Page 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

SENIN, Pahing, 19 Maret 2012/25 Rabiul Akhir 1433 H

No: 23808 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: 2.500,-


IBU Negara Ny. Ani Yudhoyono didampingi putra sulung Agus Harimurti Yudhoyono, putra bungsu Edhie Baskoro Yudhoyono dan menantu Siti Rubiyah Aliya Rajasa menyapa wartawan ketika meninggalkan RSPAD Gatot Soebroto, Jakarta, Minggu (18/3).

Irwandi Desak Polri Umumkan Pelaku Teror

Dokter: Ani Yudhoyono Pulih 100 Persen JAKARTA (Antara): Anggota tim dokter kepresidenan, dr Djoko Rahardjo memastikan Ibu Ani Yudhoyono sudah pulih 100 persen setelah menjalani operasi pengangkatan batu kandung empedu. “Sudah 100 persen,” kata Djoko ketika ditemui di RSPAD Gatot Subroto, Jakarta, Minggu (18/3) siang. Dokter Djoko menyatakan Ani Yudhoyono tidak perlu beristirahat total. Ani bisa beraktivitas secara wajar di rumah. Ani juga tidak perlu mengecek kesehatan ke rumah sakit. “Paling dokternya nanti kalau perlu dipanggil ke sana (Cikeas-red),” kata Djoko. Menurut Djoko, Ani Yudhoyono perlu mengatur pola makan. “Ya beliau tentunya masih harus makannya jangan banyak lemak, gitu aja,” katanya. Ani Yudhoyono dirawat di rumah sakit tersebut sejak Kamis (15/3). Dia menjalani operasi pengangkatan kandung empedu dan batu di dalamnya pada Jumat (16/3). Dia meninggalkan RSPAD, Minggu (18/3) siang pukul 11:10. Sesaat setelah keluar dari pintu ruangan, Ani yang mengenakan busana berwarna Lanjut ke hal A2 kol. 3

Mengaku Jiwanya Terancam


SILATURAHIM PARTAI DEMOKRAT: Presiden Susilo Bambang Yudhoyono selaku Ketua Dewan Pembina Partai Demokrat (ketiga kanan) didampingi dari kiri ke kanan, Anggota Dewan Pembina TB Silalahi, Sekretaris Dewan Pembina Andi Mallarangeng,Wakil Ketua Dewan Pembina Marzuki Alie, Ketum DPP Partai Demokrat Anas Urbaningrum dan Sekjen Edhie Baskoro Yudhoyono menghadiri acara silahturahim pengarahan dan pembekalan kepada para pengurus DPP dan DPD Partai Demokrat di pendopo kediaman pribadi presiden di Puri Cikeas, Kabupaten Bogor, Jawa Barat, Minggu (18/3) malam. Dalam pengarahannya, selain untuk konsolidasi internal partai, SBY mengangkat soal rencana kebijakan pemerintah untuk menaikkan harga Bahan Bakar Minyak (BBM) bersubsidi.

BANDA ACEH (Waspada) : Mantan Gubernur Aceh Irwandi Yusuf mendesak Polri secepatnya mengumumkan pelaku teror di Aceh.Hal itu terkait Densus 88 Mabes Polri di Aceh yang menangkap sejumlah orang disebut-sebut pelaku terror tetapi tidak dipublikasikan. Irwandi Yusuf secara terbuka mengkritik kinerja Kapolda Aceh Irjen Pol Iskandar Hasan yang terkesan menutupi hasil penangkapan dan temuan-temuan Densus 88 Mabes Polri dan menyebutnya sebagai kejahatan dengan motif ekonomi. “Tapi sayang sekali Kapolda tampak seperti berpihak kepada pelaku,” ungkap Irwandi, Minggu (18/3). Selaku kandidat, Irwandi mengaku jiwanya terancam terlebih setelah Densus 88 pada Sabtu (10/3) mengamankan tiga orang pembawa lima bom rakitan di Lhoong Aceh Besar yang ditargetkan untuk membunuhnya. “Perintah untuk menghabisi saya dan kawan-kawan adalah terstruktur dan setidaknya diketahui oleh kandidat mereka, karena itu semua demi sang kandidat juga,” kata Irwandi Sikap diam pejabat Polri ini juga dikritik pengamat politik dan keamanan Aceh, Arios Nivada, meski ia menilai rentetan kejadian itu bagian dari dilema pihak kepolisian Lanjut ke hal A2 kol. 6

Isu Kenaikan BBM Dipolitisasi SBY Minta Kader Demokrat Tidak Diam; Pembahasan Di DPR Sangat Alot JAKARTA(Waspada): Ketua Dewan Pembina Partai Demokrat, Susilo Bambang Yudhoyono menuduh kebijakan untuk memaikkan harga BBM (Bahan Bakar Minyak) telah dipolitisasi oleh pihak-pihak tertentu. Menurut SBY, hal ini merupakan salah satu upaya kampanye hitam dari lawan politiknya.

“Kalau kita lihat percaturan publik di media massa atau ruang publik, isu ini sudah berkembang politis dan jauh menyimpang dari hakekat permasalahannya. Ditambah aksi provokasi dan agitasi,” kata SBY saat membe-

rikan pengarahan dan pembekalan kepada para kader Partai Demokrat di Cikeas, Bogor, Jabar, Minggu (18/3) malam. SBY mengatakan rencana perubahan APBN 2012 prosesnya masih dibahas di DPR RI dan perdebatannya sangat

alot. Proses ini merupakan langkah demokrasi untuk menghasilkan opsi terbaik. “Kalau yang terjadi sekarang itu black campaign, buruk sangka, apapun dilakukan untuk menghadapi lawan politik, jika seperti ini maka poli-

tik jadi menyedihkan,” tegasnya. Dengan adanya rencana kebijakan ini, SBY meminta seluruh kadernya yang berada di DPR RI untuk aktif melakukan kerja politik yang rasional dan mencerdaskan. “Anggota fraksi Partai De-

mokrat di DPR harus aktif berkontribusi dalam pembahasan itu. Tampil lah. Saya masih dengar sebagian kader kita tidak tampil. Tampil lah, tapi bisa dipertanggungjawabkan,” tuturnya. “Segala sesuatunya harus

sesuai inti permasalahan itu, mendapat penjelasan yang tepat dan benar. Hangatnya politik ini harus diberi penjelasan bukan distorsi, manipulasi, sehingga menjadi bias,” kata dia. Lanjut ke hal A2 kol. 3

Sejumlah SPBU Di Jalinsum Medan-Aceh Kehabisan Solar


Pj Gubernur Aceh Di Waspada:

Aparatur Harus Mempunyai Sense Of Journalism MEDAN (Waspada): Penjabat (Pj) Gubernur Aceh Tarmizi A Karim (foto) menyampaikan salah satu upaya pendukung pembangunan di Aceh agar berjalan dengan baik, setiap aparatur harus memahami apa itu sense of journalism, yaitu rasa kewartawanan, sehingga mengerti pentingnya tugas wartawan dalam memberi informasi kepada masyarakat. “Bayangkan bila tidak ada keterbukaan dari aparatur sehingga wartawan tidak menyampaikan informasi dengan benar, maka akan sangat berpengaruh terhadap pembangunan, Oleh karena itu amat sangat penting aparatur harus menjalin komunikasi yang baik dengan wartawan,”ujar Tarmizi A Karim saat berkunjung ke Bumi Warta Waspada Jl. Letjen Suprapto No. 1, Medan, Sabtu (17/3). Pria yang masih menjabat Kepala Ba-

dan Diklat Kemendagri itu diterima Pemimpin Redaksi Harian Waspada H Prabudi Said, didampingi Redaktur Daerah Aceh Muhammad Zeini Zen dan Kepala Perwakilan Waspada di Banda Aceh, Aldin NL. Selain memaparkan tentang situasi Aceh saat ini, kunjungan itu juga dimanfaatkan Tarmizi dan Prabudi bernostalgia saat sama-sama menempuh pendidikan di American University, Amerika Serikat. Menurut Tarmizi, Waspada selama ini telah menciptakan suatu kondisi yang baik di Aceh dan membawa isu yang menarik ke Jakarta, karena koran Waspada juga dibaca di Jakarta. Hal itu sangat penting karena banyak pengambil kebijakan di Jakarta. Lanjut ke hal A2 kol. 1

LANGKAT (Antara): Sejumlah SPBU di jalan lintas Sumatera (Jalinsum) Medan - Aceh kehabisan stok solar sejak dua hari terakhir , mengakibatkan sebagian kendaraan terpaksa menunggu datangnya BBM jenis tersebut. Seperti di SPBU Km 34, Desa Stabat Lama, Kec. Wampu, Kab. Langkat, Minggu (18/3), di mana SPBU ini kehabisan stok solar, sedangkan BBM jenis premium masih ada. Menurut pihak pengelola SPBU Semangat Perangin-angin, BBM tersebut habis karena banyaknya kendaraan khususnya bus dan truk yang mengisi lebih banyak dari hari biasanya. “Biasanya stok solar baru akan habis setelah dipasok Pertamina, dalam jangka waktu empat hari, namun kini dalam dua hari saja sudah habis,” katanya. Lanjut ke hal A2 kol. 5

Polres Tapteng Sita 12 Ton BBM Bersubsidi TAPTENG ( Waspada) : Kapolres Tapteng AKBP Dicky Patrianegara bersama Kasi Intel Korem 023/KS Letkol Sudrajat, menyita sekitar 12 ton BBM bersubsidi dari sebuah rumah di Dusun Prancis, Kel. Hutablang, Kec. Badiri Tapteng, Sabtu (17/3) malam. Dari lokasi ditemukan BBM diduga telah dioplos yaitu 11 fiber plasik segi empat masing-masing berisi sekitar 1.000 liter dengan jumlah 11.000 liter , 7 drum plastik masing-masing berisi sekitar 180 liter dengan jumlah 1.256 liter, 2 jerigen plastik masing-masing berisi sekitar 35 liter dengan jumlah 70 liter dengan total BBM diduga oplosan sebanyak 13.326 liter. Turut disita alat pengoplos yaitu 2 unit mesin pompa merk robin, 4 ember plastik diduga alat mencapur minyak, peralatan pendukung lainnya 16 fiber plastik segi empat kosong, 16 drum kosong, 16, drum plastik kosong dan 40 jerigen kosong. Sedangkan penghuni rumah kabur. Pihak kepolisian masih melakukan penyelidikan atas identitas pemilik rumah. Kapolres Tapteng AKBP Patrianegara di lokasi kepada wartawan, Minggu (18/3) mengatakan, pihaknya sedang melakukan penyelidikan terhadappemilik rumah inisial HD yang melarikan diri.(a24)

Manfaat Waktu Oleh Tgk H. Ameer Hamzah Sesungguhnya setengah dari kebaikan Islam seseorang adalah meninggalkan kegiatan yang tak memberi manfaat baginya. (HR Malik, Ahmad dan Tabrani). SEORANG muslim yang baik adalah yang selalu berusaha ke arah kebaikan. Waktu yang 24 jam tersebut seluruhnya berguna baginya. Pukul 04:00 dini hari ia sudah bangun melaksanakan shalat sunat Tahajjud, Witir, sunat Fajar sambil menunggu shalat Shubuh. Pukul 07:00, ia pulang dari masjid, olahraga, mandi, sarapan dan bersiapsiap pergi kerja.

Lanjut ke hal A2 kol. 3

Perkuat Tradisi NU MEDAN (Waspada): Peran tradisi Nahdlatul Ulama (NU) yang sejuk dan toleran dalam menyebarkan dan memperkuat Islam di tengah masyarakat semakin dibutuhkan masyarakat Sumatera Utara dan bangsa Indonesia umumnya. Sekretaris Majelis Ulama Indonesia (MUI) Sumut Prof Dr Hasan Bakti Nasution, MA dan Dekan Fakultas Ekonomi USU John Tafbu Ritonga mengatakan hal itu secara terpisah di Medan, kemarin, terkait akan dilaksanakan Konferensi Wilayah XVI Nahdlatul Ulama (NU) Sumut pada 30-31 Maret di Medan. “Sebagai seorang yang pernah mendapat pendidikan Nahdlatul Ulama (PGA 4 tahun) Lanjut ke hal A2 kol. 2

Plt Gubsu Resmikan Rumah Alquran Rabbani MEDAN ( Waspada): Plt Gubsu H Gatot Pujo Nugroho meresmikan Rumah Alquran Rabbani di Jl. AR Hakim Medan, Minggu (18/3). Dalam sambutannya Gatot mengungkapkan apresiasinya kepada Pimpinan Lembaga Rabbani yang telah bekerja keras secara sungguhsungguh sehingga Rumah Alquran yang menjadikan kerinduan warga setempat telah berdiri. “Kami atas nama pemerintah Sumut berterimakasih

kepada panitia, kami juga bersyukur dengan berdirinya Rumah Alquran ini, “ ujar Gatot, dan berharap dengan berdirinya Rumah Alquran ini dapat mencetak- generasi-generasi yang Rabbani. Bukan generasi narkoba yang hanya membuang waktu untuk pekerjaan yang tidak berguna. Rumah Alquran ini, kata Gatot, merupakan berkah bagi warga sekitar. Kenapa demikian? tentu semua orangtua menginginkan keturunannya menjadi anak yang soleh dan

5 Bocah Diduga Minum Racun, 3 Orang Tewas

Jelang Konferwil XVI

Al Bayan

Waspada/Amir Syarifuddin

PLT Gubsu Gatot Pujo Nugroho meresmikan Rumah Alquran Rabbani di Jl AR Hakim Medan, Minggu (18/3).

Waspada/Rasudin Sihotang

PETUGAS kesehatan tengah memberi perawatan kepada seorang warga yang kritis terkena sabetan senjata di bagian kepalanya akibat kerusuhan, Minggu (18/3).

Baganasahan Rusuh, Dua Warga Kritis Dibacok BAGANASAHAN, ASAHAN (Waspada) : Desa Baganasahan Induk, Kab. Asahan, yang berada di kawasan Pelabuhan Panton Baganasahan rusuh. Dua warga terkapar terkena bacokan, Minggu (18/3) sekira pukul 18:00. Lanjut ke hal A2 kol. 6

LIMAPULUH (Waspada):Tiga bocah meninggal dunia setelah meminum hasil masak-masakan mereka di sekitar rumah tempat tinggal di Desa Bulan-Bulan, Kec Lima Puluh, Kab Batubara, Sabtu (17/3). Dua lainnya selamat, kini menjalani perawatan di UGD Indrapura. Korban pertama meninggal Fadli, 6, disusul adiknya Humairo, 5, pada dinihari dan Elsa, 5, meninggal dunia Minggu (18/3), setelah ketiganya ditangani medis. Informasi Waspada peroleh, kejadian itu bermula kelima korban sedang bermain masak-masakan di sekitar tempat tinggal mereka. Saat itu, mereka memasukan jenis serbuk yang semula didapati dari belakang rumah ke dalam air yang dimasak dan mencampurkan dengan gula. Begitu diminum , mereka mengalami pening dan mual sehingga orang tua mereka kebinggungan dan melarikan ke medis terdekat. Melihat kondisi yang semakin memburuk, korban dibawa ke klinik dan Rumah Sakit UGD Indrapura. Beberapa saat dirawat, Fadli meninggal dunia, disusul adiknya pada dinihari dan temannya Minggu (17/3) sore. Belum diketahui jenis serbuk yang dimasak anakanak itu. Sedangkan biaya pengobatan korban ditanggung Bupati Batubara H OK Arya Zulkarnain, SH,MM sebagaimana diungkapkan ketika menyempatkan diri membezuk korban di rumah sakit tadi malam.(a13/c04/c05)

juga tidak ketinggalan dalam ilmu pengetahuan dan teknologi. Nah, Rumah Alquran ini jawabannya. Gatot berjanji akan memperjuangkan melalui APBD untuk pembangunan Rumah Alquran.Selain itu, Gatot memberikan bantuan pribadi senilai Rp15 juta saat itu juga. Sementara itu Pimpinan Lembaga Rabbani Irwan Syahputra, MA menyampaikan, keberhasilan dalam berdirinya Lanjut ke hal A2 kol. 8

Ada-ada Saja Restoran Bertenaga Urine SEBUAH restoran di Melbourne, Australia, yang tenaga listriknya dihasilkan dari urine atau air seni telah dibuka untuk bisnis. Menurut Smart Planet, baru-baru ini, Proyek Greenhouse ini juga menggunakan produk pertanian untuk insulasi dan energi, serta Lanjut ke hal A2 kol. 2

Serampang - Isu BBM (Bikin Bapak Marah) - He...he...he...

Helikopter Jatuh Tiga Orang Tewas JAYAPURA (Antara): Tim SAR PT Freeport mengevakuasi jenazah pilot helikopter Sri Rama Krisna dari lokasi jatuhnya pesawat tersebut, Minggu (18/3) sekitar pukul 09:45 WIT. Informasi yang dihimpun, jenazah pilot berkebangsaan Selandia Baru tersebut saat ini sudah berada di Rumah Sakit Tembagapura. Lanjut ke hal A2 kol. 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Pahing, 19 Maret 2012/25 Rabiul Akhir 1433 H z zNo: 23808 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Polri Didesak Umumkan Pelaku Teror Di Aceh BANDA ACEH (Waspada) : Mantan Gubernur Aceh Irwandi Yusuf mendesak Polri secepatnya mengumumkan pelaku teror di Aceh.Hal itu terkait Densus 88 Mabes Polri di Aceh yang menangkap sejumlah orang disebutsebut pelaku terror tetapi tidak dipublikasikan. Irwandi Yusuf secara terbuka mengkritik kinerja Kapolda Aceh Irjen Pol Iskandar Hasan yang terkesan menutupi hasil penangkapan dan temuan-temuan Densus 88 Mabes Polri dan menyebutnya sebagai kejahatan dengan motif ekonomi. “Tapi sayang sekali Kapolda tampak seperti berpihak kepada pelaku,” ungkap Irwandi, Minggu (18/3). Selaku kandidat, Irwandi mengaku jiwanya terancam terlebih setelah Densus 88 pada Sabtu (10/3) mengamankan tiga orang pembawa lima bom rakitan di Lhoong Aceh Besar yang ditergetkan untuk membunuhnya. “Perintah untuk menghabisi saya dan kawan-kawan adalah terstruktur dan melibat atau setidaknya diketahui oleh kandidat mereka, karena itu semua demi sang kandidat juga,” kata Irwandi Sikap diam pejabat Polri ini juga dikritik pengamat politik dan keamanan Aceh, Arios Nivada, meski ia menilai rentetan kejadian itu bagian dari dilema pihak kepolisian dalam menuntaskan kasus teror dan kriminalitas bernuansa politik di Aceh. “Saya menilai Polda Aceh memiliki beban psikologis memposisikan dalam penuntasan kasus-kasus bernuansa politik,” kata Arios Nivada, Minggu (18/3). Desakan agar kepolisian mengungkap ke publik karena aksi-aksi Densus 88 di Aceh dengan aksi penangkapan dan penggerebekan, membingungkan publik di Aceh, seperti dua peristiwa penggerebekan di Banda Aceh, pada Jumat (17/3) di kediaman Wali Nanggroe Jl. Lanjut ke hal A2 kol.6

Lagi, Mobil Timses Cabup Aceh Timur Dibakar OTK


TINGGALKAN RUMAH SAKIT. Ibu Negara Ny. Ani Yudhoyono (kedua kanan depan) didampingi putra sulung Agus Harimurti Yudhoyono (kanan), putra bungsu Edhie Baskoro Yudhoyono (kedua kanan belakang) dan menantu Siti Rubiyah Aliya Rajasa (kelima kiri) menyapa wartawan ketika meninggalkan RSPAD Gatot Soebroto, Jakarta, Minggu (18/3). Ibu Negara Ny. Ani Yudhoyono meninggalkan RSPAD Gatot Soebroto setelah menjalani rawat inap untuk operasi pengangkatan kandung empedu beserta batunya sejak hari Kamis (15/3) lalu.

