presiden SBY, merupakan sosok negarawan yang telah menunjukkan itikad yang tulus untuk menyelesaikan persoalan bersama ini,” tulis Goh. Politisi yang saat ini menjabat sebagai Menteri Senior Emeritus ini menyampaikan pepatah, “Setiap ada kemauan, pasti ada jalan untuk menyelesaikan masalah”. Namun, di tengah [ujian itu, Goh mengkritik sejumlah menteri Kabinet Indonesia Bersatu II yang dinilainya telah

Lanjut ke hal A2 kol. 3 Waspada/Ist

TAWAF MINGGUKEMARIN: Seorang jamaah umrah asal Medan mengirimkan foto ini, memperlihatkan suasana tawaf pada Minggu (30/6). Juga terlihat suasana di belakang Ka’bah dan sekitarnya dipenuhi alat-alat berat untuk keperluan pembangunan Masjidil Haram dan sekitarnya, termasuk perluasan tempat tawaf (mataf ). Tujuan renovasi dan pembangunan adalah untuk kenyamanan para jamaah haji dan umrah di masa mendatang, direncanakan selesai tahun 2016. Namun menunggu hingga tahun tersebut, pengirim foto ini sempat tertanyatanya: ‘’Apakah (pembangunan) itu dapat mengurangi nilai ibadah atau justru sebaliknya? Para Raisan Fikri Islam lebih tahu jawabannya.’’

Pemilik Kebun Sawit Terdaftar Penerima BLSM Di Labusel KOTAPINANG (Waspada): Data masyarakat penerima Kartu Perlindungan Sosial (KPS) di Kab. Labusel, untuk mendapat Bantuan Langsung Sementara Masyarakat (BLSM) sebagai kompensasi atas kenaikan harga bahan

bakar minyak (BBM), kacau. “Bahkan ada warga pemilik perkebunan sawit terdaftar sebagai penerima. Karena itu, Pemkab Labusel diminta menunda dan jika perlu menolak BLSM itu,” kata anggota Komisi A DPRD Labusel,

Al Bayan

Evaluasi Ibadah

Jappar Siddik Nasution kepada Waspada, Minggu (30/6). Pada reses yang dilakukannya di sejumlah daerah di Kec. Sungaikanan beberapa hari lalu, didapati banyak

Lanjut ke hal A2 kol. 3

LAWAN Presiden Islamis Mesir Mohammed Moursi membawa poster berbahasa Arab yang artinya, “Tinggalkan, orang-orang yang ingin kejatuhan rezim,” dalam satu protes di luar Istana Kepresidenan di Kairo, Mesir, Minggu (30/6). Ribuan warga Mesir yang menuntut penggulingan Presiden Moursi berkumpul di Lapangan Tahrir di Kairo Pusat pada awal protes massal nasional yang dikhawatirkan dapat berubah menjadi protes maut.

MEDAN (Waspada): Satu bangunan gedung bersejarah peninggalan Belanda di Kota Medan terbakar, Minggu (30/6). Bangunan tersebut terletak di kawasan Jl. Ahmad Yani VII, Kel Kesawan, Kec Medan Barat. Tidak ada korban dalam musibah ini, kerugian puluhan juta rupiah. Informasi diperoleh Waspada di lokasi kebakaran, api muncul dari salah satu bangunan No 29, yang selama ini dijadikan kantor sekretariat organisasi kepemudaan. Dengan cepat api merambat ke gedung yang dibangun tahun

1919 itu. Kiki ,28, penarik beca bermotor yang melihat api pertama kali, mengatakan, api muncul dari sudut gedung. Awalnya Kiki melihat kepulan asap tebal dari lantai II dan berikutnya disusul kobaran api. “Kulihat asap dari lantai II sudut gedung. Asapnya berkobar terus, kemudian terlihat kobaran api,” terang Kiki. Begitu melihat kobaran api, KiKi memberitahukan kepada warga yang menghuni bangunan tua itu.

ElBaradei: Mesir Akan Runtuh, Presiden Moursi Hadapi Masa Sulit

Lanjut ke hal A2 kol. 1

Lanjut ke hal A2 kol. 6

Lemang Tebingtinggi Raih Rekor MURI

Oleh Tgk. H. Ameer Hamzah Ibadah baru diterima Allah SWT kalau kita menjaga kesucian pakaian, kehalalan rezeki dan keikhlasan beramal. (Dr. Akhyar Zein, MAg). INTELEKTUAL Muslim, Dr. Akhyar Zein, MAg, kolumnis Harian Waspada ketika berceramah Israk Mikraj di Masjid Raya Baiturrahman Banda Aceh, 27 Rajab 1434 H. yang lalu menyebutkan; Allah telah menjadikan Rajab bulan diwajibkan Shalat oleh Allah SWT. Syakban bulan mengevaluasi ibadah dan Ramadhan bulan memperbanyak ibadah. Menurut Akhyar, ibadah itu harus dievaluasi setiap tahun. Ibadah-ibadah yang perlu dievaluasi antara lain, masalah syahadah, shalat, puasa, zakat dan haji. Kelima Arakanul Islam tersebut dijadwalkan Allah sangat bersinambungan supaya iman dan takwa kita terus

Lanjut ke hal A2 kol. 6

AP

Bangunan Bersejarah Di Jl. A. Yani VII Terbakar

Waspada/Ist

LEMANG kota Tebingtinggi yang berhasil memecahkan rekor MURI sebagai lemang terbesar dan rasa terbanyak saat diukur tim MURI.

TEBINGTINGGI (Waspada): Kota Tebingtinggi meraih rekor Museum Rekor Indonesia (MURI), dengan panganan lemang terbesar dan rasa terbanyak. Lemang Tebingtinggi yang memecahkan rekor MURI, berdiameter 9 Cm dan panjang 50 Cm serta rasa sebanyak 96 macam. Menurut Tim MURI Theo Maret dan J. Ngadri, sebelum kota Tebingtinggi, kota Pagaralam di Provinsi Sumatera Selatan berhasil membuat lemang dengan 88 macam rasa. Pemecahan rekor itu, berlangsung Sabtu (29/6) malam, di Lapangan Merdeka Tebingtingi, dihadiri Wali Kota Ir. H. Umar Z Hasibuan, MM beserta unsur Muspida Tebingtinggi. Selain itu, Kota Tebingtinggi juga memecahkan rekor MURI untuk mencuci tangan terbanyak 12.219 orang. Pelaksanaan ini dilaksanakan usai acara gerak jalan sehat, Minggu (30/6), dihadiri Gubsu H Gatot Pujo Nugroho dan Kasdam I BB Brigjen I Gede Sumarta.

Lanjut ke hal A2 kol. 1

KAIRO, Mesir (Reuters): Presiden Mesir Mohammed Moursi menghadapi lagi keadaan sulit ketika kelompok oposisi dan pendukungnya sama-sama melakukan demo di seluruh penjuru negeri Minggu (30/6). Namun yang menonjol adalah demo oposisi setelah ada laporan yang menyebutkan para pemimpin liberal yang mengatakan seki-

tar 22 juta orang telah menandatangani petisi menuntut dilakukannya perubahan. Unjuk rasa itu diselenggarakan sehubungan dengan ulangtahun ke-2 pemerintahan Moursi, presiden pertama Mesir yang dipilih secara demokrasi. Menurut laman Aljazeera, pendukung Moursi pun akan menggelar demo besarbesaran untuk menyaingi anti-

Moursi yang menyebut diri mereka sebagai Tamarod, yang artinya ‘pemberontakan’ atau ‘pembangkangan.’ Anti-Moursi yang dimotori kelompok akar rumput bernama Tamarod mengklaim sudah mengumpulkan tanda tangan dari 22 juta warga Mesir. Mereka menuntut

Ada-ada Saja Berebut Mahkota BERKELAHI karena adu mulut sudah biasa, tapi apa jadinya kalau baku hantam kali ini gara-gara memperebutkan sebuah mahkota. Seperti dilansir Metro, Minggu (30/6), dua orang waria yang bersaing dalam sebuah kontes kecantikan berkelahi menyusul adanya Lanjut ke hal A2 kol. 2

Serampang - Musang itu - He...he...he...


WASPADA Demi Kebenaran Dan Keadilan

http://epaper.waspadamedan.com

SENIN, Legi, 1 Juli 2013/22 Sya’ban 1433 H

z zNo: 24270 Tahun Ke-67

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

z Terbit 24 Halaman (A1-12, B1-12)z zHarga Eceran: Rp 2.500,-

Waspada/Ist

LEMANG kota Tebingtinggi yang berhasil memecahkan rekor MURI sebagai lemang terbesar dan rasa terbanyak saat diukur tim MURI.

Lemang Tebingtinggi Raih Rekor MURI

TEBINGTINGGI (Waspada): Kota Tebingtinggi meraih rekor Museum Rekor Indonesia (MURI), dengan panganan lemang terbesar dan rasa terbanyak. Lemang Tebingtinggi yang memecahkan rekor MURI, berdiameter 9 Cm dan panjang 50 Cm serta rasa sebanyak 96 macam. Menurut Tim MURI Theo Maret dan J. Ngadri, sebelum kota Tebingtinggi, kota Pagaralam di Provinsi Sumatera Selatan berhasil membuat lemang dengan 88 macam rasa. Pemecahan rekor itu, belangsung Sabtu (29/6) malam, di Lapangan Merdeka Tebingtingi, dihadiri Wali Kota Ir. H. Umar Z Hasibuan, MM beserta unsur Muspida Tebingtinggi. Selain itu, Kota Tebingtinggi juga memecahkan rekor MURI untuk mencuci tangan terbanyak 12.219 orang. Pelaksanaan ini dilaksanakan usai acara gerak jalan sehat, Minggu (30/6), dihadiri Gubsu H Gatot Pujo Nugroho dan Kasdam I BB Brigjend I Gede Sumarta. Pemecahan rekor MURI itu dilaksanakan dalam Lanjut ke hal A2 kol.1

Waspada/M.Ishak

BUS Putra Pelangi BL 7521 AA ringsek berat setelah terjadi laga kambing dengan colt diesel BK 9691 PI di Jalinsum Banda Aceh - Medan persisnya di kawasan Alue Nireh Desa Seuneubok Jalan, Kec. Peureulak Timur, Kab. Aceh Timur, Minggu (30/6) sekira pukul 17:00.

Colt Vs Putra Pelangi 5 Tewas PEUREULAK (Waspada): Tabrakan maut antara bus angkutan umum Putra Pelangi BL 7521 AA yang datang dari Medan menuju Banda Aceh dan truk Colt Diesel BK 9691 PI yang datang dari Banda Aceh ke Medan terjadi di Jalinsum Banda Aceh- Medan kawasan Alue Nireh Desa Seuneubok Jalan, Kecamatan Peureulak Tikur,Kabupaten Aceh Timur, Minggu (30/6) sore.

Informasi Waspada peroleh, dalam peristiwa itu lima orang meninggal dunia dan belasan lainnya menderita luka-luka . Nama-nama korban meninggal dunia yakni Najriah, 54, warga Kampung Mutia Langsa, Basir, 46, warga

Lhokseumawe, Pipih Hidayah Putri, 10, warga Lhokseumawe, Marnis, 40, warga Medan, Sugiono, 45, warga Tanjungpura, Langkat. Korban luka-luka, Marhaban Rusli sopir bus Putra Pelangi, Putri Raihana, , warga

Lhokseumawe, Saribanun, 1, warga Lhokseumawe, Syamsul Bahri,55, warga Krukuh, Sofyan M Amin,49, warga Bireuen, N Katijah, 52, warga Pulo Ara, Risfan Dana, 26, warga Buketrata, Mualat, 32, warga Langsa, Salman,52,

warga Aceh Tenggara. Kedua kendaraan yang terlibat laga kambing itu, menurut saksi mata, ketika bus mencoba mendahului sepedamotor yang melaju dari arah yang sama, namun tanpa diduga muncul colt diesel bermuatan

hasil pertambakan dan menyambar bagian depan bus. Tubrukan terjadi akibat sopir tr uk tidak mampu mengelak, bahkan setelah terdengar dentuman keras, Lanjut ke hal A2 kol. 6

Soal Asap, Mantan PM Singapura Puji SBY SINGAPURA ( Wa s p a d a ) : Mantan Perdana Menteri Singapura Goh Chok Tong mengatakan Presiden Susilo Bambang Yudhoyono telah memperlihatkan kepemimpinan yang kuat dalam menanggulangi kabut asap yang disebut Goh sebagai krisis trans nasional. Da l a m p e r n y a t a a n

TAWAF MINGGUKEMARIN: Seorang jamaah umrah asal Medan mengirimkan foto ini, memperlihatkan suasana tawaf pada Minggu (30/6). Juga terlihat suasana di belakang Ka’bah dan sekitarnya dipenuhi alat-alat berat untuk keperluan pembangunan Masjidil Haram dan sekitarnya, termasuk perluasan tempat tawaf (mataf ). Tujuan renovasi dan pembangunan adalah untuk kenyamanan para jamaah haji dan umrah di masa mendatang, direncanakan selesai tahun 2016. Namun menunggu hingga tahun tersebut, pengirim foto ini sempat tertanyatanya: ‘’Apakah (pembangunan) itu mengurangi nilai ibadah atau justru sebaliknya? Para Raisan Fikri Islam lebih tahu jawabannya.’’

Moursi Hadapi Lagi Keadaan Sulit KAIRO, Mesir (Reuters): Presiden Mesir Mohammed Moursi menghadapi lagi keadaan sulit ketika kelompok oposisi dan pendukungnya sama-sama melakukan demo di seluruh penjuru negeri Minggu (30/6). Namun yang menonjol adalah demo oposisi setelah ada laporan yang me-

nyebutkan para pemimpin liberal yang mengatakan sekitar 22 juta orang telah menandatangani petisi menuntut dilakukannya perubahan. Unjuk rasa itu diselenggarakan sehubungan dengan ulangtahun ke-2 pemerintahan Moursi, presiden pertama Mesir yang dipilih secara de-

mokrasi. Menurut laman Aljazeera, pendukung Moursi pun akan menggelar demo besar-besaran untuk menyaingi anti-Moursi yang menyebut diri mereka sebagai Tamarod, yang artinya ‘pemberontakan’ atau ‘pembangkangan.’ Lanjut ke hal A2 kol. 6

yang ditulis di Facebook-nya Minggu (30/6) pagi, Goh memuji kemampuan Indonesia dalam menangani kabut asap dan berterima kasih kepada Presiden Susilo Ba m b a n g Yu dhoyono. “Sahabat saya, Presiden SBY, merupakan sosok Lanjut ke hal A2 kol. 1

Pemilik Kebun Sawit Terdaftar Penerima BLSM Di Labusel KOTAPINANG (Waspada): Data masyarakat penerima Kartu Perlindungan Sosial (KPS) di Kab. Labusel, untuk mendapat Bantuan Langsung Sementara Masyarakat (BLSM) sebagai kompensasi atas kenaikan harga bahan bakar minyak (BBM), kacau. “Bahkan ada warga pemilik perkebunan sawit terdaftar sebagai penerima. Karena itu, Pemkab Labusel diminta menunda dan jika perlu menolak BLSM itu,” kata anggota Komisi A DPRD Labusel, Jappar Siddik Nasution kepada Waspada, Minggu (30/6).

Pada reses yang dilakukannya di sejumlah daerah di Kec. Sungaikanan beberapa hari lalu, didapati banyak permasalahan menyangkut data masyarakat. “Datanya kacau, ini dapat menyulut konflik di masyarakat,” katanya dan mencontohkan, di Kel. Langgapayung, Kec. Sungaikanan, ditemukan warga yang cukup mapan perekonomiannya mendapat KPS sebagai penerima dana BLSM Rp150 ribu per bulan. Sementara ada warga yang layak menerima, Lanjut ke hal A2 kol. 3

Antara

LARANGAN BBM SUBSIDI MOBIL DINAS: Pengumuman sosialisasi larangan menggunakan Bahan Bakar Minyak (BBM) subsidi untuk mobil dinas terpasang di salah satu Stasiun Pengisian Bahan Bakar Umum (SPBU), Makassar, Sulsel, Minggu (30/6). Mulai tanggal 1 Juli 2013, Pemerintah Provinsi Sulsel akan memberlakukan larangan menggunakan BBM bersubsidi untuk kendaraan dinas berdasarkan pada Peraturan Menteri ESDM Nomor 1 Tahun 2013 tentang Pengendalian Penggunaan BBM dan Surat Edaran Gubernur Sulsel Nomor 541/30/49/ESDM.

Pramono Edhie Berpeluang Gantikan SBY JAKARTA (Waspada): Mantan Kepala Staf Angkatan Darat Jenderal (Purn) Pramono Edhie Wibowo akhirnya resmi bergabung ke Partai Demokrat. Nama Pramono sebelumnya sempat digadang-gadang dalam Konvensi Partai Demokrat Maret 2012 lalu sebagai calon ketua umum menggantikan Anas Urbaningrum yang telah dinonaktifkan.

Wacana menjadikan Pramono Edhie sebagai Ketua Umum akhirnya hilang begitu saja begitu kakak iparnya, Susilo Bambang Yudhoyono, maju sebagai kandidat terkuat dan akhirnya terpilih secara aklamasi. Setelah pensiun dari TNI, Pramono Edhie akhirnya terjun ke dunia politik. Mungkinkah Pramono diproyeksikan sebagai pengganti

SBY? Anggota Dewan Pembina Partai Demokrat Suaidi Marasabessy tak meragukan kemampuan Pramono. Menurutnya, Pramono sudah pernah menjadi KASAD, maka memungkinkan untuk maju sebagai Ketua Umum di kemudian hari. “Setiap kader pasti punya Lanjut ke hal A2 kol. 3

Ada-ada Saja

Al Bayan

Berebut Mahkota

Evaluasi Ibadah

BERKELAHI karena adu mulut sudah biasa, tapi apa jadinya kalau baku hantam kali ini gara-gara memperebutkan sebuah mahkota. Seperti dilansir Metro, Minggu (30/6), dua orang waria yang bersaing dalam sebuah kontes kecantikan berkelahi menyusul adanya kesalahan penilaian akhir dari dewan juri.

Oleh: H. Ameer Hamzah Ibadah baru diterima Allah SWT kalau kita menjaga kesucian pakaian, kehalalan rezeki dan keikhlasan beramal. (Dr. Akhyar Zein, MAg). INTELEKTUAL Muslim, Dr. Akhyar Zein, MAg, kolumnis Harian Waspada ketika berceramah Israk Mikraj di Masjid Raya Baiturrahman Banda Aceh, 27 Rajab 1434 H. yang lalu menyebutkan; Allah telah menjadikan Rajab bulan diwajibkan Shalat oleh Allah SWT. Syakban bulan mengevaluasi ibadah dan Ramadhan bulan memperbanyak ibadah. Menurut Akhyar, ibadah itu harus dievaluasi setiap tahun. Ibadah-ibadah yang perlu dievaluasi antara lain, masalah syahadah, shalat, puasa, zakat dan haji. Kelima Arakanul Islam tersebut dijadwalkan Allah sangat bersinambungan supaya iman dan takwa kita terus bertambah. Dan kelima rukun Islam itu dapat kita perdalam bulan Lanjut ke hal A2 kol. 2

Lanjut ke hal A2 kol. 1

Serampang Antara

TRADISI ZIARAH KUBUR: Seorang anak menabur bunga ketika berziarah ke makam keluarganya di TPU Karet Bivak, Jakarta, Minggu(30/6). Tradisi ziarah dilakukan umat Muslim untuk mendoakan arwah keluarganya menjelang datangnya bulan suci Ramadhan.

- Ada udang di balik asap - He... he... he...


Berita Utama

A2

Bandar Dan Dua Konsumen Sabu Ditangkap MEDAN (Waspada): ASTP, 37, warga Jl. Tanah Enam Ratus,Gang Muslim Pancasila, Kec.Medan Marelan, yang selama ini diduga sebagai bandar sabu ,Sabtu (29/6) malam, ditangkap Reskrim Polsek Medan Timur di rumahnya. Dari tersangka, polisi menyita barang bukti 20 gram sabu senilai Rp 20 juta, 1 tim-

bangan elektrik dan Hp. Selain itu, polisdi menangkap 2 konsumen ASTP. Informasi Waspada diperoleh di kepolisian, Minggu (30/ 6), tertangkapnya ASTP berawal dari penggerebekan satu kamar kos di Jl. Pabrik Tenung, Gang Belanga, Medan. Saat itu, petugas Reskrim Polsek Medan Timur dipimpin

Iptu Jama K Purba, SH, MH, mendapat informasi tentang keberadaan pasangan bukan suami yang diduga sering mengkonsumsi sabu. Berdasarkan informasi tersebut, petugas memantau keberadaan pria berinisial MN, 30, warga Jl. Mentimun Medan, dan teman wanitanya berinisial SA alias An ,23, yang kos di Jl Pabrik Tenun, Gang Belanga. Setelah beberapa jam menunggu, polisi melihat pasangan bukan suami istri itu masuk ke dalam kamar kos tersebut. Dua jam kemudian, petugas menggerebek kamar kos

dan memergoki MN dan SA alias An sedang menikmati sabu. Dari kedua sejoli itu, petugas menemukan 2 paket sabu yang belum sempat dinikmati, 1 bong dan uang Rp 215 ribu. Dari hasil pemeriksaan terhadap MN dan SA alias An, diketahui sabu tersebut dibeli dari ASTP. Berbekal informasi itu, petugas memboyong MN dan SA untuk menunjukkan rumah ASTP di kawasan Kec Medan Marelan. Sesampainya di Jl. Tanah Enam Ratus, Gang Muslim Pancasila, petugas menggerebek rumah yang dihuni ASTP. Saat itu, ASTP berusaha kabur,

namun gagal karena rumahnya sudah dikepung petugas. Dari rumah itu, petugas menyita barang bukti 20 gram sabu, 1 timbangan elektrik, 1 Hp dan uang tunai Rp 5.700.000. Kepada polisi, MN mengaku sudah lama mengkonsumsi sabu bersama teman wanitanya SA untuk menambah stamina. Menurut MN, sabu tersebut dibelinya dari ASTP. Kapolsek Medan Timur AKP Efianto didampingi Kanit Reskrim Iptu Jama K Purba menjelaskan, ketiga pengedar dan pecandu sabu masih menjalani pemeriksaan. (h04)

Pemilik...

berapa? Program ini tidak relevan. Uang Rp150 ribu per bulan tidak akan membuat masyarakat sejahtera. Dan ini tidak dapat menghapus sakit hati masyarakat atas mahalnya harga di pasar akibat harga BBM naik. Data ini aneh, pemerintah pusat kok lebih tahu tentang masyarakat miskin di Labusel? ‘’ Harusnya libatkan Pemkab Labusel, ‘’katanya. Sementara Kepala Kantor Pos Kec. Sungaikanan, Edwin Syah mengatakan, pihaknya dalam hal ini hanya berperan sebagai penyampai surat KPS dan penyalur dana BLSM kepada 2.343 masyarakat penerima di Kec. Sungaikanan. Mengenai nama-nama warga sudah ditentukan pemerintah pusat. ‘’ Pemberian uang BLSM belum ada jadwal, tapi mungkin minggu pertama Juli 2013,” terangnya. Di tempat berbeda Bagian Data BPS Labuhanbatu Jefri B juga mengatakan pihaknya tidak terkait masalah kacaunya data penerima KPS untuk

mendapat BLSM, meski data yang digunakan pemerintah untuk menentukannya merupakan data base BPS tahun 2011, yakni 40 persen masyarakat pendapatan terbawah. Menurutnya, penunjukan nama penerima BLSM dilakukan Tim Koordinasi Penanggulangan Kemiskinan Daerah (TKPKD). “Nama-namanyakan ditentukan TKPKD,” terangnya. Hal senada dikemukakan Kabag Humas Pemkab Labusel, Hasan Basri Harahap. Menurutnya, Pemkab Labusel tidak dilibatkan dalam pendataan warga penerima KPS, karena seluruh program sepenuhnya dilaksanakan pemerintah pusat. Informasi dihimpun Waspada, dua kecamatan di Kab. Labusel yakni Kec. Silangkitang dan Kec. Kampungrakyat sudah dilakukan pembayaran BLSM. Tiga kecamatan lain yakni Kotapinang, Torgamba dan Sungaikanan masih tahap pendistribusian KPS.(c18) Pembina Partai Demokrat, Suaidi Marasabessy, di selasela acara Front Pemuda Muslim Maluku (FPMM) di Taman Mini Indonesia Indah, Minggu (30/6). Djoko Suyanto kini menjabat sebagai Menteri Koordinator Politik, Hukum, dan HAM. Djoko merupakan mantan Panglima TNI tahun 20062007. Sementara Endriartono adalah mantan Panglima TNI tepat sebelum Djoko Suyanto. Suaidi mengatakan, kedua jenderal purnawirawan itu sudah sempat bertanya akan kriteria capres yang diinginkan Demokrat. Namun, lanjutnya, saat ini Partai Demokrat belum menentukan syarat pasti dalam Konvensi partai itu. “Kami akan buat kriteria untuk melakukan seleksi, lalu kami akan lakukan inventarisasi dan pendekatan kepada yang bersangkutan untuk menjelaskan mekanisme konvensi,” ucap Suaidi. Saat kandidat sudah menyatakan kesiapannya, calon itu kemudian diumumkan ke publik. Selanjutnya, mekanisme survei yang akan menentukan kandidat-kandidat tersebut terpilih sebagai capres yang akan diusung Demokrat pada Pemilu 2014. Soal kemungkinan Ketua Umum Partai Demokrat Susilo Bambang Yudhoyono berperan dalam menentukan capres terpilih, Suaidi menampiknya. “Pak SBY sama sekali tidak memilih, yang memilih nanti murni dari mekanisme survei,” ucap mantan Kepala Staf Umum TNI Angkatan Darat itu. Partai Demokrat memutuskan melakukan konvensi untuk menjaring calon Presiden. Saat ini, tim seleksi tengah dibentuk dan pengumuman akan disampaikan Juni 2013. Setelah itu, pendaftaran bagi para kandidat dilakukan. Calon internal maupun eksternal diperkenankan mendaftar sebagai kandidat capres. (kc/m09)

rangkaian menyambut Hari Jadi ke-96 Kota Tebingtinggi pada 1 Juli 2013 bersamaan dengan HUT ke- 67 Bhayangkara. Ketua tim MURI Theo Maret, mengatakan lemang yang dibuat warga Tebingtinggi panjang 50 Cm dengan diameter 9 Cm menggunakan 2.112 batang bambu. Rekor ini mengalahkan capaian yang sebelumnya diraih kota Pagaralam, Prov. Sumsel yang pernah mencatat sebagai pembuat lemang dengan 88 rasa. MURI merupakan lembaga nirlaba berkedudukan di Semarang, Jateng. Lembaga ini, kata Theo, sejak didirikan 1990 telah mencatat 6.050 rekor anak bangsa yang tercipta. Sehingga setiap hari ada saja prestasi anak bangsa yang membanggakan lahir. Wali Kota Ir.H.Umar Z Hasibuan, MM, menyatakan apresiasinya kepada Asosiasi Pedagang Lemang Kota Tebingtinggi yang memecahkan rekor lemang terbesar dan rasa terbanyak. (a09)

justru tak kebagian KPS. “Parahnya lagi, ada warga sudah meninggal dunia dan ada yang sudah pindah rumah, tapi tetap terdaftar sebagai penerima. Paling aneh, ada yang memiliki lima sepedamotor dan punya kebun sawit lebih dari tiga hektar, juga dapat BLSM,” katanya. Politisi PBB ini mengatakan, kondisi serupa ditemukan hampir di seluruh kecamatan di Kab. Labusel. Menurutnya sumber data yang digunakan pemerintah untuk menentukan warga penerima BLSM tidak jelas dan tidak akurat. Untuk itu, dia berharap Pemkab Labusel minta pemerintah pusat menunda BLSM di Kab. Labusel, atau jika perlu menolaknya. “Kalau diteruskan dikhawatirkan menimbulkan gejolak di masyarakat.” Jappar Siddik mempertanyakan datanya dari mana. Kalau dari BPS, ini data tahun

Soal Asap...

Pramono...

negarawan yang telah menunjukkan itikad yang tulus untuk menyelesaikan persoalan bersama ini,” tulis Goh. Politisi yang saat ini menjabat sebagai Menteri Senior Emeritus ini menyampaikan pepatah, “Setiap ada kemauan, pasti ada jalan untuk menyelesaikan masalah”. Namun, di tengah [ujian itu, Goh mengkritik sejumlah menteri Kabinet Indonesia Bersatu II yang dinilainya telah menyampaikan pernyataan yang kasar, bermusuhan, dan tidak konstruktif. “Presiden SBY menunjukkan bahwa dia berbeda dengan sejumlah menterinya.” Goh menyambut baik berkurangnya jumlah titik api di Provinsi Riau. Dia juga memuji pembuatan hujan buatan oleh Pemerintah Indonesia yang dinilainya sangat membantu. Kondisi udara di Negeri Merlion berangsur-angsur membaik ditambah dengan berubahnya arah angin. Untuk mencegah krisis yang sama kembali terulang tahun depan, anggota parlemen dari konstituensi Marine Parade ini menekankan, “mencegah lebih baik daripada mengobati”. Goh mendesak Pemerintah Indonesia untuk lebih tegas mengimplementasikan penegakan hukum. Tentu saja, itikad politik yang kuat sangatlah dibutuhkan, tambahnya. “Saya mengerti mustahil untuk secara total mengharapkan petani miskin itu tidak melakukan pembakaran, namun seharusnya tidak sulit bagi Indonesia untuk menghentikan perusahaan perkebunan yang sengaja membakar,” tulis Goh. (m11/kcm)

kemampuan, termasuk beliau. Jadi KASAD aja bisa, apalagi jadi ketua umum. Kan nggak semua ketua umum bisa jadi KASAD,” ujar Suaidi di selasela acara Front Pemuda Muslim Maluku (FPMM) di Taman Mini Indonesia Indah, Minggu (30/6). Suaidi menuturkan, lingkungan kerja TNI dengan partai politik memang sangat berbeda. Namun, Pramono dinilai punya kelebihan karena menjadi KASAD. Sebagai personel TNI AD, kata Suaidi, Pramono sudah memiliki pengetahuan kehidupan berpolitik, berbangsa, dan bernegara. “Jadi tidak ada masalah bagi beliau kalau mau memimpin partai politik,” ucap Suaidi. Selain itu, meski baru saja bergabung ke Partai Demokrat, Pramono sudah disambut hangat oleh para kader Demokrat. “Saya lihat sebagai new comer dalam rakornas kemarin banyak sekali yang minta berfoto. Tidak hanya yang muda tapi para politisi senior. Sehingga akseptabilitasnya cukup tinggi,” ucap mantan Kepala Staf Umum TNI AD ini. Untuk diketahui, SBY yang kini menjadi Ketua Umum Partai Demokrat akan mengakhiri masa jabatannya usai

Pilpres 2014. SBY menjelaskan bersedia menjadi ketua umum hanya untuk membantu partai yang dibesarkannya sejak awal itu. Hal ini menyusul Ketum sebelumnya, Anas Urbaningrum, dinonaktifkan setelah ditetapkan sebagai tersangka dalam kasus gratifikasi proyek Hambalang oleh Komisi Pemberantasan Korupsi. Adapun Pramono selama ini aktif sebagai jenderal bintang empat di lingkungan TNI AD. Pada awal Juni, Pramono pensiun dengan jabatan terakhir sebagai KASAD. Pada Sabtu (29/6) di Hotel Sahid Jaya, Pramono akhirnya resmi menjadi kader Partai Demokrat. Pramono mengaku hanya ingin membantu partai sang kakak, Ani Yudhoyono. Dua Jenderal Bersiap Nyapres Dua jenderal TNI kini bersiap-siap menyusun tim sukses untuk ikut dalam konvensi calon presiden (capres) Partai Demokrat. Dua jenderal itu adalah Marsekal TNI (Purn) Djoko Suyanto dan Jenderal TNI (Purn) Endriartono Sutarto. “Saya mendengar memang sudah ada dua jenderal dari kalangan TNI yang mau melamar dalam konvensi Partai Demokrat, yaitu Djoko Suyanto dan Endriartono. Mereka juga sudah siap-siap tim sukses,” kata Anggota Dewan

kungnya. Bagaimana cara mengevaluasinya? Caranya adalah dengan membuka kembali kitab Fiqh ibadah dan Mua’amalah tentunya. Kita dalami dan hayati ilmu-ilmu Fardhu A’in itu suapaya ibadah yang kita kerjakan lebih kusyuk dan ikhlas. Ustadz Akhyar Zein yang dosen IAIN Medan itu menyebut tentang manajemen masjid yang belum modern. Akhyar punya konsep manajemen masjid yang modern untuk memakmurkannya. Begitu juga ilmu tentang cara mengelola zakat modern. Akhyar mengharapkan Aceh dan Sumut menjadi pelopor ilmu manajemen. Kita sependapat dengan pandangan Akhyar. Jika pe-

ngelola masjid dapat menerima manajemen modern sebagaimana yang diuraikan malam Israk Mikraj, tentu masjidmasjid di Aceh dan Sumut akan lebih makmur, demikian pula dengan manjemen zakat yang selama ini masih kita lihat masih tersendat-sendat. Terakhir Ustadz Akhyar mengimbau umat Islam untuk mengevaluasi ibadah supaya tidak sia-sia. Supaya ibadah diterima oleh Allah SWT harus dilaksanakan secara benar sesuai dengan petunjuk Rasulullah SAW, sumber rezeki harus benar-benar diperhatikan, jangan sedikitpun ada yang haram. Sebab daging yang tumbuh dari yang haram, tempat yang pantas untuknya adalah neraka.

Waspada/Andi Aria Tirtayasa

KAPOLSEK Medan Timur AKP Efianto didampingi Kanit Reskrim Iptu Jama K Purba SH, MH, memperlihatkan barang bukti beberapa bungkus plastik sabu yang disita dari ketiga pecandu dan bandar, Sabtu (29/6) pukul 19:00.

Lemang...

Ada-ada Saja... Pemenang Miss Gay San Juan, sebuah kontes kecantikan di Peru, telah bergulat ke lantai dengan sang runner-up sesaat setelah dirinya diberi mahkota oleh dewan juri. Tak lama setelahnya, ribut-ribut dan suara gaduh pun terjadi. Rupanya para penonton di Tarapoto berteriak melihat adegan tersebut. Para kontestan yang sama-sama mengenakan sepatu hak tinggi tersebut tampak sudah tergeletak di lantai. Kedua pihak yang berkelahi ini pun saling baku hantam layaknya seorang pria sedang berantem. Mereka pun diketahui saling menarik rambut palsu lawan. “Perjuangan” mereka pun tak ayal sempat terekam dalam sebuah video. Diperkirakan, pemicu dari perkelahian tersebut karena juri salah mengumumkan nama juara 1 yang sehaAl-Bayan... rusnya runner-up. (ok/rzl) Syakban saat ini untuk kita amalkan bulan Ramadhan Jawaban Problem Catur, yang akan datang. TTS Dan Sudoku Syahadat senantiasa kita ucapkan dalam shalat, shalat Dari Halaman Sport. secara rutin kita kerjakan, tambah lagi Tarawih yang cuma Jawaban Problem Catur: ada malam Ramadhan. Afdhal juga bila bulan Ramadhan kita 1. Bd8 (target memperbanyak sedekah dan Bg8+mat), Ba8. juga mengeluarkan zakat fitrah 2. BxBa8, Kb8. serta zakat maal. Umrah bulan 3. BxK, Bh3. Ramadhan juga sangat besar 4. BxB, Gxc2. pahalanya. Dua bulan berse5. Bd-g8+mat. lang, para jamaah haji berangkat ke tanah suci. Jawaban TTS: Karena itulah, Akhyar Zein meminta umat Islam untuk TTS Topik Umum mengevaluasi amal ibadah Serba “Ang” mereka, sejak dari rukun Islam sampai perkara yang mendu-

Jawaban Sudoku: 8 4 1 3 7 6 5 2 9

7 3 5 9 1 2 8 6 4

9 2 6 5 8 4 3 7 1

4 7 3 8 2 1 6 9 5

6 9 2 7 5 3 1 4 8

1 5 8 6 4 9 7 3 2

5 6 7 4 9 8 2 1 3

2 8 4 1 3 7 9 5 6

3 1 9 2 6 5 4 8 7

WASPADA Senin 1 Juli 2013

Bangunan Bersejarah Di Jalan Ahmad Yani VII Terbakar MEDAN (Waspada): Satu bangunan gedung bersejarah peninggalan penjajahan Belanda di Kota Medan yang terletak di kawasan Jalan Ahmad Yani VII, Kel Kesawan, Kec Medan Barat, Minggu (30/6) sekira pk 16:00 terbakar. Tidak ada korban dalam musibah ini, namun kerugian mencapai puluhan juta rupiah. Informasi yang diperoleh di lokasi kebakaran, api muncul dari salah satu bangunan kantor organisasi kepemudaan no 29. Dengan cepat api merambat ke 7 kantor yang yang berada di satu gedung bangunan yang berdiri pada tahun 1919 itu. Kiki ,28, penarik beca bermotor yang melihat api pertama kali, mengatakan, api muncul dari sudut gedung. Awalnya Kiki melihat kepulan

asap tebal yang keluar dari lantai II dan detik berikutnya disusul kobaran api. “Kulihat asap di dari lantai II sudut gedung. Asapnya berkobar terus dan kemudian terlihat kobaran api,” terang Kiki. Begitu melihat kobaran api, Kini memberhentikan betornya dan memberitahukan kepada warga yang menghuni bangunan tua tersebut. Awalnya, para penghuni sempat tak percaya, namun setelah mereka keluar dari dalam bangunan tua tersebut, barulah mereka percaya setelah melihat kobaran api. Dalam beberapa menit, kobaran api terus membakar dinding kayu dan tiang-tiang kayu yang berada di bagian atas gedung. Sejumlah mobil dari Dinas Pencegah dan Pemadam Kebakaran Pemko Medan yang

tiba di lokasi akhirnya berhasil memadamkan kobaran api. Kapolsek Medan Barat Kompol Nasrun Pasaribu mengatakan, dalam peristiwa itu tidak ada menelan korban jiwa sedangkan penyebab kebakaran diduga korsleting arus pendek. “Setelah kita cek, ternyata korban tidak ada. Diduga api karena terjadinya arus pendek (korslet),” ujar Kompol Nasrun Pasaribu seraya menambahkan pihaknya masih mencari saksi-saksi untuk dimintai keterangan terkait peristiwa kebakaran tersebut. Pantauan Waspada, bangunan tua tersebut selama ini ditempati oleh sejumlah pengurus organisasi kepemudaan dan organisasi lainnya sebagai kantor masingmasing. (h04)

Balai Karantina Pertanian Gelar Sosialisasi Kepada Masyarakat KUALANAMU, Deliserdang (Waspada): Menjelang beroperasinya Kualanamu International Airport (KNIA), 25 Juli mendatang, pihak Kantor Balai Karantina Pertanian Kelas II Medan menggelar sosialisasi kepada masyarakat di gedung baru Dusun Lestari, Desa Pasar V Kebun Kelapa, Kec. Beringin, Deliserdang, Minggu (30/6). “Kegiatan ini merupakan bulan bakti Balai Karantina Pertanian tujuannya agar para pegawai dapat berbaur di tengah masyarakat sekitar untuk menciptakan harmonisisasi antara Balai Karantina Pertanian Kelas II Medan Kualanamu dan warga,’’ kata Japar Sidik SP, MH, kepala Kantor Balai Karantina Pertanian Kelas II Medan Kualanamu di hadapan dua ratusan warga dan pegawai kantor itu, kemarin. Japar mengungkapkan kegiatan bulan bakti Balai Karantina Pertanian dirangkai dengan sosialisasi dan syuku-

ran itu sekaligus menindaklanjuti rapat dengan tim Pengoperasian Bandara Kualanamu, yang mengarahkan agar semua instansi/lembaga terkait dengan Bandara di Polonia segera pindah ke Kualanamu. “Jadi momen ini amat tepat mengingat kantor kita yang sudah representatif ini harus kita perkenalkan tugas, pokok dan fungsinya kepada masyarakat,” ujarnya. Tupoksi Balai Karantina Pertanian adalah mengawasi lalulintas dan melakukan karantina terhadap media pembawa hama dan penyakit hewan dan tumbuhan baik ekspor maupun impor. Menurut Japar, saat ini pemerintah pusat sedang menggodok undang-undang soal peran Balai Karantina yang identik dengan pertahanan negara. “Khususnya mencegah tangkal hama atau virus dari luar negeri yang akan berdampak pada ancaman Negara.Jika hama itu menyebar ke ketahanan pangan kita

atau dari segi biologis jelas akan mengancam ketahanan Negara,’’ ujarnya dan mengharapkan semua pihak, khususnya masyarakat sekitar untuk ber sinergi menangkal bahaya ini. Hal senada ditegaskan Camat Beringin Batara Rival Harahap. “Kantor ini merupakan benteng pertama mencegah masuknya penyakit dari luar baik lewat hewan maupun tumbuhan. Saya dan masyarakat bangga dengan berdirinya kantor yang megah ini,” ujar Batara sembari mengharapkan lima tahun ke depan anak-anak dan generasi penerus di Beringin bisa berbuat langsung di kantor Balai Karantina Pertanian. Japar Sidik mengatakan, pihaknya dari awal merekrut putra daerah setempat, meski masih minim mengingat anggarannya terbatas, namun ke depan akan diupayakan dapat menampung lebih banyak lagi. (m16)

Colt Vs...

dan kernet truk, sopir bus Putra Pelangi serta dua penumpang yang duduk di bangku depan bus.Namun, hingga kini belum diperoleh identitas para korban. Bahkan hingga pukul

20:00, belum terlihat keluarga korban yang menjenguk dan menjemput jenazah para korban yang berada di RS Rehabilitasi Medik Peureulak dan Puskesmas Alue Lhok, Kec. Peureulak Timur. (b24/b11)

mengimbau warga Mesir untuk fokus pada dialog. Dutabesar AS untuk Mesir telah membuat gusar kalangan oposisi karena mengatakan unjukrasa tidak akan menolong kondisi perekonomian. Para pemimpin liberal, kelompok yang menderita kekalahan dalam pemilihan tahun lalu, berharap dengan mengerahkan jutaan orang turun ke jalan, mereka bisa mendorong Moursi untuk menyerahkan kekuasaan ke tangan teknokrat pemerintah yang bisa menyelenggarakan pemilihan baru. “Kami semua merasa seperti berjalan di jalan buntu dan negara ini akan runtuh,” kata Mohamed ElBaradei, mantan pejabat PBB, peraih Nobel dan pemimpin partai liberal. “Semua warga Mesir harus turun ke jalan untuk menuntut dilaksanakannya pemilihan baru, dan membangun dasar rumah yang akan kita tempati.” Setidaknya empat orang dilaporkan tewas dan 160 lainnya terluka dalam kerusuhan di Mesir. Salah satu korban tewas diketahui warga negara Amerika. WN AS itu ditikam saat terjadi bentrokan anti dan pro-Presiden Mesir Mohammad Muorsi di Kota Alexandria. Menur ut keterangan, warga AS tersebut ditikam saat mengambil foto dengan pon-

selnya di dekat kantor Ikhwanul Muslimin (IM) yang saat ini menguasai pemerintah. Pemimpin keagamaan telah mengingatkan tentang kemungkinan terjadinya ‘perang sipil’. Angkatan bersenjata mengatakan pihaknya akan meningkatkan tindakan jika aksi unjukrasa sudah melewati batas namun pihaknya menegaskan akan tetap menghormati ‘keinginan rakyat’. Di Kairo, ribuan orang berkumpul di Lapangan Tahrir, tempat terjadinya pergolakan 25 Januari 2011, sebagian besar di antara mereka mengatakan akan berkemah di sana sampai Moursi mundur. Yang lain berkumpul di luar istana presiden beberapa mil jauhnya, dijaga ketat. Di pinggiran kota Kairo, IM dan sekutunya, termasuk bekas organisasi militan, telah mendirikan kemah di luar satu masjid. Dijaga warga sipil yang bersenjatakan pentungan dan mengenakan baju pelindung, kelompok ini mengatakan mereka akan membela Moursi. Kedua pihak mengatakan mereka ingin menghindari kekerasan namun hal itu tidak mencegah insiden di mana kelompok Muslim Brotherhood mengatakan beberapa kantornya di penjuru negeri itu telah diserang dan sedikitnya lima orang pendukung kelompok itu tewas minggu lalu.(m23/m10)

Medik Peureulak dan Puskesmas Peureulak Timur. Informasi terakhir diperoleh Waspada, lima korban meninggal dunia yakni sopir

Moursi... Anti-Mursi yang dimotori kelompok akar rumput bernama Tamarod mengklaim sudah mengumpulkan tanda tangan dari 22 juta warga Mesir. Mereka menuntut penggulingan Moursi. Tanda tangan itu tidak memiliki kedudukan hukum, namun tetap memicu kemarahan kepada Moursi. Presiden Moursi dinilai membuat sejumlah keputusan kontroversial sejak duduk sebagai presiden pertama hasil demokrasi. Salah satu keputusannya yang paling dikritik adalah dekrit yang diterbitkannya November 2012. Dekrit tersebut melindungi dirinya dari gugatan hukum. Dari sisi HAM, aktivitas HAM mencatat, aksi kekerasan kian meluas. Moursi tak berbuat banyak saat petugas keamanan melakukan pelanggaran HAM. Moursi menyebut para pendukung oposisi sebagai pecundang yang didukung ‘para penjahat’ semasa kekuasaan Hosni Mubarak. Krisis ekonomi yang makin memburuk dikarenakan situasi kacau dan buntunya politik kemungkinan yang mendorong warga Mesir mendukung rapat umum, yang dimulai Minggu siang di Kairo. Presiden AS Barack Obama


A2

Berita Utama

WASPADA Senin 1 Juli 2013

Bandar Dan Dua Konsumen Sabu Ditangkap

Waspada/Surya Efendi

PETUGAS pemadam kebakaran berusaha memadamkan api dari gedung tua peninggalan Belanda di Jl. Hindu Medan yang terbakar, Minggu (30/6). Terbakarnya gedung bersejarah yang dijadikan markas salah satu OKP ini akibat arus pendek listrik.

Bangunan Bersejarah ... Awalnya, ujar Kiki, para penghuni sempat tak percaya.Namun, setelah mereka keluar dari dalam gedung, mereka melihat kobaran api. Dalam beberapa menit, kobaran api terus membakar dinding kayu dan tiang-tiang kayu yang berada di bagian atas gedung. Api dapat dipadamkan beberapa saat dengan bantuan mobil pemadam milik Pemko Medan. Kapolsek Medan Barat Kompol Nasrun Pasaribu mengatakan, dalam peristiwa itu tidak ada korban jiwa. Penyebab kebakaran diduga korsleting arus pendek. “Setelah kita cek, ternyata korban tidak ada. Diduga api karena terjadinya arus pendek (korslet),” ujar Kompol Nasrun Pasaribu seraya menambahkan pihaknya masih mencari saksi-saksi untuk dimintai keterangan terkait peristiwa itu. Pantauan Waspada, bangunan tua itu selama ini menjadi kantor sejumlah organisasi. (h04)

Bus Kontra Truk, ... Tubrukan terjadi akibat sopir truk tidak mampu mengelak, bahkan setelah terdengar dentuman keras, truk yang sebelumnya dating arah dari Banda Aceh ke Medan berbalik arah menjadi bagian depan truk bergeser ke arah Banda Aceh. Kapolres Aceh Timur AKBP Muhajir, S.Ik, MH melalui Kasat Lantas Iptu Taysar Rhofadli Priyatno saat dihubungi Waspada, membenarkan adanya lakalantas di Jalinsum Banda Aceh - Medan. “Kondisi kedua kendaraan yang terlibat dalam peristiwa ini mengalami rusak berat dan kini sudah diamankan,” katanya. Para korban meninggal dunia dan luka berat, ringan dievakuasi RSU Rehabilitasi Medik Peureulak dan Puskesmas Peureulak Timur. Informasi terakhir diperoleh Waspada, lima korban meninggal dunia yakni sopir dan kernet truk, serta dua penumpang yang duduk di bangku depan bus. Para korban hingga pukul 20:00, masih berada di RS Rehabilitasi Medik Peureulak dan Puskesmas Alue Lhok, Kec. Peureulak Timur. (b24/b11)

Lemang Tebingtinggi Raih ... Pemecahan rekor MURI itu dilaksanakan dalam rangkaian menyambut Hari Jadi ke-96 Kota Tebingtinggi pada 1 Juli 2013 bersamaan dengan HUT ke- 67 Bhayangkara. Ketua tim MURI Theo Maret, mengatakan lemang yang dibuat warga Tebingtinggi panjang 50 Cm dengan diameter 9 Cm menggunakan 2.112 batang bambu. Rekor ini mengalahkan capaian yang sebelumnya diraih kota Pagaralam, Prov. Sumsel yang pernah mencatat sebagai pembuat lemang dengan 88 rasa. MURI merupakan lembaga nirlaba berkedudukan di Semarang, Jateng. Lembaga ini, kata Theo, sejak didirikan 1990 telah mencatat 6.050 rekor anak bangsa yang tercipta. Sehingga setiap hari ada saja prestasi anak bangsa yang membanggakan lahir. Wali Kota Ir.H.Umar Z Hasibuan, MM, menyatakan apresiasinya kepada Asosiasi Pedagang Lemang Kota Tebingtinggi yang memecahkan rekor lemang terbesar dan rasa terbanyak. (a09)

Ada-ada Saja ...

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Bd8 (target Bg8+mat), Ba8. 2. BxBa8, Kb8. 3. BxK, Bh3. 4. BxB, Gxc2. 5. Bd-g8+mat. Jawaban TTS: TTS Topik

Umum Serba “Ang”

Jawaban Sudoku: 8 4 1 3 7 6 5 2 9

7 3 5 9 1 2 8 6 4

9 2 6 5 8 4 3 7 1

4 7 3 8 2 1 6 9 5

6 9 2 7 5 3 1 4 8

1 5 8 6 4 9 7 3 2

5 6 7 4 9 8 2 1 3

2 8 4 1 3 7 9 5 6

3 1 9 2 6 5 4 8 7

kesalahan penilaian akhir dari dewan juri. Pemenang Miss Gay San Juan, sebuah kontes kecantikan di Peru, telah bergulat ke lantai dengan sang runner-up sesaat setelah dirinya diberi mahkota oleh dewan juri. Tak lama setelahnya, ributribut dan suara gaduh pun terjadi. Rupanya para penonton di Tarapoto berteriak melihat adegan tersebut. Para kontestan yang sama-sama mengenakan sepatu hak tinggi tersebut tampak sudah tergeletak di lantai. Kedua pihak yang berkelahi ini pun saling baku hantam layaknya seorang pria sedang berantem. Mereka pun diketahui saling menarik rambut palsu lawan. “Perjuangan” mereka pun tak ayal sempat terekam dalam sebuah video. Diperkirakan, pemicu dari perkelahian tersebut karena juri salah mengumumkan nama juara 1 yang seharusnya runner-up. (ok/rzl)

MEDAN (Waspada): ASTP, 37, warga Jl. Tanah Enam Ratus,Gang Muslim Pancasila, Kec.Medan Marelan, yang selama ini diduga sebagai bandar sabu ,Sabtu (29/6) malam ditangkap Reskrim Polsek Medan Timur di rumahnya. Dari tersangka, polisi menyita barang bukti 20 gram sabu senilai Rp 20 juta, 1 timbangan elektrik dan Hp. Selain itu, polisi menangkap 2 konsumen ASTP. Informasi Waspada peroleh di kepolisian, Minggu (30/ 6), tertangkapnya ASTP berawal dari penggerebekan satu kamar kos di Jl. Pabrik Tenun, Gang Belanga, Medan. Saat itu, petugas Reskrim

Polsek Medan Timur dipimpin Iptu Jama K Purba, SH, MH, mendapat informasi tentang keberadaan pasangan bukan suami yang diduga sering mengonsumsi sabu. Berdasarkan informasi tersebut, petugas memantau keberadaan pria berinisial MN ,30, warga Jl. Mentimun Medan, dan teman wanitanya berinisial SA alias An ,23, yang kos di Jl Pabrik Tenun, Gang Belanga. Setelah beberapa jam menunggu, polisi melihat pasangan bukan suami istri itu masuk ke dalam kamar kos tersebut. Dua jam kemudian, petugas menggerebek kamar kos dan

memergoki MN dan SA alias An sedang menikmati sabu. Dari kedua sejoli itu, petugas menemukan 2 paket sabu yang belum sempat dinikmati, 1 bong dan uang Rp 215 ribu. Dari hasil pemeriksaan terhadap MN dan SA alias An, diketahui sabu tersebut dibeli dari ASTP. Berbekal informasi itu, petugas memboyong MN dan SA untuk menunjukkan rumah ASTP di kawasan Kec Medan Marelan. Kapolsek Medan Timur AKP Efianto didampingi Kanit Reskrim Iptu Jama K Purba menjelaskan, ketiga pengedar dan pecandu sabu masih menjalani pemeriksaan. (h04)

Buyung: Jangan ...

lu diluruskan. Karena ini menyangkut pencemaran nama baik, maka kami akan melaporkan ke instansi kepolisian,” kata Ketua DewanPertimbanganPartaiHary Tanoesoedibjo di Jakarta, Minggu (30/6). Nama Syarifuddin Suding, anggota Komisi III DPR RI, masuk aftar caleg DPR yang dianggap berkomitmen lemah menegakkan kampanye antikorupsi di Indonesia. Menurut ICW, Suding termasukanggotadewanyangmendukung revisi Undang-undang Nomor 30 Tahun 2002 tentang on berangsur-angsur membaik ditambah dengan berubahnya arah angin. Untuk mencegah krisis yang sama kembali terulang tahun depan, anggota parlemen dari konstituensi Marine Parade inimenekankan,“mencegahlebih baik daripada mengobati”. Goh mendesak Pemerintah Indonesia untuk lebih tegas mengimplementasikan penegakan hukum. Tentu saja, itikad politik yang kuat sangatlah dibutuhkan, tambahnya. (m11/kcm)

Komisi Pemberantasan Korupsi (KPK) dengan tujuan melemahkan kewenangan lembaga itu. Namun Hary berkilah dukungan itu justru demi memperjuangkan KPK sebagai lembaga pemberantasan korupsi yang bersifat “adhoc”. “Bagaimanapun juga KPK itu harus juga bisa menjadi bagian dari perbaikan lembaga kepolisian dan kejaksaan, sehingga tentunya dari UU Nomor 30 Tahun 2002 itu perlu dilakukan revisirevisiyangdiperlukan,”kataKetua Pelaksanan Pemenangan Pemilu Partai Hanura ini. Dia mengatakan setiap kader Partai Hanura yang menjadi wakil rakyat dituntut untuk berani menyerukan perbaikan terhadap undang-undangyangdirasaperlu direvisi. “Kita harus sadar bahwa butir-butir peraturan yang perlu diperbaiki ya kita harus berani merevisi,” katanya. Namun, Hary menegaskan Hanura tetap mendukung KPK. “Sepanjang Kepolisian dan Kejaksaan belum dirasakan solid, kita tetap harus dukung,” ujarnya.

mono akhirnya resmi menjadi kader Partai Demokrat. Pramono mengakuhanyainginmembantu partaisangkakak,AniYudhoyono. Dua Jenderal Bersiap Nyapres DuajenderalTNIkinibersiapsiap menyusun tim sukses untuk ikut dalam konvensi calon presiden (capres) Partai Demokrat. Dua jenderal itu adalah Marsekal TNI (Purn) Djoko Suyanto dan Jenderal TNI (Purn) Endriartono Sutarto. “Saya mendengar memang sudah ada dua jenderal dari kalangan TNI yang mau melamar dalam konvensi Partai Demokrat, yaitu Djoko Suyanto dan Endriartono. Mereka juga sudah siapsiap tim sukses,” kata Anggota Dewan Pembina Partai Demokrat, Suaidi Marasabessy. Djoko Suyanto kini menjabat sebagai Menteri Koordinator Politik, Hukum, dan HAM. Djoko merupakanmantanPanglimaTNI tahun 2006-2007. Sementara Endriartono adalah mantan Panglima TNI sebelum Djoko Suyanto. Suaidi mengatakan, kedua jenderal purnawirawan itu sudah sempat bertanya akan kriteria capresyangdiinginkanDemokrat. Namun, lanjutnya, saat ini Partai Demokrat belum menentukan

syaratpastidalamKonvensipartai itu. “Kami akan buat kriteria untuk melakukan seleksi, lalu kami akan lakukan inventarisasi dan pendekatan kepada yang bersangkutan untuk menjelaskan mekanisme konvensi,” ucap Suaidi. Saat kandidat sudah menyatakan kesiapannya, calon itu kemudian diumumkan ke publik. Selanjutnya, mekanisme survei yangakanmenentukankandidatkandidat tersebut terpilih sebagai capresyangakandiusungDemokrat pada Pemilu 2014. Soal kemungkinan Ketua Umum Partai Demokrat Susilo BambangYudhoyono berperan dalam menentukan capres terpilih, Suaidi menampiknya. “Pak SBY sama sekali tidak memilih, yang memilih nanti murni dari mekanismesurvei,”ucapmantan Kepala Staf Umum TNI Angkatan Darat itu. Partai Demokrat memutuskan melakukan konvensi untuk menjaring calon Presiden. Saat ini, tim seleksi tengah dibentuk dan pengumuman akan disampaikan Juni 2013. Setelah itu, pendaftaran bagi para kandidat dilakukan.Caloninternalmaupun eksternal diperkenankan mendaftar sebagai kandidat capres. (kc/m09)

BLSM di Kab. Labusel, atau jika perlu menolaknya. “Kalau diteruskan dikhawatirkan menimbulkan gejolak di masyarakat.” Jappar Siddik mempertanyakan datanya dari mana. Kalau dari BPS, ini data tahun berapa? Program ini tidak relevan. Uang Rp150 ribu per bulan tidak akan membuat masyarakat sejahtera. Dan ini tidak dapat menghapus sakit hati masyarakat atas mahalnya harga di pasar akibat harga BBM naik. Data ini aneh, pemerintah pusat kok lebih tahu tentang masyarakat miskin di Labusel? ‘’ Harusnya libatkan Pemkab Labusel, ‘’katanya. Sementara Kepala Kantor Pos Kec. Sungaikanan, Edwin Syah mengatakan, pihaknya dalam hal ini hanya berperan sebagai penyampai surat KPS dan penyalur dana BLSM kepada 2.343 masyarakat penerima di Kec. Sungaikanan. Mengenai nama-nama warga sudah ditentukan pemerintah pusat. ‘’ Pemberian uang BLSM belum ada jadwal, tapi mungkin minggu pertama Juli 2013,” terangnya. Di tempat berbeda Bagian Data BPS Labuhanbatu Jefri B juga mengatakan pihaknya

tidak terkait masalah kacaunya data penerima KPS untuk mendapat BLSM, meski data yang digunakan pemerintah untuk menentukannya merupakan data base BPS tahun 2011, yakni 40 persen masyarakat pendapatan terbawah. Menurutnya, penunjukan nama penerima BLSM dilakukan Tim Koordinasi Penanggulangan Kemiskinan Daerah (TKPKD). “Nama-namanyakan ditentukan TKPKD,” terangnya. Hal senada dikemukakan Kabag Humas Pemkab Labusel, Hasan Basri Harahap. Menurutnya, Pemkab Labusel tidak dilibatkan dalam pendataan warga penerima KPS, karena seluruh program sepenuhnya dilaksanakan pemerintah pusat. Informasi dihimpun Waspada, dua kecamatan di Kab. Labusel yakni Kec. Silangkitang dan Kec. Kampungrakyat sudah dilakukan pembayaran BLSM. Tiga kecamatan lain yakni Kotapinang, Torgamba dan Sungaikanan masih tahap pendistribusian KPS. (c18)

kinerja anggota dewan. ICW sebelumnyamengumumkandaftar 36 calon anggota DPR RI yang diragukan komitmennya dalam memberantas korupsi, salah satunya Zulkieflimansyah. Hanura akan laporkan ICW Sedangkan Partai Hanura akan melaporkan ICW ke polisi dengan tuduhan mencemarkan nama baik Ketua Fraksi Hanura di DPR Syarifuddin Suding yang masuk daftar 36 caleg prokorupsi. “Beliau itu justru meluruskan aturan-aturanyangsekiranyaper-

Soal Asap, Mantan ... menyampaikan pernyataan yang kasar, bermusuhan, dan tidak konstruktif. “Presiden SBY menunjukkan bahwa dia berbedadengansejumlahmenterinya.” Goh menyambut baik berkurangnya jumlah titik api di Provinsi Riau. Dia juga memuji pembuatan hujan buatan oleh Pemerintah Indonesia yang dinilainya sangat membantu. KondisiudaradiNegeriMerli-

Pramono Edhie ... “Jadi tidak ada masalah bagi beliau kalau mau memimpin partai politik,” ucap Suaidi. Selain itu, meski baru saja bergabung ke Partai Demokrat, Pramono sudah disambut hangat oleh para kader Demokrat. “Saya lihat sebagai new comer dalam rakornas kemarin banyak sekali yang minta berfoto. Tidak hanyayangmudatapiparapolitisi senior.Sehinggaakseptabilitasnya cukup tinggi,” ucap mantan Kepala Staf Umum TNI AD ini. SBY yang kini menjadi Ketua Umum Partai Demokrat akan mengakhirimasajabatannyausai Pilpres2014.SBYmenjelaskanbersediamenjadiketuaumumhanya untuk membantu partai yang dibesarkannya sejak awal itu. Hal ini menyusul Ketum sebelumnya, Anas Urbaningrum, dinonaktifkan setelah ditetapkan sebagai tersangka dalam kasus gratifikasiproyekHambalangoleh Komisi Pemberantasan Korupsi. Adapun Pramono selama ini aktif sebagai jenderal bintang empat di lingkungan TNI AD. Pada awal Juni, Pramono pensiun dengan jabatan terakhir sebagai KSAD. Pada Sabtu (29/6) di Hotel Sahid Jaya, Pra-

Pemilik Kebun Sawit ... permasalahan menyangkut data masyarakat. “Datanya kacau, ini dapat menyulut konflik di masyarakat,” katanya dan mencontohkan, di Kel. Langgapayung, Kec. Sungaikanan, ditemukan warga yang cukup mapan perekonomiannya mendapat KPS sebagai penerima dana BLSM Rp150 ribu per bulan. Sementara ada warga yang layak menerima, justru tak kebagian KPS. “Parahnya lagi, ada warga sudah meninggal dunia dan ada yang sudah pindah rumah, tapi tetap terdaftar sebagai penerima. Paling aneh, ada yang memiliki lima sepedamotor dan punya kebun sawit lebih dari tiga hektar, juga dapat BLSM,” katanya. Politisi PBB ini mengatakan, kondisi serupa ditemukan hampir di seluruh kecamatan di Kab. Labusel. Menurutnya sumber data yang digunakan pemerintah untuk menentukan warga penerima BLSM tidak jelas dan tidak akurat. Untuk itu, dia berharap Pemkab Labusel minta pemerintah pusat menunda

Waspada/Khairul K Siregar

KETUA PW NU Sumatera Utara yang juga calon bupati Deliserdang H.Ashari Tambunan (kanan) ketika menyerahkan sejumlah bantuan dan bingkisan kepada Pimpinan Persulukan Naqsabandyah Batangkuis Drs.Abdurahman Harahap dalam kunjungan silaturahmi sekaligus memohon doa restu yang berlangsung di Masjid Babussalam Nurul Hikmah, Jum’at (28/6) malam.

Cabup H Ashari Tambunan Kunjungi Persulukan Naqsabandyah BATANGKUIS (Waspada): Ketua PW NU Sumatera Utara yang juga calon bupati Deliserdang periode 2014-2019 H.Ashari Tambunan bersama rombongan melakukan kunjungan ke rumah persulukan Babussalam di Dusun IV, Desa Baru, Kec.Batangkuis , Deliserdang, Jumat(28/6) malam. Dalam kunjungan itu, Ashari didampingi Ketua PC NU Deliserdang Gustur Husin Siregar, SH, Sekretaris Dewan Tanfidziyah NU Deliserdang H.Syawal Harahap,SAg, Ketua FKUB Deliserdang H.Waluyo yang juga ketua PD Muhammadiyah Deliserdang, Rois Syuriah NU Deliserdang KH.Amin Rasyid Nst serta H.Yusuf Adi,MA, mewakili MUI DS. Kunjungan silaturahmi ke Persulukan itu diterima Pimpinan Persulukan Drs.Abdurrahman Harahap.Kunjungan itu diawali dengan Shalat Maghrib bersama di Masjid Babussalam Nurul Hikmah dengan imam Drs.Abdurahman Harahap.Dalam kunjungan itu , H.Ashari Tambunan menyampaikan

maksud kedatangannya ke perkampungan Persulukan. Dikatakan Ashari, kedatangannya merupakan kunjungan silaturahmi dalam menjalin komunikasi sebagai wujud rasa kepedulian sesama manusia termasuk yang ada di Persulukan. Mereka yang berada di Persulukan merupakan bahagian dari masyarakat di Kab. Deliserdang sehingga perlu melakukan silaturahmi itu. Menurut Ashari, penguatan silaturhami seperti yang dilakukan ini sangat besar manfaatnya. Selain untuk memperkuat tali silaturhami, juga memupuk rasa persatuan dan kesatuan sehingga dapat menjawab berbagai tantangan dan tuntutan masyarakat ke depan yang semakin kompleks seiring dengan perkembangan pembangunan. Untuk menjawab semuanya itu, kata Ashari, dia menyatakan ingin maju sebagai calon bupati Deliserdang, dengan niat yang tulus untuk meneruskan pembangunan di Deliserdang menuju arah yang lebih baik lagi ke depan.

ElBaradei: Mesir ...

mengimbau warga Mesir untuk fokus pada dialog. Dutabesar AS untukMesirtelahmembuatgusar kalangan oposisi karena mengatakan unjukrasa tidak akan menolong kondisi perekonomian. Para pemimpin liberal, kelompok yang menderita kekalahan dalam pemilihan tahun lalu, berharap dengan mengerahkan jutaan orang turun ke jalan, mereka bisa mendorong Moursi untuk menyerahkan kekuasaan ke tangan teknokrat pemerintah yang bisa menyelenggarakan pemilihan baru. “Kami semua merasa seperti berjalandijalanbuntudannegara ini akan runtuh,” kata Mohamed ElBaradei, mantan pejabat PBB, peraih Nobel dan pemimpin partailiberal.“SemuawargaMesir harus turun ke jalan untuk menuntut dilaksanakannya pemilihanbaru,danmembangundasar rumah yang akan kita tempati.” Setidaknya empat orang dilaporkan tewas dan 160 lainnya terlukadalamkerusuhandiMesir. Salah satu korban tewas diketahui warga negara Amerika. (m23/m10)

penggulingan Moursi. Tanda tangan itu tidak memiliki kedudukan hukum, namun tetap memicu kemarahan kepada Moursi. PresidenMoursidinilaimembuat sejumlah keputusan kontroversial sejak duduk sebagai presiden pertama hasil demokrasi.Salahsatukeputusannyayang paling dikritik adalah dekrit yang diterbitkannya November 2012. Dekrit tersebut melindungi dirinya dari gugatan hukum. Dari sisi HAM, aktivitas HAM mencatat, aksi kekerasan kian meluas. Moursi tak berbuat banyak saat petugas keamanan melakukan pelanggaran HAM. Moursi menyebut para pendukung oposisi sebagai pecundang yang didukung‘para penjahat’ semasa kekuasaan Hosni Mubarak. Krisis ekonomi yang makin memburuk dikarenakan situasikacaudanbuntunyapolitik kemungkinan yang mendorong warga Mesir mendukung rapat umum, yang dimulai Minggu siang di Kairo. Presiden AS Barack Obama

Al Bayan ... bertambah. Dan kelima rukun Islam itu dapat kita perdalam bulan Syakban saat ini untuk kita amalkan bulan Ramadhan yang akan datang. Syahadat senantiasa kita ucapkan dalam shalat, shalat secara rutin kita kerjakan, tambah lagi Tarawih yang cuma ada malam Ramadhan. Afdhal juga bila bulan Ramadhan kita memperbanyak sedekah dan juga mengeluarkan zakat fitrah serta zakat maal. Umrah bulan Ramadhan juga sangat besar pahalanya. Dua bulan berselang, para jamaah haji berangkat ke tanah suci. Karenaitulah,AkhyarZeinmemintaumatIslam untuk mengevaluasi amal ibadah mereka, sejak dari rukun Islam sampai perkara yang mendukungnya. Bagaimana cara mengevaluasinya? Caranya adalah dengan membuka kembali kitab Fiqh ibadah dan Mua’amalah tentunya. Kita dalami dan hayati ilmu-ilmu Fardhu A’in itu suapaya ibadah yang kita kerjakan lebih kusyuk dan ikhlas. Ustadz Akhyar Zein yang dosen IAIN Medan

Untuk itu, ia mohon dukungan dari seluruh lapisan masyarakat karena tanpa adanya kerjasama serta motivasi masyarakat, apapun yang akan dilakukan tidak akan dapat berjalan dengan baik. “Kalau masyarakat menilai saya ini baik dan pantas menjadi pemimpin di Kab. Deliserdang, saya mohon dukungan. Namun sebaliknya jika saya salah, tolong ingatkan saya dan beri arahan yang baik demi untuk kemajuan masyarakat di Deliserdang,” kata H.Ashari Tambunan. Dihadapan pimpinan Persulukan dan para jamaah, Ashari menyampaikan niatnya sekaligus memohon doa restu dari Persulukan, di mana ia akan maju sebagai calon bupati Deliserdang pada Pilkada yang digelar Oktober 2013. Semua ini bertujuan agar niatnya dapat dikabulkan Allah Swt. H Ashari Tambunan, adik kandung Bupati Deliserdang Drs H Amri Tambunan itu menambahkan, kunjungan yang dilakukannya ke Persulukan itu mempunyai arti yang sangat berharga bagi dirinnya karena dengan kunjungan ini ia berharap akan mendapatkan masukan dan nasehat dari pimpinan persulukan khususnya dari sudut pandang agama. Ashari menyadari, dia bukanlah orang yang terbaik sehingga perlu mendapatkan masukan termasuk dari Persulukan ini. Dalam kunjungan ke Persulukan itu, H Ashari Tambunan menyerahkan sejumlah bantuan dan bingkisan dalam menunjang berbagai kegiatan diterima pimpinan Persulukan Drs.Abdurrahman Harahap. Wirid Akbar Sebelum melakukan kunjungan ke Persulukan, sore harinya H.Ashari Tambunan bersama rombongan menghadiri acara wirid akbar kaum ibu se Kec. Batangkuis sekaligus penyambutan bulan suci Ramadhan di Masjid Baitul Rahman Desa Sidodadi Kec. Batangkuis. Dalam kesempatan itu H.Ashari menyerahkan sejumlah bantuan kepada kaum dhuafa dan anak yatim yang ada di Desa Sidodadi. (crul)

itu menyebut tentang manajemen masjid yang belum modern. Akhyar punya konsep manajemen masjid yang modern untuk memakmurkannya. Begitu juga ilmu tentang cara mengelola zakat modern. Akhyar mengharapkan Aceh dan Sumut menjadi pelopor ilmu manajemen. Kita sependapat dengan pandangan Akhyar. Jika pengelola masjid dapat menerima manajemen modern sebagaimana yang diuraikan malam Israk Mikraj, tentu masjid-masjid di Aceh dan Sumut akan lebih makmur, demikian pula dengan manjemen zakat yang selama ini masih kita lihat masih tersendat-sendat. Terakhir Ustadz Akhyar mengimbau umat Islam untuk mengevaluasi ibadah supaya tidak sia-sia. Supaya ibadah diterima oleh Allah SWT harus dilaksanakan secara benar sesuai dengan petunjuk Rasulullah SAW, sumber rezeki harus benar-benar diperhatikan, jangan sedikitpun ada yang haram. Sebab daging yang tumbuh dari yang haram, tempat yang pantas untuknya adalah neraka.