MADAT (Waspada) : Teror menjelang Pilkada di Aceh tampaknya terus menghantui masyarakat Serambi Mekkah. Selain aksi Petrus (penembak misterius), teror berupa pembakaran terus terjadi. Kali ini mobil milik anggota Tim Sukses Calon Bupati Aceh Timur dari jalur Independen, Muslim Hasballah-Marwi Umar, dibakar orang tak dikenal di Desa Bintah, Kec. Madat, Aceh Timur, Minggu (18/3) shubuh. Tak ada korban jiwa dalam kejadian itu, namun sebagian bodi mobil Xenia hitam BK 1694 JR itu hangus. Kasus ini sudah ditangani Kepolisian Sektor (Polsek) Madat. Informasi dihimpun Waspada, mobil itu merupakan kendaraan operasional Rusli M Yusuf alias Si-kleng, 35, warga Desa Bintah, Madat, Koordinator Timses Muslim-Marwi. Saat terbakar, mobil tersebut diparkir di samping rumah mertuanya, terpaut sekitar tujuh meter dari depan rumah Rusli. “Peristiwa ini diketahui pertamakali oleh Rosdiana, 31, tetangga Rusli. Rosdiana bangun untuk shalat shubuh. Tiba-tiba ia mendengar ban mobil meledak dan ketika keluar ia melihat mobil terbakar. Dia berteriak minta tolong dan sejumlah warga sekitar langsung memadamkan api,” kata Hamid alias Ek Busoe, 40, koordinator Timses Muslim-Marwi, Kec. Madat. Agus Supaldi alias Aneuk Jen, 30, warga Peureulak Kota yang mengaku sebagai Ketua Tim Keamanan Timses pasangan Cagub/ Wagub Irwandi Yusuf-Muhyan Yunan dan Cabup/Cawabup Aceh Timur, Muslim-Marwi, menuding aksi pembakaran mobil itu dilakukan oleh para pengecut yang takut kalah dalam Pilkada Aceh 2012. Aneuk Jen juga menyebutkan, sebelum Lanjut ke hal A2 kol.6

5 Bocah Minum Racun, 3 Tewas LIMAPULUH (Waspada):Tiga bocah meninggal dunia setelah meminum hasil masakmasakan mereka di sekitar rumah tempat tinggal di Desa Bulan-Bulan, Kec Lima Puluh, Kab Batubara, Sabtu (17/3). Dua lainnya selamat, kini menjalani perawatan di UGD Indrapura.

Korban pertama meninggal Fadli,6, disusul adiknya Humairo, 5, pada dinihari, dan Elsa, 5, meninggal dunia Minggu (18/3), setelah ketiganya ditangani medis. I n f o r m a s i Wa s p a d a

Pj Gub Aceh Di Waspada: Aparatur Harus Mempunyai Sense Of Journalism MEDAN ( Waspada): Penjabat (Pj) Gubernur Aceh Tarmizi A Karim (foto) menyampaikan salah satu upaya pendukung pembangunan di Aceh agar berjalan dengan baik, setiap aparatur harus memahami apa itu sense of journalism, yaitu rasa kewartawanan, sehingga mengerti pentingnya tugas wartawan dalam memberi informasi kepada masyarakat. “Bayangkan bila tidak ada keterbukaan dari aparatur sehingga wartawan tidak menyampaikan informasi dengan benar, maka akan sangat berpengaruh terhadap pembangunan, Oleh karena itu amat sangat penting aparatur harus menjalin komunikasi yang baik dengan wartawan,”ujar Tarmizi A Karim saat berkunjung ke Bumi Warta Waspada Jl. Letjen Suprapto No 1, Medan, Sabtu (17/3). Pria yang masih menjabat Kepala Badan Diklat Kemendagri itu diterima

Pemimpin Redaksi Harian Waspada H Prabudi Said, didampingi Redaktur Daerah Aceh Muhammad Zeini Zen dan Kepala Perwakilan Waspada di Banda Aceh, Aldin NL. Selain memaparkan tentang situasi Aceh saat ini, kunjungan itu juga dimanfaatkan Tarmizi dan Prabudi bernostalgia saat sama-sama me-

nempuh pendidikan di A m e r i c a n Un i v e r s i t y, Amerika Serikat. Menurut Tarmizi, Waspada selama ini telah menciptakan suatu kondisi yang baik di Aceh dan membawa isu yang menarik ke Jakarta, karena koran Waspada juga dibaca di Jakarta. Hal itu sangat penting karena banyak pengambil kebijakan di Jakarta. “Terutama bagi kami sebagai aparatur harus memahami tugas jurnalis dan saya juga menyampaikan kepada jajaran saya supaya jangan naïf kepada wartawan. Jangan ketika menulis bagus saja mau diwawancara ketika ada masalah sedikit saat diwawancarai marah, hal ini akan berdampak buruk terhadap pembangunan Aceh, “terangnya. Oleh karena itu, aparatur di Aceh harus memahami apa itu sense of journalism, maka aparatur ini Lanjut ke hal A2 kol.2

peroleh, kejadian itu bermula kelima korban sedang bermain masak-masakan di sekitar tempat tinggal mereka, yang saling berdekatan dan bertetangga tersebut. Saat itu, mereka mema-

sukan jenis serbuk yang semula didapati dari belakang rumah ke dalam air yang dimasak dan mencampurkan dengan gula. Begitu diminum , mereka mengalami pening dan mual. Sehingga orang tua

masing-masing kebinggungan dan berupaya melarikan ke medis terdekat. Melihat kondisi yang semakin memburuk, korban dibawa ke klinik dan Rumah Sakit UGD Indrapura. Bebe-

rapa saat dirawat, Fadli meninggal dunia, disusul adiknya pada dinihari dan temannya Minggu (17/3) sore. Belum diketahui jenis serbuk yang dimasak anakanak tersebut. Sedangkan

Jelang Konferwil XVI NU

Perkuat Tradisi NU MEDAN (Waspada): Peran tradisi Nahdlatul Ulama (NU) yang sejuk dan toleran dalam menyebarkan dan memperkuat Islam di tengah masyarakat semakin dibutuhkan masyarakat Sumatera Utara dan bangsa Indonesia umumnya. Sekretaris Majelis Ulama Indonesia (MUI) Sumut Prof Dr Hasan Bakti Nasution, MA dan Dekan Fakultas Ekonomi USU John Tafbu Ritonga mengatakan hal itu secara terpisah di Medan, kemarin, terkait akan dilaksanakan Konferensi Wilayah XVI Nahdlatul Ulama (NU) Sumut pada 30-31 Maret di Medan. Lanjut ke hal A2 kol.2

Golkar Akan Percepat Umumkan Capres JAKARTA ( Waspada): Partai Golkar berencana memajukan pengumuman kandidat calon presiden (Capres) yang bakal diusungnya. Semula, partai berlambang pohon beringin ini baru akan mengumumkan nama Capres yang diusung pada Pemilu 2014, itu di bulan Oktober 2012. Kepala Litbang Partai Golkar, Indra J Piliang, di sela orientasi kader Golkar Bali, Sabtu (17/3) menjelaskan rencana memajukan pengumuman nama Capres dikarenakan legitimasi partainya saat ini tengah menguat. Hal ini terbukti dari sejumlah survei CSIS, LSI, dan lembaga survei lain. Lanjut ke hal A2 kol.6


SEORANG anggota Jibom memeriksa bom rakitan yang ditemukan warga di Desa Pucok Alue, Kec. Baktiya Barat—Sampoinit, Aceh Utara, Minggu (18/3) siang.

Polisi Amankan Bom Rakitan Seberat 40 Kg LHOKSUKON (Waspada): Tim Penjinak Bom (Jibom) Detasemen B Brimob Jeulikat, Lhokseumawe, menyita bom rakitan aktif seberat 40 kilogram di Desa Pucok Alue, Kec.

Baktiya Barat—Sampoiniet, Aceh Utara, Minggu (18/3) sekira pukul 12:00. Informasi dari Kapolres Aceh Utara AKBP Farid Bachtiar Effendi melalui Kapolsek

Baktiya Barat Ipda Samsul Bahri, bom yang diduga sisa konflik itu ditemukan dalam tanah timbun oleh Tgk Abdullah, 40, Lanjut ke hal A2 kol.1

Ada-ada Saja

Al Bayan

Restoran Bertenaga Urine

Manfaat Waktu Oleh: H Ameer Hamzah Sesungguhnya setengah dari kebaikan Islam seseorang adalah meninggalkan kegiatan yang tak memberi manfaat baginya. (HR Malik, Ahmad dan Tabrani). SEORANG muslim yang baik adalah yang selalu berusaha ke arah kebaikan. Waktu yang 24 jam tersebut seluruhnya berguna baginya. Pukul 04:00 dini hari ia sudah bangun melaksanakan shalat sunat Tahajjud, Witir, sunat Fajar sambil menunggu shalat Shubuh. Pukul 07:00, ia pulang dari masjid, olahraga, mandi, sarapan dan bersiapsiap pergi kerja. Ketika azan shalat Dzuhur dikumandangkan, ia bersiap-siap ke masjid. Usai shalat Dzuhur berjamaah ia bekerja lagi sampai menjelang shalat Ashar. Ba’da shakat Ashar berjamaah ia berolahraga atau mencari hiburan apa saja yang bermanfaat bagi jasmani dan ruhaninya. Tentu yang dicari adalah olahraga atau hiburan-hiburan yang tidak diharamkan agama. Lanjut ke hal A2 kol.1

biaya pengobatan korban ditanggung Bupati Batubara H OK Arya Zulkarnain, SH,MM sebagaimana diungkapkan ketika menyempatkan diri membezuk korban di rumah sakit tadi malam.(a13/c04/c05)


DUA anggota Polhut Unit 3 Julok berdiri dekat tumpukan kayu ilegal yang ditemukan di kawasan Kilometer 8, Desa Seuneubok Bayu, Kec. Indra Makmu, Aceh Timur, Sabtu (17/3).

Polhut Aceh Timur Sita 3,5 Ton Kayu Ilegal KUTABINJEI ( Waspada) : Polhut Unit 3 Julok— Kutabinjei, Aceh Timur, menyita 3,5 ton kayu ilegal di kawasan Kilometer 8, Desa Seuneubok Bayu, Kec. Indra Makmu, Aceh Timur, Sabtu (17/3) sore. Lanjut ke hal A2 kol.1

Waspada/Alam Tanjung

KAPOLRES Tapteng AKBP Dicky Patrianegara saat melakukan olah TKP tempat penimbunan dan dugaan oplosan BBM, di Dusun Prancis, Kel. Hutabalang Kec. Badiri, Kab. Tapteng, Minggu (18/3).

Polres Tapteng Sita 12 Ton BBM Bersubsidi TAPTENG (Waspada) : Kapolres Tapteng AKBP Dicky Patrianegara bersama Kasi Intel Korem 023/KS Letkol Sudrajat, menyita sekitar 12 ton

BBM bersubsidi dari sebuah rumah di Dusun Prancis, Kel. Hutablang, Kec. Badiri Tapteng, Sabtu (17/3) malam. Dari lokasi ditemukan

BBM diduga telah dioplos yaitu 11 fiber plasik segi empat masing-masing berisi sekitar Lanjut ke hal A2 kol.6

S E BUA H r e s t o r a n d i Melbourne, Australia, yang tenaga listriknya dihasilkan dari urine atau air seni telah dibuka untuk bisnis. Menurut Smart Planet, baru-baru ini, Proyek Greenhouse ini juga menggunakan produk pertanian untuk insulasi dan energi, serta dibangun dengan materi-materi daur ulang. “Urine itu sangat bagus untuk nitrogen dan sangat berharga. Anda hanya memerlukan air seni dari 25 orang untuk menyediakan pupuk Lanjut ke hal A2 kol.6

Serampang - Jangan sakit-sakit lagi ya bu... - He.... he....he....


Berita Utama

Polling Pilkada Aceh

WASPADA Senin 19 Maret 2012

Polresta Medan Gerebek Judi Sabung Ayam ● 22 Orang Diamankan

Hasil polling ini dihitung berdasarkan suara pembaca Waspada yang dikirim dalam bentuk kupon yang telah disediakan (lihat halaman Pilkada Aceh). Metode polling yang digunakan tidak untuk mewakili keseluruhan suara pemilih dalam Pilkada Aceh, tapi hanya untuk mencari tahu suara pembaca Waspada terhadap kandidat yang muncul dalam Pilkada Gubernur Aceh maupun pemilihan bupati/wali kota yang ada di Aceh. Redaksi membuka peluang sebesar-besarnya kepada para pembaca Waspada untuk mengisi kupon polling berhadiah ini.(red)

Aparatur Harus ... “Terutama bagi kami sebagai aparatur harus memahami tugas jurnalis dan saya juga menyampaikan kepada jajaran saya supaya jangan naïf kepada wartawan. Jangan ketika menulis bagus saja mau diwawancara ketika ada masalah sedikit saat diwawancarai marah, hal ini akan berdampak buruk terhadap pembangunan Aceh, “terangnya. Oleh karena itu, aparatur di Aceh harus memahami apa itu sense of journalism, maka aparatur ini wajib memberikan informasi kepada wartawan untuk diketahui oleh masyarakat. “Bila aparatur kita di Aceh memberikan informasi dengan baik kepada wartawan maka hal itu akan disampaikan secara hitam di atas putih artinya wartawan akan menyampaikan secara fakta/kenyataan,”tambah Tarmizi. Ia mengharapkan kepada wartawan bisa menjaga profesional kerja. Terkadang dalam suatu keadaan ada wartawan yang nakal ketika wawancara A ditulis B, ujar Tarmizi seraya mengucapkan percaya Waspada tidak seperti itu. Pj Guberur Aceh juga mengimbau kepada aparatur di daerah jangan ada yang memanfaatkan wartawan, ia mencontohkan terkadang bila hendak diwawancara oleh wartawan si pejabat langsung menyodorkan sesuatu kepada wartawan dan ini merupakan salah satu upaya membungkam informasi kepada publik. “Saya berharap kepada aparatur jangan lagi ada hal-hal yang demikian, mulailah menciptakan kondisi yang transparan kepada wartawan agar nantinya berdampak kepada kesuksesan pembangunan di Aceh,”demikian Penjabat Gubernur Aceh. Soal Pilkada Damai Pilkada di Aceh telah menunjukkan demokrasi dalam bidang politik. Dan di Aceh yang pertama melaksanakan itu, meski sempat terjadi perbedaan pendapat terhadap tafsiran Undang-undang Pemerintahan Aceh ( UUPA), namun hal itu bukan sebuah hambatan untuk melaksanakan demokrasi. Tarmizi menyebutkan, Pilkada di Aceh semua pihak dapat mengikuti ajang pemilihan kepala daerah, baik yang tergabung dalam pencalonan perseorangan (independen-red) maupun calon yang diusung oleh partai politik nasional dan lokal. Ditanya terkait panjangnya interval waktu pra pilkada hingga

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1, ......, Bxf2+. 2. Rg1, Bg2+.

penentuan jadwal pilkada pada 9 April mendatang, Tarmizi menguraikan, jika pemerintah ingin benar-benar mengakomodir semua pendapat terkait perbedaan tafsir di UUPA.’’Ini penting, agar tidak ada lagi tuduhan jika pemerintah pusat mengabaikan UUPA,’’ terangnya. Disebutkannya, Pemerintah dalam hal ini Presiden Susilo BambangYudhoyono berpesan kepadanya melalui Mendagri Gamawan Fauzi saat pelantikan lalu agar menjaga netralitas pelaksanaan Pilkada Aceh.’’Ini merupakan penekanan yang terpenting dari pemerintah pusat sehingga keinginan mewujudkan pemilukada yang damai di Aceh terwujud,’’ terangnya. Tarmizi juga memaparkan tentang banyaknya peserta pilkada seperti di Aceh Barat yang sampai 14 pasang merupakan wujud dari demokrasi namun tidak mengabaikan aturan dan peraturan yang berlaku. Pemerintah juga katanya, mengingatkan aparatnya di pemerintahan provinsi, kabupaten/kota, kecamatan hingga desa untuk tidak berpihak kepada salah satu calon.’’Jika terbukti, sanksi berat akan diturunkan oleh pemerintah dan itu pasti bukan sekedar gertakan. Ini dilakukan agar wacana pilkada damai memang benar-benar terlaksana di pilkada Aceh nantinya,’’urai mantan Bupati Aceh Utara itu. Dengan demikian semua pihak harus bisa menjadikan pilkada Aceh sebagai momentum politik edukasi, dalam hal itu para calon harus bisa memberi ruang kepada rakyat Aceh untuk memilih pilihannya sesuai hati nurani. Ia juga mengingatkan jangan ada intimidasi dan teror. ‘’Karena bagaimanapun juga rakyat sudah semakin cerdas dalam memilih calonnya,’’ demikian Tarmizi A Karim. Dia juga mengharapkan calon yang kalah mau mengakui kekalahannya dan mendukung serta bekerjasama dengan calon yang menang agar pembangunan di Aceh dapat berlanjut. (cb01)

Ada-ada Saja ... dibangun dengan materi-materi daur ulang. “Urine itu sangat bagus untuk nitrogen dan sangat berharga. Anda hanya memerlukan air seni dari 25 orang untuk menyediakan pupuk yang digunakan untuk satu hektare ladang,” kata sang desainer asal Belanda, Joost Bakker. “Saya telah merancang restoran ini secara terbalik. Saya memulainya dengan bagian akhir terlebih dahulu, dengan menilai produksi limbah, dan bekerja dari sana.” “Saya selalu bermimpi untuk membangun sebuah restoran yang tidak menghasilkan limbah dan sekarang akhirnya saya telah mencapai hal itu!”. Setiapbagiandaribangunaninijuga dibangun dengan materi yang 100% dapat didaur ulang. (y)

3. Rh1, Bh2+ (Jika

Perkuat Tradisi NU ...

3. Rf1, Me2+mat). 4. Rg1, Mg2+mat atau Bh1+mat.

Jawaban TTS: TTS Topik







Jawaban Sudoku:

7 8 9 5 4 2 6 1 3

3 4 6 8 1 7 2 9 5

5 1 2 9 6 3 4 7 8

9 5 1 4 7 6 3 8 2

8 6 7 2 3 5 1 4 9

2 3 4 1 9 8 5 6 7

4 9 5 3 8 1 7 2 6

6 2 8 7 5 4 9 3 1

1 7 3 6 2 9 8 5 4

saya merindukan peran tradisi NU terus dikembangkan,” kata Ritonga. Pakar ekonomi dari USU ini menyebutkan cukup beralasan dia merindukan peran tradisi NU karena pernah menimba ilmu dari sekolah yang sudah tidak ada lagi seiring kebijakan pemerintah menutup semua PGA waktu itu. Untuk itu peran tradisi NU yang sejuk dan toleran dalam menyebarkan dan memperkuat Islam di tengah masyarakat semakin dibutuhkan bangsa Indonesia sekarang dan ke depan. Ritonga berharap Konferwil NU Sumut ini dapat mengukuhkan tradisi NU yang kuat. Pemberdayaan masyarakat dengan tradisi NU yang dulu bersifat holistik syariat Islam, budaya dan sosial , ekonomi yang ada saat ini semakin dibutuhkan. Posisi ulama, lanjutnya, agar diperkukuh lagi untuk membimbing umat. Begitu juga peran penggiat ekonomi dan kemasyarakatan yang lebih aktif harus dipertahankan sehingga gerakan kemasyarakatan dan dakwahnya berjalan harmonis dan menumbuhkan ketakwaan yang kolektif . Ritonga mengharapkan ke depan ulama dan pengusaha plus akademisi NU beserta keluarga besarnya memikirkan lembaga pendidikan NU. Mutlak dilakukan Hasan Bakti Nasution mengatakan mempertahankan

MEDAN (Waspada): Reskrim Unit Judi Sila Polresta Medan menggerebek lokasi judi sabung ayam beromset puluhan juta rupiah di Desa Lauchi, Kwala Bekala, Kec. Medan Tuntungan, Minggu (18/3) malam. Dari lokasi, polisi mengamankan 22 orang, berikut menyita uang taruhan judi Rp8,7 juta, handphone 18 unit, tiga ekor ayam sabung, timbangan, jam penunjuk waktu sabung ayam dan matras yang dibuat sebagai arena pembatas. Kasat Reskrim Polresta Medan Kompol Yoris Marzuki didampingi Kanit Judi Sila AKP Edi Safari, SH, kepada wartawan mengatakan, dari 22 orang yang diamankan sudah ada 8 orang yang dijadikan tersangka. “8 Orang sudah kita jadikan tersangka karena mereka ini se-

bagai penyedia lokasi sabung ayam yang mengutip bayaran Rp25 ribu kepada penonton dan pemain yang membayar Rp2 juta untuk sabung ayam,” jelasnya dan mengatakan, judi sabung ayam ini sudah berjalan cukup lama. ”Pihaknya masih melakukan pemeriksaan terhadap 22 orang yang diamankan. Mungkin besok Senin (19/3), baru bisa diketahui nama-nama tersangka,” jelasnya. Sedangkan Kapolresta Medan Kombes Monang Situmorang mengatakan, pihaknya masih melakukan pemeriksaan terhadap 22 orang yang diamankan. “Namun kalau nanti ada oknum TNI maupun Polri yangterlibatkitaproses.Tapisampai saat ini belum ada,” tegasnya. Nama-nama yang diamankan Polresta Medan dari lokasi

sabung ayam, NS, 20, warga Jl. Bunga Pancusina P. Simalingkar Medan, S, 48, warga Jl. PWS Medan, E, 20, warga Jl. Bunga, Pancurbatu, Iw, 30, warga Jl. Palas,Y, 27, warga Jl. Bunga Simalingkar, AP, 44, warga Jl.Djamin Ginting’s Padangbulan Medan, M, 50, warga Simpanglimun, DS, 44, warga Jl. Palas VII, M, 40, warga Simalingkar, E, 26, warga Padangbulan,W, 30, warga Padangbulan Medan, HS, 42, warga Tanjung Anom, S, 55, warga Tanjung Selamat, S, 56, warga Perumnas Simalingkar, RS, 42, warga Jl. Bromo, ES, 27, warga Kabanjahe, J, 24, warga Padangbulan, RS, 20, warga Padangbulan, D, 31, warga Padangbulan Medan, dan E, 52, warga Medan Sunggal. Saat ini mereka menjalani pemeriksaan di Reskrim Unit Judi Sila Polresta Medan. (m39)

Helikopter Jatuh Tiga Orang Tewas JAYAPURA (Antara): Tim SAR PT Freeport mengevakuasi jenazah pilot helikopter Sri Rama Krisna dari lokasi jatuhnya pesawat tersebut, Minggu (18/3) sekitar pukul 09:45 WIT.

Informasi yang dihimpun, jenazah pilot berkebangsaan Selandia Baru tersebut saat ini sudah berada di Rumah Sakit Tembagapura. Tim SAR juga masih terus

berupaya mengevakuasi dua korban lainnya yang merupakan penumpang helikopter yakni Adrianus Amba Sangka dan Iyan Timisela. Kedua korban itu karyawan PT Pangan Sari Utama. Helikopter dengan kode penerbangan PK-ODA yang jatuh Sabtu (17/3), ditemukan di sekitar area terowongan 70 atau di sebelah kiri terowongan dari arah Tembagapura menuju Ridge Camp. Helikopter milik Airfast yang digunakan PT Freeport dengan pilot Sri Rama Krisna, warga negara Selandia Baru itu mengalami kecelakaan saat kembali dari Awanagon menuju Tembagapura.

Sejumlah SPBU ...

pingi sejak dari dalam ruangan. Istri Ibas, Aliyah Rajasa juga ikut mendampingi. Setelah memberikan keterangan kepada wartawan, Ani Yuhoyono meninggalkan rumah sakit. Dia menaiki mobil sedan Mercedez, nomor polisi B 1925 RFS bersama Agus Harimurti. SementaraIbasdanAliyahmenggunakan mobil lain, yaitu Audi dengan nomor polisi B 1694 SB. Kedua mobil itu dikawal ketat oleh sejumlah anggota Pasukan Pengamanan Presiden.

Selain banyaknya pembeli minyak, pasokan dari Pertamina belum datang hingga aktivitas pengisian solar terhenti. “Kami juga telah meminta pasokan minyak dari Pertamina, namun belum juga dipenuhi,” ujarnya. Selain di SPBU ini, dua SPBU lainnya di Jalan lintas Sumatera jalur Medan menuju Aceh, tepatnya di Kecamatan Tanjungpura dan Kecamatan Pangkalan Susu, juga telah kehabisan stok solar. Untuk itu, masyarakat pemakai solar sangat berharap pihak Pertamina terus menyediakan solar agar bus maupun truk dapatberjalan,kataLilikyangberprofesi sebagai supir truk itu. Ia berharap pasokan segera dikirimkan ke Langkat, agar truknya bisa berjalan.

Mawas Diri Yudhoyono mengatakan kader partai selain mawas diri juga diminta tidak tinggal diam saat partai dipojokkan secara tidak adil. “Sebagai orang yang menggagas dan mendirikan Partai Demokrat, saya tidak akan berdiam diri, jika ada yang rusak atau salah saya yang pertama akan perbaikinya,” katanya. Selesai pertemuan ini, semua kader bangkit berbuat sesuatu dan aktif kembali, untuk membangun dan memajukan partai, termasuk membela dan menjaga martabat partai. “Jika partai diserang melebihi kepatutannya jangan tinggal diam,” kata Yudhoyono.

Ia mengatakan, “meski Partai Demokrat sering diserang tetapi partai kami tetap tegak berdiri, meski demikian saya melihat dan merasakan, adanya kegamangan dan kecemasan dari sebagian kader Partai Demokrat, saya akan aktif kembali bersama saudara untuk memastikan arah perjalanan dan gerak partai tetap lurus.”Ia mengajak semua kader untuk terus melakukan pembenahan. Menurut Yudhoyono, pihaknya harus menjaga martabat, harga diri dan kehormatan. Ia juga mengingatkan seperti yang pernah dikatakannya, kalau ada kesalahan kader demokrat maka harus diakui dan kemudian lakukan perbaiki diri, setelah itu belajar dari pengalaman dan jangan ulangi kesa-

lahan yang sama. “Partai segera melakukan konsolidasi, dan pembinaan internal yang sungguh-sungguh, dengan itu kita ksatria, mawas diri dan tidak begitu saja menyalahkan pihak lain, setelah semua itu dilakukan, partai kita masih terus dihantam, dan dideskriditkan, itu keterlaluan, “enough is enough” lakukan secara benar untuk membela kehormatan partai,” katanya. Silaturahmi tersebut dihadiri oleh seluruh anggota Dewan Pembina, anggota Dewan Pimpinan Pusat dan anggota Fraksi Partai Demokrat DPR RI. Pertemuan itu berlangsung mulai pukul 19:00, setelah pengarahan Ketua Dewan Pembina, pertemuan dilanjutkan secara tertutup. (vvn/ant)

tradisi NU mutlak dilakukan dan tetap dinanti masyarakat Sumut dan bangsa ini. Untuk itu Konferwil harus dapat melahirkan pemimpin yang terbaik dan memiliki komitmen akademis dan organisasi-pengabdian. Pemimpin yang memiliki komitmen akademis diharapkan mampu mengembangkan dakwah dan lembaga pendidikan NU. Sedangkan komitmen pengabdian untuk melakukan pengembangan organisasi dan pembinaan anggota NU. Menurut Hasan Bakti, fenomena saat ini banyak Ormas yang bernuansa politik, di mana cenderung mengabaikan pendidikan dan dakwah. Sebenarnya, nuansa politik dalam Ormas Islam boleh-boleh saja tetapi jangan mengabaikan fungsi pendidikan dan dakwah. Ini penting sebab umat Islam saat ini menghadapi tantangan yang kompleks. Dengan demikian perlu

pembinaan anggota dan organisasi Ormas sehingga Islam dapat bertahan dengan tantangan yang dihadapi. Jika Ormas Islam seperti NU ini kuat maka umat Islam akan kuat pula. Tak terkontaminasi politik Kepemimpinan NU Sumut saat ini, menurut guru besar IAIN Sumut ini, cukup baik tidak terkontaminasi politik dan tetap pada jati dirinya sehingga peran tradisiNUdapatberkembangdan dirasakan masyarakat Sumut. Memang ke depan pimpinan NU harus lebih intensif membina anggota yang jumlahnya tidak sedikit. Komitmen kepemimpinan akademis dan organisasi-pengabdian, lanjut Hasan Bakti, NU harus memberi penguatan internal. Dengan demikian, eksistensi NU khusus di Sumatera Utara terus memberikan kontribusi dalam mewujudkan kerukunan umat beragama di Sumut dan

Indonesia umumnya. Meski NU menjalankan tradisi“paham tua” tetapi NU terus mencari konsep yang lebih baik bahkan mengembangkan semangat modernis yang tetap berpegang pada nilai-nilai Islam. Islam moderat yang dikembangkan NU turut mengembangkan Islam di Sumut. “Dan itu saya rasakan.” Menurut Hasan Bakti, Islam modernis yang dikembangkan NU di Sumatera Utara telah menyemaikan kerukunan umat bergama di daerah ini. Untuk itu, Konferwil harus mengukuhkan kembali kepemimpinan yang sudah ada yang secara formal sudah memadai dan mendorong tradisiNUyangmodernis. Bagi periode kepemimpinan mendatang, Konferwil agar menjadikan isu ini sebagai bahan evaluasi diri dan organisasi sehingga peran tradisi NU tetap berkembang. (m13)

Waspada/Alam Tanjung

KAPOLRES Tapteng AKBP Dicky Patrianegara saat melakukan olah TKP tempat penimbunan dan dugaan oplosan BBM, di Dusun Prancis, Kel. Hutabalang Kec. Badiri, Kab. Tapteng, Minggu (18/3). Berita di halaman 1.

Dokter: Ani Yudhoyono ... hitam dan tata rias wajah berjalan menghampiri wartawan. Dia mengucapkan terima kasih kepada tim dokter yang merawat dan melakukan operasi. Ani juga mengucapkan terima kasih kepada rakyat Indonesia. “Terima kasih, doakan semoga saya tidak kembali lagi ke sini,” katanya sambil tersenyum. Kedua putranya, Agus Harimurti dan Edhie Baskoro Yudhoyono atau Ibas, mendam-

Isu Kenaikkan BBM ...

Al Bayan ... Ketika azan shalat Dzuhur dikumandangkan, ia bersiap-siap ke masjid. Usai shalat Dzuhur berjamaah ia bekerja lagi sampai menjelang shalat Ashar. Ba’da shalat Ashar berjamaah ia berolahraga atau mencari hiburan apa saja yang bermanfaat bagi jasmani dan ruhaninya. Tentu yang dicari adalah olahraga atau hiburanhiburan yang tidak diharamkan agama. Pukul 18:00 dia kembali ke masjid untuk menunaikan shalat Maghrib dan Isya berjamaah. Antara Maghrib dan Isya ia menyimak halaqah (ceramah agama) yang disampaikan para ulama. Ba’da shalat Isya berjamaah, ia pulang ke rumah. Antara Isya dan tengah malam,

banyak hal yang bermanfaat ia lakukan, antara lain; mendalami ilmu pengetahuan dengan membaca kitab-kitab dan buku-buku agama. Kadang-kadang diisi dengan lain hal, misalnya nonton televisi, mengajar anak-anak, kadangkadang menulis tulisan ilmiah popular untuk surat kabar. Tentu dalam celah-celah waktu yang bermanfaat itu telah juga terisi dengan cinta kasih kepada keluarganya. Dalam kamus orang-orang yang disiplin, tidak ada waktu yang sia-sia. Waktu selalu bermanfaat baginya. Tidak ada istilah nganggur, lalu menghabiskan waktu pada perbuatan-perbuatan lara seperti “cangpanah” (omong kosong tak berguna) di warung kopi permainan dadu, kartu, batu dan sejenisnya.

Waspada/Rudi Arman

KASAT Reskrim Polresta Medan Kompol Yoris Marzuki didampingi Kanit Judi Sila AKP Edi Safari memberikan keterangan kepada wartawan soal penggerebekan lokasi judi sabung ayam di Polresta Medan, Minggu (18/3).

Oknum Aparat Diamuk Massa LUBUKPAKAM (Waspada): Seorang oknum aparat diamuk massa, Minggu (18/3) sore, diduga karena oknum tersebut memukuli seorang sopir bus Sentosa Transport, Riston Sinaga, 33, warga Medan Amplas. Sumber dihimpun Waspada, sore itu bus penumpang BK 7720 DO, dikemudikan Riston Sinaga, berupaya mendahului bus milik kesatuan oknum tersebut yang tengah membawa rombongan keluarga. Merasa tidak senang, beberapa oknum turun dari bus, lalu menghampiri sopir bus Sentosa yang kebetulan berhenti di lampu merah Simpang Timbangan Galang-Lubukpakam. Saat itu, terjadi aksi tegang leher, beberapa oknum yang emosi spontan memukul Sinaga, hingga babak belur di bagian wajah. Kernet Sentosa, Hasiholan Simanjuntak juga tak luput

dari pukulan sang oknum. Massa yang kebetulan ramai melihat peristiwa itu, menunjukkan sikap tidak senang dan langsung menyerang oknumoknum tersebut, sehingga mereka berupaya menyelamatkan diri ke dapur warung bakso tak jauh dari lokasi kejadian. Namun, emosi massa tak bisa ditahan dan melempari dengan botol pintu dapur warung bakso tempat oknum tersebut bersembunyi. Bahkan, sebagian massa melempari bus yang ditumpangi oknum tersebut dengan benda keras hingga kaca belakangnya pecah. Saat itu, seorang di antara oknum tersebut tidak sempat menyelamatkan diri, dan menjadi pelampiasan amuk massa. Personil Sub Denpom I/13 Lubukpakam, yang tiba di rumah makan Iga-Iga, sigap menyelamatkan oknum tersebut,

dan mengevakuasinya kemarkas Sub Denpom I/1-3 Lubukpakam. Komandan Sub Denpom I/ 1-3 Lubukpakam Kapten, CPM Rifky Nurachman, SH, Minggu malam, mengatakan, akan menyerahkan permasalahan ini ke atasannya.(a07)

Irwandi Desak ...

Terlebih cara polisi melakukan penangkapan terhadap para pelaku yang disebutkan Kepala Divisi Sipil dan Politik, Mardiati dari LBH Banda Aceh sebagai cara-cara brutal dan tidak manusiawi. Hal tersebut terjadi saat polisi bertindak menangkap Dugok cs Sabtu (10/3), tanpa mengedepankan azas praduga tidak bersalah. “Kalaupun Dugok cs ditangkap karena diduga sebagai pelaku penembakan di PT Satya Agung, tetapi penangkapan tidak boleh dilakukan dengan cara melanggar hukum,” papar Mardiati dalam pernyataan tertulisnya. Pejabat Polda Aceh mengungkapkan Polri saat ini masih memburu sejumlah pelaku teror, setelah sebelumnya Densus 88 menangkap kelompok Dugok cs yang membunuh pekerja kabel optik Telkom asal Jember dan Banyuwangi, Jawa Timur di Kec. Jeumpa, Kab. Bireuen serta penangkapan kelompok Si Mayor cs yang membunuh Saiful Cagee, 22 Juli 2011. Mabes Polri saat ini masih terus melakukan pengemba-

ngan setelah beberapa kader PA ditangkap karena terlibat pembunuhan pekerja PT Satya Agung di Aceh Utara Minggu (5/12/2011). Polda Aceh telah mengumumkan 6 pelaku yang terlibat dan beberapa nama lain masih disimpan karena polisi harus melakukan pengembangan kasus-kasus kekerasan di Aceh. (b08)

Rumah Alquran ini merupakan tekad bersama pengurus untuk memberikan pendidikan Alquran bagi lingkungan sekitar.Walau tidak mengandalkan uluran tangan dan hanya mengandalkan infak dan doa serta semangat, akhirnya dapat berdiri juga. ”Apalagi dalam status kepemilikannya, kita berjuang saat itu untuk membeli lahan ini dan alhamdulillah sang pemilik lahan mengabulkan dan pembanyarannya dapat juga dengan mencicil. Ini berkat doa kita bersama,” ujarnya. (m28)

seringnya terjadi tindakan kriminal seperti perjudian, pencurian, perkelahian, juga kerusuhan di tengah masyarakat. Tetapi, pemilik warung melakukan perlawanan. Di tengah situasi keributan, puluhan pemuda muncul dari arah Jl. Denai dengan membawa senjata tajam dan balok menuju lokasi yang tengah memanas. Dari arah berlawan sejumlah pemuda juga berlari menuju TKP sehingga terjadi perang antar dua kelompok. Akibatnya, dua warga Nazar, 19, dan Jimmy terluka di bagian kepala dan kondisinya kritis akibat terkena sabetan senjata tajam dan kini dirawat di Puskesmas Desa Ba-

ganasahan Pekan. Menurut seorang ibu yang turut berunjukrasa ke warung tuak, M boru Siregar, 41, mereka sudah tidak tahan karena segala kejahatan muncul di Baganasahan. Hal itu terjadi, akibat maraknya peredaran narkoba, minuman keras sehingga muncul kejahatan lainnya. Hal itu telah barlangsung sejak empat hari terakhir. Seorang warga Ongah, 30, juga terkena bacokan. Diduga peristiwa itu buntut dari kerusuhan sehari sebelumnya. Sampai berita ini dikirimkan pukul 22:00, situasi di Desa Baganasahan masih mencekam.Wargaberjaga-jagadi rumahnya masing-masing. (a32)

dalam menuntaskan kasus teror dan kriminalitas bernuansa politik di Aceh. “Saya menilai Polda Aceh memiliki beban psikologis memposisikan dalam penuntasan kasus-kasus bernuansa politik,” kata Arios Nivada, Minggu (18/3). Desakan agar kepolisian mengungkap ke publik karena aksi-aksi Densus 88 di Aceh dengan aksi penangkapan dan penggerebekan, membingungkan publik di Aceh, seperti dua peristiwa penggerebekan di Banda Aceh, pada Jumat (17/3) di kediaman Wali Nanggroe Jl. Pemancar dan Sabtu (18/3) malam di kediaman Mentro Malek. Di dua tempat tersebut polisi menyita sejumlah pucuk senjata api dan amunisi, namun tidak terlihat ada penangkapan. Rentetan kejadian yang disaksikan warga di dua tempat tersebut tidak juga diumumkan ke publik oleh pejabat Polri di Aceh. Perburuan para pelaku penembakan warga Jawa di wilayah sakral milik Partai Aceh itu telah membuat publik resah.

Baganasahan Rusuh, ... Informasi dihimpun Waspada, kejadian berawal saat ratusan kaum ibu dan anakanak turun ke jalan Pelabuhan Panton persisnya di dekat pengutipan retribusi PT Pelindo I Cabang Tanjungbalai. Mereka bermaksud mendatangi sejumlah warung tuak dan meminta agar pemilik menutup warungnya, karena keberadaan warung tersebut sangat menganggu. Mereka juga meresahkan maraknya peredaran narkoba seperti sabu, ganja di warungwarung. Sehingga banyak anakanak dan remaja yang telah terkontaminasi berakibat pada

Waspada/Hotma Darwis Pasaribu

Sopir Bus Sentosa, Riston Sinaga, babak belur.

Plt Gubsu Resmikan ...

Berita Utama

A2 Polling Pilkada Aceh

Hasil polling ini dihitung berdasarkan suara pembaca Waspada yang dikirim dalam bentuk kupon yang telah disediakan (lihat halaman Pilkada Aceh). Metode polling yang digunakan tidak untuk mewakili keseluruhan suara pemilih dalam Pilkada Aceh, tapi hanya untuk mencari tahu suara pembaca Waspada terhadap kandidat yang muncul dalam Pilkada Gubernur Aceh maupun pemilihan bupati/wali kota yang ada di Aceh. Redaksi membuka peluang sebesar-besarnya kepada para pembaca Waspada untuk mengisi kupon polling berhadiah ini.(red)


Pukul 18:00 dia kembali ke masjid untuk menunaikan shalat Maghrib dan Isya berjamaah. Antara Maghrib dan Isya ia menyimak halaqah (ceramah agama) yang disampaikan para ulama. Ba’da shalat Isya berjamaah, ia pulang ke rumah. Antara Isya dan tengah malam, banyak hal yang bermanfaat ia lakukan, antara lain; mendalami ilmu pengetahuan dengan membaca kitab-kitab dan buku-buku agama. Kadang-kadang diisi dengan lain hal, misalnya nonton televisi, mengajar anak-anak, kadangkadang menulis tulisan ilmiah popular untuk surat kabar. Tentu dalam celah-celah waktu yang bermanfaat itu telah juga terisi dengan cinta kasih kepada keluarganya. Dalam kamus orang-orang yang disiplin, tidak ada waktu yang sia-sia. Waktu selalu bermanfaat baginya. Tidak ada istilah nganggur, lalu menghabiskan waktu pada perbuatan-perbuatan lara seperti “cangpanah” (omong kosong tak berguna) di warung kopi permainan dadu, kartu, batu dan sejenisnya.


Tim SAR juga masih terus berupaya mengevakuasi dua korban lainnya yang merupakan penumpang helikopter yakni Adrianus Amba Sangka dan Iyan Timisela. Kedua korban itu karyawan PT Pangan Sari Utama. Helikopter dengan kode penerbangan PK-ODA yang jatuh Sabtu (17/3), ditemukan di sekitar area terowongan 70 atau di sebelah kiri terowongan dari arah Tembagapura menuju Ridge Camp. Helikopter milik Airfast yang digunakan PT Freeport dengan pilot Sri Rama Krisna, warga negara Selandia Baru itu mengalami kecelakaan saat kembali dari Awanagon menuju Tembagapura. Sebelum mengalami kecelakaan yang diduga akibat cuaca buruk, pilot helikopter itu sempat mengontak pihak helipad 66 Tembagapura untuk meminta izin mendarat darurat. Namun kemudian hilang kontak.


Truk pengangkut barang bukti sempat tiga kali bocor ban terkena ranjau paku yang diduga sengaja ditebar pihak ‘pemain kayu’. Alhasil, proses evakuasi barang bukti menjadi lambat dan barang sitaan baru tiba di Kantor Dishutbun Aceh Timur di Langsa, Minggu (18/3) dinihari. Kadishutbun Aceh Timur Saifuddin MP menjelaskan, kayu jenis cengai dan Seumantok itu diamankan berkat informasi masyarakat. “Identitas pemiliknya masih kita dalami. Yang jelas, ini kayu ile-


warga Desa Pucok Alue. Selanjutnya, dilaporkan aparat desa ke Polsek, dan diteruskan ke Polres serta tim Jibom Detasemen B Brimob Jeulikat. “Tanah timbun itu diangkut dengan truk dari kawasan tanggul Cot Paya, Baktiya Barat. Jadi bom itu dari sana,” kata Ipda Samsul Bahri. Panit Jibom Detasemen B Brimob Jeulikat Bripka Asep menambahkan, bom rakitan itu berdiameter 15 centimeter, panjang 30 centimeter dan berat sekitar 40 kilogram. “Bom ini masih aktif, termasuk jenis low explosive atau berdaya ledak rendah,” katanya. (b19)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1, ......, Bxf2+. 2. Rg1, Bg2+. 3. Rh1, Bh2+ (Jika 3. Rf1, Me2+mat). 4. Rg1, Mg2+mat atau Bh1+mat.