Medan Metropolitan Turis Australia Dirampok

WASPADA Senin 1 Juli 2013

MEDAN (Waspada): Dua pengendara sepedamotor merampok turis Australia yang menumpang becak bermotor di Jln. SM Raja Medan, usai melihat Masjid Raya Al-Mashun, Minggu (30/5) sore.

Akibat peristiwa itu Jessica Clare Cumberland, 20, menderita kerugian tas berisi paspor, 1 unit iPhone 4, uang tunai Rp400ribu, 1 unit kamera Sony, dan dua kartu kredit dengan total kerugian sekitar Rp10 juta. Setelah kejadian itu korban

bersama kelima temannya membuat pengaduan ke Polresta Medan. Korban yang berencana menikmati kota Medan juga shock atas apa yang baru dialaminya. Teman sekampus Jessica di University of Sidney, Australia,

Elsa Syarif Tegaskan Tidak Ada Dualisme IWAPI MEDAN (Waspada): Ketua Dewan Pimpinan Pusat (DPP) Ikatan Wanita Pengusaha Indonesia (IWAPI) Elsa Syarief menegaskan tidak ada dualisme dalam tubuh IWAPI. “Selama ini, memang berkembang ada dua versi IWAPI. Tapi saya pastikan, IWAPI yang saya lantik ini adalah yang legal. Karena kita sudah terdaftar di Kemendagri dan Kesbangpol Linmas. Selain itu, dalam gugatan meja hijau, kita juga menang di tingkat kasasi,” tegas Elsa usai melantik pengurus IWAPI Sumut periode 2013-2018 di Aula Martabe Kantor Gubsu, Jumat (28/6) petang. Pengurus yang dilantik yakni Ketua DPD IWAPI Sumut

Ludfi Thahir SE; Sekretaris Ir. Dewi Sartika Nasution dan Bendahara Lindawani Girsang. Pengurus DPD IWAPI Sumut 2013-2018 ini terdiri dari beberapa seksi dan pengurus lainnya, dengan Pelindung Ketua TP PKK Sumut Hj. Sutias Handayani Gatot Pujo Nugroho dan Penasihat Prof. Dr. T. Silvana Sinar. Dalam amanatnya, Elsa Syarief berharap pengurus IWAPI Sumut 2013-2018 bisa memberikan sumbang pikiran untuk menciptakan lapangan pekerjaan bagi wanita-wanita yang kurang beruntung. “Disamping menciptakan lapangan pekerjaan, para pengurus IWAPI Sumut juga bisa ber-

Waspada/ist

ELSA Syarief saat melantik pengurus IWAPI Sumut periode 20132018.

peran dalam mengantisipasi tindakan kekerasan dalam rumah tangga (KDRT),” ucap Elsa. Sebagai visi misi IWAPI, lanjut Elsa, wanita harus berperan dalam pergerakan perekonomian yang tangguh dan menjadi tonggak perekonomian di Indonesia. Dengan banyaknya pengusaha wanita, diharapkan dapat memberikan kontribusi kepada wanita-wanita di sekeliling kita yang tidak mempunyai pekerjaan. IWAPI juga diharapkan menjadi tonggak perekonomian di Indonesia baik secara nasional maupun internasional bekerjasama dengan lembagalembaga ekonomi lainnya. Sementara itu, Humas IWAPI Sumut Dewi Budiati TJ Said mengatakan, IWAPI dibawah kepemimpinan Elsa Syarif diyakini akan maju. Sebab, program IWAPI ke depan dinilai cukup baik. Apalagi IWAPI akan melakukan pendampingan dengan pengusaha kecil sekaligus memfasilitasi agar pengusaha kecil di daerah ini maupun daerah lainnya bisa cepat berkembang. Jadi, tidak sekadar besar sendiri, tapi lebih fokus pada pembinaan wanita-wanita pengusaha kecil. Elsa juga cukup supel dan membuka diri kepada semua anggotanya,” ujar Dewi.(m25)

Dok. Waspada/Ist

BERSALAMAN DENGAN PRESIDEN. Siswi SMA Perguruan Eria berjabatan tangan dengan Presiden Susilo Bambang Yudhoyono di Istana Negara, Jakarta. Siswi tersebut, Puspita Ladiba, berhasil lulus menjadi anggota Pasukan Pengibar Bendera Pusaka Merah Putih di Istana Negara pada 17 Agustus 2012. Dia adalah satu diantara dua utusan Sumatera Utara ke Istana Negara, pada kesempatan mana diterima Presiden untuk beramah tamah. Puspita diterima masuk Universitas Gajahmada di Yogyakarta. Dia juga mendaftar masuk Akademi Militer, tahun pertama untuk wanita. Tinggal satu pantauan terakhir bagi Puspita untuk menjadi taruni Akmil.

Alice Lim menuturkan, peristiwa penjambretan tas Jessica terjadi ketika mereka sedang menumpangi becak bermotor (betor) usai melihat Masjid Raya AlMashun di Jln. SM Raja Medan. Saat becak melaju di jalan tersebut, satu sepedamotor yang dinaiki dua pria mendekat. “Begitu dekat, pelaku langsung mengambil tas yang ditaruh di belakang,” kata Alice kepada wartawan di Polresta Medan. Menurut dia, mereka berenam berencana pulang ke hotel tempat menginap di Karibia Hotel Jln. Timor Medan. Namun, akibat peristiwa ini rencana tersebut terganggu. Setelah membuat laporan, Jessica dan dua temannya dijemput taksi. “Dia (Jessica) ke Konsulat karena paspor nya hilang,” kata Alice didampingi Belinda, dan Hanna, dua temannya sesama mahasiswi Animal SciencediUniversityofSidneyAustralia. Hanna menambahkan, mereka berenam baru tiba di Medan Sabtu (29/6) dan berencana ke Bukit Lawang melihat Orang-

utan. “Ya, ini baru pertama kali kemari. Besok rencananya mau ke Bukit Lawang lihat Orangutan,” tuturnya. Dari catatan Waspada, sepertinya turis menjadi sasaran empuk kawanan penjambret di Kota Medan. Beberapa waktu lalu, Helen, 50, seorang wisatawan asing dari Belanda, dijambret dua pria yang mengendarai sepedamotor saat berjalan di kawasan Jln. Ahmad Yani Kel. Kesawan, Kec. Medan Barat, Minggu (12/5) malam. Akibat kejadian ini, korban mengalami kerugian uang dan handphone yang dibawa kabur pelaku. Bukan cuma itu korban juga harus mendapat perawatan di Rumah Sakit Columbia Asia Jln. Listrik Medan, akibat terjatuh saat mempertahankan harta bendanya. Kemudian aksi perampokan juga dialami Cristof, wisatawan asal Belgia, di kawasan Jln. SM Raja dekat Masjid Raya, Rabu (27/2). Akibatnya korban kehilangan kalung emas yang melingkar di lehernya. (m39)

A3

Waspada/ist

KETUA DPP MPI Sumut Irwan Pulungan menyerahkan bantuan kain sarung kepada kaum dhuafa.

MPI Sumut Bantu Kaum Dhuafa MEDAN (Waspada): Dewan Pimpinan Provinsi Masyarakat Pancasila Indonesia (DPP MPI) Sumut menyerahkan bantuan 250 kain sarung kepada kaum dhuafa yang ada di sekitar Masjid Agung Medan, Jumat (28/6). Bantuan ini merupakan wujud kepedulian Ketua Umum (Ketum) DPN MPI Meherban Shah. Kegiatan yang dilaksanakan usai shalat Jumat dipimpin Ketua DPP MPI Sumut Irwan Pulungan, SSos, MSi. Turut hadir

Ketua Harian DPN MPI Marzuki Hutasuhut dan Ketua DPK MPI Sibolga Rahmat Pasaribu. Ketua DPP MPI Sumut Irwan Pulungan mengatakan, bantuan kain sarung tersebut sebagai wujud kepedulian MPI terhadap nasib rakyat kecil. Rakyat kecil perlu dibantu, agar mereka senang karena masih orang peduli kepada mereka. “MPI hadir di tengah masyarakat untuk selalu berbuat apa adanya, bukan ada apanya. Ka-

rena MPI adalah wadah orangorang yang berjiwa idealis, Pancasilais dan anti korupsi serta selalu menjaga keutuhan NKRI,” tegas Irwan Pulungan. Di tempat terpisah, Ketua Umum DPN MPI Meherban Shah mengatakan, sebagai umat manusia, sudah sepantasnya saling membantu tanpa membeda-bedakan suku, agama dan ras sebagaimana dimaksud Bhinneka Tunggal Ika. (m36)


Medan Metropolitan Kanit Reskrim Bebaskan GM Angkatan 66 Adakan Silaturahmi Pasangan Selingkuh A4

WASPADA Senin 1 Juli 2013

Kapolsek Medan Kota Mengaku Tidak Tahu MEDAN (Waspada): Kepala Unit (Kanit) Reskrim Polsek Medan Kota Iptu Gunawan membebaskan pasangan selingkuh yang ditangkap massa di rumah kontrakan Jln. Air Bersih Gg Saderek, Jumat (28/6) malam. Kedua pasangan selingkuh itu dibebaskan beberapa jam setelah diantar massa ke Mapolsek untuk diproses hukum. Kepada Waspada saat pemeriksaan terhadap pasangan selingkuh berinisial A, 30, dan

selingkuhannya PH, 24, warga Rengas Pulau, Marelan, serta pelapor (suami A), Kanit Reskrim Iptu Gunawan mengatakan, tidak akan menahan kedua pasangan selingkuh itu. Dia beralasan, ancaman hukuman terhadap kedua pasangan selingkuh itu dibawah lima tahun, sehingga tidak akan menahan keduanya. “Undang-undang yang mengatur seperti itu, kami tidak bisa melakukan penahanan, meskipun suaminya keberatan,” sebut Gunawan. Namun, Kapolsek Medan Kota Kompol PH Sinaga dikon-

Kodam I/BB Peringati Isra Mikraj MEDAN (Waspada): Kodam I/BB memperingati Isra Mikraj Nabi Muhammad SAW 1434 H di Masjid At Taqwa Makodam I/ BB, Kamis (27/6). Pangdam I/BB Mayjen TNI Burhanuddin Siagian yang hadir pada Isra Mikraj itu, menekankan kepada prajurit untuk mampu mewujudkan nilai-nilai yang terkandung di dalam Isra Mikraj. “Hal ini untuk meningkatkan kualitas keimanan dan ketaqwaan yang diimplementasikan dalam kehidupan sehari-hari. Sehingga, peringatan ini bukan sekadar seremonial keislaman belaka tanpa bisa mengambil esensi dan maknanya,” sebutnya. Sementara itu, Al Ustadz M. Hasbi Al Mawardi Lubis dalam ceramah agamanya mengatakan, bulan Rajab dalam kalender Islam merupakan bulan bersejarah, dimana Nabi Muhammad SAW pada malam 27 Rajab di perjalankan atau di Isra Mikrajkan dari Masjidil Haram ke Masjidil Aqsho sebagai kuasanya Allah SWT. “Kuasa Allah SWT melalui perjalanan Rasul yang menjadi utusannya memberikan arti dan makna yang tegas tentang kehendak Allah SWT yang tak bisa dirubah oleh siapapun,” katanya. Hadir dalam acara tersebut Staf Khusus Pangdam I/BB, Para Staf Ahli Pangdam I/BB, Para Asisten,a Kabalakdam I/BB, Para Danyon BS Sewilayah, Perwakilan Batalyon BS Sewilayah Medan dan Masyarakat setempat. (h02)

Mahasiswa STIE Harapan Terima Penghargaan MEDAN (Waspada): Ketua Sekolah Tinggi Ilmu Ekonomi (STIE) Harapan Medan H. Kersna Minan, SE, Msi, Ak memberikan penghargaan kepada enam mahasiswa dari Himpunan Mahasiswa Akuntansi (HMA) STIE Harapan, setelah meraih juara 3 dalam kegiatan Cerdas Cermat Akuntansi-II Fakultas Ekonomi Universitas Pancabudi, baru-baru ini. Penghargaan yang diberikan tersebut karena HMA STIE Harapan Medan sangat aktif dalam meningkatkan kemampuan keilmuan dan kompetensi konsentrasi akuntansi keuangan dan akuntansi perpajakan. Saat menerima penghargaan tersebut, keenam mahasiswa didampingi Pembantu Ketua-III Mukhsini Moenir, BA, SH, MH dan Kabag Mahasiswa Alvin Fahlevi, Ssos serta dosen pembimbing Liza Novietta, SE, Msi, Ak. Ketua STIE Harapan mengharapkan agar kegiatan mahasiswa akuntasi dapat terus ditingkatkan. Kegiatan cerdas cermat yang mereka ikuti setiap tahun juga merupakan salah satu upaya meningkatkan logika berfikir serta kesiapan mental dalam menghadapi kehidupan sehari-hari.(m49)

Waspada/ist

ENAM Mahasiswa Akuntansi foto bersama dengan Ketua STIE Harapan,Pembantu Ketua -III dan Kabag Mahasiswa STIE Harapan di Kampus Harapan Jl.Imam Bonjol Medan.

firmasi mengatakan, bisa menahan kedua pasangan selingkuh itu. “Bisa, masuk delik aduan,” katanya ditanya via BBM. Sehingga pada Sabtu sore, wartawan kemudian meminta agar Kapolsek memaparkan kasus itu berikut memperlihatkan pasangan selingkuh itu. Tetapi disaat Kapolsek memanggil anggotanya untuk membawa keduanya untuk konfrontir, ternyata keduanya sudah dibebaskan pada Sabtu dinihari, beberapa jam setelah pemeriksaan dilakukan. “Maaf, tadi malam sudah dibebaskan karena tidak cukup bukti dan saksi,” kata Kapolsek menyebutkan keduanya tetap diharuskan wajib lapor. Namun, kata Kapolsek, pihaknya akan memeriksa kembali pasangan selingkuh itu jika ada saksi-saksi lain yang mengetahui, mendengar atau melihatnya persetubuhan antara keduanya. Pelapor Sabaruddin Amir, 33, suami A, yang mengetahui keduanya dibebaskan polisi,

mengaku sangat kecewa. “Saya sangat kecewa. Saat penggerebekan itu massa sudah emosi akan melakukan pemukulan, tetapi saya halangi. Saya yang minta agar keduanya dibawa ke kantor polisi untuk diproses, tetapi kenapa dibebaskan,” ujarnya, Minggu (30/6), mengaku sudah memiliki satu anak dari A. Sebelumnya, Jumat sekira pukul 20:00, Sabaruddin Amir bersama puluhan massa menggerebek kedua pasangan selingkuh itu di kediamannya Gang Saderek. Sabaruddin mengetahui istrinya membawa pria lain setelah diberitahu warga. Ketika pintu digedor sekali, tidak ada respon, baru kemudian A melongok dari jendela disaat gedoran kedua. “Saat itu dia mengenakan pakaian minim, ketika tahu saya dan warga yang menggedor pintu langsung lari masuk kamar berganti baju,” tuturnya. Dia mengatakan, saat pintu dibuka, pasangan selingkuh istrinya sempat menggertak,

mengatakan “siapa kau.” Ucapan itu membuat warga emosi, namun segera diredam Sabaruddin. “Dia baru terdiam ketika tahu saya suaminya A,” sebutnya. Malam itu juga kedua pasangan selingkuh tersebut dibawa ke Mapolsek Medan Kota. Disana, warga diminta menunggu di luar, sedangkan pasangan selingkuh dan suaminya dibawa masuk ke Polsek. Hanya saja sampai pukul 22:30, petugas belum melakukan pemeriksaan, bahkan kedua pasangan selingkuh itu tampak tenang berduaan dikawal seseorang mengaku calon anggota legislatif dari Belawan. Karena terlalu lama menunggu, warga emosi dan masuk ke Mapolsek mendatangi pasangan selingkuh itu. Setelah sempat terjadi cekcok dengan warga, akhirnya petugas melakukan pemeriksaan. Tetapi setelah pelapor dan warga pulang dari Polsek sekira pukul 01:15, pasangan selingkuh itu dibebaskan.(m27)

Terkait Kabut Asap

Permintaan Maaf SBY Bentuk Kegagalan Diplomasi Indonesia MEDAN (Waspada): Presidium Majelis Kedaulatan Rakyat Indonesia (MKRI) Razman Arif Nasution menilai, permintaan maaf Susilo Bambang Yudhoyono (SBY) kepada Malaysia dan Singapura terkait kabut asap dari kebakaran hutan yang melanda Riau sangat tidak pantas dilakukan oleh seorang presiden. Permintaan maaf itu justru memberikan preseden buruk terhadap Indonesia, artinya pemerintah Indonesia ‘menampar’ wajahnya sendiri di mata dunia. “Seharusnya cukup Dubes Indonesia atau setingkat menteri saja yang berbicara soal asap kepada negara-negara tersebut. Saya menilai permintaan maaf SBY lebih kepada bentuk kegagalan diplomasi Indonesia ditingkat negara tetangga, ini jelas Indonesia menampar wajahnya sendiri di mata dunia,” kata Razman Arif (foto) yang juga Caleg DPR RI Sumut 2 Partai Gerindra, Minggu (30/6). Padahal, kata dia, pemerintah Malaysia tidak pernah meminta maaf sama sekali kepada Indonesia terkait sengketa Sipadan dan Ligitan, saat kapal patroli Malaysia memepet kapal nelayan Indonesia di Perairan Indonesia tahun 2010, perlakuan kasar terhadap Tenaga Kerja Indonesia di Malaysia dan lainnya. “Sedikitpun pemerintah Malaysia tidak pernah menyampaikan maaf kepada Indonesia,” sebutnya. Selain bentuk kegagalan berdiplomasi, menurut Razman, SBY juga gagal dalam memanagerial dan berkomuni-

kasi dengan pemerintahan yang dipimpinnya. Artinya, SBY dan menterinya tidak seragam dalam bersikap dan memberikan pernyataan terkait kabut asap yang melanda di dua negara itu. “Jadi sangat tidak pantas seorang presiden menegur 3 menterinya dimuka umum karena menteri-menteri itu berbicara sedikit keras terhadap negara tetangga yang berkomentar soal kabut asap,” tuturnya. Permintaan maaf SBY, lebih baik ditujukan kepada Masyarakat Riau dan sekitarnya yang terkena dampak langsung dari kebakaran hutan tersebut. “SBY seharusnya minta maaf kepada rakyat Indonesia atas ‘dosa-dosanya’ dalam membuat kebijakan yang tidak pro rakyat, seperti kenaikan BBM dan lainnya. Dan saya nilai, seharusnya saat fit and propert tes terhadap menteri kehutanan, menteri itu harus punya data hutan rawan terbakar dan memiliki kemampuan dalam pencegahan dini kebakaran hutan di Riau ini, sehingga dari tahun ke tahun masalah ini tidak berlarut-larut,” sebut Razman sembari menduga saat fit dan proper tes, SBY

hanya memilih orang yang patuh kepadanya atau berdasarkan like and dislike. Bahkan, Razman menduga permintaan maaf itu membuktikan bahwa SBY tidak percaya diri dalam memimpin bangsa ini. “Semakin kuat dugaan SBY itu selalu mengejar penghargaan luar negeri daripada dalam negeri, padahal yang memilih dia rakyat Indonesia. Dan, agar negara luar negeri sana menilai SBY baik, padahal di dalam negeri keropos. Mungkin permintaan maaf ini juga karena dia ingin membangun image positif di mata dunia karena dugaan saya target dia adalah jadi Sekjen PBB. Jangan bermimpilah untuk jadi Sekjen PBB,” tuturnya. Razman juga menilai SBY merupakan presiden yang paling gagal memimpin Indonesia ini, sebab dalam membangun Indonesia kurang melibatkan tokoh-tokoh dan elit bangsa ini. “Dan seharusnya, dalam mengambil keputusan soal permintaan maaf itu, harus melibatkan parlemen karena berhubungan dengan eksternal dan internal. Inikan dia mengambil keputusan sendiri,” katanya. Dia meminta SBY untuk berdoa, agar diakhir kepemimpinannya tidak diadili oleh rakyat. “Dan saya juga berharap, presiden 2014 terpilih harus mengusut tuntas penyalahgunaan kekuasaan SBY, maraknya kasus korupsi dari partai yang dia pimpin dan lainnya. Mudah-mudahan, SBY tidak minta suaka ke negara lain jika tidak lagi memimpin negara ini,” ujar Razman. (cwan)

MEDAN (Waspada): Gerakan Muda (GM) Angkatan 66 Sumut mengadakan silaturahmi senior dan junior, di Hotel Madani Jln. Sisingamangaraja Medan. “Acara ini diadakan anakanak dan sekaligus menyambut HUT ke III GM Angkatan 66,” kata Ketua Umum Gerakan Muda (GM) Angkatan 66 Sumut HM Efdi Boy SH, kepada Waspada di Medan, Sabtu (29/6) sore. Efdi Boy didampingi Sekretaris Umum Farianda Putra Sinik SH, dan Humas Nasrun Hartanto SH mengatakan, Pjs Wali Kota Medan Dzulmi Eldin yang juga Penasehat GM Angkatan 66 Sumut dalam sambutannya mengutarakan jasa-jasa tokoh GM Angkatan 66 di antaranya HMY Efendy Nasution (alm), Bambang Irsad (alm), Jansen Hasibuan (alm), Saat Gurning (alm). Sedangkan yang masih hidup antara lain Yan Faruhum Lubis yang disapa Ucok Majestik, Yopi Batubara, H Marzuki, DR H Ibrahim Sinik, Riswan Harahap, Drs H Amran YS. Kata Efdi Boy, GM Angkatan 66 Sumut juga melakukan berbagai kegiatan secara rutin seperti dalam menyambut bulan suci Rahmadan melakukan

Waspada/ist

KETUA Umum GM Angkatan 66 Sumut HM Efdi Boy, SH foto bersama Dzulmi Eldin. ziarah dan memberikan bantuan kepada panti asuhan. Menurut dia, GM Angkatan 66 Sumut terus melakukan hubungan dengan tokoh-tokoh

nasional Angkatan 66. Kali ini acara HUT III GM Angakatan 66 Sumut dengan tema “Mempererat Hubungan Silaturahmi Senior dan Junior.” (m36)

PLN Medan Johor Percontohan Zona Integritas Tanpa Suap MEDAN (Waspada): PLN Rayon Medan Johor terpilih sebagai percontohan zona integritas pelayanan PLN bersih. “Ini merupakan momentum bagi PLN Rayon Medan Johor dan umumnya PLN Area Medan serta PLN Kantor Wilayah Sumut,” kata Manager PT (Persero) PLN Area Medan Abdul Harris Nasution pada peresmian PLN Rayon Medan Johor sebagai percontohan zona integritas PLN bersih di kantor Rayon Medan Johor Jln. Karya Wisata, Jumat (28/6). Dia mengatakan, penunjukan zona integritas itu sesuai surat keputusan GM PT PLN (Persero) Wilayah Sumut No. 030/ 2013. Terpilihnya Rayon Johor, bukan berarti suatu kesenangan, tetapi merupakan beban dalam memberikan pelayanan terbaik kepada pelanggan. “Kenapa saya katakan beban, karena kita dituntut bersih, no suap dan no gratifikasi, jadi jangan hanya slogan saja,” sebutnya. Harris menyebutkan, terpilihnya Rayon Johor sebagai zona integritas tidak terlepas dari kerja keras serta keseriusan seluruh karyawannya dan kon-

tribusi dari manager rayon sebelumnya (Kishartanto), sehingga Rayon Johor yang merupakan rayon termuda dari 9 Rayon PLN di Area Medan ditetapkan sebagai rayon percontohan zona integritas. Program PLN bersih no suap, merupakan program dicanangkan Dirut PLN Nur Pamudji dan sebagai pilot project 10 kantor distribusi/wilayah seIndonesia, dimana Rayon Johor lah yang mewakili PLN Wilayah Sumut. “Karena itu kita patut bangga, namun harus tetap bekerja keras agar predikat PLN bersih dapat ditingkatkan. Kepada seluruh pihak agar mendukung program ini,” tutur Harris. Acara itu ditandai penguntingan pita oleh Manager PLN Rayon Area Medan, penandatanganan pakta integritas pelayanan, sekaligus pembacaan komitmen pelayanan PLN bersih, serta dirangkai pemberian santunan kepada anak yatim piatu yang ada disekitar kantor PLN Rayon Johor. Selain menjadi zona integritas, Johor merupakan rayon pertama melakukan pelayanan

tanpa tatap di Sumut, dimana pelanggan dapat dilayani tanpa harus bertatap muka dengan petugas, cukup melalui telepon. “Model ini akan kita kembangkan di seluruh rayon di Area Medan,” ujarnya. Sementara Manager PLN Rayon Medan Johor Evan Suseno Sirait mengatakan, secara umum PT PLN (Persero) sudah memiliki komitmen serius melayani masyarakat dengan menjalankan program pelayanan PLN bersih no suap, no korupsi dan no gratifikasi, dan dalam hal ini penetapan PLN Johor sebagai zona integritas pelayanan menjadi bukti keseriusan program tersebut. Hadir dalam acara itu, Asisten Manajer Pelayanan dan Administrasi Area Medan Lelan Hasibuan, Manager PLN Rayon Medan Kota Zainuddin, Rayon Medan Selatan Supriono, Rayon Medan Baru Irianto, Rayon Medan Timur Jhon Simbolon, Rayon Medan Sunggal Arli Wijaya dan Rayon Medan Labuhan H Bejo, juga Kapolsek Delitua Kompol Baktiar Marpaung dan Danramil 08/Medan Johor Kapten Azwar.(m27)

Waspada/Ist

MANAGER PLN Area Medan Harris Nasution didampingi Manager PLN Rayon Medan Johor Evan Suseno Sirait (kiri) memotong pita tanda diresmikannya kantor PLN Rayon Medan Johor sebagai percontohan zona integritas PLN bersih, disaksikan Kapolsek Delitua Kompol Baktiar Marpaung dan Danramil 08/Medan Johor Kapten Azwar.

Ahli Manajemen Rumah Sakit Asal Belanda Beri Kuliah Umum Di Universitas Sari Mutiara MEDAN (Waspada): Ahli manajemen rumah sakit asal Belanda, dr. Titus Vissers, Med. Spec, N.P, MPH memberikan kuliahumumdiUniversitasSariMutiara (USM) Indonesia Jln. Kapten Muslim Medan, Kamis (27/6). Lulusan Public Health Faculty Harvard University, Amerika Serikat ini, menyampaikan materi tentang “Manajemen rumahsakitbagiperawatdanbidan”. Menurut Titus, ada tiga hal yang dapat dilakukan dalam manajemen di rumah sakit. Pertama, Strategy : yang dapat dibuat dalam perencanaan jangka panjang (3-5 tahun) Kedua, Tactical : perencanaan tahunan yang dapat mengukur apakah kita sedang mencapai tujuan atau tidak. Hal ini dapat dibuat berdasarkan kualitas pelayanan, kepuasan pasien serta catatan pendapatan dan pengeluaran. Ketiga, Operational : bagaimana kualifikasi dan jumlah tenaga kerja yang diperlukan untuk mencapai tujuan. Titus juga memaparkan tentang cara memenej tenaga kesehatan di rumah sakit. Dalam hal ini, perawat dan bidan yang bekerja di rumah sakit harus mampu menunjukkan bahwa mereka telah memiliki kompetensi

untuk bekerja sebagai tenaga kesehatan. Kemudian, perawat dan bidan harus mampu bekerja berdasarkan pertimbanganpertimbangan dasar profesinya seperti: a. Melakukan asuhan pasien dengan menjaga kebersihan. Misalnya, cuci tangan sebelum dan sesudah merawat pasien sehingga mencegah penularan infeksi. b. Bekerja berdasarkan prosedur tetap yang berlaku untuk setiap tindakan. c. Mampu menunjukkan pengetahuan tentang penyakit. d. Mampu bekerja secara kooperatif bersama tenaga kesehatan lain. Perawat harus mampu bekerjasama dan melakukan proses asuhan Learn by Doing. Artinya, jika ada kesalahan-kesalahan yang dilakukan perawat, maka perawat tersebut harus mengakuinya dan melakukan diskusi baik dengan perawat senior maupun dokter spesialis sehingga dapat menghindari terulangnya kesalahan yang sama. Selain itu, Titus menambahkan bahwa Pelayanan yang diberikan tenaga kesehatan kepada pasien merupakan Kartu Bisnis (Business Card) untuk sebuah rumah sakit).

Sementara itu, Rektor USM Indonesia DR. Dra. Ivan Elisabet Purba, MKes mengatakan, Universitas Sari Mutiara memiliki visi yaitu Menjadi perguruan tinggi yang unggul dan kompeten dalam menghasilkan lulusan berkualitas dan profesional, serta Iptek yang sesuai kebutuhanmasyarakatpadaTahun 2020. Karena itu, USM Indonesia selalu mendatangkan para ahli di bidangnya baik dari dalam dan luar negeri agar melakukan transfer ilmu pengetahuan sehingga menambah wawasan para mahasiswa. Kali ini, USM Indonesia menghadirkan ahli manajemen rumah sakit dari Belanda dr.TitusVissers, Med.Spec, N.P MPH guna memberikan kuliah umum kepada mahasiswa kesehatan. Dengan adanya kegiatan ini diharapkan para tenaga kesehatan yang didik di Universitas Sari Mutiara Indonesia dapat menjadi manajer yang handal berkualitas dan profesional. “Kami berkomitmen kegiatan seperti akan selalu dilakukan bukan hanya untuk program studi kesehatan saja tetapi untuk program studi lainnya,” tegas Ivan. Sebagaimana diketahui,

Universitas Sari Mutiara Indonesia memiliki tujuh fakultas terdiri dari Fakultas Ilmu Kesehatan dengan program studi Kesehatan Masyarakat (S1), Keperawatan (S1), Ners (Profesi), Keperawatan (D3), Kebidanan (D3), Analis Kesehatan (D3) dan Teknik Elektro Medik (D3). Fakultas Matematika dan IPA dengan program studi Kimia (S1), Farmasi (S1) serta Analisa Farmasi dan Makanan (D3). Fakultas Ilmu Komputer dengan program studi Sistem Informasi (S1). Fakultas Psikologi dengan program studi Psikologi (S1). Fakultas Ekonomi dengan program studi Akuntansi (S1) dan Manajemen (S1). Kemudian, Fakultas Ilmu Komunikasi dan Perpustakaan dengan program studi Ilmu Komunikasi (S1) dan Ilmu Perpustakaan (S1). Fakultas Hukum dengan program studi Ilmu Hukum (S1). USM Indonesia juga memiliki Program Pasca Sarjana dengan program studi Kesehatan Masyarakat (S2). Kini, Universitas Sari Mutiara Indonesia terus berbenah dengan melengkapi berbagai fasilitas, sarana dan prasarana kampus sebagai penunjang segala aktivitas para mahasiswa.(m25)

Waspada/ist

AHLI manajemen rumah sakit asal Belanda, dr. Titus Vissers, Med. Spec, N.P, MPH (kiri) didampingi Rektor USM Indonesia DR. Dra. Ivan Elisabeth Purba, MKes (dua dari kiri) saat mendengarkan pertanyaan yang disampaikan mahasiswa di Kampus USM Indonesia Jln. Kapten Muslim Medan, Kamis (27/6).


Medan Metropolitan

WASPADA Senin 1 Juli 2013

A5

Tempat Hiburan Malam XXX Tidak Tersentuh Razia BNN MEDAN (Waspada): Razia penyalahgunaan narkoba yang digelar Badan Narkotika Nasional (BNN) Provinsi Sumut, Jumat (28/6) malam, ternyata tidak menyentuh tempat hiburan malam XXX di gedung Yanglim Plaza Jln. Emas Medan. Razia yang terkesan pilih kasih ini, sangat disesalkan masyarakat. “Ada kesan razia ini cuma sebatas pencitraan agar masyarakat menilai BNN Provinsi Sumut sudah bekerja memberantas penyalahgunaan narkoba,” ujar seorang warga kepada Waspada di Medan, Minggu (30/7). Seharusnya, lanjut warga tersebut, petugas BNN Provinsi Sumut melakukan silent opera-

tion (operasi tersembunyi) sehingga bisa lebih maksimal mengungkap kasus penyalahgunaan narkoba yang diduga marak di tempat hiburan malam XXX. Informasi razia yang bocor bukan jadi alasan pembenaran untuk tidak merazia tempat hiburan malam XXX. Aroma tebang pilih dalam razia yang digelar BNN Provinsi Sumut ini memang sangat terasa. Sebab, BNN Provinsi Sumut hanya melakukan razia di tempat hiburan malam yang lokasinya berada di tempat terbuka/ pinggir jalan. Sedangkan tempat hiburan yang berlokasi di lantai atas gedung bertingkat, luput dari razia. Pantauan Waspada di lapangan, Jumat (28/6) malam, petugas BNN Provinsi Sumut hanya melakukan razia terha-

dap tempat hiburan malam Station yang berlokasi di pinggir Jln. Kolonel Sugiono/Jln. Wajir Medan. Petugas BNN Provinsi Sumut langsung memasuki ruangan karaoke secara door to door dengan membawa peralatan tes urine. Dalam razia itu, petugas sejumlah pengunjung yang dinyatakan positif menggunakan narkoba setelah menjalani tes urine. Kabag Humas BNN Provinsi

Sumut Heru Herlambang mengatakan, pihaknya memang berencana melakukan razia terhadap tempat hiburan malam XXX. Namun karena informasi razia tersebut sudah bocor, maka petugas mengalihkan razia ke tempat hiburan Station. Razia itu dipimpin Kabid Pemberantasan BNN Provinsi Sumut AKBP H. Joko Susilo, SH dibantu Kasi Idik Kompol Sanggam Nainggolan, SH; Kasi Intelijen AKP Tohap Siregar, SH de-

ngan melibatkan 18 personel dari Provost, Sabhara dan Sat Reserse Narkoba Polresta Medan. Sementara itu, Kabid Pemberantasan BNN Provinsi Sumut AKBP H. Joko Susilo, SH menegaskan, tidak ada istilah tebang pilih dalam melakukan razia tempat hiburan malam. “Razia tempat hiburan malam akan dilakukan secara rutin dengan sasaran narkoba,” demikian Joko. (m36)

Sopir Curi Mobil Mantan Majikan MEDAN (Waspada): Sopir yang mencuri mobil milik mantan majikannya dan penadahnya ditangkap petugas Polsek Delitua, Sabtu (29/6). Tersangka SR, warga Jln. Cengkeh, Perumnas Simalingkar, Kel. Mangga, Medan Tuntungan, mencuri mobil mantan bosnya Mariati Tambunan, 46, warga Jln. Rotan, Desa Simalingkar A, dari didepan Aprtemen Bahagia Ruko Garden Vista Jln. Bungalow, Medan Tuntungan, yang sebelumnya telah menduplikatkan kunci mobil tersebut. Sedangkan barang bukti mobil Avanza Silver BK 1231 QF ditemukan di rumah pena-

dahnya NHD, 26, warga Gang Madrasah, Bandar Baru, Kec. Sibolangit. Kapolsek Delitua Kompol Bahtiar Marpaung SH, SSos, MHum, didampingi Kanit Reskrim Iptu Martualesi Sitepu mengatakan, tersangka SR menjual mobil tersebut dengan harga Rp16 juta kepada tersangka NHD dengan mengganti nomor polisinya untuk menghilangkan jejak. Kritis Ditikam Sementara itu, Juned Ginting, 35, warga Jln. Besar Pasar VIII, Desa Sukarende, Kec. Kutalimbaru, kritis ditikam pencuri tabung gas dan terpaksa menjalani perawatan di RSUP H Adam

Malik Medan, Jumat malam (18/6). Sedangkan pelaku penikaman diperkirakan dua orang melarikaan diri. Menurut informasi, malam itu korban diberitahu tetangganya bahwa ada dua remaja mengendarai sepedamotor mencuri dua tabung gas elpiji isi 3Kg dari teras kedai korban. Korban mengejar pencuri tabung gas itu. Setelah sejauh 4 Km, Juned berhasil mendapatkan kedua pelaku yang terjatuh dari sepedamotornya. Ketika korban mendekati pelaku, seorang di antaranya segera mengambil pisau dari pinggangnya langsung menikam perut korban satu liang. (m40)

Kader PAN Medan Diingatkan Tetap Bersama Masyarakat Waspada/Rudi Arman

KASAT Lantas Polresta Medan Kompol M Budi Hendrawan mendonorkan darahnya di Sat Lantas Jln. Adinegoro Medan.

HUT Bhayangkara Ke-67

Sat Lantas Polresta Medan Gelar Donor Darah MEDAN (Waspada): Sedikitnya 300 orang ikut donor darah dalam rangka Hari Ulang Tahun (HUT) Bhayangkara ke-67 yang dilaksanakan jajaran Polresta Medan, di Sat Lantas Jln. Adinegoro Medan, Sabtu (29/6). Setiap pendonor ditargetkan bisa menyumbangkan darahnya masing-masing 250 CC darah. Terlihat seluruh perwira di jajaran Polresta Medan berkontribusi dalam kegiatan itu. Mulai dari para Kapolsek, Kabag hingga Kasat turut mendonorkan darah. Bahkan, Kapolresta Medan AKBP Nico Afinta danWakapolresta Medan AKBP Yusuf Hondawantri Naibaho, tampak berpartisipasi dan berkontribusi dalam kegiatan yang bekerjasama dengan PMI Kota Medan, Dinas Perhubungan Kota Medan, Jasa Raharja, dan Rumah Sakit Pirngadi Medan. Kasat Lantas Polresta Medan Kompol Budi Hendrawan kepada wartawan mengatakan, kegiatan ini sebagai bukti kepedulian Polisi kepada masyarakat. Terlebih khususnya pihak Satuan Lalulintas. “Kegiatan ini bentuk keprihatinan dan bantuan atas tingkat kecelakaan lalulintas yang terbilang cukup tinggi, sehingga dengan darah yang didonorkan itu, dapat memudahkan penanggulangan terhadap korban kecelakaan lalulintas,” katanya. Budi mengatakan, pernah kita mengalami kejadian memprihatinkan, dimana saat itu ada korban kecelakaan. Saat dalam penanggulangan medis, ternyata stok darah sedang habis. Terpaksa saat itu kita mencari orang yang bersedia memberikan darahnya dan kita bayar. “Hal itu menjadi salah satu dasar keprihatinan kita dan dengan kegiatan ini semoga dapat membantu mereka yang membutuhkannya,” ujarnya. Menurutnya, donor darah bukan hanya sebagai bentuk sosial saja. Secara kesehatan, donor darah secara tidak langsung membersihkan darah, sehingga membuat diri semakin sehat dan baik. Kata Budi, kegiatan donor darah tersebut rencananya akan rutin dilaksanakan setiap 6 bulan sekali. (m39)

MEDAN (Waspada): Ketua Dewan Pimpinan Daerah (DPD) Partai Amanat Nasional (PAN) Kota Medan H Ahmad Arief SE, MM, mengingatkan seluruh kadernya untuk tetap bekerja dan bekerja. “Saya mengingatkan seluruh kader PAN Kota Medan untuk terus bekerja, bekerja dan bekerja,” katanya dalam acara memperingati Isra Mikraj dan penyambutan bulan Ramadhan sekaligus penyerahan bingkisan kepada anak-anak kurang mampu, yang dilangsungkan di Hotel Garuda Plaza Jln. Sisingamangaraja Medan, Jumat (28/6) malam. Dihadapan seribuan kader dan undangan yang juga hadir Staf khusus Menteri Koordinator Perekonomian Ir H Abdullah Rasyid ME, Sekda Kota Medan Ir Syaiful Bahri, Asisten Kesejahteraan Masyarakat Erwin Lubis, Ahmad Arief mengingatkan seluruh kadernya untuk bekerja dengan cerdas dan masuk akal saat bersentuhan dengan masyarakat, kemudian berserah diri kepada Allah. “Dalam bekerja juga seluruh kader harus mengedepankan bekerja cerdas dan masuk akan baru kemudian hasilnya kita serahkan kepada Allah,” ujarnya. Arief yang juga Anggota DPRD Medan, mengingatkan seluruh kadernya tidak melakukan cara-cara ilegal dalam kampanye menyongsong 2014. “Dalam kesempatan ini saya juga mengingatkan agar seluruh kader tidak melakukan black campaign, karena perjuangan kita niatkan untuk membesar-

Waspada/Ayu

KETUA DPD PAN Kota Medan Ahmad Arif bersama staf ahli Menko Perekonomian RI H Abdullah Rasyid menyerahkan bantuan seragam sekolah kepada anak dari keluarga kurang mampu. kan partai,” katanya. Menurut dia, menyongsong 2014 ini persaingan akan sangat keras, untuk itu seluruh kader PAN agar tetap bekerja dan berada bersama masyarakat. “2014 yang akan datang merupakan perhelatan akbar politik dimana pesertanya merupakan yang terbaik. Sudah dipastikan, persaingat akan sangat keras. Untuk itulah kader PAN agar tetap bekerja keras dan berada bersama masyarakat,” sebutnya. Tidak lupa dalam kesempatan tersebut, memaknai Isra Mikraj, Ahmad Arief mengajak untuk terus memperbaiki hubungan dengan Alla SWT ‘ Hablum minallah” karena esensi dari Isra Mikraj Nabi adalah sha-

lat yang tentunya merupakan hubungan langsung manusia dengan Tuhannya. Sementara itu, Ir HM Rasyid ME, mengajak seluruh kader PAN solid dan tetap bekerja menyongsong Pemilu 2014. “Sesuai dengan arahan Ketua Umum PAN harus berada di dua digit, untuk itu mari kita sukseskan,” katanya. Sedangkan Sekda Kota Medan Ir Syaiful Bahri mengatakan, keberadaan Partai Amanat Nasional (PAN) Kota Medan telah banyak membantu perkembangan Kota Medan, untuk itu diharapkan kedepan kerjasama antara eksekutif dan PAN yang ada di legislatif tetap terjaga dan solid. (m30)

Kanker Serang Kelompok Usia Muda

Waspada/ist

DARI kiri ke kanan, Regional Operation Manager III PT Fast Food Indonesia Teddy Hariadi, tokoh pemuda kompleks Asia Mega Mas, Gelmok Sidabalok dan investor KFC Asia Mega Mas melakukan pengguntingan pita menandai beroperasinya KFC Asia Mega Mas, Jumat (28/6).

KFC Asia Mega Mas Santuni 50 Anak Yatim MEDAN (Waspada): Kentucky Fried Chicken (KFC) Asia Mega Mas memberikan santunan kepada 50 anak yatim pada acara launching restoran cepat saji tersebut, Jumat (28/6). Regional Officer Marketing (ROM) III PT Fast Food Indonesia Tbk, Charles Marbun mengatakan, kegiatan ini merupakan syukuran pihak KFC atas terlaksananya pembukaan KFC Asia Mega Mas yang merupakan cabang ke-20 di Kota Medan. “Wujud syukur kami atas pembukaan KFC Asia Mega Mas yakni, kami berbagi kepada 50 anak yatim ini,” kata Charles. Menurut Charles, meski kondisi ekonomi saat ini kurang baik, namun tingkat penjualan KFC di Kota Medan tetap stabil. Bahkan untuk cabang-cabang tertentu mengalami trend peningkatan. Salah satunya adalah KFC yang berlokasi di Jln. Gajah Mada Medan. Antusias konsumen terhadap produk-produk KFC masih cukup tinggi. Bahkan untuk memenuhi permintaan konsumen yang tetap tinggi, dalam waktu dekat KFC akan menambah gerai baru di Kota Medan dan Aceh.(m25/rel)

MEDAN (Waspada): Jumlah penderita kanker terus bertambah.Yang paling mengkhawatirkan, penyakit kanker juga menyerang kelompok usia muda. Dulu penyakit ini hanya ditemukan pada kelompok usia 35 tahun ke atas. Kini, banyak penderita kanker berusia di bawah 20 tahun. Demikian dikatakan dr. Kamal Basri Siregar, SpB(K), Onk yang tampil sebagai narasumber pada acara Tausiyah dan Seminar Kanker yang berlangsung di Royal Ballroom Selecta, Sabtu (29/6). Selama ini, kata Basri, pasien memeriksakan diri ke dokter setelah penyakit tersebut sudah memasuki stadium lanjut. Padahal penyakit kanker bisa dideteksi sedini mungkin dan ditangani hingga sembuh. Untuk mencegah penyakit ini, masyarakat harus menerapkan pola makan dan gaya hidup yang sehat. Dengan adanya acara ini,

menurut Basri, masyarakat bisa mendapatkan pengetahuan tentang penyakit kanker dari para narasumber. “Kita juga menggabungkan peran ulama melalui tausyiah untuk memberikan pencerahan pada saudara-saudara kita tentang penyakit kanker ini,” tambahnya. Sementara itu, Ustadz Heriansyah dalam tausiyahnya mengatakan, ada kalanya kesulitan itu datang kepada manusia tanpa ada sebabnya dan ini disebut musibah. “Ada juga yang datang karena akibat perbuatan kita. Kalau ini yang terjadi, maka kita harus banyak bersabar. Karena musibah yang kita lewati dengan penyakit itu akan bernilai ibadah. Semua kesulitan yang kita lewati ini, akan berganjal pahala di sisi Allah,” tambahnya. Jika hasil penelitian menyatakan penderita penyakit kanker kemungkinan bertahan lima tahun, namun bila Allah berbuat sesuatu, maka tidak ada yang

tidak mungkin bagi Allah untuk menyembuhkannya. Karena penyakit itu datang dari Allah, maka Allah juga yang akan menyembuhkannya. “Dari sudut pandang agama, bila mengurangi salah satu dari anggota tubuh kita yaitu melakukan intervensi pada diri kita tanpa sebab, maka tindakan itu dosa besar. Tapi bila dalam kondisi untuk mempertahankan jiwa, maka hal itu boleh dilakukan,” ujar Heriansyah. Tausiyah dan seminar kanker ini menghadirkan lima narasumber yakni dr. Deri Edianto, MKed, (OG) ; dr Widi Rahardjo, SpP(K); dr. Deny Rifsal Siregar, SpB(K) Onk dan dr Kamal Basri Siregar, SpB (K) Onk. Acara ini diselenggarakan FUI Sumut dan Perhimpunan Ahli Bedah Onkologi Indonesia serta didukung, Perwanta, muslimat NU, BKMT, Muslimat AlWashliyah, Bulat Sabit Merah Indonesia, Mer C serta ormas Islam lainnya.(h02)

PARA narasumber yang tampil pada acara Tausiyah dan Seminar Kanker .

Waspada/ist

Waspada/Surya Efendi

ULANG TAHUN: Wagubsu Erry Nuradi membagikan nasi tumpeng kepada para relawan di rumah silaturahmi GanTeng Jl. Adam Malik Medan, Minggu (30/6).

Wagubsu Dapat Surprise Dari Pendukung MEDAN (Waspada): Pada hari ulang tahun ke-49, Wakil Gubernur Sumut (Wagubsu) Tengku Erry Nuradi mendapat kejutan dari para relawan pendukungnya. Sekitar 40-an organisasi pendukung Erry membuat acara syukuran pada ulang tahunnya ke-49 di Rumah Silaturrahmi GanTeng, Jln. Adam Malik No. 5, Medan, Minggu (30/6). Sejak pukul 15:00, ratusan pendukung Erry pada Pemilukada Gubernur dan Wakil Gubernur Sumut sudah berkumpul. Satu jam kemudian, Erry yang mengenakan kemeja gelap lengan panjang tiba di lokasi. Sontak semua pendukung bangkit dan bergegas menyalami sekaligus memberikan selamat HUT ke-49 kepada Erry. Selanjutnya Erry ditepungtawari dan dilanjutkan dengan doa bersama serta pemberian santunan kepada anak yatim. “Terima asih kepada masyarakat Sumut yang sudah memberikan amanah kepada kami untuk memimpin Sumut. Alhamdulillah, hari ini juga bertepatan dengan hari jadi saya ke-49,” ujar Tengku Erry saat memberi sambutan. Dia berharap ke depannya, masyarakat ikut

mengawasi dan mendukung pemerintah dalam melaksanakan program pembangunan yang prorakyat. “Mohon doa dan dukungannya karena masih banyak PR yang harus dilakukan. Kami butuh dukungan dari seluruh masyarakat Sumut,” tambahnya. Ketua Konsisten Salahuddin yang mewakili seluruh tim pemenangan Erry mengungkapkan rasa bangganya. Sebab, belum genap berusia 50 tahun, Erry sudah mendapat kepercayaan dari rakyat memimpin Sumut. “Kami akan mengawal sampai lima tahun mendatang,” tegas Salahuddin. Selanjutnya, dia bersama pendukung lainnya menyerahkan foto berukuran besar bergambar Tengku Erry mengenakan baju resmi Wakil Gubernur. “Mohon ini dipajang di ruang kerja ya pak, biar bapak ingat sama kami,” ujar Salahuddin sambil tersenyum. Setelah memberikan sambutan, Erry memotong tumpeng dan membagikannya kepada seluruh pendukung yang hadir. “Mana yang paling muda, saya berikan dulu tumpeng ini untuk yang paling muda,” ujarnya sambil tersenyum.(m46)

Tolak UKT, HMI USU Demo Di Pintu Masuk MEDAN (Waspada): Himpunan Mahasiswa Islam (HMI) Komisariat Fakultas Sosial Politik (Fisip) USU menggelar unjukrasa di Pintu 1 Kampus USU Jln. Dr. Mansyur Medan, Kamis (27/6). Mereka menolak pemberlakuan Uang Kuliah Tunggal (UKT) bagi mahasiswa baru tahun ajaran 2013/2014. “Penerapan sistem UKT tidak sesuai dengan asas pemerataan pendidikan. Kami menolak itu,” teriak Koordinator Aksi, Mukhlis dalam orasinya. Massa HMI membawa spanduk dan membakar ban bekas, sehingga aksi itu mendapat perhatian pengguna jalan dan masyarakat sekitar. Menurut Mukhlis, UKT merupakan kebijakan pusat dan penerapannya diserahkan kepada kampus bersangkutan.“Perberlakuan sistem UKT, sangat memberatkan mahasiswa. Sampai kapan pun kami menentang konsep UKT,” katanya. Dia mengatakan, konsep UKT akan membuat mahasiswa baru terkotak-kotak. Disamping itu, penerapan UKT sarat indikasi komersialisasi pendidikan. Sebab, indikator dipakai menentukan besarnya uang kuliah bagi mahasiswa baru, seperti data pajak kendaraan bermotor, data besaran rekening listrik yang dibayarkan keluarga, dinilai tidak tepat dan rentan dipermainkan untuk menentukan golongan mahasiswa baru. “Kami tidak sependapat mahasiswa baru yang punya satu unit sepedamotor, langsung digolongkan kelompok ekonomi mampu. Ini

belum akurat, bahkan dinilai keliru dan pembodohan, “ tukasnya. Untuk itu, dalam aksi itu, Mukhlis menyampaikan tiga butir pernyataan sikap HMI Komisariat Fisip USU. Pertama, mendesak pemangku kebijakan mencabut sistem UKT di USU. Kemudian, menolak komersialisasi pendidikan dan menolak RUU Kamnas. “Konsep UKT dipastikan mengundang kontroversi tersendiri terkait penerapannya,” jelasnya. Menurut Mukhlis, konsep UKT yang didasarkan dari UU Pendidikan Tinggi No 12/2012 Pasal 88, tidak sesuai dengan tujuan untuk mengurangi biaya pendidikan tinggi bagi mahasiswa. “Subsidi silang menjadi andalan konsep UKT berkeadilan dikhawatirkan akan menimbulkan pengelompokkan di dalam peserta didik. Perbedaan-perbedaan jumlah biaya pendidikan yang dibebankan pada peserta didik akan menimbulkan kecemburuan antar peserta didik,” bebernya. Secara terpisah, Kabag Humas USU Bisru Hafi kepada Waspada mengatakan, sistem UKT akan berlaku bagi mahasiswa yang masuk tahun ajaran 2013/2014. Sedangkan, mahasiswa yang melakukan aksi itu tentu bukan angkatan itu. “Mungkin mereka melakukannya sebagai bentuk solidaritas,” ujarnya. Konsep UKT diberlakukan pemerintah tentu sudah melalui pertimbangan matang dan melalui berbagai kajian mendalam. (m49)


A6

WASPADA Senin, 1 Juli 2013

Waspadai PTS Tanpa Izin MEDAN (Waspada): Dalam penerimaan mahasiswa baru, Tahun Akademik 2013/2014 di lingkungan Perguruan Tinggi Swasta (PTS) Aceh-Sumut, Koordinator Kopertis Wilayah I Prof Dian Armanto MPd MA MSc PhD mengimbau masyarakat agar mewaspadai PTS yang tidak memiliki izin operasional. “Izin operasional yang dikeluarkan Direktorat Jenderal PendidikanTinggi (Dikti) Kemdikbud sangat penting untuk menunjukkan program studi PTS yang berhak menyelenggarakan perkuliahan,” kata Dian di kantor Kopertis, Jl Setia Budi Medan, Sabtu (29/6). Dijelaskan, jika ada PTS yang menyatakan memiliki izin agar dipastikan asli atau palsu. Hal itu, lanjut Dian, bisa diketahui dengan mengakses situs www.kopertis1.org atau www.evaluasi.dikti.go.id. Dian mengakui, imbauan itu disampaikan karena ada PTS yang memiliki izin palsu dan terus melakukan pembohongan publik dengan menggelar proses perkuliahan. Selain itu, perlu juga diperhatikan akreditasi prodi PTS sebagai prodi yang terukur proses perkuliahan, sarana prasarana yang tersedia serta SDM dosen, pegawai plus mahasiswanya. Dengan demikian, PTS berhak mengeluarkan ijazah jika memiliki status akreditasi, baik itu A, B maupun C. Untuk melihat akreditasi prodi PTS, masyarakat dapat membuka situs www.ban-pt.kemdiknas.go.id. Hal penting lainnya adalah adanya Evaluasi Program Studi Berdasarkan Evaluasi Diri (EPSBED) atau Pangkalan Data PerguruanTinggi (PDPT). “PTS yang sah, harus memiliki data mahasiswa dan dosen yang terdaftar di EPSBED/PDPT Dikti dan Kopertis,” sebut Dian lagi. Dijelaskannya, Kopertis adalah lembaga layanan Pengawasan Pengendalian dan Pembinaan (Wasdalbin) PTS yang merupakan perpanjangan tangan Dikti Kemdikbud. “Jadi, sudah semestinya kami beritahukan kepada masyarakat tentang daftar PTS berizin yang ada di Wilayah I Aceh-Sumut dengan harapan tidak dibohongi oleh pihak-pihak tertentu yang mengambil kesempatan dalam kesempitan,” ucapnya. Dian menyebutkan, PTS di Wilayah I terdapat 362 PTS (257 di Sumut dan 105 di Aceh). Karena itu, jika ada salah satu PTS tidak tercantum dalam situs

Kopertis dan Dikti, maka PTS tersebut dinyatakan tidak berizin. Kopertis pun tidak melayani Wasdalbin bagi PTS dengan prodi yang tidak memiliki izin operasional karena bukan wewenangnya. “Hanya masyarakat, aparat kepolisian, LSM, mahasiswa, Pemda/Pemko dapat menindak dan menutup PTS yang prodinya tidak memiliki izin tersebut. Dirjen Dikti ataupun Kopertis tidak dapat menindak karena tidak pernah memberikan izin PTS tersebut untuk menyelenggarakan pembelajaran dan perkuliahan,” ungkapnya. Diingatkan bagi masyarakat yang hendak memasuki PTS, agar memperhatikan izin operasional, data EPSBED/PDPT, dan akreditasi, sebab legalitas prodi di PTS ditentukan ketiga hal tersebut. Menurut Dian, saat ini Kopertis telah mendaftar seluruh PTS yang prodinya memiliki izin operasional. Daftar tersebut disusun berdasarkan data dari www.evaluasi.dikti.go.id dan Laporan EPSBED di Kopertis Wil I Aceh-Sumut. Berdasarkan daftar tersebut, dapat diketahui bahwa untuk Sumatera Utara, misalnya, Universitas Islam Sumatera Utara (UISU) yang terdaftar dan berizin prodinya adalah kampus yang terletak di Jl Karya Bakti No 34 Medan. Dengan mempertimbangkan daftar ini, Surat Direktur Kelembagaan dan Kerjasama Dirjen Dikti No 3226/E2.2/2012 perihal akreditasi UISU, Surat BAN-PT No 929/BAN-PT/LL/2012 tentang legalitas UISU di Medan, dan Surat Koordinator Kopertis I No 057/L1.2.1/PS/2010, maka masyarakat diimbau memilih UISU di Jl Karya Bakti karena terdaftar dan berizin operasional prodinya. “Jika PTS tidak terdaftar dan tidak berizin prodinya, apalagi tidak terakreditasi serta dosen dan mahasiswanya belum terdaftar di EPSBED, maka tidak terdapat legalitas (civil effect) terhadap ijazah yang dikeluarkan,” tegasnya. Imbauan ini disampaikan dengan mempertimbangkan banyaknya arus informasi yang membingungkan dan membodohi masyarakat, termasuk baliho dan pameran pendidikan tentang UISU yang sah. Kopertis berharap dan mengimbau seluruh masyarakat ikut membantu sekaligus memotivasi tercapainya penyatuan UISU secara baik, benar, efektif, dan efisien. “Pihak Kopertis meyakini masyarakat telah lelah menunggu dan berharap adanya penyelesaian UISU. Konflik yang berlangsung 7 tahun, terlalu lama untuk penyelesaian sebuah konflik PTS,” sambung Dian. Terkait itu, Kopertis mengakui pihaknya telah menunggu dua bulan komitmen pimpinan UISU di Jl Sisingamangaraja untuk menyelesaikan masalah tersebut. Disebutkan, konflik tersebut menyebabkan mahasiswa, dosen, pegawai, dan masyarakat menjadi korban. (m33/rel)

Perguruan Tinggi Swasta Sumatera Utara Kdpti

Nama Perguruan Tinggi Swasta

Alamat dan nomor telepon Perguruan Tinggi

Kota

011001 011002 011003 011004 011006 011007 011008 011009 011010 011011 011012 011017 011025 011026 011027 011029 011033 011036 011037 011040 011041 011042 011045 012003 012004 013002 013003 013004 013005 013009 013010 013011 013022 013024 013041 013042 013061 013063 013064 013066 013067 013068 013069 013070 013071 013072 013074 013077 013079 013081 013085 013091 013098 013099 013100 013101 013105 013108 013109 013113 013115 013117 013119 013122 013130 013131 013134 013140 013142 013147 013148 013155 013157 013158 013161 013162 013163 013165 013175 014001 014002 014005 014006 014008 014013 014021 014027 014028 014029 014030 014036 014037 014039 014041 014042 014043 014044 014046 014053 014056 014057 014058 014061 014062 014070 014117 014119 014120 014126 014129 014132 014133 014134 014135 014137 014140 014141 014142 014143 014147 014148 014150 014152 014153 014157 014158 014165 014168 014178 014186 014187 014191 014192 014195 014199 014205 014209 014213 014215 014216 014217 014219 014224 014236 015003 015004 015005 015007 015008 015009 015011 015013 015016 015017

Universitas Islam Sumatera Utara Universitas HKBP Nommensen Universitas Muhammadiyah Sumatera Utara Universitas Pembangunan Panca Budi Universitas Methodist Indonesia Universitas Darma Agung Universitas Medan Area Universitas Katolik Santo Thomas Universitas Amir Hamzah Universitas Sisingamangaraja XII Universitas Dharmawangsa Universitas Alwashliyah Universitas Pembangunan Masyarakat Indonesia Universitas Al-Azhar Universitas Muslim Nusantara Al-Wasliyah Universitas Cut Nyak Dhien Universitas Prima Indonesia Universitas Dian Nusantara Universitas Setia Budi Mandiri Universitas Quality Universitas Sutomo Universitas Pelita Harapan Medan Universitas Sari Mutiara Indonesia Medan InstitutTeknologi Medan Institut Sains Dan TeknologiTD Pardede STKIP Riama Sekolah Tinggi Ilmu Ekonomi Swadaya Medan Sekolah Tinggi Bahasa Asing Swadaya Medan Sekolah Tinggi Ilmu Hukum Swadaya Sekolah Tinggi Ilmu Ekonomi Harapan Sekolah Tinggi Bahasa Asing Harapan SekolahTinggi Teknologi Harapan Sekolah Tinggi Ilmu Ekonomi Nusa Bangsa Sekolah Tinggi Olahraga Dan Kesehatan Bina Guna Sekolah Tinggi Teknologi Immanuel Sekolah Tinggi Ilmu Komunikasi Pembangunan STMIK Budi Darma STMIK Mikroskil Sekolah Tinggi Ilmu Ekonomi Tricom Sekolah Tinggi Ilmu Ekonomi Al-Hikmah Sekolah Tinggi Ilmu Ekonomi Eka Prasetya Sekolah Tinggi Ilmu Ekonomi Graha Kirana Sekolah Tinggi Ilmu Hukum Graha Kirana Sekolah Tinggi Ilmu Hukum Al-Hikmah Sekolah Tinggi Ilmu Ekonomi Indonesia Medan STMIK Sisingamangaraja XII Sekolah Tinggi Ilmu Ekonomi IBBI Sekolah Tinggi Ilmu Ekonomi LM Immanuel Indonesia Sekolah Tinggi Teknik Graha Kirana Sekolah Tinggi Ilmu Ekonomi Riama Sekolah Tinggi Ilmu Manajemen Sukma Sekolah Tinggi Ilmu Ekonomi ITMI Medan Sekolah Tinggi Ilmu Bahasa Asing ITMI Medan STIE IBMI Medan Sekolah Tinggi Kelautan Dan Perikanan Indonesia Sekolah Tinggi Ilmu Kesehatan Helvetia STMIK Time Sekolah Tinggi Ilmu Kesehatan Sumatera Utara STMIK Logika Sekolah Tinggi Teknik Poliprofesi STMIK IBBI STMIK Potensi Utama Sekolah Tinggi Teknologi Sinar Husni Sekolah Tinggi Ilmu Kesehatan Binalita Sudama STMIK ITMI Medan STIPER Agrobisnis Perkebunan STIE Akuntansi Dan Bisnis Internasional STIKES Santa Elisabeth Medan STIE Informasi Teknologi Dan Bisnis STMIK Pelita Nusantara Medan Sekolah Tinggi Ilmu Komputer Medan STMIK Kristen Neumann Indonesia STMIK Triguna Dharma STBA Persahabatan Internasional Asia Sekolah Tinggi Ilmu Kesehatan RS Haji Medan Sekolah Tinggi Ilmu Kesehatan Flora STIE Professional Manajemen College Indonesia STIE Mikroskill STIKES Widya Husada Medan Akademi Perniagaan dan Perusahaan APIPSU Medan Akademi Keuangan Perbankan Swadaya Medan Akademi Maritim Indonesia Medan Akademi Akuntansi YPK Medan Akademi Pariwisata Dan Perhotelan Darma Agung Akademi Teknik Indonesia Cut Meutia Akademi Teknologi Lorena Akademi Sekretari Manajemen Cendana Akademi Sekretari Manajemen Lancang Kuning Akademi Pariwisata Taman Harapan Akademi Teknik Industri Immanuel AMIK Medan Business Polyteknik Akademi Manajemen Informatika Dan Komputer Itmi Akademi Pariwisata Nusantara Medan Akademi Farmasi Indah Deli Serdang Akademi Kebidanan Nusantara 2000 Akademi Manajemen Informatika & Komputer Universal AMIK Widya Loka Medan Akademi Manajemen Informatika Dan Komputer Logika Akademi Kebidanan Helvetia Medan Akademi Kebidanan Imelda Akademi Kebidanan Bakti Inang Persada AMIK Polibisnis Medan AMIK Stiekom Sumatera Utara Akademi Kebidanan Darmo Medan Akademi Kebidanan Sehat Medan Akademi Manajemen Informatika Dan Komputer Medan Akademi Keperawatan Indah Akademi Kebidanan Indah Akademi Informatika Dan Komputer Medicom Akademi Kebidanan Senior Akademi Kesehatan Lingkungan Binalita Sudama Akademi Refraksi Optisi Binalita Sudama Akademi Keperawatan Binalita Sudama Akademi Teknik Elektro Medik Binalita Sudama Akademi Kebidanan Dewi Maya Akademi Pariwisata Medan Hotel School Akademi Kebidanan Hasarma Medan Akademi Keperawatan Helvetia Medan Akademi Kebidanan Cipto Medan Akademi Keperawatan Darmo Medan Akademi Keperawatan Imelda Medan Akademi Kebidanan YYS Pendidikan Dr Rusdi Medan Akademi Kebidanan Mitra Husada Medan Akademi Kebidanan Hafsyah Medan Akademi Kebidanan Budi Mulia Medan Akademi Kebidanan Sehati AMIK Harapan Medan Akademi Keuangan Dan Perbankan ICM Cantrika Mitra Akademi Kebidanan Delima Deli Serdang Akademi Kebidanan Sari Husada Akademi Akuntansi Profesional Indonesia AKPERTenaga Pembangunan Arjuna Laguboti Akademi Kebidanan Palapa Husada Akademi Perekam Medik Dan Infokes Imelda Akademi Keperawatan Columbia Asia Akademi Keperawatan Malahayati Medan Akademi Kebidanan Sifra Husada Akademi Manajemen Informatika dan Komputer Imelda Akademi Kebidanan Audi Husada Medan Akademi Keperawatan RSU Herna Akademi Fisioterapi Siti Hajar Akademi Kebidanan Bina Sejahtera Ameta Akademi Keperawatan Kesdam I/Bukit Barisan Medan Akademi Keperawatan Wirahusada Medan Politeknik Unggul LP3M Politeknik Ganesha Nusantara Politeknik Mandiri Bina Prestasi Politeknik Profesional Mandiri Politeknik Poliprofesi Medan Politeknik LP3I Medan Politeknik Santo Thomas Politeknik Yanada Politeknik Kesehatan YRSU Dr Rusdi Politeknik IT&B Medan