Jawaban TTS: TTS Topik







Jawaban Sudoku:

7 8 9 5 4 2 6 1 3

3 4 6 8 1 7 2 9 5

5 1 2 9 6 3 4 7 8

9 5 1 4 7 6 3 8 2

8 6 7 2 3 5 1 4 9

2 3 4 1 9 8 5 6 7

4 9 5 3 8 1 7 2 6

6 2 8 7 5 4 9 3 1

1 7 3 6 2 9 8 5 4

gal yang diduga kuat ditebang dalam kawasan hutan lindung,” katanya. Saifuddin menambahkan, proses penyitaan kayu tersebut melibatkan 20 personel Polhut dari Unit 3 Julok. Pasukan penjaga hutan tersebut sempat kewalahan membawa barang bukti ke Langsa karena ban truk sempat tiga kali bocor terkena ranjau paku di seputaran KM 8 Indra Makmu. “Ranjau paku itu sulit kita deteksi karena disembunyikan atau ditanam dalam kubangan jalan. Perjalanan dari lokasi temuan kayu ke Alue Mirah yang normalnya memakan waktu satu jam, molor hingga 5 jam lebih, karena waktu tersita untuk mengganti ban bocor,” imbuh Saifuddin. (b19)

Perkuat... “Sebagai seorang yang pernah mendapat pendidikan Nahdlatul Ulama (PGA 4 tahun) saya merindukan peran tradisi NU terus dikembangkan,” kata Ritonga. Pakar ekonomi dari USU ini menyebutkan cukup beralasan dia merindukan peran tradisi NU karena pernah menimba ilmu dari sekolah yang sudah tidak ada lagi seiring kebijakan pemerintah menutup semua PGA waktu itu. Untuk itu peran tradisi NU yang sejuk dan toleran dalam menyebarkan dan memperkuat Islam di tengah masyarakat semakin dibutuhkan bangsa Indonesia sekarang dan ke depan. Ritonga berharap Konferwil NU Sumut ini dapat mengukuhkan tradisi NU yang kuat. Pemberdayaan masyarakat dengan tradisi NU yang dulu bersifat holistik syariat Islam, budaya dan sosial , ekonomi yang ada saat ini semakin dibutuhkan. Posisi ulama, lanjutnya, agar diperkukuh lagi untuk membimbing umat. Begitu

Pj Gub... wajib memberikan informasi kepada wartawan untuk diketahui oleh masyarakat. “Bila aparatur kita di Aceh memberikan informasi dengan baik kepada wartawan maka hal itu akan disampaikan secara hitam di atas putih artinya wartawan akan menyampaikan secara fakta/ kenyataan,”tambah Tarmizi. Ia mengharapkan kepada wartawan bisa menjaga profesional kerja. Terkadang dalam suatu keadaan ada wartawan yang nakal ketika wawancara A ditulis B, ujar Tarmizi seraya mengucapkan percaya Waspada tidak seperti itu. Pj Guberur Aceh juga mengimbau kepada aparatur di daerah jangan ada yang memanfaatkan wartawan, ia mencontohkan terkadang bila hendak diwawancara oleh wartawan si pejabat langsung menyodorkan sesuatu kepada wartawan dan ini merupakan salah satu upaya membungkam informasi kepada publik.

WASPADA Senin 19 Maret 2012

Konvoi Calon Gubernur Diserang Massa S U L AW E S I S E L ATA N (Waspada): Mobil rombongan kandidat calon gubernur dari Partai Demokrat Ilham Arief Sirajuddin (IAS) dihadang ratusan orang di Kab. Gowa, Sulawesi Selatan. Penghadangan iring-iringan mobil rombongan IAS terjadi di Jl.Tamallaing, Kec. Bontonompo. Akibatnya, salah satu kaca mobil Alphard rombongan dengan plat DD 224 MB, pecah di bagian belakang setelah dilempar batu, kursi dan kayu. “Massa tiba-tiba masuk ke jalan raya dan berusaha menghadang iring-iringan mobil. Mereka melempar dan memaksa membuka pintu,” kata

juru bicara Partai Demokrat Sulsel, Syamsu Rizal, Minggu (18/3). Syamsu menambahkan, penghadangan terjadi usai IAS dan rombongan menghadiri silaturrahmi dan menyerahkan bantuan kepada warga setempat. Saat itu, rombongan sedang menuju tempat pelaksanaan panen raya padi atas undangan warga Desa Kaccikacci, Bontonompo. Tapi karena penghadangan tersebut, rombongan IAS langsung balik ke Makassar. IAS sendiri berhasil lolos, tidak ditemukan oleh massa yang menghadangnya. Pasalnya, IAS berada di mobil urutan ke-

empat, sementara mobil yang dirusak warga adalah mobil kedua setelah mobil patroli. Usai kejadian, rombongan langsung melapor ke Kantor Polres Gowa. Mereka membawa barang bukti sejumlah kayu, batu serta pecahan kaca mobil. Kapolres Gowa Ajun Komisaris Besar Totok Lisdiarto berjanji akan menindaklanjuti laporan tersebut. Ia menegaskan, akan segera mencari, menangkap dan memproses para pelaku sesuai aturan sebenarnya. “Kami masih melakukan pemeriksaan saksi-saksi untuk mengungkap kasus ini,” kata AKBP Lisdiarto. (vn)

Polresta Barelang Kirim Dua Senpi KPK Palsu BATAM (Antara): Polres Kota Batam Rempang Galang (Polresta Barelang) akan mengirimkan dua senjata api (Senpi) yang diamankan bersama JI, seorang diduga otak pemerasan mengatasnamakan dan memalsu identitas petugas Komisi Pemberantasan Korupsi (KPK), ke Polda Metro Jaya untuk penyelidikan lebih lanjut. “Senpi, 22 proyektil, dan berkas-berkas lain yang diamankan bersama JI akan kami limpahkan ke Jakarta, Senin, karena senjata tersebut diamankan dari penangkapan JI di Jakarta,” kata Kapolresta Barelang, Kombes Pol Karyoto, di Batam, Minggu (18/3). Salah satu dari dua senpi yang diamankan tersebut identik dengan senjata revolver standar kepolisian. “Nantinya akan dicek keasliannya oleh Polda Metro Jaya, untuk mempermudah penelusuran asal senjata itu” katanya. Menurut dia, jika nanti

ada temuan lain oleh Polda Metro Jaya yang bisa mengungkap kepemilikan dua senpi tersebut akan mempermudah pengungkapan jaringan JI yang mengatasnamakan KPK saat melakukan pemerasan. “Saat ini kami masih terus melakukan pemeriksaan pada JI, laptop dan bukti-bukti surat elektronik juga masih kami periksa,” katanya. Sebelumnya, Satuan Reserse Kriminal Polresta Barelang dan Polda Metro Jaya menangkap JI, anggota Komisi Pemberantasan Korupsi gadungan di Jakarta Selatan yang diduga otak pemerasan terhadap Bupati Karimun Nurdin Basirun, Rabu (14/3) sekitar pukul 22.00 WIB. “Selain menjadi otak penipuan terhadap Bupati Karimun, JI juga aktor intelektualis kejahatan serupa di beberapa daerah,” kata Kanit IV Jatanras Polresta Barelang, Iptu Chrisman Panjaitan. Ia mengatakan, tersangka

pelaku dan jaringannya memang menjadikan daerahdaerah baru dan berada di pinggiran sebagai target operasi mereka. Chrisman mengatakan, selain menangkap JI, polisi juga mengamankan satu senjata revolver dan satu senjata jenis FN, stempel KPK palsu, alat cetak (printer), laptop, tujuh tanda pengenal KPK, dua tanda pengenal ajudan Ketua DPR, dan beberapa kartu pengenal lain yang semuanya palsu. “Pistol revolvernya memang organik, tetapi nomor serinya sudah dihilangkan. Senjata api ini akan kami selidiki,” kata Chrisman. Chrisman mengatakan, masih terus melakukan koordinasi dengan KPK untuk mengungkap jaringan JI. “Kami terus telusuri, tidak menutup kemungkinan ada pihak-pihak di Jakarta yang terlibat,” katanya menambahkan.

Pemerintah Berlebihan Sikapi Demo BBM J A K A RTA ( Wa s p a d a ) : Ketua Bidang Organisasi DPP Hanura, Jafar Badjeber menilai aksi demontrasi masyarakat terhadap rencana kenaikan harga bahan bakar minyak (BBM) bersubsidi seharusnya tidak perlu ditanggapi pemerintah dengan reaksi berlebihan. Apalagi jika sampai memunculkan kekhawatiran. “Harga BBM naik, rakyat berunjuk rasa itu hal yang

wajar,” kata Jafar dalam sambutannya pada pelantikan Badan Pemenangan Pemilu (Bappilu) Partai Hanura Seluruh Bali di Kabupaten Bandung, Bali, Sabtu (17/3). Jafar mengatakan, pemerintah seharusnya menyadari bahwa keputusannya menaikkan harga BBM akan mendapat reaksi negatif dari masyarakat. Kebijakan itu dipastikan akan menambah

beban kehidupan warga yang semakin berat.

juga peran penggiat ekonomi dan kemasyarakatan yang lebih aktif harus dipertahankan sehingga gerakan kemasyarakatan dan dakwahnya berjalan harmonis dan menumbuhkan ketakwaan yang kolektif . Ritonga mengharapkan ke depan ulama dan pengusaha plus akademisi NU beserta keluarga besarnya memikirkan lembaga pendidikan NU. Mutlak dilakukan Hasan Bakti Nasution mengatakan mempertahankan tradisi NU mutlak dilakukan dan tetap dinanti masyarakat Sumut dan bangsa ini. Untuk itu Konferwil harus dapat melahirkan pemimpin yang terbaik dan memiliki komitmen akademis dan organisasipengabdian. Pemimpin yang memiliki komitmen akademis diharapkan mampu mengembangkan dakwah dan lembaga pendidikan NU. Sedangkan komitmen pengabdian untuk melakukan pengembangan organisasi dan pembinaan anggota NU. Menurut Hasan Bakti, fenomena saat ini banyak

Ormas yang bernuansa politik, di mana cenderung mengabaikan pendidikan dan dakwah. Sebenarnya, nuansa politik dalam Ormas Islam bolehboleh saja tetapi jangan mengabaikan fungsi pendidikan dan dakwah. Ini penting sebab umat Islam saat ini menghadapi tantangan yang kompleks. Dengan demikian perlu pembinaan anggota dan organisasi Ormas sehingga Islam dapat bertahan dengan tantangan yang dihadapi. Jika Ormas Islam seperti NU ini kuat maka umat Islam akan kuat pula. Tidak terkontaminasi politik Kepemimpinan NU Sumut saat ini, menurut guru besar IAIN Sumut ini, cukup baik tidak terkontaminasi politik dan tetap pada jati dirinya sehingga peran tradisi NU dapat berkembang dan dirasakan masyarakat Sumut. Memang ke depan pimpinan NU harus lebih intensif membina anggota yang jumlahnya tidak sedikit. Komitmen kepemimpinan akademis dan organisasi-pengabdian, lanjut Hasan Bakti, NU harus memberi penguatan

internal. Dengan demikian, eksistensi NU khusus di Sumatera Utara terus memberikan kontribusi dalam mewujudkan kerukunan umat beragama di Sumut dan Indonesia umumnya. Meski NU menjalankan tradisi “paham tua” tetapi NU terus mencari konsep yang lebih baik bahkan mengembangkan semangat modernis yang tetap berpegang pada nilai-nilai Islam. Islam moderat yang dikembangkan NU turut mengembangkan Islam di Sumut. “Dan itu saya rasakan.” Menurut Hasan Bakti, Islam modernis yang dikembangkan NU di Sumatera Utara telah menyemaikan kerukunan umat bergama di daerah ini. Untuk itu, Konferwil harus mengukuhkan kembali kepemimpinan yang sudah ada yang secara formal sudah memadai dan mendorong tradisi NU yang modernis. Bagi periode kepemimpinan mendatang, Konferwil agar menjadikan isu ini sebagai bahan evaluasi diri dan organisasi sehingga peran tradisi NU tetap berkembang. (m13)

“Saya berharap kepada aparatur jangan lagi ada halhal yang demikian, mulailah menciptakan kondisi yang transparan kepada wartawan agar nantinya berdampak kepada kesuksesan pembangunan di Aceh,”demikian Penjabat Gubernur Aceh. Soal Pilkada Damai Pilkada di Aceh telah menunjukkan demokrasi dalam bidang politik. Dan di Aceh yang pertama melaksanakan itu, meski sempat terjadi perbedaan pendapat terhadap tafsiran Undang-undang Pemerintahan Aceh ( UUPA), namun hal itu bukan sebuah hambatan untuk melaksanakan demokrasi. Tarmizi menyebutkan, Pilkada di Aceh semua pihak dapat mengikuti ajang pemilihan kepala daerah, baik yang tergabung dalam pencalonan perseorangan (independenred) maupun calon yang diusung oleh partai politik nasional dan lokal. Ditanya terkait panjangnya interval waktu pra pilkada

hingga penentuan jadwal pilkada pada 9 April mendatang, Tarmizi menguraikan, jika pemerintah ingin benar-benar mengakomodir semua pendapat terkait perbedaan tafsir di UUPA.’’Ini penting, agar tidak ada lagi tuduhan jika pemerintah pusat mengabaikan UUPA,’’ terangnya. Disebutkannya, Pemerintah dalam hal ini Presiden Susilo Bambang Yudhoyono berpesan kepadanya melalui Mendagri Gamawan Fauzi saat pelantikan lalu agar menjaga netralitas pelaksanaan Pilkada Aceh.’’Ini merupakan penekanan yang terpenting dari pemerintah pusat sehingga keinginanmewujudkan pemilukada yang damai di Aceh terwujud,’’ terangnya. Tarmizi juga memaparkan tentang banyaknya peserta pilkada seperti di Aceh Barat yang sampai 14 pasang merupakan wujud dari demokrasi namun tidak mengabaikan aturan dan peraturan yang berlaku. Pemerintah juga katanya, mengingatkan aparatnya di pemerintahan provinsi,

kabupaten/kota, kecamatan hingga desa untuk tidak berpihak kepada salah satu calon.’’Jika terbukti, sanksi berat akan diturunkan oleh pemerintah dan itu pasti bukan sekedar gertakan. Ini dilakukan agar wacana pilkada damai memang benar-benar terlaksana di pilkada Aceh nantinya,’’urai mantan Bupati Aceh Utara itu. Dengan demikian semua pihak harus bisa menjadikan pilkada Aceh sebagai momentum politik edukasi, dalam hal itu para calon harus bisa memberi ruang kepada rakyat Aceh untuk memilih pilihannya sesuai hati nurani. Ia juga mengingatkan jangan ada intimidasi dan teror. ‘’Karena bagaimanapun juga rakyat sudah semakin cerdas dalam memilih calonnya,’’ demikian Tarmizi A Karim. Dia juga mengharapkan calon yang kalah mau mengakui kekalahannya dan mendukung serta bekerjasama dengan calon yang menang agar pembangunan di Aceh dapat berlanjut. (cb01)

Kondisi itu semakin diperparah dengan kebijakan batas minimal uang muka kredit kendaraan bermotor yang dikeluarkan Bank Indonesia dan Kementerian Keuangan. “(Selama ini) sepeda motor tersebut digunakan untuk bekerja menghidupi keluarganya,” kata dia. (vn)


WARGA memperhatikan mobil timses pasangan Cabup/Cawabup Aceh Timur, Muslim Hasballah—Marwi Umar di Desa Bintah, Madat, Minggu (18/3).

Lagi... mobil itu terbakar, Rusli dan Ek Beusoe Cs juga sempat menerima sms ancaman bunuh karena mereka mendukung Irwandi dan Muslim. Kapolres Aceh Timur AKBP

Polri... Pemancar dan Sabtu (18/3) malam di kediaman Mentro Malek. Di dua tempat tersebut polisi menyita sejumlah pucuk senjata api dan amunisi, namun tidak terlihat ada penangkapan. Rentetan kejadian yang disaksikan warga di dua tempat tersebut tidak juga diumumkan ke publik oleh pejabat Polri di Aceh. Perburuan para pelaku penembakan warga Jawa di wilayah sakral milik Partai Aceh itu telah membuat publik resah. Terlebih cara polisi melakukan penangkapan terhadap para pelaku yang disebutkan Kepala Divisi Sipil dan Politik, Mardiati dari LBH Banda Aceh sebagai cara-cara brutal dan tidak manusiawi. Hal tersebut terjadi saat

Ada-ada Saja... yang digunakan untuk satu hektare ladang,” kata sang desainer asal Belanda, Joost Bakker. “Saya telah merancang

Golkar... “Golkar berada di urutan pertama dari sebelumnya di nomor dua. Momentum politiknya ada,” kata Indra. Indra mengatakan, alasan percepatan pengumuman Capres dari Partai Golkar juga didasarkan pertimbangan upaya konsolidasi di tubuh partai yang dipimpin Aburizal Bakrie itu. Terlebih lagi, suara kader dan pengurus partai saat ini sudah mengerucut pada satu nama. “Seluruh kader meng-

Polres... 1.000 liter dengan jumlah 11.000 liter , 7 drum plastik masing berisi sekitar 180 liter dengan jumlah 1.256 liter, 2 jerigen plastik masing-masing berisi sekitar 35 liter dengan jumlah 70 liter dengan total BBM diduga oplosan sebanyak

Iwan Eka Putra melalui Kapolsek Madat Ipda Zainir mengatakan, kasus itu masih dalam proses penyelidikan. Catatan Waspada, mobil tersebut adalah mobil kedua milik Timses Muslim-Marwi yang dibakar dalam sepekan

terakhir. Kamis, 15 Maret 2012 dinihari, mobil Panther pickup milik Musnadi, 30, anggota Timses Muslim juga dibakar OTK saat diparkir di samping rumahnya, di Desa Beusa Seubrang, Peureulak Barat, Aceh Timur. (b19)

polisi bertindak menangkap Dugok cs Sabtu (10/3), tanpa mengedepankan azas praduga tidak bersalah. “Kalaupun Dugok Cs ditangkap karena diduga sebagai pelaku penembakan di PT Satya Agung, tetapi penangkapan tidak boleh dilakukan dengan cara melanggar hukum,” papar Mardiati dalam pernyataan tertulisnya. Pejabat Polda Aceh mengungkapkan Polri saat ini masih memburu sejumlah pelaku teror, setelah sebelumnya Densus 88 menangkap kelompok Dugok Cs yang membunuh pekerja kabel optik Telkom asal Jember dan Banyuwangi, Jawa Timur di Kec. Jeumpa, Kab. Bireun serta penangkapan kelompok Si Mayor cs yang membunuh Saiful Cagee, 22 Juli 2011. Mabes Polri saat ini masih

terus melakukan pengembangan setelah beberapa kader PA ditangkap karena terlibat pembunuhan pekerja PT Satya Agung di Aceh Utara Minggu (5/12/2011). Polda Aceh telah mengumumkan 6 pelaku yang terlibat dan beberapa nama lain masih disimpan karena polisi harus melakukan pengembangan kasus-kasus kekerasan di Aceh. Kapolri Timur Pradopo, Rabu (14/3), berjanji segera mengumumkan ke publik terkait penangkapan para kader Partai Aceh itu. Janji serupa juga disampaikan Kapolda Aceh Irjen Pol Iskandar Hasan melalui Humas Polda Aceh, Kombes Pol Gustav Leo yang menyebutkan akan membeberkan seluruhnya usai Pilkada. (b08)

restoran ini secara terbalik. Saya memulainya dengan bagian akhir terlebih dahulu, dengan menilai produksi limbah, dan bekerja dari sana.” “Saya selalu bermimpi untuk membangun sebuah

restoran yang tidak menghasilkan limbah dan sekarang akhirnya saya telah mencapai hal itu!”. Setiap bagian dari bangunan ini juga dibangun dengan materi yang 100% dapat didaur ulang.(y)

inginkan beliau. Belum lama ini Fraksi Golkar DPR menyatakan mendukung Ical dan mereka bergerak ke bawah menyatakan hal itu. Sebentar lagi juga seluruh Fraksi Golkar DPRD se-Indonesia. Sayap partai juga sudah menyatakan demikian. Untuk apalagi ditunda-tunda,” tegas dia. Bulan Oktober, saat Rapimnas digelar, menurut Indra, merupakan ruang untuk pengambilan keputusan dari Aburizal Bakrie. Kendati begitu, sambung Indra, elektabilitas Golkar harus berada

pada angka 22 persen. “Kenapa begitu, itu adalah angka psikologis Pemilu 2004 dan 2009. Jadi yang ingin dikatakan adalah kami sudah melewati masa itu dalam 10 tahun. 2013 kita ingin di atas 25 persen. 20 persen kursi 25 persen pemilih, itu syaratnya,” papar Indra. Saat ini, Indra melanjutkan, Golkar sudah memenuhi syarat 20 persen kursi di DPR RI. “Sekarang kalau kita ambil angka 17,7 persen, maka 20 persen kursi sudah terpenuhi. Bang Ical ini orangnya logis,” kata dia.