Jl. Karya Bakti No. 34 Medan Telp. 061-7866932 Jl. SUTOMO NO. 4 A SUMATERA UTARATelp. 061-4522922 Jl. KAPT MUKHTAR BASRI BA No.3 GLUGUR DARAT II Telp. 061-6619056 Jl. JEND GATOT SUBROTO KM 4,5 Telp. 061-8455571 Jl. HANGTUAH No. 8 MEDAN Telp. 061-4536735 Jl. DR.TD PARDEDE No. 21 MEDANTelp. 061-4535432/061-4535432 Jl. Kolam No. 1 Medan Estate Telp. 061-8201994 Jl. SETIA BUDI No. 479 F TANJUNG SARI Telp. 061-8210161 Jl. PANCING PSR V BARAT MEDAN ESTATETelp. 061-6614160 Jl. PERINTIS KEMERDEKAAN NO.9Telp. 061-4146659 Jl. KL YOS SUDARSO NO. 224 Telp. 061-6613783 Jl. SISINGAMANGARAJA KM 5,5 MEDAN Telp. 061-7842301 Jl. TELADAN No. 15 MEDANTelp. 061-7362927 Jl. PINTU AIR IV Telp. 061-8361811 Jl. GARU II No. 2 dan No. 93 Telp. 061-7867044/061-7868487 Jl. JAMBI No. 59 Telp. 061-4551815 Jl. BELANGA No. 1 MEDAN Telp. 061-4532820 Jl. Bromo No 35 Medan Telp. 061-736831 Jl. Jend AH NasutionTelp. 061-8364427 Jl. Nibung II No. 128 Telp. 061-4578388 Jl. Sutomo Ujung 28 DTelp. 061-699888000 Jl. Mestika No. 37 Medan Telp. 081311220483 Jl. Kapten Muslim No. 79 Telp. 061-8476769 Jl. GEDUNG ARCA No. 52Telp. 061-7363771 Jl. DR. TD PARDEDE No. 8 Telp. 061-4569877 Jl.TRITURA NO 6 MARENDAL MEDAN Telp. 061-7862285/061-7862286 Jl. RAYA MEDANTENGGARATelp. 061-7343075 Jl. RAYA MEDAN TENGGARA No. 175 ATelp. 061-7343072/061-7343075 Jl. RAYA MEDAN TENGGARA No.175 A MEDAN Telp. 061-7343075 Jl. IMAM BONJOL No. 35 Telp. 061-4514560 Jl. IMAM BONJOL No. 35 Telp. 061-4514435 Jl. IMAM BONJOL No.35 MEDAN Telp. 061-4515661 Jl. SEI SERAYU No. 80 Telp. 061-4157032 Jl. ALUMINIUM No. 77TANJUNG MULIATelp. 061-6615718 Jl. GATOT SUBROTO No. 325 Telp. 061-4569548/061-4573158 Jl. SISINGAMANGARAJA No. 84Telp. 061-7361898 Jl. Sisingamangaraja No. 338 I Telp. 061-7875998 Jl. THAMRIN 124/140 Telp. 061-4573767 Jl. BRIGJEN KATAMSO No. 32 I-J (SIMPANG Jl. MANTRI)Telp. 061-4159767 Jl. MESJID No. 1 MEDAN ESTATETelp. 061-7355561 Jl. Perdana No. 81Telp. 061-4151391 Jl. KIRANA RAYA No. 20-22 Telp. 061-4521924 Jl. KIRANA No. 20-22 Telp. 061-4521924 Jl. MESJID No. 1 MEDAN ESTATETelp. 061-7355561 Jl. PERBAUNGAN No. 2 Telp. 061-7321152/7321118 Jl. URIP No. 9 Telp. 061-4566622 Jl. SEI DELI No.18 Telp. 061-4567111 Jl. MT HARYONO A1 Telp. 061-4532311 Jl. KIRANA RAYA No 20-22 Telp. 061-4521924 Jl. TRITURA No.6 MEDANTelp. 061-7862285/061-7862286 Jl. SISINGAMANGARAJA No. 92 A Telp. 061-7325418 Jl. TIMAH PUTIH BLOK G 15-17 KOMPLEKS ASIA MEGA MAS Telp. 061-7356888 Jl. TIMAH PUTIH BLOK G 16-17 KOMPLEKS ASIA MEGA MAS Telp. 061-7356888 Jl. PERNIAGAAN BARUTelp. 061-4523425 Jl. Tirta Deli No. I Telp. Jl. KAPTEN SUMARSONO No. 107Telp. 061-8451021 Jl. MERBABU No. 32 AA/BB Telp. 061-4561932 Jl. JAMIN GINTING KEC. MEDANTUNTUNGAN MEDANTelp. 061-77808399 Jl. KL YOS SUDARSO No. 374 C Telp. 061-6632858 Jl. SEI BATANG HARI No. 3-4Telp. 061-8446729/061-8446701 Jl. SEI DELI No. 18 Telp. 061-4567111 Jl. KL YOS SUDARSO No. 76 G Telp. 061-6620049 Jl. VETERAN Gg UTAMA PASAR V KECAMATAN HELVETIATelp. 061-8463690 Jl. GEDUNG PBSI/Jl. PANCINGTelp. 061-620661/061-620662 Jl. ASIA RAYA BLOK F 10 -15 KOMPLEKS ASIA MEGA MAS Telp. 061-7356888 Jl. WILLEM ISKANDAR SAMPALI MEDAN ESTATE PO BOX 1329Telp. 061-6613364/061-6637060 Jl. Kl Yos Sudarso No. 3A Km 6 Telp. 061-6640525 Jl. BUNGATEROMPET 118 KEL. SEMPAKATATelp. 061-8214020 Jl. MAHONI No.16 Telp. 061-4530505/061-77839687 Jl. Iskandar Muda Telp. Jl. Iskandar Muda No. 43 Telp. 061-4510020 Jl. JAMIN GINTING KM 10.5 Telp. 061-8369305 Jl. Pintu Air I No. 73 Telp. 061-8224051 Jl. KL Yos Sudarso Lk XI No. 17 Telp. 061-6616247 Jl. Rumah Sakit Haji Medan Est Telp. 061-6637572 Jl. Rajawali No. 24 Medan Telp. 061-8454408/8454407 Jl. H Misbah Komp Multatuli Ind Telp. 061-4578818 Jl. Thamrin 124/140 Telp. 061-4573767 Jl. Williem Iskandar Telp. 061-6621202 Jl. JAMBI No. 59 Telp. 061-4551815 Jl. RAYA MEDANTENGGARA No. 175 A PASAR MERAH Telp. 061-7343072/061-7343075 Jl. BRIGJEN BEJO D/H PERTEMPURAN No. 125 MEDANTelp. 061-6615034 Jl. SAKTI LUBIS Gg PEGAWAI No. 8 SIMPANG LIMUNTelp. 061-7863988 Jl. DR. TD PARDEDE No. 21 Telp. 061-4529514 Jl. Veteran No. 17 A-B-C Jl. GATOT SUBROTO No. 325 MEDANTelp. 061-4573158 PUSAT NIAGA ASIA MEGA MAS BLOK L No. 6-7-8 Telp. 061-7357773 Jl. KPT. MUSLIM KOMPLEKS GRIYA Telp. 061-8464919 Jl. GAJAH MADA No.31 Telp. 061-4519057 Jl. GATOT SUBROTO No. 325 MEDAN-SUMUTTelp. 061-4569548 Jl. JAMIN GINTING NO. 285-287 PADANG BULANTelp. 061-8216244 Jl. TIMAH PUTIH BLOK G 15-17 KOMPLEKS ASIA MEGA MAS Telp. 061-7356888 Jl. T CIK DITIRO No. 11O MEDAN-Sumut Telp. 061-4555367 Jl. JAYA II No. 24 Telp. 061-7869045 Jl. PANGLIMA DENAI No.28Telp. 061-77274402 Jl. SETIA BUDI No. 90 K-LTANJUNG SARI Telp. 061-8222972 Komp MMTC Blok B No 29-32 Jl.P Telp. 061-6640800 Jl. KL YOS SUDARSO No. 374-C Telp. 061-6632858 Jl. KAPTEN SUMARSONO No. 107Telp. 061-8451021 Jl. BILAL No. 24 Telp. 061-6610072 Jl.TB SIMATUPANG No. 31 KAMPUNG LALANG PINANG BARISTelp. 061-8444614/061-8444615 JL. LETJEN DJAMIN GINTING No. 296 - 298Telp. 061-8220631 Jl. AKSARA No. 132-133 Telp. 061-7322705 Jl. TALI AIR No. 23 MEDAN KEL MANGGA Telp. 061-8360589 Jl. BRIGJEN H. A. MANAP LUBIS GAPERTA UJUNGTelp. 08126335972 Jl. GAJAH MADA No. 31 Telp. 061-4573314 Jl. JAYA II No.24 Telp. 061-7869045 Jl. JAYA No.24 SIMPANG LIMUNTelp. 061-7869045 Jl. BANTAM No. 12 Telp. 061-4578074 Jl. BAHAGIA Gg. PELITA No. 32 PADANG BULAN MEDANTelp. 061-77819854 Jl. Gedung PBSI Psr V No. 1 Telp. Jl. GEDUNG PBSI PSR V MEDAN ESTATETelp. 061-6615628 Jl. GEDUNG PBSI/Jl. PANCING PS V MEDAN ESTATETelp. 061-6620661 Jl. GEDUNG PBSI PSR V MEDAN ESTATETelp. 061-6625953 Jl. Ring Road No. 100 Telp. 061-8219500 Jl. DWIKORA No. 17TANJUNG REJO MEDAN SUNGGALTelp. 061-8214345 Jl. GATOT SUBROTO No. 108/128 Telp. 061-8456318 Jl. SEI MENCIRIM Gg. PELITA MEDAN KRIO Telp. 061-8451021 Jl. PERJUANGAN No. 159Telp. 061-6640249 Jl. TALI AIR No. 23 Telp. 061-8360589 Jl. BILAL No. 24 P BRAYAN DARAT KEC MEDAN TIMUR Telp. 061-6631380 Jl. H. SUTAN OLOAN No. 1 KOMP PONDOK SURYA Telp. 061-8474290 Jl. LUKU III No. 33 SIMP KWALA KEL. KWALA BEKALA KEC. Medan JohorTelp. 061-77419099 Jl. LETDA SUJONO Gg. SENTOSA N0 241 F BANDAR SELAMAT Telp. 061-77509333 Jl. SEI SERAYU No. 80 Telp. 061-77075921 Jl. PEMBANGUNAN No. 39 HELVETIATelp. 061-77816129 Jl. HM JONI No. 70 Telp. 061-7368470/061-7349455 Jl. DIPONEGORO No. 18 WISMA BIITelp. 061-4532782 Jl. MEDAN BATANG KUISTelp. 061-7385863 Jl. Guru Sinumba No. 04 Karya Telp. 061-845656 Jl. GAJAH MADA No. 31 Telp. 061-4578818 PINTUBOSI LAGUBOTITOBASA SUMATERA UTARATelp. 06327000420 Jl. Bunga Lau No. 9 MedanTuntunganTelp. 061-75239915 Jl. Bilal No. 24 Telp. 061-6610072 Jl. HA MANAF LUBIS No. 58 GAPERTA UJUNGTelp. 061-8461422 Jl. Cendrawasih No. 161 Sei Sik Telp. 061-8452445 Jl. Kanal No. 10 Marindal Telp. 061-76392391 Jl. Bilal No. 24 Telp. 061-6610072 Jl. Bunga Ncole No. 3 Telp. 061-7340503 Jl. Dr. TD Pardede/Bantam No 21 Telp. 061-451844 Jl. Letjend Jamin Ginting No. Telp. 061-8223030 Jl. Simpang Kantor 6 Medan Labu Telp. 061-6851396 Jl. Putri Hijau No. 17 Telp. 061-4550069 Jl. Bunga Ncole No. 100 Telp. 0618366731 Jl. SYAILENDRA/TD PARDEDE No. 21 JKLM Telp. 061-4530701/061-4530702 Jl. Veteran No. 40-41Telp. 061-7760123 Jl. JAMIN GINTING No. 267-271 PADANG BULAN MEDANTelp. 061-8218605 Jl. Setia Budi No. 75 Helvetia 061-8455417 Jl. SEI BATANGHARI No. 3-4Telp. 061-8446729/061-8446701 Jl. SISINGAMANGARAJA No. 24/275 SIMPANG LIMUN MEDANTelp. 061-7867311 FAX. 7874466 Jl. MATAHARI RAYA No. 84-A MEDAN HELVETIATelp. 061-8450764 Jl. Gajah Mada No. 31 Telp. 061-4519057 Jl. H. Adam Malik No. 140-142 Telp. 061-6614941 Jl. Mahoni No. 16 Telp. 061-4530505

Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan

011005 011044 013001 013047 013051 013088 013090 014010 014040 014060 014067 014068 014123 014127 014220 014222 015021

Universitas Simalungun Universias Efarina Sekolah Tinggi Hukum YNI Sekolah Tinggi Ilmu Ekonomi Mars Sekolah Tinggi Ilmu Ekonomi Surya Nusantara SekolahTinggi Ilmu Ekonomi Sultan Agung Sekolah Tinggi Filsafat Theologi S Nusantara Akademi Sekretari Manajemen Maria Goreti AMIK Parbina Nusantara Akademi Kebidanan Hendersen Akademi Keperawatan Surya Nusantara Akademi Manajemen Informatika & Komputer Multicom AMIK Tunas Bangsa Akademi Kebidanan Agatha Akademi Keperawatan Abdi Florensia Akademi Keperawatan Kesdam I/BB Pematangsiantar Politeknik Bisnis Indonesia

Jl. SISINGAMANGARAJA BARAT Telp. 0622-24670 Jl. Sutomo Kompleks Ruko Griya Pematang Raya Kab.Simalungun Telp. 0622-331578 Jl. MERDEKA No. 209 Telp. 0622-431373 Jl. AHMAD YANI No. 400 Telp. 0622-21104 Jl. MEDAN KM 5 Telp. 0622-23478/0622-431216 Jl. SURABAYA No. 19 Telp. 0622-25932/0622-25944 Jl. MEDAN KM. 5 Telp. 0622-431216/0622-23478 Jl. BAHAGIA No. 1Telp. 0622 -27165 Jl. LINGGA No. 32 PEMATANGSIANTARTelp. 0622-431979 Jl. MEDAN-PEMATANGSIANTAR KM 8,5 No. 72Telp. 0622-7436144 Jl. RAKUTTA SEMBIRING PEMATANGSIANTARTelp. 0622-23478/0622-431218 Jl. ASAHAN KOMP. MEGALAND BLOK A Jl. HOS COKROAMINOTO No. 149-154Telp. 0622-7553367 Jl. JEND SUDIRMAN BLOK A No. 2/3 Telp. 0622-22431 Jl. PDT J WISMAR SARAGIH Telp. 0622-7077543 Jl. PDT J Wismar Saragih Telp. 0622-25330 Jl. Gunung Simanuk-manuk No. 6 Telp. 0622-25696 Jl. Sriwijaya No. 9 C-E Telp. 0622-420466

Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar Pematangsiantar

013027 013028 013029 013046 013118 014054 014181 014204 014207 014223

Sekolah Tinggi Ilmu Ekonomi Pelita Bangsa STKIP Pelita Bangsa STKIP Budi Daya Sekolah Tinggi Teknik Pelita Bangsa STMIK Kaputama Akademi Kholisatur Rahmi Akademi Kebidanan Eunice Rajawali Binjai Akademi Keperawatan Sehat Binjai Akademi Kebidanan Kharisma Husada Binjai Akademi Keperawatan Kesdam I/Bukit Barisan Binjai

Jl. KEBUN LADA No. 24 DESA KEBUN LADA KEC. BINJAI UTARA Telp. 061-921501 Jl. KEBUN LADA No. 24 DESA KEBUN LADA KEC. BINJAI UTARA Telp. 061-921501 Jl. GAHARU No. 147 JATI MAKMUR KEC. BINJAI UTARA Telp. 061-8823928 Jl. Kebun Lada No 24 Telp. 061-7785481 Jl. VETERAN No. 4 A-9 A KOMPLEKS BINJAI MAS Telp. O61-8875535 Jl. SAMANHUDI PASAR III BINJAI KOTA Telp. 061-8823834 Jl. Danau Poso No. 59 Binjai Telp. 061-77835135 Jl. Samanhudi Psr III Binjai Telp. 061-8823834 Jl. Letjen Jamin Ginting No. Telp. 081370777176 Jl. Bandung No. 4 Telp. 061-8823458

Binjai Binjai Binjai Binjai Binjai Binjai Binjai Binjai Binjai Binjai

013030 013095 013168

Sekolah Tinggi Ilmu Ekonomi Al-Washliyah Sekolah Tinggi Perikanan Sibolga STIKES Nauli Husada

Jl. PADANGSIDIMPUAN KM. 5 SARUDIK Telp. 0631-21757 Jl. KAKAP No.57 SIBOLGA SUMATERA UTARATelp. 0631-7001808 Jl. Jend. Sudirman No. 29 Telp. 0631-25561

Sibolga Sibolga Sibolga

013097 014059 014200 015010 015012

Sekolah Tinggi Ilmu Ekonomi Bina Karya Akademi Kebidanan Bina Husada Tebing Tinggi Akademi Keperawatan Bina Husada Tebing Tinggi Politeknik Tugu ’45 Medan Politeknik Trijaya Krama

JL. BADAK No. 24 TEBINGTINGGITelp. 0621-24775 Jl. PROF. HM YAMIN SH No. 1A Telp. 0621-21449 Jl. Prof. HM Yamin SH No. 1 A Telp. 0621-21449 Jl. Sudirman (SBC) No. 41-42 Kecamatan Rambutan Jl. Sudirman No. 405 TebingtinggiTelp. 0621-21974

TebingTinggi TebingTinggi TebingTinggi TebingTinggi TebingTinggi

011014 011015 013020 013031 013036 013076 013172 014125 014167 014172 014174 014232

Universitas Muhammadiyah Tapanuli Selatan Universitas Graha Nusantara SekolahTinggi Ilmu Hukum Benteng Huraba STKIPTapanuli Selatan Sekolah Tinggi Pertanian Benteng Huraba Sekolah Tinggi Ilmu Ekonomi YP Kampus STIKES Aufa Royhan Akademi Kebidanan Sentral Akademi Kebidanan Matorkis Akademi Kebidanan Mitra Syuhada Padangsidimpuan Akademi Kebidanan Darmais Padangsidimpuan Akademi Keperawatan Syuhada Padangsidimpuan

Jl. ST. MOHD ARIEF No. 32 Telp. 0634-21696 Jl. DR. SUTOMO No. 14 Telp. 0634-25292 Jl. MERDEKA No. 35 Telp. Jl. STN MHD ARIF BTG AYUMI JAE Telp. 0634-7000104/0634-7000105 Jl. MERDEKA No. 35 Telp. Jl. ST SORIPADA MULIA 64 A PADANGSIDMPUAN UTARATelp. 0634-22896/0634-21682 Jl. Batunadua ujung Gurap PadaTelp. 0637-009557 Jl.TANDANG MULIA No.1 KOMPLEKS SIDIMPUAN BARU SILANDITTelp. 0634-22213 Jl. MANDAILING No. 39 SIHITANGTelp. 0634-23559 Jl. Imam Bonjol Km 5,5 Telp. 0634-28789 Jl. MERDEKA G. MANGARAJA Telp. 0634-7020950 Jl. Imam Bonjol Km 5,5 Telp. 0634-22808

Padangsidimpuan Padangsidimpuan Padangsidimpuan Padangsidimpuan Padangsidimpuan Padangsidimpuan Padangsidimpuan Padangsidimpuan Padangsidimpuan Padangsidimpuan Padangsidimpuan Padangsidimpuan

012001 013089 014184

IKIP Gunung Sitoli SekolahTinggi Ilmu Ekonomi Pembangunan Akademi Kebidanan Harapan Keluarga

Jl.YOS SUDARSO No. 118/E-S GUNUNGSITOLI Telp. 0639-21616 Jl. YOS SUDARSO No. 145 Telp. 0639-22037 Jl.YOS SUDARSO GUNUNG SITOLI Telp. 0639-7000268

Gunung Sitoli Gunung Sitoli Gunung Sitoli

015015

PoliteknikTanjungbalai

Jl. Sei Raja Kel. Sei Raja Kec. Telp. 0623-92102

Tanjungbalai

011016 013043 013060 013173 014118 014121 014163 014176 014177 014183

Universitas Asahan Sekolah Tinggi Ilmu Ekonomi Muhammadiyah Kisaran Sekolah Tinggi Ilmu Hukum Muhammadiyah Kisaran Sekolah Tinggi Manaj.Informatika & Komputer Royal Akademi Manajemen Informatika & Komputer Royal AMIK Intelcom Global Indo Kisaran AKPER Gita Matura Abadi Kisaran Akademi Kebidanan Ibtisam Aulia Akademi Kebidanan Bina Daya Husada Akademi Kebidanan As-Syifa Medan

Jl. JEND. A. YANI Telp. 0623-42643 Jl. MADONG LUBIS No. 8 KELURAHAN SELAWAN KISARANTelp. 0623-44525 Jl. MADONG LUBIS No. 8 MUTIARA Telp. 0623-44525 Jl. Iman Bonjol No. 179 Telp. 0623-41056 Jl. IMAM BONJOL No. 179 KISARAN Telp. 0623-41056/0623-42366 Jl. COKROAMINOTO No. 127Telp. 0623-41959 Jl. KH AGUS SALIM No. 45 Telp. 0623-42915 Jl. Jend. Sudirman No. 190 Bunu Telp. 0623-43602 JL. SUTOMO No. 158 KISARAN ASAHAN SUMATERA UTARATelp. 0623-43066 Jl. Durian Lk IV Kisaran Naga Telp. 081360577855

Kisaran Kisaran Kisaran Kisaran Kisaran Kisaran Kisaran Kisaran Kisaran Kisaran

011028 011038 013073 013082 013083 013084 014045 014154

Universitas Islam Labuhan Batu Universitas Al-Washliyah Labuhan Batu Sekolah Tinggi Ilmu Ekonomi Labuhan Batu STKIP Labuhan Batu SekolahTinggi Ilmu Pertanian Labuhan Batu Sekolah Tinggi Ilmu Hukum Labuhan Batu AMIK Labuhan Batu Akademi Kebidanan Ika Bina Labuhan Batu

Jl. PADANGBULAN No. 110Telp. 0624-351426 Jl. H. ADAM MALIK LABUHAN BATU Telp. 0624-351765 Jl. SM RAJA No. 126 A AEKTAPA Telp. 0624-21901 Jl. SM RAJA No. 126 A AEKPATA Telp. 0624-21901 Jl. SM RAJA No. 126 A AEKTAPA Telp. 0624-21901 Jl. SM RAJA No. 126 A AEKTAPA Rantauprapat Telp. 0264-21901 Jl. SM RAJA No. 126 A KM 3,5 AEKTAPA Rantauprapat Telp. 0624-21901 Jl. DEWI SARTIKA KOMP CITRA RAYSA INDAH Telp. 0624-351160

Rantauprapat Rantauprapat Rantauprapat Rantauprapat Rantauprapat Rantauprapat Rantauprapat Rantauprapat

013100 013102 013104 014052 014145 014178 014196 014209 014238 014239 014240 014241

SekolahTinggi Kelautan Dan Perikanan Indonesia Sekolah Tinggi Ilmu Kesehatan Medistra Sekolah Tinggi Ilmu Kesehatan Deli Husada Akademi Teknik Deli Serdang Akademi Kebidanan Harapan Mama Deli Serdang Akademi Kebidanan Delima Deli Serdang Akademi Keperawatan Harapan Mama Deli Serdang Akademi Kebidanan Sifra Husada Akademi Kebidanan Deli Husada Delitua Medan (Alih Bina) Akademi Keperawatan Deli Husada Delitua Medan (Ali Bina) Akademi Keperawatan Medistra Lubuk Pakam (alih bina) Akademi Kebidanan Medistra Lubuk Pakam (alih bina)

Jl. Tirta Deli No. I Telp. Jl. SUDIRMAN No. 38 L. PAKAM SUMATERA UTARATelp. 061-7952262 Jl. BESAR No. 77 DELITUA KAB. DELI SERDANG Telp. 061-7030082 Jl. PAGAR MERBAU III GEDUNG ATDS Telp. 061-7950308/061-77282612 Jl. MEDAN-BATANG KUIS KM. 14,5 No. 10 SEI ROTAN 20371 Telp. 061-7381813 Jl. MEDAN BATANG KUISTelp. 061-7385863 Jl. Medan-Batang Kuis No. 10 Km 14,5 Telp. 061-7382286 Jl. Kanal No. 10 Marindal Telp. 061-76392391 Jl. Besar No. 77 Delitua Telp. 061-7030082 Jl. Besar No. 77 Delitua Telp. 061-7030083 Jl. Jenderal Sudirman No. 38 Telp. 0617952262 Jl. Jenderal Sudirman No. 38 Telp. 06177952262

Deli Serdang Deli Serdang Deli Serdang Deli Serdang Deli Serdang Deli Serdang Deli Serdang Deli Serdang Deli Serdang Deli Serdang Deli Serdang Deli Serdang

014138 014171 014188 014214

Akademi Kebidanan Arta Kabanjahe Akademi Kebidanan Takasima Kabanjahe Akademi Keperawatan Arta Kabanjahe Akademi Keperawatan Takasima Kabanjahe

Jl. JAMIN GINTING No. 27 Telp. 0628-20677 Jl. Jamin Ginting No. 81 Telp. 0628-92280 Jl. Jamin Ginting No. 27 Telp. 0628-20677 Jl. Jamin Ginting No. 81 Telp. 0628-92280

Kabanjahe Kabanjahe Kabanjahe Kabanjahe

013141 014122

STIKES Putra Abadi Langkat Akademi Kebidanan Langkat

Jl. R. SUPRAPTO No. 10 STABAT LANGKAT-SUMUTTelp. 061-8910920 Jl. T. PUTRA AZIS No. 2 STABAT Telp. 061-8911906

Langkat Langkat

013150 013151

STIE Nias Selatan STKIP Nias Selatan

Jl. Diponegoro Nari-Nari Pasar Telp. 063-07321325 Jl. Diponegoro Nari-NariTelp. 063-07321325

Teluk Dalam Teluk Dalam

014166 014173 014175

Akademik Kebidanan Armina Centre Panyabungan Akademi Kebidanan Namira Kotanopan Akademi Kebidanan Madina Husada

Jl. BHAYANGKARA DS MOMPANG JULU KEC. PANYABUNGAN UTARA Telp. 0636-321716 Jl. Bhayangkara Ds GunungTua Telp. 0636-321875 Jl. Willem Iskandar No. 154 F Telp. 0636-7003136

Panyabungan Panyabungan Panyabungan

011018 014128

Universitas Sisingamangaraja XII Tapanuli Utara Akademi Keperawatan Pemkab Tapanuli Utara

Jl. SISINGAMANGARAJA XII No. 9 SILANGIT Telp. 0633-41017 Jl. AGUS SALIM No. 2 Telp. 0633-21212

Tarutung Tarutung

014191 014227 014234 015002

AKPERTenaga Pembangunan Arjuna Laguboti Akademi Farmasi Yayasan Tenaga Pembangunan Arjuna Akademi Keperawatan HKBP Balige Politeknik Informatika Del Toba Samosir

PINTUBOSI LAGUBOTITOBASA SUMATERA UTARATelp. 0632-7000420 Jl. Arjuna Pintubosi-LagubotiTelp. 0632-331380 Jl. Gereja No. 17 Balige Telp. 063221137 Jl. SISINGAMANGARAJA SITOLUAMA Telp. 0632-331234

Balige Balige Balige Balige

014198

Akademi Kebidanan Paluta Husada

Simpang Portibi Telp. 0635-510870

Gunung Tua

013171

STKIP Barus Tapanuli Tengah

Jl. Hamzah Fansyuri No. 1 A Ba Telp. 0638-510363

Tapanuli Tengah

014069 014160

Akademi Keperawatan Teladan Bahagia Akademi Kebidanan Kesehatan Baru

Bukit Inspirasi/sipalakki Telp. 085270168029 Jl. SISINGAMANGARAJA No. 14Telp. 0633-31535

Doloksanggul Doloksanggul

014180

Akademi Kebidanan Baruna Husada Sibuhuan

Jl. KH DEWANTARA PADANG LUAR Telp. 0636-421898

Padang Lawas

Perguruan Tinggi Swasta Aceh Kdpti

Nama Perguruan Tinggi Swasta

Alamat dan nomor telepon Perguruan Tinggi

Kota

011022 011023 011024 011030 013019 013025 013034 013035 013038 013039 013055 013056 013058 013103 013107 013114 013116 013125 013127 013132 013137 014007 014012 014017 014023 014025 014031 014038 014073 014130 014144 014155 014169 014179 014182 014193 014194 014212 014221 014225 014230 014242 014243 015014 015018

Universitas Iskandar Muda Universitas Abulyatama Universitas Muhammadiyah Aceh Universitas Serambi Mekkah SekolahTinggi Ilmu Ekonomi Indonesia Banda Aceh SekolahTinggi Ilmu Ekonomi Sabang STMIK Abulyatama SekolahTinggi Ilmu Kehutanan Pante Kulu Sekolah Tinggi Ilmu Administrasi Iskandar Thani Sekolah Tinggi Teknik Iskandar Thani SekolahTinggi Ilmu Manajemen SekolahTinggi Ilmu EkonomiYPHB Sekolah Tinggi Teknik Bina Cendikia Sekolah Tinggi Ilmu Psikologi Harapan Bangsa STKIP Al-Washliyah STKIP An-Nur Nangro Aceh STKIP Bina Bangsa Getsempena Sekolah Tinggi Ilmu Kesehatan Harapan Bangsa SekolahTinggi Ilmu Kesehatan U’budiyah STISIP Al Washliyah Banda Aceh STMIK U’budiyah Indonesia Akademi Teknik Iskandar Muda Akademi Pertanian Iskandar Muda ** Akademi Sekretaris Manajemen Nusantara AMIK Indonesia Akademi Pariwisata Muhammadiyah Banda Aceh Akademi Keuangan Perbankan Nusantara Akademi Maritim Nusantara Malahayati Akademi Maritim Aceh Darussalam Akademi Perikanan Dan Ilmu Kelautan Akademi KeperawatanTeungku Fakinah Banda Aceh Akademi Kebidanan Saleha Akademi KebidananYayasan Pendidikan Mona Akademi Kebidanan Nadhirah Akademi Teknik Otomotif Banda Aceh Akademi Fisioterapi Harapan Bangsa Banda Aceh Akademi Analis Farmasi Dan Makanan Banda Aceh Akademi Farmasi YPPM Mandiri Akademi Kebidanan Muhammadiyah Banda Aceh Akademi Keperawatan Abulyatama Banda Aceh Akademi Keperawatan Kesdam Iskandar Muda Akademi Perekam dan Info Kes Sihat Beurata (alih b Akademi Teknik Elektro Medik Kupula Aceh Politeknik Aceh Politeknik Indonesia Venezuela

Jl. KAMPUS UNIDA SURIEN Telp. 0651-42098 Jl. BLANG BINTANG LAMA KM 8,5Telp. 0651-23699 Jl. MUHAMMADIYAH No. 91 Telp. 0651-31583 Jl.TGK IMUM LUENG BATADESA BATHOHTelp. 0651-26160 Jl. SULTAN MALIKUL SALEH PO BOX 008 BANDA ACEH Telp. 0651-33595 Jl. PEURADA UTAMA PO BOX 166 Telp. 0651-53051 Jl. BLANG BINTANG LAMA KM 8,5 ACEH BESAR Telp. 0651-21569 Jl. T. NYAK ARIEF DARUSSALAM BANDA ACEH Telp. 0651 54309 Jl. T. UMAR No. 259 SETUI Telp. 0651-40942 Jl. Alue Naga Telp. 08126910249 Jl.T. NYAK ARIEF (DEPAN PERUMNAS JEULINGKE No 333 D)Telp. 0651-7551116 Jl .T. HASAN DEK No 230 JAMBO TAPE Telp. 0651-25559 Jl.TEUKU NYAK ARIEF No. 333 JEULINGKETelp. 0651-7551093 Jl. JENDRAL SUDIRMAN No 27-29Telp. 0651-7429628 Jl. T. CIK DITIRO NO 4-6 BANDA ACEH Telp. 0651-29488 Jl. T. NYAK ARIEF No 182 JEULINGKE Telp. 0651-7410930 RAMA SETIA 9 LAMPASEH KOTA/TENTARA PELAJAR 5,7,9,11/CEMPALA Telp. 0651-32144 Jl. Dr. MR Moehamad Hasan Desa KOMPLEKS RS TEUNGKU FAKINAH Telp. 0651-41454 Jl. T. NYAK ARIEF LAMNYONG Telp. 0651-25153-7400431 Jl. PANTI AL WASHLIYAH NO. 1 Telp. 0651-29488 KOMPLEKS KAMPUS TIBANGTelp. 0651-7400341 Jl. Kampus Unida SurienTelp. Kampus Unida Surien No 15 Telp. Jl. MEDAN - BANDA ACEH ACEH TIMUR Telp. 0651-7412601 Jl. T. NYAK ARIEF SP MESRA NANGGROE ACEH DARUSSALAM Telp. 0651-7552408 Jl. MUHAMMADIYAH No. 93 BATOHTelp. 0651-28423 Jl. MEDAN BANDA ACEH PEUREULAK ACEH TIMURTelp. 0651-755106 Jl. LAKSAMANA MALAHAYATI No. 17 KM 5 KRUENG CUT Telp. 0651-555441 Jl. TWK ABDUL AZIS No. 12 MERDUATI Telp. 0651-637745 Jl. T CIK DITIRO No. 4-6 PEUNITI BANDA ACEH Telp. 0651-27541/7406108 Jl. JENDERAL SUDIRMAN No. 27 Telp. 0651-41454/42754 Jl. KRUENG JAMBO AYEEGEUCEU KOMPLEKS Telp. 0651-7406610 Jl. TGK Abdurrahman Meunasah MTelp. 0651-7425546 Jl. SOEKARNO-HATTATelp. 0651-7454883 Jl. Sulaiman Daud Telp. 0651-27541 Jl. Jenderal Sudirman No. 27-29 Telp. 0651-41454 Jl. T Cik Ditiro No. 17 Peuni Telp. 0651-32432 Jl. T. Nyak Arief No. 333 C Telp. 0651-7412705 Jl. Punge Blang Cut Lr Penya Telp. 0651-43027 Jl. Blang Bintang Lama Km. 8.5 Telp. 0651-34455 Jl. T. Hamzah Bendahara Kutaala Telp. 0651-26583 Jl. Pocut Baren no. 79 Banda Aceh Telp. Telp. Jl. Politeknik Aceh Pango Raya Telp. 0651-7415005 Jl. Bandara SIM KM 12 Desa Cot Telp. 0651-34492

Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh Banda Aceh

013086 013106 013133 013136 013139 013143 013149 013174 014016 014131 014226

STMIK Bina Bangsa Sekolah Tinggi Ilmu Administrasi Nasional STIE Bumi Persada Lhokseumawe SekolahTinggi Ilmu Ekonomi Lhokseumawe STIKES Darussalam Lhokseumawe STIKES Muhammadiyah Lhokseumawe STIKES Bumi Persada Lhokseumawe STKIP Bumi Persada Lhokseumawe Akademi Sekretaris Manajemen Tanah Rencong Akademi Kebidanan Darussalam Akademi Keperawatan Kesdam Iskandar Muda

Jl. MERDEKA TIMUR No. 92 LHOKSEUMAWE Telp. 0645-41626 Jl. MERDEKA TIMUR No. 235 ACUNDA Telp. 0645-42208 Jl. MERDEKA UTAMA No. 148 CUNDA LHOKSEUMAWETelp. 0645-42468 Jl. MERDEKA TIMUR No. 235 ACUNDA Telp. 0645-42208 Jl. ISKANDAR MUDA No. 24 Telp. 0645-48082 Jl. DARUSSALAM No. 47 Telp. 0645-42580/43308 Jl. Merdeka Utama 148 Cunda Lh Telp. 0645-42468/42634 Cunda LhokseumaweTelp. Jl.TEUKU MAHARAJA No. 16 MON GEUDONGTelp. 0645-40521 Jl. ISKANDAR MUDA No. 24 Telp. 0645-48082 Jl. Alkalali No. 9 Hagu Selatan Telp. 0645-40066

Lhokseumawe Lhokseumawe Lhokseumawe Lhokseumawe Lhokseumawe Lhokseumawe Lhokseumawe Lhokseumawe Lhokseumawe Lhokseumawe Lhokseumawe

011019 013052 013135 013138 014146 014156

Universitas Samudra Langsa Sekolah Tinggi Ilmu Manajemen Pase STIKES Cut Nyak Dhien Langsa SekolahTinggi Ilmu Kesehatan Langsa Akademi Kebidanan Bustanul Ulum Langsa Akademi Kebidanan Harapan Ibu Langsa

DESA MEURANDEHLANGSA TIMURTelp. 0641-21443/426534 Jl. KEBUN BARU No.05 A Telp. 0641-20885 Jl. PERUMNAS No. 45 PAYA BUJOKSEULEMAK Telp. 0641-23363 Jl. PROF A. MADJID IBRAHIM Telp. 0641-22886 Jl. SYIAH KUALA No. 48 B Telp. 0641-21253 Jl. LILAWANGSA GEUDUBANG JAWATelp. 085270529992

Langsa Langsa Langsa Langsa Langsa Langsa

011021 014032 014202 014210 014233 014235

Universitas Jabal Ghafur AMIK Jabal Ghafur Akademi Kebidanan Darul Husada Akademi Kebidanan Medica Bakti Nusantara Akademi Kesehatan Lingkungan Jabal Ghafur Akademi Keperawatan Jabal Ghafur

GLEGAPUI Telp. 0653-21259 Jl. Lingkar Keuniree Telp. 0653-21259 Jl. Prof A. Madjid Ibrahim No. Telp. 0653-22550 Jl. Prof A. Majid Ibrahim N Telp. 085260417111 Jl. Prof H. Majid Ibrahim Simp. Telp. 085260269754 Jl. Prof A. Majid Ibrahim Sp C Telp. 0653-22397

Sigli Sigli Sigli Sigli Sigli Sigli

011032 013160 014190

Universitas Al Muslim SekolahTinggi Ilmu Ekonomi Kebangsaan Bireuen Akademi Kebidanan Munawarrah Bireuen

Jl.T. ABDURRAHMAN No. 37 MATANG GLUMPANG DUATelp. 0644-41126/41384 Jl. Banda Aceh-Medan No. 8-10 Telp. 0644-324647 Jl. Medan-Banda Aceh Telp. 06517454883

Bireuen Bireuen Bireuen

011034 013096 013144 013169 014149 014237

UniversitasTeuku Umar Meulaboh SekolahTinggi Ilmu Manajemen Indonesia Meulaboh STIKES Medika Seramoe Barat STKIP Bina Bangsa Meulaboh Akademi Kebidanan Public Health Medical Nursing Akademi Kebidanan Meuligoe Nur Amin

ALUE PEUNYARENG KEC. MEUREBOTelp. 06557012801 Jl. BAKTI PEMUDA MEULABOH MeulabohTelp. 081360002465 Jl. INDUSTRI DUSUN SENEBOK KEC. JOHAN PAHLAWAN-MeulabohTelp. 0651-7551306 Jl. Nasional Meulaboh-TapaktuaTelp. 085360603461 Jl. CENDRAWASIH No. 14 RUNDENGTelp. 0655-7551205 Jl. Cendrawasih No. 14 Kec. Joh Telp. 0655-7551434

Meulaboh Meulaboh Meulaboh Meulaboh Meulaboh Meulaboh

011039 013059 013124 014201

Universitas Gajah Putih SekolahTinggi Ilmu Hukum MuhammadiyahTakengon STKIP Muhammadiyah Aceh Tengah Akademi Kebidanan Adhira Mustika Gayo

Jl. Yos Sudarso No. 10 Telp. 0643-23129 Jl. QURATA’AINI MAMPAK KEBAYAKANTelp. 0643-21445 Jl. SENGEDA MAMPAQ KEBAYAKANTelp. 0643-21445 Jl. Pertamina Ds Lemah Burbana Telp. 0643-22673

Takengon Takengon Takengon Takengon

013126

STIKES Payung Negeri Aceh Darussalam

Jl. Bireuen-Takengon No. 86 Wi Telp. 0651-7551306

Bener Meriah

011043 013166 013170 014159 014206

Universitas Gunung Leuser Aceh STIKES Nurul Hasanah Kutacane STKIP Usman Safri Kutacane Akademi Kebidanan Nurul Hasanah Akademi Kebidanan Medica Alas Leuser

Jl. Iskandar Muda No. 1 Kutacane Telp. 0629-522574 Jl. Ahmad Yani P Kemiri A Tenggara Telp. 0629-21934 Jl. Pulonas Baru No. 6 Kec. Law Telp. 0629-2524021 Jl. AHMAD YANI P KEMIRI A TENGGARA Telp. 0629-21934 Jl. Raya Kutacane Bl Kejeren Km Telp. 0629-2524110

Kutacane Kutacane Kutacane Kutacane Kutacane

014170 015020

Akademi Kebidanan Medica Putro Bungsu Politeknik Aceh Selatan

Jl. T. Ben Mahmud Lhok Keutapan Telp. 0656-322491 Jl. Merdeka Kompleks Reklamasi Telp. 0656-323699

Tapaktuan Tapaktuan

013152

STIKES Getsempena Lhoksukon

Jl. Banda Aceh-Medan Km 300 P Telp. 0645-31662

Lhoksukon

013164

STKIP Muhammadiyah Aceh Barat Daya

Jl. Nasional Kompleks Pendidikan Telp. 0659-91305

Blangpidie

013146

Sekolah Tinggi Ilmu Administrasi Pelita Nusantara

Jl. Nasional Jeuram Telp.

Nagan Raya

014197

Akademi Kebidanan Gayo Luwes

Jl. Kapten Geunap KP Jawa Blan Telp. 0645-48082

Blang Kejeuren

013153 014203

STIKES Bina Nusantara Akademi Kebidanan Bunga Bangsa Idi

Jl. Medan-Banda Aceh No.3,5,7 Telp. 0646-21591 Jl.Medan Banda Aceh GP.Jalan I Telp.

Idi Rayeuk Idi Rayeuk

014211

Akademi Kebidanan Pidie Jaya

Jl. Banda Aceh Medan Km 158 Si Telp. 0653-51121

Meureudu

013154 014218

STIKES Bina Bangsa Kuala Simpang Akedemi Kebidanan Medika Sri Tamiang

Jl. Ir. H. Juanda No 9 Karangba Telp. 0641-32173 Jl. Juanda Kampung Dalam Telp. 0651-7551306

AcehTamiang AcehTamiang

013120 014139

SekolahTinggi Ilmu Pertanian Yashafa Akademi Keperawatan Yappkes Aceh Singkil

Jl. SINGKIL-SUBUSSALAM Telp. 08153119009 Jl. RAYA RIMO-SINGKIL KM 10 G. MERIAH ACEH SINGKIL Telp. 0658-21877

Singkil Singkil

014208

Akademi Keperawatan Ibnu Sina Kota Sabang

Jl. Bay Pass Cot Ba’U Telp. 0652-3324111

Sabang

NB : Sumber dari evaluasi.dikti.go.id dan laporan EPSBED


Laporan Khusus

WASPADA Senin 1 Juli 2013

A7

Gubsu H.Gatot Pujonugroho Pada Acara Wisuda Politeknik MBP

Ciptakan SDM Kompeten Tidak Gampang Program Studi

Kita masih ingat ucapan Gubernur Sumatera Utara (Gubsu) H.Gatot Pujonugroho (waktu itu masih Plt) , bahwa untuk menciptakan sumber daya manusia (SDM) yang kompeten tidak gampang dan lagi pula tidak bisa diselesaikan dalam tempo satudua hari. Namun sebaliknya kita dituntut untuk bekerja secara serius, terus menerus tanpa henti-henti, tanpa mengenal lelah dan tanpa kenal waktu dan entah berapa dana yang dihabiskan. Di situ letak sangat pentingnya peran perguruan tinggi seperti Politeknik MBP dalam mencetak kader bangsa intelektual yang memiliki berbagai bidang pengetuan untuk diabdikan dalam membangun dan memajukan bangsa dan negara yang berada dalam Kesatuan Negara RI (NKRI) . Ucapan itu dilontarkan Gubsu H.Gatot Pujunugroho, ST, M.Si pada acara wisuda lulusan Politeknik MBP beberapa waktu lalu di Aula kampus perguruan tinggi swasta itu di Jalan Letjen Jamin Ginting, Padang Bulan Medan, yang turut dihadiri Kopertis Wilayah I SumutAceh serta Direktur AMIK MBP Drs.Tenang Malem Tarigan, M.Si, Ak, KetuaYayasan Mandiri Bina Prestasi dr. Anna Mari Uli-

na Bukit dan Civitas Akademika dan Undangan lainnya. Karena dalam pembangunan Indonesia menuju masyarakat Sumut yang cerdas, adil, bermartabat dan sejahtera berbasis teknologi informatika, kata Gubsu, sangat dituntut adanya SDM yang handal . Kepada seluruh Wisudawan Politeknik MBP, orang nomor satu di Sumut itu mengajak lulusan termasuk mahasiswa ataupun

calon mahasiswa agar bisa beradaptasi dengan pekerjaan yang akan dipilih dan lapangan profesi yang dimasuki. Kepada Direktur Politeknik MBP Gatot Pujonugroho berharap agar kiranya lebih meningkatkan produktifitas akademik, dosen dan layanan akademik terhadap para mahasiswa serta pengelolaan kampus sesuai dengan standar perguruan tinggi yang baik.

Akuntansi Keuangan & Perbankan Bahasa Inggris Administrasi Bisnis Manajemen Hotel Teknik Mesin

UANG KULIAH Uang kuliah per tahun di Politeknik MBP adalah Rp 4.900.000/ tahun, atau Rp 9.800.000 selama tiga tahun (bayar dua tahun uang kuliah lunas selama tiga tahun). Pembayaran juga dapat dilakukan dengan menggunakan kartu kredit Bank BNI dengan cicilan bunga nol persen. GUBSU H.Gatot Pujonugroho, ST,M.Si foto bersama pada acara Wisuda Politeknik MBP, terdiri dari Drs.Tenang Malem Tarigan, M.Si,Ak (Direktur Politeknik MBP), Dr.Anna Mari Ulina Bukit (ketua Yayasan Menadiri Bina Prestasi (MBP), Dra. Katharina Priyatiningsih, M.Si (Ka.Bid.KerjsamaUPPM POLBAN), Dr. Ediana Sutji Redjeki (Ka.UPPM POLBAN), Ir. Mei Sutrisno, M. Sc, Ph. (Direktur Politeknik Negeri Bandung), Ermina Tiorida, SE, M.Si dan Nursiah Burhan, SE,M.Si (Direktur AMIK MBP Medan).

Lulusan Dan Impian Ke Depan “Kalau hanya sebatas lulus, perguruan tinggi lain juga melahirkan hal yang sama, baik pada program study serupa ataupun jurusan lain yang berbeda. Namun itulah impian ke depan dari Politeknik MBP (Mandiri Bina Prestasi), tengah meramu dalam bentuk rencana strategi jangka panjang, yakni melahirkan lulusan yang berkompetensi global . Artinya, para mahasiswa yang sudah menyelesaikan kuliahnya pada bidang study masing-masing, sudah bisa disebut tidak jago kandang lagi, tetapi sudah bisa bersaing memperebutkan peluang di berbagai bidang pekerjaan yang tersedia pada berbagai perusahaan luar negeri atau berskala internasional.” Demikian bagian dari penjelasan Direktur Politeknik MBP Drs.Tenang Malem Tarigan,M.Si, Ak dalam suatu pertemuan dengan Waspada Senin

(10/7) di ruang kerjanya, kampus Politeknik MBP, Jalan Letjend Jamin Ginting, Padang Bulan, No.285-287 Medan. Turut hadir dalam pertemuan itu Ketua Yayasan Mandiri Bina Prestasi (MBP) dr. Anna Mari Ulina Bukit, Pembantu Direktur I AfridaYanti Surbakti, SE.,M.Si, Pembantu Direktur II Rosmaida Tambun, SE,M.Si, Ak, Pembantu Direktur III Drs. Anggiat P. Simamora, SH dan Humas Drs. Romanus Sipayung. Dasar pemikiran Drs. Tenang Malem Tarigan, M.Si.,Ak untuk menggiring Politeknik MBP mampu menghasilkan lulusannya pada tingkat bergengsi internasional adalah, selain semakin ketatnya persaingan mendapatkan pekerjaan dalam negeri, lebih-lebih lagi di Sumatera Utara sendiri, tetapi juga sebagai bentuk pengabdian dalam melakukan terobosan baru hingga bisa lahir

satu perguruan tinggi (Politeknik MBP) swasta terunggul di Indonesia, atau setidaknya di luar pulau Jawa. “Memang ukuran kita untuk tingkat nasional, tetapi standard mutu pendidikan sudah berskala internasional,” kata Tenang Malem Tarigan yang mengaku proses ke arah itu tengah berjalan, dan tahun 2020 paling lambat target itu sudah terlaksana semua. Satu langkah maju yang sudah dilakukan, menurut Tenang Malem Tarigan adalah, Politeknik MBP sudah memperoleh Sertifikat pelayanan mutu manajemen pendidikan tinggi berstandard internasional dari SAI Global ISO 9001:2008 (International Sertification Organisation) yang berpangkalan di Australia dan Selandia Baru pada 2 Maret 2011. Karena pengawasan dan penilaian dilakukan kedua

lembaga sertifikasi internasional, serta KAN (Komite Akreditasi Nasional) secara terus menerus sepanjang tahun, Dia memanjatkan rasa syukur yang tinggi bahwa Politeknik MBP berhasil mempertahankan pengakuan jaminan Sistem Manajemen dan Layanan Mutu Sertifikasi ISO 9001:2008, setelah melakukan Survillance Audit (Audit Pengawasan) selama dua hari pada akhir Maret 2012. “Dengan pengakuan dari lembaga penilai internasional itu, kami dari pihak Politeknik MBP sangat lega dan bangga karena sudah ada pihak asing yang menilai perguruan tinggi ini dengan hasil yang bagus,” kata Tenang Malem Tarigan dengan mengaku sebelumnya perguruan tinggi swasta yang dipimpinnya itu belum punya standard mutu, baik secara nasional, ataupun internasional.Yang ada hanya penilaian dari Badan

Akreditasi Nasional (BAN) PerguruanTinggi (PT) Dikti Kementrian Pendidikan Nasional RI. Bersama Ketua Yayasan MBP, dr. Anna Mari Ulina Bukit, Drs. Tenang Malem Tarigan, M.Si.,Ak menyebutkan gebrakan lain yang dilakukan untuk menjadikan lulusan Politeknik MBP berkompetensi global atau internasional. Berbagai upaya yang dilakukan dengan pihak perusahaan asing di luar negeri, termasuk dengan Politeknik di sana, telah membuahkan hasil, yakni para mahasiswa Politeknik telah diterima kuliah magang di berbagai perusahaan di Singapura, Malaysia, Hongkong, Korea, Jepang serta beberapa negara di Eropa, termasuk Amerika Serikat. Itu belum termasuk perusahaan berskala nasional dan internasional yang ada di Indonesia, termasuk yang ada di kota Medan. Upaya lain adalah menaja-

AMIK MBP Siap Bersaing M

anajemen mengakui program dalam mengembangkan AMIK MBP itu bukan hanya sebatas melengkapi fasilitas dalam kampus, tetapi kini sudah melangkah lagi dengan menjalin kerjasama dengan berbagai pihak . Jalinan kerjasama dengan Politeknik Negeri Medan (Pol med) tercatat pertama dila-

kukan AMIK MBP sepanjang perjalanannya yang kini memasuki usia 12 tahun. Setelah dengan Polmed, kerjasama serupa terjalin dengan lembaga pendidikan Persahabatan Indonesia Amerika (PPIA) dan Politeknik Negeri Bandung. Dan yang terbaru adalah kerjasama dengan Universiti Teknologi MARA Terengganu Malaysia dalam bentuk pertukaran dosen dan ma-

NAMA besar yang sudah dicapai bukan berarti harus berhenti untuk mengembangkan diri, tetapi langkah pasti dengan melakukan terobosan-terobosan baru terus dilakukan tanpa henti. Menstandarkan mutu pelayanan di bidang manajemen, mahasiswa, dosen serta kelengkapan sarana perkuliahan melalui badan penilaian nasional dan internasional, serta peningkatkan kualitas tenaga pengajar dengan menjalin kerjasama dengan berbagai perguruan tinggi ternama di Indonesia dan luar negeri, merupakan bagian dari upaya untuk lebih membesarkan nama AMIK MBP serta menjadikan lulusannya berkualitas dan siap dalam persaingan global. Di situlah letak salah satu atau beberapa keunggulan Akademi Manajemen Informatika Komputer Medan Business Polytechnic.

GEDUNG kampus AMIK MBP yang berlokasi di Jl. Letjend Jamin Ginting No. 285-287, Padang Bulan, Medan cukup strategis dan nyaman bagi para mahasiswa untuk berkuliah pagi sampai malam. Gedung ini dilengkapi berbagai fasilitas perkuliahan yang lengkap, termasuk laboratorium bahasa dan komputer yang Full AC gampang dijangkau dari segala penjuru kota Medan dan tersedia tempat indekos dilokasi kampus sekitar kampus USU.

Teknik Listrik / Elektro Teknik Elektronika Teknik Telekomunikasi Teknik Sipil Pertanian / Hortikultura Peternakan

hasiswa, serta kerjasama dalam riset dan lainnya yang Nota Kesepatan (MoU) dilakukan di Malaysia antara pihak AMIK MBP dan Universiti Teknologi MARA milik Negara Bagian Terengganu Malaysia. Jadi AMIK MBP sebagai perguruan tinggi swasta bergengsi di Sumatera Utara dengan standar kualitas nasional dan internasional karena sudah meraih Sertifikasi ISO 9001:2008 dari Badan Internasional, kini mulai memasuki sistem globalisasi dengan menjalin kerjasama dengan dunia pendidikan berbagai negara sehingga mutu lulusannya benar-benar teruji yang bisa diterima bukan hanya instansi pemerintah kita dan lembagai-lembaga negara perwakilan asing tetapi juga perusahaan swasta nasional dan in-

ternasional. Sama sepereti tahun-tahun sebelumnya, AMIK MBP untuk tahun akademik 2013-2014 akan memberikan beasiswa kepada mahasiswa berprestasi dan kurang mampu dengan sumber dana berasal dari yayasan Mandiri Bina Prestasi, Dirjen DIKTI dan Kopertis Wilayah I Sumut-Aceh, serta mitra kerja lainnya dari perguruan tinggi. Anak guru, veteran dan wartawan juga mendapat kesempatan untuk mendapatkan beasiswa tersebut, atau setidaknya diberikan potongan uang kuliah. “Ini sebagai kepedulian kita terhadap lulusan SLTA sederajat sebagai generasi penerus bangsa ini agar mendapat kesempatan melanjutkan pendidikan tinggi,” kata Dr.Anna Ulina Maria Bukit, KetuaYayasan MBP.

lin kerja sama dengan Politeknik Negeri Bandung untuk menyelenggarakan Program D4 untuk Program Studi Akuntansi Pemerintahan, Perbankan Syariah, Administrasi Bisnis dan Management Asset, dan Universiti Teknologi MARA Terengganu, Malaysia. Politeknik yang sudah beberapa kali memperoleh dana hibah dari pemerintah melalui DIKTI. Khusus bagi kalangan keluarga kurang mampu yang memiliki prestasi atau keinginan untuk melanjutkan pendidikan di perguruan tinggi, Politeknik MBP membantu melalui beasiswa BIDIK MISI, beasiswa Bidik Misi (Dikti) dalam bentuk gratis uang kuliah dan biaya hidup Rp 600 ribu per bulan, serta beasiswa dari Kopertis dalam bentuk Bantuan Belajar Mahasiswa (BBM) dan Peningkatan Prestasi Akademik (PPA), serta beasiswa dari Yayasan MBP

Penerimaan Mahasiswa Baru Sama seperti pada AMIK MBP, Politeknik MBP juga menerima calon mahasiswa baru dalam tiga gelombang yang gelombang pertama mulai 08 April 2013 dan gelombang terakhir berakhir 14 Oktober 2013.

DENGAN menempati gedung bertingkat, inilah kampus tempat kuliah mahasiswa Politeknik MBP di Jl. Letjend Jamin Ginting No. 285-287 Padang Bulan Medan

Sistem Pendidikan Sistem pendidikan di AMIK MBP disesuaikan dengan Visi dan Misi yaitu menjadi Lembaga Pendidikan Terbaik Di Bidang Informatika antara lain: 1. Lama pendidikan untuk Program D3 selama tiga tahun (enam semester = 115 SKS) 2. Menerapkan Sistem Kredit Semester (SKS) dalam mempercepat proses penyelesaian studi. 3. Sistem pendidikan terdiri dari 75 persen praktek dan 25 persen teori 4. Menerapkan Kurikulum berbasis Kompetensi (KBK) yang disesuaikan dengan kebutuhan pasar/Industri 5. Strategi dan Metode Pembelajaran menggunakan metode Ceramah, Diskusi, Demonstrasi secaraterjadwal dan terstruktur 6. Media Pembelajaran menggunakan fasilitas yang termodern, antara lain LCD, TOPEX, TELECONFERENCE. 7. Diasuh oleh dosen yang professional dan telah berpengalaman baik dari dalam dan luar negeri, termasuk dari USU, UI, ITB, UGM, USM dan Universiti Ohio Amerika Serikat.

Penerimaan Mahasiswa Baru Penerimaan baru sudah dimulai dari sekarang yang terbagi dalam tiga gelombang dan terakhir 09 Oktober 2013. Mahasiswa bisa datang langsung ke kampus AMIK MBP di Jl.Let jen Jamin Ginting, Padang Bulan, No.285-287 Medan , atau menghubungi melalui telepon 061-8217222

Jurusan Jurusan pada AMIK MBP terdiri dari: 1. Jurusan Manajemen Informatika Komputer yang berkonsentrasi pada: a. Komputerisasi Akutansi b. Manajemen Informasi Bisnis 2. Jurusan Teknik Informa-tika Komputer yang terkonsentrasi pada a. Multimedia b. Web & Jaringan

Uang Kuliah Sementara uang Kuliah untuk semua jurusan adalah Rp 5.750.000 per tahun dan dapat dicicil. Apabila pembayaran tunai satu tahun dapatkan satu unit Leptop. Pembayaran juga dapat dilakukan dengan menggunakan kartu kredit Bank BNI dengan cicilan bunga nol persen.

STIKOM Medan Bukan PTS Baru Sudah Banyak Cetak Sarjana Komputer YAYASAN Pendidikan Sekolah Tinggi Ilmu Komputer (STIKOM) bukan perguruan tinggi swasta yang baru dibentuk, tetapi jelas sudah lama berdiri di Medan dengan mencetak sejumlah sarjana S1 pada bidang keahlian yang berbasis komputer. Dengan bangunan kampus milik sendiri, berlokasi di Jl. Iskandar Muda No.45, depan Pasar Peringgan, Medan, STIKOM tidak henti-henti mengembangkan diri dengan melengkapi fasilitas dan perangkat belajar agar mahasiswa tidak mengalami kesulitan dalam mendapatkan pengetahuan dan keterampilan sebagai bekal masuk ke dunia kerja. Ketua STIKOM Wanra Tarigan, ST.,M.Kom, serta Pembina Yayasan AMIKOM Medan Ny. dr. Anna Mari Ulina Bukit dan Humas Armansyah Harahap, M.Pd dalam penjelasannya baru baru ini di kampus itu, mengakui minat lulusan SLTA masuk ke perguruan tinggi swasta ini terus meningkat dari tahun ke tahun. Sedangkan ma-

hasiwa yang kuliah di STIKOM saat ini juga berasal dari berbagai etnis dan bukan hanya berasal dari kota Medan semata tetapi mencakup berbagai kota dan daerah. Wanra Tarigan, ST.,M.Kom mengaku tidak jarang masyarakat terutama dari kalangan orang calon mahasiswa mempertanyakan mengenai status

perguruan tinggi yang dipimpinnya. Dengan menunjuk surat keputusan Badan Akreditasi Nasional Perguruan Tinggi (BAN-PT), Ketua STIKOM Medan itu menyebutkan bahwa STIKOM itu telah terakreditasi di BAN-PT dengan Nomor 029/ BAN-PT/Ak-XIII/SI/XII/2010. “Jadi tepatnya sudah sejak tiga tahun lalu STIKOM terakreditasi di BAN-PT,” katanya sambil mengingatkan kalangan orangtua dan calon mahasiswa tidak perlu kuatir bila melanjutkan pendidikan tinggi di STIKOM karena ijazahsarjana S1yangdikeluarkan sah sehingga tidak ada masalah. Menyinggung program studi (Prodi),Wanra menyebutkan terdapat tiga program studi untuk S1 dan dua program studi D3. Untuk Sarjana (S1) meliputi : Teknik Informatika, de-

ngan tujuan menyiapkan tenaga kerja potensial yang mampu menguasai analisa dan teknik – teknik optimalisasi perangkat lunak sistem. Selain itu lulusan S1 itu juga telah memiliki pengetahuan sistem dari mekanisme kerja komputer, serta menguasai dasar-dasar pengetahuan analisa dan perancangan komputer. Lulusan juga mampu merekayasa perangkat lunak degan menggunakan metode teknik dan alat bantu tertentu berikut dokumentasinya untuk mengoptimalkan kinerja perangkat lunak. Prodi Study S1 kedua adalah Sistem Komputer , dan KetigaadalahSistem Informasi. Sementara untuk D3meliputiTeknikKomputerdan Manajemen Komputer. Uang Kuliah Mengenai uang kuliah Rp 4.900.000, Bagi calon mahasiswa

yang melunasi uang kuliahnya untuk satu tahun akan mendapat satu unit laptop secara gratis. Selain itu STIKOM juga memberikan beasiswa dalam bentuk beasiswa PPA, BBM, Yayasan, Supersemar, BKN (Bantuan Khusus Mahasiswa ) dan beasiswa dari Mitra Kerja. Masa Pendaftaran Masa pendaftaran calon mahasiswa baru terdiri dari tiga Gelombang. Gelombang pertama sudah berakhir, dan gelombang kedua sampai 06 Juli 2013 dan Gelombang terakhir berakhir 31 Agustus 2013. Tempat pendaftaran terdapat di tiga lokasi:Yakni di Jl. Iskandar Muda No.45, (Kampus STIKOM) Medan, Jl. Pertahanan No.19, Ruko Amplas, danJl.LetjendJaminGinting, kampus AMIK MBP Medan (tempat pendaftaran gabungan).

GEDUNG perkulihan yang juga kampus STIKOM Medan di Jl.Iskandar Muda, dekat Pajak Peringgan Medan


Nusantara

A8

WASPADA Senin 1 Juli 2013

Munarman Mengaku Cuma “Ngasih Minum” KPI: Pelajaran Agar Pilih Narasumber Sesuai SOP

Waspada/Ismanto Ismail

SALAH satu pos polisi dirusak ketika terjadi demonstrasi penolakan kenaikan BBM. Para pendemo merusak fasilitas umum antara lain kantor Pos Polsek Medan Baru dan traffic light di Jln. Iskandarmuda dan Trasimpang Jln. Letjen Jamin GintingPadangbulan Medan beberapa waktu lalu.

Sumut Dan Papua Teratas Perusakan Fasilitas Polri JAKARTA (Waspada): HUT ke-64 Polri hari ini Senin (1/7) diwarnai hubungan kurang baik dengan masyarakat selama enam bulan terakhir ditandai terjadinya pengrusakan kantor dan fasilitas polisi sebanyak 58 tempat, Sumatera Utara dan Papua merupakan paling teratas. ”Periode Januari hingga Juni 2013, ada 58 fasilitas Polri yang dirusak dan dibakar masyarakat dalam 14 peristiwa konflik atau amuk massa di sekitar kantor polisi. Sumut dan Papua paling teratas yang banyak merusak fasilitas Polri,” kata Ketua Presedium Indonesia Police Watch (IPW) Neta S Pane di Jakarta, Minggu (30/6). Data yang dilansir IPW ini, kata Neta, untuk menyongsong

HUT Polri, agar berintropeksi diri dan tidak hanya melakukan perayaan Hari Bhayangkara ini tidak hanya sebatas serimonial semata. Sebab, kata Neta, angka amuk massa meningkat tajam jika dibandingkan tahun sebelumnya. Dikatakannya, secara umum peningkatan angka tersebut dari tahun 2010 - 2012 adalah, untuk tahun 2012 ada 85 fasilitas Polri yang dibakar dan dirusak masyarakat, terdiri dari 56 kantor polisi, 18 mobil polisi, 10 motor polisi dan satu rumah dinas polisi. ”Tahun 2011 hanya 65 fasilitas Polri yang dirusak terdiri dari 48 kantor polisi, 12 mobil polisi dan 5 rumah dinas. Sedangkan tahun 2010 lebih kecil lagi. Hanya 20 kantor polisi yang dirusak massa,” beber Neta.

Tahun 2013 ini, hanya waktu enam bulan sudah terjadi 58 fasilitas Polri yang dirusak dan dibakar warga yakni terdiri dari, 13 kantor polisi (5 pospol, 4 Polsek dan 4 Polres), 25 motor polisi, 8 mobil polisi dan 2 rumah dinas polisi. Akibat konflik di sekitar kantor polisi itu 143 orang ditangkap, 23 warga luka, 5 warga tewas, 15 polisi luka dan satu polisi tewas. ”Aksi perusakan dan pembakaran fasilitas Polri merata terjadi di seluruh wilayah Indonesia, mulai dari Sumut hingga Papua. Wilayah yang terbanyak amuk massa terhadap fasilitas Polri masih ‘dipegang’ Sumut dan Papua, sama seperti tahun 2012 lalu merupakan daerah paling rawan konflik dengan aparat kepolisian,” ucap Neta. IPW sangat prihatin dengan

amuk massa yang dipicu akibat benturan dengan jajaran Polri. ”IPW prihatin melihat makin buruknya hubungan masyarakat dengan Polri sejak lima tahun terakhir ini,” ucapnya. Benturan ini, lanjut Neta, menunjukkan Polri gagal meningkatkan kualitas jajaran bawahnya. Jika Polri tidak segera membenahi kondisi ini, hubungan polisi dengan rakyat akan semakin marak. ”Sebab sebagian besar aksi perusakan pada fasilitas Polri itu dikarenakan rasa jengkel rakyat terhadap sikap arogan, sikap represif, dan pepihakan polisi pada para pengusaha. Sikap nekat melawan polisi muncul karena warga merasa tidak punya harapan lagi untuk mendapatkan keadilan,” katanya.(j02)

Calon TKI Diimbau Daftar Ke Lembaga Resmi SIJUNJUNG( Waspada): Anggota Komisi IX DPR RI, Poempida Hidayatulloh mengingatkan kepada para calon tenaga kerja Indonesia (TKI) yang ingin bekerja di luar negeri agar mendaftar pada lembaga resmi atau Dinas Tenaga Kerja kabupaten/kota setempat. “Bekerja ke luar negeri harus siap segalanya. Yang lebih penting adalah harus terdaftar identitasnya di Dinas Tenaga Kerja kabupaten/kota atau lembaga resmi supaya tercatat identitasnya oleh negara, sehingga jika ada permasalahan di akan mudah melacaknya,” ujar Poempida dalam sosialisasi Penempatan dan Perlindungan TKI melalui media tradisional yang diselenggarakan Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indo-

nesia (BNP2TKI) di Lapangan Pasar Inpres Kabupaten Sijunjung, Sumbar, Sabtu malam, (28/6). Poempida mengatakan pencatatan identitas TKI sebelum berangkat ke luar negeri ini sangat penting dilakukan, sehingga jika TKI tersebut mengalami masalah di luar negeri akan mudah dicari datanya dan diselesaikan. “Jika tidak terdaftar kita akan sulit mengurusnya dan melindunginya,” paparnya. Pemerintah melalui BNP2TKI, lanjut Poempida, saat ini telah memiliki Sistem online TKI yaitu Sistem Komputerisasi Tenaga Kerja Luar Negeri (SISKOTKLN), dengan sistim online tersebut seluruh data TKI tecatat dengan baik dan lengkap. Jika TKI mengalami masalah di luar negeri akan mudah

dipecahkan dan diberikan bantuan. Poempida yang juga politisi Fraksi Partai Golkar itu mengucapkan terimakasih kepada BNP2TKI yang telah melakukan sosialisasi program penempatan dan perlindungan TKI di Kabupaten Sijunjung ini. Dia mengatakan sosialisai tatap muka secara langsung melalui pagelaran seni tradisional merupakan prorgam yang baik dan bermanfaat untuk masyarakat terutama calon TKI, mantan TKI dan keluarganya. Melalui sosialisasi ini, fungsi penempatan dan perlindungan TKI dapat disampaikan kepada masyarakat. Selain itu masyarakat mendapatkan informasi yang benar tentang prosedur menjadi TKI yang berdokumen. “Jika terbuka pasar dan permin-

8 Ribu Guru Ikuti Kongres PGRI JAKARTA (Waspada): Sebanyak 8000 guru akan berpartisipasi aktif sebagai peserta Kongres ke-21 Persatuan Guru Republik Indonesia (PGRI), 1 sampai 5 Juli di Jakarta. Sejumlah tempat, yakni Gelora Bung Karno Senayan, Gedung Manggala Wana Bhakti serta Kementerian Pendidikan dan Kebudayaan siap menjadi tempat para guru berkongres. Ketua PGRI, Sulistyo mengatakan, selain memilih Ketua Umum PGRI periode 20132018, kongres juga dimaksudkan sebagai ajang pembahasan berbagai hal terkait kondisi pendidikan di Indonesia, utamanya terkait peran guru. “Hasil kongres ini akan di-

sampaikan langsung ke bapak Presiden, sebagai masukan bagi dunia pendidikan ke depan,” kata Sulistyo, saat keterangan pers di kantor Pengurus Besar (PB) PGRI, Jakarta, Minggu (30/6). Sejumlah pembahasan penting terkait regulasi bidang pendidikan, desentralisasi pendidikan, sistem pendidikan, anggaran, persoalan tenaga pendidik dan kependidikan sampai kurikulum baru, diprediksi akan berlangsung penuh semangat. “Guru-guru, khususnya yang dari daerah sangat bersemangat. Masing-masing perwakilan guru dari 502 kabupaten dan 33 provinsi siap memberikan argumentasinya,” kata

Sulistyo. Menurut Sulistyo, persoalan pendidikan di Indonesia titik beratnya ada di guru dan tenaga kependidikan lainnya. Pemerintah sulit mengklaim keberhasilan pendidikan kalau kualitas dan kesejahteraan guru tidak diprioritaskan. “Percuma mau melaksanakan kurikulum yang bagusnya seperti apa, kalau gurunya tidak dipersiapkan dengan baik. Jadi selain sarana pendidikan, guru menjadi ujung tombak kemajuan pendidikan,” kata Sulistyo. Sulistyo sendiri akan mengakhiri jabatannya sebagai Ketua Umum PGRI Periode 20082013 jika ada ketua terpilih lewat Kongres tahun ini. (dianw)

taaan peluang kerja masyarakat bisa memanfaatkannya. Tentu semua itu dilakukan melalui proses dan prosedur yang benar,” tuturnya. Sementara itu Direktur Sosialisasi dan Kelembagaan Penempatan BNP2TKI Rohyati Sarosa mengatakan sosialisasi melalui media tradisional BNP2TKI di Kab. Sijunjung merupakan kegiatan sosialisasi yang ke sebelas yang dilakukan BNP2TKI pada tahun 2013 ini. Sebelumnya sosialisasi melalui media tradisional BNP2TKI telah dilakukan di Kabupaten Banyuwangi, Malang, Tulungagung, dan Ponorogo ( Jawa Timur), Pemalang dan Cilacap (Jawa Tengah), Cirebon, Garut, dan Sukabumi (Jawa Barat), Lampung Timur (Lampung). Rohyati mengatakan Kab. Sijunjung merupakan daerah potensial dalam penempatan TKI di Provinsi Sumatera Barat. Sebagaimana diketahui, penempatan TKI formal di Sumbar cukup banyak. Selain dihadiri Anggota Komisi IX DPR RI, Poempida Hidayatulloh, Bupati Kabupaten SijunjungYuswir Arifin, Direktur Sosialisasi dan Kelembagaan Penempatan BNP2TKI Rohyati Sarosa, Kepala Biro Perencenaan dan Administrasi Kerjasama BNP2TKI Yunafri, Ketua DPRD Kabupaten Sijunjung Muklis, Kadisosnakertrans Kabupaten Sijunjung Irwandi, Kapolres Kabupaten Sijunjung Sugeng Riyadi, dan tokoh masyarakat setempat, kegiatan ini menyedot perhatian masyarakat karena menampilkan artis Ratu Si Kumbang dan Pelawak Mak Item yang cukup dikenal masyarakat setempat.(J07)

Ketua DPD Tak Bersikap Atas Kenaikan Harga BBM JAKARTA (Waspada): Dewan Perwakilan Daerah (DPD) RI ternyata tidak bersikap dalam kenaikan harga BBM. Bahkan Ketua DPD RI terkesan terus sibuk dengan kepentingannya sendiri yang akan maju sebagai Capres 2014 melalui konvensi Capres yang akan digelar oleh Partai Demokrat (PD). Sebagaimana diberitakan selama ini, PD mempersilakan Irman Gusman, Mahfudh MD, Jokowi, Marzuki Alie, Dahlan Iskan dan lainnya untuk mengikuti konvensi Capres. “Kewenangan untuk menyikapi kenaikan harga BBM itu ada pada Komite IV DPD RI. Tapi, kita tahu Ketua DPD RI Irman

Gusman kan mau maju sebagai Capres. Tapi, kita lihat nanti apa ada hubungannya dengan tak bersikapnya DPD dalam kenaikan harga BBM itu,” tandas anggota DPD RI Dapil DKI Jakarta, Dani Anwar dalam talk show dampak kenaikan BBM bersama Ketua Umum KWK DKI La Ode Djeni Hasmar dan pengamat transportasi Yayat Supriyatna, di Gedung DPD/ MPR RI Jakarta, Jumat (28/6). Dani menilai dengan menaikkan harga BBM seharusnya pemerintah menyiapkan segala kemungkinan yang akan terjadi. Termasuk tarif angkutan umum (angkot) agar masyarakat maupun operator tak dirugikan. Se-

bab, tujuan pemerintahan itu antara lain melindungi dan menertibkan masyarakat. Untuk itu dia meminta semua anggota DPD di seluruh Indonesia memperhatikan dan mengawal transportasi umum dan mem-back up operator di daerah. “Jadi, operator harus diperhatikan dengan memberikan subsidi,” ujarnya. “Kalau pemerintah dengan menaikkan harga BBM ini masyarakat malah resah, berarti negara telah gagal, dengan mengembalikan harga BBM ke pasar dunia. Padahal sebelum menaikkan BBM anggaran lembaga tinggi negara dipotong puluhan miliar rupiah.