13.326 liter. Turut disita alat pengoplos yaitu 2 unit mesin pompa merk robin, 4 ember plastik diduga alat mencapur minyak, peralatan pendukung lainnya 16 fiber plastik segi empat kosong, 16 drum kosong, 16, drum plastik kosong dan 40 jerigen kosong. Sedangkan penghuni ru-

mah kabur. Pihak kepolisian masih melakukan penyelidikan atas identitas pemilik rumah. Kapolres Tapteng AKBP Patrianegara di lokasi kepada wartawan, Minggu (18/3) mengatakan, pihaknya sedang melakukan penyelidikan terhadappemilik rumah inisial HD yang melarikan diri. (a24)

WASPADA Senin 19 Maret 2012

Medan Metropolitan A3 Polsek Sunggal Amankan 25 Remaja Perburuan Anggota Geng Kereta Berlanjut MEDAN (Waspada): Pasca penyerangan yang dilakukan anggota geng kereta Skandal Kota Medan (SKM) terhadap warga di Jln. Kaswari, pekan lalu, hingga kini Polsek Sunggal terus memburu para pelakunya.

Waspada/Ismanto Ismail

KAPOLSEK Sunggal Kompol M Budi Hendrawan, SH, SIK (kiri) sedang menginterogasi 25 remaja yang diamankan karena diduga terlibat sebagai anggota geng kereta, Minggu (18/3) dinihari pukul 03:40.

Pantauan Waspada di lapangan mulai Sabtu (17/3) pukul 22:00 hingga Minggu (18/3) subuh pukul 05:00, Kapolsek Sunggal Kompol M. Budi Hendrawan, SH, SIK mengerahkan sebagian besar personelnya untuk memburu seluruh anggota geng kereta yang meresahkan masyarakat. Tim khusus Polsek Sunggal dipimpin Kanit Reskrim AKP Victor Ziliwu, SH, SIK ditugaskan memburu para anggota geng kereta SKM dan lainnya ke sejumlah lokasi yang diduga sebagai tempat mangkal mereka. Kemudian, Waka Polsek Sunggal AKP SupriyadiYTO, SH; Kanit Sabhara AKP P. Bangun, SH dan Kanit Binmas AKP R. Samosir bersama personelnya menggelar razia di sejumlah lokasi termasuk Jln. Kaswari dan melakukan patroli di wilayah hukum polsek tersebut.

Hasilnya, sekitar 25 remaja yang diduga sebagai anggota geng kereta dan pelaku balapan liar diamankan dari kawasan Jln. Ringroad, Jln. Setiabudi, Jln. Sunggal, Jln. Sei Batanghari, Jln. Amal serta Jln. Sei Serayu. Selain itu, Polsek Sunggal juga menyita 20 sepedamotor yang digunakan para remaja tersebut. Sementara itu, saat menggelar razia di Jln. Kaswari, Kelurahan Sei Sikambing B, Kecamatan Sunggal, personel Polsek Sunggal mengeluarkan 10 surat tilang terhadap pengendara sepedamotor yang tidak bisa memperlihatkan Surat Izin Mengemudi (SIM) dan Surat Tanda

Nomor Kendaraan (STNK). Kapolsek Sunggal Kompol M Budi Hendrawan, SH, SIK, didampingi Kanit Reskrim AKP Victor Ziliwu, SH, SIK yang ditemui Waspada di lapangan mengatakan, pihaknya terus memburu para anggota geng kereta dan meningkatkan razia terhadap kendaraan bermotor. Menurut Budi, aksi para anggota geng kereta yang kerap melakukan penyerangan terhadap warga dan pencurian sepedamotor, telah menimbulkan gangguan keamanan dan ketertiban masyarakat (kamtibmas) di wilayah hukum Polsek Sunggal. Karenanya, polisi segera

mengambil tindakan tegas terhadap aksi kejahatan di jalanan tersebut. Budi juga mengimbau para orangtua agar ikut serta mengawasi segala aktivitas anakanaknya terutama yang berusia remaja agar tidak ikut terlibat sebagai anggota geng kereta. “Tahapan sosialisasi dan pembinaan sudah dilakukan ke sekolah-sekolah agar para remaja tidak terlibat sebagai anggota geng kereta yang melakukan aksi kejahatan di jalanan. Kini, polisi akan mengambil tindakan tegas guna menekan angka kriminalitas,� demikian Budi.(m36)

Medan Metropolitan Pemekaran Medan Utara Harga Mati A4

MEDAN (Waspada): Untuk mempercepat pembangunan di Medan Utara, maka pemekaran merupakan harga mati. Masyarakat di sana tidak menemukan jalan lain kecuali pemekaran. Janji Wali Kota Medan Rahudman Harahap, yang akan meningkatkan kesejahteraan masyarakat melalui berbagai program pembangunan, juga tidak terwujud. Pengurus Presidium Masyarakat Medan Utara (PMMU), Kamis (15/3), berdiskusi dengan pengurus Persatuan Wartawan Indonesia (PWI) Cabang Sumut, di Gedung PWI Sumut Jalan Adinegoro No.4 Medan. Hadir Ketua PWI Sumut Muhammad Syahrir, Sekretaris Edward Thahir,Wakil Ketua Bidang Kesejahteraan Zulkifli Harahap, Sekretaris Dewan Kehormatan Daerah (DKD) Hendra DS, dan Wa-

kil Sekretaris Zul Anwar Marbun. Sedangkan PMMU dihadiri Ketua Saharuddin beserta unsur fungsionaris di antaranya Zahir Syah, Ahyar, Syamrin, dan Agus Leo. Dipaparkan Saharuddin, PMMU yang terbentuk 31 Agustus 2006 meletakkan dua pondasi gerakan. Pertama, mendorong percepatan pembangunan Medan Utara. Kedua, mewujudkan pembentukan Pemko Medan Utarasesuai Peraturan Pemerintah (PP) No.78 Tahun 2007. “Kedua pondasi gerakan itu bukan opsi, tetapi merupakan hak dan kewajiban pemerintah dan masyarakat untuk bersinergi agar kawasan Medan Utara, yang terdiri dari Kecamatan Medan Belawan, Medan Labuhan, Medan Marelan dan Medan Deli, dapat tumbuh dan berkembang untuk kesejahteraan masyarakat,” katanya. Selama ini, kata Saharuddin, janji Wali Kota Medan, baik Abdillah maupun Rahudman untuk membangun daerah pinggiran berupa perbaikan infrastrukur, pendidikan, kesehatan

BLSM Tidak Mendidik MEDAN (Waspada): “Program Bantuan Langsung Sementara Masyarakat (BLSM) yang diberikan kepada masyarakat miskin terkait kenaikan harga BBM subsidi, terkesan tidak mendidik,” kata Anggota Komisi X DPR RI Hasrul Azwar, Minggu (18/3), usai membuka try out di Yayasan Pendidikan Islam Terpadu Khairul Imam Medan. Pasalnya, lanjut Hasrul, kompensasi untuk masyarakat itu diserahkan secara langsung sehingga terkesan Republik ini membagi-bagikan atau uang. Saat melakukan pertemuan denganWapres RI, Hasrul meminta agar bantuan atau kompensasi itu diarahkan kepada infrastruktur pedesaan, pendidikan, kesehatan dan transportasi massal. “Lihat seperti anak-anak didik kita di Banten, selalu berjuang melewati sungai ketika pergi sekolah. Lebih baik bantuan itu dimanfaatkan untuk membangun jembatan di sana atau daerahdaerah lainnya yang bernasib sama,” katanya sembari mengatakan, hampir seluruh sekretaris gabungan koalisi menginginkan bantuan itu tidak berbentuk BLSM. Jika pemerintah tetap menjalankan program ini, Hasril menilai ada kepentingan politik dibalik pemberian BLSM ini. (h02)

Syukuran HUT Ke-66 Marinir BELAWAN (Waspada): Sejak lahir, manusia telah mendapat rezeki dari Allah SWT. Namun, banyak manusia yang tidak bersyukur sehingga dalam masa hidupnya selalu merasa tidak berkecukupan dan gelisah. Islam sangat menganjurkan umatnya agar selalu bersykur atas segala rezeki yang diberikan Allah SWT. “Manusia harus bersyukur jika ingin hidup tenang,” kata Al Ustadz Ilham Maulana dalam berceramahnya pada acara syukuran Hari Ulang Tahun (HUT) ke-66 Marinir di gedung Serba Guna Suhermanto Mako Yonmarhanlan I Belawan, Jumat (16/3) malam. Acara syukuran berlangsung sederhana, diawali dengan pembacaan surat Yasin, ceramah agama, doa bersama dan penyerahan bantuan kepada 15 anak yatim piatu dan warga kurang mampu serta diakhiri dengan makan bersama. Turut hadir Komandan Yonif Marinir Pertahanan Lantamal I (Danyonmarhanlan I) Belawan Mayor (Mar) Agung Setiawan beserta staf dan keluarga besar Marinir Belawan serta puluhan warga sekitar. Danyonmarhanlan I Belawan Mayor (Mar) Agung Setiawan mengatakan, guna menyemarakkan HUT ke-66 Marinir, pihaknya melaksanakan serangkaian kegiatan bakti sosial seperti pemasangan kaki dan tangan palsu untuk 40 warga Belawan, donor darah serta penyerahan kacamata baca. “Syukuran ini merupakan puncak kegiatannya,” kata mantan perwira Paspampres tersebut.(h03)

Waspada/ Rustam Effendi

DANYONMARHANLAN I Belawan Mayor (Mar) Agung Setiawan (kanan) menyerahkan bantuan secara simbolis kepada warga pada acara syrukuran HUT ke-66 Marinir di gedung Serba Guna Suhermanto MakoYonmarhanlan I Belawan, Jumat (16/3) malam.

dan sektor kelautan belum menunjukkan realisasi yang diharapkan. Begitu juga dengan konsep dasar untuk mempercepat pembangunan Medan Utara masih kabur. Bahkan, janji Wali kota Medan Rahudman akan membangun Sekolah Menengah Kejuruan (SMK) terpadu, memajukan minapolitan sebagai ikon, kawasan ekonomi khusus (KEK), pembangunan Islamic Center, wisata bahari Danau Siombak, dan Kampung Nelayan, masih sebatas janji. Malah, kawasan wisata mangrove di Sicanang yang sudah dicanangkan pembangunannya pada 27 Januari 2012 lalu, kini terbengkalai. Sangat layak Terkait pemekaran Medan Utara, Saharuddin melihat sudah sangat layak. Tidak hanya melihat dari sisi potensi, tapi juga dari jumlah penduduk dan luas area. Dibanding Kota Sibolga, Pematang Siantar, Tanjung Balai, Tebing Tinggi, Binjai dan Padang Sidimpuan, kawasan Medan Utara berkali lipat jauh lebih unggul dengan jumlah penduduk 436.851 jiwa dan luas

wilayah 107,28 kilometer per segi. Untuk mempersiapkan pemekaran, kata Saharuddin, pihaknya telah mendeklarasikan Tim Pemrakarsa Pemekaran Medan Utara pada 8 Januari 2011, di Belawan. Tim Pemrakarsa menargetkan pemekaran Medan Utara akan selesai pada 2014. Tim terdiri atas berbagai elemen masyarakat dari empat kecamatan di Medan Utara. Dukungan atas usulan pemekaran sudah direspon Ketua Tim Kerja III Komite I Dewan Perwakilan Daerah (DPD) RI Kamaruddin, ketika Tim Pemrakarsa Pemekaran Medan Utara berdelegasi ke Gedung DPDRI di Jakarta 15 Maret 2011 lalu. Hanya saja Kamaruddin meminta persyaratan administrasi, teknis dan fisik terlebih dahulu dipenuhi, baru kemudian Tim Kerja III Komite I DPD-RI turun ke lapangan. Selain itu, kata Saharuddin, Tim Pemrakarasa yang diketuai Ibeng Syafruddin telah melakukan penandatanganan kesepakatan (MoU) dengan Fakultas Ilmu Sosial dan Ilmu Politik (FISIP) Universitas Sumatera

Utara (USU) pada 7 Maret 2011 lalu. MoU dilakukan untuk melengkapi syarat akademis pemekaran sebuah wilayah. Menanggapi paparan Saharuddin, Ketua PWI Sumut Muhammad Syahrir menyambut positif. Dia berharap, perjuangan masyarakat Medan Utara, tetap semangat dan tidak kendur. Karena upaya mendorong dan meningkatkan kesejahteraan masyarakat merupakan tugas semua pihak, termasuk PWI. Karena itu, PWI secara kelembagaan maupun secara personel akan menyuarakan perjuangan masyarakat Medan Utara. Syahrir mengajak Presidium Masyarakat Medan Utara serta pihak-pihak lainnya untuk bersinergi dengan PWI Sumut, dalam menyuarakan aspirasi sepanjang hal itu memang untuk tujuan kebaikan masyarakat, bangsa dan negara. “Kami berharap, perkembangan demi perkembangan perjuangan masyarakat Medan Utara terus dikomunikasikan. Dengan demikian, pengawalan PWI Sumut atas aspirasi masyarakat Medan Utara dapat dilakukan secara optimal,” katanya. (m08)


PENGURUS PWI Cabang Sumatera Utara dan Presidium Masyarakat Medan Utara saat berdiskusi dalam rangkaian silaturahmi di Gedung PWI Sumut Jalan Adinegoro Medan.

Masjid Diharapkan Jadi Pusat Pengembangan Zakat Produktif MEDAN (Waspada): Ketua Umum Masyarakat Ekonomi Syariah (MES) Sumatera Utara Gus Irawan Pasaribu mengharapkan masjid menjadi pusat pengembangan zakat produktif, dengan tujuan meningkatkan kesejahteraan umat melalui semangat kemandirian dan kewirausahaan. Hal itu dikatakan Gus Irawan yang juga sebagai Direktur Utama Bank Sumut seusai melakukan peletakan batu pertama pembangunan menara Masjid Al Ikhlas di Dusun III, Desa Pujimulio, Kec. Medan Sunggal, Kamis (14/3). “Masjid memilki fungsi strategis tidak hanya sebagai tempat melaksanakan shalat, melainkan juga sebagai pusat peradaban Islam, terutama pusat pengembangan ekonomi Islam dan fungsi sosial-ekonomi lainnya sebagaimana pernah dicontohkan Rasulullah,” katanya. Menurut dia, tanpa mengabaikan zakat bersifat konsumtif, umat Islam di Indonesia perlu membangun kemandirian kaum dhuafa, khususnya para mustahiq (orang yang berhak menerima zakat) melalui semangat kewirausahaan dengan memberikan modal usaha yang bersumber dari zakat. “Khususnya zakat mal (harta) ataupun zakat profesi,” ujarnya. Di Indonesia yang mayoritas penduduknya Islam, sebut Gus, masih banyak warga hidupnya di bawah garis kemiskinan. “Zakat produktif merupakan solusi mengentaskan kemiskinan, karena zakat produktif inilah yang dapat mendorong keluarga prasejahtera untuk be-

rusaha mandiri agar keluar dari garis kemikskinan,” tuturnya. Sesuai data Badan Amil Zakat Nasional (Baznas), potensi zakat di Indonesia diperkirakan mencapai Rp217 triliun, tapi yang bisa terhimpun baru Rp1,5 triliun. “Masih rendahnya kesadaran masyarakat berzakat, disebabkan oleh masih banyaknya umat Islam yang belum memiliki kesadaran menunaikan kewajiban membayar zakat dan belum optimalnya sinergi antar lembaga amil zakat, sehingga perlu dilakukan akselarasi,” sebutnya. Zakat produktif, lanjut Gus, setidaknya dapat diawali dari penyaluran bantuan modal usaha untuk sektor usaha mikro. Hal itu sudah dipraktikkan Gus Irawan melalui Lembaga Amil Zakat (LAZ) Bank Sumut

sejak beberapa tahun lalu, yang sumber dananya berasal dari pemotongan 2,5 persen gaji karyawan muslim di Bank Sumut. Dari zakat produktif itu, sudah lebih 5.000 keluarga prasejahtera yang mendapat bantuan modal usaha mikro. Selain itu, secara pribadi Gus melaluiYayasan Murni Gus Irawan Foundation juga telah menyalurkan zakat produktif berupa dana modal usaha secara bergulir guna mengoptimalkan pemanfaatan dana zakat seluas-luasnya kepada para mustahiq. Pada acara peletakan batu pertama pembangunan menara Masjid Al Ikhlas itu, Gus Irawan juga menyalurkan bantuan dari LAZ Bank Sumut sebesar Rp5 juta dan bantuan dariYayasan Murni Gus Irawan Foundation sebesar Rp10 juta.(rel/m06)


GUS IRAWAN (kiri) menyerahkan bantuan pembangunan menara Masjid Al Ikhlas di Medan Sunggal.

WASPADA Senin 19 Maret 2012

Waspada/Mursal AI

PEMBINA YPIT Khairul Imam Hasrul Azwar saat meninjau pelaksanaan try out di aula yayasan tersebut, Minggu (18/3).

750 Siswa SMP Ikut Try Out Di YPIT Khairul Imam MEDAN (Waspada): Sebanyak 750 siswa SMP Negeri dan Swasta di wilayah Medan Medan Johor mengikuti try out yang dilaksanakan Yayasan Pendidikan Islam Terpadu (YPIT) Khairul Imam Jln. STM Medan, Minggu (18/3) pagi. Hadir pada pembukaan try out Ketua Pembina YPIT Khairul Imam Hasrul Azwar dan Kadis Pendidikan Medan H. M. Rajab Lubis. Ketua PembinaYPIT Khairul Imam Hasrul Azwar mengharapkan para siswa yang mengikuti try out agar menerapkan kejujuran. “Perlu kejujuran, jangan sekali-kali menyontek. Tidak perlu nilai 10 atau seratus kalau didapat dari hasil yang tidak jujur, karena hidup ini perlu jujur,” imbuhnya. Menurut Hasrul, di dunia pendidikan perlu menerapkan kejujuran dan kualitas. Karena itu, kejujuran harus ditanamkan kepada siswa sejak dini. “Kejujuran harus dimulai dari sekarang, agar anak-anak didik kita ini tidak menjadi koruptor,” jelas Hasrul yang juga anggota DPR RI.