DPD sendiri anggarannya dipotong Rp24 miliar,” tegas Dani lagi. La Ode Djeni Hasmar berharap pemerintah harus adil. Misalnya jika pembagian bantuan langsung sementara masyarakat (BLSM), maka khusus untuk operator angkutan umum diberi kemudahan atau subsidi terkait kebutuhan angkot. Seperti regulasi, aturan, izin, onderdil-sparepart dan sebagainya bekerjasama dengan Kemendag, Perindustrian, Menkeu dan Kemenkop dan UKM. “Pemda yang akan terapkan tarif juga bisa memperhatikan ini,” katanya.(J07)

JAKARTA (Waspada). Acara diskusi Apa Kabar Indonesia Pagi yang ditayangkan TvOne Jumat pagi diwarnai insiden. Juru Bicara FPI Munarman menyiram sosiolog Universitas Indonesia (UI) Thamrin Amal Tomagola dengan secangkir teh. Munarman mengaku kesal dengan Thamrin karena sosiolog itu memotong-motong pembicaraannya. “Orang lagi ngomong juga ditunjuk-tunjuk, nggak sopan,” tegas Munarman, sebagaimana diberitakan koran Merdeka Jakarta, Sabtu (29/6). Namun, hingga acara diskusi selesai, mantan Ketua Yayasan Lembaga Bantuan Hukum Indonesia (YLBHI) ini enggan untuk meminta maaf kepada Thamrin. “Biasa-biasa saja, ngapain saya minta maaf, saya tantang sekalian, saya ladeni,” tantang Munarman. Thamrin yang menjadi korban penyiraman teh ini mengatakan Munarman tidak suka pernyataannya. Thamrin membeberkan penyebab Munarman reaktif dalam tiga poin. “Pertama ancaman polisi akan menindak ormas yang melakukan sweeping, yang itu adalah agenda polisi tahunan. Kemudian dia menyatakan, penyebab polisi melarang sweeping adalah karena pertanyaan wartawan kepada polisi, sehingga polisi menjawab akan menindak. Ketiga, dia bilang aparat Negara tidak pernah hadir saat ada kekerasan, saya bilang betul. Negara banyak membiarkan kekerasan, nah pada saat saya melakukan komentar itu. Dia anggap saya membela yang minoritas,” terang Thamrin. Kemudian Thamrin menambahkan, Munarman menudingnya selalu membuat analisa yang menyudutkan Islam. Dirinya menambahkan, kekerasan harus dihentikan dimulai dari rumah tangga, komunitas, sekolah, lembaga legislatif dan lingkungan. “Jangan sampai meniru kekerasan. Itu konyol. Kemarahan itu berasal dari sana (kepincangan ekonomi). Dan, kita juga

net

Juru Bicara FPI Munarman terlihat menyiram sosiolog Universitas Indonesia (UI) Thamrin Amal Tomagola dengan secangkir teh pada acara diskusi Apa Kabar Indonesia Pagi yang ditayangkan TvOne Jumat pagi. harus hindari dakwah dengan yang keras. Mereka yang berada dalam posisi yang tidak berdaya, akan merasa terancam,” jelasnya. Pernyataannya itu, menurut Thamrin, disebutnya sebagai pemicu kemarahan Munarman hingga menyiramkan segelas minuman kepada dirinya. Dia tidak akan melakukan laporan ke Polri atas kejadian ini. Ia hanya meminta kepada Polri untuk bertindak atas kejadian itu. “Sebaiknya yang bertindak polisi, karena itu kejadian di depan publik, apalagi Pak Boy kan juga salah satu narasumbernya. Itu tindakan kekerasan di publik. Saya tidak mau melayani Munarman. Ngapain saya melayani preman. Sesudah dia menyiram saya, baru saya bi-lang saya tidak akan membalas tindakan premanisme seperti yang Saudara (Munarman) lakukan terhadap saya. Saya bilang ke dia, tindakan itu tindakan preman,” beber Thamrin Amal Tamagola. Munarman kemudian memastikan, tindakan yang ia lakukan akan dipertanggungjawabkan. “Saya akan ladeni dia, saya tidak takut. Karena dalam diskusi itu, argumentasinya ngawur. Makanya, dia saya sebut intelektual sampah,” tegas Munarman lagi.

Selain itu, tidak tampak sama sekali penyesalan di wajah Munarman. Bahkan, Menurut dia, siraman pantas didapat Thamrin yang kerap memotong pembicaraannya. Dengan santai, Munarman pun berkelakar dia tidak menyiram Thamrin, tapi hanya ‘ngasih minum’.”Saya lihat dia (Thamrin) pagi-pagi belum minum teh, haus, ya kita kasih minum. Karena jauh, ya jadinya begitu,” katanya dengan santai. Insiden Juru Bicara FPI Munarman yang menyiram muka sosiolog Universitas Indonesia (UI) Thamrin Amal Tomagola dengan secangkir teh, di acara diskusi yang disiarkan langsung oleh TvOne itu, tak luput dari pantauan Komisi Penyiaran Indonesia (KPI). Wakil Ketua KPI Eski Tri Rezeki Widianty menegaskan, insiden tak senonoh itu harus menjadi pelajaran bagi TvOne ke depan. Mereka harus mendefinisikan kembali siapa yang layak menjadi narasumber sesuai dengan Standar Operasional Prosedur (SOP) tentang pemilihan narasumber, terutama untuk acara live. “Kami sebenarnya sudah berkali-kali mengingatkan stasiun televisi untuk memilih

narasumber yang sesuai. Acara tadi pagi itu saya sudah lihat. Ini harus menjadi pelajaran bagi TvOne,” kata Eski yang juga menjabat sebagai Komisioner Isi Siaran di KPI ini. Menurut Eski, acara diskusi di TvOne tadi pagi berkaitan dengan organisasi kemasyarakatan (ormas). Namun televisi itu memilih narasumber dari Front Pembela Islam (FPI). Dia menilai, pemanggilan FPI itu lebih banyak sensasinya dari pada muatan pengetahuan. Seharusnya, dia melanjutkan, masih banyak ormas lebih baik lain yang bisa dimintai pendapat dan menjadi narasumber. “TV kita memang cenderung lebih banyak mengedepankan sensasi, dari pada informasi yang mendidik untuk publik. Jadi jangan hanya mengejar sensasi,” tuturnya. Elki mengaku, jika sudah seharusnyaTvOnememintamaaf kepada publik atas insiden yang tidak patut ditonton tersebut. Pihaknya berharap, agar siaran tv lebih mengedepankan muatan pengetahuan dibandingkan hanya mengejar sensasi semata. “Mereka berjanji akan mengevaluasi internal, dan berjanji ke depan tidak akan terjadi lagi,” pungkasnya. (mdk/tn)

Silakan Kritik Konvensi Demokrat Setelah Ada Aturannya JAKARTA (Waspada): Wakil Ketua Majelis Tinggi Partai Demokrat, Marzuki Alie mempersilakan siapapun melontarkan kritik terkait rencana konvensi yang akan digelar Partai Demokrat. Tetapi, dia berharap kritik itu disampaikan setelah Partai Demokrat resmi membuat aturan konvensi . Pernyataan ini dilontarkan Marzuki Alie menanggapi pernyataan mantan ketua Mahkamah Konstitusi, Mahfud MD yang dinilainya terburuburu mengkritik rencana konvensi Partai Demokrat.

“Saya sayang Pak Mahfud, makanya saya minta jangan dikritik dahulu. Kalau aturan (mekanisme) sudah keluar baru dikritik.Sekarang kan aturan itu belum ada, jadi kita lihat saja dulu seperti apa aturannya,” kata Marzuki kepada wartawan di Geduang DPR Jakarta, Jumat (28/6). Menurut Marzuki, bila sudah ada dan jelas aturan main nantinya, baru bisa terlihat apakah konvensi capres Demokrat sekadar akal-akalan atau bukan. “Kalau memang akal-akalan kan bisa dilihat dari sana benar

seperti itu apa tidak, “ujarnya sembari mengakui bahwa dia sendiri belum mengetahui mekanisme konvensi capres yang akan diterapkan ketua majelis tinggi, Susilo Bambang Yudhoyono. Apa lagi, aku Marzuki, dirinya jarang bertemu SBY karena kesibukan masing-masing dalam menjalankan tugas . Sebelumnya Mahfud mengatakan bahwa konvensi calon presiden (capres) akal-akalan saja, tidak bisa mendapatkan legitimasi karena aturan main itu belum ada.

Disinggung mengenai niatnya maju dalam konvensi, Marzuki mengatakan belum pasti. “Kalau dalam perjalanan nanti pikiran berubah, bisa saja saya kembali ke kampung,” katanya. Menanggapi survei terakhir LIPI mengenai elektabilitas Partai Demokrat menjadi 11,1 persen, Marzuki mengatakan hal itu menunjukkan kepercayaan kepada Partai Demokrat meningkat. “Persoalan partai mulai nggak ada, kepercayaan publik kembali lagi,”tukasnya. (aya)

Zakat Jadikan Hidup Lebih Berkah JAKARTA (Waspada): Bulan Ramadhan yang sebentar lagi t i b a m e m b e r i s e ma n g a t tersendiri bagi ummat Islam untuk berloba-lomba berbuat baik. Selain berpuasa dan sholat tarawih, ibadah yang paling banyak dilakukan adalah berzakat. Potensi zakat mal, zakat penghasilan, zakat fitrah, infak dan sodhaqoh dapat mencapai ratusan miliar. Sayangnya, masih banyak yang tidak dikelola dengan baik atau tidak tepat sasaran. “Makanya perlu diedukasi ke masyarakat bahwasannya beramal harta itu sangat bermanfaat kalau tepat sasaran,” kata Direktur Kemitraan Pos Kemanusiaan Peduli Umat (PKPU), Nana Sudiana, di sela kampanye menyambut Ramadhan 1434H, bersama elemen masyarakat lainnya, di Bundaran Hotel Indonesia, Minggu (30/6). Meski demikian, bukan

berarti masyarakat harus menahan-nahan keinginan untuk berzakat dan beramal sholeh saat Ramadhan. Hal itu terkait dengan kebiasaan memberi kepada para pengemis di jalanan. “Intinya silahkan beramal kapan saja, di mana saja dan kepada siapa saja. Tapi seandainya memungkinkan berbuat lebih jauh lagi bagi kebaikan ummat, tidak ada salahnya memilih lembaga amal yang dipercaya,” kata Nana. Direktur Utama PKPU, Agung Notowiguno, menambahkan, pesan utama dari kampanye ini, untuk menggugah semangat dalam menyambut bulan suci Ramadhan dan segera menunaikan zakat di awal Ramadhan. “Jangan ditahan-tahan. Kalau nafsu harus ditahan, tapi zakat dan sedekah jangan ditahan, biar hidup penuh keberkahan,” tandasnya.

PKPU sendiri menargetkan potensi zakat sebesar Rp45 miliar, naik Rp5 miliar dari tahun sebelumnya. Karenanya, pihak-

nya terus mengedukasi masyarakat untuk tidak menahan zakat yang menjadi hak kaum dhuafa. (dianw)

KPK Diminta Selidiki Pengadaan Pesawat Dari China JAKARTA (Waspada): Anggota Komisi III DPR RI dari Fraksi Gerakan Indonesia Raya (F Gerindra) Martin Hutabarat meminta Komisi Pemberantas Korupsi aktif menyelidiki dugaan penyimpangan dalam pengadaan pesawat MA-60 dari China. “Penyelidikan ini perlu guna memberi kepastian ada tidaknya potensi kerugian negara dalam pengadaan pesawat itu, “ujar Martin Hutabarat pada rapat kerja Komisi III dengan KPK, Kamis (27/6) di Gedung DPR Jakarta. Menurutnya, banyak pihak

selama ini mempersoalkan pengadaan 15 unit pesawat MA-60 dari China yang dioperasikan PT Merpati Nusantara Airlines karena diduga tidak clear dan sarat kepentingan orang tertentu. Martin berpendapat, yang perlu disoroti bukan hanya sistem keselamatannya saja yang mengkhawatirkan, tapi pengadaannya juga sejak awal sudah penuh kontroversi. “Saya berharap KPK aktif menyelidiki dugaan penyimpangan dalam pengadaan pesawat MA-60 dari China tersebut,” tukasnya.

Air Asia Hentikan Kerja Sama Dengan ANA Holdings Inc JAKARTA ( Waspada) : AirAsia hentikan kerjasama dengan ANA(All Nippon Airways) Holdings Inc. untuk operasional AirAsia Jepang. Penghentian kerjasama tersebut ditandai penandatanganan kedua belah pihak pada Selasa (25/6), Kerjasama yang dimulai dua tahun lalu dengan membentuk AirAsia Jepang ini, menghadapi berbagai tantangan. Cukup banyak isu yang mengakibatkan berakhirnya kerja sama, dari yang paling fundamental yakni perbedaan pendapat diantara pemegang saham mengenai bagaimana seharusnya bisnis berjalan berdasarkan manajemen biaya, hingga tidak adanya kesepahaman tentang lokasi pusat operasional AirAsia Jepang. AirAsia Berhad melalui AirAsia Investment Ltd. telah memiliki sebanyak 25.120 voting

share dan 23.880 non-voting share dengan nilai JPY 50.000 per saham, yang mewakili 49% saham di AirAsia Jepang. Penghentian kerja sama ini berupa pembelian seluruh saham AirAsia di AirAsia Jepang oleh ANA Holdings Inc. dengan nilai JPY 2.450.000.000 (atau sekitar RM80.475.150 berdasarkan kurs mata uang saat ini). Selain itu, semua pesawat, termasuk uang pembayaran sewa pesawat, yang dipinjamkan oleh AirAsia kepada AirAsia Jepang akan dikembalikan dengan batas waktu hingga 1 Nopember 2013. AirAsia Jepang akan menyelesaikan semua pembayaran tagihan dan menghentikan penggunaan brand AirAsia serta kegiatan operasional, termasuk penggunaan nama AirAsia Jepang per tanggal 1 Nopember 2013. Adapun pengoperasian penerbangan

AirAsia Jepang akan berjalan normal hingga 31 Oktober 2013. Setelah pengalihan saham dan pembayaran senilai yang disetujui, Perjanjian Pemegang Saham, Perjanjian Lisensi Brand, dan kontrak niaga lainnya antara pihak-pihak yang terkait akan dihentikan segera. CEO Grup AirAsia, Tony Fernandes mengatakan, menghormati ANA sebagai maskapai lokal terkemuka di Jepang, namun kini saatnya bagi kami untuk menentukan langkah sendiri dan fokus pada keahlian kami, yaitu mengelola Low Cost Carrier (LCC). ”Walaupun terjadi masalah biaya, brand AirAsia telah dikenal di kalangan pengguna jasa transportasi udara di Jepang, dan pertumbuhan yang kami lihat untuk bulan Juli dan Agustus sangat kuat di seluruh negeri. Saya tetap berfikir positif

mengenai perkembangan pasar di Jepang dan percaya akan ada kesempatan besar bagi LCC untuk berhasil, seperti yang telah dibuktikan oleh AirAsia X. Kami belum menyerah dan tetap ber-harap dapat merubah perjala-nan udara di Jepang serta kem-bali melayani masyarakat di sana,” kata Tony Fernandes dalam keterangan persnya yang diterima Waspada di Jakarta, belum lama ini. Menurutnya, kegiatan operasional AirAsia X, afiliasi AirAsia yang melayani penerbangan jarak jauh, tidak akan terganggu dengan penghentian kerja sama ini. ”AirAsia X akan tetap menyediakan layanan penerbangan menuju Jepang, termasuk rute penerbangan dari Kuala Lumpur menuju Tokyo (Haneda) dan Osaka (Kansai),” kata Tony Fernandes.(j02)


Luar Negeri

WASPADA Senin, 1 Juli 2013

A9

Serangan Atas Konvoi Pasukan Keamanan Di Pakistan, 16 Tewas PESHAWAR, Pakistan (AP): Satu bom mobil meledak di saat konvoi pasukan paramiliter melintasi kota Peshawar, Pakistan, Minggu (30/6) dan menewaskan sedikitnya 16 orang dan menciderai 42 lainnya, kata polisi. Sebagian besar korban yang tewas dan cedera adalah warga sipil. Bom tersebut mengenai satu kenderaan konvoi pasukan Korps Perbatasan, namun yang lainnya lewat dengan selamat, kata polisi Shafiullah Khan. Tidak jelas apakah itu serangan bom bunuhdiri atau ledakan di mobil yang dioperasikan dari jarak jauh. Ledakan itu merusak banyak mobil dan toko di daerah itu, menurut liputan siaran televise. Kenderaan Korps Perbatasan dikerahkan ke tempat kejadian untuk memberikan pertolongan setelah serangan, di saat polisi mengumpulkan bukti dari lobang yang ditimbulkan bom itu. Belum ada yang mengaku bertanggungjawab. Namun kecurigaan tertuju pada Taliban Pakistan. Kelompok itu selama ini melancarkan pemberontakan berdarah terhadap pemerintah selama bertahun-tahun yang telah menewaskan ribuan personil keamanandansipil.PeshawarterletakdiujungkawasansukuPakistan, kantor persembunyian utama Taliban di negara itu, dan telah diserang sejumlah pemboman selama beberapa tahun. Serangan di Peshawar terjadi di saat PM Inggris David Cameron berkunjung ke ibukota Pakistan, Islamabad. Cameron mengatakan kepada sempalannya dari Pakistan, Nawaz Sharif, bahwa Inggeris akan melakukan segala upaya untuk membantu memerangi ekstrimisme.(m23)

AS Minta Ekuador Tak Beri Suaka Kepada Snowden QUITO, Ekuador (Reuters): Presiden Ekuador Rafael Correa mengatakanASmemintanyauntuktidakmemberikansuakakepada mantan kontraktor Badan Keamanan Nasional (NSA) AS Edward Snowden dalam pembicaraan telepon yang dilakukan dengan Wakil Presiden AS Joe Biden. Correa mengatakan Sabtu (29/6), dia berjanji menghormati pendapatWashington dalam mengevaluasi permintaan itu. Negara Andea tersebut mengatakan, pihaknya tidak bisa memproses permintaan Snowden sampai dia sampai di Ekuador atau salah satu kedutaannya. Snowden, yang diburon AS karena membocorkan rincian program pengintaian lewat komunikasi yang dilakukan AS, diyakini masih berada di bandara Sheremetyevo di Moskow setelah meninggalkan Hongkong. Sambil memuji cara Biden yang baik berbeda dengan‘kecaman’ di Kongres AS yang mengancam akan memutus perdaganganEkuadorterkaitmasalahSnowden,Correamengatakan lewat televisi “Dia menyampaikan permintaan AS agar kita menolak permohonan suaka.” Biden yang berinisiatif melakukan telefon, kata Correa. “Ketika Snowden tiba di tanah Ekuador, jika telah sampai..tentu saja, pendapat pertama yang kita pertimbangkan adalah dari AS,” kata Correa.Seorang pejabat Gedung Putih yang menyertai Presiden Barat Obama dalam perjalanan ke Afrika, Sabtu membenarkan pembicaraan telefon tersebut. Kasus tersebut menjadi hal memalukan bagi pemerintahan Obama, yang sekarang menghadapi kecaman dari seluruh dunia karena program pengintaian yang dikenal sebagai Prism yang diungkap oleh Snowden. Satu majalah Jerman Sabtu, mengutip dokumen rahasia, yang melaporkan bahwa AS menyadap kantor-kantor Uni Eropa dan mengakses jaringan komputer internal UE, yang sepertinya akan menambah heboh soal program pengintaian AS tersebut. Correa mengatakan konsulat Ekuador di London mengeluarkan dokumenberizinbagiSnowden,kemungkinanhasildarikomunikasi dengan pendiriWikiLeaks Julian Assange, yang tinggal di kedutaan London setelah menerima suaka tahun lalu. Assange mengatakan Senin bahwa Snowden telah menerima dokumen pengungsi dari pemerintah Ekuador untuk memberikan jalur aman ketika dia meninggalkan Hong Kong menuju Rusia. Pemerintah Correa sebelumnya membantah hal ini.(m23)

Gelombang Udara Panas Di AS Ambil Korban Jiwa LASVEGAS, AS (CNN): Gelombang udara panas yang menggigit diperkirakan akan terus memanggang kawasan baratdaya AS mulai Minggu (30/6) sampai seminggu mendatang. Panas yang telah mencatat record di beberapa kota seperti Phoenix (119 derajat Fahrenheit, kira-kira 48 derajat Celsius) dan Lancaster, California (111 derajat F). Las Vegas mencatat panas 115 derajat F pada Sabtu. Pejabat sipil dan penanggulangan situasi darurat di baratdaya AS mengatakan, jika ada yang dikhawatirkan, inilah dia. Alasannya bukan hanya karena panas yang tinggi, tapi kenyataan bahwa cuaca tersebut akan bertahan, dan mungkin malah bertambah panas, dalam beberapa hari ke depan. Gelombang panas tersebut diperkirakan telah menyebabkan seorang lansia meninggal dunia di LasVegas. Paramedis menemukan pria itu dalam rumahnya, yang tidak memiliki AC, kata jubir Las Vegas Fire & Rescue Tim Szymanski. Dia meninggal karena serangan jantung dan panas diperkirakan menjadi penyebabnya, meski ahli forensic masih akan memastikan, kata Szymanski. Gelombang panas terjadi hanya beberapa minggu sebelum peringatan 100 tahun apa yang disebut Badan Cuaca Nasional ‘suhu udara terpanas di muka Bumi’ 134 derajat Fahrenheit (sekitar 56 derajat Celsius) yang melanda Greenland Ranch di DeathValley, AS, pada 10 Juli 1913. “Saya tidak khawatir pada orang-orang yang sudah lama tinggal di sini,” SersanTroy Stirling, jubir polisi di Lake Havasu, Arizona, dekat California.“Tapi wisatawan yang datang ke daerah ini, bahkan dari California Selatan, yang tidak biasa dengan panas menyengat seperti ini.”PerusahaanpenerbanganASterpaksamembatalkan18penerbangan Sabtudikarenakancuacapanas,katajubirToddLehmacher.Diamengatakan pesawat diperbolehkan lepas landas sampai 118 derajat F, tapi suhu meningkat sampai 119 derajat F di Phoenix. Badan Cuaca Nasional mengeluarkan peringatan soal cuaca panas untuk sebagian besar wilayah California, Nevada dan Arizona.Banyak peringatan panas diperkirakan sampai Selasa malam. Mulai Rabu, suhu akan menurun sampai beberapa derajat dan mendekati suhu normal.(m23)

Gema Internasional

Pemerintah Thai Umumkan Perombakan Baru Kabinet BANGKOK, Thailand (AP): Pemerintah Thailand yang saat ini mengalami kemunduran telah mengumumkan perombakan kabinet lagi setengah jalan dari masa jabatannya, dalam sebuah langkah luas dilihat sebagai upaya untuk menyelamatkan penurunan popularitas pemerintah. Jajaran baru Kabinet itu, yang diumumkan Minggu (30/ 6), dilakukan ketika pemerintahan PM Yingluck Shinawatra menghadapi setumpuk isu. Perombakan itu merupakan yang keempat kalinya sejakYingluck menduduki jabatannya Agustus 2011. Perombakan itu melibatkan 18 jabatan menteri, termasuk perdagangan penting, pertahanan dan kementerian pendidikan. Jurubicara pemerintah Teerat Ratanasevi mengatakan perombakan itu dilakukan untuk memungkinkan para menteri dengan keahlian yang sesuai untuk mengendalikan langkah strategis pemerintah. (m10)

The Associated Press

TENTARA INDIA TEMBAK MATI DUA WARGA KASHMIR. Para keluarga menangis dalam satu prosesi pemakaman salah seorang korban penembakan Irfan Nabi Gana di Markondal, 30 km di utara Srinagar, India, Minggu (30/6). Tentara India menembak mati dua orang dan mencederai seorang lainnya Minggu di Kashmir, yang merupakan bagian India, yang mengundang protes rusuh yang mengakibatkan lima tentara pemerintah cedera, kata sejumlah saksimata.

Filipina Tuduh China Ancaman Perdamaian Karena Kerahkan Kekuatan Militernya Di Laut China Selatan BANDAR SERI BEGAWAN, Brunei (ap/Antara/AFP): Filipina Minggu (30/6) menuduh China mengerahkan kekuatan ‘besar’ militerdiLautChinaSelatan,yang disengketakan,danmengingatkan dalamforumkeamanankawasan bahwa siasat raksasa Asia itu adalah ancaman terhadap perdamaian. Pernyataan Menteri Luar Negeri Filipina Albert Del Rosario itu memastikanbahwapening-katan pertikaianmenyangkutsalingklaim atas laut kaya sumber alam dan penting secara strategis tersebut kembalimenjadipusatpentingperundinganempathariAsia-Pasifik. “Del Rosario hari ini menyatakan sangat cemas atas militerasi yang meningkat di Laut China Selatan,” kata satu pernyataan pemerintah Filipina yang disiarkan pada hari pertama konferensi di ibu kota Brunei itu. Del Rosario mengatakan “kehadiran dalam jumlah besar ka-

pal-kapal militer dan paramiliter China “ di gugusan pulau dalam zona ekonomi ekslusif Filipina Beting Scarborough dan Beting Second Thoimas. Menurut laporan pers Minggu, gesekan antara China dan Filipina atas wilayah yang disengketakan di wilayah minyak dan gas laut yang kaya telah terjadi sejak tahun lalu. 10 negara anggota ASEAN berharap bisa membujuk Beijing untuk bergabung mengenai pembicaraan tentang Kode Etik yang diusulkan (CoC) tahun ini. Tetapi tindakan angkatan laut China telah membuat khawatir beberapa negara, khususnya Filipina dan Vietnam. Diketahui, Filipina menuduh China melanggar batas wilayahnya setelah tiga kapal China berkumpul hanya lima mil dari laut, di mana Filipina mempertahankan kekuatan militer kecilnya. Bulan ini, Filipina menggera-

Taman Gezi,namun berkembang menjadi lebih luas yaitu penentangan kepada pemerintahan PM Recep Tayyip Erdogan. Apa yang terjadi di Alun-alun Taksim,masyarakatduniasedang menyaksikan suatu aktivisme politik dalam negeri Turki sebagaimanadicontohkanolehparapemrotes yang mendemonstrasikan suatu bangsa yang tidak puas melalui internet selain juga di jalan-jalanyangmeluaskeberbagai kota seluruh Turki. Rangkaian peristiwa lagi-lagi mendemonstrasikan pengaruh yang tak terelakkan dari media sosial yang berdampak pada perilaku kolektif semasa kerusuhan politik, mengingatkan kita pada peristiwa revolusi yang pertama kalidicetuskandiAlun-alunTahrir, kota Kairo dua tahun lalu. Akhir-akhir ini, para peneliti di University of Washington menemukanbahwasemasaArab Spring media sosial memobilisasikan pemberontakan dan mem-

Kemenlu China bahwa dia tidak ‘nyaman’ untuk berkunjung ke China pada saat ini. Binay telah merencanakan akan berangkat ke Beijing untuk menyampaikan sepucuk surat dari Presiden Benigno Aquino III yang menyerukan kepada rekan sejawatnya Xi Jinping, untuk mengubah hukuman mati dari terpidana, seorang wanita berusia 35 tahun, menjadi hukuman seumur hidup. “China telah mengirimkan pesan yang sekarang ini menyebabkan tidak nyaman bagi saya berkunjung ke China,” kata Binay dalam satu pernyataan, yang menunjukkan rasa sedih atas sikap Beijing. Pemerintah Filipina tidak menanyai terpidana wanita, kata Binay, yang menambahkan bahwa dia ingin terbang ke China untuk ‘secara pribadi menyerukan “secara pribadi memohon belas kasihan.”ParapejabatChinatidak segera merespon kepada pernyataan Binay.(m10)

Pasukan Syria Didukung Jet Serang Homs, 6 Tewas BEIRUT, Lebanon (Antara News): Pasukan Presiden Syria Bashar Assad melancarkan serangan besar-besaran terhadap pemberontak di Homs, dalam usaha terbaru mereka untuk mengamankan poros hubungan Damaskus ke Laut Tengah. Para aktivis mengatakan jetjet dan mortir-mortir menggempur daerah-daerah pemberontak kota itu yang telah dikepung pasukan Syria selama setahun, dan tentara terlibat pertempuran dengan para petempur pemberontak di beberapa distrik. “Pasukanpemerintahsedang berusaha untuk menyerang (Homs) dari segala penjuru,” kata seorang aktivis yang mengaku bernama Abu Muhammad. Para aktivis menunjukkan ledakan kuat dan kabut asap putih membumbung dari apa yang mereka sebut distrik-distrik pemberontak dan mengatakan 6 orang tewas. Suara ledakan dan senjata api yang terkosentrasi juga terdengar. Media pemerintah Syria mengatakan militer ‘telah mencapai

kemajuan besar’ di daerah Khalidiyah.Serangan terhadap kota Homs setelah kemenangan-kemenangan militer pasukan Bashar, yang didukung para petempur Hizbullah Lebanon di desa-desa Provinsi Homs dan kota-kota yang dekat perbatasan Lebanon. Tiga pekan lalu para petempur Hizbullah memelopori penguasaankotaperbatasanQusair, satubekaspangkalanterdepanbagi penyelundupan senjata dan para petempur pemberontak ke Syria, dan pekan lalu merebut kota perbatasan lainnya, Tel Kalakh. Kemenangan-kemenanganitu telahmengkonsolidasikankekuasaanBasharatassatukoridordaerah yang membentang dari ibu kota DamaskusmelaluiHomskedaerah tradisionalsekteminoritasnyaAlawi dipegunungan yangmenghadap Medite1rania. Mereka juga menggusarkan para pendukung internasional pemberontak, yang dipimpin AS mengumumkanakanmeningkatkan dukungan militer. Arab Saudi

Media Sosial Dan Aksi Politik

PEMANFAATAN media sosial yang semakin luas dan mengandung humor politiktelah memberikan semacam efek virus ke sejagad raya, contoh nyata anda bisa mengetahuidalamsekejapadanya demonstrasi yang bertemakan demokrasi, kebebasan sosial dan politikdanberbagaibentuktujuan lainnya. Tersebarnya berbagai informasi seperti mengharapkan dukunganataujugamenghimpun kekuatan,gerakan,organisasidan lain sebagainya. Inilah yang terasakan saat ini jika anda rajin menengokatauakseskedalammedia sosial. Menarik sebagaimanaterjadi di Turki, ada informasi yang diposteddalamFacebookmengenai penggusuran Taman Gezi kota Istanbul. Macam-macam tanggapanyangmunculsetelahkerusuhan di Alun-alun Taksim yang saat ini telah masuk minggu ke empat yaitu suatu aksi massa yang tadinya menentang pemerintah kota Istanbul yang ingin menggusur

kan lebih banyak pasukan dan perlengkapannya berada dalam zona 200 mil laut tanpa pengecualian.China,yangtidakmengakui zona tersebut, mengutuknya sebagai ‘kependudukan ilegal.’ “Pernyataan yang di counterstrike adalah salah satu yang tidak bertanggungjawab.Kamimengutuk setiap ancaman penggunaan kekuatan,”kataDelRosario,kepada salah seorang wartawan di Brunei, setelah pertemuan para menteri luar negeri ASEAN. Batalkan kunjungan WapresFilipinamembatalkan satu lawatan Minggu ke China pada saat mana dia akan melakukan pendekatan final kepada PresidenChinaagarmenyelamatkan nyawa seorang pecandu narkoba Filipina yang menghadapi pelaksanaanhukumanmati,mengatakan Beijing tidak mendorong dia untuk melakukan kunjungan. Wapres Jejomar Binay mengatakan dia telah dijelaskan oleh

besarkanekspektasikeberhasilannya. Manusia yang berbagi kepentingan dalam demkrasi membangunjaringansosialyangluasdan mengorganisiraksipolitik. “Media sosial menjadi bagian yang kritis sebagai alat menuju kebebasan yang lebih luas”, sebagaimana dilaporkan oleh pemimpin riset, Philip Howard. Walaupunbanyakperbedaan dengan Arab Spring, ‘revolusi’ di Turkibaru-baruini jugamengandalkan internet untuk menyebarluaskankabaryangbelumpernah terjadi sebelumnya. Saat ini, apa yang diberikan para pemrotes yaituefek‘virus’yangsecarakonstan digunakan sebagai humor politik dan keinginan para pengunjuk rasa dan kemampuan memutar setiap langkah yang janggal pada saatadanyakesempatanmenampilkan sindiran dalam media sosial. Perlawanan terhadap penguasa semakin lebih cepat lagi-

lagi ibarat virus melalui on-line yang tiba-tiba telah mencapai global. Bangsa Turki tidak asing terhadapsensorkhususnyainternet yang diduga keras dilakukan oleh anti oposisi AK Party bertahuntahun. Tapi sekarang ini, bagi orang-orang yang ingin mencari informasi pada hari-hari pertama peristiwa unjuk rasa, cara yangterbaikialahmelaluiinternet. Bahkan video di-posted dan ditweeted dalam media sosial tersebut. Sindiran politik memiliki tradisi yang kuat di Turki, dan Erdogan dengan gaya pidatonya yang terus terang dan impulsif, dia sering menggambarkan para pemrotes sebagai perampok dan penjarah. Dia pun menganggap bahwaparapemrotesituberjuang untuk kepentingan orang lain. Berbicara media sosial, apresiasibesardiberikanpadaPresiden AS Barack Obama. Sang presiden bisa dikatakan sebagai pionir kampanye melalui media sosial

telah mempercepat pengiriman senjata-senjata canggih,kata sumber-sumber Teluk Persia. Intervensi oleh Arab Saudi, pendukung kuat pemberontak, dan kelompok Hizbullah membuat pemberontakan 27 bulan di Syria itu membagi Timur Tengah dalam garis sektarian. Negara-negara Arab Teluk, Turki dan Mesir mendukung pemberontak sementara Iran dan Hizbullah aktif membantu militer Bashar. Keluarga Bashar, yang memerintah Syria selama empat dasa warsa berasal dari sekte minoritas Alawi, bagian dari Syiah. Lebih dari 100.000 orang tewas dalam perang saudara itu,yang juga menyebabkan 1,7 juta orang mengungsi ke luar negeri dan empat juta orang terlantar di Syria. Harapan-harapan untuk menyelenggarakan konferensi perdamaian yang didukung AS dan Rusia memudar, dengan pemberontak enggan berunding karena mereka berada dalam militer yang defensif dan ketega-

pada saat kampanye pemilihan presiden tahun 2008. Obama menularkan slogan:“Yes,We Can” yang awalnya memobilisasi dukunganparakawulamudamelalui internet. Semenjak2008jaringansosial telah menjadi jalan yang panjang sebagaimanaterlihat dalamabad baru: “Arab Spring” khususnya di Mesir,dan sekarang bermigrasi ke Turki. Tahun 2012 ada sekitar 31 juta tweets mencurahkan perhatianpadakampanyepemilihan presidendiAmerikadibandingkan dengan hanya 1,5 juta saja empat tahun sebelumnya. Dewasa ini banyaksekaliwahanadansarana mediasosial sebagaitempatsuara seseorang untuk didengar. Jadi, “suara” anda mau didengar? Berbunyilah melalui media sosial, sepanjang anda tidak melanggar aturan perundangundanganyangberlakubaiksecara nasional maupun internasional. (Kosky)

ngan antara Moskow dan Washington yang berbeda pendapat menyangkut Syria. ParawargaSyiahIrakikutberperang membantu pasukan pemerintah Presiden Bashar al-Assad, kata Menteri Luar Negeri Irak Hoshyar Zebari dalam satu pernyataan, Jumat. Dia menegaskanbahwainibukankebijakan pemerintah Baghdad yang dipimpin Syiah. “Saya tidak membantah bahwa para petempur Syiah Irak ikut serta dalam petempuran di Syria, seperti halnya para petempur Sunni dariTeluk Persia melakukan tindakan yang sama di negara itu,” katanya dalam pernyataan yang disiarkan surat kabar Arab Raya, Al Hayat. “Tetapi itu bukan kebijakan pemerintah,” tambah Zebari, yangiasendiriadalahwargaKurdi yangberaliranSunni.Parapetempur dari gerakan Hizbullah Lebanon juga ikut bertempur membantu pasukan Presiden Bashar al-Assad, yang berasal dari sekte Alawi, satu bagian dari Syiah.

Pertemuan Menlu ASEAN Dimulai BANDAR SERI BEGAWAN, Brunei (Antara/PNA/Xinhua): PertemuanMenteriLuarNegeriPerhimpunanBangsaAsiaTenggara(ASEAN) dan serangkaian pertemuan terkait dengan menteri luar negeri mitra rembuk dan negara terkait dimulai di Brunei Minggu (30/6). Pertemuan tersebut dimulai Minggu pagi, dengan komunike bersama diperkirakan dihasilkan pada akhir kegiatan itu. “Saya pikir hal utama akan, pertama, apa yang pemimpin kita minta untuk melakukan di pertemuan puncak pemimpin terakhir (April), dan kedua, untuk menemukan cara-cara memperkuat keseluruhan perdamaian dan stabilitas di kawasan ini,” kata Menteri Luar Negeri dan Perdagangan Brunei Pangeran Mohamed Bolkiah dalam sambutannya. Topik diskusi diharapkan termasuk yang terkait dengan Petajalan untuk komunitas ASEAN, arah masa depan ASEAN dan hubungan eksternal ASEAN, menurut sekretariat ASEAN. “Kami sedang bekerja pada upaya untuk membangun, masyarakat yang dinamis dan berkelanjutan tangguh pada tahun 2015 dan potensi untuk memperkuat koordinasi serta kolaborasi antara ASEAN dan mitra dialog dalam bekerja menuju saling pengertian, dialog politik dan kerja sama yang baik,” kata Sekretaris Jenderal ASEAN Le Luong Minh sebelumnya. Pertemuan Menteri Luar Negeri ASEAN akan diikuti oleh Konferensi Pasca-Menteri, Forum Regional ASEAN ke20 dan Pertemuan Ketiga KTT Menteri Luar Negeri Asia Timur. Pertemuan diharapkan menjadi platform untuk diskusi yang melibatkan para menteri luar negeri ASEAN serta para menteri luar negeri dari negara-negara besar, termasuk Menteri Luar Negeri AS John Kerry, Menteri Luar Negeri Rusia Sergey Lavrov dan Menteri Luar Negeri ChinaWangYi. Mereka juga diharapkan melakukan pertemuan dwipihak dan multilateral di sela-sela pertemuan. Sebagian besar pertemuan akan ada sesi tertutup, tetapi laporan dapat diharapkan. Berbagai macam topik diharapkan akan dihadiri oleh para menteri luar negeri dalam diskusi mereka, seperti integrasi regional dan kerja sama, keamanan regional, pengelolaan sengketa maritim serta asap lintas batas. Mereka mungkin juga menyinggung pada situasi di Suriah dan denuklirisasi di Semenanjung Korea. “Forum Regional ASEAN adalah salah satu forum di mana semua negara peserta bisa duduk di sekitar meja,” kata Menteri Luar Negeri Indonesia Marty Natalegawa kepada wartawan Sabtu. Pangeran Mohamed Bolkiah mengatakan Minggu bahwa para tokoh pendiri ASEAN berpendapat “gagasan regionalisme sebagai jalan ke depan bagi perdamaian dan stabilitas mendapatkan dukungan.” Pangeran juga mengatakan dia berharap bahwa para menteri luar negeri ASEAN akan“memperjuangkan ide sentralitas ASEAN.” Pertemuan para Menteri Luar Negeri ASEAN di Phnom Penh tahun lalu gagal menghasilkan komunike bersama karena Filipina mencoba untuk mendorong isi pada sengketa teritorial dengan China di Laut China Selatan untuk dimasukkan dalam komunike. Para pemimpin ASEAN sejak menyerukan sentralitas ASEAN dalam kerja sama regional harus dihormati. “Mari kita berharap kali ini kita akan melakukan pertemuan lebih tenang daripada yang kita lakukan tahun lalu, dan saya tidak pesimis,” kata Marty.

China Tingkatkan Operasi Keamanan Di Xinjiang BEIJING, China (AP): China mengatakan akan meningkatkan operasi untuk mengatasi serangan-serangan menyusul kerusuhan selama beberapa hari terakhir di Provinsi Xinjiang. Kantor berita Xinhua melaporkan pihak berwenang tidak akan ragu-ragu menggunakan berbagai cara untuk menghentikan serangan teroris. Hal itu dilakukan guna menegakkan hukum dan menjaga stabilitas sosial di Xinjiang. Mengutip seorang pejabat senior Partai Komunis, Xinhua melaporkan pemerintah juga akan menjatuhkan hukuman berat bagi mereka yang terlibat. “Kitaakanmeningkatkantindakanuntukmenumpaskelompokkelompok teroris dan organisasi-organisasi ekstremis dan memburu orang-orang yang terlibat,” kata Yu Zhengsheng, anggota Komite Biro Politik Partai Komunis Sabtu (29/6). Yu juga menyerukan kepada warga untuk tetap tenang dan waspada. Seruan dikeluarkan sehari setelah lebih dari Klik 100 orang bersenjata tajam dan mengendarai sepeda motor menyerang kantor polisi di kota Hotan, Xinjiang. Pihak keamanan dilaporkan meningkatkan pengamanan di ibukota Xinjiang, Urumqi. Berbagai media Barat melaporkan militer menggelar latihan di jalan-jalan ibukota hari ini. Sebagian besar pusat kota ditutup karena digunakan latihan, antara lain melibatkan tank dan kendaraan tempur. Kerusuhan di wilayah Xinjiang telah menewaskan setidaknya 35 orang. Kerusuhan dipicu olehkonflikantaraduakelompok etnik, komunitas Uighur Muslim dan China Han. Banyak orang di antara penduduk minoritas Uighur tidak puas dengan kekuasaan tangan besi pemerintah. (m10)

Seorang Nenek Di Mexico Lulus SD Di Usia 100 Tahun MEXICOCITY,Mexico(Waspada): Seorang nenek di Mexico menjadi bahan pembicaraan di masyarakatsekitar.Gara-garanya perempuan bernama Manuela Hernandez itu merampungkan pendidikantingkatSDpadausianya yang ke-100. ManuelayanglahirJuni1913, terpaksa meninggalkan bangku sekolahdasar,dimanadiasempat belajar selama setahun, karena kondisikemiskinankeluargapada saat itu. Manuela harus bekerja untuk membantu menghidupi keluarga. Oktobertahunlalu,diamendaftar lagi di salah satu SD di kawasan Oaxaca. Dia melakukan itu atas dorongan salah satu cucunya.Dandiusianyayangke100,Manuelamendapatkanstatus ‘lulusSD’.Tentunyaprestasiyang menterengmengingat usiayang sudahrentadanstatistikdiOaxaca yangmanalebihdariseparuhpen-

duduknya tidak lulus SD. “Saya sangat suka dengan kegiatansekolah,namunsayasaat itutidakbisamelanjutkanbelajar,” kata Manuela mengingat masa lalunya yang suram. Meski usianya sudah 100 tahun, Manuela

mengakumasihcukupbugaruntuk belajarlayaknyamuridSD.Bahkan diajugamasihbisame-lakukanhalhal lain. “Tahundepansayamasihbisa mencuci dan menyetrika,” ujar Manuela.(vn/r-m10)


Sport Rangers Lepas Cesar

A10

WASPADA Senin 1 Juli 2013

LONDON (Waspada): Queens Park Ranger (QPR) yang terdegradasi dari Liga Premier akhir musim lalu, memastikan bakal melepas kiper utamanya Julio Cesar.

zimbio.com

Lyon Terpaksa Lego Martial PARIS (Antara/AFP): Tim yang baru promosi Ligue 1 Prancis, AS Monaco, telah mendatangkan penyerang berusia 17 tahun Anthony Martial dari Olympique Lyon dengan biaya transfer lima juta euro. Menurut manajemen Lyon, Minggu (30/ 6), keputusan untuk melego pemain Prancis U-18 itu terpaksa diambil karena alasan keuangan, setelah Les Gones gagal mendapatkan pembeli untuk striker senior Bafetimbi Gomis. Martial gabung Lyon saat masih berumur 14 tahun dan menandatangani kontrak profesional pada Agustus 2012. Tapi dia hanya tiga

kali membela Lyon di liga domestik dan sekali di Liga Europa. Monaco diharapkan dapat menjadi penantang juara bertahan Paris Saint Germain, setelah menandai promosinya dengan mendatangkan sejumlah pemain mahal, termasuk membeli penyerang Kolumbia Radamel Falcao dari Atletico Madrid. Namun mereka akan memulai musim baru dengan minus dua angka setelah mendapat hukuman dari panitia Ligue 1, menyusul kerusuhan penonton pada pertandingan divisi dua melawan Le Mans musim lalu.

Menurut Harry Redknapp, manajer Rangers, kiper berumur 33 tahun itu positif akan meninggalkan Loftus Road ke klub lebih besar untuk mengamankan posisinya sebagai kiper nomor satu Brazil di Piala Dunia 2014. “Julio Cesar dipastikan cabut. Dia kiper utama Brazil dan tidak pantas bermain di Championship, karena posisinya bisa terancam,” beber Redknapp lewat talkSPORT, Minggu (30/6) AS Roma dan Arsenal disebut-sebut paling berpeluang mendapatkan mantan kiper Inter Milan. Namun Roma yang terdepan, karena Cesar sangat cocok dengan kehidupan di Italia. Pemain bernama lengkap Julio Cesar Soares de Espindola tanpa masalah ketika tujuh tahun hidup di Negeri Pizza ketika membela I Nerazzurri pada

2005-2012. Istri Cesar, Susana Werner (foto kiri) beserta sepasang anak mereka, pun demikian. Werner malah lebih paham lagi dengan lifestyle Italia, karena pernah mendampingi mantan suaminya Luiz Nazario Ronaldo (foto kanan) hidup di Milan pada 1997-1999. Dorongan artis dan model seksi berusia 35 tahun itu tentu sangat berpengaruh dalam keputusan masa depan Cesar. Apalagi, pendekatan Roma lebih serius, sebab sudah kontak langsung dengan manajemen Rangers. Cesar sendiri tidak menampik adanya pembicaraan antara dirinya dengan Il Gialorossi. “Saya sudah membaca di beberapa surat kabar Italia bahwa AS Roma tertarik untuk merekrut saya,” ungkapnya. “Itu tentu menggembira-

kanku. Sebab setelah proses perpindahan yang penuh masalah dari Inter ke QPR musim lalu, praktis hanya Roma yang menyatakan ketertarikannya kepada saya,” ujarnya lagi. Prestasi puncaknya juga terjadi saat membela Inter. Scudetto Liga Seri A direbutnya selama lima musim beruntun pada 2005/06 hingga 2009/10. Cesar cs malah meraih treble winner pada 2009/2010 dari arena Liga Champions, Seri A dan Coppa Italia. “Itu momen terbaik dalam karir saya. Saya tidak akan melupakan sepakbola Italia,” kenang Cesar. Namun Arsenal juga sudah siap mengajukan tawaran. Bekal utama The Gunners untuk memboyongnya adalah kesempatan mentas di Liga Champions 2013/2014. Fiorentina bisa menjadi kuda hitam, setelah mengatakan tertarik untuk memboyong kiper yang membawa Brazil mulus menembus final Piala Konfederasi 2013 tersebut. (m15/goal/tkst/fi)

Pesta Gol Debut Pep MUNICH, Jerman (Waspada): Debut Pep Guardiola sebagai pelatih baru Bayern Munich, Sabtu (Minggu WIB), ditandai dengan pesta gol 15-1 atas tim gabungan fans lokal yang menjadi lawan eksibisi Toni Kroos cs. Setelah unggul 3-0 pada babak pertama, pasukan Pep mencetak selusin gol tambahan di babak kedua di antaranya melalui Kroos, Patrick Weihrauch, Julian Green, Franck Ribery, dan Mitchell Weiser. Weihrauch yang bakal dipromosikan ke tim utama, memborong empat gol, sedangkan Green mencatat hatrik. Kroos juga tampil cemerlang setelah pulih dari cedera yang melilitnya hampir sepanjang musim lalu. Namun menurut kapten Philipp Lahm, Die Roten masih butuh waktu untuk beradaptasi dengan sentuhan Pep. “Kami butuh waktu untuk terbiasa dengan Guardiola, tapi itu tak akan lama. Kami semua memberikan

perhatian pada apa yang terjadi di tim,” klaim Lahm melalui Bild. Lahm merasa akan banyak perubahan dalam tim, tetapi itu tidak masalah. “Pramusim masih panjang, kami akan memanfaatkannya. Saya tidak khawatir tentang hal itu,” tekad bek sayap andalan Bayern dan Timnas Jerman itu. “Dia (Pep) begitu komunikatif sepanjang waktu, juga banyak berbicara. Dia ingin kami mengerti dia secepat mungkin, banyak hal akan berubah,” tambah Lahm. Mantan entrenador Barcelona berusia 42 tahun itu dikontrak tiga tahun oleh FC Hollywood, yang musim lalu meraih treble winner dari arena Liga Champions, Bundesliga dan Piala Jerman bersama pelatih Jupp Heynckes. “Saya telah mengalami banyak pergantian pelatih. Ini juga bukan sesuatu yang luar biasa bagi saya, semua bagian

PELATIH baru Pep Guardiola (tengah) terus menggenjot fisik para pemain Bayern Munich di Allianz Arena Stadium. -APdari pekerjaan,” jelas Lahm. “Ini seperti saat seseorang

mendapatkan bos lain di perusahaan lain. Hal yang berbeda

tiba-tiba menjadi lebih penting, tapi terlalu dini untuk menarik

kesimpulan,” katanya menambahkan. (m15/vvn/bild)

Gomez Bagus Bagi Viola

AP

MARIO Gomez (kiri) musim lalu kalah bersaing dengan Mario Mandzukic di Munich.

MUNICH (Waspada): Fiorentina secara terbuka telah menyatakan tertarik untuk mendatangkan Mario Gomez dari Bayern Munich pada bursa transfer musim panas ini. Menurut Luca Toni, striker senior Fiorentina, Gomez penyerang kelas atas dengan penampilan gemilang dan sangat bagus jika diboyong La Viola. “Kita bicara mengenai pemain fantastis. Kita harus lihat bagaimana dia bisa beradaptasi dengan sepakbola Italia, tapi dia pemain kelas atas,” tegas Toni, seperti dikutip dari Football Italia, Minggu (30/6). “Saya tak tahu apakah kedatangan dia bisa membuat kami berpeluang meraih scudetto, tapi dia salah satu striker terbaik di

dunia,” tambah penyerang veteran Italia itu. Gomez musim lalu kalah bersaing dengan bomber baru Bayern asal Kroasia, Mario Mandzukic. Kedatangan pelatih anyar Josep Guardiola menggantikan Jupp Heynckes di Allianz Arena, pun belum memberikan jaminan striker Jerman itu bakal kembali menjadi pilihan utama di garis serang The Bavarians. Karenanya Gomez kembali mengisyaratkan untuk hengkang, kendati kontraknya baru akan berakhir pada Juni 2016. Ingin bermain secara regular untuk mendapatkan tempat di skuad Der Panzer pada Piala Dunia 2014, menjadi alasan utamanya.

Musim lalu Gomez hanya 21 kali membela FC Hollywood di Bundesliga, 15 di antaranya turun dari bangku cadangan. Namun ketajamannya tak luntur setiap kali dimainkan. Potensi ‘membunuh’ Gomez itu membuat La Viola tertarik mendatangkannya ke Artemio Franchi. “Gomez merupakan salah satu pemain yang membuat kami tertarik,” beber Manajer Umum Fiorentina, Sandro Mencucci. Untuk membuka jalan ke sana, Mencucci melalui La Gazetta dello Sport mengaku, siap melego Stevan Jovetic, yang musim lalu menjadi sumber gol utama Si Ungu. Juventus tetap menjadi klub yang paling serius membajak

Jovetic, meskipun juara dua tahun beruntun Liga Seri A itu baru saja mengontrak striker Carlos Tevez dari Manchester City. Super Juve dikabarkan siap menebus klausul bomber berumur 23 tahun itu dengan nilai 30 juta euro. Tetapi Mencucci mengaku, pemilik Fiorentina tak akan senang bila pemain andalannya mendarat di Turin. “Jovetic ke Juventus? Kami tidak terlalu memikirkan uang. Klub mana pun bisa saja membelinya,” jelasnya. “Tetapi harus diakui, keluarga DellaValle (pemilikViola) tidak akan senang jika Jovetic memutuskan untuk pindah ke Juventus,” pungkas Mencucci. (m15/goal/fi/lgds)

Rio Naik Podium GP2 SILVERSTONE, Inggris (Waspada): Prestasi gemilang digapai pebalap Indonesia, Rio Haryanto. Dalam GP2 seri Inggris Raya di Sirkuit Silverstone, Minggu (30/6), Rio untuk pertama kalinya menapaki podium setelah menjadi runner-up race kedua. Hasil tersebut sekaligus menjadi pencapaian terbaik Rio sejak berkiprah di kancah GP2 musim lalu dengan total 35 lomba. Remaja berusia 20 tahun itu secara keseluruhan tampil sangat baik di Silverstone. Setelah finish ketujuh di sesi kualifikasi, pebalap Barwa Addax Team itu juga mendapatkan posisi sama pada balapan pertama sehari sebelumnya. Rio pun telah membuat rekor tersendiri karena sebelumnya cuma sekali finish di posisi 10 besar kala menduduki peringkat sembilan di Barcelona. Di race kedua, Rio bahkan tampil lebih baik dengan catatan waktu 37 menit 26,041 detik. Podium utama direbut Jon Lancaster (Hilmer Motorsport) dengan selisih 6,513 detik untuk memuaskan publik tuan rumah. Torehan enam poin di race pertama dan 12 di race kedua di Silverstone ini membuat koleksi angka Rio bertambah menjadi 20. Untuk sementara, Rio masih berada di urutan 17 klasemen sementara. Berikutnya, Rio akan kembali berpacu di Sirkuit Nuerburgring, Jerman, 5-7 Juli nanti. (m33/f1live)

f1live

PEBALAP Indonesia Rio Haryanto naik podium kedua GP2 Inggris di Sirkuit Silverstone, Minggu (30/6).

Pecatur Sumut Gagal Sapu Bersih JAKARTA (Waspada): Tim catur Sumut gagal meraih hasil maksimal pada babak pertama nomor klasik kelas terbuka Kejuaraan Nasional (Kejurnas) Catur ke-43 di Asrama Haji, Pondok Gede, Jakarta, Minggu (30/6). Dari tujuh pecatur Sumut yang turun di babak pertama, lima di antaranya sukses menorah kemenangan. M Johan Goliong, memegang bidak putih di meja 87, sukses meraih kemenangan pertama tim catur Sumut dengan menghentikan atlet Maluku Utara. Pitra Andika, bermain di meja 16, menyusul hasul mengandaskan Hard Rusen (Sulut) pada langkah ke-36. Kemenangan Sumut berlanjut kala Maruhum EN Manalu mengalah-

Waspada/Yuslan Kisra

PITRA Andika (kiri) menghadapi Hard Rusen (Sulut) pada babak pertama catur klasik nomor terbuka Kejurnas Catur 2013 di Asrama Haji, Pondok Gede, Jakarta, Minggu (30/6). kan IWayan Ekananta (Bali) dan Sarmadoli Siringo-ringgo menghentikan M Syafri Simamora (Lampung). Kemenangan mengesankan

juga mampu ditoreh Sabar Tobing yang di luar dugaan sukses menghentikan langkah NM Endang Adrian (Babel). Sayangnya, hal tersebut tidak diikuti Roy

Charles Marpaung yang kandas di tangan Sugeng Rahadi (Jateng) dan Marihot Simanjuntak yang harus mengakui keunggulan pecatur asal Gorontalo. “Ini baru babak pertama, makanya belum bisa komentar banyak. Masih panjang perjuangan yang harus dilalui,” kata Pitra Andika kepada Waspada. “Permainan masih akan ramai. Kami yang menang belum bisa menjamin akan terus mulus. Begitu pula dengan teman yang mengalami kekalahan,” pungkas Pitra, pecatur dari tim Mikroskil. Peringkat atas belum menemui kendala berarti. IM Tirta Chandra Purnama, unggulan pertama, menang atas Pulan Purnabowo (Lampung). Begitupula peringkat kedua yang diduduki GM Cerdas Barus. (yuslan)

BBC A Kampiun Kejurcab PBSI T Tinggi TEBINGTINGGI (Waspada): Bagelen Badminton Club (BBC) menjadi juara klub pada Kejuaraan Cabang PBSI KotaTebingtinggi dengan menaklukkan juara bertahan PB Bengawan 3-2 di GOR Jl Thamrin, Sabtu (29/6) malam. Dua partai ganda dimenangkan BBC, sedangkan tunggal dan ganda usai 80-90 tahun direbut PB Bengawan. Penentu kemenangan BBC direbut Angga/Yusuf yang mengalahkan Edi/Peranginangin. Ketua Harian KONI Tebingtinggi, Chaidir Chandra, meminta agar PBSI fokus dalam pembinaan atlet bulutangkis usia dini. Ketua Panitia Kejurcab, M Syofian, mengatakan kegiatan ini sudah sesuai kalender kerja PBSI dan berlangsung sesuai harapan. Juara tunggal usia dini putra: Taufik Hidayat (PB Mandiri), Maulana (PB Sentosa), Anje (PB Baja), Annasrul (PB Baja), sedangkan usia dini putri: Alfira (PB BBC), Nurul Ijabi, Johana (PB Mandiri), dan Stepani Ong (SD Djuanda). Tunggal anak anak putra: Irwan Effendi (PB Baja), Wahyu Ruanda (PB Mandiri), Shanda Amalia (PB Mandiri), dan M Dewa (PB Mandiri). Tunggal anak anak putri: Dewi (PB Baja), Joy Hasana (PB Baja), Yola (PB Manggis), dan Aura (PB Baja). Tunggal pemula putra: Fajar Siddiq (Alwashliyah), Dani (PB Baja), Faisal (PB Baja), Maulana Simatupang (Pabatu). (a09)


Sport

WASPADA Senin 1 Juli 2013

Tevez Masih Utang Kerja Sosial 250 Jam TURIN, Italia (Waspada): Pindah ke Juventus dari Manchester City, Carlos Tevez ternyata masih punya utang yang belum dilunasinya di Inggris, yakni hukuman kerja sosial selama 250 jam yang dijatuhkan pengadilan April lalu. Hukuman itu merupakan ganjaran atas pelanggaran lalu lintas yang dilakukan suami Vanessa Mansillo (foto) itu. Tevez tertangkap basah mengemudi saat masih dalam masa percobaan larangan mengendarai mobil pribadi. Padahal salah satu dasar keputusan striker Argentina itu keluar dari Inggris karena ingin menghindari hukuman tersebut. Namun menurut pengacaranya, Gwyn Lewis, bomber berjuluk Fuerte Apache itu sama sekali tidak bermaksud demikian.

“Tak ada regulasi yang diabaikan. Kami atas nama tuan Tevez menyatakan tidak akan menghindar dari hukuman,” dalih Lewis melalui Daily Mail, Minggu (30/6). Tevez punya waktu untuk menyelesaikan hukuman kerja sosialnya dalam 12 bulan terhitung April 2013 sampai April 2014. Jika tidak menuntaskannya, dia bisa dijebloskan ke penjara selama enam bulan. Bomber berumur 29 tahun itu diboyong Super Juve dari City dengan nilai transfer •9 juta atau setara Rp116 miliar, plus •6 juta sebagai bonus penampilan. Meski sempat muncul kontroversi terkait pemberian nomor 10 kepada Tevez sepeninggal striker legendaris Alessandro Del Piero, penggemar Juve malah memborong jersey

mantan penyerang Manchester United itu. Juventini, julukan tifosi The Old Lady, ternyata sangat antusias menyambut kedatangan ayah dari Florencia dan Katia, hasil perkawinan Tevez dengan Vanessa tersebut. Corriere dello Sports seperti dilansir Football Italia, Minggu (30/6), mengklaim bahwa kaus dengan nama Tevez terjual di Juve Store sebanyak 95 persen dalam tiga hari terakhir. Fenomena Tevez berbanding terbalik dengan Nicklas Bendtner. Media Denmark mengabarkan, Juve Store tak mampu menjual kostum penyerang pinjaman dari Arsenal itu. Bendtner sendiri musim lalu hanya 10 kali membela Juve dengan tanpa satu gol pun. Di Manchester, kepergian Tevez ke Turin membuat mana-

jemen Citizens terpaksa kerja keras mencari penggantinya. Manajer anyar City Manuel Pellegrini sampai gerilya ke Spanyol untuk merayu striker Sevilla Alvaro Negredo, supaya mau mengikuti jejak winger Jesus Navas. Pellegrini akan berusaha merekrut Negredo dengan klausul pembelian £18 juta, meski durasi kontraknya masih empat

A11 Dailymail

tahun lagi di Sevilla. Radar City juga mengarah pada penyerang asal Paraguay, Oscar Rene Cardozo Marin, yang sudah enam musim memperkuat Benfica. The Eastlands dikabarkan siap merogoh kocek 14,5 juta pound atau sekira Rp220 miliar demi Cardozo, yang musim lalu mengemas 33 gol bersama Benfica. (m15/vvn/dm/fi/sun)

Pembuka Sempurna PSMS Hancurkan PSSB 4-1 MEDAN (Waspada): Bagi PSMS Medan, hasil laga awal putaran kedua Divisi Utama Liga Prima Indonesia Sportindo (LPIS) 2013 berakhir sempurna. Menjamu PSSB Bireuen di Stadion Kebun Bunga, Minggu (30/6), PSMS menang telak 4-1. Tampil dengan komposisi berbeda, Saktiawan Sinaga dan kawan-kawan tampak masih terlalu tangguh bagi tim tamu. Sayang, serangkaian peluang emas yang didapat tuan rumah masih gagal membobol gawang PSSB yang dikawal M Nazar. Beruntung, PSMS masih mampu mencetak gol di menit 35 ketika Edy Syahputra lolos dari kawalan barisan belakang

PSSB. Terlalu fokus pada sosok Saktiawan yang juga kapten tim, lini pertahanan M Rizal cs lengah hingga membiarkan Edy berdiri bebas. Tanpa ampun, sontekan Edy menaklukkan kiper lawan dan membuka skor PSMS. Setelah sesekali memberi kejutan di babak pertama, PSSB akhirnya berhasil mencuri gol. Skor imbang 1-1 setelah Romy Agustiawan salah antisipasi

hingga membuat Rahmat Ibra meneruskan bola ke dalam gawang Oki Rengga yang mengisi tempat Yuda Andika di bawah mistar gawang PSMS. Selanjutnya, Donny F Siregar cs mengatur irama lebih tenang guna mengubur ambisi PSSB yang hendak mencuri poin tandang. Ternyata, kombinasi Donny didukung Zulkarnain, Madya Siregar, dan Edy Syahputra di lini tengah membuahkan tiga gol tambahan bagi skuad Ayam Kinantan. Menit 63, Edy Syahputra pun mencetak gol keduanya bagi tuan rumah lewat sundulan kepala. Tak lama berselang, pelatih

H Edi Syahputra menarik Saktiawan untuk memasukkan M Safri Koto. Striker muda jebolan PON Sumut ini bahkan menyumbangkan gol ketiga bagi PSMS di menit 75. Sebagai penutup pesta kemenangan Ayam Kinantan, sepakan keras Donny F Siregar gagal diantisipasi M Nazar yang harus memungut bola dari jalanya untuk keempat kali. Dari luar kotak penalti, tendangan keras Donny melewati kepala Nazar. Uniknya, bola tersebut menyentuh permukaan tanah yang kurang rata sehingga berbelok arah sekaligus mengecoh kiper lawan. Pada Kamis (4/7) mendatang, PSMS akan kembali bertanding dengan menjamu PSBL Langsa di Stadion Teladan Medan. (m17)

Waspada/Austin Antariksa

KIPER PSSB, M Nazar, berusaha menguasai bola sebelum disontek gelandang PSMS Madya Siregar (2 kanan) dalam lanjutan Divisi Utama LPIS di Stadion Kebun Bunga Medan, Minggu (30/6).

Eddy Sofyan Coreng Sumut Soal Maradona

Waspada/Dedi Riono

TIM juara festival sepakbola Bintang Johor Cup III diabadikan bersama seusai penyerahan hadiah dan trofi, Minggu (30/6).

SSB Tasbi, Karisma Kampiun Bintang Johor Cup III MEDAN (Waspada): SSB Tasbi menjuarai kategori kelompok umur U-11 dan U-13 dalam Festival Sepakbola Bintang Johor Cup III di Lapangan Kelapa Kuning, Jl STM Ujung Medan, Minggu (30/6). Tasbi menjadi kampiun U13 setelah menaklukkan SSB Rajawali lewat adu penalti 2-0 dan kembali meraih kemenangan atas SSB Rajawali pada kategori U-11 dengan skor 1-0 berkat gol semata wayang dari Egy Maulana Fikri. SSB Karisma juga tampil juara dengan mengungguli SSB Gumarang Medan pada kategori U-12. Karisma meraih kemenangan tipis 1-0 hasil gol cetakan Arya. Posisi ketiga diduduki tuan rumah SSB Bintang Johor yang mengungguli Sejati Pratama 2-1. Festival sepakbola yang mempertandingkan tiga kelompok umur itu resmi ditutupWakil Ketua Klub Bintang Johor FC, Irsal Fikri SSos. Irsal turut memberi apresiasi kepada ke-64 SSB

di Sumut yang telah berpartisipasi sejak 27 Juni lalu. “Festival Bintang Johor Cup sudah digelar sebanyak tiga kali. Ini menjadi bukti SSB Bintang Johor sangat mendukung peningkatan pembinaan pemain

usia dini lewat kompetisi yang rutin, mengingat pembinaan tidak cukup hanya latihan saja, melainkan juga dibutuhkan kompetisi untuk lebih menguji mental pemain,” ucap Irsal. (m42)

MEDAN (Waspada): Wakil Ketua DPRD Medan, Ir H Kamaluddin Harahap MSi, menegaskan H Eddy Sofyan yang juga Ketua Umum Badan Sepakbola Rakyat Indonesia (Basri) Pusat telah berbohong dan mencoreng marwah masyarakat Sumut. Hal ini terjadi karena Eddy terkesan buang badan atas sikapnya yang membatalkan kunjungan Diego Armando Maradona ke Medan. Padahal, panitia lokal telah menyiapkan segala keperluan kedatangan legenda sepakbola dari Argentina itu dengan menggelontorkan dana Rp160 juta untuk biaya booking dua hotel berbintang di Medan, izin keramaian dan keamanan serta izin Stadion Teladan. “Jadi, kenapa Eddy Sofyan itu seenaknya menyatakan pelaksanaan keamanan untuk Maradona tidak siap?!” tanya pena-

sehat panitia lokal kedatangan Maradona ke Medan itu, Minggu (30/6). Ditambahkan, pihak kepolisian maupun jajarannya di Medan bisa marah kalau Eddy Sofyan menuding keamanan di Medan tidak kondusif. Padahal kegiatan lain yang lebih besar,

Jalan Santai Keluarga Bersama Ngogesa

Problem Catur

TTS TOPIK

Waspada/Abdul Khalik

GUBSU Gatot Pujo Nugroho bersama Wagubsu HT Erry Nuradi dan Kasdam I BB Brigjen I Gede Sumarta melepas peserta gerak jalan HUT Kota Tebingtinggi ke 96, Minggu (30/6). jadi pusat pertumbuhan ekonomi dan Tebingtinggi harus mengambil kesempatan. Ratusan hadiah lucky draw

juga diserahkan kepada peserta gerak jalan dengan hadiah utama berupa satu unit sepeda motor. (a09)

P BRANDAN (Waspada): Sebanyak kurang lebih empat ribu peserta Jalan Santai Keluarga 2013 bersama Bupati Langkat H Ngogesa Sitepu SH memadati Lapangan Sepakbola Kampung Baru, Pangkalanberandan, Minggu (30/6). Acara yang diprakarsai PK Golkar Kec Babalan, PK Golkar Kec Sei Lepan, dan tim relawan GSC ini digelar menyambut datangnya bulan suci Ramadhan. Peserta pun dilepas Bupati Langkat, H Ngogesa Sitepu, sebelum melalui rute Jl Cempaka,

Sudoku

Jawaban di halaman A2.