Sementara itu, Kepala Dinas Pendidikan Medan Rajab Lubis mengatakan, try out merupakan upaya untuk meningkatkan kualitas dan kemampuan dalam menghadapi UN 2012 ini. “Try out mencoba kemampuan kita. Ini proses pembelajaran, bukan final,” katanya. Pemko Medan melalui Dinas Pendidikan Medan bertekad menyelenggarakan pencanangan dan ikrar UN Jujur dan Berprestasi dalam waktu dekat ini. “Kita dari elemen Dinas Pendidikan Medan akan mengkampanyekan UN secara jujur dan berprestasi. Dalam pencanangan tersebut kita hadirkan guru, pengawas, siswa maupun orangtua siswa agar mereka berikrar melaksanakan UN dengan jujur dan berprestasi,” katanya. Sedangkan Koordinator Try Out Burhanuddin Zuchri mengatakan, kegiatan ini dilaksanakan untuk mengetahui kemampuan siswa dalam menghadapi UN yang sudah diambang pintu. “Nanti yang juara pertama dalam try out ini mendapat fasilitas sekolah gratis di Khairul Imam,” katanya sembari mengatakan, tidak ada pengutipan biaya kepada siswa terkait try out ini. (h02)

Partai Gerindra Sumut Buka Pendaftaran Balon Gubsu MEDAN (Waspada): DPD Partai Gerakan Indonesia Raya (Gerindra) Sumut, resmi membuka pendaftaran kepada semua masyarakat untuk diusung menjadi bakal calon (balon) Gubernur Sumatera Utara (Gubsu) pada tahun 2013 mendatang. “Pembukaan pendaftaran ini dilakukan karena Partai Gerindra Sumut ingin mencari atau menyaring sosok calon Gubsu yang diinginkan masyarakat Sumut,” kata Ketua Panitia Kerja Seleksi Pemilihan Kepala Daerah Sumatera Utara 2013-2018 Partai Gerindra Sumut Ir Yantoni Purba MM, di Kantor Sekretariat DPD Gerindra Sumut Jalan Raya Menteng No. 239 Medan, Kamis (15/3) malam. Yantoni yang didampingi para anggota panitia seleksi pemilihan di antaranya Ir Astrayuda Bangun, Drs Taroni Hia, Hj Wiwik Susiana Dewi, H Abdullah Mubarok, Drs Idham Hasibuan, Juliana Simatupang ST, Kamarul Ta’ato, Partahi Hutagaol, dan Ketua DPC Gerindra Batubara M Rafiq, mengatakan, selain diinginkan masyarakat, balon Gubsu itu juga harus dikenal luas masyarakat dan mampu membangun Sumut kedepannya. “Jadi pembukaan pendaftaran ini dilakukan karena Partai Gerindra telah menerima surat dari KPU Sumut, soal tahapan pemi-

lihan Gubsu tahun 2013. Karenanya sebagai Parpol kita melakukan proses internal dan juga melakukan rapat pimpinan daerah cabang se-Sumut, belum lama ini. Hasilnya memberikan wewenang penuh kepada pimpinan daerah Sumut untuk melakukan proses seleksi. Makanya dibentuklah panitia seleksi pemilihan Gubsu,” sebutnya. Pada prinsipnya, Partai Gerindra Sumut melakukan seleksi calon Gubsu seluas-luasnya dan terbuka bagi semua masyarakat. “Jadi ada proses penjaringan dan kemudian proses seleksi, tentunya dengan kriteria calon Gubsu itu harus memenuhi ketentuan dan UU yang berlaku,” ujarnya. Menurut dia, bakal calon Gubsu ingin mendaftar dirinya boleh melalui struktural partai di tingkat cabang di kabupaten/kota, atau langsung ke Sekretariat DPD Partai Gerindra Sumut Jalan Raya Menteng No. 239 Medan. Cuma perlu diingat, tambahnya, calon Gubsu dari Gerindra tidak bisa diputuskan DPD melainkan DPP. “DPD hanya punya kewenangan mengusulkan hasil dari seleksi yang kita lakukan. Setelah itu kita juga harus berkoordinasi dengan partai lain yang memiliki satu visi dan misi, sebab Partai Gerindra dalam mencalonkan Gubsunya tidak bisa mandiri karena kuota suaranya tidak cukup,” katanya.(cwan)

Pengurus BM-PAN Sumut Pilih Ketua MEDAN (Waspada): Lebih kurang 380 pengurus Barisan Muda Penegak Amanat Nasiona (BM-PAN) se-Sumut, akan memilih ketua pada Musyawarah Wilayah (Muswil) IV BM-PAN Sumut. Menurut rencana Muswil yang akan dilaksanakan di Parapat tanggal 1 April 2012 itu akan dibuka langsung oleh Ketua Umum DPP BM-PAN Yandri Susanto. Ketua BM-PAN Sumut Zulkifli Husein berbicara kepadaWaspada, di ruang rapat Fraksi Partai Amanat Nasional (FPAN) DPRD Sumut, Jumat (16/3). Dia didampingi panitia penyelenggara Muswil, di antaranya Ketua Panitia Hendra Cipta, Sekretaris Edwin Sugesti Nasution, Ketua SCWempy Saragih, serta Sekretaris BM-PAN Sumut Isa Ansari. Kepada pantia, Waspada mempertanyakan jadwal pelaksanaan Muswil yang terus mudur dari jadwal yang telah ditetapkan. Kata Ketua BM-PAN Sumut Zulkifli Husein, itu karena pihaknya menyesuaikan jadwal dengan Ketua Umum. “Sekarang tidak mundur lagi. Tanggal 1 April di Niagara Hotel, Parapat,” katanya. Zulkifli meminta seluruh PD BM-PAN se-Sumut untu segera mengirimkan data ke-

pesertaannya, selambat-lambatnya tanggal 21 Maret 2012. Ditambahkan Sekretaris DPW BM-PAN Sumut Isa Ansari, Muswil kali ini akan diikuti oleh 380 peserta. Mereka merupakan ketua dan sekretaris DPD BM-PAN yang ada di kabupaten/kota dan ketua-ketua DPC BM-PAN yang ada di kecamatan di Sumut. “Data kepesertaan menjadi sangat penting sebagai syarat mengikuti Muswil ini,” katanya. Sementara itu, Ketua Panitia Hendra Cipta mengatakan, pihaknya sudah sangat siap menggelar acara Muswil IV ini. Tidak ada lagi kendala teknis yang dihadapi panitia. “Dan Ketua Umum DPP juga sudah memastikan dapat hadir membuka langsung acara ini,” sebutnya. Ketua OC Wempy Saragih juga menyebutkan hal yang sama. Katanya, pihaknya sudah menyiapkan seluruh materi yang akan dibawa ke arena Muswil, seperti rancangan program kerja maupun rancangan rekomendasi internal maupun eksternal. Khusus untuk pendaftaran calon formatur, telah dibuka sejak tanggal 16 Maret dan berakhir tanggal 21 Maret 2012. Formulir calon formatur dapat diambil di sekretariat panitia Jalan Gunung Karakatau Medan. (m12)

WASPADA Senin 19 Maret 2012

Medan Metropolitan


Tabrak Pagar Beton Dua Mahasiswa Tewas Polsek Percut Seituan Bertemu 10 Pemilik SPBU MEDAN (Waspada): Polsek Percut Seituan mengimbau pengusaha Stasiun Pengisian Bahan Bakar Umum (SPBU) tetap melayani konsumen sesuai dengan prosedur dan tidak melakukan spekulasi dalam menyalurkan bahan bakar minyak (BBM) kepada seluruh konsumen. Polisi membantu pengamanan di setiap SPBU. “Semua pengusaha SPBU sepakat akan melayani seluruh konsumen sesuai dengan prosedur dan tidak melakukan spekulasi seperti penimbunan BBM ataupun dengan tujuan lainnya yang merugikan konsumen,” ujarWaka Polsek Percut Seituan AKP Azwar kepada 10 pengusaha SPBU yang berada di wilayah hukum Polsek Percut Seituan saat melakukan pertemuan di ruang kerja Kapolsek, Sabtu (17/3).

Dijelaskan Azwar, sebelum hari H pengumuman terjadinya kenaikkan harga BBM, aparat kepolisian telah menjaga lokasi 10 SPBU yang berlokasi di wilayah hukum Polsek Percut Seituan. “Sejak pekan lalu, polisi telah menjaga SPBU saat melayani seluruh pengendara kendaraan bermotor yang datang mengisi minyak. Pembeli minyak pakai drum/jerigen juga ditertibkan dan harus ada izin dari Disperindag,” sebut Azwar didampingi Kanit Patroli AKP Bazooka dan Kanit Binmas AKP Nurmaida Manalu. Menurut dia, penjagaan setiap SPBU bekerjasama dengan security masing-masing SPBU, untuk mengantisipasi dini terjadinya gejolak saat melayani konsumen. 10 SPBU tersebut masing-masing berada di Jalan Letda Sujono (3 unit),

SPBU H Anif Jalan Cemara, Jalan Irian Barat Desa Sampali, Desa Laut Dendang, Desa Cinta Rakyat, Jalan Pancing, Jalan Mandala Bypass. Pemilik SPBU yang hadir tetap sepakat melayani kebutuhan konsumen sesuai peraturan yang ditetapkan oleh pemerintah dan tidak melayani konsumen yang membawa drum atau jerigen diluar dari ketentuan yang berlaku. “Kami juga meminta agar aparat kepolisian tetap berjaga di setiap SPBU untuk menjaga terjadinya hal-hal yang tidak diinginkan,” ujar seorang pemilik SPBU. Para pemilik SPBU juga tidak akan melakukan penimbunan BBM demi mencari keuntungan, tetap melayani pembelian minyak sesuai mekanisme yang ditetapkan oleh pihak pemerintah. (h04)

Waspada/Andi Aria Tirtayasa

WAKAPOLSEK Percut Seituan AKP Azwar didampingi Kanit Patroli AKP Bazooka dan Kanit Binmas AKP Nurmaida Manalu, memberikan pengarahan kepada 10 pengusaha SPBU.

MEDAN (Waspada): Dua mahasiswa perguruan tinggi swasta di Medan, tewas usai menabrak pagar beton rumah warga di Jalan Pintu Air IV, Medan, Minggu (18/3) sekira pukul 03:00. Kedua korban tewas Ropiadotan Sinaga, 21, dan Saut Mangatur Siboro, 21, mereka tinggal di Jalan Tempuling, Kec. Medan Tembung. Informasi yang diperoleh di kepolisian, kedua korban dengan mengendarai sepedamotor melintas di Jalan Pintu Air IV dengan kecepatan tinggi. Persis di tikungan yang agak tajam,

Ropiadotan Sinaga tidak bisa mengendalikan sepeda motornya sehingga menabrak pagar beton rumah warga No197. Akibatnya, dari telinga Ropiadaton Sinaga mengeluarkan darah segar, kepala luka koyak dan meninggal dunia di lokasi kejadian, sedangkan Saut Mangatur Siboro menderita luka robek di kening, pelipis mata kiri dan rongga mulut. Siboro sempat dilarikan ke Rumah Sakit Mitra Sejati namun nyawanya tak tertolong lagi. Petugas Unit Kecelakaan Satlantas Polresta Medan Aiptu Kaspul Sinaga dan Aipda M Hutauruk yang datang ke lokasi kejadian tak menemukan sepedamotor milik kedua korban. Kedua korban selanjutnya dibawa ke RSU Dr Pirngadi Medan

untuk divisum. “Saat kami tiba di TKP, sepedamotor milik korban tidak diketahui keberadaannya, sedangkan saksi tidak ada yang melihat peristiwa tersebut.Warga cuma menemukan kedua korban sudah tergeletak namun tidak ada warga yang melihat kejadian tersebut,” ujar Aiptu Kaspul Nasution. Sementara itu, jenazah kedua korban telah dibawa oleh pihak keluarganya di Kabupaten Samosir karena saat didatangi ke rumah duka di Jalan Tempuling No 56 tidak terlihat ada suasana duka dan pintu rumah dalam kondisi terkunci. “Mayat korban dibawa oleh keluarganya ke kampungnya di Samosir sana,” sebut seorang tetangga korban. (h04)

Massa Hajar Penjambret MEDAN (Waspada): Seorang penjambret tas milik mahasiswi, dipukuli warga di Jalan Tuamang, Kel. Sidorejo Hilir, Kec. Medan Perjuangan, Minggu (18/3) sekira pukul 10:00. Selanjutnya tersangka DS, 22, warga Jalan Letda Sujono Gang Jawa, Kel. Bantan Timur, Kec. Medan Tembung, dalam kondisi babak belur dijbloskan ke sel Mapolsek Percut Seituan. Informasi yang diperoleh di kepolisian, pagi itu korban Andika Syahputri Harahap, 21, warga Komplek SD Negeri Jalan Bawal, Kel. Pandau Hulu II, Kec. Medan Area, bersama temannya hendak pergi ke kampus Unimed mengendarai sepedamotor. Sebelum ke kampus, korban ingin mencuci sepedamotornya di doorsmeer Jalan Tuamang. Namun, belum sampai ke lokasi doorsmeer, persis di Jalan Tuamang depan Gang Mulyo, tiba-tiba korban dipepet oleh dua pria mengendarai sepeda-

motor Mio BK 6628 AAT. Begitu berada di samping korban, tersangka DS langsung merampas tas milik Andika Syahputri. Selanjutnya, kedua pelaku berusaha melarikan diri. Sedangkan korban spontan berteriak. Sejumlah warga yang melihat dua penjambret kabur segera mengejarnya. Kedua penjambret tersebut terjatuh saat hendak membelok di perempatan Jalan Tuamang-Tuasan. Massa kemudian menangkap tersangka DS dan menghajarnya, sementara temannya yang bertindak sebagai pengemudi sepedamotor berhasil

meloloskan diri. Polisi yang melintas di lokasi kejadian segera menyelamatkan tersangka DS dari amuk warga dengan memboyongnya ke Polsek Percut Seituan berikut sepedamotor Mio BK 6628 AAT yang digunakan untuk menjambret. Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan menjelaskan, tersangka DS sudah menjalani pemeriksaan, sedangkan satu lagi temannya yang identitasnya sudah diketahui masih dalam pengejaran. “Pelaku merupakan pengangguran sehingga mau saja diajak menjambret,” tuturnya. (h04)

Waspada/Ismanto Ismail

KAPOLSEK Medan Helvetia Kompol Sutrisno Hady sedang menginterogasi tersangka An yang melakukan pencurian sepedamotor.

Pencuri Sepedamotor Babak Belur MEDAN (Waspada): Pencuri sepedamotor berinisial An, 26, penduduk Jln. Beringin Gg Kaswari, Pasar VII, Tembung, Kec. Deliserdang, babak belur dihajar massa karena kepergok mencuri sepedamotor yang diparkirkan di Jln. Cempaka VII, Blok XV, Kel. Medan Helvetia, Kamis (15/3) malam. Dari tersangka An, polisi menyita barang bukti sepedamotor Yamaha Jupiter MX milik Ikhsan, 18, dan dompet milik tersangka berisikan uang Rp100.000, handphone, Kartu Tanda Penduduk (KTP), dan surat lainnya. Saksi mata Tempat Kejadian Perkara (TKP) mengatakan, peristiwa itu terjadi pukul 22:00, bermula korban Ikhsan, penduduk Jln. Anggrek I, Blok X, Perumnas Helvetia Medan, malam itu berkunjung ke rumah temannya Budi dan memakirkan sepeda-motornya dekat kedai rokok. Ketika korban membantu Budi mengeluarkan sepedamotor Yamaha King temannya itu untuk jalan-jalan, melihat tersangka mengambil sepedamotornya. Korban spontan berteriak maling, sehingga warga sekitar dan seorang petugas Reskrim Polsek Medan Helvetia yang sedang melintas di kawasan tersebut melakukan pengejaran. Akhirnya tersangka berhasil ditangkap dan sempat dihajar massa hingga babak belur, sebelum diboyong ke Mapolsek Medan Helvetia. Kapolsek Medan Helvetia Kompol Sutrisno Hady S, SH, SIK mengatakan, tersangka belum bisa diambil keterangannya karena babak belur dihakimi massa.“Kita telah memintai keterangan korban Ikhsan dan dua warga lainnya sebagai saksi,” ujarnya. (m36)

Indomaret Dibobol Maling MEDAN (Waspada): Swalayan Indomaret di Jalan Pancing, Kel. Sidorejo Hilir, Kec. Medan Tembung, Jumat (16/3), dibobol maling sehingga mengalami kerugian Rp10 juta. Pencurian itu baru diketahui pihak swalayan sekira pukul 07:00, saat karyawan hendak masuk bekerja sebagaimana biasanya. Seorang karyawan melihat gembok pintu besi sudah hilang. Begitu pintu besi dibuka, ternyata pintu lapis kedua yang terbuat dari kaca telah pecah. Diduga maling masuk setelah memecahkan kaca pintu swalayan tersebut. Maling menggondol beberapa bungkus rokok, susu, dan alat-alat kosmetik. Selanjutnya, pihak perusahaan melalui M Tiar Arif, 24, warga Desa Buntu Bedimbar, Kec. Tanjungmorawa, melaporkan peristiwa tersebut ke Polsek Percut Seituan. Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan yang dikonfirmasi membenarkan terjadinya aksi pencurian tersebut. “Pelakunya masih dalam penyelidikan,” sebutnya. (h04)

Mantan Ketua PPRN Sumut Diadukan Ke Polisi

Waspada/Andi Aria Tirtayasa

KANIT Reskrim Polsek Percut Seituan AKP Faidir Chan sedang menginterogasi tersangka jambret berinisial DS (duduk).

Air Bersih Non-Kimia Bantu Usaha Peternakan MEDAN (Waspada): Konsumsi air bersih non-kimia bebas bakteri sebagai pengganti air biasa, ternyata sangat membantu masyarakat peternak sapi dan ayam karena mampu mendongkrak produksi serta menurunkan angka kematian ternak hingga di bawah 30 persen. Demikian rangkuman seminar Redo Water System yang digelar baru-baru ini di Medan dengan menghadirkan narasumber tunggal Attila Galambodi dari Jerman. Menurutnya, Redo Water System merupakan cara baru membunuh kuman atau bakteri yang berada dalam saluran itu dengan teknologi mutakhir.

Menurut Atilla, teknologi ini cukup sederhana tanpa memerlukan ruangan luas dan hanya digerakkan menggunakan listrik 12-16 watt. Sedangkan bahan bakunyaberupagaramyangdicampur ke dalam air dan diproses menggunakan alat teknologi tadi. “Dalam tempo satu menit, proses pencampuran garam dan air akan mampu mematikan semua bakteri yang berada dalam saluran air tersebut. Jika air tersebut dikonsumsi ternak, maka akan menurunkan risiko kematiannya dan meningkatkan produksinya,” kata Atilla di depan puluhan peserta seminar termasuk sejumlah dokter hewan. (m22)

MEDAN (Waspada): Diduga menggelapkan uang kas partai, mantan Ketua DPW Partai Peduli Rakyat Nasional (PPRN) Sumut berinisial JKPM, dilaporkan oleh Wakil Bendahara DPW PPRN Sumut Adil Makmur, SSos ke Poldasu. Usai memberi keterangan kepada penyidik Poldasu, Jumat (16/ 30), Adil Makmur menjelaskan, oknum ketua PPRN Sumut itu diduga menggelapkan Rp230 juta uang kas partai dan tidak bisa dipertanggungjawabkannya. Berkali-kali diminta pertanggungjawabannya itu, JKPM tidau mau memberikan klarifikasinya. “Sebelumnya, PPRN Sumut telah mengundang JKPM, baik secara lisan maupun tulisan, namun yang bersangkutan tidak mau datang juga sehingga kami terpaksa melaporkannya ke Poldasu,” sebut Adil Makmur, selaku pelapor. Menurut dia, pihaknya telah memberikan bukti-bukti lengkap kepada penyidik dan berharap agar kasus tersebut segera diproses secara transparan. Sementara itu, kuasa hukum PPRN Sumut Henry Sianturi menjelaskan, pihaknya terpaksa menempuh jalur hukum karena JKPM tidak memiliki niat baik untuk mengembalikan uang partai. Kata dia, uang kas tersebut sangat berarti untuk keperluan membesarkan partai. “Namun, jika oknum mantan ketua DPW PPRN itu tidak mengembalikannya, maka kami minta pihak kepolisian segera memprosesnya,” ujarnya. Selain meminta pertanggungjawaban uang kas partai yang digelapkan, DPW Partai PPRN Sumut juga meminta pertanggungjawaban inventaris dan dokumen penting dari DPW PPRN saat dipimpin oknum JKPM. Dijelaskan Henry, oknum JKPM yang dilaporkan ke Poldasu sesuai No LP/228/II 2012 tertanggal 27 Pebruari 2012 itu merupakan mantan ketua DPW PPRN Sumut yang terlengserkan dari hasil MUswilub PPRN tahun 2011, di Hotel Niagara, Prapat. (h04)

Lima Polisi Jalani Sidang Disiplin MEDAN (Waspada): Lima anggota Polresta Medan menjalani sidang disiplin yang dilakukan Propam Polresta Medan di ruang Deli Bhayangkari Mapolresta, Kamis (15/3) sore. Sidang disiplin dipimpin Kabag Sumda Kompol Iskandar, Kasiwas AKP T Sinaga, sekretaris Kasi Propam AKP Benno Sidabutar dan anggota. Dari lima personel yang disidang hanya empat yang datang. Tiga orang personel dikenakan sanksi, satu masih dalam proses dan satu lagi tidak hadir sudah dikeluarkan Daftar Pencarian Prajurit Polri (DP3). Kasis Propam AKP Benno Sidabutar yang dikonfirmasi Waspada di ruang kerjanya, Jumat (16/3) mengatakan, Briptu Ade Saputra anggota Pleton Dalmas Polresta Medan disidang disiplin karena tidak masuk saat ditugaskan melakukan pengamanan dan dikenakan sanksi ditempatkan disel khusus 7 hari. Aiptu Koster Aritonang anggota Polsek Medan Area kasus penanganan perkara karena saat bertugas di Polresta Medan ada korban yang membuat pengaduan yang seharusnya kasus tersebut perdata dibuat pidana dan dalam putusan sidang mendapat teguran tertulis. Bripda Vico Daniel Panjaitan anggota Pam Obvit Polresta Medan kasus kelalaian membuat orang lain meninggal. Karena sudah berdamai yang difasilitasi Komnas HAM dan tidak ada penuntutan dan dianggap selesai mendapat sanksi tunda gaji berkala 1 tahun, tunda kenaikan pangkat 1 tahun dan teguran tertulis. Kemudian Bripda Doni Alexander Sembiring anggota Sat Sabhara, tidak masuk dinas, tidak menghadiri sidang disiplin dan telah dikeluarkan Daftar Pencarian Prajurit Polri (DP3). Terakhir Aiptu Manuntut Hutapea anggota Polsek Patumbak kasus penanganan perkara belum dikenakan sanksi karena masih dalam proses. (m39)

Pentas Demokrasi Aceh


WASPADA Senin 19 Maret 2012

10 Calon Bireuen Mendaftar, Satu Gagal Waspada/Muhammad H. Ishak

MUSNADI memperlihatkan mobilnya yang dibakar OTK Kamis (15/3) dinihari di Desa Beusa Seubrang, Kec. Peureulak Barat, Kab. Aceh Timur.