MENDATAR

5

4

3

2

1 A

B

C

D

E

F

G

H

undian pemenang hadiah utama berupa satu unit motor bike yang kemudian dimenangi Ny Ginting, warga Jl Tanjungpura Pangkalanberandan. Peserta jalan santai itu pun didominasi kaum ibu rumah tangga dan pelajar. Hadir di antaranya Ketua DPW PAN Sumut Syah Afandin atau akrab disapa Ondim, tokoh masyarakat Teluk Aru H Syarifuddin Basyir, Plt Sekda Langkat Indra Salahuddin, Camat Babalan Faizal Rizal Matondang, dan lainnya. (c01)

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan dalam waktu lima menit. Jawabannya di halaman A2 kolom 1.

8

6

Melati, Stasiun, Imam Bonjol, Jl Babalan, Jl Masjid, Jl Sutomo, dan kembali ke garis finish di Kampung Baru. Ketua Panitia, M Idris Nasution, melaporkan kegiatan berjalan sukses berkat kerjasama masyarakat dan panitia. Dalam laporan tersebut, Idris menyebutkan acara jalan santai terbesar yang pernah dirasakan masyarakat Pangkalanberandan itu juga menyediakan 300 buah hadiah menarik. Pada kesempatan itu, Ngogesa langsung mencabut kupon

UMUM SERB A ““ANG” ANG” SERBA

Putih melangkah, mematikan lawannya lima langkah.

7

tia, kami akan gugat Eddy Sofyan,” sebut Bendahara Panitia, Magdaluna Lubis. Manajemen Hotel JW MarriottjugabersiapmenggugatEddy Sofyan karena telah melanggar MoU (nota kesepahaman) antarkeduanya dengan pembatalan secara sepihak. (m17)

-Waspada/Chairil Roesli-

Gerak Jalan HUT Tebingtinggi ngamangaraja, Diponegoro, DI Panjaitan hingga finish di Jl Sutomo lagi. Kegiatan juga dirangkai upaya pemecahan rekor Museum Rekor Indonesia (Muri), yakni jumlah warga terbesar mencuci tangan. Dilaporkan, massa yang terkumpul mencuci tangan mencapai 12 ribu orang. Gubsu mengatakan agar warga Kota Tebingtinggi mempersiapkan diri menghadapi pembukaan dua kota baru pendukung ekonomi, yakni Kualanamu dan Sei Mangkei. Dikatakan, dua daerah tersebut akan

mahal bila tidak mengklarifikasi serta mengganti uang panitia lokal,” timpal panitia lainnya, Ahmad Riyadi. “Nama besar Medan telah tercoreng atas sikapnya itu. Karena itu, bila dalam tempo sepekan tidak memberi klarifikasi maupun mengganti uang pani-

BUPATI Langkat H Ngogesa Sitepu didampingi Ketua DPW PAN Sumut Syah Afandin mengumumkan pemenang lucky draw Jalan Santai Keluarga 2013 di Lapangan Sepakbola Kampung Baru, Pangkalanberandan, Minggu (30/6).

Puluhan Ribu Massa Ramaikan TEBINGTINGGI ( Waspada): Puluhan ribu massa meramaikan gerak jalan sehat menyambut HUT Kota Tebingtinggi ke 96, Minggu (30/6). Peserta dilepas Gubsu Gatot Pujo Nugroho dan Kasdam I BB Brigjen I Gede Sumarta serta Wali Kota Tebingtinggi Ir H Umar Z Hasibuan MM dari Jl Sutomo. Hasil pantauan, gerak jalan sehat ini merupakan yang terbesar sepanjang adanya kegiatan tersebut beberapa tahun belakangan. Rute peserta menyusuri jalan sepanjang 4 km, mulai Jl Sutomo, Suprapto, AYani, Sisi-

seperti pertemuan APEC SOM III berlangsung aman. “Kalau Medan tidak aman, bagaimana bisa menggelar pertemuan APEC SOM tersebut?!” ketus Ketua Asosiasi Sepakbola PSSI Sumut itu lagi. “Atas sikapnya itu, Eddy Sofyan diklaim harus ‘membayar’

1. Lapisan udara yang melingkupi bumi; Langit. 4. Pohon palem hutan, daunnya dapat dianyam untuk tampi dsb; Tepak tempat sirih. 7. Gambar, tulisan dsb yang dibuat pola; Rancangan; Tiruan bunyi genderang. 8. Arena. 10. Pintu masuk. 11. Bekuk; Ringkus. 15. Perkawinan dengan janda bekas istri saudara. 16. Jalan kecil. 18. Burung besar, ada tonjolan seperti cula di atas paruhnya. 19. Inang bagi anak-anak raja. 21. Bahan bakar hitam warnanya. 23. Azan. 24. Singkatan Angkatan. 25. Angkat; Naikkan; Bingung (minang). 26. Berada di atas tempat yang tinggi; Jongkok. 27. Hawa; Udara; Hasil tiupan.

MENURUN

1. Orang yang menjadi bagian dalam suatu golongan (dewan, partai dsb). 2. Koral; Tulis cerita dsb. 3. Duga; Kulit kerang besar. 4. Lubang kecil. 5. Sobek besar; Berlubang besar (tentang tembok). 6. Tumbuhan menjalar, daunnya seperti ginjal dan untuk obat; Centella Asiatica. 9. Celah; Renggang. 12. Pohon tinggi, buahnya dimakan; Artocarpus heterophyllus. 13. Binatang laut keluarga tiram. 14. Pernyataan rasa hormat terhadap orang yang berwibawa dsb (Jawa). 17. Alat musik bambu. 18. Hasil mengerang. 19. Alat bernapas ikan. 20. Apik dan berwibawa (tingkah laku, gaya dsb). 22. Yang (istilah).

8

5 6 3 9 5 7 6 3 2 8 7 9 1 4 1 9 5 7 1 8 5 9 3 6 2 4 8 7 5 3 6 1 7 2 4 9 4 3 9 3 7 1 8 9

*205


A12

Sukses Rosberg SILVERSTONE, Inggris (Waspada): Nico Rosberg merebut kemenangan keduanya di arena balap mobil Formula One (F1), setelah menjuarai GP Inggris yang dramatis di Sirkuit Silverstone, Minggu (30/6). Pebalap Mercedes asal Jerman itu memanfaatkan nasib sial Sebastian Vettel (Red Bull) yang gagal finish saat memimpin lomba yang kembali diwarnai perang ban tersebut. Rosberg mencatat waktu terbaik 1:32:59,456 sekaligus mengatasi

Rossi Bingung ASSEN, Belanda (Waspada): Valentino Rossi (foto) naik ke podium utama seri MotoGP Belanda di Sirkuit Assen, Sabtu (29/6). PebalapYamaha asal Italia itu mencatat waktu terbaik 41 menit 25,202 detik, mengungguli Marc Marquez (Repsol Honda) dan Cal Crutchlow (Yamaha Tech 3). Ini juga pertama kali bagi Rossi meraih kemenangan setelah terakhir menggapainya pada 2010 silam di MotoGP Malaysia. Atas pencapaiannya tersebut, The Doctor pun gembira sekaligus bingung bisa menjadi pemenang. Rossi mengaku masih tak percaya dengan hasil tersebut. “Saya senang, tapi tak percaya. Rasanya luar biasa bisa kembali ke posisi pertama setelah di Sepang 2010,” ungkapnya, Minggu (30/6). “Saya selalu bertanya-tanya, apakah bisa kembali ke posisi terdepan. Ini jelas periode yang sulit, namun saya tetap berusaha keras,” sambung pemegang tujuh gelar MotoGP kelas premium tersebut. Cedera yang dialami rekan setimnya di Yamaha, Jorge Lorenzo, diakui Rossi menjadi motivasi sendiri untuk memberikan prestasi terbaik di Assen. Mantan rider Ducati itu paham jika itu merupakan moment yang tepat baginya untuk membayar kepercayaan Yamaha. “Sebelum balapan, saya berpikir harus bisa menang karena Jorge (Lorenzo) cedera. Saya benar-benar berusaha untuk mewujudkannya,” seru Rossi. (m33/mgp) motogp

Pedrosa Salut Lorenzo ASSEN, Belanda (Waspada): Tingginya tekad Jorge Lorenzo (foto) tetap membalap di MotoGP Belanda pada Sabtu (29/6) lalu mendapat pujian. Meski baru saja naik meja operasi, kegigihan pebalap Yamaha itu mendapat acungan jempol dari rivalnya, Dani Pedrosa. Lorenzo mengalami patah tulang selangka di sesi latihan bebas Sirkuit Assen, Jumat (28/ 6). Usai naik meja operasi di rumah sakit di Barcelona, Lorenzo ikut balapan. Mengawali balapan dari posisi 12, rider asal Spanyol itu menyentuh garis finish di posisi lima. Bahkan, Lorenzo sempat menekan Pedrosa di awal lomba. “Selamat untuk Jorge, karena apa yang dia lakukan dan bagaimana melakukannya sangat mengesankan. Saya angkat topi untuknya,” ucap Pedrosa, Minggu (30/6). Pedrosa sebenarnya sempat menjadi pemimpin lomba di Assen. Tapi, sesama pebalap Spanyol itu gagal mempertahankannya dan harus puas finish keempat. “Hari ini saya memulai dengan baik, selamat dari kecelakaan di awal lomba dengan ban yang dingin, mampu lanjut, dan membuat lap-lap yang bagus,” ujar Pedrosa. “Tapi, setelah itu saya punya masalah dengan ban, baik depan maupun belakang. Saya masih mencoba mempertahankannya selama mungkin karena saya tak ingin itu jadi alasan,” pungkasnya. (m33/mgp)

Pasang Iklan Telp. 4528431 HP. 081370328259 Email: iklan_waspada@yahoo.co.id

driver Red Bull asal Australia, MarkWebber dalam 52 putaran. Posisi ketiga diisi andalan Ferrari, Fernando Alonso, disusul rekan setim Rosberg di Mercedes juga pebalap Inggris, Lewis Hamilton. Di belakang Hamilton, ada Kimi Raikkonen motogp

(Lotus) dan pebalap veteran Ferrari, Felipe Massa. Ini merupakan gelar kedua Rosberg musim ini, setelah GP Monaco akhir Mei lalu. Meski posisi klasemen tidak berubah, gagalnya Vettel menambah persaingan sengit dalam perebutan gelar juara dunia musim ini. Safety car tercatat dua kali masuk lintasan. Pertama, untuk membersihkan puing-puing akibat insiden pecahnya ban mobil Jean-Eric Vergne (Toro Rosso). Tersisa 11 putaran lagi, safety car kembali masuk guna memberi kesempatan evakuasi mobil milik Vettel. Selepas GP Inggris,Vettel tetap memimpin dengan 132 angka disusul Alonso (111) dan Kimi (98). Kendati menang, Rosberg tetap di urutan enam dengan koleksi 82 poin atau masih kalah

Sport

WASPADA Senin, 1 Juli 2013 Hasil GP Inggris Nico Rosberg (Jerman/Mercedes) 1:32:59,456 Mark Webber (Australia/Red Bull) + 0,7 detik Fernando Alonso (Spanyol/Ferrari) 7,1 Lewis Hamilton (Inggris/Mercedes) 7,7 Kimi Raikkonen (Finandia/Lotus) 11,2 Felipe Massa (Brazil/Ferrari) 14,5 Adrian Sutil (Jerman/Force India) 16,3 Daniel Ricciardo (Australia/Toro Rosso) 16,5 Paul di Resta (Inggris/Force India) 17,9 Nico Hulkenberg (Jerman/Sauber) 19,7

dari Hamilton (89) dan Webber (82). (m47/ap)

AP

PEBALAP Mercedes Nico Rosberg (kanan) berjalan menuju podium utama setelah menjuarai GP Inggris di Sirkuit Silverstone, Minggu (30/6).


Sumatera Utara

WASPADA Senin 1 Juli 2013

Kota

Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:30 12:43 12:31 12:38 12:38 12:34 12:31 12:27 12:33 12:33

15:57 16:11 15:58 16:05 16:05 16:00 15:58 15:53 16:00 16:00

Magrib 18:41 18:57 18:42 18:52 18:50 18:41 18:41 18:36 18:44 18:45

‘Isya

Imsak

Shubuh Syuruq

Kota

19:56 20:13 19:56 20:07 20:05 19:55 19:55 19:51 19:59 20:00

04:46 04:55 04:47 04:51 04:51 04:55 04:48 04:44 04:49 04:47

04:56 05:05 04:57 05:01 05:01 05:05 04:58 04:54 04:59 04:57

L.Seumawe 12:36 L. Pakam 12:29 Sei Rampah12:29 Meulaboh 12:40 P.Sidimpuan12:28 P. Siantar 12:29 Balige 12:29 R. Prapat 12:25 Sabang 12:43 Pandan 12:30

06:18 06:28 06:19 06:23 06:23 06:26 06:19 06:15 06:21 06:19

Zhuhur ‘Ashar 16:03 15:56 15:55 16:07 15:54 15:55 15:55 15:52 16:10 15:56

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur

‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:50 18:40 18:39 18:52 18:35 18:38 18:37 18:33 18:58 18:37

20:05 19:55 19:54 20:07 19:49 19:53 19:52 19:48 20:13 19:52

04:49 04:45 04:44 04:55 04:48 04:46 04:47 04:44 04:55 04:49

04:59 04:55 04:54 05:05 04:58 04:56 04:57 04:54 05:05 04:59

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:30 12:31 12:41 12:34 12:31 12:37 12:26 12:36 12:29 12:28

18:37 18:40 18:55 18:42 18:42 18:50 18:35 18:46 18:37 18:38

19:52 19:55 20:10 19:57 19:56 20:05 19:50 20:01 19:51 19:53

04:49 04:49 04:53 04:52 04:46 04:51 04:43 04:53 04:48 04:45

04:59 04:59 05:03 05:02 04:56 05:01 04:53 05:03 04:58 04:55

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:27 12:34 12:31 12:27 12:29 12:26 12:26 12:36 12:30 12:24 12:26

15:53 15:59 15:58 15:54 15:56 15:52 15:52 16:03 15:56 15:51 15:53

18:32 18:39 18:40 18:37 18:38 18:33 18:32 18:49 18:38 18:32 18:35

19:47 19:53 19:55 19:52 19:53 19:48 19:47 20:04 19:53 19:47 19:50

04:48 04:55 04:49 04:44 04:47 04:46 04:47 04:49 04:48 04:44 04:44

04:58 05:05 04:59 04:54 04:57 04:56 04:57 04:59 04:58 04:54 04:54

06:21 06:17 06:16 06:27 06:19 06:17 06:18 06:16 06:27 06:21

15:56 15:58 16:08 16:00 15:58 16:04 15:52 16:03 15:55 15:55

06:20 06:20 06:25 06:24 06:18 06:23 06:15 06:24 06:19 06:16

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Tujuh RS Di Binjai Tak Punya Insinerator BINJAI (Waspada): Tujuh Rumah Sakit Umum (RSU) di Kota Binjai ternyata tak memiliki insinerator (mesin pemusnah sampah padat dan cair) sebagai salah satu persyaratan operasional. Hal ini diungkapkan Kepala Badan Lingkungan Hidup Aspian, melalui Kabid Amdal Mahruzar, ketika ditemui wartawan. Ia mengatakan, rumah sakit yang tidak memiliki insinerator yaitu, RS Bangkatan, RS Bidadari, RS Latersia, RS Artha Medica, RS Kesrem, RS Al Fuadi, dan RS Ibu dan Anak Syilviana. “Hanya RSU Djeolham yang memiliki mesin insinerator, yang lainnya tidak ada,” jelasnya. Insinerator sendiri, lanjut dia, berfungsi sebagai mesin pemusnah atau penghangus sampah yang baik bagi limbah medis yang

bersumber dari rumah sakit atau Puskesmas. “Jadi kalau rumah sakit tidak memiliki mesin itu, kemana mereka membuang limbah medisnya?” sebutnya. Seharusnya, kata dia barubaru ini, pihak rumah sakit menyediakan tempat untuk limbah medis dan non medis. Untuk limbah non medis, bisa langsungdibuangketempatsampah karena tidak mengandung zatberbahaya,sedangkan limbah

medis mengandung bahan berbahaya dan beracun (B3), harus dimusnahkan melalui mesin insinerator, agar bakteri atau virus danzat-zatberbahayayangterkandung di dalamnya tak menyebar. “Soalnya, limbah medis mengandung bahan berbahaya dan beracun (B3), dapat membahayakankesehatandankeselamatan orang lain. Dan itu sudah diatur dalamundang-undang,”sebutnya. UUNo.30tahun2009tentang perlindungan dan pengelolaan lingkungan hidup, jelasnya, pada Bab pertama (I) pasal 1 ayat (20) menyebutkan,limbahadalahsisa hasilusahaataukegiatan.Kemudian pada Pasal (21) disebutkan,

bahan berbahaya dan beracun (B3) adalah zat, energi atau komponen lain yang karena sifat, konsentrasi dan jumlahnya, baik langsungmaupuntidaklangsung dapat mencemarkan/merusak lingkungan hidup dan atau membahayakan lingkungan hidup, kesehatan serta kelangsungan hidup orang lain. Selainitu,bagipengusahaatau industri yang melakukan pelanggaran ini, dapat dikenakan sanksi pidanaberupakurunganminimal satu tahun dan atau denda Rp3 miliar. “Jadi persoalan ini bukan masalah sepele, karena menyangkut hajat hidup orang banyak,” tegasnya.

Waspada/Edi Saputra

KABAG Ops Polres Sergai, Kompol Moch. Raisya Mustario, S.Ik didampingi Kasubbag Humas, AKP ZN Siregar saat menginterogasi kedua tersangka bandar narkoba abang beradik di ruang Satnarkoba.

06:19 06:26 06:21 06:15 06:18 06:18 06:18 06:21 06:20 06:15 06:16

Dukungan Ke Ngogesa Terus Bertambah

Ketika ditanya langkah BLH terhadap 7 rumah sakit ini, Mahruzar mengatakan, dari ketujuhrumahsakitadabeberapa yangbekerjasamadenganrumah sakit lain yang memiliki mesin insinerator. “KalauPuskesmassemuanya bekerjasama dengan RSU Djoelham, RS Bangkatan kerjasama dengan salah satu RS di Medan, kalau yang lain saya kurang tahu. Tapikitaakuiadakelemahandalam melakukanpengecekanrutinsetiap enam bulan sekali di lapangan, karenakitatidakbisamemaksakan diriuntukmasukketikapemimpin atau pengelola rumah sakit tak berada di tempat,” tegasnya.(a05)

Abang Beradik Bandar Sabu Dijebloskan Ke Sel SEIRAMPAH (Waspada): Personel Satuan Narkoba Polres Serdang Bedagai menjebloskan ke sel abang beradik bandar sabu, SM, 51, dan adiknya SY, 45, keduanya warga Dusun II Sidodadi Desa Liberia Kec. Teluk Mengkudu, Kab. Serdang Bedagai, Rabu (26/6) malam setelah diringkus dari rumahnya. Dari SM diamankan tiga paket sabu dalam kemasan, dua plastik tembus pandang dan dua pipet plastik. Informasi diperoleh Waspada, malam itu Kasat Narkoba, AKP Hendra mendapat informasi dari masyarakat mencurigai ada warga sebagai bandar sabu yang beroperasi di desa tersebut. Selanjutnya KasatNarkobamemerintahkanKBONarkoba,IpdaA.ChaidirHarahap S.Sos bersama opsnalnya turun ke lokasi guna menindaklanjuti. Sekira pukul 21:00 aparat berhasil meringkus keduanya. Di Mapolres Sergai, SM, ayah 7 anak dan 6 cucu mengaku telah enam bulan mengkonsumsi sabu dan baru 10 hari menjadi pengedar. Sedangkan yang bertugas membeli barang haram tersebut adiknya SY, yang setiap kali membeli satu ji, kemudian dibagi menjadi paket kecil seharga Rp100 ribu hingga Rp150 ribu per paket. Sisa penjualan kemudian dikonsumsi bersama. Kapolres Sergai, AKBP Arif Budiman, S.Ik, MH melalui Waka Polres Sergai, Kompol Zahri didampimgi Kasat Narkoba, AKP Hendra dan Kasubbag Humas, AKP ZN Siregar membenarkan, kedua tersangka dan barang bukti telah diamankan guna pengembangan perkaranya.(c03)

B1

MEDAN ( Waspada): Dukungansertapujiankepada sosok Haji Ngogesa Sitepu, SH (foto) yang saat ini menjabat Bupati periode 2009-2014 dan akan mengakhiri masa jabatannya Februari 2014 mendatang, terus bertambah. Kalangan ibu-ibu perwiritan di berbagai kecamatan di Kab. Langkat mengidolakan sosok Ngogesa pria berperawakan tinggi besar, namun sangat lembut dalam bertutur kata, berwajah dan berhati ikhlas dalam kepedulian sosialnya kepada masyarakat kurang mampu. Menurut Hj. Fadhilah Nasution, Ketua DPD Al Hidayah Kab. Langkat, Minggu (30/6), perhatian Bupati Ngogesa terhadap ibu-ibu perwiritan dan pengajian sangat baik. “Bahkan kami memuji beliau yang merupakan pembina di Al Hidayah, beliau sangat peduli terhadap seluruh perwiritan di Langkat. Bahkan istri Bupati Hj. Nuraida sangat dekat dengan para kaum perempuan, dengan selalu berbaur di mana pun. Kita mendukung agar Bapak Ngogesa Sitepu bisa kembali memimpin Kab. Langkat periode kedua. Karena kepedulian beliau sangat tinggi terhadap kalangan masyarakat bawah, kalangan warga tidak mampu, beliau selalu memberi, membantu kesulitan warga dengan ikhlas. Sebab Ngogesa Sitepu tidak diragukan lagi keder-

mawanannya,sehinggapantas kalaubeliaudijulukipemimpin merakyat dan sulit mencari sosok seperti Ngogesa,’’ papar Hj. Fadhilah Nasution. Menurut Hj. Lisdar, S.Pdi, guru pengajian Alquran, warga Sidomulyo Kec. Stabat, kewibawaan Ngogesa Sitepu selaku pemimpin di Langkat sangat mempesona kalangan ibu- ibu, sebab selalu mau berbaur, memperhatikan dan selalu peduli akan kesulitan di kalanganperwiridan,pengajian sehingga kehadirannya memberi rasa sejuk. Pihaknya merasakan dan tidak memungkiri kalau Bupati Ngogesa sosok berwajah dan berhati ikhlas, sebab semua yang dilakukan, diberikan, dibantunya, betul-betul dengan wajah dan hati ikhlas,bukan karenamau mengharapkanimbalan, bukan karena mau maju kembali untuk menjadi bupati. ‘’Kini apa lagi yang mau dicari, kalau di depan mata, dihati kita sudah ada yang peduli, dekat dan mau berbuat kepada masyarakat, sebab beliau selaku Bupati bukan “bekarya kata, tapi bekarya nyata”, bagi bupati ini tidak ada keberuntungan atau berkat yang bertahan jika rezeki hanya dinikmatinyasendiri.Untukitukitaberharapmasyarakat kembali mendukung, memenangkan dengan memilih Ngogesa Sitepu agar kembali memimpin di Langkat,’’ ujar Hj Lisdar, S.Pdi optimis.(m14)

Masyarakat Takkan Goyah Dan Bijak Berfikir Waspada/HM Husni Siregar

WABUP H. Zainuddin Mars (tengah depan ) mengikuti zikir bersama ribuan masyarakat sekaligus peringatan Israk Miraj Nabi Besar Muhammad SAW sekaligus menyambut Bulan Suci Ramadhan 1434 H, di Lapangan Segitiga Lubukpakam.

Sambut Hari Jadi Ke 67

Pemkab DS Gelar Zikir Dan Israk Mikraj LUBUKPAKAM (Waspada) :MenyambutHariJadiKe67,pada 1 Juli 2013, Pemkab Deliserdang menggelar zikir bersama ribuan masyarakat sekaligus memperingati Israk Mikraj Nabi Besar Muhammad SAW, sekaligus menyambut Bulan Suci Ramadhan 1434 H, di Lapangan Segitiga Lubukpakam, Kamis (27/6). Zikir bersama masyarakat dipandupimpinanLembagaZikir MiftahulJannahArRoyanDeliserdang H. Syamsuddin Nur Sirait, M.Pd, menghadirkan penceramah H. Akhyar Nasution, Lc, MA. HadirWakil Bupati H. Zainuddin Mars,anggota DPRD Khairul Anwar, SE, unsur Muspida, Ketua TP PKK Ny. Hj. Anita Amri Tambunan, Ketua GOPTKI Ny. Hj. Asdiana Zainuddin, Ketua

Dharma Wanita Persatuan Ny. Hj. Fauziah Azwar S, Ketua GOW Sri Rahmawati Barus, sejumlah pimpinan SKPD, tokoh agama, LVRI, para Camat bersama warga masyarakat se Deliserdang. Wabup H. Zainuddin Mars mengajak masyarakat untuk menjadikan momentum Hari Jadi Kab. Deliserdang yang dirangkai zikir akbar dan Israk Mikraj sekaligus menyambut bulan suci Ramadhan, sebagai pengikat silaturrahmi menuju peningkatan kualitas keimanan dan ketaqwaan kita kepada Allah SWT. Melalui kegiatan ini diharapkan dapat menjadi modal kekuatan bagi percepatan pembangunan Deliserdang sebagaimana dilakukanselamaini,yaituadanya

kesinerjian antara pemerintah didukung pihak swasta dan partisipasi masyarakat. “Bahkanmelaluizikirdandoa kita bermohon kehadirat Allah SWT agar semua terus bangkit melanjutkan pembangunan mewujutkancita-citamenjadikan Deliserdang yang semakin baik, berprestasi sebagaimana diperoleh selama ini,” ujar H. Zainuddin Mars. Sementara Ustadz H Akhyar Nasution Lc MA dalam tausiyahnya menguraikan sejarah perjalanan Nabi melaksanakan Israk Mikraj serta mengajak seluruh umat muslim untuk melaksanakan ibadah puasa Ramadhandengansempurna,sehingga memperoleh keampunan dari Allah.(a06)

LIMAPULUH (Waspada): Masyarakat kat desa tersebut mengikuti perlombaan desa pemakai jalan boleh berlega, karena ruas Jalan percontohan terbaik di tingkat Provsu. Apakah hal ini dulu pernah jadi perhatian. Simpang Dolok-Limapuluh, Kab. Batubara ditingkatkan. “Lihat ini ruas jalan masih dalam Padahal di antara nama balon bupati yang maju proses peningkatan sehingga bertambah lebar pada Pilkada 2013, sebelumnya mempunyai posisi dari sebelumnya,” kata beberapa warga pemakai di legislatif yang berperan dalam menggodok anggaran pembangunan. jalan kepada Waspada, Minggu (30/6). “Kenapahaldemikiantidakdilakukandariawal. Ruas Jalan Simpang Dolok mendapat peningkatan. Selain itu juga sejumlah jalan desa Sekarangbarusibukmenyumbangdanmembantu lainnya di Kec. Limapuluh. “ Ini mencerminkan mendekat.Masyarakatkinitakkangoyahdanmereka Batubara secara bertahap menunjukkan sudahbijakberfikir,apayangtelahdibuatdandirasakan kemajuan terutama di sisi infrastruktur,” ujarnya. sekarangmaupunrencanapembangunanBatubara Syaiful Zuhri, tokoh pemuda Simpang Dolok ke depan sebagaimana komitmen Bupati H. OK menyambut baik gebrakan pembangunan Arya Zulkarnain, SH, MM,” katanya.(a13) dilakukan Pemkab Batubara. “Ini mencerminkan Batubara secarabertahapsudahbangkit dari sebelumnya selama kepemimpinan Bupati H. OK Arya Zulkarnain,” tuturnya. Kamajuanpembangunan ini, katanya, tidak saja di Simpang Dolok, namun se Batubara, sejalan atensi bupati terhadapdesadalammengalokasikan dana pembangunan denganmenyisihkan10persen dari jumlah APBD Batubara. “Ini komitmen bupati membangun desa berarti membangun Batubara,” katanya. Sedangkan Desa Pulau Waspada/Iwan Has Sejuk tidak saja merasakan sisi BUPATI Batubara H. OK Arya Zulkarnain, SH, MM turun ke pembangunan fisik tapi juga lapangan mencek lokasi pembangunan sebagaimana permintaan non fisik, sehingga mengang- masyarakat.

Selintas Sejarah Penetapan Hari Jadi Kota Tebingtinggi (Bagian ke 1 dari 2 Tulisan) MENGAMATI sejarah berdirinya kota Tebingtinggi di masa lalu, setidaknya ada dua versi yang berkembang. Kedua versi sejarah itu, selintas terlihat kontradiktif antara satu dengan lainnya, meski sebenarnyamasihbisadikompromikan berdasarkan data sejarah yang ada.Versi pertama, memuat tentang keberadaanseorangbangsawanasal Kerajaan Raya, Simalungun bernama Datuk Bandar Kajum. Sedangkan versi kedua, adalah sejarah yang memuat tentang keberadaan seorang raja Kerajaan Padang bernama Raja Tebing Pengeran. Kedua versi sejarah itu, mengklaim bahwa tokoh masing-masing merupakan pendiri kotaTebingtinggi. Datuk Bandar Kajum, diceritakan masuk ke Tebingtinggi sekira 1864, sedangkan Raja Tebing Pangeran merupakan rajaKerajaanPadangke7yang berkuasapada1807-1823.Ada baiknya,sejarahsingkatkedua sosok itu diceritakan sebagai bahan renungan dan pertimbangan masyarakat kota lintasan itu. Kota Tebingtinggi Sebuahmakalahberjudul ‘Kertas Kerja Mengenai Pokok-Pokok Pikiran Sekitar Penetapan Hari Berdirinya Kotamadya Tingkat II Tebingtinggi,’ mengisahkan tentang awal berdirinya kota Tebingtinggi. Makalah yang dibuat pada 1978 itu oleh sembilan tokoh masyarakat,

yakni Datuk Idris Hood, Adnan Ilyas, Drs. Mulia Sianipar, Kasmiran, Amirullah, Djunjung Siregar, Mangara Sirait, OK Siradjoel Abidin, mengisahkan awal pertamanya kota Tebingtinggi dihuni komunitas masyarakat. Diceritakan, pada 1864, seorangbangsawanasalKerajaan Raya bernama Datuk Bandar Kajum bersama keluarga dan pengikutnya berlayar dari hulu menuju hilir sungai Padang. Tujuan mereka, mencari hunian baru untuk tempat tinggal. Saat pertama mereka berlabuh, menjejakkan kaki di sekitar Tanjung Marulak (sekarang Kel. Tanjung Marulak, Kec. Rambutan). Kehidupan Datuk Bandar Kajum,keluargadanpengikutnya tidaklah tenteram, karena selalu mendapat ancaman dan gangguan dari orang-orang Kerajaan Raya.Dia,kemudianpindahlebih ke hilir, yakni pada sebuah tebing yang tinggi. Tebing itu bersisian dengan muara sungai Bahilang (sekarang komplek pemakaman keluarga dan keturunan Datuk Bandar Kajum di Kel. T.Tinggi Lama, Kec. T.Tinggi Kota). Saat itu tebing di tepian sungai Padang itu memang tinggi. Sehingga Datuk Bandar Kajum menyebutkan pemukimannya itu ‘Tebingtinggi.’ Hunian baru itu, oleh Datuk Bandar Kajum dan pengikutnya dipagari dengan kayu-kayu besar, guna menghindari serangan musuh. Namun, suatu kali kembali orang-orang dari Kerajaan Raya,

Simlaungun melakukan penyerangan ke pemukiman Datuk Bandar Kajum. Namun, karena tak berada ditempat, bangsawan Kerajaan Raya itu selamat dari upaya pembunuhan. Sedangkan pengikut dan keluarganya melarikan diri ke Kebun Rambutan yang saat itu dikuasai Belanda. Dibantu pasukan Belanda, Datuk Bandar Kajum pun melakukan serangan balik atas perusuh,hinggamusuhkalahdan melarikan diri kembali ke kerajaanmereka. Setelahsuasana

aman, Datuk Bandar Kajum mengadakan perjanjian dengan Belanda. Dalam perjanjian yang terjadi di muara sungai Bahilang di atas sampan besar bernama ‘Sagur,’ Datuk Bandar Kajum menyerahkan pengelolaan wilayah itu kepada Belanda dan meleburkan diri dengan Kerajaan Deli. Sejak itu, KampungTebingtinggi didatangi banyak imigran dariberbagaidaerahhinggamancanegara, karena Belanda melanjutkan membuka perkebunan di

sekitar kampung Tebingtinggi. Beberapapuluhtahunkemudian, KampungTebingtinggi kian ramai, demikian pula dengan kampung-kampungdisekitarnya, yakni Badak Bejuang, Pasar Baru dan Rambung. Tiga kampung berada di tepian sungai Bahilang danPadang,sedangkansatukampung lagi berada di perbukitan. Karena, ke empat kampung itu kianramai,bahkanBelandamembangun sejumlah fasilitas umum, ada keinginan agar kampungkampung ramai itu, berada

Waspada/Abdul Khalik

BANGUNAN patung berbentuk cecak dan monyet, diperkirakan sebagai batu persembahan dari keluarga komunitas hunian masa lalu di hulu Sei Padang.

langsung di bawah pengawasan dan kekuasaan Belanda. Residen Belanda di Sumatera berkedudukan di Bengkalis, Kerajaan Siak (Riau) kemudian memutuskanTebingtinggi bersama Medan menjadi wilayah otonom yang lepas dari kekuasaan kerajaan Deli dan Kerajaan Padang. Penetapan Tebingtinggi sebagai daerah otonom terjadi pada 1 Juli 1917 berdasarkan ‘Ordonantie van Staatblad 1917 tanggal 1 Juli 1917, meliputi empat kampung, yakni kampung Tebingtinggi, Badak Bejuang, Pasar Baru dan Rambung. Sedangkan Medan ditetapkan sebagai government berdasarkan Staatblad van Ordonantie No.749 tanggal 1 Juli 1917. Batas-batas Gementee Tebingtinggi dibuat berupa patok batu serta aliran sungai. Patok batu wilayah Gementee hingga kini masih bisa di lihat, misalnya di Kel. Sri Padang, Kec. Rambutan (persis di belakang rumah Ibnu Hibban Saragih). Kerajaan Padang Sebuah buku berjudul ‘Sejarah Berdirinya Kerajaan Padang Tebingtinggi,’ di tulis Muhammad Ridwan alias Putra Praja pada 1991, mengisahkan pula tentang keberadaanKerajaanPadangberkedudukan di kota Tebingtinggi. Kerajaan Padang berdiri di Bajenis dengan raja pertama Umar Saleh Qamar (1656). Ada dua versi tentang asal muasal raja pertama ini.Versi pertama, Umar Saleh Qamar merupakan anak dari Raja Kerajaan Raya di hulu sungai Padang bernama Tuan

Nengel Saragih. Anak raja KerajaanituitubernamaTuanMortiha Saragih Garingging gelas Tuan HapultakangelarTuanPoltakRaja Saragih Dasalak. Ketika masuk Islam pada 1630 mengubah nama jadi Umar Saleh Qamar (Sinar, 1974). Versi kedua, pendiri Kerajaan Padang itu, adalah anak dari raja Kerajaan Bandar Khalifah bernama Saleh Qamar. Raja Kerajaan Bandar Khalifah itu, merupakan keturunan dari Kesultanan Darul Qamar di Aceh. Di mana kerajaan itu dipersatukan Sultan Iskandar Muda saat mendirikan Kerajaan Aceh (Achin). Salah seorang keturunan sulthan Kerajaan Darul Qamar melakukan pelayaranhinggasampaidimuara sungai Padang dan mendirikan kerajaan kecil sekira pertengahan Abad 16 dengan nama Kesulthanan Bandar Khalifah (Putrapraja, 1991). Sepeninggal raja pertama Kerajaan Padang ini, selama hampir 3 abad, terdapat tujuh raja lainnya yang memimpin kerajaan. Sejarah panjang kerajaan itu, pusat pemerintahannya berada di kota Tebingtinggi, pada beberapa kampung, mulai dari Kampung Bajenis, Kuta Usang dan Bandar Sakti. Dari delapan raja Kerajaan Padang, ada tiga raja yang dinilai berpengaruh besar bagi sejarah kerajaan kecil yang disebut-sebut menjadi vassal (protektorat) KerajaanDeliini.YakniRajaTebing Pengeran atau Datuk Pangeran (1807-1823), Marah Hakum alias Raja Geraha (1823-1870) dan

Marah Hudin alias Tengku HajiMuhammadNurdinalias Tengku Haji (1870-1914). Di masa Raja Tebing Pangeran,KerajaanPadangyang memiliki kekuasaan di sepanjang sungai Padang, mulai dari hulu di kaki pegunungan Simbolon (Sipispis) hingga ke hilir di Bandar Khalifah. Kerajaan ini dikenal sebagai kerajaan otonom tempat pengumpulan/pertukaran hasil bumi dengan hasil kerajinan. DatukPangeran,merupakan raja yang dikenal ahli perdagangan. Sebagai raja yang menguasai aliran sungai Padang, Datuk Pangeran membuka sejumlah pangkalan untuk menampung hasil bumi dari hulu sungai. Maka dibukalah sejumlah pangkalan,mulaidariBandarSono, Bandar Sakti dan Pangkalan Tebing. Pangkalan Tebing, merupakan terminal terakhir pengumpulan hasil bumi, sebelum diangkut ke pelabuhan lebih besar di Bandar Khalifah. Pangkalan Tebing ini, terletak di pertemuan antara muara Sungai Bahilang dan sungai Padang. Mengambil nama tebingyangberadadipinggiran sungai Padang. Sejak itu, daerah itu menjadi perkampungan yang kemudian dikenal dengan nama Kampung Tebingtinggi. (Bersambung besok). * Abdul Khalik


Sumatera Utara

B2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

KOTAPINANG (Waspada): Kelangkaan gas elpiji kemasan 3 kilogram dalam sebulan terakhir kembali terjadi di sejumlah wilayah di Kab. Labusel khususnya di Kec. Kotapinang. Warga menduga telah terjadi kecurangan, dan berharap Pemkab memperketat pengawasan terhadap penyaluran elpiji 3 Kg. M.Yunus warga Jl. Labuhan, Kel. Kotapinang kepada Waspada,Minggu(30/6)mengatakan, selama sepekan terakhir elpiji 3 Kg kosong di kios-kios pengecer. Parahnya, kata dia, di tingkat agen pun elpiji tersebut tidak tersedia. Akibatnya, dirinya terpaksa menggunakan kompor solar untuk keperluan sehari-hari. “Katanya belum masuk. Ini

sudah hampir seminggu. Kita berharap Pemkab memperketat pengawasan, karena dicurigai gas bersubsidi itu diselewengkan,” kata pria yang menjabat sebagai Ketua Panwas Pilgubsu Kab. Labusel itu. Sumarsono, salah seorang pedagang warung makanan di Kotapinang juga menuturkan hal serupa. Tidak hanya langka.

Kalaupun ada, elpiji yang tersedia harga belinya cukup mahal yakni antaraRp14ribuhinggaRp16ribu per tabung. “Kami pengusaha kecil seperti ini mengandalkan usaha memakai elpiji 3 Kg, kalau langka begini usaha kami bangkrutlah,” katanya. Menenanggapi itu Kepala Dinas Perindustrian, Perdagangan, Koperasi dan UKM PemkabLabusel,AhmadFuadmengatakan pihaknya belum mengetahui perihal kelangkaan elpiji 3 Kg tersebut. Dia berjanji akan segera melakukan pengecekan terkait masalah itu. “Nanti kita coba cek dulu. Kita tidak bisa berandaiandai,” katanya. (c18)

Siswi SD Tewas Terseret Arus TANJUNGBALAI (Waspada): Seorang siswi kelas VI Sekolah Dasar (SD) di Kota Tanjungbalai, Sari, 12, diduga tewas tenggelam akibat terseret arus Sungai Silau, Jumat (28/6). Informasi dihimpun, kejadian berawal saat korban warga Jl. Andak Pase, Kel. Pasarbaru, Kec. Seitualang Raso, Kota Tanjungbalai pergi mandi di pinggir sungai dekat TKP. Diduga

akibat tempat mandi yang licin, korban tergelincir lalu terseret derasnya sungai. Tak berapa lama, seorang warga yang tak jauh dari lokasi terkejut saat menemukan korban tersangkut di antara tiang tangkahan pinggiran sungai. Masyarakat lalu melakukan evakuasi dan membawa korban ke rumah sakit terdekat. Sayang, nyawa korban tak tertolong hingga

menghembuskan nafas terakhirnya. Menurut warga sekitar, korban tinggal bersama nenek dan ayahnya. Sehari-hari warga sekitar termasuk korban sudah biasa mandi di tempatnya tergelincir. Kapolres Tanjungbalai AKBP ML Hutagaol dikonfirmasi melalui Kapolsek Seitualang Raso mengatakan belum menerima laporandaripihakkeluarga. (a32)

PNS Batubara Belum Terima Rapel Kenaikan Gaji BATUBARA ( Waspada): RibuanPegawaiNegeriSipil(PNS) se Kab. Batubara sampai, Jumat (28/6)belummenerimakenaikan gaji yang diberikan pemerintah terhitung Januari 2013. Menurut salah seorang PNS diBatubara,Jumat (28/6),mereka tidakmengetahuipenyebabbelum dibayarnya kenaikan gaji selama 5 bulan (Januari - Mei 2013). Se-

dangkan kenaikan Juni sudah dibayarbersamapembayarangaji, hanya saja belum pasti apakah kenaikangaji5bulanakandirapel. Yang pasti, PNS di kabupaten lain di Sumut sudah lama menerima rapel kenaikan gaji tersebut. PNS di Batubara mengharapkan PemkabBatubaradapatmembayarkanrappelkenaikangajibersamaan dengan gaji ke-13 guna

dimanfaatkanuntukbiayamelanjutkan sekolah anak-anak. “KalaubisaPemkabBatubara membayar kenaikan gaji (rapel) sekaligus gaji ke-13 agar dapat digunakanmembiayaimelanjutkan sekolah anak-anak,” ujar salah seorang ibu mengaku PNS menunggugajike-13danrapelkenaikan gajiuntukbiayaanaknyakePerguruan Tinggi di Medan. (a12)

Zainuddin Siregar, KabagHukum HapsahSH,SekretarisInspektorat Labuhanbatu dan juga dihadiri unsur Muspika Kec. Panai Hilir, para kepala Desa, tokoh agama, tokoh masyarakat, Tim Pengerak PKK Kec. Panai Hilir dan undangan lainnya. Asisten Tata Pemerintahan Drs H Sarbaini dalam arahannya menyampaikan, bahwa serah terima jabatan camat ini adalah satuhalyangbiasadilakukanyang bertujuan agar roda organisasi pemerintah tetap berjalan. Selain

itujugauntukpenyegarandansekaligusuntukmencapaitujuanorganisasi yang optimal dalam rangka pelayanan kepada masyarakat. Sarbaini mengingatkan kepada camat yang baru untuk meningkatkanterusfungsipelayanan kepada masyarakat baik yang bersifat administratif maupun peningkatan kesejahteraan masyarakat. Dan dapat membina serta menjaga hubungan koordinasidenganunsurMuspika,dinas Instansi ditingkat kecamatan agar tetap harmonis. (c07)

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO

� Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Reuni Akbar Dwi Warna Digelar Agustus RANTAUPRAPAT (Waspada): Para alumni Yayasan Dwi Warna Medan dari mulai berdirinya sekolah di ajak bergabung pada acara reuni akbar seluruh angkatan dan jurusan yang akan diadakan pada 11 Agustus 2013. ‘ “Segera daftarkan ke panitia reuni akbar Dwi Warna,” kata Sariani Matondang, yang juga alumni SMA angkatan 1990 Dwi Warna kepada Waspada, Kamis (27/6) melalui seluler. Sariani menambahkan, untuk pendaftaran sampai 30 Juni 2013 ke panitia reuni akbar Dwi Warna Medan, pembayaran dapat dilakukan via transfer atas nama: Sariani Matondang Bank Mandiri Medan Maimoon No Rekening 1050011180654, Hilda Winanda Azhar Nasution Bank BRI Langsa No Rekening 0042-01-00655953-2. Acara reuni akbar dilaksanakan di lokasi acara Sekolah Dwi Warna Medan Jalan Gedung Arca 52, Pasar Merah Barat, Medan Area, 11 Agustus 2013, di mulai pukul 09.00 s/d selesai, dan untuk contact person dapat menghubungi Is Hariyanto 081377448838, HildaWinanda Azhar Nasution 085277615105, Sariani 081360133241 dan Darma Yanti 081370112997, ungkap Sariani. “Sambil menunggu kita berbuat sesuatu menghitung mundur hari pada reuni akbar Dwi Warna, mari kita sukseskan reuni akbar kita bersama-sama,” ujar Isharyanto dan Ahmad Priyadi, alumni STM angkatan 1997. (c07)

PARA calon kepala Desa Seinangka, diantaranya Irwansyah, Syahrial, Imran Sitorus, Khairuddin, dan Abd Rahman memperlihatkan surat keberatan yang akan dibawa ke DPRD Kab.Asahan.

Pilkades Seinangka Diduga Sarat Kecurangan SEIKEPAYANG (Waspada): Lima calon kepala desa menduga pelaksanaan Pemilihan Kepala Desa Seinangka, Kec. Seikepayang Barat, Kab. Asahan beberapa waktu lalu sarat kecurangan. “Pilkades ini harus diulang, kami tidak terima karena diduga banyak sekali terjadi ketimpangan dan kecurangan,” kata lima Calon Kades Khairuddin, Syahrial, Imran Sitorus, Irwansyah, dan Abd Rahman kepada Waspada, Minggu (30/6). Khairuddin menjelaskan, beberapa kecurangan tersebut antara lain dugaan keberpihakan Ketua Panitia Pilkades inisial ARL kepada salah satu calon yakni IG. Hal itu dibuktikan dengan

adanya dugaan pembagian (money politics) oleh ARL kepada masyarakat. Kecurangan lainnya, banyaknya masyarakat yang tidak menerima undangan untuk datang ke tempat pemungutan. Paling mencolok ungkap Khairuddin, tanggal 23 Juni 2013 pukul 18.00 Pjs Kades yang juga Sekdes inisial MY mengundang para calon kades untuk menandatangani DPT. Padahal, keesokan harinya Pilkades sudah harus dilaksanakan. Atas berbagai kecurangan itu kata para Kades, mereka akan melapor ke DPRD Kab. Asahan. Para calonkadesmemintaagarhasilpemungutansuara dibatalkan dan dilakukan Pilkades ulang. (a32)

Usaha Positif Melahirkan Hal Baik KISARAN(Waspada):PeringatkanIsrakMikraj banyak mengandung pengetahuan dan keteladanan Nabi Muhammad dalam menjalankan perintahAllah,sehinggamenjadiusahayangpositif karena Allah akan melahirkan hal yang baik bagi diri sendiri dan orang lain. Hal itu diungkapkan ustadz Dr.H. Azhari AkmalTarigan,dalamtausiyahnyamalamperingatan Israk Mikraj dan menyambut Bulan Suci Ramadhan di Masjid Agung Kisaran, Kamis (27/6). Dia menuturkan, bahwa perjalanan Nabi dari Masjidil Haram ke Masjidil Aqsa mengandung nilai-nilai keteladanan bila kita mau mempelajari. Karena Nabi Muhammad SAW, dalam menyebarkan agama Islam, dan menjalankan perintah Allah SWT, tidak pernah lelah, dan dia selalu berusaha

semampunya, dan selanjutnya menyerahkan keputusan kepada Allah. “TidakadayangtidakmungkinbilaAllahmenghendaki,olehsebabitukitajangantakutdalammenjalanikehidupanini,selagiyangkitalakukanituhanya karena mencari ridho Allah semata,” jelas Azhari. Sementara, Bupati Asahan melalui Asisten I Taufik ZA, mengajak, melalui peringatan Israk Mikraj dan menyambut Ramadhan, bisa menjadikan Asahan lebih baik dan melakukan perbuatan yang baik semata karena Allah, demi menuju Asahan yang religius, sehat, cerdas dan mandiri. “Kegiatan ini merupakan sarana pendidikan rohani bagi masyarakat, untuk menjadi pribadi yang baik dalam membatu perintah dalam membangun,” jelas Taufik. (a15)

Serah Terima Jabatan Camat Panai Hilir PANAI HILIR (Waspada): Bupati Labuhanbatu dr H Tigor Panusunan Siregar S.pPD yang diwakiliAsistenTataPemerintahan Drs H Sarbaini melaksanakan acara serah terima jabatan camat Kec. Panai Hilir dari pejabat lama Gunawan SmHK kepada Abdul SyarifSH, berlangsungdiaulakantor camat Panai Hilir, Kamis (28/6). Acara sertijab ini dihadiri Kaban Kesbang Polinmas dan Damkar H Hasnul Basri, S.Sos, Asisten Administrasi Umum Elfin Riswan SE, Sekretaris BKD

Penerbit: PT Penerbitan Harian Waspada

� Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.

Senin 1 Juli 2013

LPG 3 Kg Di Kotapinang Kembali Langka

Hubungi kami

� Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

WASPADA

Waspada/Budi Surya Hasibuan

ASISTEN I Tata Pemerintahan Drs H Sarbaini saat menandatangani berita acara Sertijab Camat Kecamatan Panai Hilir.

Waspada/Sapriadi

USTADZ Dr H.Azhar Akmal Tarigan memberikan tausiyah pada peringatan Israk Mikraj dan penyambutan Bulan Ramadhan di Masjid Agung Kisaran.

Soal Santunan, PJTKI Harus Tanggungjawab LIMAPULUH (Waspada): PJTKI yang mempekerjakan Almh Siti Aminah Jamal penduduk Dusun IV Desa Pahang, KecTalawi, Kab. Batubara yang tahun lalu tewas dalam kecelakaan maut di Malaysia tidak bisa lepas tangan. Juga harus bertanggungjawab mengurus Jasa Raharjamaupunbentuksantunanlaindarijabatan berwenang Kerajaan Malaysia kepada keluarga ditinggalkan sampai sekarang belum mereka dapatkan. “Di sini pihak PJTKI selaku perusahaan penyalur tenaga kerja harus bertanggungjawab menyelesaikan santunan kepada keluarga ditinggalkan. Apakah itu Jasa Raharja kecelakaan atau bentuk lainnya dari tempatnya bekerja di Malaysia,” sebut tokoh masyarakat Batubara kepada Waspada, Jumat (28/6). “Pihak perusahaan memberangkatkan mengurussemuahakkorban,terutamamengenai hakdantanggungankeluargakorban,gaji,asuransi,

dan biaya lainnya,” kata tokoh lainnya. Asri suami almarhumah mengatakan pihaknya sudah mendatangi Disnaker Batubara untuk membantu agar apa menjadi hak korban dapat mereka terima.Termasuk mengontak pihak PJTKI mengaku semua itu dalam proses pengurusan. Sedangkan keluarga ahli waris tinggalkan untuk bersabar menunggu. Padahal kejadian kecelakaan lalu lintas menewaskan Siti Aminah Jamal dua tahun lalu Januari 2012. “Kami harapkan BNP2TKI, Disnaker maupun DubesRIdiKualaLumpuruntukdapatmembantu agar apa menjadi hak korban dapat diterima,” katanya. Kecelakaan maut menimpa korban terjadi di Jalan Raya, Selangor KM 15.2 arah Shah Alam, KualaLumpurketikamenunggutaxiuntukpulang. Tiba-tiba sebuah mobil jenis Proton Savvy melaju ke arah korban sehingga tabrakan tak dapat dihindarkan. (a13)

67 Tahun Deliserdang Dan Siapa Figur Pengganti Amri 1 JULI 2013 Kab. Deliserdang memperingati hari jadi ke-67. Ada catatan penting pada peringatan hari jadi tersebut tahun ini, yakni H Amri Tambunan, seorang birokrat yang memimpin dua periode di kabupaten berpenduduk 1,7 juta jiwa itu bakal meninggalkan warga yang sangat dicintainya. Masa jabatan H Amri Tambunan berakhir pada 7 April2014,setelahPilkadayang digelar pada Oktober 2013. H Amri Tambunan resmi menduduki kursi bupati Deliserdang berpasangan dengan Yusup Sembiring (almarhum), setelah dilantik Menteri Dalam Negeri atas nama Presiden Susilo Bambang Yudhoyono dalam sidang paripurna DPRD Deliserdang di Lubukpakam pada 7 April 2004. Tahun-tahun pertama menjabat sebagai bupati, H Amri Tambunan tidak mulus begitu saja menjalankan roda pemerintahan. Padahal, saat itu masyarakat Deliserdang yang ‘panca warna’ itu sangat berharap banyak dengan sosok putra mantan gubernur Jambi H Djamaluddin Tambunan, tersebut untuk membenahi Deliserdang ke arah yang lebih baik. Utamanya

pembangunan pendidikan, infrastruktur dan kesehatan, disampingpembangunanmental dan spiritual warga masyarakat. Hal ini wajar saja, karena H Amri Tambunan yang pernah menduduki posisi strategis sebagai pejabat (Assisten II Ekonomi Pembangunan) di Deliserdang pada zaman Bupati H Wasiman, H Ruslan Mansyur dan H Maymaran NS, banyak memberikan ide pembangunan bagikemajuanDeliserdang.Salah satunya adalah mewujudkan pembangunan akses jalan lintas pesisir dari Kecamatan Percut Seituan hingga perbatasan Kabupaten Asahan (Kini Kabupaten Batubara) dan pembangunan penahan ombak di Pantaicermin (kini masuk wilayah Kabupaten Serdang Bedagai) pada zaman Bupati H Ruslan Mansyur. Harapan masyarakat kiranya sejalan dengan cita-cita H Amri Tambunan dalam membangun Deliserdang.Tetapi kendala yang dihadapi H Amri Tambunan cukup banyak. Kendalautamayangdihadapi HAmriTambunan adalah anggaran belanja pembangunan yang tersedia dari kas APBD (Anggaran Pembangunan dan Belanja Daerah) Deliserdang tahun 2004, hanya tersisa Rp 5 miliar setelah dipotong belanja pegawai. Jika dana itu dibagi untuk memba-

ngun di 22 kecamatan yang ada di Deliserdang, bisa buat apa? Salah satu perioritas bagi H AmriTambunan ketika itu adalah perbaikan sarana pendidikan, karena lebih 50 persen dari sekitar 436 bangunan gedung Sekolah Dasar Negeri di Deliserdang tidak layak pakai. Pertanyaannya : apakah anggaran APBD 2004 yang Rp5 miliar cukup merehabilitasi semua gedung yang tidak layak pakai itu? Sangat tidak mungkin. Ditengahketidakmungkinan itu pula H Amri Tambunan menuai banyak kecaman dari saingan politiknya. Ia diisukan lamban.Tetapi, dukungan dari berbagai elemen masyarakat terhadap H AmriTambunan terus mendorongnya untuk terus berbuat. Dorongan itu membuat H Amri Tambunan bangkit dengan mencari terobosan baru. Ia melihat potensi masyarakat dan peranan swasta terutama para pengusaha atau dermawan di Deliserdang cukup besar untuk terlibat dalam pembangunan. Dengan melibatkan dua pilar kekuatan (masyarakat dan swasta)yangdisinergikan dengan peran Pemerintah Kabupaten Deliserdang selaku motivator, H Amri Tambunan membuat terobosanyangbelumpernahdilakukan kepala daerah manapun. Terobosan inilah yang mela-

hirkan Konsep Cerdas (Percepatan Rehabilitasi dan Apresiasi Terhadap Sekolah). Hasilnya dalam kurun waktu 2 tahun, lebih 200 gedung sekolah berhasil direhabilitasi. Dari tidak layak pakaimenjadilayakpakaidengan swadaya masyarakat, swasta dan dorongan pemerintah. Keberhasilan itu ditantang oleh Pusat, saat Presiden Susilo BambangYudhoyono menginstruksikan seluruh gedung sekolah harus layak pakai pada tahun 2009, H Amri Tambunan memberikan garansi semua gedung sekolah di Deliserdang sudah layak pakai pada tahun 2007. Sukses dengan Konsep Cerdas, tidak membuat H AmriTambunan puas diri. Ia terus mencari terobosan baru untuk memajukan Deliserdang. Peningkatan ekonomi adalah hal utama untuk masyarakat . Tetapi, untuk meningkatkan ekonomi rakyat, tidak harusdiberiuang.Mening-katkan ekonomi masyarakat harus dirangsang dengan infrastruktur yang bagus dengan membuka semua akses jalan. Setelah melakukan musyawarah dengan berbagai elemen, pada tahun 2006 H Amri Tambunan menggulirkan Gerakan Deliserdang Membangun atau GDSM. Sasarannya membuka akses infrastruktur jalan, jembatan, irigasi dan lainnya agar per-

ekonomian masyarakat Deliserdang, meningkat. Konsep GDSM disahuti oleh Ir Faisal selaku kepala Dinas PU Deliserdang, juga melibatkan tiga pilar.Hasilnya,dalamkurunwaktu 7 tahun, GDSM yang dilakukan dengan pola swakelola mampu menambah panjang jalan lebih kurang 2.200 kilometer. Sehingga panjang jalan di wilayah Deliserdang sekarang ini menjadi 3.700 kilometer dari 1.500 kilometer sebelumnya. Partisipasi masyarakat mendukung GDSM jika dihitung secara materi lebih Rp 225 miliar berupa hibah tanah untuk pelebaran jalan. Memilih Pemimpin Jika tidak ada aral melintang, pada 23 Oktober 2013, warga masyarakat Deliserdang akan melakukan pemilihan kepala daerah (Bupati-Wakil Bupati) untuk periode lima tahun ke depan. H Amri Tambunan yang sudah dua periode menduduki kursi bupati, sesuai undang-undang, tidak diperkenankan untuk mencalonkan diri. Dengan demikian, pada peringatan hari jadi ke-67Deliserdangpada1Juli2013, merupakan hari terakhir bagi H Amri Tambunan tampil sebagai orang nomor satu di mimbar peringatan itu. Pertanyaannya: Bagaimana Deliserdang ke depan setelah H AmriTambunan tidak lagi menja-

di bupati. Apakah pembangunan Deliserang masih tetap gencar seperti sekarang ini?. Tentu, warga menginginkanDeliserdangkedepantidak mundurkebelakangtapilebih hebat dari sekarang ini. Apalagidenganselesainyabandara Kualanamu International Airport (KNIA) dan infrastrukturnya, nama Deliserdang akan terus melejit. Sekaligus meningkatkan pertumbuhan ekonomi warganya. Untuk itu Deliserdang harustetapdipimpinolehfigur seperti H Amri Tambunan. Figur yang lebih mementingkan kesejahteraan rakyatnya. Terutama cepat merespon keluhan rakyat tentang jalan rusak. Jika dalam Pilkada nanti, rakyat Deliserdang salah pilih dan hanya tergiur dengan iming-iming dari para calon bupati yang saat ini sedang membangun pencitraan, niscaya Deliserdang ke depan tidak akan maju sebagaimana harapan warganya. Sekarang, semuanya terpulang kepada warga Deliserdang untuk mengamati secarateliti danmemilih sosok yang mampu meneruskan cita-cita H Amri Tambunan itu. Wallahualam. * Rudhy Faliskan


Sumatera Utara

WASPADA Senin 1 Juli 2013

B3

SKPI Bupati Karo Wewenang Polisi Anggota DPRD Ngotot Bentuk Pansus KABANJAHE(Waspada): Persoalan keabsahan surat keterangan pengganti ijazah (SKPI) Bupati Karo, terus saja menggelinding. Bahkan, di lingkungan DPRD Karo, dikabarkan mencuat usulan pembentukan pansus. Wakil Ketua DPRD Karo Ferianta Purba, SE menilai, perlu pembelajaran politik yang benar kepada masyarakat, agar masyarakat tidak salah menerima informasi, khususnya permasalahan SKPI Bupati Karo. DidampingiWakil Ketua dan anggota DPRD Karo lainnya, Onasis Sitepu, SE, Frans Dante Ginting, Rendra Gaulle Ginting, SH, Suranta Ginting dan Ketua Badan Kehormatan DPRD, Pengamat Sembiring kepada warta-

wan di Kabanjahe, kemarin, mengaku, SKPI tersebut sepenuhnya wewenang pihak penyidik kepolisian. “Sesuai tugas pokok dan fungsi dewan, penganggaran, legislasi dan pengawasan. Pertanyaanyasekarang,kebijakan manayangsalahdilakukanBupati Karo, sehingga teman-teman ngotot membentuk Pansus. Karena, salah satu tugas kita, adalah pengawasan kebijakan. Pemahaman seperti ini harus

Latihan Geladi Posko-I Kodim 0206 Dairi SIDIKALANG (Waspada): Setelah berlangsung tiga hari sejak dibuka Selasa (25/6), pelaksanaan Latihan Geladi Posko I Kawal Samudra Tanggap XIII, Kodim 0206 Dairi, ditutup dengan upacara dipimpin Kasrem 023/KS, Letkol Inf. Martohap Simorangkir di Lapangan Makodim 0206/DR Jalan Gereja Sidikalang, Kamis 27/6). Latihan yang baru saja diselesaikan melalui Geladi Posko I ini, pada dasarnya merupakan salah satu upaya melakukan pembinaan kesiapan satuan secara internal dan terintegrasi dengan pemerintah daerah,gunamengantisipasisegalabentukpermasalahan yangtimbul. Upacara penutupan Latihan Geladi Posko I Kodim 0206/DR diikuti Dandim 0206/DR, Letkol. Inf. Drs. S. FahmiTambunan,Dandim 0211/TT, Letkol. Inf. Indra, serta seluruh Perwira Staf jajaran Kodim 0206/DR, dan sejumlah personel Kompi 125 Simbisa serta sejumlah pengawas dan penyelenggara Geladi. Dalam amanat tertulis, Danrem 023/KS, Kol.Inf. Andika Perkasa yang dibacakan, Kasrem 023/KS, Letkol Inf Martohap Simorangkir berharap, dengan berakhirnya kegiatan gladi, seluruh peserta akan semakin memahami, dan semakin mampu melaksanakan tugas perbantuan kepada pemerintah daerah, apabila di wilayah dimaksud terjadi bencana alam, khusunya bencana tanah longsor. Mengingat pentingnya materi latihan Geladi, baik bagi penyelenggara maupun bagi pelaku, Komandan Korem 023/KS itu juga berharap, agar dapat dijadikan sebagai bekal pengalaman yang harus dipelihara dan ditingkatkan, sehingga setiap saat dapat digunakan dalam rangka pelaksanaan tugas ke depan, khususnya satuan komando kewilayahan yang akan semakin kompleks, dan menuntut profesionalisme dalam menyelesaikan tugas kewilayahan. (ckm)

dijelaskan kepada masyarakat sebagai pencerahan politik yang baik dan benar,” ujarnya. Pada prinsipnya, lanjut dia, usulan pembentukan Pansus di DPRD sesuai dengan PP No 16 Tahun 2010 yang berkaitan dengan kebijakan bupati sebagai kepala daerah, kita sangat mengapresiasi teman-teman DPRD Kabupaten Karo, apabila pembentukan pansus tersebut berkaitan dengan kebijakan Bupati Karo. Di Undang-Undang Nomor 32Tahun 2004 tentang Pemerintahan Daerah sebagaimana telah diubah beberapa kali terakhir dengan Undang-UndangNomor 12Tahun2008tentangPerubahan Kedua Undang-Undang Nomor

32 Tahun 2004 tentang Pemerintahan Daerah, katanya, semua sudah jelas. “Apa syarat, fungsi dan wewenangkepaladaerah,dariketiga hal tersebut mana yang dilanggar Bupati Karo? Jadi, kenapa harus ngotot membentuk Pansus kalau tidak ada menyalahi peraturan perundang-undangan, termasuk tidak ada kebijakan bupati yang menyalahi,” katanya lagi. Perlu diingat, lanjut dia, jauhjauh hari sebelum Karo Jambi dilantik sebagai Bupati Karo, pihaknyasudahmelaporkanSKPI tersebutkePoldaSumateraUtara, dan sudah clear. “Nah, kalau memang murni, kenapa bukan dari dulu, saat itu dimana teman-teman semua?

Kendatidemikian,kalaumemang ada bukti baru serahkan kepada pihak penyidik. Jangan hanya cuap-cuap saja di media, seakanakan tidak percaya kepada kepolisian selaku pemegang otoritas untuk menyelidikinya. Lagipula SKPI Bupati Karo sudah melewati proses politik yang cukup ketat sesuai peraturan dan perundang-undangan di KPUD Karo. Perlu digarisbawahi, DPRD itu bukanlah lembaga penyidik,” tandas Ferianta. Lebih jauh dipaparkannya, jangan mencari popularitas seakan-akan ada faktor lain. Jauh lebih elegan, kata dia, memprioritaskan tugas-tugas penting dewanuntukkepentinganseluruh rakyat Kabupaten Karo. (c10)

Personel Korem 022/PT Latihan Menembak PEMATANGSIANTAR (Waspada): Korem 022/PT melaksanakan program kerja yang sudah ditetapkan dari komando atas dan sesuai dengan kalender latihanKorem022/PTpadaminggu militer akhir Juni 2013, yakni latihanmenembaksenjataringan pistol dan senjata laras panjang. “Kemampuan menembak merupakan salahsatu kemampuan dasar bagi seorang prajurit dalam mendukung keberhasilan pelaksanaan tugas. Untuk itu, kemampuan menembak yang telah dimiliki prajurit haruslah senantiasa dipelihara dan diting-

katkanmelaluipembinaanlatihan secara terencana dan terprogram sertadilaksanakanevaluasisecara terus-menerus,” terang Kapenrem 022/PT Mayor Caj Drs. Prinaldi tentang latihan menembak yang dilaksanakan seluruh militer Korem 022/PT dan dinas jawatan di lapangan tembak Makorem 022/PT, Jalan Asahan, Pematangsiantar, Kamis (27/6). Untuk mendukung itu, lanjut Kapenrem, perlu diadakan latihan berupa latihan menembak senjata pistol dan senjata laras panjang. “Materi untuk senjata

laraspanjangmenggunakanjarak 100 meter dengan posisi tiarap dudukdan berdiri,sedangsenjata ringan pistol berjarak 25 meter hanya dengan sikap berdiri saja.” Kapenrem menyebutkan, sasaran latihan menembak itu antaralain kuantitatif yakni seluruh personel militer Korem 022/ PT, sedang sasaran kualitatifnya yakni seluruh personel militer Korem 022/PT dan jajaran minimal mencapai tingkat mampu pada materi tembak tepat, baik senjata ringan pistol maupun senjata laras panjang. (a30)

Korpri Pemkab Dairi Peringati Israk Mikraj SIDIKALANG (Waspada): Korps Pegawai Republik Indonesia Kab. Dairi menggelar Peringatan Israk Mikraj Nabi Muhammad SAW dan sekaligus menyambut Bulan Suci Ramadhan 1434 H, di Gedung Olah Raga (GOR) Jl. RSUD Sidikalang, baru-baru ini. Acara diikuti oleh unsur Muspida, para pejabat, serta Pegawai Negeri Sipil (PNS) dan honorer di lingkungan Pemkab Dairi tersebut mendatangkan penceramah Al Ustadz Amhar Nasution, MA. Wakil Bupati, Irwansyah Pasi,SH meminta agar hadirin saling bermaafanuntukmembersihkandirimemasukibulansuciRamadhan, bulan penuh ampunan, serta bulan yang menjadi kesempatan emas bagi kita semua yang beriman untuk beribadah dan berlombalomba mengumpulkan kebajikan. Pada kesempatan itu Wakil Bupati juga mengharapkan doa dan dukungan atas pencalonan dirinya kembali menjadi calon Wakil Bupati untuk melanjutkan program yang belum tuntas. Al Ustadz Amhar Nasution, MA dalam tausiyahnya menjelaskan berbagai keutaman dan menekankan akan pentingnya ibadah shalat wajib lima waktu sebagai tiang agama. Selain itu, mengerjakan puasa Ramadhan merupakan kewajiban umat Islam yang harus dilaksanakan. (ckm)

Penyerahan BSM Langsung Ke Siswa PEMATANGSIANTAR(Waspada):PenyerahandanaBantuanSiswa Miskin (BSM) yang dilaksanakan diseluruh kantor POS di kota PematangsiantardankabupatenSimalungun berjalanlancartanpamasalah. Kepala Kantor Pos Pematangsiantar, Khairil Anwar melalui Kepala SDM,Gilbert Sirait yang didampingi kepala cabang Pos pembantu Tiga Balata, Sabaruddin Hasibuan, kepada Waspada, mengatakan, penyerahan dana BSM langsung diserahkan kepada siswa bersangkutan,artinya tanpa perantara atau diwakilkan. Total siswa miskin yang menerima dana BSM untuk tahun 2013 ini, untuk siswa di kota Pematangsiantar 10.179 orang dan untuk siswa di Kab. Simalungun 3.625 orang. Dana diserahkan untuk siswa kelas dua sampai kelas lima Rp360.000 per tahun, sedangkan untuk siswa kelas enam Rp180.000 per tahun. Penyerahan dana BSM tersebut dilakukan di 18 kantor cabang tersebar di Kab. Simalungun serta tiga kantor pos pembantu di kota Pematangsiantar. (crap)

Waspada/Edoard Sinaga

PERSIAPAN menembak dilakukan para prajurit Korem 022/PT sebelum melaksanakan latihan menembak di lapangan tembak Makorem 022/PT, Jalan Asahan, Pematangsiantar.

Ditindak Tegas, Angkutan Umum Naikkan Ongkos Lebih 20 Persen SIMALUNGUN (Waspada): Dinas Perhubungan dan InformatikaPemkabSimalungunakan menindaktegasangkutanumum yang menaikan tarif ongkos angkutanumumdiatas20persen menyusul kenaikan harga bahan bakar minyak (BBM). Kepala Dinas Perhubungan Pemkab Simalungun, Mixnon AndreasSimamoramenegaskan, penyesuaian tarif ongkos angkutan umum atau angkutan pedesaan sudah ditetapkan maksimal 20 persen dari tarif semula. Ketetapan itu diputuskan dalam rapat dengan Organisasi

Angkutan Darat (Organda), DPRD, Polres Simalungun dan instansi terkait, kemarin. “Disepakati, kenaikan tarif angkutan umum di Simalungun hanya boleh dilakukan pengusaha maksimal 20 persen dari tarif lama. Jikaadapengusahaataukaryawan angkutanumumyangmenaikkan tarif lebih dari 20 persen, akan ditindak keras dengan ancaman izin trayek dicabut,” kata Simamora. Menurut Simamora, kenaikan tarif angkutan umum di wilayah Kab. Simalungun, tidak dilakukan berdasarkan kilometer,

namun dinaikan antara 15-20 persen dari tarif lama. “Itulah hasil kesepakatan dengan Organda dan pertimbangannya karena menilai cukup banyak jalan yang rusak di daerah lintasan angkutan umum, sehinggajikakenaikantarifdidasari jaraktempuh banyakpengemudi yang keberatan,” ujarnya. Ketua Organda Kabupaten Simalugun,Timbul Jaya Sibarani mengharapkan para pengusaha danpengemudiangkutanumum mematuhi ketentuan kenaikan tarif angkutan umum yang telah disepakati. (a29)

36 Pejabat Baru P. Siantar Dituntut Tingkatkan Kualitas PEMATANGSIANTAR (Waspada): Sekda Drs. Donver Panggabean, M.Si atas namaWali Kota Hulman Sitorus, SE mengambil sumpah dan janji serta melantik 36 pejabat eselon II, III dan IV di lingkungan Pemko Pematangsiantar. “Pejabat yang baru diambil sumpah/janji jabatan pada hari ini agar dapat menjalankan amanah dan kepercayaan dari negara terhadap PNS berdasarkanprofesionalisme,kompetensi serta bertanggungjawab dan meningkatkan kedisiplinan. Sebagai aparatur pemerintah, dituntut untuk meningkatkan kualitas pengabdian dan kinerja terbaiknya kepada masyarakat,” minta Wali Kota melalui Sekda saat pengambilan sumpah dan janji serta pelantikan para pejabat itu di ruang data Pemko, Jalan Merdeka,Pematangsiantar,Selasa (25/6).

Untuk mewujudkan pemerintah yang baik (good governance), kata Sekda, para pejabat yang dilantik juga harus menandatangani fakta integritas. “Untuk memperkuat komitmen bersama dalam pencegahan dan pemberantasan korupsi, menumbuhkembangkan keterbukaan dan kejujuran, mewujudkan pemerintahyangberkualitasserta mewujudkan pemerintah dan masyarakat Indonesia yang maju danbertanggungjawab,terutama di Pematangsiantar.” Sekda juga berpesan agar pejabat yang baru dilantik dapat mensukseskan agenda kerja Pemko serta memelihara dedikasi, integritas dan loyalitas. “Diharapkan, pejabat yang dilantikmampumenyikapisecara konstruktif berbagai kritik dari masyarakatsertabahumembahu dalam bekerja sesuai dengan prosedur serta mampu melaksa-

nakan tugas pengabdian dengan penuh tanggung jawab.” Ke-36pejabatdilantikdiantaranya Leonardo H Simanjuntak, SH, M.Hum sebagai Asisten I Administrasi Pemerintahan dan Kesejahteraan Rakyat, Dra. Fatimah Siregar sebagai Sekretaris Dinas Pemuda, Olah Raga, Kebudayaan dan Pariwisata (Disporabudpar), Drs. Hotlan Pasaribu sebagai Sekretaris Badan Pelayanan Perizinan Terpadu (BPPT), Ir. Sangap Sitepu sebagai Kabid Penataan Ruang Dinas Tarukim, Samsuden sebagai Pj. Kasubbag SandidanTelekomunikasiBagian Humas dan Protokoler, Daniel Rumandar Parulian Purba, SE sebagai Pj. Kasubbag Pengumpulan, Pemberitaan dan Penyebarluasan Informasi Bagian Humas dan Protokoler dan Donal Hermanto Simanjutak, SE sebagai PJ.Lurah Parhorasan Nauli, KecamatanSiantarMarihat. (a30)

Peringatan Israk Mikraj Desa Mekar Sari SEISUKA (Waspada): Peringatan Israk Mikraj Desa Mekar Sari, Kec. Sei suka Kab. Batubara, Jumat (28/6) di Musholla Dusun X berlangsung khidmat, diikuti ratusan warga. DenganmengundangustadzChairuddinyangmembawakantema hikmah Sirak Mikraj dan ibadah dalam mengisi bulan Ramadhan yang akan segera datang, warga terlihat antusias mendengarkan tausiahnya. Hadir dalam kesempatan itu Kepala Desa Mekar Sari Dian Suartono,KetuaBPDHermadi,KetuaLPMPoniranKaurpemSugianto. Dian dalam sambutannya menyampaikan terimakasi kepada seluruh warga Desa Mekar Sari yang turut berperan aktif melaksanakan kegiatan Irak Mikraj ini. “Dalam menghadapi bulan suci Ramadhan ini, mari kita melaksanakan gotong royong di desa agar desa kita menjadi bersih dan nyaman,” kata Dian. (c05)

Meriah, Pesta Kerja Tahun Di Karo Rudi Hartono Bangun: Ini Bentuk Rasa Syukur KARO (Waspada): Pesta Kerja Tahun dan Gendang Guro-guro Aron 2013 di Desa Perbesi, Kec. Tiga Binanga, Kab. Karo, berlangsung meriah dihadiriribuanwarga,Jumat(28/6)malam.Ribuan warga berbaur bersama Bupati Karo Kena Ukur Karo Jambi, anggota DPRD Sumut Layari Sinukaban, Ketua DPRD Kab. Langkat H. Rudi Hartono Bangun, SE, M.AP, dan sejumlah pimpinan SKPD Kab. Karo. Rudi Hartono Bangun yang diminta menyampaikankatasambutan,mengungkapkan, kawula muda harus dilibatkan dalam pesta adat, seperti sekarang ini, agar kawula muda lebih memahami adat-istiadat leluhur mereka. “Ini penting dilakukan agar kawula muda tidak terseret arus negatif kemajuan teknologi dan globalisasi.” kata Rudi. Rudi Hartono Bangun menyatakan bangga kepada penampilan tarian tradisional Karo dibawakan para kawula muda Desa Perbesi. Dalam sambutannya, Rudi juga memberikan apresiasi dan mendalamkepadapanitiapelaksana yang dikomandoi oleh Kepala Desa Perbesi, Raja Edward Sebayang, yang telah berhasil merayakan Hiburan Kerja Tahun dan Gendang Guro-guro Aron tersebut dengan sangat meriah. Terlihat

wajah cerah warga masyarakat Desa Perbesi yang sedang berpesta pada malam itu. Karena mereka dihibur oleh perkolong-kolong Keleng Barus dan Anita, serta tarian-tarian tradisional Karo dibawakan kawula muda Desa Perbesi. Rudi Hartono Bangun, yang juga calon anggota DPR RI Partai Demokrat nomor urut 8 dari Dapil Sumut 3 ini, mengingatkan, Pesta Kerja Tahun bagi masyarakat Suku Karo bukan sembarang pesta.Tapi sebagai bentuk rasa syukur rakyat di Tanah Karo kepada Tuhan Yang Maha Esa yang telah memberikan begitu banyak rezeki dan kemudahan bagi rakyat Tanah Karo. Pesta Kerja Tahun juga dimaknai sebagai pulang kampung bagi warga Desa Perbesi yang merantau dan kemudian memberikan sumbangsihnya kembali kepada desa asalnya. Rudi Hartono Bangun menyatakan memberikan sumbangan kepada panitia pelaksana Rp5 juta rupiah, yang diwarnai oleh tepuk tangan yang meriah dari ribuan hadirin yang memadati Loss Desa Perbesi tersebut. BupatiKaroKenaUkurKaroJambimengucapkan selamat Pesta KerjaTahun kepada masyarakat Desa Perbesi dan memberikan sumbangan Rp5 juta kepada panitia pelaksana. (ihn)

BPN Simalungun Terbitkan 125 Sertifikat Tanah Wakaf

Rp4 M Dana APBD Karo Berdayakan Petani Jeruk TIGA PANAH(Waspada): Dinas Pertanian dan Perkebunan Kab. Karo akan melakukan border lahan pertanian jeruk Karo, untuk mengendalikan hama lalat buah secara sistem border areal lahan pertanian jeruk dengan me blok. “Dengan anggaran Rp4 miliar dari APBD terserap dalam program pengendalian hama lalat buah Dinas Pertanian dan Perkebunan Kabupaten Karo,” ujar Kepala Dinas Pertanian dan Perkebunan Karo AgustoniTarigan SP didampingi Kabid Produksi Munarta Ginting SP saat melakukan sosialisasi data penerimaan meblok di Kec. Tiga Panah kepada Waspada, baru-baru ini. Peran-serta pengendalian hama lalat buah bukan semata-mata ditujukan pada Dinas Pertanian dan Perkebunan saja melainkan peran badan penyuluhan pertanian (BPP), PPL terutama petani jeruk yang terhimpun dalam kelompok tani, karenannya. “Mengenai pembagian teknologi pengendalian hama lalat buah, Dinas Pertanian dan Perkebunan Kabupaten Karo direncanakan akan membagi alat bantu pengendali hama lalat buah ke kelompok tani awal Juli 2013,” ujar Agustoni Tarigan SP. Selain itu, Dinas Pertanian dan Perkebunan Kab. Kabupaten Karo punya program bagi petani jeruk Karo yang ingin menggantikan dengan tanaman lain seperti kopi, Dinas Pertanian dan Perkebunan Karo akan menyediakan bibit dan bagi petani jeruk yang memiliki tanama jeruk layak tumbang Dinas Pertanian dan Perkebunan Karo juga menyediakan bibit. “Syarat calon penerima bantuan bibit dari Dinas Pertanian dan Perkebunan Kabupaten Karo cukup mengajukan surat permohonan atau proposal dari petani ke Dinas atas nama kelompok tani,” ujar Kabid Produksi Munarta Ginting SP. (c10)

Waspada/Ist

KETUA DPRD Langkat yang juga caleg DPR RI Dapem 3 Sumut H.Rudi Hartono Bangun, SE, M.AP (ketiga dari kiri) didampingi Bupati Karo Kena Ukur Karo Jambi (di sebelah kiri Rudi), dan anggota DPRD Sumut Layari Sinukaban (kedua dari kanan), sedang menyaksikan pagelaran tari tradisional Karo oleh muda-mudi Desa Perbesi, Kec. Tiga Binanga.

Waspada/Edoard Sinaga

PENGAMBILAN sumpah dan janji serta pelantikan 36 pejabat eselon II, III dan IV di lingkungan Pemko Pematangsiantar dilakukan Sekda Drs. Donver Panggabean, M.Si atas nama Wali Kota Hulman Sitorus, SE di ruang data Pemko, Jalan Merdeka.

SIMALUNGUN (Waspada): Kantor Badan Pertanahan Nasional (BPN) Simalungun dalam dua tahun terakhir menyelesaikan 125 bidang sertifikat tanah wakaf tersebar di berbagai nagori (desa) dan kecamatan di daerah itu. Kepala Seksi Pengendalian dan Kordinator Tanah Wakaf BPN Simalungun, Yandi Kesuma, didampingi Kasubsi Penetapan Hak, Endi Faisal Lubis, kepada Waspada di ruang kerjanya mengatakan, dengan terselesaikannya penerbitan sertifikat tersebut, berarti sudah 40 persen tanah wakaf di daerah ini memiliki sertifikat tanah yang sah. Sedangkan 60 persen lagi tanah wakaf yang tersebar di berbagai daerah itu pensertifikatannya disegerakan untuk diproses. Persoalan tanah wakaf di Simalungun yang sudah menjadi problem bagi pengelola tanah wakaf, karena sulitnya prosedur dan administrasi yang diberlakukan petugas di BPN sebelumsebelumnya. Masyarakat sempat frustasi mengajukan permohonan pensertifikatan tanah

wakaf. Namun pada 2012, BPN lewat program percepatan penerbitan sertifikat tanah wakaf bekerjasama dengan Kementerian Agama (Kemenag) Simalungun menghimpun dan mendata tanah wakaf yang sebelumnya dimohonkan disertifikatkan. Berkat kerjasama serta kerja keras tim, sampai Juni 2013 ini, sudah 125 bidang tanah wakaf selesai disertifikatkan. Tanah wakaf di Simalungun yang telah disertifikatkan itu terdiri dari tanah wakaf rumah ibadah, tanah wakaf pemakaman umum dan tanah wakaf produktif, seperti tanah wakaf pertanian dan sebagainya yang dikelola yayasan. Dijelaskan, para pengelola rumah ibadah (nazir), pemakaman umum dan tanah wakaf lainnya dapat mengajukan permohonan pensertifikatan tanah wakaf melalui kantor KUA atau langsung ke kantor Kementrian Agama di daerah ini untuk selanjutnya diteruskan ke kantor BPN. (crap/c16)

Belum Ada Tersangka Kecelakaan Maut Mobil Dinas BPBD G. Sitoli GUNUNGSITOLI (Waspada): Penyidik Polres Nias melalui Unit Laka Sat Lantas hingga saat ini masih belum menetapkan siapa yang menjadi tersangka atas insiden kecelakaan maut mobil dinas BPBD Kota Gunungsitoli yang menelan satu korban jiwa dan sembilan terluka di Simpang Meriam Jalan Diponegoro, Kel. Ilir, Kota Gunungsitoli, Rabu (26/6). Polisi masih melakukan pemeriksaan terhadap sejumlah saksi dan korban. Demikian disampaikan Kepala Unit Kecelakaan Lalu Lintas Polres Nias Ipda Daniel kepada wartawan ketika ditemui di kantornya, Kamis (27/6. “Untuk saat ini, kita masih belum menetapkan siapa tersangka dalam kasus kecelakaanini.Kitamasihmelakukanpenyelidikan,” terang Ipda Daniel. Mengenai kehilangan barang berupa tas berisi uang yang dialami korban tewas Faigisokhi Harefa saat kecelakaan terjadi, Ipda Daniel menegaskan hal tersebut tidak dicampuri Unit Laka, karena menurut Daniel pihaknya hanya sebatas menangani kasus kecelakaan dan baru tiba saat kerumunan massa sudah banyak di TKP. Daniel menjelaskan, dari sembilan korban terluka termasuk sopir, hanya satu korban mengalami luka parah yakni Amin SyarifTanjung, dan saat ini korban telah dirujuk dari klinik Tabita ke RSU Gunungsitoli. Korban lainnya yang

tergolong luka ringan menurut Daniel sudah meninggalkan RSU dan kembali ke rumah. Sedangkan sopir mobil dinas BPBD Kota Gunungsitoli, Ariston Lombu, sebut Daniel, tergolong luka ringan dan masih dirawat di RSU Gunungsitoli. Namun Ariston masih belum bisa dimintai keterangan oleh polisi, karena dia masih belum ingat apa yang terjadi. Sementara itu di tempat terpisah, Peringatan Harefa alias Ama Risto salah seorang kerabat korban tewas Faigisokhi Harefa saat ditemui wartawan di rumah duka, Jalan Maena, Desa Sisobahili Gunungsitoli mengaku, pihak keluarga sangat sedih dan terpukul atas kepergian korban dalam kecelakaan maut tersebut. Menurut Peringatan, keluarga duka sudah menyepakati akan melaksanakan acara pemakaman korban pada, Jumat (28/6) di Dusun I Lawinda, Desa Sifalaete, Kecamatan Gunungsitoli, Kota Gunungsitoli. Peringatan Harefa juga mengakui pasca kejadian pihak BPBD Kota Gunungsitoli telah mengutus dua orang pegawai untuk melayat serta menyerahkan bantuan berupa peti jenazah kepada keluarga korban. Menurutnya Kepala BPBD, Sozisokhi Lombu yang masih berada di luar daerah berjanji akan melayat dan menghadiri langsung pemakaman. (a25)

‘Horas Parapat Fiesta’ Dibuka PARAPAT (Waspada): Pagelaran Seni Budaya ‘Horas Parapat Fiesta’ dibuka secara resmiWakil Bupati Simalungun Hj Nuryati Damanik SH di open stage Parapat, Kamis (27/6). Ketua Pelaksana Horas Parapat Fiesta Jhoni Sinaga SH mengatakan , terselenggaranya acara ini hasilswadayamasyarakat dan didukungpelaku wisata dan pengusaha hotel di Parapat. Pelaksanaannya tidak ada tendensi apapun apalagi dikaitkan dengan politik, murni untuk kemajuan masyarakat Parapat dan untuk mendukung budayayangadadiParapat.Direncanakan,kegiatan ini akan dilaksanakan berkesinambungan pada tahun-tahun berikutnya. Wakil Bupati Simalungun HjNuryatiDamanik SH dalam sambutannya mengatakan, semakin banyak lembaga percepatan pembangunan kemasyarakatan dan kelompok kerja pemerhati dan pecinta seni budaya dan pariwisata, maka akselerasi dan percepatan pembangunan dan pengembanganpariwisataakanmeningkatsecara signifikan, apalagi seni budaya dan olahraga merupakan bagian tidak terpisahkan dari berbagai variabeldankomponenindustripariwisataitusendiri. Oleh karenanya, Hj Nuryati Damanik SH memberi apresiasi yang tinggi kepada semua pihak terutama kepada masyarakat Simalungun

dan khususnya masyarakat Parapat ataupun yang ada di perantaun yang tampil menjadi motivator untukpembangunandanpengembanganindustri pariwisata di Parapat sehingga Kota Parapat akan menjadi pintu gerbang utama kota wisata di Sumatera Utara. Wakil bupati berharap kepada masyarakat Girsang Sipangan Bolon mampu menjadi masyarakat pariwisata. Kepada pengurus LPMP (Lembaga Musyawarah Pembangunan Masyarakat Parapat) diharap untuk menciptakan kader wisata yang terprogram secara proporsional dan profesional. “Jika semuanya dapat diaktualisasi maka harapanuntukpengembangankotawisataParapat akan dapat bertahap dan berkesinambungan yang pada gilirannya untuk meningkatkan kesejahteraan masyarakat,” tandasnya. Acara berlangsung tiga hari mulai 27-30 Juni 2013 diisi acara pagelaran budaya, lomba kuliner, festivalvokalgrupSMP&SMA,lombasoluparsadasadaan, festival tor-tor tradisional,vokal solo tingkat SD, lomba renang, aksi paralayang, eksibisi perahu layar, solu bolon, sepak bola Utte, solu pardua-duaan, tor-tor sawan,vokal grup lapo tuak. Panitia juga menyediakan berbagai hadiah dan dihibur artis ibukota. (crn)


Sumatera Utara

B4

WASPADA Senin 1 Juli 2013

Heboh Bagi-bagi Proyek Di Dinas PU Madina PANYABUNGAN (Waspada): Informasi yang menyeruak ke sejumlah kalangan mengenai bagibagi proyek di Dinas Pekerjaan Umum (PU) Mandailing Natal (Madina), menggebohkan banyak pihak. Wakil Bendahara Umum (Wabendum)BadkoHMISumur Faizal Ardiansyah, misalnya, menilai adanya informasi bagibagi paket proyek di Dinas PU Madina baru-baru ini diduga dilakukan sejumlah oknum, menjadi indikasi aroma korupsi nasih menggurita di instansi yang saat ini menjadi perhatian Komisi Pemberantasan Korupsi (KPK). “Kita minta kepada jaksa, polisi, BPK dan KPK untuk segera melakukan pemeriksaan kepada

seluruh panitia, Kabid dan Kasubbagdalamkaitaninformasi bagi-bagi proyek fisik di Dinas PU. Kalau memang ini benar, atas dasar apa mereka membagi-bagi proyektersebutdanadakemungkinan Bupati/Wakil Bupati tidak mengetahui kebijakan itu,” ujar Wabendum Badko HMI Sumut FaizalArdiansyahdiGedungDPRD Madina ketika berdialog dengan anggota DPRD Madina Iskandar Hasibuan, Jumat (28/6). Menurut Faizal Ardiansyah,

Pejabat PU Paluta Ditangkap Di Kamar Hotel Bersama WIL P. SIDIMPUAN (Waspada): Satreskrim Polresta Padangsidimpuan menangkap basah Kabid PU Padanglawas Utara (Paluta) sedang bersama wanita idaman lain (WIL) di kamar Hotel Lancer Kota Padangsidimpuan, Sabtu (29/6), sekira Pukul 09:00. Menurut Juper Satreskrim Polresta Padangsidimpuan, H. Ag Harahap penangkapan itu berdasarkan laporan dari keluarga istri Kabid PU Paluta, AES, 42, warga Gunungtua. Dia ditangkap di kamar Hotel Lancar Nomor 218 bersama wanita warga Gunungtua, RHP, 29. Saat ditemui, RHP tak bersedia memberi komentar. Menurut Juper, Kabid tersebut dijerat pasal tentang perzinahan dengan ancaman maksimal lima tahun penjara. Hingga berita ini dikirim, Kabid itu masih dalam pemeriksaan. Sebelumnnya, menurut kakak ipar dari Kabid PK Harahap, sejak dia menjabat Kabib barubaru ini, dia seperti lupa diri. “Sejak dia menjabat Kabid di PU Paluta, ipar saya itu bagai tak tentu arah, adek saya dizoliminya. Kasus serupa sudah pernah terjadi, namun saat itu kami maafkan,” ujar PK Harahap. (c13)

KPU Palas Ajak Warga Perangi Kecurangan SIBUHUAN (Waspada): Ketua Komisi Pemilihan Umum (KPU) Padanglawas (Palas) Atas Siregar mengajak semua komponen agar bersama-sama mencegah kecurangan, menjauhi politik transaksional, intimidasi dan kekerasan. “Mari kita buktikan, Kabupaten Padanglawas mampu melaksanakan pemilu yang aman, damai, lancar dan berkualitas dengan menjaga integritas dan netralitas,” ujar Atas Siregar saat acara sosialisasi Pemilu 2014 di Sibuhuan, Kamis (28/6), dalam acara diselenggarakan KPU Palas. Kegiatan ini diselenggarakan untuk meningkatkan pemahaman terkait Pemilu 2014 kepada seluruh elemen masyarakat, selain partai politik peserta pemilu. Ketua KPU Padanglawas Atas Siregar didampinggi anggota Balyan Kadir Nasution, Rahmat Efendi Siregar, H. Ahmad Rizal Daulay, pada kesempatan itu meminta kontribusi dari semua pemangku kepentingan seperti partai politik peserta pemilu, masyarakat, pemerintah, swasta, pegiat pemilu, pemantau, organisasi kemasyarakatan (Ormas) demi terciptanya suasana yang kondusif dalam penyelenggaraan tahapan pemilu. Sebelumnya sekretaris KPU Palas, juga mengatakan, sosialisasi pemiludiperlukanuntukmemberikanpemahamanyangutuhtentang substansi pemilu dan teknis pemilu kepada seluruh elemen masyarakat. Pemahaman substantif, katanya, berkaitan dengan pemenuhan hak konstitusional warga untuk dapat menggunakan hak pilih dengan baik pada pemilu 2014. Selain menekankan pentingnya masyarakat memaknai urgensi kehadiran mereka di Tempat Pemungutan Suara (TPS). (a33)

Lestarikan Aksara Mandailing PANYABUNGAN (Waspada): Surat tulak- tulak merupakan aksara asli Mandailing untuk membaca dan menulis yang tak ternilai harganya. Ini sebagai jati diri orang Mandailing yang mesti dilestarikan dalam kehidupan, apalagi aksara ini salahsatu dari tujuh aksara yang ada di Indonesia. Hal itu dikatakan Muhammad Bakhsan Parinduri gelar Jasinaloan pada kegiatan sosialisasi penulisan surat tulak-tulak Mandailing digelar Pusat Informasi dan Dokumentasi Mandailing (Kelompok Humaniora Pokmas Mandiri) Sumut di Sopo Sio Parsarimpunan Ni Tondi Mandailing Sabagarabak Hutapungkut Jae Kecamatan Kotanopan Kabupaten Mandailing Natal, barubaru ini. “Selain kekayaan aksara surat tulak-tulak yang memiliki keunikan karena mempunyai tujuh ragam diksi, suku bangsa Mandailing juga memiliki bahasa tersendiri yaitu bahasa Mandailing yang merupakan salahsatu bahasa dari 746 bahasa di Indonesia,” ucapnya. Hadir dalam sosialisasi ini ketua Pusat Informasi dan Dokumentasi Mandailing (PIDM) Imran Nasution, Kadispora,Kebudayaan dan Pariwisata Madina diwakili Kabid Kebudayaan dan Pariwisata Rizal Fahlefi Lubis dan Bahder Sulaiman, Camat Kotanopan H. Suyono, Plt UPT Dinas Pendidikan Kotanopan Ahmad Hidayat, guru-guru serta tokoh masyarakat setempat. Ketua PIDM Sumut Imran Nasution menyebutkan, maksud dan tujuan diselenggaralkannya sosialisasi guna mengenalkan kembali dan melestarikan aksara Mandailing atau surat tulaktulak kepada generasi Mandailing Natal, karena belakangan ini warga Mandailing sangat minim yang bisa membaca dan menuliskan aksara ini. (a28)

Bus Batang Pane Baru Tabrak Dua Truk, 5 Luka-luka PERBAUNGAN (Waspada): Bus penumpang CV. Batang Pane Baru BB 7027 LJ menabrak dua truk, truk tanki Bk 9505 BK dan truk Trailer BK 9815 DN, mengakibatkan sedikitnya lima penumpang bus terluka. Tabrakan terjadi di Jalinsum Medan -Tebingtinggi KM 36-37 Lingk. Tempel, Kel. Simpang Tiga Pekan, Kec. Perbaungan, Kab. Serdang Bedagai, baru-baru ini. Ke 5 penumpang bus Batang Pane Baru yang luka-luka, Sella,13, warga Gunungtua, Padangsidimpuan, Alsadi Hasyim, 18, warga Sosa Padanglawas, Siska Devi br Rajaguguk, 17, warga Rokan Hulu, Riau, Ali Rangkuti, 22, Desa Makmur, Kec. Barumun Tengah, Kab. Padanlawas. Seluruh korban dirawat di RSU Sawit Indah di Ke. Batang Terap, Kec. Perbaungan Informasi diperoleh, bus Batang Pane Baru melaju dari arah Tebingtinggi menuju Medan dengan kecepatan tinggi. Setibanya di lokasi kejadian bus berusaha mendahului kendaraan yang ada di depannya dengan mengambil jalur terlalu ke kanan. Di saat bersamaan melaju truk tangki BK 9505 BK dikemudikan Ramatullah, 40, warga JL. Pelita, Kel. Titi Papan, Medan Deli. Tabrakan tak terhindarkan. Setelah itu bus kembali menghantam truk Trailer BK 9815 DN dikemudikan Suyatmin, 54, warga Jalan Ir. Soekarno Hatta, Lingk.II, Kel. Tambangan Kota Tebingtinggi. Kedua sopir truk selamat, sementara sopir bus kabur setelah kejadian. Kasatlantas Polres Sergai, AKP Hasan Basri membenarkan peristiwa itu.(c03)

dia memahami, proyek fisik di bawahRp200jugaadalahhakdari pihak Dinas PUD menentukan siapa kontraktor yang mengerjakannya, namun tentu ada dasar dan kriteria dari yang mendapatkanpaketproyek,misalnyaperusahan yang mendapat paket mempunyai kinerja yang baik selama ini,tapibukanpengusahayangtelah memberikan dana lebih duluan. “Kita telah menanyakan kepada pengusaha jasa kontruksi secara langsung mengenai info bagi-bagi paket proyek. Kontraktormengakubanyaktidakmengetahui, karena sistemnya dikabarkan lebih cenderung dilakukan secara diam-diam. Kita berharap,

40 anggota DPRD Madina mempertanyakan kebenaran info ini kepada kepada panitia tender,” ujar Wabendum Badko HMI Sumut Faizal Ardiansyah. Diamengungkapkan,pihaknya jugadalamwaktudekatakanmempertanyakanlangsungkepadapihak DinasPUdanWakilBupatiMadina tentangkriteriadarikontraktoryang kebagianpaketproyekdiDinasPU. “Jangan-jangan,kalaupunmisalnya benar ada bagi-bagi proyek, ini justrutanpasepengetahuan Wakil Bupati,” katanya. Mereka juga mendengar kabar ada sejumlah oknum mendapat jatah paket proyek yang tertampung dalam APBD Tahun

2013 ini. Dikatakan, sekarang ini, rekan-rekan mahasiswa sedang mengumpulkan data terkait proyekPLyanganggarannyadibawah Rp200 juta sedang. “Kita sedang mendata proyek apa saja dan siapa kontraktornya, serta perusahaansiapayangmendapatkannya dan apa keistimewaan perusahaan tersebut.” Sekretaris Fraksi Perjuangan Reformasi DPRD Kab.Madina Iskandar Hasibuan dalam acara dialog dengan mahasiswa itu, mengutarakan, agar para mahasiswa berdialog dengan anggota Komisi 3 karena komisi itu mitra kerja Dinas PU, Dinas Pertambangan dan Energi. (ihn)

calon Bupati Palas Drs H Rahmat PHasibuan (foto) tidaksaja mempunyaiakseskepemerintahpusat dan pemerintah provinsi, juga sangat memahami birokrasi, juga punyakonseppembangunanbernuansakerakyatan,kebersamaan. “Kami melihat, sejak 2008, Padanglawas nyaris tidak berubah. Begitu-begitu saja. Tidak ada perkembangan. Potret kemiskinandemikianmudahdijumpai di sana. Padahal, salahsatu tujuan pemekaran Padanglawas dari Kab. Tapsel, ya, untuk meningkatkankesejahteraanmasya-

rakat,” ujar Munawir Hamdani Nasution. Padahal, lanjut dia, kita tahu persis, sumber daya alam Padanglawas luar biasa khususnya di bidang pertanian, perkebunan dan pertambangan, yang seharusnya dapat dimanfaatkan sebaik-baiknya untuk kepentingan orang banyak di Palas. “Dengan kemampuan Bang Haji Rahmat, kami yakin Padanglawas akan lebih baik. Percepatan pembangunan Palas insya Allah mampu diwujudkan. Apalagi kita melihat keikhlasan beliau membangunkampunghalaman,”tambahMunawirHamdaniNasution. Sedangkan Sekjen HIMPPAS Syahril Iman Panggabean mengungkapkan, selain latar belakang Rahmat P Hasibuan yang politisi danmantanbirokratyangpernah malang-melintang bertugas di sejumlah daerah di Sumut, Rahmat juga dinilai memiliki konsep yang jelas melakukan percepatan pembangunan Padanglawas dengan mengandalkan kebersamaan. (ihn)

Waspada/Ist

WALI KOTA Sibolga Drs. HM Syarfi Hutauruk saat menyampaikan arahan rencana pelaksanaan proyek pembangunan jalan beton bertulang seputar Jalan KH Ahmad Dahlan atau Jalan Mojopahit sepanjang 900 meter dengan anggaran Rp14,7 miliar.

Warga Pancuran Bambu Rahmat P Hasibuan Dinilai Mampu Bersyukur Jalan Dibangun Lakukan Percepatan Bangun Palas MEDAN (Waspada): Untuk mengejar ketertinggalan Kab. Padanglawas (Palas) sekaligus meningkatkan kesejahteraan masyarakat sebagai salahsatu tujuan pemekaran, dinilai harus dilakukan dengan konsep yang jelasdenganpemimpinyangtidak saja mampu memaksimalkan potensi sumber daya alam Palas, tapi juga mampu melakukan lobi ke pemerintah pusat dan pemerintah provinsi. “Bagaimana mungkin melakukanpercepatanpembangunan Padanglawas kalau tidak bisa melobi pemerintah pusat dan pemerintah provinsi, karena alokasi anggaran tidak saja harus melulu dari APBD Palas, juga dari APBD Sumut dan APBN. Bahkan peran investor harus dimaksimalkan untuk kesejahteraan masyarakat,” ujar Ketua Himpunan MahasiswaPemudaPadanglawas (HIMPPAS) Munawir Hamdani Nasution didampingi Sekjen Syahril Iman Panggabean kepada Waspada di Medan, kemarin. Menurut HIMPPAS, sosok

Bupati Palas Akan Realisasikan Aspirasi Masyarakat Gading BARUMUN TENGAH (Waspada): Bapati Padanglawas H. Ali Sutan Harahap akan merealisasikan aspirasi amasyarakat luat Desa Gading sekitar untuk menjadi kecamatan tersendiri, Kec. Barumun Barat terlepas dari Kec. Barumun Tengah. Bupati Palas di Desa Gading Kec. Barumun Tengah dalam kunjungan kerja, Rabu (26/6), menyampaikan, sekalipun saat ini terjadi moratorium pemekarankecamatan,namunkitaharus terusberbenahdanmempersiapkan diri, menggalang kekuatan serta mencari dukungan sosial. Pemerintah kabuaten dalam menyahuti aspirasi masyarakat, lanjut bupati, akan berupaya melakukanpendekatansekaliguspeninjauan langsung ke masyarakat

demi mendapatkan data pendukung yang seobjektif mungkin. “Karena, pemerintah sangat mendukung percepatan pembangunan, apalagi pemekaran kecamatan demi memperpendek rentang kendali dan pelayanan pemerintahn yang juga akan mendorong pemerataan pembangunan,” katanya. Namun harus disadari bersama, lanjut bupati, dengan pemekaran kecamatan tentu akan membenabani anggaran daerah dalam menjalankan organisasi pemerintahan, baik dalam rangka mempersiapkan aparatur maupun perkantoran. “Sekalipun demikian, kita terus berupaya untuk melakukan yang terbaik, dengan meminta kerjasama yang baik dengan

DPRD Kabupaten Padanglawas serta seluruh elemen masyarakat, sehingga aspirasi dan harapan masyarakat Desa Gading sekitar untuk mewujudkan pemekaran kecamatan akan segera terwujud,” ujar bupati. H. Mukhlis Harahap, tokoh masyarakat Desa Gading Kec. Barumun Tengah menyampaikan terimakasihmasyarakatterhadap kepemimpinan H. Ali Sutan Harahap yang sangat perhatian terhadap kondisi masyarakat. Apalagi dia dinilai memiliki kepedulian tinggi terhadap berbagai kegiatan sosial, termasuk dukungan positif terhadap kegiatan keagamaan maupun perhatian istimewa terhadap anak yatim piatu di setiap kali melakukan kunjungan ke desa. (a33)

Sergai Peringati Hari Lansia

Kesehatan Lansia Belum Dapat Perhatian Masyarakat PANTAICERMIN(Waspada): Plh. Bupati Sergai Ir. H. Soekirman mengatakan, saat memasuki usia lanjutparalansiaseharusnyalebih memperhatikan kesehatan dan menjaga agar kondisi tubuh tetap prima di usia senja. Namun pada kenyataannya sampai saat ini kesehatanlansiamasihbelummendapat perhatian dari masyarakat. Plh. Bupati Sergai Ir. H. Soekirman mengatakan itu pada peringatan Hari Lanjut Usia (Lansia) di wisata bahari Pantai Pondok Lestari Indah Kec. Pantai Cermin, Kamis (27/6). Hadir mewakili Sekretaris DitjenRehsosKementerianSosial RI Dra. Agustina Br Kaban, M.Si, Sekdakab Sergai Drs. H. Haris Fadillah, M.Si, mewakili Kadis Kesejahteraan dan Sosial Provsu, Ketua GOPTKI Ny. Hj. Marliah

Soekirman, Ketua DWP Hj. Imas Haris Fadillah, mewakili unsur Forum Komunikasi Pimpinan Daerah (FKPD), para Asisten dan Staf Ahli Bupati dan lainnya. Acara yang mengusung tema “Lanjut Usia Pelopor Jati Diri Bangsa” memaknai bahwa lansia adalah sosok yang menyatukan bangsa dan pernah mengambil bagian dalam kehidupan bernegara. Untuk itu diharapkan lanjut usia aktif, sehat dan sejahtera, lansia teladan sepanjang masa dan pemersatu bangsa. “Peran serta lansia dalam berbagai bidang kehidupan perlu terus ditingkatkan sehingga stigma para lansia sebagai beban keluarga akan berubah, menjadi lansia yang bermanfaat, mandiri, sejahtera dan tetap berdaya guna, memberi sumbangsih dalam

pembangunan bangsa dan negara hingga akhir hayat,” kata H. Soekirman. PlhBupatiSergaimengimbau generasi muda khususnya di kabupaten tanah bertuah negeri beradat agar selalu berupaya meningkatkan derajat kesehatan para lansia, sehingga harapan hidup yang menjadi salah satu indikator kebersihan pembangunan nasional semakin meningkat. Sebelumnya Kadis Sosnakerkop H. Karno SH, MAP melaporkan acara Hari Lansia tahun 2013 ini dirangkai pertemuan rutin Komda Lansia dimeriahkan senam lansia, pemeriksaan kesehatan gratis para lansia, pemberianbingkisandantaliasihkepada 114 lansia serta penerimaan dua perahu karet dari Dinas Kessos Pemprovsu.(a08)

SIBOLGA (Waspada): Warga masyarakat Kelurahan Pancuran Bambu bersyukur dan menyambut baik pembangunan Jalan KH Ahmad Dahlan yang sudah lama didambakan untuk kepentingan kelancaran transportasi untuk menunjangpeningkatanpendapatanmasyarakat. HalitudikatakanketuaLPMKelurahanPancuran BambuSyahnulPasaribu,STusaisosialisasirencana pembangunanJalanKHAhmadDahlan,Rabu(26/ 6) di aula Kantor Kelurahan Pancuran Bambu. Turut hadir sosialisasi tersebut Wali Kota Sibolga Drs. HM Syarfi Hutauruk, Asisten I Junedi Tanjung, Asisten II Ir. Basar Sibarani, Kadis PU Ir.Thamrin Hutagalung, Camat Sibolga Sambas FaisalPahmiLubis,S.Sos,KapolsekSibolgaSambas, AKP Jalanak, Kasatlantas polresta Sibolga AKP Syahrul Lurah Pancuran Bambu Ardiansyah Putra Lubis,SSTP,Kasi Pembangunan Kelurahan Pancuran Bambu Alam Satriwal Tanjung,S.Sos

serta ratusan warga masyarakat. Dalam kesempatan tersebut atas nama masyarakat Kelurahan Pancuran Bambu Syahnul mengucapkan terimakasih kepada Pemko Sibolga karena rencana pembangunan jalan tersebut dari aspal hotmix menjadi jalan beton bertulang dengan ketahanan diperkirakan 25 tahun. Kadis PU Kota Sibolga Ir.Thamrin Hutagalung dalam ekspos mengatakan bahwa rencana pembangunan jalan beton bertulang dimulai dari simpang lima jalan Horas Kelurahan Pancuran Dewa sampai simpang Jalan Dame dengan total anggaran Rp20 miliar, namun tahap awal direalisasikan Rp14,7 miliar sepanjang 900 meter. Wali Kota Sibolga Drs. HM Syarfi Hutauruk memohon maaf kepada masyarakat karena proses pembangunan jalan ini nanti akan mengganggu aktivitas masyarakat terutama bongkar muat ikan di tangkahan. (a24)

Nelayan Pantai Barat Madina Dua Minggu Tak Melaut PANYABUNGAN (Waspada): Selama dua pekan terakhir ini, nelayan yang ada di wilayah pantai barat Kab. Mandailing Natal yakni Kec. Batahan, Natal dan Muara Batang Gadis jarang melaut.Pasalnya,cuacadidaerahitutidakmenentu serta ancaman badai. Zailani, 40, salah seorang nelayan Kecamatan Batahan,mengungkapkan,kemarin,kondisicuaca tak menentu dan badai membuat para nelayan tidak bisa melaut atau melakukan aktivitas mencari ikan. Situasi ini, katanya, sangat mengganggu per-

ekonomian warga. “Kondisi ini sudah berlangsung duaminggulebih.Untukmenutupikebutuhanrumahtangga,banyaknelayanterpaksamencaripekerjaansampingansebagaiburuhupahanpadaperkebunankelapasawityangadadidaerahkami,”ujarnya. Menurutnya,kalaukeadaanterusberlangsung, sangat dikhawatirkan membuat nelayan kelimpungan. Sebab, saat ini kebutuhan keluarga sangat banyak, mulai dari kebutuhan anak sekolah, masuknya tahun ajaran baru, terjadinya kenaikan harga BBM serta adanya kenaikan harga kebutuhan pokok menjelang Ramadhan 1434 H. (a28)

Kantor Bupati Paluta Selesai Akhir Tahun GUNUNGTUA (Waspada): Kepala Dinas Pekerjaan Umum (PU) Padanglawas Utara Makmur Harahap ST MM meninjau pelaksanaan pembangunan kantor bupati dan aula serba guna dikerjakankontraktorpelaksanapemenangtender PT Waskita Karya, Rabu, (26/6). Kantor Bupati Paluta direncanakan rampung akhir tahun ini. Dalam survei lapangan tersebut, Kepala Dinas PU Paluta Makmur Harahap bersama Humas PT Waskita Karya Eka Haitami Tanjung ST dan Budi tampak serius melakukan diskusi teknis, dan memberikan petunjuk atau arahan dengan para teknisi, Satker, PPK, Pelaksana dan Konsultan Supervisi. “Saya juga mantan pengawas proyek, makanya saya ingin langsung mengeceknya,” ujar Makmur Harahap kepada Humas PTWaskita Karya Eka Haitami Tanjung ST dan Budi didampingi konsultan PT Waskita Karya. Selain itu, Makmur juga sempat melakukan

pengukuran ulang ketinggian bangunan kantor bupati mulai dari lantai hingga dasar keramik, hal ini dilakukan dalam upaya mendapatkan pelaksanaan lapangan yang efektif dan efesien, sehingga target mutu dan kinerja dapat tercapai dengan baik dilapangan. Di tempat terpisah, Humas PTWaskita Karya Budimengatakan,pihaknyaakanmerampungkan pembangunan kantor bupati dan gedung serba guna sesuai dengan target dan akan rampung danbisadifungsikanakhirtahunini.“Sesuaidengan target bulan November ini,” ungkapnya. Bangunan utama Kantor Bupati dibangun di atas lahan seluas 2.244 meter persegi dengan konstruksi bangunan bertingkat tiga sehingga akan dapat memenuhi kebutuhan tempat bertugasuntukruangkerjabupatidanwakilbupati,ruang sekda, staf ahli bupati dan asisten. Ruang kerja bagiansekretariatdaerah,ruangrapatrepresentatif serta fasilitas parkir kendaraan memadai. (a35)

Kejari Akan Tetapkan Tersangka Korupsi Perjalanan Dinas Rp17 M STABAT (Waspada): Penyidik Kejari Stabat masih terus memproses kasus korupsi perjalanan dinas para wakil rakyat di DPRD Langkat tahun 2012/2013 senilai Rp17 miliar. “Beberapa saksi telah kita mintai keterangan, dalam waktu dekat akan ditetapkan tersangka,” tegas Kajari Stabat, Hendri kepada Waspada, disela-sela Sertijab Kasi Pidsus Chairun Parapat kepada Ricardo Marpaung, Jumat (28/6). Dikatakan Hendri, tidak ada kendala penyidikan untuk menetapkan tersangka, hanya saja penyidik menunggu data pendukung dari dua pihak maskapai penerbangan meski telah ada dua alat bukti yang cukup. “Ada perjalanan dinas fiktif tidak ada dalam database maskapai penerbangan tentang keberangkatan anggota dewan. Ada juga bentuk penyimpangan lain yang belum dapat diuraikan demi kepentingan penyidikan,” tambah Hendri. Meski masih menunggu hasil audit BPKP

Sumut terkait kerugian negara, penyidik sudah menyimpulkan kerugian negara dalam perjalanan dinas itu mencapai lebih dari Rp1 miliar. Kajari Stabat menambahkan, oknum yang akan ditetapkan sebagai tersangka adalah orang yang paling bertanggungjawab dalam mengelola keuangan perjalanan dinas tersebut. “Kemudian mengarah ke wakil rakyat bersangkutan,” tambahnya. Pantauan sebelumnya, Sekretaris DPRD Langkat H. Salman, mantan Sekretaris Supono, Kabag Hukum Zurwansyah, Kabag Umum DPRD Ali Hasri dan Bendahara Dewan Novriani sudah dimintai keterangan oleh penyidik. Sekretaris DPRD Langkat, H. Salman ketika dimintaitanggapannyakemarinterkaitpenyidikan oleh Kejari Stabat, mengatakan menghormati hal itu. “Data-data yang mereka minta telah kita serahkan, yang jelas tidak ada yang fiktif,” akunya.(a03)

Polisi Tangkap Pembunuh Basuni

Waspada/Ist

PLH BUPATI Sergai Ir. H. Soekirman didampingi Sekdakab Drs. H. Haris Fadillah, Ketua GOPTKI Ny. Hj. Marliah Soekirman, Ketua DWP Ny. Hj. Imas Haris Fadillah, Kadis Sosnakerkop H. Karno menyerahkan bingkisan dan tali asih kepada perwakilan lansia disela-sela acara peringatan Hari Lansia tahun 2013.

BERINGIN (Waspada): Sat Reskrim Polsek BeringinmenangkapSA,36,wargaPasarVI,Dusun PurwoAsri,DesaSidodadiRamunia,Kec.Beringin, Deliserdang, tersangka pembunuh dan pembakaran Basuni, 56, yang ditemukan tewas telungkup di parit kering areal perkebunan sawit PTPN II di Pasar III, Afdeling VII, Blok 97, Dusun III, Desa Emplasment Kuala Namu, Kec. Beringin, pada Sabtu (22/6). Informasi diperoleh, terungkapnya pembunuhan terhadap Basuni setelah pihak kepolisian secara marathon memeriksa sejumlah saksi.Dariketeranganparasaksimengarahkepada SA. Selain keterangan saksi, di tempat kejadian perkara (TKP) polisi juga menemukan puntung rokok kretek yang biasa dikonsumsi korban, dan

puntung rokok filter yang dikonsumsi pelaku. Pengakuan tersangka, kemarin, awalnya dia menegur prilaku anak korban yang sering kumpul kebo dengan janda. Mendengar itu korban emosi. Tapi tersangka minta maaf dan mengajak korban ke warung kopi di Gang Sedar, Desa Sekip. Namun, di Dusun III, Desa Emplasmen Kwalanamu, Beringin, korban kembali emosi dan cekcok mulut pun terjadi sehingga keduanya terlibat baku hantam. Melihat korban telungkup, pelaku langsung mencekik dan memukul wajah dan perut korban dengan pelepah pohon sawit hingga korban tewas. Untuk menghilangkan jejak pelaku membakar korban dengan batang pelepah sawit. Kapolsek Beringin AKP Lamsan Manurung, membenarkan penangkapan itu.(a07/m16/c02)


Agenda

WASPADA Senin 1 Juli 2013

07:00 Dahsyat 09:00 SINEMA PAGI 11:00 INTENS 12:00 SEPUTAR INDONESIA SIANG 12:30 SI DOEL ANAK SEKOLAHAN (RR) 14:30 KABAR KABARI 15:00 SILET 15:30 Yang Muda Yang Bercinta 16:30 SEPUTAR INDONESIA 17:00 Tangan Tangan Mungil 18:15 BERKAH 20:00 Layar Drama Indonesia :Tukang Bubur Naik Haji 22.00 Sinema RCTI

CATATAN

07:00 SL Inbox 09:00 Halo Selebriti 10:00 SCTV FTV 11.00 Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:30 SL Liputan 6 Petang 17:00 Heart Series 2 18:15 Pesantren & Rock n Roll Season 3 21.00 Love in Paris Season 2 22.00 Liputan 6 Terkini 22:30 SCTV FTV Utama

07:00 Upin & Ipin Dkk 07:30 Pose 08:00 Layar Unggulan 09:30 Kisah Unggulan 11:00 Di Antara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Top Pop 16:00 Lintas Petang 16:30 Tuntas 17:00 Animasi Spesial 18:00 Bola Bolu 19:00 Tendangan Si Madun Season 3 20:30 Raden Kian Santang 22:00 Hidayah 00:00 Premier Highlights

07:30 Perempuan Hebat 08:00 Seleb @ Seleb 09:00 KLIK! 10:00 Ngobrol Asik 11:00 New Friends 11:30 Topik Siang 12:00 Seputar Obrolan Selebriti 13:00 Bulepotan 13:30 Chhota Bheem Aka Bima Sakti 14:00 Panda Fanfare Aka Kungfu Panda 14:30 Duckula 15:00 Tom & Jerry 15:30 Curious George 16:00 Mr. Bean 16:30 Topik Petang 17:00 Suka-Suka Nizam 18:00 Pesbukers 19:30 RT Sukowi 20:30 Mel’s Update 21:30 Sinema Spesial 23:30 Cakrawala

07:00 KISS Pagi 08:00 Sinema Tv Spesial 10:00 Pagi Pagi Bagi Bagi 11:30 Patroli 12:00 Sinema Pintu Taubat Siang 14:00 HOT KISS 15:00 Fokus 15:30 Penolong Misterius 16:00 Drama Asia (Korea): Faith @ The Great Doctor 17:00 Drama Asia (Korea): Fashion King 18:00 Drama Seri Indonesia: Setulus Kasih Ibu 19:00 Sinema Indonesia 21:00 Drama Seri Keluarga: Brama Kumbara 23:00 Sinema Unggulan

07:05 Bedah Editorial Media Indonesia 08:05 8 Eleven Show 09.05 8 Eleven Show 11:05 Sisi Berita 11:30 Metro Siang 13:05 Wideshot 17:05 Metro Hari Ini 18:05 Prime Time News 20:05 Suara Anda 21:05 Top News 21:30 Economic Challenges 22:30 Sentilan Sentilun 23:05 Politika 23:30 Metro Sports

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

B5 07:30 New Ranking 1 08:30 Spektakuler 10:00 Wisata Kuliner 10:30 Reportase Siang 11:00 Insert 12:00 Bioskop Indonesia 14:00 Sketsa 15:15 Show Imah 16:30 Reportase Sore 17:00 Insert Investigasi 18:00 Ethnic Runaway 19:00 Oh Ternyata 20:00 Bioskop TRANSTV Spesial 22:00 Bioskop TransTV 00:00 Harta Tahta Wanita 00:30 Reportase Malam

07:00 Live News Apa Kabar Indonesia Pagi 09:00 EnsikloTIVI 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Ruang Kita 14:30 Live News Kabar Pasar 15:00 Divisi Utama Liga Indonesia 2012 - 2013 17:30 Live News Kabar Petang 19:30 Kabar Utama 21:30 Live News Kabar Malam 22:30 Menyingkap Tabir 23:00 Kabar Arena 23:30 Live News Kabar Hari Ini

07:30 The Penguins Of Madagascar 08:00 Auto B Good 08:30 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Serasi 13:00 Dimas dan Raka 14:00 100% Ampuh 15:30 Fokus Selebriti 16:00 Arjuna 16:30 Si Kriwil Jadi 2 17:30 Spongebob Squarepants 18:30 Night at The Museum 21:00 Konser Semangat Bersama Bank BJB 23:30 Initial D

07:30 Selebrita Pagi 08:00 Makan Besar 08:30 Gak Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Dunia Binatang 14:00 Brownies 14:30 Tau Gak Sih 15:00 Fish N Chef 15:30 Jejak Petualang 16:00 Redaksi Sore 16:30 Indonesiaku 17:00 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Opera Van Java 23:30 Jam Malam **m31/G

Rolling stones Manggung Perdana Di Glastonbury Pertunjukkan panggung Rolling Stones meningkatkan reputasi mereka sebagai grup band rock paling hebat, ketika tampil di hadapan 100 ribuan penggemar dalam festival musik Glastonbury yang terkenal di Inggris, Sabtu.

The Rolling Stones/globo.com

Meskipun personel band itu rata-rata berusia 69 tahun, gaya mereka dalam memamerkan petikan gitar dan pekikkan suara selama dua jam masih memukau dengan lagu pembuka Jumping Jack Flash serta ditutup dengan Satisfaction diiringi percikan kembang api. Kerumunan massa bersorak

dan ikut bernyanyi bersama band memperingati tahun emas, 50 tahun mereka berkecimpung di panggung bisnis hiburan itu beraksi dengan memainkan lagu baru dan lama. Pasukan keamanan juga bekerja keras menghadapi kerumunan yang merangsek masuk. “Sungguh menyenangkan bisa berada di sini, ikut festival, setelah bertahun-tahun kami selalu diminta,” ujar si bibir dower Mick Jagger, yang bulan depan akan genap berusia 70 tahun. Glastonbury berawal sebagai hiburan kaum hippies pada 1970-an dan kemudian dikenal sebagai festival musik menampilkan mega bintang seperti Beyonce, U2, Bruce Springsteen dan David Bowie. Rollingstones

adalah kelompok band selama ini dikenal selalu tidak hadir dalam daftar bintang. Pendiri festival, Michael Eavis menyelenggarakan acara di atas lahan pertanian sekitar 365 hektare di Inggris barat daya, sangat bergembira ketika akhirnya bisa membujuk Rollingstone tampil pada ajang musik berlangsung tiga hari dan menarik sekitar 150 ribu pengunjung serta para penggemar para bintang hingga Sabtu. Tidak terlihat ada kesenjangan usia dalam penampilan Rollingstones di tempat itu, ketika penonton berjingkrak dan bersorak ikut menyanyikan Honky Tonk Woman dan Miss You. Jagger memperkenalkan lagu baru kelompok gaek itu berjudul Glastonbury Girl yang ka-

tanya ditulis bagi seorang gadis bertemu dengannya dalam festival pada Jumat malam ketika Jagger berbaur dengan penonton menyaksikan Artic Monkeys. “Saya mengucap terimakasih atas kehadiran Anda menyaksikan pertunjukkan kami selama 50 tahun” seru Jagger, sambil hilir mudik di atas panggung memperkenalkan rekan-rekan kelompoknya, CharlieWatts, penggebuk drum dan dua pemain gitar Ronnie Wood serta Keith Richards. “Jika ini adalah kali pertama Anda menyaksikan pertunjukkan kami, datang lagi ya lain kali,” Jagger bercanda, setelah sebelumnya pada hari yang sama ia mengaku akan terus menyanyi sepanjang penggemar menginginkannya.(ant)

Julie Perez Goyang MNCTV Festival Medan Julia Perez menggoyang panggung MNCTV Festival Medan bersama artis ternama lainnya digelar Minggu (30/6) siang di halaman Istana Maimon disaksikan ribuan masyarakat yang rela berpanas terik matahari menikmati aksi para artis pendukung. Julia Perez tampil bersama Gondang 9 diawal pertunjukan didampingi Next Dancer membawakan lagu Mau Dong Ah. Goyang Jupe begitu panggilannya langsung memanaskan suasana hingga ribuan penonton ikut larut bersamanya. Tidak cuma Jupe yang tampil menyentak, penyanyi dang-

dut Siti Badriah pun tak mau kalah, ia membawakan lagu Berondong Tua. Suasana menjadi heboh ketika Sm*sha idola anak muda muncul ke panggung. Sm*sh memang masih punya daya tarik tersendiri membawakan lagu Patah Hati membuat para ABG berteriak histeris. Suasana panas menyelimuti arena pertunjukkan tak membuat para penonton beranjak dari lokasi saat 7 Icons muncul membuat arena menjadi tambah panas lewat lagunya Playboy, disusul Five Minutes mengandalkan lagu hitsnya Aisyah. Acara disiarkan langsung MNCTV ini dipandu pembawa

acara Lolita bersama Arie Untung berlangsung selama tiga jam. Namun panggung MNCTV Festival Medan berlangsung hingga pukul 18.00 dikaitkan juga merayakan HUT Kota Medan. Artis lainnya turut tampil seperti Chintya Sari bersama Siti membawakan lagu Buaya Buntung dimedley dengan lagu mandarinYe Liang Tai, Sharmila menyumbangkan tembang GiveYour Money, SOS ‘Drof It Low’ serta Citra Scholastika membawakan lagu Pasti Bisa serta Novita Dewi menyanyi lagu O Tano Batak dan Anak Medan. Rangkaian MNCTV Festival Medan dibuka menggelar pen-

tas musik MNCTV Grebek Nusantara di Pasar Marendal Sabtu, (29/6) dilanjutkan Minggu, (30/ 6) di Terminal Mandala menampilkan artis-artis Julia Perez, 7 Icon, Shamila, Citra Scholastika, Max 5 dan Nita Thalia. Melengkapi rangkaian acara spesial di Medan, digelar MNCTV Minggu Ceria Bersama Coolant. Kegiatan terdiri jalan sehat, panggung hiburan dan fun games. MNCTV Festival Medan terasa semakin meriah, karena selain bertabur artis dan musisi ibukota juga mengangkat kebudayaan khas dan seluk beluk kota, kuliner dan budaya khas Medan.(m19)

Waspada/Arianda Tanjung C MAN turut memeriahkan Medan Internasional Photography bertajuk Nusantara Photo Fest 2013 di Taman Sri Deli, Medan, Kamis (27/6).

C Man Band Ramaikan Nusantara Photo Fest 2013 Grup band Jazz asal Kota Medan, C Man turut memeriahkan pembukaan Medan Internasional Photography bertajuk “Nusantara Photo Fest 2013” di Taman Sri Deli, Medan, Kamis (27/6). Pameran foto tersebut, kata Eru, sangat luar biasa bisa menampilkan tidak hanya hasil karya dari Medan, tapi seluruh fotografer di Indonesia. “Dari pameran tersebut saya melihat berbagai momen penting yang ada di Indonesia ba-

hkan dunia terekam lewat karya fotografi dengan kemasan eksotis. Ini bukan sekedar pecahan beling bingkai ataupun lembaran kertas foto, ini adalah ekspresi tingkat tinggi,” cetus Erucakra kepada Waspada. Frontman C Man, Erucakra Mahameru, mengaku senang bisa berpartisipasi dalam event Nusantara Photo Fest 2013 digelar Pewarta Foto Indonesia (PFI) Medan. “Merupakan kebanggan bisa terlibat dalam acara ini, karena event seperti ini sangat

langka. Apalagi bisa memamerkan hingga 5000 hasil karya foto.” Tambahnya lagi Saat ditanya tentang perkembangan musik jazz di Kota Medan, Eru menjelaskan, musik jazz sudah banyak digandrungi kawula muda, itu berarti bahwa musik tersebut sudah tidak lagi terkesan eksklusif. Musik jazz menurutnya sudah mulai bisa diterima khalayak. “Saya akui saat ini musik jazz sudah menyentuh seluruh lapisan masyarakat, selain itu pena-

mpilan C Man dalam Nusantara Photo Fest 2013 digelar di tempat terbuka menandakan jika musik jazz juga merakyat,” tutup Eru. Dalam event tersebut, band digawangi Erucakra Mahameru pada gitar dan vokal, Rusfian karim pada drum, Dwiky dan Dian Syuhada pada bass serta Brian dan Heri pada keyboard membawakan beberapa lagu diantaranya what do you want do for love, come together, mohax, spain dan anak medan. (cat)

XL Gelar BBM Ketemu NOAH

Waspada/ t.junaidi Goyangan Jupe di panggung MNCTV Festival Medan bersama SM*SH, Five Minutes dan lainnya Minggu (30/6) siang

XL menggelar program buka puasa bersama NOAH merupakan salah satu dari berbagai rangkaian Ramadhan Seru BagiBagi Maaf bersama XL digelar di lima kota besar nasional mulai tanggal 17 hingga 26 Juli 2013. Buka puasa bersama NOAH dihadiri pemenang BBM-an Bisa Jadi Superstar, dan para frontliners. Selain buka bersama, acara ini juga akan menyuguhkan XLkustik with NOAH, foto Augmented Reality with NOAH, serta pameran Gadget Hemat Ramadhan menyediakan berbagai produk bundling ponsel XL dengan diskon menarik. Swandi Tjia General Manager Sales Northern Sumatera bersama Bambang Badra Manager Finance Management Service menyebutkan, rangkaian program BBM Superstar ini merupakan bagian dari program XL Superstar Tanpa Bakat sedang berlangsung. Sebuah program bagi para anak muda ingin menjadi superstar tanpa perlu memiliki ke-

ahlian khusus, maupun kriteria penampilan fisik tertentu diluncurkan pada 12 Juni 2013 lalu. Tidak hanya Bagi-Bagi Maaf, XL special Ramadhan juga mengadakan Ramadan Asik BagiBagi Mudik. Program Bagi-Bagi Mudik ini menyediakan fasilitas mudik bagi 1200 frontliners dan 100 guru akan pulang ke kampung halaman. XL telah menyiapkan sejumlah sarana transportasi dengan berbagai tujuan mudik mulai dari bus untuk pemudik tujuan Solo, Semarang dan Surabaya Memasuki bulan suci Ramadan 1434H di bulan Juli, PT XL Axiata Tbk (XL) juga meluncurkan program ‘Ramadan Bagi-Bagi Maaf (BBM)’. Sebuah program menawarkan cara baru bersilaturahmi di bulan Ramadhan menggunakan Gratis Stiker SMS XL. Selain Stiker SMS, tersedia juga layanan Ring Back Tone, Status RBT untuk mengupdate status lewat RBT, Muslim Life bagi pelanggan ingin berlang-

Dancer Jagoan Muda turut memeriahkan perkenalan program buka puasa bersama NOAH digelar Jumat (28/6) di Cambridge Mall ganan konten Islami, LBS untuk mencari lokasi kerabat dan keluargamu melalui nomor XL mereka, XL Karaoke, Musikkamu, dan XL Cuapss akan memfasilitasi pelanggan dalam berbagi SMS dan update suara dengan teman dan keluarga. Untuk bisa mengikuti prog-

ram ini, pelanggan XL cukup melakukan registrasi, dan upload video maaf kamu sesuai dengan syarat dan ketentuan berlaku di www.XLjagoanmuda.com/superstartanpabakat. Peserta dengan vote terbanyak akan keluar sebagai pemenang.(m19)


Opini

B6

Perburuan Snowden

TAJUK RENCANA

HUT Ke-423 Kota Medan Kemacetan Makin Parah

P

emerintah Kota Medan menggelar beragam kegiatan hiburan dan olahraga menyambut Hari Ulang Tahun ke-423 Kota Medan pada 1 Juli 2013. Sudah selayaknya warga Kota Medan menyambut gembira hari ulang tahun kotanya, namun banyak warga ‘’Kampung Patimpus’’ –sebutan Kota Medan masa tempo doeloe— malahan tidak tahu kotanya berulang tahun. Kegiatannya nyaris tak bergaung di masyarakat. Warga Kota Medan malah menikmati perayaan HUT ke-486 Kota Jakarta lewat tayangan sejumlah televisi swasta. Hingga puncaknya Sabtu dan Minggu kemarin kemeriahan HUT Ibukota itu masih dapat dirasakan seluruh rakyat Indonesia. Gubernur DKI Jakarta Jokowi memang memuaskan warganya dengan beragam kegiatan dan hiburan rakyat yang berlangsung berhari-hari, termasuk hiburan rakyat di areal Monas, sehingga kenaikan harga BBM pun tidak begitu dirasakan oleh masyarakat Jakarta dan sekitarnya. Itu terbukti dari minimnya aksi unjuk rasa pasca pemerintah menaikkamn harga BBM dari Rp4500 jenis premium menjadi Rp6500 per liter dan solar dari Rp4500 menjadi Rp5500 per liternya pekan lalu. Pelaksana tugas Wali Kota Medan Dzulmi Eldin mengharapkan seluruh warga Kota Medan meramaikan berbagai acara, seperti lomba dayung sampan tradisional yang berlokasi di Tempat Pelelangan Ikan (TPI) Perumahan Nelayan Indah Kelurahan Nelayan Indah, Kecamatan Medan Labuhan. Juga kegiatan fun bike yang dirangkaikan dengan Hari Bhayangkara ke-67, senam massal, gerak jalan beregu di Stadion Teladan. Kemudian Car Free Day Medan Bersepeda, Semarak Karya Nusantara, Pesta Kembang Api dll. Dibandingkan dengan perayaan HUT Kota Medan sebelumnya terlihat penurunan kualitas dan kuantitas. Di masa Abdillah dilanjutkan periode awal Rahudman Harahap begitu banyak kegiatan untuk menyemarakkan HUT Kota Medan. Sehingga warga Kota Medan memperoleh hiburan murah dan meriah. Namun kini sepertinya masyarakat kurang dilibatkan, mungkin disebabkan kurangnya perencanaan dari Intisari panitia. Hemat kita, peringatan HUT sangat baik kita –seluruh warga kota— dapat me’Kota Medan semakin bila maknainya dengan benar. Artinya, bukan semrawut dan macet perayaan yang seremonial yang diperlukan parah bila KA Kuala Na- saat ini, tapi bagaimana semua pihak dapat melihat kenyataan terkait kemajuan dan mu sudah beroperasi 30 kekurangan kotanya. Diperlukan evaluasi secara benar sehingga kita memperoleh solusi menit sekali’ untuk meningkatkan kinerja masing-masing. HUT Kota Medan tahun ini diwarnai dengan keprihatinan, mengapa? Hal ini disebabkan Rahudman Harahap tersangkut masalah hukum sehingga dalam operasional sehari-hari diangkat Plt Wali Kota Dzulmi Eldin. Kita berharap Plt Wali Kota bisa meningkatkan kewaspadaan sehingga tidak mudah tergiur dengan ‘’rayuan maut’’ pihak-pihak yang ingin merusak Kota Medan ke depannya. Keprihatinan warga Kota Medan pada HUT ke-423 tahun ini terlihat jelas dengan minimnya kegiatan yang melibatkan warganya. Dulu di berbagai sudut kota Medan berlangsung perlombaan, juga ada pesta rakyat, kembang api, doa, dan zikir dll. Namun saat ini hampir tidak ditemukan lagi. Pokoknya semua prihatin dengan situasi dan perkembangan Medan saat ini. Pembangunan bisa dibilang jalan di tempat. Semoga jalannya roda pemerintahan tidak ikut tersendat sehingga pelayanan kepada masyarakat mengalir sebagaimana diharapkan. Yang menggembirakan tahun ini Kota Medan kembali memperoleh Piala Adipura. Berarti dua tahun berturut Kota Medan mampu mendapatkan piala bergengsi itu walaupun masalah persampahan tetap menjadi problem besar bagi Kota Medan karena produksi sampah terus bertambah, sementara yang dapat dibuang hanya sebagian saja, sehingga di sejumlah lokasi sampah masih berserakan dan menumpuk. Mendapatkan Piala Adipura memang suatu prestasi, namun yang jauh lebih diinginkan oleh masyarakat adalah upaya menjadikan kotanya benar-benar berkembang menuju Kota Metropolitan, bersih, dan aman. Terus terang untuk saat ini belum begitu dirasakan oleh warga Medan dan sekitarnya. Justru itu, prestasi penghargaan yang diraih Kota Medan hendaknya sejalan dengan kenyataan di lapangan. Jangan seperti dulu. Kota Medan pernah merajai Adipura sampai lima kali, dari sertifikat hingga 2004, 2005, dan 2006 berupa Piala Adipura. Kalau saja program pembangunan Kota Medan benar-benar dijalankan sesuai master plan. Kemajuan yang dicapai Kota Medan saat ini sudah luar biasa. Faktanya, Kota Medan semakin macet, semakin semrawut karena aturan tata kotanya selalu berganti-ganti, rawan banjir, dan sebenar lagi Kota Medan bakal diperparah kamacetannya bila KA Kuala Namu sudah beroperasi 30 menjit sekali karena jalur yang dipakai masih jalur lama. Kiranya mendapat perhatian dari semua pihak terkait.+

Oleh Ir B.Ricson Simarmata, MS, EE, IPM Benarkah apa yang dilakukan Snowden sudah masuk tahap membahayakan negara Amerika Serikat sehingga segala upaya dilakukan untuk menangkapnya, termasuk mengefektifkan diplomasi tingkat tinggi?

B

elum satu bulan genap Presiden Amerika Serikat Barack Obama dan Presiden China Xi Jinping melakukan pertemuan untuk menghentikan perang ciber (cybercrime) melalui kesepakatan yang terbangun di Amerika Serikat— muncul pula ketegangan baru antara keduanya. Sebelumnya dunia mengetahui mementum yang sangat bersejarah dimana Presiden Amerika Barack Obama dan Presiden China Xi Jinping memulai pembicaraan informal di Sunnylands, dekat Los Angeles. Pertemuan ini merupakan yang pertama kalinya sejak Xi Jinping memegang jabatan sebagai Presiden China tahun ini. Obama menyampaikan harapannya agar kedua negara bisa bekerjasama pada berbagai isu– termasuk keamanan dunia maya. Beberapa laporan baru-baru ini telah menuduh operasi yang berbasis di China, mencuri rahasia-rahasia militer dan komersial Amerika lewat spionase dunia maya. Sementara itu Xi Jinping menyampaikan harapannya agar kedua negara bisa membangun model baru hubungan “negara-negara besar”. Kedua pemimpin diperkirakan akan menyampaikan keprihatinan Amerika tentang serangan dunia maya China terhadap bisnis dan militer Amerika, sementara China menyampaikan keprihatinan tentang peningkatan keterlibatan Amerika di kawasan Asia-Pasifik dan tuntutan untuk memeroleh akses yang lebih mudah ke pasar Amerika. Kini kedua negara tersebut kembali bersitegang karena seorang Edward Snowden. Siapa sebenarnya Edward Snowden sehingga menjadi manusia yang paling diburu oleh pemerintah Amerika Serikat layaknya seorang teroris yang siap meluluhlantakkan negara super power tersebut? Snowden kini menjadi bahan perbincangan karena ulahnya mengumbar rahasia sistem teknologi informasi Amerika Serikat. Pemerintah Amerika Serikat berang dan marah kepada negara China karena dianggap melakukan pembiaran kepada Snowden yang sedang mereka buru—membocorkan dokumen rahasia Amerka Serikat ke berbagai pihak. Amerika Serikat melihat apa yang dilakukan oleh Snowden merupakan kejahatan yang tidak bisa diampuni.