Mobil Timses Calon Independen Dibakar OTK PEUREULAK (Waspada): Mobil Isuzu Panther pick-up BK 9608 BN milik Timses calon Bupati Aceh Timur Muslim H-Marwi U dibakar orang tak dikenal (OTK) di Dusun Meunasah Rayeuk, Desa Beusa Seubrang, Kecamatan Peureulak Barat, Kabupaten Aceh Timur, Kamis (15/4) sekira pukul 02:30. Korban bernama Musnadi Bin Zakaria, 30, warga Dusun Matang Rayeuk, Desa Beusa Seubrang. Pembakaran dilakukan dengan menggunakan kain yang dilumuri bensin dan ditempelkan ke badan mobil. Akibatnya mobil mengalami kerusakan berat antara lain, ban depan sebelah kanan terbakar, body dan kap di bagian penutup mesin juga ikut terbakar. Tidak ada korban jiwa, namun kini korban dan mobil yang dibakar diamankan di Mapolres Aceh Timur, guna pengusutan lebih lanjut. “Ketika kejadian saya bersama keluarga sedang tidur, tibatiba terdengar suara berisik dari arah mobil, sehingga saya sempat berteriak maling, namun begitu istri saya melihat lewat jendela rupanya bagian depan mobil telah mengeluarkan api,” kata Musnadi seraya mengatakan, setelah dirinya minta bantuan wargapun berdatangan ke lokasi memadamkan api. Kapolres Aceh Timur AKBP Iwan Eka Putra, SIK melalui Kasat Reskrim AKP Priyo Utomo, SH, SIK ketika dikonfirmasi mengatakan kasus itu sedang dalam penyelidikan. “Ya, kita telah mengamankan mobil tersebut sebagai barang bukti di Polres guna penyelidikan lebih lanjut,” tandasnya. (b24)

Deklarasi Damai Kandidat Simeulue Ditunda Besok SIMEULUE (Waspada): Deklarasi damai calon bupati/wakil bupati Simeulue periode 2012-2017 yang semula dijadwalkan KIP setempat digelar hari Senin (19/3) ini ditunda. Sekretaris KIP Simeulue Hanifuan, S.Sos kepada Waspada kemarin mengatakan acara akan dilakukan pada Selasa (20/3). “Harinya aja diundur, sementara lokasi tetap di Lapangan Pendopo Bupati Simeulue, pk. 14:00.” Deklarasi disertai pawai bersama. Masing-masing pasangan hanya dibolehkan membawa 40 anggota atau simpatisan. Hal yang sama juga disampaikan salah seorang anggota KIP Simeulue Imran Hamid. Diharapkannya para kandidat dapat memaklumi penundaan itu. Dia memaklumkan supaya para kandidat hadir semua saat acara deklarasi karena kesepakatan ditandatangani bersama tak bisa diwakilkan. (cb04)

Hanya Dua Lokasi Kampanye Di PiJay MEUREUDU (Waspada): KIP Kabupaten Pidie Jaya (PiJay) merombak lokasi kampanye Pilkada Aceh dari yang semula ditetapkan terpusat di empat lokasi berbeda, kini hanya tinggal dua lokasi. Kampanye Pilkada gubernur dan wakil gubernur Aceh hanya akan berlangsung di dua tempat yakni Lapangan Wisata Pantai Kuthang Trienggadeng dan Lapangan YPKM Meureudu, kata Ketua KIP Pidie Jaya Drs.Basri M.Sabi didampingi Ketua Pokja Sosialisasi dan Kampanye Musman, SH, Selasa (13/3). Sebelumnya lokasi kampanye gubernur dan wakil gubernur Aceh ditetapkan di empat lokasi terpisah, meliputi Lapangan Ulee Gle, Kec. Bandar Dua, lapangan PSLS Lueng Putu, Kecamatan Bandar Baru, Lapangan Trienggadeng, dan Lapangan Meureudu. Namun setelah dilakukan rapat teknis antara KIP Aceh dan KIP kabupaten/kota se-Aceh di Kantor KIP Aceh, Senin (12/3) lalu, Pidie Jaya hanya dibenarkan menggunakan dua lokasi kampanye. Kedua lokasi kampanye kandidat gubernur dan wakil gubernur itu dinilai letaknya sangat strategis, yakni di PantaiWisata Kuthang, Kecamatan Trienggadeng dan Lapangan YPKM Meureudu. Untuk tahun 2012 ini Pidie Jaya khusus melaksanakan Pilkada gubernurwakil gubernur Aceh. Sedangkan Pilkada Bupati dilaksanakan setelah periode bupati sekarang (2009-2014) berakhir. (b09)

KIP Lemah Menertibkan Atribut Partai LHOKSUKON (Waspada): Ketua Panitia Pengawas Pemilu Aceh Utara DR Muklir menyatakan, atribut partai yang dipasang sebelum masa kampanye di sejumlah titik di Aceh Utara sulit ditertibkan karena KIP terkesan lemah. “Kalau Panwas, hanya berwenang memantau dan meminta KIP menegur pihak terkait agar menurunkan atribut partai yang dipasang tak sesuai aturan. Panwas tidak berwenang menurunkan atribut partai,” kata Muklir, Rabu (14/3), yang saat dihubungi via telefon mengaku sedang di Surabaya untuk mengawasi proses percetakan kertas suara. Secara aturan, kata Muklir, sebelum masa kampanye Pilkada 2012 dimulai, atribut partai, termasuk baliho calon, hanya boleh dipasang di kantor partai atau Posko pemenangan. Sedangkan di lokasi lain, baru boleh dipasang ketika masa kampanye 22 Maret-5 April 2012. “Jika Panwas mendapati atribut partai yang dipasang menyalahi aturan, yang bisa kita lakukan menyurati KIP dan KIP kemudian menegur pihak yang bersangkutan. Jika teguran itu tak digubris, Satpol PP atas perintah KIP bisa menurunkan atribut itu secara paksa,” imbuh Muklir. Sementara Ketua Pokja Kampanye KIP Aceh Utara T Hidayatuddin mengatakan, penertiban atribut partai atau pasangan calon merupakan tugas bersama Panwas, KIP dan Pemda Aceh Utara dalam hal ini Satuan Polisi Pamong Praja.(b19)

Mukhtar Siap Letakkan Jabatan BIREUEN (Waspada): Ir H Mukhtar, MSi menyatakan dirinya siap meletakkan jabatan Kabid Pengelolaan Lahan Dan Air di Dinas Pertanian Peternakan Perkebunan dan Kehutanan, Bireuen yang dijabatnya selama ini. Hal itu menyusul dirinya ditetapkan KIP sebagai calon wakil bupati berpasangan dengan H Ruslan yang diusung Partai Aceh untuk bertarung dalam Pilkada Bireuen. Dirinya mengaku dengan jiwa besar menerima apapun keputusan KIP nanti untuk mengikuti Pilkada, karena dia mencalonkan dirinya untuk mengabdi kepada masyarakat bila dirinya dipercayakan menjadi wakil bupati mendatang. “Insya Allah, saya sudah siap meninggalkan jabatan saya, sehingga proses Pilkada berjalan mulus tanpa hambatan,” katanya menjawab Waspada, Jumat (16/3), terkait dirinya masih menjabat kabid tersebut sekarang ini. Menurutnya, sebelum ada penetapan sebagai calon dirinya tetap menjalankan tugas. Namun setelah ditetapkan sebagai calon nanti dirinya sudah siap meninggalkannya. “Saya calonkan diri juga untuk mengabdi kepada masyarakat, makanya saya juga siap berkorban untuk masyarakat juga nanti,” pungkasnya. (cb02)

BIREUEN (Waspada): Sejak pendaftaran hari pertama Minggu (11/3) hingga pendaftaran hari terakhir Sabtu (17/3) KIP Bireuen telah menerima bekas pendaftaran 10 pasangan Cabup/Cawabup Bireuen. Sementara satu pasangan Faisal Ridha, SAgFaurizal Moechtar, ST, MM yang sudah menyerahkan berkas, gagal mendaftar. Pengamatan Waspada pendaftaran Cabup Bireuen diterima komisioner KIP Muchtaruddin, SH, MH dan Ir Ridwan dan sejumlah staf KIP lainnya berjalan tertib dan lancar. Pasangan Drs H Hamdani Raden mantan PJ Bupati Bireuen periode 1999-2002 berpasangan Murdani Yusuf, SE (anggota DPRK) Bireuen (FPPP) mendaftar diusung koalisi partai Demokrat dan PPP. Pasangan H Ruslan HM DaudIr H Mukhtar Abda, MSi diusung Partai Aceh dan 9 pasangan lainnya mendaftar melalui jalur perseorangan. Pendaftar hari pertama H Husaini H Ilyas mantan Wakil Ketua DPRK Bireuen (PA) yang sudah duluan mengundurkan dari jabatan legislatif berpasangan Ir Razuardi Ibrahim, MT (Sekdakab Bireuen) sekarang. Pendaftaran kedua Drs H Hamdani Raden-Murdani Yusuf, SE anggota Komisi D DPRK Bireuen (F-PPP) merangkap

Ketua PMI Cabang Bireuen. Pendaftar ketiga pasangan H Ruslan HM Daud- Ir H Mukhtar Abda, MSi diusung Partai Aceh dan Jumat (16/3) disusul pendaftar keempat pasangan H MunawarYusuf mantanWakil Ketua DPRK Bireuen (F-PAN) berpasangan Drs H Hasan Basri, MSi mantan Sekdakab Bireuen periode 2002-2007. Hari yang sama juga mendaftar pasangan Husaini M Amin alias Tgk Batee mantan kombatan yang berpasangan dengan Yusri, SKM, MPh. Pendaftar keenam pasangan Drs H Mustafa A Glanggang mantan Bupati Bireuen priode 2002-2007 berpasangan dengan Anwar BA Camat Peusangan sekarang. Pendaftar ketujuh Ir Saifuddin, MH ang-gota Komisi

D fraksi gabungan DPRK Bireuen berpasangan Dra Hj Rosnany Bahruny Apt, anggota Komisi C fraksi gabungan. Sementara Drs Nurdin Abdul Rahman, bupati Bireuen sekarang berpasangan Zakwan Usman, SP, Kabid Kehutanan mendaftar Jumat (16/3) petang dan malamnya disusul Azhari, SSos Kabag Mukim dan Gampong Setdakab Bireuen berpasangan Drs IskandarYusuf, MM mantan Kadis Perindagkop & UKM Bireuen. Sabtu pagi (17/3) mantan Wakil Bupati Bireuen Drs H Amiruddin Idris, SE, MSi (Rektor Unimus) sekarang berpasangan Drs Muhammad Arif Andepa mendaftar di urutan ke-10. Pendaftaran pasangan Ri-

Waspada/H.AR Djuli

DRS H Mustafa A Glanggang berpasangan dengan Anwar, BA mendaftar di KIP Bireuen, Jumat (16/3).

dha-Faurizal Moechtar ditolak karena berkasnya dinyatakan tidak lengkap. Pasangan ini mendatangi kantor KIP sekira pukul 22.30 dan diterima Ketua DivisiTeknis Pelaksanaan Pemilu Mukhtaruddin, SH, MH. Infromasi yang diperoleh Waspada, Minggu (18/3) menyebutkan, dalam pemeriksaan berkas persyaratan calon, KIP Bireuen menemukan syarat dukungan calon perseorangan berupa bukti salinan dukungan hanya diserahkan satu rangkap dari yang seharusnya tiga rangkap. Kemudian bukti dukungan itu dikembalikan kepada pasangan untuk digandakan. Alhasil, hingga pukul 00:00 (batas waktu akhir pendaftaran) pasangan bakal calon yang maju lewat jalur perseorangan ini tidak mampu merampungkan secara lengkap fotocopy bukti dukungan dimaksud. Zulfahmi, Tim Sukses pasangan balon ini kepada wartawan Minggu (18/3) mengaku keberatan atas penolakan pendaftaran oleh KIP Bireuen. Menurutnya, alasan penolakan tersebut bertentangan dengan Surat Keputusan KIP Aceh No 12 Tahun 2011. Karenanya, pasangan Faisal Ridha-Faurizal Moechtar menyatakan telah mengirimkan surat yang ditujukan ke Ketua Panwaslu Kabupaten Bireuen untuk menelusuri kasus itu secara transparan. (b12/b17).

Calon Banda Aceh Ucap Ikrar Damai BANDA ACEH (Waspada): Lima pasangan calon wali kota Banda Aceh sepakat mengucapkan ikrar bersama dalam rangka menciptakan Pemilukada damai yang akan digelar 9 April. Deklarasi Pemilukada damai bagi pasangan wali kota/ wakil wali kota Banda Aceh dipusatkan di halaman stadion H. Dhimurtala, Sabtu (17/3). Acara ini dihadiri seluruh pasangan calon, kecuali Mawardy Nurdin, yang dikabarkan sedang sakit. Deklarasi berlangsung meriah, diselingi dengan tarian dan lagu dari para pejabat yang hadir. Para calon datang ke arena diiringi oleh timses masingmasing yang dikawal oleh aparat keamanan. Usai pengucapan ikrar Pemilukada damai yang dipandu komisioner KIP Banda Aceh

Munawarsyah, para calon menandatangani ikrar damai di atas spanduk besar yang disediakan KIP Banda Aceh. Lima calon yang membubuhkan tandatangan Pemilukada damai tersebut nomor urut 1 pasangan ZulmaifikarLindawati, nomor urut 2 pasangan Aminullah UsmanTgk. H. Muhibban H.M.Hajat, nomor urut 3 pasangan T.Irwan H.T. Djohan-Tgk. Alamsyah, nomor urut 4 pasangan Mawardi Nurdin-Illiza Sa’aduddin Djamal dan nomor urut 5, pasangan T. Banta HermanMuhammad Hasan. Turut juga membubuhkan tandatangan sebagai saksi masing-masing Pj.walikota Banda Aceh T.Saifuddin TA, Ketua DPRK Banda Aceh Yudi Kurnia, Dandim 0101/BS Letkol Czi Saptono Syiwarudi, Kapol-

resta Kombes Moffan MK, Ketua PN M. Arsyad Sundusin, Kajari Soufnir Chibro, Ketua Mahkamah Syariah H. Rafiuddin, Ketua MPU Tgk. A.Karim Syeikh, Ketua KIP Aidil Azhary dan Ketua Panwaslu Kota Banda Aceh Andriansyah. Pj.Walikota Banda Aceh T.Saifuddin TA dalam sambutannya mengatakan, Pemilukada bukan sekadar urusan politik dan politisi. Lebih dari itu, kata dia, adalah proses pendewasaan bermasyarakat. “Ini menjadi salah satu penentu masa depan bangsa,”katanya. Sementara Ketua KIP Banda Aceh Aidil Azhary mengimbau para calon dalam kampanye yang akan digelar pada 22 maret-5 April agar tidak melakukan intimidasi, money politics, memfitnah dan perbuatan tercela lainnya.

Artinya, para calon dalam berkampanye agar mencerminkan keimanan seorang muslim sesuai dengan syariat Islam. Jangan menghina calon, kampanye hitam dan sebagainya. Begitu juga, kepada anggota KIP, PPK jangan curang, tapi harus independen dan transparan dalam menghitung suara calon. Turut memberikan sambutan pada acara Deklarasi Pemilukada Damai itu Ketua DPRK Banda Aceh Yudi Kurnia, Dandim 0101/BS Letkol.Czi Saptono Syiwarudi, Kapoltabes Kombes Moffan MK dan Ketua KIP Aceh Abdul Salam Poroh. Deklarasi Pemilukada Damai Pemilihan wali kota/wakil wali kota Banda Aceh diakhiri dengan pelepasan burung merpati dan ratusan balon ke udara oleh Pj. wali kota dan pejabat lainya. (b02)

Tudingan Ke Darni Pembunuhan Karakter BANDA ACEH (Waspada): Berbagai persoalan yang dialamatkan ke pasangan Darni M Daud dan Ahmad Fauzi dinilai sebagai upaya pembunuhan karakter tokoh akademik itu. “Kami melihat ada upaya penggiringan opini agar rakyat tidak simpati kepada Darni Daud dan Ahmad Fauzi,” ujar juru bicara pasangan cagub/cawagub Aceh Darni Daud-Ahmad Fauzi, Amin Said, SH kepada pers di Banda Aceh, Jumat (16/3). Setidaknya ada tiga hal

selama ini sempat menjadi opini negatif pasangan rektor Unsyiah dan dosen IAIN Ar Raniry itu. Pertama soal status rektor yang disandang Darni yang ramai diperbincangkan.Tapi kini sudah mereda sebab Darni sudah memenuhi persyaratan sebagai calon gubernur dan tidak harus meletakkan jabatan sebagai rektor Unsyiah. Kedua tentang tudingan melanggar aturan kampanye yang belum waktunya dan ketiga nama pasangan calon

untuk calon lain ditulis secara benar jabatan terakhir. Seperti Irwandi Yusuf sebagai mantan gubernur Aceh dan M Nazar mantan Wagub Aceh. Sedangkan untuk Darni M Daud dan Ahmad Fauzi, sebagai PNS dan bukan sebagai rektor dan dosen untuk pasangannya. “Saya menilai ada kesengajaan untuk mengecilkan keberadaan Darni dan Ahmad Fauzi oleh KIP Aceh ketika mencetak nama pasangan kandidat sebagai media sosialisasi,” tegas

Amin Said. Terkait gugatan Panwas Lhokseumawe yang melaporkan bahwa Darni melanggar aturan kampanye dan sudah dilaporkan ke Polres Aceh Utara, Amin Said yang bertindak sebagai advokasi pasangan ini menyatakan bukan melanggar pidana, tapi dugaan pelanggaran Pemilu. Tapi, dia sayangkan, karena yg dilakukan bukan kampanye tapi arahan untuk tim sukses bukan kepada masyarakat. (b01)

Calon Abdya 9 Kali Kampanye Terbuka BLANGPIDIE (Waspada): KIP Abdya, Jumat (16/3), menetapkan jadwal dan lokasi kampanye terbuka bagi para kontestan. Setiap pasangan calon memperoleh kesempatan 9 kali kampanye terbuka. Ketua Komisi Independen Pemilihan (KIP) Aceh Barat Daya (Abdya) Nazli Hasan S.Ag mengatakan, kampanye akan dimulai 22 Maret dan berakhir pada 5 April. “22 Maret akan ada penyampaian visi dan misi para kandidat di gedung DPRK Abdya dan 5 April diadakan debat kandidat,” kata Nazli. Sementara lokasi pelaksanaan kampanye dikatakan Nazli, untuk Kecamatan Babahrot diadakan di lapangan bola kaki Pante Rakyat, Kecamatan Kuala Batee lapangan bola kaki Gampong Pasar Kota Bahagia, Kec. Jeumpa lapangan bola kaki Cot Mane dan Kec. Susoh diadakan di Marinir. Selain itu untuk Kec. Blangpidie diadakan di lapangan bola kaki Gampong Mata Ie, Kec. Setia Gampong Pisang, Kec. Tangan-Tangan di Gampong Gunung Cut, Kecamatan Manggeng di lapangan bola kaki Manggeng dan Kec. Lembah Sabil diadakan di lapangan Meunasah Sukon. KIP Abdya mempersiapkan sebanyak 2,5 persen kertas suara cadangan dari total jumlah pemilih berkisar 24.446 lembar. KIP juga akan mencetak kertas suara keseluruhan jumlah pemilih tetap yakni 97.874 lembar. Hal itu terungkap dalam


KOMISIONER KIP Abdya T.Renaldi memperagakan bentuk sampel kertas suara di hadapan calon kandidat di ruang aula KIP setempat, Jumat (16/3). acara verifikasi jadwal kampanye dan bentuk kertas suara serta penetapan lokasi acara deklarasi Pilkada damai untuk daerah Abdya yang diselenggarakan KIP bersama para calon bupati/ wakil bupati Abdya periode 2012-2017 di Aula KIP setempat, Jumat (16/3). Dikatakan Komisioner KIP Abdya dari Pokja Pendaftaran Renaldi, pihak KIP Abdya akan menyiapkan jumlah keseluruhan kertas suara sebanyak 122.320 lembar, kertas suara dimaksud terdiri dari 97.874 lembar kertas suara wajib dari jumlah daftar pemilih tetap (DPT) dan 24.446 lembar merupakan kertas suara cadangan. Pembahasan ataupun verifikasi bentuk surat suara pada hari itu menuai kritikan

dari 2 pasangan calon yakni Jufri Hasanuddin (calon usungan Partai Aceh dengan nomor urut 6) dan Ramli Bahar (pasangan calon yang maju lewat jalur perseorangan dengan nomor urut 2). Jufri mengkritik warna latar dari gambar dirinya di kertas suara, dimana katanya warna latar merah yang ditampilkan terlalu pekat sehingga merubah mimik muka calon, pihaknya meminta agar KIP bisa mendesain kembali dengan mencerahkan warna latar. Kritikan Jufri dibenarkan Ramli Bahar yang fotonya dalam kertas suara itu berlatar biru. Pihaknya meminta KIP agar bisa mencerahkan warna latar dengan warna biru muda. Acara yang dipimpin Ketua

KIP Abdya Nazli Hasan S.Ag itu juga membahas jadwal kampanye dan deklarasi Pilkada damai. Jadwal pelaksanaan Pilkada damai disepakati 20 Maret 2012 dengan lokasi masjid Pusaka Kec. Susoh berdasarkan usulan Dandim 0110 Abdya Letkol ARM E Dwi Karyono AS dan disetujui semua kandidat. Acara itu turut dihadiri unsur Muspida plus Abdya seperti wakil bupati Ir Syamsu-rizal, M.Si, Dandim 0110 Abdya Letkol ARM E Dwi Karyono AS, Kapolres AKBP Eko Budi Susilo, S.Ik, mewakili Kajari Blangpidie Adenan Sitepu, SH (Kasie Pidsus), Ketua Panwaslu Abdya Eddy Faisal, SH, Sekretaris KIP Abdya Salman, SH, enam pasangan calon serta beberapa staf di Sekretariat KIP Abdya. (cb05)


DANDIM 0110 Abdya Letkol Arm E.Dwi Karyono AS terlihat akrab dengan wartawan dalam acara coffee morning di Aula Makodim Abdya, Jumat (16/3).