Faks 061 4510025

Benarkah apa yang dilakukan oleh Snowden sudah masuk tahap membahayakan negara Amerika Serikat sehingga segala upaya dilakukan untuk menangkap Snowden, termasuk mengefektifkan diplomasi tingkat tinggi? Diplomasi tingkat tinggi yang dilakukan oleh Amerika nampaknya belumlah efektif. Snowden mungkin membaca dan tahu mana tempat yang aman untuk berlidung dari kejaran pemerintahan USA. Saat Snowden berada di Hongkong yang secara administratif merupakan wilayah China kemudian melanjutkan perjalanan ke Moscow Rusia. Amerika Serikat juga berusaha menggunakan pendekatan diplomatik bagaimana supaya pemerintah Rusia menangkap Snowden karena akan melakukan perjalanan udara ke Havana atau Ekuador untuk memperoleh perlindungan diplomatik atau suaka. Belajar dari kasus ini, apa yang sebenarnya terjadi dengan dunia digital yang sangat canggih dewasa ini? Apakah perburuan Snowden murni sebagai kejahatan digital yang dianggap sangat membahayakan kemananan Amerika Serikat? Sekali lagi, benarkah ini karena kejahatan digital? Memang sangat sulit untuk menjawab pertanyaan ini. Tetapi saat ini dunia dihadapkan pada perlombaan teknologi. Ada sebuah teori siapa yang menguasai teknologi maka dia akan menguasai dunia. Benarkah demikian? Tidak bisa kita pungkiri bangsabangsa yang menguasai teknologi sekarang berjaya dengan kedigdayaan ekonomi. Korea Selatan dan Jepang merupakan bangsa yang berbasis teknologi tingkat tinggi. Dengan penguasaan teknologi yang sangat tinggi mereka terus berekspansi pada semua negara. Produk mereka merajai dunia. Korea Selatan dengan Samsung dan Hyundainya sekarang menguasai pasar dunia. Jepang dengan Toyotanya menguasai dunia. Mereka menjadi bangsa yang sangat kuat. Ekonomi mereka tumbuh dan bergerak cepat sehingga mereka mampu memberikan kesejahteraan bagi rakyatnya. Di tengah kemajuan teknologi bangsa-bangsa tersebut, bagaimana mereka menggunakan teknologi untuk perdamaian dunia, humanisasi, kebersamaan global? Adakah nilainilai universal atas dasar persaudaraan global ditengah kemajuan teknologi

Facebook Smswaspada

+6282370322108 MoU Helsinky di Finlandia th.2005 telah membuat perubahan yg cukup besar dan mendasar bagi kedudukan Aceh didalam tatanan negara didalam NKRI ternyata belum mampu dipahami secara benar, tepat dan utuh oleh banyak pihak di Indonesia bahkan bagi masyarakat. Aceh sendiri.Sosialisasi sangat dibutuhkan dalam menafsirkan butir2 perjanjian, sehingga berbagai kekeliruan akan terus terjadi didalam pengambilan kebijakan terhadap Aceh kedepan.. ternyata pelaku politik saja bisa mengalami kebingungan dan gamang dalam penyelarasan antara Pusat dan daerah..ini sangat mencemaskan nasip perdamaian itu sendiri... +6281376549336 Setiap Manusia waras ingin Uang , Kaya Tapi Ambillah Yg Halal Halal, Yg Sah Sah,yg Wajar Wajar Supaya Kita Selamat Dunia Akhirat Masih Banyak Lagi saudara saudaramu yg Melarat,Sengsara yg Hanya Perjuangan Makan Pagi Sore Biaya Sekolah SD pun Tidak Mampu Sadarlah jangan Lagi KORUPSI MENIPU Sebelum Ajal Tiba YA ALLOH TUNJUKILAH HATI KAMI UNTUK TENGGANG RASA ANTARA SI KAYA DAN SI MISKIN AAAMIIIN YAROBBAL ALAMIIIN. +6281396184826 Kepada seluruh pembaca media cetak yg baik dan nan murah hati di sini saya mengajak saudara mengulurkan bantuan pada Muamar pasien RSUP H Adam Mdn penderita kanker darah dan defresi di karenakan ortu nya ke 2 nya telah meninggal sekarang keadaannya semakin parah dan memperhatinkan kotorannya pun darah dan terus blooding pendarahan harapannya saudara ku yg berhati mulia bisa mengirimkan bantuan ke rek BRI: 3955-01-003030-53- 7 a/ n nurul aini ini rekening kakak kandungnya yg merawat dia. Saya berharap bantuan itu karena muamar tidak ada biaya lagi. +6285277850101 Memang lahirnya qanun bendera, lambang Aceh dan WN merupakan turunan dan amanah MoU, tapi yang menyakitkan dan menjadi masalah MENGAPA harus warna, bentuk, gambar dan ketentuannya berbau MAKAR/SEPARATIS. MENGAPA tidak mengakomodir keACEHan secara menyeluruh atau Aceh Nasionalis... Karena hak dan kewajibannya tidak diakomodir, jadi wajar, layak dan pantas daerah ALA ABAS untuk membentuk Pemerintahan sendiri dan dapat membuat QANUN sendiri yg sesuai keinginan masyarakat mereka sendiri yang bernafas Nasionalisme dan (mengHARAMkan QANUN MAKAR). +6285362885515 Ass..W.W, kepada Bpk Mentri Pendidikan, Bagaimana kalau P4 kembali di Tanamkan kepada setiap Siswa Baru? Lihatlah, Moral generasi Muda sekarang, banyak yang menyimpang dari Nilai nilai dasar Pancasila +6282370585631 Kata nya negara DEMOKRASI.. Tp knp setiap org yg dgn ciri2 berjanggut,pake peci,shalat dan mengaji,mengerjakan puasa..!! Di tembak tanpa ada di interograsi..??? Padahal mereka tdk tau apa2 dan org2 yg tdk bersalah.!! Tapi, kenapa org2 yg berdasi,korupsi.,dll di biarkan dan di lindungi serta di elu2kan oleh negara.? Apa ini arti DEMOKRASI..???

Serikat melakukan instropeksi diri tentang perannya dalam pergaulan internasional. Rahasia kebocoran rahasia memang sangat bertentangan dengan sistem keamanan sebuah negara. Di balik kebocoran rahasia IT Amerika Serikat saatnya menjadi momentum menggunakan teknologi informasi untuk mengembangkan kehidupan yang lebih beradab dan persaudaraan global yang saling membangun. Jangan ada lagi paradigma berpikir bagi semua negara untuk saling menguasai melalui ekonomi dengan dukungan perangkat IT. Semua harus saling berbagi untuk mengurangi ketimpangan global yang sangat terasa saat ini. Terlepas apakah yang dilakukan oleh Snowden murni kejahatan digital, tetapi Amerika Serikat harus menggunakan perangkat teknologi informasinya untuk membangun tatanan dunia baru global yang lebih beradab dan manusiawi. Amerika Serikat harus hadir sebagai pemberi solusi yang adil bagi semua negara di dunia. Dengan demikian akan tercipta tatanan masyarakat global yang lebih manusiawi dan humanis. Penulis adalah Ketua STMIK IBBI Medan, Mantan Rektor UHN Medan.

(Tanggapan Tulisan M. Ridwan Lubis, Guru besar UIN Syarif Hidayatullah) Oleh Muhammad Erwin, SPdI

+6285760056399 Saleum lon bri ateuh jeumada, Tolong kepada bapak gabenoer dan wali nanggro provinsi NAD, jangan sampai Aceh ada pemekaran provinsi yg baru, oleh karena itu tolong jangan sampai itu terjadi, karena dikawatirkan akan terjadi permasalahan yg baru karena Aceh sekarang sudah membaik, jadi jangan ada masalah yang lain lagi, sayangi masyarakat kita. Trmoeng genaseh. .menyena pham yg slah lon lake meuah siploh jaroe.

mereka? Amerika Serikat saat ini diklaim sebagai negara kapitalisme karena menguasai dunia dengan dukungan teknologi tingkat tinggi. Dimana-mana bertebaran perusahaan multinasional (korporasi) negara Amerika. Tetapi tidak sedikit perusahaan Amerika Serikat yang melakukan kejahatan lingkungan. PT.Freeport sampai saat ini masih diperdebatkan kehadirannya di Papua. Apakah Freeport bermanfaat untuk Papua? Amerika Serikat saat ini memang sering melakukan standard ganda dalam menguasai dunia. Dengan alasan demokrasi dan HAM mereka memboncengi kepentingan ekonominya di berbagai negara. Amerika Serikat dikatakan sebagai salah satu negara yang menyebarkan virus kapitalisme pada semua negara di dunia. Bahkan Josep Stiglitz peraih nobel ekonomi 2001 pernah mengritik habis resep IMF dalam menangani negara-negara berkembang dengan menduduh IMF sebagai biang kerok krisis global. Kini Amerika Serikat dengan perangkat teknologi informasinya berusaha menguasai dunia. Saat yang bersamaan Snowden hadir sebagai pembocor rahasia teknologi Informasi Amerika yang super cangggih tersebut. Dari kasus ini sudah saatnya Amerika

Kelemahan Persuasi Dan Solusinya

APA KOMENTAR ANDA SMS 08116141934

WASPADA Senin 1 Juli 2013

…masyarakat tidak akan mau dipersuasi. Lebih baik mereka bekerja mencari uang memenuhi kebutuhan hidupnya daripada mendengarkan calon anggota DPR ngoceh tanpa ada suatu yang dapat dibawa pulang.

M

enarik sekali menyimak pendapat M. Ridwan dalam rublik opini Waspada Kamis 27/6/ 2013 yang mengatakan bahwa hendaknya para calon anggota DPR memulai perjalanan panjang memersuasi rakyat di daerah pemilihannya agar menjatuhkan pilihannya kepada mereka. Artinya beliau mencoba memberikan trik kepada calon anggota DPR untuk dapat menang pemilihan tanpa menggunakan uang yang jumlahnya fantastis. Tanggapan pertama; saya mengenai pendapat beliau adalah bahwa dalam sistem demokrasi kekuatan uang adalah mutlak diperlukan. Hal ini sudah diakui oleh semua politikus baik senior maupun pemula. Memang pendapat beliau baik sekali jika dapat diterapkan. Sayangnya hal seperti itu tidak akan pernah dapat diterapkan selama sistem yang digunakan adalah sistem demokrasi. Karena dalam sistem demokrasi keputusan ada di tangan mayoritas rakyat. Jika ingin diputuskan menjadi wakil rakyat tentu harus menguasai suara mayoritas rakyat. Dan untuk memperoleh suara mayoritas rakyat, sekalipun hanya teknik persuasi tentulah juga memerlukan dana yang besar karena melakukan persuasi kepada sejumlah besar rakyat. Setiap kali persuasi ke masyarakat tentu akan mengeluarkan biaya perjalanan sekaligus memberikan sedikit “buah tangan” kepada anggota masyarakat yang mau dipersuasi agar teknik persuasi berjalan mulus. Jika tidak tentu masyarakat tidak akan mau dipersuasi. Lebih baik mereka bekerja mencari uang untuk memenuhi kebutuhan hidupnya yang selama ini dimiskinkan secara struktral, daripada mendengarkan calon anggota DPR ngoceh tanpa ada suatu yang dapat dibawa pulang. Buah tangan yang kecil saja pun jika diberikan kepada banyak orang tentu menjadi buah tangan yang besar. Dan yang namanya persuasi tentu dilakukan berkali-kali. Dari sini dapat dilihat bahwa untuk menghindarkan politik uang dalam

sistem demokrasi, merupakan hal yang tak mungkin terjadi. Tanggapan kedua; katakanlah teknik persuasi dapat dilaksanakan dengan baik. Lalu apakah negara akan menjadi baik? Menurut beliau sih iya. Berdasarkan tulisannya yang berbunyi “manakala para calon wakil rakyat tidak memiliki kemampuan persuasi, dan hanya mengandalkan kekuatan finansial maka keberadaan bangsa kita akan semakin jauh tertinggal”. Dari kalimat ini dapat diambil pemahaman bahwa jika para calon wakil rakyat memiliki kemampuan persuasi maka ketertinggalan terhadap bangsa lain akan terkejar. Sangat tidak masuk akal karena permasalahan negeri ini begitu kompleks dan penyebabnya adalah pada demokrasi itu sendiri. Lihat saja konsep demokrasi yang dipuja-puja oleh para pengagungnya ternyata di dalamnya terdapat konsep kebebasan individu yang begitu merusak. Sistem kebebasan invidu yang terangkum dalam empat kebebasan, yaitu: Kebebasan beragama (freedom of religion), kebebasan berpendapat (fredom of speech) kebebasan kepemilikan (freedom of ownership), kebebasan bertingkah laku (personal freedom). Kebebasan kepemilikan dipujapuja telah melahirkan sistem ekonomi kapitalisme, yang selanjutnya melahirkan ide penjajahan terhadap bangsabangsa di dunia serta perampokan kekayaan alamnya. Lihatlah bagaimana kekayaan alam kita ternyata dinikmati oleh Amerika, Inggris, Prancis, dll. Mereka para pemilik modal bebas pula memiliki apapun yang mereka inginkan, walaupun mengorbankan kepentingan orang banyak. Padahal semuanya itu merupakan kepemilikan umum yang menyangkut hajat hidup orang banyak sehingga seharusnya negaralah yang mengelolanya untuk digunakan sebesar-besarnya bagi kepentingan rakyat. Sayangnya hal ini tidak berlaku dikarenakan adanya konsep kebebasan kepemilikan dalam demokrasi.

Mereka juga bebas berprilaku, menetapkan bahwa setiap orang dalam perilaku dan kehidupan pribadinya berhak berbuat apa saja sesuai kehendaknya, sebebas-bebasnya, tanpa boleh ada larangan baik dari negara atau pihak lain terhadap perilaku yang disukainya. Ide kebebasan ini telah membolehkan seseorang untuk melakukan perzinaan, homoseksual, lesbianisme, meminum khamr, bertelanjang, dan melakukan perbuatan apa saja walaupun sangat hina dengan sebebas-bebasnya tanpa ada ikatan atau batasan, tanpa tekanan atau paksaan. Sehingga rusaklah tatanan sosial kemasyarakatan di negeri demokrasi. Lihatlah bukti nyata bagaimana buruknya kehidupan sosial di Amerika dan Inggris sebagai negeri penganut demokrasi. Selain hal di atas, yang tidak kalah merusaknya dalam sistem demokrasi adalah bahwa standar kebenaran berada pada suara mayoritas. Jadi jika mayoritas rakyat sepakat untuk menzinahi anak Balita misalnya, maka hal ini tidak dapat dipersalahkan karena berdasar keputusan mayoritas. Lagi pula buat apa menargetkan mengejar ketertinggalan terhadap bangsa lain? Bangsa lain pun saat ini sedang dalam kondisi sakit. Ambil contoh Amerika dan negera-negara Eropa yang dikatakan sebagai negara maju. Apakah Amerika dan negeranegara Eropa bisa dijadikan standar suatu kemajuan bangsa? Kalau dilihat dari kemampuannya menguasai bangsa lain tentu saja jawabannya ya. Namun jika dilihat dari sisi lain, maka Amerika dan negera-negara Eropa adalah bangsa yang hancur! Generasi mudanya pezinah, Narkoba, tingkat kriminalitas tinggi, bahkan ekonomi Amerika pun saat ini sedang menuju kehancurannya. Kalau begini, buat apa mengejar bangsa lain? Yang harus dilakukan adalah mencari sistem pengganti demokrasi yang terbukti merusak itu. Dan bagi umat Islam, sebenarnya sudah ada sistem negara yang terjamin akan di ridhoi Tuhan dan juga memakmurkan, yaitu sistem khilafah. Khilafah adalah suatu model pemerintahan berdasarkan Alquran dan Alhadis. Memerhatikan defenisi tersebut, harusnya semua orang Islam setuju akan tegaknya khilafah. Hal ini dikarenakan menjalankan apa-apa yang tercantum pada kedua sumber hukum tersebut merupakan kewajiban semua orang Islam.

Kewajiban menegakkan khilafah bagi orang Muslim tidak perlu dipertanyakan lagi, karena hal itu sudah merupakan suatu keniscayaan. Dan penegakan khilafah adalah solusi tuntas atas semua permasalahandiIndonesiabahkandidunia.Tentu saja hal ini sangat mungkin mengingat sumber sistem khilafah berasal dari yang menciptakan dunia. Mari sama-sama berjuang menegakkan khifaha rosyidah ‘ala minhaj annubuah, dengannya bukan hanya mengejar bangsa lain, tetapi jauh melampaui kemajuan bangsa-bangsa penjajah! Dan memperoleh ridha Allah. Wallahu ‘alam bishawab. Penulis adalah Alumni FT IAIN-SU Medan, Ketua Lajnah Khusus Mahasiswa Mahaliyah AKA DPD II Hizbut Tahrir Medan.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang di-kirim adalah karya orisinil, belum/tidak diterbitkan di Media mana-pun.Tulisan menjadi milik Was-pada dan isi tulisan menjadi tanggung-jawab penulis.

SUDUT BATUAH * Perwal belum diteken, ongkos angkot dilarang naik - Udah pun naik! * Kemenkeu janji cairkan an nual fee PT Inalum - Asal jangan janji tinggal janji * Warga sudah meninggal di Besitang terdaftar penerima BLSM - Orang mati pun jadi proyek!

oel

D Wak


Opini

WASPADA Senin 1 Juli 2013

B7

Oposisi Setengah Hati & Oposisi Palsu Global Warming Pemanasan global adalah suatu isu serius yang membutuhkan aksi sesegera mungkin untuk bisa diselesaikan. Kita tidak dapat membiarkan diri untuk menunda-nunda ketika berkaitan dengan pemanasan global karena semakin lama kita menunda akan semakin besar juga efeknya untuk planet kita ini. Setiap individu diharapkan partisipasinya untuk bekerjasama saling bantu membantu dalam menghentikan pemanasan global. Kita tidak harus menunggu pemerintah untuk turun tangan dengan mengeluarkan suatu kebijakan politik yang drastis untuk menangani isu ini. Setiap orang dari kita dapat melakukan sesuatu guna menghentikan isu ini. Kita tidak harus melakukan sesuatu yang luar biasa karena dengan sesuatu yang kecil, dilakukan dengan kesadaran diri tinggi dapat membuat hasil yang besar. Menyelamatkan planet kita sangat penting untuk generasi masa depan. Dengan melakukan hal tersebut berarti kita memberikan kesempatan kepada mereka untuk bergembira dan tumbuh berkembang seperti yang kita lakukan di bumi sekarang ini. Karena apa yang kita miliki sekarang merupakan pinjaman dari generasi sebelum kita untuk diteruskan ke generasi sesudah kita. Namun kenyataannya planet kita saat ini terancam dengan berbagai macam jenis risiko dan bahaya termasuk menipisnya lapisan ozon, polusi dan pembalakan hutan liar serta masih banyak ancaman lainnya. Kita mungkin berpikir bahwa satu orang hanya akan memberikan dampak kecil untuk menjaga keberlangsungan planet ini namun hal itu sama sekali tidak benar. Setiap orang dapat membuat perubahan bermakna untuk alam ini. Tindakan kecil kita sangat dapat membantu menyelamatkan planet ini. Siapa yang tahu pohon yang indah dan kuat dapat tumbuh dari benih tunggal yang di kemudian hari dapat menyelamatkan hidup manusia? Selagi menjalankan tindakan kecil disertai kebaikan dan semangat nyata, ajak dan motivasi orang lain untuk melakukan hal yang sama. Gabungan dari tindakan tersebut secara pasti dapat membuat perubahan besar untuk kebaikan bersama. Ingat bahwa melakukan suatu tindakan menyelamatkan planet ini, bukan berarti harus pergi ke hutan untuk menanam satu pohon. Tapi dapat melakukan hal yang sama cukup di halaman belakang atau depan rumh. Kita akan selalu dapat melakukan sesuatu dari rumah yang nyaman, mungkin itu dari go green, go clean ataupun keduanya, atau dapat juga go save! Mulai dari sekarang bukan besok. Usahakan untuk mengurangi limbah rumah tangga. Juga, pergunakan kembali, daur ulang ataupun perbaiki alat maupun tempat-tempat makanan. Bantu mengurangi akumulasi efek rumah kaca dengan menghindari pengeluaran emisi yang terlalu banyak, dimana manusia menghasilkan emisi ketika membakar energi fosil seperti batubara, minyak dan gas. Gunakan lampu hemat energi dan manfaatkan cahaya matahari sebanyak mungkin. Ketika matahari terang (pagi, siang, sore di waktu normal tidak mendung) gunakan cahayanya untuk menerangi kamar, ruangan ataupun segala bagian dari rumah yang memerlukan pencahayaan, buka korden, dan matikan lampu. Meskipun kita semua tahu bahwa listrik merupakan sumber energi yang sangat penting dan digunakan setiap orang, tidak berarti kita perlu bergantung pada listrik secara total. Segalanya dimulai dari pengorbanan yang sangat kecil dan ini yang saya lakukan. Dini Novita Tanjung Universitas Sumatera Utara

Dedi Sahputra

Foliopini

*** Ketika meneliti tentang waktu, ilmuwan Mesir Zaghlul an-Najjar menyimpulkan bahwa peredaran bumi pada masa silam lebih cepat

…pihak pendemo tidak selalu sadar apa yang dilakukannya,dan begitu pun ia tidak selalu sadar kepentingan pihak-pihak lain dapat lebih besar dari kepentingan yang disuarakannya dengan kemasan idealistik.

W

akil Ketua DPR-RI Pramono Anung bersumpah (jika perlu lillahi ta’ala, katanya) bahwa DPR telah “ditipu” oleh pemerintah (eksekutif ) karena hanya memberi tahu adanya dana untuk ekses LAPINDO ratusan miliar pada last minutes—yakni saat forum lobby menjelang penetapan Perubahan ABPN 2013, kemaren. Ia pun “memprovakasi” rakyat agar melakukan judicial review ke Mahkamah Konstitusi (MK). Beberapa tahun lalu, ketika pemerintahan SBY hanya bersedia mengalokasikan dana untuk pendidikan di bawah 20 persen dengan melanggar ketentuan imperatif UUD 1945, dan itupun dengan pola alokasi yang sangat membingungkan (karena by design tak menunjukkan kefahaman tentang domain pendidikan), MK pun bertitah meluruskan. Tentulah jika rakyat menyambut lebih gempita dan lebih seru muatan komunikasi politik Pramono Anung, akan ada tambahan bahan untuk perlawanan terhadap pemerintah yang Jumat malam menetapkan harga baru BBM bersubsidi di Indonesia pasca penetapan Perubahan APBN 2013. Tetapi dengan semua itu, dan dengan dramatisasi penolakan partai non koalisi termasuk PKS, keadaan juga tidak lebih buruk. Kesimpang-siuran tentang adanya percaloan dalam penetapan harga baru BBM bersubsidi itu, pun tak menambah kehangatan protes melampaui ukuran yang sebelumnya diprediksi. Memang ada demonstrasi yang meluas di banyak kota dengan perbedaan tensi dan keluasan seperti di sekitar Jakarta, Surabaya, Medan, kawasan Indonesia Timur, dan lain-lain. Pada posisi yang tidak begitu menguntungkan, di beberapa tempat, mahasiswa yang melakukan demo pun dihadapkan dengan rakyat yang “diajak” untuk beropini menolak. Rakyat tidak suka demo anarkis dan tak suka ada gangguan ketertiban. Itu katanya. Tidak Ada Revolusi Semua pemerintahan yang pernah berkuasa di Indonesia meman-

dang rakyat membayar lebih banyak atas BBM menjadi trend umum. Apalagi pada zaman pak Harto, dengan ketertutupan politik tentulah tidak akan ada yang berani. Pemerintahan SBY tidak berbeda dengan pemerintahan sebelumnya (Megawati), sama-sama melihat dengan logika yang sama: APBN perlu diselamatkan, dan rakyat perlu ikut berkorban. Semua pemerintahan yang pernah berkuasa juga berpendapat sama: subsidi harga BBM dinikmati oleh orang atau pihak yang tak mustahak. Semua pemerintahan itu sama saja: hanya tahu masalah namun tak pernah menggunakan kewenangannya untuk menanggulangi masalah. Mungkin perbedaannya ialah bahwa pemerintahan SBY pernah membuat program kompensasi Bantuan Langsung Tu n a i ( B LT ) yang cukup buruk, dan itu akan diulangi lagi dengan Bantuan Langsung Sementera Masyarakat (BLSM) yang rawan penyimpangan dan politisasi (trade in influence). Semua komoditi perdagangan adalah lahan penting bagi orang jahat, di mana pun. Aneh kali Indonesia dengan kekayaan dan kesuburan tanah tetap mengimpor beberapa komoditi “awam” seperti ubi kayu. Apalagi minyak? Ada kekuatan yang sangat tak mungkin dijelaskan. Itulah sebabnya semua pihak yang berdemo kebanyakan tidak tahu secara mendalam apa substansi yang harus disuarakan dalam demo, kecuali sekadar menunjukkan sikap oposisional. Demo-demo yang didesign untuk membentur kekuatan negara dan terkadang dengan membidik langsung simbol-simbol serta institusi strategis, bukan tidak disadari berbahaya. Justru di situ tingkat keseksian dalam marketing demo dan setiap pemberontakan.

Semua orang di permukaan bumi diharapkan tahu aspirasi yang disuarakan, dan diharapkan mendukung tidak hanya dalam wacana, melainkan ikut ambil bagian menyerang pihak paling bertanggungjawab. Jika itu pemerintah, maka gulingkan. Itu logikanya. Suatu ketika Hariman Siregar, si dedengkot Malari 74 pun secara jujur mengungkapkan bahwa ia tak pernah membayangkan sebegitu besar akibat yang muncul dari pikiran dan gerakan yang mereka lakukan. Itu artinya pihak pendemo tidak selalu sadar apa yang dilakukannya, dan begitu pun ia tidak selalu sadar kepentingan pihak-pihak lain dapat lebih besar dari kepentingan yang disuarakannya dengan kemasan idealistik. Karena itu orang yang berharap kenaikan harga BBM 22 Juni 2013 akan bisa menjadi sangat mirip dengan kejatuhan Soeharto, harus kecewa berat. Partai politik mana pun tidak termasuk y a n g berharap seburtuk itu. Mereka memilih memanfaatkan kekecewaan u n t u k memperbesar elektabilitas. Tidak Ada Partisan Tangguh Ti d a k a d a partisan yang tangguh bermakna tidak akan ada revolusi, betapapun sikap SBY kelihatan sangat canggung dengan keragu-raguannya yang lazim. Kelihatannya pada tingkat tertentu ada ketidak-percayaan yang menjadi penyebab tidak selarasnya sikap partai-partai yang menolak kenaikan harga BBM dengan kelompok-kelompok pendemo meski masih sangat bisa ditelusuri kaitankaitan tertentu yang dibangun. Secara umum agenda mereka memang berbeda sekali. Para partisan hanya ingin mengalahkan lawan-lawan politiknya pada Pemilu tahun 2014, sedangkan para pendemo pada umumnya ingin perbaikan substantif yang jika simbol ketidak-beresan yang mengganggu perjalanan menuju Indonesia sejahtera itu adalah SBY dan rezim, hal itu pun akan dihadapi. Ada frustrasi pada kedua belah pihak, memang. Tetapi jelas secara substantif sangat berbeda. Ketidakpuasan dalam agenda “menyenang-

nyenangkan diri” dengan cita-cita kekuasaan, tentulah tidak akan dapat memprovakasi kemurnian tuntutan idealis para pendemo khususnya yang berpangkalan di kampus. Mereka lebih berjarak dengan kekuasaan meski kini kampus sudah dilanda kepentingankepentingan politik dengan perpanjangan tangan kelompok-kelompok pragmatis terutama yang mengatasnamakan kelompok kepemudaan. Dengan mentor-mentor dari luar itulah mahasiswa yang sudah menjadi bagian dari mata-rantai “kekuasaan pragmatis” tidak akan pernah sampai pada bedah kasus yang objektif atas sesuatu masalah. Sikap ekspresif mereka memang kerap sudah dipilihkan oleh para mentor dari luar. Relative Deprivation Dalam analisis tentang motif kekerasan dan terutama pemberontakan (rebellion), para analis gerakan sosial (social movement) sejak tahun 1940an mengenal teori relative deprivation (teori perasaan keterampasan). Ada fakta objektif dan ada fakta subjektif. Orang yang benar-benar miskin boleh jadi sangat tidak tahu dirinya miskin, karena tak tahu dan tak memiliki peluang untuk membandingkan keberadaannya dengan keberadaan orang lain yang secara normatif mestinya setara. Di sinilah peran-peran strategis para aktor politik diperlukan. Tetapi jika aktor politik itu hadir dengan maksud-maksud dan agenda politik tertentu yang tak selaras dengan aspirasi rakyat yang merasa terampas, mereka akan gagal mempertautkan suara dan protes. Indonesia cukup parah dalam disparitas yang semestinya rawan terhadap pemberontakan yang mengarah pada kritik pedas terhadap pemerintahan yang tidak mampu layaknya autopilot. Tetapi di sisi lain pemerintah cukup mampu menyajikan data-data yang menjadi pembanding sehingga orang dapat percaya bahwa Indonesia cukup sejahtera meski secara subjektif sangat banyak orang yang terjerumus aksi kriminal karena terpaksa untuk memertahankan hidup. Tetapi, sekali lagi, para partisan hanya sibuk menggantang kemenangan dan peluang pergiliran untuk berkuasa. Mereka jauh dari para pendemo itu (dan para ekstrimis): secara sosiologis maupun politis. Ini memang oposisi setengah hati atau bahkan oposisi palsu. Penulis adalah Dosen FISIP UMSU, Koordinator Umum Pengambangan Basis Sosial Inisiatif & Swadaya (‘nBASIS).

dedisahputra@yahoo.com

Waktu Rasanya baru saja saya menulis kolom hari Senin, kini tiba lagi Senin. Bahkan, baru kemarin rasanya sukacita menyambut Ramadhan itu, kini akan sampai di Ramadhan lagi.Yang lebih spektakuler adalah ketika hujan kemarin saya masih membaui udara masa kecil, seakan baru saja melintas. Kecepatan waktu memang bisa berlangsung dengan sangat tak terukur. Saya kira anda juga punya perasaan sama tentangwaktu.Ininiscayaadanya.Karenasemua kelambatan yang terjadi, telah berubah menjadi kecepatan. Jarak Medan-Makkah, sudah terlalu kuno untuk ditempuh berbulan-bulan menumpang kapal laut. Kereta api yang dulu dibanggakan sebagai transportasi masa depan, kini jadi sangat tradisional ketika kecepatan Shinkansen di Jepang yang 300 km per jam telah dilampaui kereta api China. Sepedamotor bebek yang karena cepatnya, dulu diiklankan Ateng sebagai superhero, kini pun jadul. Sama halnya jaringan internet.Tidak cuma semakin cepat, tapi malah semakin gampang dan mudah.Dulubesarnyasepertietalsewarung lontong, kini cukup dikantongi. Berkomunikasi juga, tak perlu berhari-hari menunggu surat yang dilayangkan tiba ditujuan.Karenadidetik engkau berniat melakukannya, detik berikutnya bisa jadi nyata, How awesome... Wa k t u itu berlangsung cepat dan mengajak segala sesuatu untuk juga cepat, ini hukum yang berlaku tanpa kecuali. Jadi untuk menjadi kuno, tak perlu melihat masa lalu, engkau cukup berdiam saja pada tempatmu, maka tiba-tiba engkauakanmenyadaribetapakunonyadirimu. Saya mengenal orang yang mengakrabi mesin tik untuk menulis. Zaman ketika mesin tik muncul, ia adalah orang yang paling modern karena sedikit orang yang punya, apalagi tak semuaorangbisamengetik.Tapiketikakomputer mulai datang, dia masih setia pada mesin tiknya itu. Belum sempat ia memahami kerumitan sistim WS dengan reboot DOS-nya, tiba-tiba muncul seri Windows entah berapa kalidiiringi serangan komputer portable. Belum lagi benar-benar sampai pada kecanggihan Windows 8 terbaru, model gadget sudah datang pula. Maka orang yang masih setia dengan mesin tiknya itupun menjadi manusia kunohanya karena ia tak bergerak seiring perubahan. Padahal yang disebut perubahan itu datang dan pergi secepat kedipkan mata. Ini bukan semata masalah teknologi, tapi ini terjadi karena alam raya sedang menegaskan keberadaannya- yang dalam bahasa agamanya disebut sunnatullah.

Oleh Shohibul Anshor Siregar

dari masa sesudahnya. Dulu bumi berputar jauh lebih cepat. Ini berarti jumlah hari dalam setahun jauh lebih banyak saat ini ketimbang masa lalu. Masa awal penciptaan langit dan bumi yang dijelaskan dengan teori Big Bang, kecepatan edar bumi di porosnya sangat tinggi. Saat itu jumlah hari dalam setahun melebihi 2.200 hari dengan panjang malam dan siang kurang dari empat jam. Selanjutnya jumlah hari dalam setahunpada periode Cambrian sekitar 600 miliun tahun lalu-sama dengan 425 hari, pada pertengahan periode Ordicivian (450 miliun tahun lalu) 415 hari, periode Triassic (200 miliun tahun lalu) 385 hari. Dan kini kecepatan bumi berputar pada porosnya menimbulkan satuan waktu 365 hari, lima jam 49 menit, dan 12 detik). Alam raya ini diperkirakan berusia antara 10 sampai 15 biliun tahun, dan bekas-bekas kehidupan tertua di bumi diperkirakan berumur sekitar 3.800 tahun. Ini berarti masa penyiapan bumi untuk dihuni mahluk hidup sekitar 800 miliun tahun, dan manusia hidup diperkirakan baru sekitar 100 ribu tahun. Bayangkanlah kehidupan di awal-awal masa penciptaan tersebut, pasti berjalan lambat. Untuk masak air misalnya, perlu berjam-jam untuk menemukan batu dan menimbulkan api darinya. Sudah pasti sepedamotor dan pesawat udara belum pernah terbayangkan. Nyatanya memang begitu. Saat bumi berputar cepat, saat itu hidup berjalan lambat. Sebaliknya saat bumi semakin melambat, saat itu kehidupan berjalan cepat. *** Karena perubahan itu adalah watak alam, maka keluaran terbaru merek ponsel dan komputer canggih itu hanya refleksi beradaan alam raya. Segala mekanise perputaran planet pada orbitnya, tumbuhkembang pepohonan, serta pembusukan oleh tanah-untuk menjadi zat menghidupkan tetumbuhan dan manusia-merupakan perlengkapan perubahan di alam raya. Ada manajemen satu atap yang saling berhubungan, dari mulai perputaran kosmos sampai metabolisme tubuh manusia atau bahkan metabolisme ubi kayu misalnya. Semuanya bergerak untuk satu irama senada perubahan. Lantas apa yang terjadi? Mengapa cepatnya perubahan di muka bumi, tapi justru bumi mengalami proses pelambatan perputaran? Banyak tafsir mungkin bisa menjelaskannya. Alam raya ini memang bergerak pada waktu yang terbatas. Tapi alam juga berpesan, semakin ke ujung semakin cepat berubah untuk mengejar ketertinggalan. Mestinya semua kita juga begitu. (Vol.425, 1/7/2013).

Kolom foliopini dapat juga diakses melalui http://epaper.waspadamedan.com

Memaknai HUT Bhayangkara Oleh Tigor Damanik SH … bukan hanya dirasa belum maksimal kinerjanya,tapi kebiasaan berpikir “untung”. Benak banyak oknum penyidik seperti ini menjadi tantangan “maha berat” untuk menuju Polri profesional

K

epolisian Republik Indonesia (Polri) pada 1 Juli 2013 merayakan hari jadinya ke- 67 (1 Juli 1946 – 1 Juli 2013) yang disebut Hari Bhayangkara. Kalau diumpamakan umur manusia, usia 67 merupakan usia tua. Tapi tua dalam arti “matang” pada ucapan maupun tindakan, bersikap/ berperilaku maupun dalam berpembawaan. Tegas dalam pengambilan setiap keputusan, terutama atas keputusan masalah ataupun peristiwa sensitif dan penting, sekalipun mungkin keputusannya sangat tidak populer. Tapi telah dinalari sebagai “memang” sudah adil dan mengedepankan HAM (Hak-hak Azasi Manusia). Berharap agar setiap anggota Polri tidak melulu berpikir untung rugi dan uang, namun senantiasa pro aktif dan fokus pada setiap pelaksanakan tugas dan fungsinya sesuai hukum/ketentuan yang berlaku. Lebih mengutamakan fungsi sebagai pelayan dan pengayom masyarakat ketimbang statusnya sebagai anggota Polri. Menghindarkan diri dari perbuatan tercela, amoral, asusila dan KKN (Kolusi, Korupsi dan Nepotisme). Tema Dan Makna Tema Hari Bhayangkara kali ini “Sinergitas Kemitraan & Anti KKN, Wujudkan Pelayanan Prima, Gakkum dan Kamdagri Mantap Sukseskan Pemilu 2014“. Sinergitas, melaksanakan setiap kegiatan atau operasinya secara gabungan (bersinergi) agar transparan. Berusaha mengambil tindakan/ keputusan dengan selalu mempertimbangkan masukan pihak-pihak tertentu, baik penegak hukum lain maupun dari para pakar, nara sumber dan media sebagai mitra sinergis. Kemitraan, dalam pelaksanaan tugas mana Polri wajib memiliki rekan kerja dari pihak- pihak yang dirasa perlu dan pas. Karena dengan pola kemitraan, menjadikan para pihak mulai kaum intelektualitas, agamais, masyarakat umum, LSM, Ormas, terutama media sebagai mitra/rekan kerja positifnya— maka Polri dapat melaksanakan tugasnya dengan baik. Beroleh berbagai masukan positif, faktual dan jitu. Setiap tugas yang sudah diniati dan dilaksanakan sesuai ketentuan yang berlaku dan tanpa cela, maka secara

otomatis akan terwujud pelayanan yang prima, penegakan hukum (Gakkum) yang adil yang hilirnya tercipta Kamdagri (keamanan dalam negeri) yang mantap. Seyogianya tema HUT Bhayangkara tahun ini bukanlah semata diperuntukkan bagi pengamanan Pemilu 2014, namun pada setiap saat, sebelum, menjelang, maupun saat dan pasca perhelatan akbar Pemilu 2014 (legislatif dan presiden). Kritis Dan Makna Profesionalisme Lima tahun sejak reformasi bergulir harus diakui bahwa Polri terkesan lesu darah alias kurang vitamin sehingga tidak sepenuhnya dapat melaksanakan tugas pelayanan dan pengayomannya masyarakat. Terkesan asal jalan, kecuali memang terjadi peristiwa hukum. Sehingga untuk dapat dikatakan Polri telah melayani masyarakat secara prima dan mendekati sempurna, masih jauh panggang dari api. Sekedar membandingkan kualitas pelayanan Polri ketika era Orde Baru, terutama kala malam hari. Dewasa ini “sangat” jarang terlihat anggota Polri yang berdinas keliling atau berpatroli. Juga, coba diamati, ketika lalu lintas crowded (macat total dan semrawut), sering kali tak satupun anggota Polantas (polisi lalulintasnya) terlihat. Malah bersama petugas DLLAJR (Dinas Lalu Lintas Angkutan Jalan Raya) terlihat asyik kongkow-kongkow di warung/kedai, ngeteh atau mengopi. Namun kalau terjadi peristiwa hukum, terjadi kecelakaan barulah personil Polantas muncul. Sampling cermin ulah nakal oknum anggota Polri kita ambil di kota Medan. Pada beberapa persimpangan lampu lalu lintas (traffic light), seperti di simpang empat Jalan Ir H.Juanda (belok kanan) menuju Bandara Internasional Polonia—kalau ada yang melanggar lampu merah, maka segera terjadi transaksi “duit”. Juga seperti di simpang empat Pos Polisi dari arah Amplas menuju/sebelum Asrama Haji. Kalau ada yang melanggar lampu merah, malah ketika melintasi lampu masih kuning namun pas di tengah lampu memerah karena lalu lintas memang semrawut, maka priiitt... Setelah sebelumnya memberi salam dan hormat dengan santun, namun di sana tidak ada tawar-tawar, UUD

(ujung-ujungnya duit) juga! Mungkin saja di kota-kota lain di Indonesia juga kurang lebih mengalami hal serupa. Berikut mengritisi petugas penyidik Polri, dimana bukan hanya dirasa belum maksimal kualitas kerja dan kinerjanya, tapi kebiasaan berpikir “untung”. Benak banyak oknum anggota penyidik seperti ini menjadi kendala dan tantangan “maha berat” untuk menuju Polri profesional yang sesungguhnya. Bukan profesional sebagaimana yang sudah-sudah yang sarat dengan retorika. Di mana bagi setiap orang yang terkena (dugaan terlibat) kasus, terutama kasus kejahatan/pidana, berharap urusannya berjalan lancar dan adil, malah kerap terjadi sebaliknya. Sudah sulit malah semakin sulit. Sudah menderita malah semakin sengsara ketika harus berurusan dengan (proses penyidikan) oknum anggota Polri. Dari segi ketepatan waktu si pesakitan juga kerap dipermainkan. Disuruh datang pukul delapan pagi namun baru dilayani antara pukul dua hingga tiga sore. Katanya atau berdalih sebagai shock teraphy. Logikanya, apa yang seperti ini yang dinamakan mendidik dan mengayomi? Memang kasus-kasus semacam ini bukan hanya terjadi di institusi Polri, tapi juga di kantor penegak hukum lain (kejaksaan, pengadilan, dll). Maksud hati (si oknum masyarakat terduga kasus kejahatan) hendak mencari keadilan kepada lembaga penegak hukum, namun yang datang justru sebaliknya, yakni ketidakadilan. Bukan bermaksud ingin menjelekjelekkan institusi Polri terutama Polantas dan penyidiknya. Tapi kenyataan seperti ini harus dijadikan bahan renungan dan koreksi diri bagi Polri. Dimana modus, gaya dan perilaku banyak oknum penegak hukum seperti ini bak sudah menjamur dan terbiasa. Seharusnya Polri-lah yang memeloporinya untuk segera menguubahnya secara radikal dengan hati legowo. Karena gaya arogansi seperti itu sudah semakin usang, tidak laku lagi. Juga setiap praktik“arogan” cepat atau lambat selalu terpantau, terutama oleh media apalagi di zaman era keterbukaan informasi publik seperti yang sekarang ini. Dengan reformasi beberapa kali di tubuh Polri, bisa jadi, 60 – 80 persen di tingkat pejabat Polrinya memang sudah bekerja maksimal, jujur, berdisiplin dan cukup profesional. Namun bagaimana dengan para anggota bawahannya, yang mungkin berdalih gaji/insentif yang minim. Bisa-bisa terbalik, hanya sekitar 20 – 40 pesen saja anggota Polri yang benar-benar maksimal dan profesional (jujur dan sudah benar-benar menegakkan keadilan).

Profesionalisme adalah menguasai/ahli di bidangnya, yakni di bidang kepolisian sebagai pengayom maupun pelindung/pengaman (dalam negeri) masyarakat. Dengan selalu mengedepankan keahlian dan kompetensi dalam menjalankan tugas dan tanggungjawabnya yang diwujudkan dalam perilaku yang menjunjung tinggi kompetensi, komitmen dan hukum positif. Sebagai abdi masyarakat, setiap anggota Polri diharapkan mampu bekerja optimal. Sanggup melaksanakan tugasnya dengan segera mengubah paradigma dari pemaksaan/kekerasan ke komunikatif, konstruktif, kompromis, bijaksana dan pendekatan pribadi tanpa mengabaikan kepatuhan terhadap hukum. Jika hal ini bisa diwujudkan maka optimistis akan dapat segera tercipta Polri pelindung masyarakat berbasis HAM dan keadilan. Proses mewujudkan Polri profesional memang tidak semudah membalikkan telapak tangan. Mulai dari rekrutmen secara persaingan murni tanpa KKN menuju jenjang karir yang transparan. Jangan berdalih globalisasi dan kompetensi, dimana sistem manajemen jabatan di Polri menjadi asal “main comot” atau sarat KKN hingga meninggalkan prinsip manajemen lama namun masih efektif, yakni ”asas senioritas”. Manajemen karir “logika” yang wajib mendahulukan senior, kecuali senior tidak berkompeten atau berkasus atau alasan kesehatan. Pasca diabaikannya asas senioritas inilah menjadikan institusi Polri melemah dan semakin tak berwibawa. Sehingga berakibat ”perang saudara” (umumnya secara tertutup) yang berakibat lambat atau cepat tentu dan pasti akan merusak institusi Polri itu sendiri. Sehingga penerapan UU Polri No. 2 Tahun 2002—terutama pasal 2 dan 4-nya yang menyebutkan bahwa fungsi kepolisian adalah salah satu fungsi pemerintahan negara di bidang pemeliharaan keamanan dan ketertiban masyarakat, penegakan hukum, perlindungan, pengayoman, dan pelayanan kepada masyarakat—jelas menjadi terkendala. Oleh karena itulah maka sesegeranyalah berbalik. Sosok Polri, mulai dari Kapolri hingga ke Kapolsek wajib memiliki komitmen anti KKN, terutama dengan menempatkan agenda pemberantasan korupsi sebagai prioritas utama. Sesegeranya pula meningkatkan moral Polri yang pernah dan sempat terpuruk seraya melakukan aksi bersihbersih diri. Selamat HUT Bhayangkara Ke-67! Penulis Alumnus FHUI Jakarta 1982, Pemerhati Polri, Tinggal Di Medan.


Ekonomi & Bisnis

B8

BBM Dan UKM Catatan Gus Irawan SAYA cukup terkesan dap produksi industri kecil Untuk usaha kecil, dengan cara Harian Waspada dan menengah. Terutama di saya perkirakan ini menampilkan profil warga Jawa dan Bali. Angka 1,2 mereka sedang yang tidak menerima bantuan persen merupakan simulasi langsung sementara masyaterhadap tiga juga industri melakukan hitungrakat (BLSM) sebagai bagian kecil di wilayah tersebut. hitungan cermat soal dari kompensasi kenaikan Benar memang, kenaikan biaya produksi, harga harga bahan bakar. harga bahan bakar hanya berjual dan daya beli. Beberapa kisah saya fikir dampak pada lonjakan ongSampai kemudian cukup menarik. Ibu-ibu miskos transportasi dan bahan memutuskan pada satu kin, para orang tua yang berbaku. Pengaruhnya menurut tarung sendiri menghadapi kementerian sangat kecil dari titik akan seperti apa kerasnya hidup dan mereka seluruh proses produksi. mereka menghadapi yang sebenarnya layak menuBisa saja kajiannya begitu. kenaikan harga bahan rut kita menerima bantuan itu Namun pada prinsipnya, pebakar yang sudah malah diabaikan. rajin dan pengusaha industri diberlakukan Liputan seperti itu diimpasti punya pengalaman bangi pula dengan kepadatan sendiri. Bukankah mereka di kantor pos tempat penyayang langsung berhadapan luran bantuan ditandai banyaknya sepeda- dengan kenaikan demi kenaikan. motor milik para penerima bantuan. Kalau Kementerian Perindustrian Kemudian Jumat lalu Menteri Sosial mengklaim kenaikan bahan bakar hanya menyatakan BLSM atau yang biasa juga berdampak 1,2 persen, tidak demikian halnya disingkat balsem siap distop kalau tidak tepat dengan Tolibin penjual gula aren. Saya juga sasaran. Laporan-laporan yang dimuat harian membaca pengalaman Tolibin ini dari media. ini mengingatkan saya lagi pada beberapa Dia sudah harus menghadapi kenaikan catatan tentang penerima balsem yang tidak harga kayu bakar dari Rp300 ribu menjadi Rp400 tepat sasaran. ribu per pick up. Selama sebulan dia butuh Akan terulang lagi seperti apa sebenarnya empat pick up kayu bakar. penikmat dana kompensasi bahan bakar Dari sisi keuntungan produksi gula arennya beberapa tahun lalu. Secara pendataan kita kini dia juga harus menghadapi penurunan. memang masih lemah. Jangan-jangan Biasanya setiap menjual 12 kg gula aren dia akan penerima dana itu bukan mereka yang layak. mendapat untung Rp30 ribu. Namun kini sudah Wajar kalau kemudian banyak yang protes. berkurang Rp7.500. Namun dampak gelombang kenaikan harga Saya berasumsi dampak kenaikan harga bahan bakar akan terus kita rasakan. Tarif bahan bakar pasti sudah dirasakan seluruh angkutan kota sudah digodok akan naik. masyarakat. Masih belum naik saja, masyarakat Di sisi lain, kita juga akan melihat bagaimana sudah menghadapi dampaknya. dampak kenaikan harga bahan bakar kepada Apalagi sekarang. Dan pasti di Juli ini akan pengusaha kecil atau para usaha kecil terasa lebih menonjol. Badan Pusat Statistik menengah (UKM). Penjual makanan, gorengan menyebutkan dampak kenaikan akan terasa dan penjual keliling. di Juli. Atau perhitungan mereka sekira 60-70 Secara langsung bisa saja pedagang es persen dampak kenaikan terjadi di Juli. keliling tak akan terpengaruh. Namun efek tidak Hanya ada 25 persen saja yang naik di Juni. langsung harus mereka rasakan. Bukankah Kemudian ada lima persen lagi naik di Agustus. mereka juga harus menggunakan transportasi, BPS sudah mengingatkan kalau dampak membiayai keperluan rumah, membeli bahan kenaikan terjadi selama empat bulan. baku dan menyekolahkan anak. Bahkan untuk usaha kecil, saya perkirakan Otomatis dampak kenaikan harga bahan mereka sedang melakukan hitung-hitungan bakar harus ikut mereka terima. Dan saya baru cermat soal biaya produksi, harga jual dan daya saja membaca kajian dari Direktur Industri Kecil beli. Sampai kemudian memutuskan pada satu Menengah wilayah II Kementerian Perin- titik akan seperti apa mereka menghadapi dustrian. kenaikan harga bahan bakar yang sudah Dalam kajian mereka kenaikan harga bahan diberlakukan pemerintah.(kritik dan saran bakar hanya akan berdampak 1,2 persen terha- email: mediacenter@gusirawan.com)

Ebay Gugat Perusahaan Indonesia MEDAN (Waspada) : Ebay Inc, perusahaan yang membawahi tempat belanja online terkemuka, termasuk www. ebay.com, mengajukan gugatan atas pendaftaran nama domain “ebay.co.id” oleh perusahaan Indonesia. Kuasa hukum Ebay Inc, Iman Sjahputra, menyatakan gugatan yang dilayangkan terhadap perusahaan CV Ebay Indonesia yang berdomisili di Jakarta, ketika Ebay Inc selaku penggugat bermaksud mendaftarkan nama ebay.co.id sesuai dengan merek global yang dimiliki penggugat. “Namun ternyata nama ebay.co.id untuk wilayah Indonesia telah didaftarkan oleh Ken Arifin, dari pihak tergugat,” ujarnya melalui siaran pers yang diterima di Medan, Sabtu (29/ 6). Menurut Iman, kata “ebay” telah diciptakan, digunakan dan didaftarkan oleh penggugat sebagai nama merek ataupun nama domain di berbagai belahan negara di dunia. Sehingga pemilihan dan pendaftaran kata “ebay” pada nama “ebay.co.id” yang digunakan tergugat dapat dipastikan dilakukan untuk meniru dan mendompleng

merek “ebay” yang sudah mendunia. Dia mengemukakan pihaknya telah mengirimkan somasi pada tanggal 28 Maret 2012 dan 10 April 2013 kepada CV Ebay Indonesia. Mereka juga telah melakukan pertemuan dan mediasi dengan pihak tergugat. Namun ternyata tidak menemukan solusi, karena tergugat mengajukan kompensasi good will sebesar Rp10 miliar. “Nilai kompensasi itu sangat tidak masuk akal,” tuturnya. Menurut Iman, pihaknya sempat melakukan penawaran untuk memberikan kompensasi sebesar 20 ribu dolar AS terhadap pihak tergugat karena pertimbangan untuk menyelesaikan masalah secara cepat, hemat biaya, bukan karena merasa tidak punya posisi hukum yang kuat. Tapi pihak CV Ebay Indonesia menolak penawaran tersebut. Karena itu, Iman, melanjutkan pihaknya kemudian mendaftarkan kasus tersebut ke Pengadilan Negeri Jakarta Pusat pada 20/6/2013 lalu dengan nomor 299/PDT.G/ 2013/PN.JKT.PST Dia mengatakan perbuatan tergugat yang mendaftarkan

nama domain ebay.co.id dengan itikad tidak baik dapat dikualifikasikan sebagai perbuatan melawan hukum sesuai dengan ketentuan pasal 1365 KUHPerdata. Isinya menyatakan bahwa tiap perbuatan melanggar hukum yang membawa kerugian kepada seorang lain, mewajibkan orang yang karena salahnya menerbitkan kerugian itu mengganti kerugian tersebut. Ken Arifin dari pihak CV Ebay Indonesia saat dikonfirmasi via telepon ke kantornya tidak menjawab, padahal stafnya bernama Ria telah meneruskan sambungan telepon kepadanya. “Coba kepada sekretaris saja, tapi beliau sedang tidak berada di kantor, “ kata Ria beralasan. (rel/m38)

Pemerintah Harus Segera Kendalikan Harga BOGOR (Waspada): Alumni Institut Pertanian Bogor (IPB) menyebutkan pemerintah harus segera mengendalikan harga kebutuhan pokok di pasaran. Kata Ketua Himunan Alumni IPB Dr Said Didu, pengenda-

lian harga harus dilakukan guna mengantisipasi dampak kenaikan harga bahan bakar minyak (BBM). Karena bila harga naik, maka akan membebani masyarakat terutama menjelang Ramadhan dan Lebaran. Berbicara di Bogor, akhir pekan lalu, Said Didu, mengatakan pengendalian harga pasar harus segera dilakukan sebelum semuanya menjadi liar, terutama menjelang Ramadhan ini. Katanya, kenaikan harga yang

Gabah Masih Stabil SIMPANG ULIM (Waspada): Harga gabah di Kabupaten Aceh Timur hingga saat ini masih stabil. Harga beli di tingkat petani masih normal, yakni Rp4.250 per kg. Mustafa, salah seorang penampung gabah petani di Kecamatan Simpang Ulim, Minggu (30/6), mengatakan kenaikan harga bahan bakar minyak (BBM) sepertinya belum mempengaruhi harga gabah. Bahkan, menurutnya dalam dua pekan terakhir ini dia sempat membeli padi dari petani dengan harga Rp4.300 per kg nya. Sementara tahun lalu harga gabah di petani sempat mencapai Rp4.500 Per kg. Menurutnya, turunnya harga gabah petani kemungkinan disebabkan banyak padi warga yang kondisinya basah. Karenakan saat musim panen dalam bulan ini juga dibarengi dengan curah hujan yang meningkat.(cri)

terjadi akibat kenaikan BBM akan membebani masyarakat yang berpenghasilan tetap, seperti PNS dan buruh. Menurut Said, masyarakat berpenghasilan tetap akan mengalami kesulitan menyeimbangi kenaikan harga dengan penghasilan mereka. Sedangkan untuk masyarakat berpenghasilan tidak tetap, hal ini tidak menjadi persoalan. Karena pendapatan mereka mengikuti atau menyesuaikan harga di

Sumut Dapat Pasokan Listrik Akhir Tahun MEDAN (Waspada): Sistem kelistrikan Sumut yang saat ini terus mengalami gangguan baru akan mendapat pasokan baru akhir tahun. Itupun jika PLTU Pangkalan Susu berkapasitas 2x200 MW beroperasi. Yao Hong, Indonesia Chief of Representative Medan Project Guangdong Power International Engineering Corp (GPEC) China, Yao Hong, mengatakan itu akhir pekan lalu. Katanya, proyek PLTU 2 x 200 MW (megawatt) Pangkalan Susu, dijadwalkan akan selesai Desember 2013. Saat ini pekerjaannya sudah mencapai 80 persen. Yao Hong, memperkirakan proyek itu sudah beroperasi komersial pada Maret 2014. ‘’Proyek selesai maka akan menambah 25 persen dari kapasitas terpasang saat ini yang baru mencapai 1200 MW,” katanya. Dijelaskannya bahwa saat ini, pekerjaan proyek sedang dalam puncak-puncaknya. Pembangunan PLTU unit 1 ditargetkan Desember 2013.Target COD (Commercial Operation Date), Maret 2014. ‘’Rencana awal, pembangunan proyek ini selesai dalam waktu tiga tahun, sekitar Juli 2010. Tetapi di tengah per-

jalannya mengalami berbagai hambatan,’’ kata Yao Hong. Kendala yang dihadapi proyek itu, kata Yao Hong, seperti lokasi yang merupakan hutan bakau dan harus mengurus izin pinjam pakai dari Kementerian Kehutanan. Juga ada berbagai kendala pekerjaan sipil. Sementara itu Harmansyah Purba, Kepala Project Pembangunan PLTU 2 X 200 MW menjelaskan, proyek ini merupakan proyek kerja sama pemerintah Indonesia dan pemerintah China yang pembangunannya dilaksanakan Consortium of Guandong Power Engineering Corp dan PT Bagus Karya. ”Ini adalah proyek PLTU terbesar di luar Jawa-Bali,” ujarnya. Proyek yang terletak di areal seluas 105 hektare ini berlokasi di Desa Tanjung Pasir, Kecamatan Pangkalan Susu, Kabupaten Langkat. Listrik yang dihasilkan PLTU Pangkalan Susu akan diinterkoneksi melalui gardu induk Binjai. Dari sana akan didistribusikan ke daerahdaerah di Sumut. Harmansyah Purba, menambahkan proyek PLTU yang kontraknya ditandatangani di

Jakarta, 30 Oktober 2007 ini adalah program pemerintah percepatan 10.000 MW tahap pertama. Proyek ini dikerjakan berdasarkan Peraturan Presiden RI (Perpres) No.71 Tahun 2006, tanggal 5 Juli 2006 tentang penugasan kepada PLN untuk melakukan Percepatan Pembangunan Pembangkit Listrik yang menggunakan Batu Bara. Perpres inilah menjadi dasar bagi pembangunan 10 PLTU di Jawa dan 25 PLTU di luat Jawa – Bali atau yang dikenal dengan nama proyek percepatan PLTU 10.000 MW. Harmansyah, memaparkan tujuan pelaksanaan pembangunan PLTU Pangkalan Susu diantaranya untuk memenuhi kebutuhan energi yang meningkat di Sumut. Juga untuk mengurangi subsidi BBM dengan batubara dan merangsang pertumbuhan industri. Dia menungkapkan sekitar 1.100 orang pekerja saat ini bekerja di proyek itu. Sebagian dari para pekerja sudah bekerja di sana sejak 2008, sejak proyek ini dimulai. “ Sebanyak 50 persen dari pekerja berasal dari daerah Langkat dan sekitarnya,” ujarnya.(m06)

Tiket Pesawat Bertahan Di Angka 1,7 Juta MEDAN (Waspada): Penumpang pesawat udara mengeluh. Sampai Minggu (30/ 6), harga tiket tujuan Jakarta dan Batam masih sangat mahal. Sementara pemerintah dinilai tidak berdaya menghadapi lonjakan harga yang rutin berlangsung ini. Operator penerbangan menyebut, tiket pesawat mahal karena penumpang padat (peakseason). Yakni saat ini memasuki liburan sekolah.Tiket Medan tujuan Jakarta bertahan rata-rata Rp 1,7 juta. Pillion Hutabarat, Agen tiket dari Bison Travel Pilion Hutabarat dan agen tiket Vina Travel

Rajab, mengatakan harga tiket naik tajam.Tdinya, untuk tujuan Jakarta dengan pesawat Lion Air, Sriwijaya Air Citilink dan Mandala Tiger paling mahal Rp700.000. “Tapi saat ini sangat sulit penumpang memperoleh harga tiket ke Jakarta Rp 1 juta,” kata Hutabarat. Staf penerbangan Lion Air Humisar, menyebutkan bahwa harga tiket pesawat erat kaitan dengan meningkat arus penumpang. ‘’Kalau booking seat berangkat mendadak, otomatis harga tiket meningkat,” katanya. Dia membenarkan bahwa harga tiket mahal sejak beberapa hari belakangan ini, karena

Harga Sembako Mulai Naik BIREUEN (Waspada): Sejumlah harga bahan pokok di pasar tradisional di Matangglumpang Dua, Kabupaten Bireuen mulai melonjak. Kenaikan harga diduga akibat kenaikan harga BBM dan menjelang bulan Ramadhan. Zulfikri, pedagang sembako di sana kepada Waspada, Minggu (30/6), mengatakan harga yang telah naik saat ini diantaranya telur. Dari Rp1.000, sekarang naik menjadi Rp1.500 per butir. Harga minyak goreng curah juga mengalami peningkatan dari Rp10.000 menjadi Rp 11.000 per kg. Begitu juga dengan gula pasir. Harga sebelumnya Rp575.000 per sak (50 kg), menjadi Rp 600.000 per sak. Stabil Sementara itu, di Aceh Utara kenaikan BBM belum berdampak terhadap kenaikan harga kebutuhan pokok. Di sejumlah pasar tradisional di sana harga minyak goreng, beras, telur ayam dan gula masih stabil. ‘’Hasil pantauan kami, pada pusat pasar tradisional di wilayah barat dan timur, harga kebutuhan masil stabil. Hanya bawang merah yang merangkak naik,” kata Kabid Perdagangan Dalam Negeri Dinas Perindustrian dan Perdagangan Aceh Utara Zainal Abidin, Jumat (28/6). Zainal, merinci, harga bawang merah naik 6,67 persen. Di pasar, bawang merah harga eceran Rp30.000 per kg. (b17/cmk).

WASPADA Senin 1 Juli 2013

Waspada/Ist

Direktur Utama PT Sidomuncul Irwan Hidayat mengunjungi stand Sidomuncul di Pekan Raya Jakarta, akhir pekan lalu. Disela-sela kunjungan tersebut, Irwan Hidayat ikut membagikan sampel produk dan berbincang-bincang dengan pengunjung stand. Kegiatan PRJ menjadi agenda khusus yang dilakukan oleh Sidomuncul selama delapan tahun.

libur sekolah. Rata-rata pesawat ke segala rute penerbangan meningkat permintaan seat. Zuraidah Wahab, salah seorang penumpang Lion Air mengeluh saat akan bertolak ke Jakarta, Minggu, harga tiket saat liburan terlalu mahal. Dia mengaku kecewa dengan sikap pemerintah yang tidak dapat menertibkan harga tiket ini. Menurutnya, sudah bertahun-tahun peristiwa seperti ini terjadi. Namun pemerintah diam saja. Kenaikan harga tiket yang begitu tinggi pada momen-momen tertentu sangat tidak wajar. Pemerintah harusnya segera menertibkan hal seperti ini. (m32)

pasaran. Langkah utama yang harus dilakukan pemerintah, kata Said Didu, adalah menetapkan tarif transportasi yang berkaitan dengan penyaluran barang kebutuhan. Karena jika belum ada kepastian tarif dari pemerintah, pengusaha akan mengambil posisi aman. Yakni dengan menaikkan harga terlebih dahulu untuk mengambil posisi aman. Untuk beras, lanjutnya, tidak perlu dikhawatirkan, karena stabil dengan adanya

Bulog. Yang perlu diantisipasi harga sayuran, cabai dan kebutuhan lain. Menurut Said, bila harga sudah menjadi liar dan tidak terkendali akan menyusahkan masyarakat. Dia menyebutkan, momentum mengendalikan harga sudah terlambat. Harusnya itu sudah sejak Februari 2012 lalu. “Karena BBM ini sudah diprediksikan akan menjadi masalah besar sejak Januari 2012. Harusnya kenaikan BBM dilakukan Februari 2012 lalu kalau tidak naik bertahap,” katanya. (ant)

IHSG Diprediksi Terpengaruh Tekanan Jual JAKARTA (Waspada): Indeks Harga Saham Gabungan (IHSG) awal pekan ini diprediksi masih terpengaruh tekanan jual, melanjutkan pekan sebelumnya. Bahkan, kebijakan kenaikan harga bahan bakar minyak (BBM) yang telah diumumkan pekan sebelumnya, juga belum mampu membalikkan pasar. “Dampak kenaikan harga BBM merembet ke kenaikan biaya transportasi dan harga bahan pangan, sehingga menimbulkan kekhawatiran secara psikologis terhadap lonjakan inflasi. Selain itu masih jualannya asing, membuat IHSG tidak kuat bertahan lama di zona positif di awal pekan ini,” jelas Kepala Riset Trust Securities, Reza Priyambada, dalam risetnya, Minggu (30/6). Lebih lanjut, ditambahkan dia, adanya pelemahan bursa saham AS di pekan sebelumnya dan masih adanya rilis data-data ekonomi yang mungkin kurang baik bisa saja akan menghambat peluang kenaikan lanjutan tersebut. Oleh karena itu, dia mengimbau untuk mencermati sektor industri dasar, konsumer, keuangan, manufaktur, pertambangan, dan perdagangan. “Diperkirakan pekan depan, IHSG akan berada pada rentang support 4.350-4.585 dan resisten 4.900-4.965,” imbuh Reza. Adapun saham-saham yang dapat diperhatikan pada perdagangan sepekan depan yakni saham ICBP, SMGR, BMTR, MAPI, INDF, BMTR, BDMN, CPIN, AISA, BMRI, JPFA, INCO, AKRA, ITMG, ASII, ROTI, SDRA, UNVR, BBCA, dan MNCN. (okz)

BNI Terus Dekatkan Diri Pada Nasabah MEDAN (Waspada): PT BNI (Persero) Tbk berjanji akan terus mendekatkan diri kepada nasabahnya dan masyrakat. Itu dilakukan sebagai komintemen perusahaan dalam meningkatkan pelayanannya, memenuhi kebutuhan perbankan para nasabahnya. CEO BNI Kantor Wilayah Medan Jhonny R Tampubolon, mengatakan itu disela-sela kegiatan Family Gathering, di Taman Ahmad Yani, Sabtu (29/6). Kegiatan dilaksanakan dalam memperingingati HUT ke-67 BNI tanggal 5 Juli 2013 nanti. Johnny, menyebutkan BNI Kanwil Medan telah membuka enam outlet baru, sebagai melengkapi 91 outlet yang telah ada. Itu merupakan upaya yang dilakukan untuk lebih mendekatkan dengan nasabahnya. Rencananya, BNI akan menambah 164 ATM untuk melengkapi 487 unit ATM yang telah ada. Selain itu BNI Kanwil Medan berencana menambah 1 unit BNI Layanan Gerak, 1 unit sentra kredit dan 1 unit payment point. Selain itu, lanjutnya, untuk melengkapi layanan di Kota Medan, BNI Kanwil Medan juga membuka layanan weekand banking yaitu outlet yang buka di hari libur yaitu di Jalan Sutomo dan BNI USU yang buka pada hari Sabtu, serta BNI Plaza Medan Fair yang buka pada hari Sabtu dan Minggu. Penambahan jaringan juga diikuti upaya perbaikan di bidang layanan. Berdasarkan survey Marketting Research Indinesia (MRI) tahun 2012-2013, peringkat BNI meningkat dari 4 menjadi 2. Malah untuk beberapa kriteria, BNI berada di peringkat pertama. Seperti kriteria satuan pengamanan, peralatan banking hall, kenyamanan ruangan, dan ATM. (m41)


WASPADA, Senin 1 Juli 2013

Indonesia Selenggarakan Karnaval Wayang Dunia 2013 JAKARTA (Waspada): Indonesia siap menyelenggarakan Wayang World Puppet Carnival (WWPC) 2013 awal September mendatang. Sebanyak 40 negara dijadwalkan siap mengikuti karnaval wayang dan boneka yang menjadi kekayaan budaya masing-masing negara. Ke-40 negara tersebut diantaranya Argentina, Mexico, Inggris, Mesir, Jerman, India, Italia, Korea, Jepang, Malaysia, Belanda, New Zealand, Singapura, Afika Selatan, Spanyol, Australia dan Amerika Serikat, Myanmar, Philippina, Kanada, Vietnam, Rumania dan Rusia. Ketua Umum Persatuan Pedalangan Indonesia (Pepadi), Ekotjipto dalam sambutannya di acara Wayang Goes to Mall, di Jakarta, kemarin mengatakan, penyelenggaraanWWPC dimaksudkan sebagai promosi

kepada dunia bahwa Indonesia adalah rumah wayang. “Lebih dari itu, kegiatan ini diharapkan dapat memicu sebuah gerakan nasional untuk kembali cinta budaya tradisi,” kata Ekotjipto. Wayang Indonesia sudah diakui lembaga kebudayaan dunia, UNESCO sebagai warisan mahakarya dunia yang tak ternilai. Meski di seluruh dunia ada beragam jenis boneka yang seni pertunjukannya mirip wayang, tapi wayang milik Indonesia memiliki keunikan tersendiri dari segi gaya tutur. “Itulah makanya, hanya wayang dari Indonesia yang sangat spesial dan diakui dunia sebagai warisan dunia. Kita harus bangga dengan terus melestarikannya lewat kegiatankegiatan promosi atau festival seperti ini,” kata Ekotjipto.

Sebagai pembuka kegiatan, WWPC dimuali denganWayang Goes To Mall. Sejumlah pusat perbelanjaan terkemuka akan diajak berkolaborasi menampilkan pergelaran wayang dengan nuansa masa kini. Tujuannya mengenalkan wayang kepada generasi muda. Di Indonesia sendiri, sedikitnya ada 100 jenis wayang. Mulai dari Sumatera, Jawa, Bali sampai Nusa Tenggara. Seiring waktu, wayang mengalami pasang surut sebagaimana bahasa daerah yang mulai sepi penuturnya. Sejumlah wayang yang kini surut peminat adalah Wayang Palembang, Wayang Banjar, Wayang Golek Cepak, Wayang Klitik, Wayang Gedog serta Wayang Beber. “Tapi masih untung. Belum lama iniWayang dari Palembang

dan Banjar sudah direvitalisasi lewat bantuan UNESCO di 20052007. Hasilnya cukup menggembirakan, terbukti bahwa pentas dari kedua jenis wayang tersebut mulai hidup di masyarakat dan menghasilkan seniman dalang generasi baru,” kata Ekotjipto. WWPC 2013 terselenggara dengan dukungab penuh dari Yayasan Arsari Djojohadikusumo (YAD) pimpinan Hashim Djojohadikusumo yang memberi perhatian besar bagi upaya pelestarian alam dan budaya Indonesia. “Kita semua yakin, kebudayaan adalah salah satu benteng terakhir yang menjadi perekat penjaga persatuan dan kesatuan sera tolak ukur peradaban suatu bangsa,” kata Direktur Eksekutif YAD, Catrini Kubontubuh. (dianw)

B9

Antara

JAKARTA KARNAVAL: Gubernur DKI Jakarta Joko Widodo dengan mengenakan pakaian hias menaiki kuda saat mengikuti Jakarta Karnaval saat melintasi Jalan Merdeka Selatan Jakarta, Minggu (30/6). Jakarta Karnaval yang mengangkat tema “Keajaiban Ondel-Ondel” dengan rute Balaikota-Bundaran HI tersebut dimeriahkan 1500 peserta dari DKI Jakarta, Jember, Solo, Subang, dan Magelang dalam rangka memperingati HUT ke-486 Jakarta.


Aceh

B10

BANDA ACEH (Waspada): Sebanyak 105 unit mobil pusat layanan internet kecamatan (MPLIK) dari Kementerian Komunikasi dan Informatika (Kemkominfo), didistribusikan ke berbagai wilayah di Aceh. Sekda Aceh, T. Setia Budi melepas keberangkatan 55 unit MPLIK yang sudah tiba di Banda Aceh, untuk dioperasionalkan di berbagai kecamatan di Aceh, Jumat (28/6) sore di halaman kantor gubernur. MPLIK ini berupa kendaraan roda empat yang didalammnya terdapat enam unit laptop yang sudah terhubungkan dengan layanan

Data Penerima BLSM Tak Akurat, Keuchik Datangi DPRK Banda Aceh

Lawatan Sejarah Merajut Keindonesiaan Di Gayo Lues BLANGKEJEREN (Waspada) : Untuk mengenali dan meningkatkan pengetahuan generasi muda pada sejarah kebudayaan lokal. Balai Pelestarian Nilai Budaya Banda Aceh menggelar lawatan sejarah daerah 2013. Kegiatan bertema “ Merajut Simpul Keindonesiaa Di Negeri Seribu Bukit dan Tanah Alas”. Ketua Tim Lawatan Sejarah Daerah, Djuniat, S.Sos menyebutkan, acara berlangsung selama empat hari, terhitung sejak Sabtu (29/6) di Balai Musara komplek Pendopo Bupati Gayo Lues. Dengan jumlah peserta 72 orang semuanya terdiri dari para siswa antara lain, dari SMAN 11 Banda Aceh 8 orang, SMAN1 Aceh Besar 9 orang, SMAN Perisai Kutacane 4 orang, SMAN 1 Kutacane 5 orang, SMAN 1 Blangpegayon 15 orang, SMAN 1 Barus Jahe, Karo, Sumut 8 orang, SMAN 1 Bireun 1 orang, SMA Sukma Bangsa, Bireuen 4 orang, MAN Peusangan Bireuen 1 orang, SMA Pakpak Bharat, Sumut 7 orang dan 8 guru kelas dari Kabupaten Aceh Tengah serta dari Bireuen. Peserta akan mengunjungi masjid asal Penampaan, komplek makam Datok Sere, Benteng Tampeng, Bekas Tangsi dan Kolam renang Belanda, Sanggar Saman dan Bines Kampung Gele, makam Datok Khaje Dewa, makam Bupati Haji Syahadat, rumah adat Alas, monumen benteng Kute Reh. Dalam kegiatan ini, juga dilakukan penancapan ranting di daerah perbatasan, dan penampilan kesenian daerah di Gayo Lues dan Aceh Tenggara. Selain mengunjungi, sebanyak 70 siswa SMA dan guru pelajaran sejarah, pemerhati sejarah dan budaya, pemerintah, wartawan, juga akan berdiskusi dan berdialog langsung dengan saksi sejarah di sana. Wakil Bupati Gayo Lues Adam,SE, saat menyambut para peserta antara lain menyebutkan masih banyak situs-situs sejarah di Gayo Lues yang perlu dibenahi serta dilakukan pelestariannya. Dia kemudian menunjuk masjid asal penampaan yang berdiri di pinggir Sungai Penampaan Belah Imam, Kecamatan Blangkejeren, yang menurut dari cerita rakyat masjid itu didirikan pada tahun 815H/1412M. Artinya bila informasi ini tepat, masjid itu berdiri pada masa kerajaan Pasai. (cjs)

warga yang berpapasan dengan kendaraan ditumpangi calon bupati /wakil bupati Pijay itu melambai-lambaikan tangan seolah mendukung pasang itu melanjutkankan kembali memimpin Pidie Jaya, lebih maju lagi untuk lima tahun ke depan. Setiba, di kantor KIP Pijay, pasangan disambut Ketua Komisioner Musman, SH bersama sejumlah anggota komisioner lainnya. Gade Salam, tidak ikut naik ke lantai dua dan diwakili HM Yusuf Ibrahim. Gade Salam hanya nongkrong di dalam mobil bak terbuka, sambil sekali-kali mengacungkan dua jarinya ke arah simpatisannya dan wartawan yang kebetulan melintasi lokasi mobilnya parkir, persis di teras kantor KIP Pijay. “ Saya tidak naik ke atas, biarlah Pak Cawabup saja bersama kawan-kawan dari PAN yang naik ke atas. Saya biarlah di bawah bersama kawankawan pendukung” kata Gade Salam dengan bahasa yang jelas dan tegas. HM Yusuf Ibrahim, di selasela pendaftaran dan penyerahan dokumen di kantor KIP Pijay, kepada Waspada, mengungkapkan ia bersama HM Gade Salam, maju kembali pada Pilkada Pijay priode 2014/2019, ka-

internet, televisi dan sambungan telepon untuk diakses masyarakat. Pemerintah Aceh minta kepada PT Tazki yang mengoperasionalkan MPLIK di Aceh, agar dikelola secara efektif dan berdaya guna. Sehingga masyarakat diwilayah pedesaan dapat memanfaatkan maksimal. Selain itu, Sekda minta gampong yang jadi sasaran sosialisasi MPLIK harus berpindah-pindah, dalam periode tertentu secara merata. “Utamakan gampong yang belum tersentuh jaringan internet,” tegasnya. (b06)

Pemerintah Aceh Dukung LSF Daerah Waspada/Muhammad Zairin

SEKDA Provinsi Aceh, T Setia Budi melepas keberangkatan 55 unit mobil pusat layanan internet kecamatan (MPLIK), untuk didistribusikan dan dioperasionalkan di berbagai wilayah di Aceh, Jumat (28/6) di halaman kantor gubernur, Banda Aceh.

Kualitas Pendidikan Tugas Berat Pemerintah Aceh BANDA ACEH (Waspada): Gubernur Zaini Abdullah mengatakan masalah kualitas pendidikan, merupakan salah satu tugas berat yang harus diatasi pemerintah Aceh dalam beberapa tahun ke depan. Demikian disampaikan Gubernur Aceh dalam sambutan yang dibacakan Asisten II Setda Aceh, T. Said Mustafa pada penutupan program SEDIA, Jumat (28/6) malam di Meuligo Gubernur, Banda Aceh. Gubernur mengakui pendidikan di Aceh telah mendapat dukungan dana relatif besar, ter-

masuk dari dana Otonomi Khusus. Namun prestasi yang diperoleh belum berjalan seperti yang diharapkan. Kualitas guru misalnya, hasil uji kompetisi guru tingkat nasional Aceh berada pada peringkat 28 dari 34 provinsi. “Lebih memprihatinkan lagi, pelajar tingkat sekolah menengah Aceh termasuk paling banyak tidak lulus UN tahun ini,” sebutnya. Kata dia, untuk memperbaiki kualitas pendidikan tidak boleh menutup mata dari semua kelemahan. “Berbagai langkah harus kita tempuh untuk mengatasinya, termasuk melahirkan sejumlah kebijakan dan membangun kerjasama dengan berbagai pihak.”

Program SEDIA, merupakan program penguatan kualitas pendidikan yang didukung Australian AID (AusAID) yang dilaksanakan sejak Agustus 2009 di sejumlah kabupaten/kota di Aceh. Tujuan program ini untuk mendorong perbaikan, efektivitas dan efisiensi di bidang pendidikan dasar yang dalam pelaksanaannya bekerjasama dengan Disdik, Kanwil Kemenag dan Majelis Pendidikan Daerah Aceh. “Meski program ini telah berakhir, kami berharap agar perhatian dan dukungan bagi kemajuan pendidikan di Aceh tetap menjadi perhatian kita bersama,” pinta gubernur.(b06)

Gubernur Minta BP Kapet Rumuskan Percepatan Ekonomi BANDA ACEH (Waspada): Rapat Kordinasi Nasional (Rakornas) Badan Pengelola (BP) Kawasan Pengembangan Ekonomi Terpadu (Kapet) digelar di Banda Aceh pada 28-30 Juni 2013. Kegiatan yang dilangsungkan di salah satu hotel di Banda Aceh secara resmi dibuka oleh Gubernur Aceh Zaini Abdullah kemarin malam. Rakornas yang diikuti 13 pengelola BP Kapet se Indonesia tersebut menghadirkan narasumber dari Kementerian Pembangunan Daerah Tertinggal (KPD), dan juga keynote speaker Menteri Pekerjaan Umum (PU) yang diwakili Direktur Jendral (Dirjen) Penataan Ruang Muhammad Basuki Muljono. Gubernur Aceh meminta agar kegiatan ini dapat menghasilkan rumusan penting dalam upaya percepatan pengembangan ekonomi di Kapet. Gubernur menjelaskan, Keputusan Presiden Nomor 150 tahun 2000 tentang Kawasan Pengembangan Ekonomi Terpadu atau (KAPET) menegaskan bahwa di Indonesia terdapat 13 KAPET. Dari jumlah itu,

12 di antaranya berada di wilayah timur dan satu di Wilayah barat. “Di Sumatera hanya ada satu Kapet, yakni Kapet Banda Aceh Darussalam,” sebutnya. Zaini melanjutkan, keberadaan Kapet harus mampu menjadi motor penggerak bagi pertumbuhan ekonomi daerah yang dikawasan yang memiliki kesenjangan. “Selayaknya Kapet menjadi perhatian semua pihak, Bagi Aceh sendiri, kapet di Aceh terdiri atas tiga zona, yakni Banda Aceh, Aceh Besar dan Kabupaten Pidie,” sebutnya. Keberadaan Kapet sendiri di Aceh baru menjadi fokus dan perhatian utama Pemerintah Aceh sejak empat tahun terakhir, hal ini disebabkan karena banyak faktor, antara lain konflik, tsunami dan proses rehab rekon. “Sejak 2009 hingga saat ini, pemerintah telah berinvestasi dalam pengembangan Kapet di Aceh senilai Rp43 miliar,” ungkapnya. Sementara itu, Menteri Pekerjaan Umum yang tampil selaku keynote speaker yang semula dijadwalkan hadir, namun digantikan oleh Direktur Jendral

Gade Salam: Sakit Tubuh, Tapi Jiwa Sehat MEUREUDU (Waspada): Calon bupati Pidie Jaya (Pijay) Incombent, HM Gade Salam, Minggu (30/6), menegaskan meski tubuhnya baru sembuh dari sakit, namun pikiran dan jiwanya tetap sehat. Buktinya, Kabupaten Pijay, untuk ketiga kalinya kembali meraih penghargaan pertama se- Indonesia, sebagai daerah otonomi baru, berdasarkan hasil evaluasi tingkat nasional di Tarakan, Provinsi Kalimantan Utara sejak 27-28 Juni. Peryataan itu disampaikan Gade Salam, di sela-sela ia bersama pasangannya HM Yusuf Ibrahim dipeusijuek (tepung tawari-red) di Posko pemenangan calon bupati (Cabup) calon wakil bupati (Cawabup) Seuramoe Gade Salam/Yusuf Ibrahim, Simpang Tiga, Meureudu. Amatan Waspada, usai ditepung tawari, pasangan CabupCawabup Pijay incumbent HM Gade Salam/HM Yusuf Ibrahim yang didukung Partai Amanat Nasional (PAN), diiringi ribuan kendaraan pendukung simpatisannya bergerak menuju kantor Komisi Indepen Pemili-han (KIP) setempat. HM Gade Salam/HM Yusuf Ibrahim, menumpang mobil bak terbuka. Sepanjang jalan

Senin 1 Juli 2013

Kemkominfo Operasionalkan 105 MPLIK Di Aceh

Parlementaria DPR Kota Banda Aceh Enam Keuchik di wilayah Kecamatan Kuta Alam dan Kutaradja, Kota Banda Aceh berdelegasi ke DPRK Banda Aceh untuk melaporkan berbagai masalah Bantuan Langsung Sementara Masyarakat (BLSM), yang dinilai pendataan BPS terhadap warga miskin sebagai penerima bantuan diwilayahnya tidak akurat. Enam keuchik yang mendatangi gedung DPRK Banda Aceh, itu adalah Keuchik Gampong Lampulo Alta Zaini, Keuchik Gampong Peunayong Syarifuddin Adi, Keuchik Gampong Laksana Rahmad, Keuchik Kuta Baro Halik S dan Keuchik Gampong Keudah Razali Chaidir. Para Keuchik ini diterima Ketua DPRK Banda Aceh Yudi Kurnia,SE di ruang rapat, Kamis (27/6). Keuchik Gampong Lampulo Alta Zaini menuding pihak Badan Pusat Statistik (BPS) dalam pendataan warga miskin di daerahnya tidak akurat. Dia menyebutkan, sesuai surat pemberitahuan dari Kantor Pos Banda Aceh, penerima BLSM di gampong Lampulo sebanyak 135 orang. Padahal, data pakir miskin di Gampong yang berbatasan dengan laut, itu seluruhnya 310 KK. ‘’Nah, bagaimana sekarang kita siasati agar 310 KK itu bisa seluruhnya mendapat BLSM. Artinya, jangan nanti kami yang dipersalahkan oleh masyarakat,’’ cetus Alta. Dia juga mempertanyakan, perbedaan data fakir miskin yang memperoleh bantuan lain, seperti bantuan dari baitul mal, PNPM, Jamkesmas dan bantuan lainnya, sehingga kami Kepala Desa menjadi bingung. ‘’Jadi, sebenarnya bukan BPS yang menyatakan seseorang itu mampu atau tidak mampu, tapi yang tahu betul adalah Keuchiknya. Kalau tidak percaya data dari Kepala Desa (Keuchik-red) bubarkan saja Kepala Desa,’’ tandas Alta dengan suara lantang. Hal senada juga dilontarkan Keuchik Kota Baru, dalam data yang diterima dari pos, warga miskin di gampongnya mendapat BLSM sebanyak enam orang. Padahal data yang memperoleh kartu Jamkesmas yang baru berjumlah 23 orang. Dia juga mengaku data di gampongnya berbeda antara penerima Raskin dengan Jamkesmas. ‘’Akibatnya, warga bertanya sejak kapan saya dikeluarkan dari keluarga miskin. Yang dipersalahkan Keuchik terus ,’’ pungkas Halik. Persoalan yang sama juga dilontarkan para Keuchik lainnya, yang keberatan atas jumlah data penerima BLSM di wilayahnya masing-masing. Para Keuchik ini meminta dewan bersama instansi terkait, seperti BPS, Pemko, Baitul Mal dan lainnya untuk menyelesaikan masalah ini, sehingga para Kepala Desa ini tidak dipersalahkan. Menanggapi keluhan para Keuchik, Ketua DPRK Banda Aceh Yudi Kurnia berjanji dalam waktu dekat akan melakukan koordinasi dengan lembaga-lembaga yang mengeluarkan data itu. Artinya, data yang dikeluarkan antara satu lembaga dengan lembaga lain harus sinkron nantinya. “Seharusnya lembaga Statistik dalam mengeluarkan data harus berkoordinasi dengan aparat gampong yang sangat mengetahui kondisi gampongnya,” tegas politisi dari Partai Demokrat ini.****

WASPADA

Waspada/Muhammad Riza

CABUP Pijay incumbent HM Gade Salam, mengacungkan dua jarinya ke arahWaspada, di sela-sela menyerahkan dokumen berkas pendaftaran di Kantor KIP Pijay. Bupati Pijay ini terlihat sehat dan enerjik, meski baru sembuh dari sakit. Foto direkam, Minggu (30/6). rena desakan tokoh masyarakat dan ulama di daerah itu. Dukungan itu diharapkan, supaya dapat kembali melanjutkan program-program pembangunan Pijay, yang selama ini telah berlangsung baik. Semisal di bidang infrastruktur sudah 80 persen baik dan itu sudah dirasakan banyak masyarakat di daerah itu.

“ Mudah-mudahan dengan ada dukungan ini, kami bila terpilih kembali akan memfokuskan pembangunan pada bidang peningkatan perekonomian masyarakat, kesehatan, pendidikan serta penambahan fasilitas umum lainnya bagi masyarakat Pijay secara menyeluruh,” demikian HM Yusuf Ibrahim. (b10)

tata ruang Muhammad Basuki Muljono Dalam paparannya, Menteri PU menyampaikan ucapan terimakasihnya atas kesediaan Aceh menjadi tuan rumah pelaksanaan Rakornas BP Kapet. Basuki mengatakan, keberadaan Kapet kedepan harus lebih strategis dan mampu memberikan kontribusi positif terhadap perekonomian nasional. “Kapet memiliki keunikan dibandingkan dengan kawasan lain,” ujarnya. Tantangan lainnya dalam pengembangan Kapet, tambah menteri adalah belum adanya rencana tata ruang Kapet. “Sejak UU Nomor 26 tahun 2007 tentang penataan ruang disahkan, hingga saat ini rencana tata ruang Kapet belum ada,” sebut Basuki membaca pidato menteri . Memang saat ini, kata Basuki, keberadaan Kapet belum berkontribusi positif dalam ekonomi nasional. Hal ini terlihat dari realisasi investasi di Kapet sejak tahun 2005 baru mencapai Rp20,5 triliun, atau hanya setara 3,4 persen dari realisasi investasi secara nasional. (cb01)

BANDA ACEH (Waspada): Pemerintah Aceh mendukung rencana pembentukan Lembaga Sensor Film Daerah (LSF-D). Keberadaan lembaga dianggap bukan untuk mematikan kreatifitas masyarakat, namun filter agar tidak merusak moral. Hal itu diungkapkan Asisten I Setda Aceh, Dr Iskandar A Gani, ketika membuka kegiatan Sosialisasi Lembaga Sensor Film LSF-D Provinsi Aceh di Banda Aceh, di sebuah hotel bintang empat, Sabtu (29/6). Ketika ditanya wartawan usai membuka acara, Iskandar mengatakan memang masyarakat butuh hiburan, tapi semua itu tidak boleh melanggar kultur Aceh yang bernuansa islami. “Dunia globalisasi tidak bisa dibendung, orang bisa kapan saja menonton lewat internet, tv kabel dan lain-lain,” ujar dia. Namun, lanjutnya bagi Aceh, nilai kultur itu harus dipertahankan sehingga tidak melanggar syariat Islam dan budaya Aceh. “Ini bagus untuk menjaga moral masyarakat yang dimasa

sekarang hidup di zaman global,” papar dia. Sementara Wakil Ketua LSF, Drs Nunus Supardi mengatakan, Aceh adalah provinsi ke11 pihaknya menggelar kegiatan tersebut. Kata dia, pembentukan LSF di daerah termasuk Aceh adalah amanah undang-undang nomor 33 tahun 2009. “Langkah ini bisa mendorong lahirnya film atau sinetron-sinetron di daerah agar tak didominasi film asing. Kita butuh film-film yang edukatif (mendidi),” ujar Nunus. Sosialisasi yang menghadirkan pemateri dari LSF seperti Ariwibowo, Goodwill Zubir dan pegiat Komunitas Tikar Pandan Reza Indria. Kegiatan juga dihadiri para pekerja film di Aceh, serta sejumlah pengelola rumah produksi lokal. “Bagi Aceh yang memiliki kekhususan, ini dapat menjadi angin segar bagi perfilman Indonesia untuk menghadirkan film-film yang berkualitas tanpa merusak relegiulitas dan moralitas,” sebut Goodwill Zubir. (b07)

Aceh Tengah Belum Bisa Dikatakan Kabupaten Mandiri TAKENGEN (Waspada): Pendapatan Kabupaten Aceh Tengah Tahun Anggaran 2012 meningkat sebesar 12,88 persen dari tahun 2011 yang hanya berjumlah Rp545 miliar. Tapi, walaupun mengalami peningkatan, tidak disebabkan oleh adanya inovasi-inovasi strategi untuk menggali potensi daerah. “ Walaupun pendapatan meningkat besar tapi belum bisa dikatakan daerah ini mandiri,” kata Hamdani Koordinator Gerakan Antikorupsi Gayo (GeRAK Gayo), Kamis (27/6). Hamdani menambahkan, Pendapatan Asli Daerah (PAD) yang bersumber dari potensi asli di daerah stagnan untuk tahun 2011 ke tahun 2012. Begitu juga dengan dana perimbangan dan pendapatan lain-lain yang sah. “ Gambaran itu menunjukkan konsistensi ketergantungan daerah ini terhadap pusat. Dengan angka pendapatan dari dana perimbangan di atas 80 persen,” ungkapnya. Menurutnya, jika dilihat lebih dalam tentang potensi daerah Kabupaten Aceh Tengah, sebetulnya ada peningkatan pendapatan dari sektor pajak dan lain-lain PAD yang sah pada tahun 2012. Tapi sayang retribusi daerah mengalami penurunan sedangkan kekayaaan daerah yang dipisahkan mengalami stagnan. “ Seperti kita ketahui Kabupaten Aceh Tengah memiliki beberapa Badan Usaha Milik Daerah (BUMD) yang sebetulnya ini merupak potensi untuk meningkatan pendapatan daerah, namun kenyataannya malah tidak berpotensi,” sebut koordinator Gerak Gayo ini. Dilanjutkan, PAD sendiri berkontribusi terhadap pendapatan daerah sebesar 4,2 persen dan mengalami penurunan pada tahun 2012 menjadi 3,7 persen. Sedangkan kontribusi terhadap belanja PAD berkontribusi sebesar 4,1 persen dan turun juga kontribusi kepada belanja tahun 2012 menjadi 3,7 persen. Diperlukan pemikiran seluruh elemen di Kabupaten ini untuk menggenjot potensi-potensi pendapatan khususnya yang menjadi potensi pendapatan asli daerah. Peningkatan alokasi belanja dari tahun 2011

ke tahun 2012 bisa saja di didorong karena bertambahnya jumlah pegawai atau adanya kebijakan nasional tentang kenaikan gaji Pegawai Negeri Sipil (PNS). Bisa dilihat adanya kenaikan Belanja Tidak Langsung yang dialokasikan untuk belanja pegawai sebesar 3 persen menjadi 67 persen pada tahun 2012. Pada tahun 2011 proporsi alokasi belanja untuk pegawai sebesar 64 persen. “ Jika dilihat dari proporsi alokasi belanja pada tahun 2011 maupun 2012, pemerintah Kabupaten Aceh Tengah masih menempatkan prioritas pada pembangunan fisik. Hal ini bisa disebabkan penyedian sarana dan prasarana khususnya sarana pelayanan yang cukup besar .” Analisa Hamdani. Dari 8 SKPK yang memiliki alokasi belanja terbesar di Kabupaten Aceh Tengah. 5 di antaranya merupakan SKPK penyedia pelayanan publik. Ditambahkannya, yang menarik untuk dicermati antara lain untuk sektor pendidikan Pemerintah Kabupaten Aceh Tengah sudah m e m e n u h i m a n d a t re g u l a s i d e n g a n mengalokasikan dana sebesar 34 persen pada tahun 2011 dan meningkat pada tahun 2012 menjadi 39 persen. “ Untuk sektor kesehatan Pemerintah Kabupaten Aceh Tengah belum mampu memenuhi mandat regulasi untuk mengalokasikan belanja untuk sektor kesehatan sebesar 10 persen tidak masuk di dalamnya belanja pegawai,” ungkapnya. Dilanjutkan, alokasi anggaran untuk kelompok marginal lain di Kabupaten Aceh Tengah, untuk kelompok anak dialokasikan sebesar Rp 14 miliar pada tahun 2011 tetapi turun pada tahun 2012 menjadi 2011. Sama halnya dengan kelompok perempuan alokasi anggaran untuk perlindungan anak harus diperhatikan. Karena menjadi salah satu per-hatian isu dalam MDG’ yang target capaian harus sudah terelaisasi pada tahun 2015. Salah satunya adalah menurunkan angka kematian bayi dan ibu melahirkan. (b33/cb09)

Dua Balon Bupati Pijay Mendaftar Ke KIP MEUREUDU (Waspada): Dua Calon Bupati (Cabup) dan Calon Wakil Bupati (Cawabup), Pidie Jaya, pasangan Tgk Saiful Bahri/Iqbal Idris dan pasangan Ir Yusri Yusuf/ Drs Rusli Daud, mendaftar ke Komisi Independen Pemilihan (KIP) setempat, Sabtu (29/6). Amatan Waspada, pasangan Tgk Saiful Bahri/Iqbal Idris datang lebih awal ke Kantor KIP Pijay sekira pukul 10:00. Setelah rombongan pasangan Tgk Saiful Bahri/Iqbal Idris mendaftar dan meninggalkan kantor KIP Pijay. Selanjutnya sekira pukul 11:15, datang rombongan pasangan Yusri Yusuf/Drs Rusli Daud. Kedatangan kedua pasangan itu sama-sama disambut Ketua Komisioner KIP Pijay Musman, SH, bersama anggotanya. Ada pemandangan menarik dari dua pasangan Cabup/Cawabup Pijay yang mendaftarkan diri mereka ke KIP setempat. Pasangan Tgk Saiful Bahri/Iqbal Idris datang ke KIP dan keduanya mengenakan pakaian adat Aceh serta diantar ribuan simpatisan pendukungnya. Pada konvoi kendaraan pendukungnya memasang bendara Aceh. Padahal pasangan ini tidak didukung Partai Aceh (PA).

Sedangkan pasangan Yusri Yusuf/Rusli Daud, keduanya mengenakan kemeja dan diantar seratusan simpatisan pedukungnya. Kendati begitu situasi selama proses pendaftaran berlangsung massa dari kedua pendukung terlihat tertib. Cabup Saiful Bahri didampingi cawabup Iqbal Idris, usai mendaftarkan diri di KIP Pijay, kepada Waspada mengatakan, pencalonan pihaknya pada Pilkada Pijay 2013 ini dikarenakan semangat untuk membawa Pidie Jaya ke arah lebih baik. Saiful Bahri mengungkapkan, bila ia bersama pasangannya terpilih menjadi bupati dan wabup Pijay, akan berupaya meningkatkan perekonomian masyarakat menengah ke bawah dengan beberapa program yang andalan yang telah dipersiapkan. Begitupun, pasangan Ir YusriYusuf/Drs Rusli Daud, mereka juga termotivasi mencalonkan diri karena melihat selama lima ini, masih kurang menyentuh pembangunan peningkatan ekonomi rakyat. Kendati begitu, Yusri, melihat pertumbuhan pembangunan di Kabupaten Pidie Jaya di ba-wah kepemimpinan M Gade Salam, selama ini sangat posistif,

Waspada/Muhammad Riza

PASANGAN Cabup/Cawabup Pidie Jaya Tgk Saiful Bahri/Iqbal Idris menyerahkan data dan dokumen saat mendaftar pasangannya di KIP Pijay. Dokumen pasangan ini diterima langsung Ketua Komisioner KIP Pijay, Musman, SH, Sabtu (29/6). terutama di bidang infrastruktur. Ke depan kata Yusri, apabila ia bersama pasanganya dipercayakan rakyat Pijay untuk memimpin daerah itu lima tahun ke depan, pihaknya akan memprioritaskan dan mendukung ekonomi rakyat, baik nelayan

maupun pertanian. “Saya ada sedikit pengalaman di bidang pertanian dan nelayan. Pengalaman itu akan saya lakukan dengan konsep-konsep strategis supaya pertumbuhan ekonomi masyarakat lebih menggeliat di seluruh Pidie Jaya,” demikian Yusri Yusuf. (b10)


Aceh

WASPADA Senin 1 Juli 2013

Pemuda Tambon Tunong Dapat Bantuan Bibit Lele Dumbo

Pantai Ulee Rubeik Dibuka Lagi SEUNUDDON (Waspada): Setelah sempat ditutup kalangan santri karena dinilai rawan maksiat, lokasi wisata pantai Bantayan atau yang lebih dikenal pantai Ulee Rubeik, Kec. Seunuddon, Aceh Utara, dibuka lagi untuk umum, mulai Minggu (30/6). “Pantai kita buka kembali berdasarkan kesepakatan bersama antara Keuchik delapan desa di kawasan pesisir Seunuddon, kalangan pesantren dan Muspika. Pantai kita buka untuk umum, khusus hari Sabtu dan Minggu,” kata Fatwa Maulana, Camat Seunuddon, kemarin. Fatwa menambahkan, meski belum ada regulasi khusus dari pemerintah, wisata pantai di Seunuddon, dikelola secara Islami. Para pengunjung diawasi secara ketat oleh tim gabungan dari kalangan santri, Wilayatul Hisbah (WH) atau polisi syariat, Polsek dan Koramil Seunuddon. Panglima Laot Seunuddon Amir Yusuf, mengharapkan para pengunjung yang mandi atau sekedar menikmati pemandangan di Pantai Bantayan, menghormati kesepakatan bersama. Para pengunjung harus berperilaku dan berpakaian islami, serta terpisah antara laki-laki dan perempuan. (b19)

Nelayan Lhokseumawe Keluhkan Kedangkalan Mulut Kuala

Waspada/Mustafa Kamal

LHOKSEUMAWE (Waspada): Para nelayan tradisional Kecamatan Muara Satu dan Blang Mangat, Pemko Lhokseumawe mengeluh akibat kondisi mulut kuala yang semakin dangkal. Perahu nelayan sering kandas, ketika keluar masuk kuala. Keluhan nelayan disampaikan kepada Kontak Tani Nelayan Andalan (KTNA) Lhokseumawe. Ketua KTNA Lhokseumawe, HZ Rusli MS kepada Waspada, Kamis (27/6) mengatakan, sejumlah nelayan mengeluh dengan kondisi kuala di Lhokseumawe. Dua kuala yang semakin dangkal yaitu, Kuala Krueng Geukuh di Kecamatan Muara Satu dan Kuala Meuraksa di Kecamatan Blang Mangat. Menurut Rusli, Kuala Krueng Geukueh menampung arus air dari Sungai Beureghang, Sungai Nisam dan Sungai Simpang Keuramat. “Setiap musim hujan, lumpur dari sungai Beureghang, Nisam dan Simpang Keuramat dibawa air dan menumpuk di Kuala Krueng Geukueh,” jelasnya. Akibatnya, mulut kuala semakin dangkal. Kondisi kuala semakin dangkal, mengakibatkan nelayan tidak bisa masuk ke lokasi pendaratan ikan di Blang Naleung Mameh. “Untuk memasuki kuala, nelayan harus menunggu air pasang,” tambah Rusli. Begitu juga untuk keluar dari kuala, mereka juga menunggu air di mulut kuala penuh.(b15)

MGMP Dan KKG Telah Mati Suri BIREUEN (Waspada): Musyawarah Guru Mata Pelajaran (MGMP) dan Kelompok Kerja Guru (KKG) hampir seluruh sekolah di Aceh mati suri. Padahal dua kegiatan tersebut sangat penting dalam meningkatkan kinerja guru. Demikian dikatakan, Kepala, Unit pelaksana Teknik DinasPusat pengembangan Mutu Guru (UPTD-PPMG) Wilayah III Aceh, As’ari kepada Waspada, Jumat (28/6) sore, di sela-sela acara bimbingan teknis KKG untuk guru SD/MI dan MGMP untuk guru SMP di SMPN I Peudada, Bireuen, yang diikuti sekitar 260 peserta. Menurutnya, MGMP dan KKG sangat dibutuhkan, maka yang selama ini mati suri akan dihidupkan atau diaktifkan kembali. Kadis Pendidikan Bireuen, Nasrul Yuliansyah dalam acara pembukaan acara tersebut, berharap, acara tersebut dapat mem-beri konstribusi kepada para peserta, sehingga dapat meningkatkan mutu pendidikan di kabupaten tersebut. “Mutu pendidikan ada di tangan guru, maka tingkatkan kompetensinya, supaya lulusan punnya daya saing yang kuat,’’ ungkapnya. (cb02)

Stand Pameran MPU Bagikan Buku Saku SUBULUSSALAM ( Waspada): Sejak dua hari jelang penutupan Musabaqah Tilawatil Quran (MTQ) ke-31 Prov Aceh di Subulussalam, stand pameran gabungan Majelis Permusyawaratan Ulama (MPU), Majelis Adat Aceh (MAA), Majelis Pendidikan Daerah (MPD) dan Baitul Mal (BM) Subulussalam bagikan buku saku kepada pengunjung. Buku saku dengan judul ‘Menciptakan Kesejukan dan Keutuhan Dalam Rumah Tangga’ dan ‘Alquranku Pelita Dalam Hidupku’ karangan Ustadz Sabaruddin Siahaan, anggota MPU setempat, seperti disampaikan Alim Malau, penjaga stand itu ditemui Waspada, Minggu (30/6), dibagi mencapai 200 eksemplar. Kenapa tidak dari awal pasca pembukaan pameran dibagi buku setebal 12 dan 22 halaman itu, Alim mengaku ada kesalahan cetak. “Ada kesalahan cetak, tapi syukur masih ada waktu untuk dibagikan,” papar Alim. Ustadz Sabaruddin Siahaan, sang pengarang mengatakan, untuk penggandaan buku itu menjadi tanggung jawab Sekretariat MPU Subulussalam. (b28)

ANGKUTAN umum jenis L-300 BL 1580 AB terjungkir balik saat menghindarkan sepedamotor BL 4501 QB yang berlawanan arah, bersama mobil sedan BL 758 N. Kedua mobil berlaju dari arah timur (Medan) menuju arah barat, persisnya sebelah barat SPBU di Desa Blang Panyang Kecamatan Muara Satu, Lhokseumawe, Jumat (28/6). Akibat insiden ini, sekitar lima penumpang L-300 kritis dan dirawat di RS PT Arun.

Soal KIP, Mahasiswa Protes DPRK Aceh Utara LHOKSEUMAWE (Waspada): Elemen mahasiswa dan masyarakat yang ada di Kabu-paten Aceh Utara dan Kota Lhokseumawe men-datangi Komisi A DPRK Aceh Utara. Mereka memprotes tata cara uji kelayakan dan kepatutan terhadap 15 calon anggota Komisi Independen Pemilihan (KIP) yang sarat ada ‘permainan’. “Fit and proper test tidak terbuka diduga ada sesuatu di balik hal itu,” kata Muhammad

Nasrullah, ketua umum Himpunan Mahasiswa Islam (HMI) Aceh Utara di Gedung DPRK Aceh Utara, kemarin. Sebelumnya, Ketua Komisi A Amiruddin B membuat pernyataan dan telah dimuat di beberapa media kalau uji kelayakan dan kepatutan dilakukan secara terbuka di depan umum. Kemudian, dia juga menambahkan hasil pleno uji kelayakan dan kepatutan langsung diumumkan pada hari itu juga. Pantauan Waspada, beberapa elemen mahasiswa yang ikut berdelegasi terdiri dari Koordinator BEM se Aceh, Korwil II BEM se Aceh, BEM UTU Meulaboh, BEM Unimal, STAIN Ma-

likussaleh, Sekolah Demokrasi, HMI Meulaboh, HMI Banda Aceh,HMIPidie,HMIPekanbaru, HMI Cabang persiapan Malaysia, dan BEM Jurusan Tarbiyah. Menanggapi pernyataan mahasiswa tersebut, Ketua Komisi A Amiruddin B dan anggota Anwar Sanusi mengatakan, semua tahapan perekrutan calon anggota KIP Aceh Utara telah dilakukan sesuai perintah undang-undang dan qanun yang berlaku, jika ada yang menganggap pekerjaan itu dilakukan tidak sesuai aturan, maka dipersilakan para masyarakat dan mahasiswa untuk membawa persoalan ini ke ranah hukum. (b18)

Empat Perwira Dan 39 Bintara Polres Bireuen Naik Pangkat BIREUEN (Waspada) : Bertepatan dengan peringatan HUT Bhayangkara ke-67 1 Juli 2013, sebanyak empat perwira dan 39 bintara jajaran Polres Bireuen naik pangkat setingkat dari pangkat semula Kapolres Bireuen AKBPYuri Karsono, SIK melalui Kabag Sumda Kompol Abu Isa menjelaskan hal itu menjawab Waspada di Mapolres setempat Jumat (28/6). Penyematan kenaikan pangkat 4 perwira dan 39 bintara dilaksanakan Kapolres Bireuen AKBP Yuri Karsono dalam upacara peringatan HUT Bhayangkara 1 Juli hari ini. Empat perwira yang naik pangkat setingkat menjadi Iptu masing-masing Ipda Syarifuddin MA Kapolsek Peusangan, Ipda M Husin Hamid Ka SKKT Polres, Drs H Idris Hamid Kasiwas Polres dan Ipda M Amin Kapolsek Jangka. Dua bintara berpangkat Aipdanaikpangkatsetingkatmenjadi Aiptu masing-masing Aipda Edy Saputra Kaur Mintu Sat Sabhara dan Aipda T Saiful Mahdisyah Kanit I Pidum Sat Reskrim. Enam bintara berpangkat Bripka naik menjadi Aipda ma-

sing-masing, Bripka Muslem,SH Kanit Provos Polsek Peudada, Bripka Alfian,SH Ba Polses Bireuen, Bripka Sufiany Kanit Provos Polsek Makmur, Bripka Wawan Sumarna Kanit Provos Polsek Samalanga, Bripka Ridwan,SE Paur MIN Bag OPS dan Bripka Tarmizi,SH Kasi Humas Polsek Juli. Sepuluh bintara berpangkat Brigadir naik menjadi Bripka, Brigair M Nasir bin Yusuf, Kasi Humas Polsek Makmur, M Hatta bin Ibrahim Nanit Yanmas Polsub Sektor Plimbang, Brigadir Husaini bin Ibrahim Ba Polsek Peudada, Brigadir Mufrad bin Muhammad Kasi Humas Polsek Gandapura, Brigadir M Nasir Bin Ben BanitYanmas Polsub Sektor Kuta Blang, Brigadir Djauhari bin Ramli Kanit Idik I Narkoba Brigadir Azhar bin Thaib Kanit Binmas Polsek Jeunieb, Brigadir Sulaiman Kanit Sabhara Polsek Jangka, Brigadir Herman Saputra A Md Kanit Intelkam Polsek Peusangan dan Brigadir Alfian Z Arifin. 21 Bintara berpangkat Briptu naik menjadi Brigadir , masing-masing, Briptu Muzakir

Banit Patroli Polsub Sektor Plimbang, Briptu Bambang Setiawan Kanit Reskrim Polsek Juli, Briptu Muhammad Khozim Ka SPKT Polsek Gandapura, Briptu Agus Salem Banit Yanmas Polsub Sektor Kuala. Briptu Wira Purnama Banit Reskrim Polsek Juli, Briptu Yasrizal Kanit Bimas Polsek Samalanga, Briptu Saifullah Banit Sabhara Polesk Juli, Briptu Firdaus Banit Intelkam Polsek Samalanga, Briptu Zulfikar Ba Sat Res Narkoba, Briptu Asriadi Kanit IV Sat Intelkam. Briptu Redi Kusneri Thaib Banit Reskrim Polsek Kota Juang, Briptu Rizal Sahputra Banit Reskrim Polsek Kota Juang, Bripti Rico Kardo Ba Polsek Kota Juang, Briptu Fajri Ferdinal Banit IV Sta Intelkam, Briptu Julizar Putra Ka SPKT Polsek Kota Juang, Briptu Haswandi Paur Dalgar Bag Ren, Briptu Suhartedi Ka SPKT I Polsek Makmur. Briptu Eri Prasetiyo Kanit Sabhara Polsek Makmr, Briptu Feni Mardiansyah Kaurmintu Sat Binmas, Briptu Mayriza Kanit Binmas Polsek Makmu dan Briptu Fadlun Ka SPKT Polsek Gandapura. (b12)

PT Telkom Launching Indi School HI-Fi Di SMPN 1 Sabang SABANG (Waspada): PT Telekomunikasi (Telkom) Indonesia launching program Indi School HI-Fi di SMPN 1 Sabang dan memberi bantuan 5 unit laptop bagi sekolah setempat. Sekretaris Dinas Pendidikan Kota Sabang, Bustami mengatakan hal itu kepada Waspada di

Waspada/Khairul Boangmanalu

DUA buah buku saku karangan Ustadz Sabaruddin Siahaan, dibagikan MPU Subulussalam kepada sejumlah pengunjung saat MTQ ke-31 Prov Aceh berlangsung. Foto direkam, Minggu (30/6).

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu)

Garuda Indonesia

GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Berangkat (flight, tujuan, waktu)

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35

12:50

SJ 011 Medan/Jakarta

13:35

12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45

14:00

FY 3400 Penang*

14:20

B11

sela-sela kegiatan gotong royong di lokasi wisata Sumur Tiga Ie Meulee Sabang, Sabtu (29/6). Kata dia, pihak PT Telkom telah melakukan launching Indi School HI-Fi di SMP negeri 1 Sabang, pada hari kamis lalu turut dihadiri Wali Kota Sabang. Eksekutif General Manager

(EGM) PT. Telkom Indonesia Divisi Busines Service (DBS) Arko Maryono saat Launching HI-Fi di SMPN 1 Sabang mengatakan, Indi School Merah Putih merupakan salah satu dari sub Program Telkom yaitu Indonesia digital network. (b31)

DEWANTARA (Waspada): PT Pupuk IskandarMuda(PIM)terusberupayamembantumasyarakat desa binaan. 10 pemuda dari GampongTambon Tunong, Kecamatan Dewantara mendapat bantuan bibit lele dumbo sebanyak 60.000 ekor yang ditabur dalam 4 kolam. Bantuan bersumber dari dana Corporate Social Responsibility (CSR). Hal itu disampaikan Eko Sunarko, Dirut PT PIM didampingi Sya’ban Daud, Sekretaris Perusahaan dan Manejer Humas Suryadi, Minggu (30/6) siang. Program pengembangan ternak lele dumbo sengaja diberikan kepada para pemuda selain untuk memberikan kesempatan kepada mereka untuk memperoleh lapangan pekerjaan juga untuk mencegah para pemuda dari hal-hal yang tidak baik. Sebelumnya, para peternek lele dumbo memanfaatkan lahan kosong PT PIM, namun karena lahan akan digunakan untuk lahan terbuka hijau, PIM sepakat untuk membuka kolam baru di Gampong Tambon Tunong. Selain memberi-

kan bantuan bibit, kelompok usaha pemuda juga diberikan modal untuk pembersihan lahan, pembuatan kolam hingga bantuan pakan. Ada 4 kolam yang dibantu, untuk dua kolam ditabur 30.000 bibit lele dumbo, itu artinya ada 60.000 bibit lele dumbo yang dibantu untuk 10 pemuda gampong setempat. “Insya Allah, lele dumbo akan dapat dipanen 3 bulan ke depan. Kami berpikir, jenis usaha ini sangat menjanjikan dan menguntungkan para peternak. Jika pilot project ini berhasil, maka akan dikembangkan hingga ke daerah (desa) lain,” kata Sya’ban Daud. Untuk menghidar para muda dari bahaya Narkoba, PIM juga ikut memberi bantuan pelaksanaan turnamen PIM Muara Dua Cup. Kegiatan ini rutin dilaksanakan setiap tahun. Pada tahun 2013, PIM membantu Rp45 juta untuk turnamen itu. PIM juga ikut berpartisipasi dalam pencegahan Narkoba dengan memberikan penyuluhan kepada para pemuda bekerjasama dengan Badan Narkotika Nasional (BNN) belum lama ini. (b18)

Aceh Timur Berpeluang Juara Umum MTQ Ke-31 IDI (Waspada): Dalam pelaksanaan Musabaqah Tilawatil Quran ke 31 tingkat Provinsi Aceh yang diselengarakan di kota Subulussalam, kafilah Kabupaten Aceh Timur masih berpeluang besar untuk merebut kembali gelar juara umum tahun ini. Pada pelaksanaan MTQ Ke-30 di Aceh Tamiang gelar juara umum direbut kafilah tuan rumah, Aceh Tamiang. Besarnya peluang para kafilah asal kabupaten Aceh Timur untuk merebut kembali gelar juara umum ini dilihat dari 24 orang peserta MTQ asal Aceh Timur yang mengikuti 10 cabang perlombaan, 13 pesertanya dari 9 cabang masuk ke babak final dan siapa yang tampil sebagai juara nantinya akan diumumkan pada Minggu (30/6) tadi malam. Demikian Sekretaris kontingen kafilah Aceh Timur Tgk Amiruddin, SAg.MAP kepada Waspada, Sabtu (29/6). Disebutkannya, adapun kafilah peserta MTQ asal Aceh Timur yang memberikan harapan kepada daerah mereka yakni dari cabang Tartil putra dan putri atas nama Muhammad Rizki dan Sahula Ruzni. Untuk cabang tilawah putri atas nama Nur-

hayati, untuk cabang Qira’ah Sab’ah putri atas nama Salmawati Hasyem, untuk cabang Hifdzil 5 Juz putri atas nama Hikmatul Husna, cabang Mufasir Bahasa Inggris, Aceh Timur meloloskan peserta putra dan putrinya yakni M Khaidir dan Nurul Husna. Kemudian, cabang Khattil Quran naskah putri atas nama Mahyani dan cabang Khattil Quran dekorasi atas nama Fakrullah, cabang MK2IQ yang lolos ke babak final yakni Mawaddah Idris. Lanjutnya, sementara itu untuk cabang Fahmil Quran putri, tutia rahmi, Aulia Rahmi dan Ramaza Rizka harus mengakui keungulan tim fahmil Putri asal Aceh Besar setelah di babak final Aceh Timur tertinggal angka sangat tipis dengan Aceh Besar yakni 50 angka. Dalam perolehan poin akhir Nagan Raya memperoleh poin 1.050, Aceh Timur 1100, Aceh Besar 1.150 dan Bireuen 600 poin. Dengan demikian tim Fahmil Quran putri Aceh Timur berhak menempati posisi kedua dalam cabang ini. Menurut Asisten II bidang Ekonomi Dan Keistimewaan Aceh Ikhsan Hayat, SSTP.MAP yang turut memberikan dukungan moril kepada para kafilah. (cri)

Aceh Utara Boyong Juara I Fahmil Quran LHOKSEUMAWE (Waspada): Setelah berjuang keras untuk mengalahkan peserta dari 23 kabupaten/kota lainnya, peserta lomba Musabaqah Tilawatil Quran (MTQ) Cabang Fahmil Quran Putra dari Kabupaten Aceh Utara berhasil tampil gemilang dan berhasil memboyong juara satu pada cabang perlombaan tersebut, dengan perolehan nilai 1.025. Hal tersebut disampaikan Tengku Idris, Kepala Dinas Syariat Islam Kabupaten Aceh Utara ketika diwawancarai Waspada, Minggu (30/ 6) sore. “Alhamdulillah, anak-anak dari Cabang Fahmil Quran (cerdas cermat) putra telah berhasil tampil dengan maksimal dan mereka berhak membawa juara I dengan peroleh nilai 1.025. Ini semua berkat usaha keras para peserta dan doa dari masyarakat Aceh Utara,” kata Kepala Dinas

SI Aceh Utara itu bahagia. Tiga peserta yang tampil dalam cabang lomba Fahmil Quran itu adalah MuhammadWali Alkhalidi, berperan sebagai juru bicara, didampingi oleh Ilham dan Rizka Azhari. Menjawab Waspada, Idris menyebutkan, para kafilah dari 12 cabang lomba lainnya juga berhasil masuk final, namun hasilnya baru diketahui, Minggu (30/6) tadi malam, saat para dewan juri mengumumkan di hadapan publik. Begitupun, Idris yakin dan percaya dari beberapa bocoran yang dia dapatkan, kafilah Aceh Utara bakal berhasil meraih juara II dan bahkan tidak tertutup kemungkinan bakal meraih juara I pada MTQ ke-XXXI Subulussalam. Rival terberat yang dihadapi para kafilah Aceh Utara hanya dari Aceh Besar. (b18)

13 Duta Subulussalam Tembus Babak Final SUBULUSSALAM (Waspada): Tuan rumah Musabaqah Tilawatil Quran (MTQ) ke-31 Prov. Aceh, Kota Subulussalam menempatkan 13 orang finalis untuk beberapa cabang. Cabang tersebut meliputi qiraah sab’ah putri, cacat netra putri, tiga orang khattil quran, empat orang tafsir, dua orang M2IQ dan dua orang hifzil quran. Seperti disampaikan Hermaini, Wakil Ketua Kafilah Subulussalam, Sabtu (29/6) 40 duta daerah ini bertarung di beberapa cabang, meliputi tilawah (tartil anak-anak, remaja dan dewasa putra-putri), qiraah sab’ah putra putri, cacat netra putri, syarhil campuran satu regu, hifzil (gol 1 juz putri, 5 dan 10 juz putra-putri, 20 dan 30 juz putra. Lalu tafsir (Bahasa Indonesia putra, Bahasa Arab dan Bahasa Ingris putra-putri), khattil quran (naskah, hiasan mushaf dan dekorasi putraputri), cabang M2IQ putra-putri dan fahmil quran putra-putri.

Keberhasilan 13 finalis di sana menurut Hermaini memungkinkan Subulussalam capai target lima besar. “Insya Allah tiga besar, lebih dari target,” sebutnya. Prestasi serupa dicapai kontingen Aceh Utara, seperti disampaikan Hasballah kepada Waspada. Sejumlah finalisnya meliputi cabang fahmil quran putra, M Wali Al Khalidi, Ilham dan Rizka Azhari. Lalu cabang khattil quran, masing-masing gol naskah putri, Azlina, gol hiasan mushaf putra, Kadarisman dan gol dekorasi putri, Humaira. Selanjutnya cabang tilawah remaja putra, M Ikhsan, cabang hifzil quran gol 1 Juz putra, Tajul Fuzari dan putri, Misbahul Jannah, gol 5 juz putri, Raudhatul Jannah dan gol 30 juz putri, Asmaul Husna. Sedangkan finalis cabang tafsir quran, yakni gol Bahasa Indonesia, Riza Wahyuni dan cabang syarhil quran, Awis Kurni, Hafidz Al Mansuri dan Vivian Dwinsi Flora. (b28)

Bazar Buku Islam Digelar Di Dayah Jeumala Amal MEUREUDU (Waspada): Bazar buku bertajuk “Jeumala Book Fair” resmi dibuka di Dayah Jeumala Amal, Lueng Putu, Pidie Jaya, Sabtu (29/6). Ajang yang diharapkan jadi penumbuh semangat membaca di kalangan murid dayah ini diren-

canakan berlangsung hingga 2 Juli mendatang. Ketua Panitia Jeumala Book Fair, Husaini Nurdin, mengatakan bazar buku ini menyediakan beragam jenis buku khususnya buku-buku bertemakan Islam baik fiksi maupun nonfiksi.

“Ini kali pertama kami mengadakanbazaarbukudilembaga pendidikan Islam berkat kerjasamaBandarBukudenganDayah Jeumala Amal dan juga Foskadja sebagai forum alumni Dayah Jeumala Amal,” ungkap Husaini, Minggu (30/6).(b04)

Waseda University Siap Terima Mahasiswa Almuslim PEUSANGAN (Waspada): Waseda University Jepang, memberi sinyal untuk tahap pertama bersedia menerima seorang mahasiswa Universitas Almuslim (Umuslim) Peusangan, Bireuen, untuk melanjutkan pendidikan. Sedangkan untuk ilmu riset akan dipelajari lebih lanjut lagi. Demikian dilaporkan, Rektor Umuslim, Dr H Amiruddin Idris SE.MSi, kepada Waspada, Minggu (30/6), langsung dari Jepang melalui telepon selular. “Tahap pertama Waseda University akan menampung seorang mahasiswa pendidikan Umuslim,” katanya. Rektor Umuslim yang datang ke Jepang bersama tim Sanggar Seni Mirah Delima pimpinan, Hj Nuryani Rachman SPd, untuk kunjungan Muhibah Seni mewakili Indonesia, pada hari kedua berada di negara matahari terbit langsung berkunjung ke Waseda University yang berada di Kota Shinjuku, Tokyo, saat itu lang-

sung disambut suka cita. Karena keinginan untuk berkerjasama dengan perguruan tinggi yang bermotto Independent of Learning atau kebebasan belajar dengan perguruan tinggi swasta yang dipimpinnya bermotto unggul, profesional, dan islami hampir terwujud. Namun, pihak Waseda juga mengharapkan, adanya pertukaran budaya Aceh dengan budaya Jepang lebih lanjut serta berbagai seni budaya lainnya. “Saat itu kami sangat bahagia karena keinginan kita untuk kerjasama dengan perguruan tinggi yang pernah hancur akibat serangan bom pada masa perang dunia II dan universitas yang banyak melahirkan politisi ternama di Jepang atau enam perdana menteri itu sudah siap bekerjasama dengan Umuslim,” katanya. Kecuali itu, Amiruddin mengatakan, penampilan grup sanggar seni Mirah Delima yang membawakan tarian tradisonal nusantara dalam kesempatan

itu juga sangat meriah dan antusias. Bahkan mereka terkagum-kagum ketika melihat pergerakan heroik tari tarian tradisional Aceh Saman yang diiringi dengan seurune kalee serta rapa’i, sehingga tidak sedikit yang mereka histeris saat anakanak Umuslim membawakan seni drama tarian tsunami. Setelah, menyaksikan penampilan itu, tidak sedikit yang mengundang tim sanggar Seni Mirah Delima untuk tampil di beberapa tempat lainnya, namun karena waktu yang sangat terbatas atau jadwal yang telah tersusun, sehingga dengan berat hati mereka tidak bisa memenuhi undangan mereka. “Begitulah memang sambutan yang luar biasa terhadap kami saat itu,” katanya seraya menambahkan, Senin (1/7) hari ini, tim Umuslim dari Tokyo akan melakukan hal yang sama ke Doshisa Bussinees School di Kyoto dengan menggunakan kereta cepat dengan menempuh perjalanan lebih kurang sekira 3 jam. (cb02)

Waspada/ist

REKTOR Umuslim, Dr H Amiruddin Idris SE, MSi, menyerahkan bungoeng jaroe kepada kedubes RI di Jepang di kantor KBRI Jepang.


Aceh

B12

WASPADA Senin 1 Juli 2013

Kondisi Wartawan Waspada Masih Koma

Waspada/dede

SEORANG anggota Sat Lantas Polres Langsa membantu menyeberangkan seorang ibu di Jalan Lintas Banda Aceh-Medan atau Jalan Ahmad Yani. Hal ini sebagai cermin di HUT Bhayangkara ke-67 yang jatuh pada tanggal 1 Juli 2013, Polri sebagai abdi masyarakat yang mewujudkan Polri yang dimiliki, dicintai dan dibanggakan oleh masyarakat. Foto direkam belum lama ini.

MEDAN (Waspada): Pasca operasi di Rumah Sakit Malahayati di Medan, kondisi wartawan/koresponden Harian Waspada di Kota Langsa, H Syahrul Karim BA, Minggu (30/6) belum juga siuman dari komanya setelah dirinya mengalami kecelakaan saat menjalankan tugas peliputan gerak jalan santai peringatan HUT ke-67 Bhayangkara di Mapolres Langsa, Sabtu (29/6) sekira pukul 07:30. Menurut anak korban, Karmena SyafriYana, Syahrul Karim saat itu, sedang mengambil foto di Jalan Agusalim, Gampong Blang, Langsa Kota mengikuti rombongan gerak jalan santai Kapolres Langsa AKBP Hariadi, SH. SIK beserta perwira di jajaran Polres Langsa. Setahu bagaimana, tiba-tiba mobil Honda Jazz yang dikendarai, Didi, anggota Koramil Peureulak Barat melintas dan menyerempet sepedamotor Syahrul Karim. Akibatnya, Syahrul Karim terhempas dan kepala korban menghantam bahu jalan. Sopir Honda Jazz mencoba melarikan diri dan berhasil dihentikan Polantas dari Polres Langsa di Gampong Lhok Bane bersama warga. Sementara kondisi korban yang mengalami benturan keras mengalami koma dengan luka benjolan di kepala sebelah kanan seukuran genggaman tangan orang dewasa langsung dibawa ke RSUD Langsa untuk mendapat

rawatan intensif. “Namun, melihat kondisi korban yang tak sadarkan diri dan mengeluarkan buih di mulut, pihak keluarga langsung merujuk korban ke RS Malahayati pukul 09:30. Lalu, tepat pukul 13:00 korban tiba di RS Malahayati dan dilakukan scanning di kepala korban. Hasil scanning, di kepala korban ditemukan cairan tepatnya di otak sebelah kanan dan harus segera menjalani operasi untuk mengeluarkan cairan itu,” katanya. Kemudian, terang Karmena, sekira pukul 19:00, korban menjalani operasi selama tiga jam lebih. Sementara saat korban menjalani operasi, hadir Pemimpin Redaksi Harian Waspada H Prabudi Said, Wakil Penanggungjawab Harian Waspada H Sofyan Harahap dan Redaktur Aceh M Zeinizen. Kini korban masih menjalani perawatan pasca operasi itu di ruang ICU Malahayati, namun hingga saat ini korban belum sadar juga dari komanya. “Sementara ucapan doa terus berdatangan dari kerabat korban, agar cepat sembuh dan siuman dari komanya, seperti PTPN I Langsa, Ketua PWI Langsa, dan rekan-rekan korban seprofesi di Langsa dan Aceh. Di mana kita ketahui korban merupakan wartawan terlama yang sudah mengabdi di Harian Waspada sejak tahun 70-an,” sebutnya. (m43)

250 Kaleng Miras Disita Di Lhokseumawe LHOKSEUMAWE ( Waspada) : Petugas Satpol – PP dan Wilayatul Hisbah ( WH) Kota Lhokseumawe berhasil menyita sebanyak 250 kaleng dan botol minuman keras, Minggu (30/6) dalam sebuah rumah di Kampung Cina, Kecamatan Banda Sakti. Ratusan minuman haram itu ditemukan petugas dalam sebuah kegiatan razia yang menanggapi laporan masyarakat. Razia itu dipimpin Kepala Satpol PP dan WH Kota Lhokseumawe Irsyadi dibantu Kapolsek Banda Sakti dan Danramil Banda Sakti, yang dimulai pada pukul 01:00. Para petugas melakukan penyisiran di Kampung Cina.

Kepala Satpol PP dan WH Lhokseumawe, Irsyadi mengatakan, ratusan kaleng minum keras yang disita adalah barang haram yang dipasok dari luar Aceh oleh pengedarnya. “Razia ini, merupakan sebagai tugas rutin kita. Kita bertekad memberantas penjualan minuman keras, terutama menjelang bulan suci Ramadhan,” ujar Irsyadi.

MT Gampong Sidorejo Gelar Ceramah LANGSA (Waspada): Majelis Tak’lim (MT) Dusun Mulia Gampong Sidorejo, Kecamatan Langsa Lama, menyelenggarakan ceramah satu panggung dua ustadz untuk menyambut bulan puasa 1434 H dan menyantuni anak yatim di lapangan gampong setempat, Jumat (28/6) malam. Hadir penceramah dari Sumatera Utara, yakni Ustadz H Zulkifli A Dian LC dari Stabat, Langkat dan Ustadz Drs Ishak Ibrahim MA dari Kota Binjai serta Wakil Wali Kota Langsa, Drs Marzuki Hamid MM dan para ibu dan pemuda-pemudi gampong setempat. Wakil Wali Kota Langsa, Marzuki Hamid, menyampaikan kebanggaannya kepada masyarakat Dusun Mulia gampong setempat, yang mampu menyelenggarakan acara ini dengan mendatangkan dua penceramah sekaligus. “Saya bangga terhadap masyarakat dusun ini, karena acara sebesar ini panitia pun tidak dibentuk sangat luar biasa,” ujarnya. Koordinator pelaksana, Doles mengucapkan, terimakasih kepada masyarakat Dusun Mulia gampong setempat, yang telah berpartisipasi untuk mensukseskan kegiatan ini. Penceramah diawali Ustadz H Zulkifli A.Dian LC dalam tausiahnya, menyampaikan, salah satu ciri manusia yang muslim yakni melaksanakan kewajiban seperti berpuasa dan membayar zakat selain salat serta mengucapkan syahadat yang utamanya. Ustadz mengajak kepada umat Islam selama di bulan suci Ramadhan agar dapat terus mendekatkan diri dan taqwa kepada sang Khalik sebagaimana yang dituangkan dalam Alquran dan Hadis. (m43)

Waspada/dede

WAKILWali Kota Langsa, Drs Marzuki Hamid MM, saat menyantuni anak yatim yang dilaksanakan oleh Majelis Tak’lim Dusun Mulia, Gampong Sidorejo, Kecamatan Langsa Lama, di lapangan gampong setempat, Jumat (28/6) malam.

6 Perwira Polres Langsa Naik Pangkat LANGSA (Waspada): Kapolres Langsa, AKBP Hariadi, SH. SIK menyematkan tanda pangkat baru bagi kenaikan pangkat 6 perwira di jajaran Polres Langsa. Mereka; Iptu Jhonwir, Iptu Jamalus, Iptu Buola, Iptu Yusman Akub, Iptu Dailami serta Iptu Sadanur, dengan upacara sederhana di halaman Mako Polres Langsa, Jumat (28/6). Selain 6 perwira, Kapolres Langsa, juga menyematkan tanda pangkat baru bagi kenaikan pangkat 39 personil polisi dari jajaran Polres Langsa secara simbolis dari pangkat Brigadir Satu menjadi Brigadir, AKBP Hariadi dalam arahannya mengatakan, kenaikan pangkat adalah merupakan hak atas suatu pencapaian perestasi yang diterima oleh masing-masing anggota Polisi, namun perlu diingat, semakin tinggi pangkat yang dimiliki maka akan lebih menambah beban moral. Turut hadir, Waka Polres Langsa Kompol Nono Suryanto, SIK, Kabag Ops Kompol Galih Indragiri, SIK, para Kasat serta seluruh Kapolsek dalam Jajaran Polres Langsa.(m43)

Waspada/dede

KAPOLRES Langsa AKBP Hariadi, SH. SIK ketika melakukan peusijuk kepada salah seorang personil Brigadir Dopi di halaman Mapolres Langsa, Jumat (28/6)

Setelah mengamankan seluruh miras, kemudian petugas melanjutkan kegiatan razia dengan bergerak ke Pulau Semudu di Rancong, Kecamatan Muara Satu Kota Lhokseumawe.

Di sana petugas menemukan dua orang wanita dan satu orang pria yang diduga melakukan pelanggaran Syariat Islam dengan berkhalwat. Ketiga pelaku yang tidak di-

sebutkan identitasnya itu, diamankan petugas untuk mendapatkan sanksi peringatan dan pembinaan dengan dikembalikan kepada keluarganya masing – masing. (b16)

Jamaluddin Jamil Ketua KNPI Aceh BANDAACEH (Waspadas): Perkiraan Jamaluddin Jamil,ST (foto) terpilih sebagai Ketua DPD KNPI Aceh periode 2013-2016 tak meleset. Hanya saja tidak semudah prediksi sebelumnya. Kubu Jamal harus berjibaku mengalahkan kubu Fakhrizal Murfy dan hanya terpaut dua suara untuk kemenangan Jamal pada Musda XII KNPI Aceh yang berakhir, Minggu (30/6) menjelang subuh. Pada putaran pertama penjaringan bakal calon, Jamaluddin memperoleh 37 suara, saingannya, Fakhrizal Murfy memperoleh 43 suara, sedangkan lima peserta abstain. Putaran pertama dipimpin Azhari, mantan Ketua KNPI Kabupaten Aceh Barat, yang seharian sebagai Kepala Biro Organisasi Setda Aceh itu.

Sempat terjadi protes dari kubu Jamal dan waktu sempat molor lebih dua jam. Baru pukul 03:00 putaran kedua untuk pemilihan ketua dimulai dan pimpinan sidang digantikan oleh Khalid, SP . Perhitungan suara saling kejar dan akhirnya Jamaluddin dari unsur Anshor/ MKGR dinyatakan sebagai pe-

menang, karena mendulang 43 suara, sementara Fakhrizal Murfy 41 suara. Begitu Jamal terpilih, ia kebanjiran ucapan selamat. Tidak kecuali Gubernur Aceh, Zaini Abdullah dan Wagub Muzakkir Manaf mengapresiasi terpilihnya Jamalsebagaiketualembagayang membawahi pemuda di Aceh. Jamaluddin yang dikenal low profil dan flamboyan ini akan bekerja keras membangun kepemudaan di Aceh dan bisa bersinerji dengan Pemerintah Aceh. “Saya juga akan mendorong tumbuhnya jiwa enterpreneurship (kewirausahaan) di kalangan pemuda sehingga bisa dengan mudah terciptanya lapangan kerja baru di Aceh,” kata Jamal yang dikenal mudah bergaul dengan semua kalangan itu. (b01)

Tenaga Pendidik Aceh Timur Raih Guru Prestasi Se-Aceh IDI (Waspada): Empat tenaga pendidik di Kabupaten Aceh Timur berhasil meraih predikat sebagai guru berprestasi Aceh pada lomba guru dan kepala sekolah (Kepsek) berprestasi yang berlangsung sejak 23 26 Juni lalu di Banda Aceh. Ketua Persatuan Guru Republik Indonesia (PGRI) Aceh Timur H Agussalim, SH.MH

kepada Waspada menuyebutkan, keempatnya masing-masing Erliadi, SPd (guru SMKN 1 Peureulak) meraih juara II Guru Prestasi Kategori Guru SMK se Aceh, Indah Jelita, SPd.MPd (Guru SDN Cot Keh, Peureulak) meraih juara II untuk kategori Guru SD se Aceh. Selanjutnya, Marzuki, SPd (guru SDN Ranto Peureulak) meraih Juara III un-

tuk kategori Guru SD se Aceh dan M Isa, SAg.MAg (Kepala MAN Peureulak) untuk kategori Kepala MA. Kegiatan yang digelar selama empat hari di Banda Aceh diikuti ratusan guru dan Kepala Sekolah (Kepsek) dari 23 kabupaten/kota yang digelar PGRI Aceh, mulai dari TK, SD, SMP hingga SMA sederajat.(b24)

Waspada/dede

KONDISI koresponden Harian Waspada di Langsa, Syahrul Karim yang belum sadarkan diri dari komanya di RS Malahayati setelah menjalani operasi selama tiga jam, Minggu (30/6).

Bireuen Juara Umum Haul Darussa’adah IDI (Waspada): Setelah mengumpulkan 61 poin, akhirnya Bireuen sebagai Wilayah II Darussa’adah Teupin Raya Aceh berhasil meraih Juara Umum Musabaqah Tilawatil Quran (MTQ) dalam rangka Haul Darussa’adah Ke 45 se Aceh yang digelar sejak 25-30 Juni 2013 di Ponpes Darussa’adah cabang Idi Cut, Kabupaten Aceh Timur. Pembagian hadiah dan uang pembinaan dilakukan bertepatan dengan malam penutupan Haul Darussa’adah Ke-45 yang ditutup Asisten III Setdakab Aceh Timur, Drs Irfan Kamal, M.Si atas nama Bupati Aceh Timur Hasballah M.Thaib, Minggu (30/6) sekira pukul 00:15 dinihari. Hadir antara lain Kajari Idi, Hasanuddin, SH dan unsur Muspika Kecamatan Darul Aman serta ribuan pengunjung di sekitar Idi Cut. Ketua Dewan Hakim, Tgk H Musri, SPdI kepada Waspada di sela-sela pembagian hadiah menjelaskan, nilai 61 yang diperoleh wilayah

II merupakan kumpulan sejumlah juara dari berbagai cabang yang diraihnya. “Untuk kategori Juara I poinnya 3 poin, Juara II sebanyak 2 poin dan Juara III poinnya 1,” katanya seraya menambahkan, dengan banyaknya juara yang diraih membuat Bireuen berada di posisi teratas. Untuk urutan kedua, lanjut H Musri, berhasil diraih Wilayah I yakni Pidie dengan jumlah 49 poin. “Sementara tuan rumah Aceh Timur berada pada urutan ketiga yakni Wilayah III. ‘Alhamdulillah kegiatan ini sukses dilaksanakan dengan berbagai kegiatan lomba seperti MTQ Cabang Tilawah, Fahmil Quran, Qiraatul Kutup, Syahril Quran serta Pidato dalam tiga bahasa,” sebut H Musri. Bupati Aceh Timur, Hasballah M. Thaib dalam sambutan tertulis yang dibaca Asisten III Setdakab Aceh Timur, Drs Irfan Kamal, MSi menyatakan siap mendukung berbagai kegiatan keislaman. (b24)

Waspada, senin 1 juli 2013  

Waspada Daily

Read more
Read more
Similar to
Popular now
Just for you