Netralitas TNI Tak Bisa Ditawar BLANGPIDIE (Waspada): Netralitas TNI dalam Pilkada tidak bisa ditawar-tawar. Masyarakat juga kita imbau untuk tidak mencoba mengajak anggota TNI untuk masuk ke ranah politik dan mendukung kandidat manapun. “Jika menemukan pelanggaran tersebut silakan lapor, kita pasti akan tindak tegas setiap personel TNI yang masuk menjadi pendukung atau tim sukses kandidat tertentu,” ujar Komandan Kodim 0110 Aceh Barat Daya (Abdya) Letkol Arm E. Dwi Karyono AS dalam acara temu ramah dan coffee morning dengan para pekerja media di Aula Makodim 0110 Abdya, Blangpidie, Jumat (16/3). Menurut Dandim, agenda Pilkada Aceh khususnya di wilayah Abdya harus menjadi fokus perhatian semua pihak dalam rangka mensukseskan pelaksanaannya secara aman dan damai, sehingga diharapkan muncul pemimpin terbaik yang lahir dari sebuah pelaksanaan Pilkada yang demokratis, sehingga diharapkan dukungan semua pihak untuk menghindari upaya pelanggaran dalam Pilkada. Letkol Arm E Dwi Karyono AS juga mengancam akan melakukan tindakan tegas serta penangkapan terhadap pihakpihak yang mencoba melakukan kekacauan serta upaya kriminal dalam pelaksanaan Pilkada, seperti kegiatan politik uang ataupun provokasi yang mengarah anarkis serta disharmonisasi. Tindakan tegas tersebut menurut Dandim akan dikedepankan untuk mengamankan aspek yang lebih besar yaitu kepentingan daerah dan rakyat. “Saya sudah perintahkan kepada seluruh personel untuk menangkap pihak-pihak yang mencoba melakukan pelanggaran seperti money politics (politik uang) dan menyerahkan mereka nantinya ke polisi untuk ditindaklanjuti, kita berkewajiban untuk mendukung pihak kepolisian dalam rangka mensukseskan Pilkada ini,” seru Dandim di acara yang ikut dihadiri Ketua Balai PWI Abdya Drs. H.ZainunYusuf, Ketua RAPI (Radio Antar Penduduk Indonesia) Abdya Tgk.Eddy Darmawan, S.Sos, MM, Ketua GM FKPPI Abdya T.Renaldi, seluruh Danramil dan perwira di jajaran Kodim 0110 Abdya. (cb05)

Spanduk Cabup Bener Meriah Dipasang Di Aceh Timur LHOKNIBONG (Waspada): Spanduk bergambar calon bupati Bener Meriah Tagore Abubakar dipasang di Dusun Sarah Gala dan Sijudo Desa Blang Seunong. Padahal, sesuai surat keputusan gubernur Aceh dan surat Mendagri, daerah itu wilayah sah Kecamatan Pante Bidari Kabupaten Aceh Timur. Sabar Hati, 26, warga Dusun Sarah Gala kepada Waspada, Jumat (16/3) melaporkan, spanduk itu dipasang Kamis (15/3) sekitar pukul 14.00 oleh orang yang mengaku warga Bener Meriah tapi tinggal di Aceh Timur dan berstatus sebagai anggota tim sukses Tagore Abubakar. Terkait ini, Asisten Bidang Pemerintahan Setdakab Aceh Timur Muhammad, SH, MH mengatakan, masalah perbatasan Aceh Timur dan Bener Meriah sudah tuntas seiring keluarnya SK Gubernur nomor 136/34954 dan surat Mendagri Nomor 136/ 250/PUM tertanggal 31 Januari 2012. Dalam surat itu, Mendagri jelas menyebutkan, SK gubernur Aceh soal batas Aceh Timur dan Bener Meriah sudah tepat. Artinya, sejumlah dusun, termasuk Dusun Sarahgala dan Dusun Sijudo yang sempat diklaim Bener Meriah sebagai wilayahnya merupakan wilayah Sah Kabupaten Aceh Timur. “Jika benar ada spanduk Cabup Bener Meriah di Blang Seunong, itu pelanggaran serius dan harus kita tindak tegas,” kata Muhammad seraya berjanji akan segera turun ke Blang Seunong bersama unsur terkait lainnya untuk memastikan kebenaran informasi soal spanduk cabup Bener Meriah di Dusun Sarah Gala Dan Dusun Sijudo. (b19)

Pilkada Panggung Ujian Keharmonisan Di Bumi Rencong LANGSA (Waspada): Ketua Forum Peduli Rakyat Miskin (FPRM) Kota Langsa Nasruddin mengatakan, Pemiluka Aceh kali ini merupakan panggung ujian bagi keharmonisan di bumi rencong, semenjak tonggak MoU Helsinki disepakati 15 Agustus 2005. Kedamaian sebagai cita-cita seluruh komponen bangsa, kata dia, meski sedikit sempat terganggu dengan adanya kasus penembakan dan intimidasi, haruslah lebih penting dikedepankan dan senantiasa harus diperjuangkan semua pihak yang cinta damai. Berangkat dari alasan tersebut, kata Nasruddin kepada Waspada di Langsa, Kamis (15/3), pihaknya berencana mengadakan diskusi Pemilukada Aceh Damai di Kota Langsa dengan bermaksud mengajak seluruh komponen masyarakat berpartisipasi, acara tersebut akan diselenggarakan di kantor Bappeda Aceh Timur, Senin (19/3). Tujuan yang ingin dicapai, kata Nasruddin, antara lain untuk mendapatkan informasi upaya apa yang dilakukan pemerintah dalam hal ini TNI/Porli bersama penyelenggara dalam menjaga kedamaian selama proses Pemilukada berlangsung. Hal itu penting untuk diketahui masyarakat agar mereka tidak menjadi takut, maka itu Kapolres Langsa bersama Dandim 0104/Aceh Timur, KIP dan Panwaslu diharapkan bisa hadir. “Undangannya sudah kita kirim,” ujar Nasruddin seraya menjelaskan tujuan lainnya, agar forum diskusi tersebut juga bisa menjadi salah satu bentuk kerja sama seluruh stakeholder yang ada di Kota Langsa untuk mewujudkan Pemilukada Aceh damai. (b20)

Irwandi Santuni Anak Yatim Di Kota Sabang BANDA ACEH (Waspada): Calon gubernur Aceh Irwandi Yusuf memberikan santunan kepada 577 anak yatim piatu dari seluruh wilayah di Kota Sabang, Kamis (15/3) siang. Santunan ini diberikan secara simbolis dalam acara maulid akbar yang digelar di Kantor Seuramoe Irwandi-Muhyan di Desa Cot Bak U, Kecamatan Suka Jaya, Kota Sabang. Ketua Panitia Pelaksana Sulaiman Daud mengatakan, kegiatan ini dilaksanakan selain untuk memperingati Maulid Nabi Besar Muhammad SAW, sekaligus untuk bersilaturahmi bersama seluruh masyarakat di Kota Sabang. Tak kurang 20 ribu undangan disebar untuk acara yang dikemas sekaligus makan siang bersama tersebut. “Semoga acara ini dapat semakin mempererat silaturahmi antar masyarakat di Kota Sabang,” ujar Sulaiman seraya menambahkan untuk kegiatan ini pihaknya mempersiapkan 10 ekor sapi untuk menjadi hidangan bagi para undangan. Pantauan di lapangan, sejak dimulai pada pukul 11.00 masyarakat yang hadir tumpah ruah menyatu dalam beberapa tenda yang dipersiapkan panitia. Selain masyarakat Kota Sabang, turut hadir dalam undangan Wakapolres Sabang Kompol S. B Lubis dan beberapa staf di jajaran Pemerintah Kota Sabang. Irwandi Yusuf yang datang khusus dalam acara ini mengaku dirinya merasa sangat senang melihat antusiasme masyarakat yang hadir dalam acara tersebut. Oleh karena itu dirinya mengucapkan terima kasih atas perhatian masyarakat yang begitu besar kepadanya. (b04)

Luar Negeri A8 Kandidat Oposisi Unggul Dalam Pemlihan Presiden Timor Leste DILI, Timor Leste (Antara/AFP): Hasil-hasil awal dari pemilihan presiden di Timor Leste, Minggu (18/ 3) menunjukkan kandidat Francisco “Lu Olo” Guterres dari partai Fretilin unggul dari Jose Ramos-Horta, presiden sekarang yang menempatkan urutan ketiga. Hasil pemilihan presiden yang disiarkan komisi pemilihan negara itu di radio dan stasiun televisi RTTL negara itu menunjukkan Guterres meraih sekitar 27 persen dari 325.000 suara yang telah dihitung sejauh ini— hanya sekitar separuh dari para pemilih yang menggunakan hak pilih mereka.

Mantan pemimpin gerilya Taur Matan Ruak menempati urutan kedua dengan perolehan suara 24 persen, sementara Ramos-Horta yang peraih hadiah Nobel Perdamaian menduduki peringkatketigadengan19persen suara. Surat-surat suara dihitung secaramanual,disejumlahdaerah

terpencilkarenakomunikasiyang buruk, dengan hasil-hasil resmi tidak akan dapat diumumkan sampai akhir pekan ini, kata para pejabat pemilihan. Ermenegildo Lopes ketua Bloku Proklamador yang proaliansi memiliki lima kursi di parlemen yang beranggotakan 65 orang, mengatakan dia meragukan para kandidat akan meraih suara yang cukup yang diperlukan menghindari putaran kedua

pemungutan suara. “Wakil-wakil kami di distrikdistrik mengisyaratkan bahwa suara itu pecah. Dengan 12 kandidat yang ikut bertarung sangat sulit bagi salah seorang dari mereka memperoleh lebih dari 50 persen suara mayoritas yang menurut konstitusi diperlukan sebagai pemenang mutlak,” katanya kepada AFP. Pada pemilihan tahun 2007 Ramos-Horta, seorang peme-

nang hadiah Nobel Perdamaian kiniberusahauntukmasajabatan lima tahun kedua, mengalahkan Guterres. Putaran kedua pemungutan suara akan diselenggarakan dalam waktu dua minggu, jikatidakadapemenangyangjelas dari pemungutan suara Sabtu itu. Pemilihanpresidenituadalah yang pertama dalam serangkaian peristiwa-peristiwa penting di negarayangtidakstabildanmiskin itu.

Pada Mei, Timor Leste akan merayakan 10 tahun kemerdekaannya, yang diproklamasikan setelah tiga tahun berada dalam pemerintah PBB. Kemudian padaJuni,parapemilihakanmemilih satu pemerintah baru dalam satu pemilu. Pada akhir tahun ini negara yang berpenduduk 1,1 juta jiwa ituakanditinggalkanpasukanPBB yang digelar di negara itu sejak tahun 1999.

Mauritania Tangkap Pemimpin Senior Libya Yang Dicari ICC

Puluhan Orang Ditangkap Di New York

Terdakwa Penjahat Nazi John Demjanjuk Meninggal BERLIN (AP): Kepolisian Jerman mengatakan John Demjanjuk — yang didakwa tahun lalu bertugas sebagai pengawal satu kemp maut Nazi — telah meninggal dunia. Pejabat kepolisian Rosenheim Kilian Steger mengatakan kepada The Associated Press bahwa jompo berusia 91 tahun itu meninggal dunia Sabtu (17/3) di satu rumah panti jompo di selatan Jerman di mana dia tinggal sejak berakhirnya peradilan atas dirinya di Munich tahun lalu. Demjanjuk telah dibebaskan sementara menunggu banding di satu pengadilan federal, yang belum juga disidangkan. Steger mengatakan para jaksa di Traunstein melihat kematian Demjanjukakibatalami.Demjanjuk,seorangpensiunanpekerjapabrik mobilOhio,telahdideportasikeJermantahun2009untukmenghadapi peradilan di Munich setelah digugurkan warganegara AS-nya. Pada saat peradilannya, hakim menemukan bahwa bukti-bukti menunjukkanDemjanjukadalahseorangpengawaldikempkematian Nazi di Sabibor, yang dulu merupakan daerah Polandia, pada masa Perang Dunia I. Mereka menjatuhkan hukuman lima tahun penjara atas Demjanjuk. Demjanjuk secara konsisten membantah tuduhan itu, menyatakan bahwa dia tidak pernah bertugas sebagai pengawal di manapun dan dia sendiri ditahan di Jerman hampir sepanjang masa perang. (m10)

KRONOLOGI DEMJANJUK Demjanjuk dituduh tahun lalu sebagai alat dalam Bukti substatif , termasuk foto era-Nazi ini -pembunuhan di kemp kematian Sobibor di foto tanda jatidiri yang dinyatakan Polandia selama tahun 1943 , namun telah Demjanjuk palsu -dibebaskan karena alasan usianya yang menyebutkan dia adalah uzur petugas di kemp kematian Sobibor


Peristiwa penting dalam hidupnya

1920 Lahir di Ukraine 1941 Mendaftar masuk tentara Rusia 1942 Menyatakan dia menghabiskan sebagian besar masa perang sebagai tawanan Jerman 1951 Melakukan emigrasi ke AS, menjadi warga negara AS tahun 1958 1977 Bukti bermunculan yang menunjukkan Demjanjuk telah menjadi seorang pengawal Nazi 1981 Kewarganegaraaan AS-nya digugurkan dan diekstradisi ke Israel. 1988 Hadapi dakwaan

1988 Didakwa menjadi ‘Ivan yang Mengerikan’ dan dijatuhi hukuman mati 1993 Pengadilan Tinggi Israel menolak dakwaan atas dirinya, dia dibebaskan setelah adanya catatan lain tentang seorang ‘Ivan yang Mengerikan’ 1998 Demjanjuk dapatkan kembali kewargaan AS. 1999 Departemen Kehakiman AS ajukan kembali kasusnya. Tinggal di 2009 Dideportasi Ohio, AS ke Munich, Jerman

2002 Kewargaan AS-nya dibatalkan lagi 2005 Diperintahkan untuk dideportasi 2009 MARET: Pengadilan Jerrman

keluarkan perintahkan penahanan Demjanjuk 11 MEI Demjanjuk dideportasi ke Jerman 13 JULI Pengadilan Munich menuduh Demjanjuk 2012 Meninggal dunia di satu panti jompo di Jerman , berusia 91 tahun Dituduh lakukan kejahatan perang di Sobibor, Polandia 1988 Dijatuhi hukuman di Israel

Foto Demjanjuk : Reuters / Jack Dabaghian ID Nazi : dari Departemen Kehakiman AS

2012 Meninggal dunia di panti jompo AMERIKA di Bad Feilnbach, Jerman SERIKAT

AFRIKA Sumber: Laporan pers


Gerakan Sadr Irak Bebaskan ‘Tentara AS’ BAGHDAD (Antara/AFP): Gerakan yang setia kepada ulama anti-AS Moqtada al-Sadr di Irak membebaskan seorang pria tawanan yang diidentifikasi sebagai mantan tentara Amerika, namun para pejabat AS menolak untuk mengkonfirmasi identitas pria itu. Pria itu disebut oleh para pengikut Sadr sebagai Sersan Randy Michael Hills, 59, dan para pejabat Sadr mengatakan dia dibebaskan demi sikap kemanusiaan dan diserahkan kepada misi PBB di Irak (UNAMI).PBB mengatakan Sabtu (17/3) dia adalah warga negara Amerika, tapi tidak memberikan rincian lebih lanjut tentang identitas pria itu. Dua anggota parlemen senior yang setia kepada Sadr“diserahkan kepada UNAMI di malam hari Sabtu 17 Maret warga negara Amerika yang mereka katakan telah ditahan selama sekitar sembilan bulan oleh faksi bersenjata Irak,” kata juru bicara PBB Radhia Achouri. “UNAMI saat ini sedang dalam kontak dengan kedutaan besar Amerika Serikat di Baghdad untuk menindaklanjuti tentang masalah ini,” tambahnya, tapi tidak merinci. Seorang pejabat di kantor pusat Sadr di kota suci Syiah Najaf mengatakan, pria yang digambarkan sebagai “tentara” itu ditangkap pada 18 Juni 2011. “Dia dibebaskan karena alasan kemanusiaan,” kata pejabat, yang berbicara tanpa menyebut nama. “Tidak ada kesepakatan langsung atau tidak langsung atau perundingan dengan Amerika atau pihak lain.” Pejabat dan Maha al-Duri, seorang anggota parlemen Sadr, mengatakan bahwa pria itu telah mengambil bagian dalam pertempuran antara tentara AS dan Sadr, yang sekarang dinonaktifkan dari milisi Tentara Mahdi pada tahun 2004. Kedutaan besar AS menolak untuk segera mengkonfirmasi identitasnya,danklaimSadrtampaknyalangsungbertentangandengan laporan pejabat AS bahwa sisa-sisa jasad prajurit terakhir ditemukan dari perang di Irak dan diserahkan lebih dari sebulan lalu.

Korut Pertahankan Rencana Luncurkan Satelit

NOUAKCHOTT (AP): Badan informasi resmi Mauritania mengatakan para pejabat keamanan di sama telah menangkap mantan pejabat rezim Libya Abdullah al-Senoussi. Dia merupakan orang yang dicari oleh Mahkamah Kejahatan Internasional (International Criminal Court = ICC). PernyataanresmimengatakanmantankepalaintelijenMoammar Khadafi itu ditahan Sabtu (17/3) di bandara ibukota negara Afrika Barat tersebut. Katanya, dia akan terbang ke Maroko dan membawa paspor palsu Mali. Jurubicara Kementerian Luar Negeri Libya Saad al-Shilmanimengatakanpenangkapanitubelumdapatydikonfirmasi. ICC mendakwa al-Senoussi dan putra Moammar Khadafi melakukan kejahatan terhadap kemanusiaan, termasuk pembunuhan massal, yang diduga dilakukannya pada saat mantan rezim Khadafi melakukan penumpasan atas pembangkang. (m10)

NEWYORK (Reuters): Polisi menangkap puluhan pengunjukrasa Occupy Wall Street Sabtu (17/3) malam dalam aksi unjukrasa yang menandai enam bulan berdirinya gerakan tersebut di tempat lahirnya di Zuccotti Park di New York. Polisi yang menyisir taman tersebut menjelang tengah malam menutup aksi demonstrasi dan pawai sepanjang hari di Manhattan. Belum ada keterangan resmi tentang jumlah orang yang ditangkap namun puluhan orang dipastikan digari dan dibawa keluar taman tersebut. Sebelumnya di hari yang sama, 15 orang ditangkap dan tiga polisi mengalami cedera, kata polisi. Pengunjukrasa berkumpul lagi di taman itu setelah pawai sore hari di sepanjang distrik keuangan NewYork. Pukul 11:00 malam sekitar 300 orang berkumpul di sana. “Ini serangan musim semi yang kami lancarkan,” kata Michael Premo, 30, dari New York, yang mengaku sebagai jubir gerakan itu. “Orang-orang mengira gerakan Occupy sudah mati. Kami merasa orang-orang harus tahu bahwa kami masih ada.” Terinspirasi pergolakan di negara Arab yang disebut dengan Arab Spring, para pengunjuk rasa diWall Street mencecar kebijakan keuangan AS yang mereka tuding sebagai penyebab semakin lebarnya gap antara kaum kaya dan miskin di negara itu, antara apa yang mereka sebut kelompok 1 persen dan 99 persen. Pada demonstran berkumpul di Zuccotti Park 17 September dan menyulut gelombang aksi unjuk rasa di seluruh penjuru AS. Sabtu malam, puluhan polisi mengepung taman tersebut dan mengawasimassa.DetektifBrianSessamengatakantidakakandiambil tindakan selama para aktivis tidak berniat mendirikan tenda.Tak lama setelah pukul 11:30 malam, pengunjukrasa mulai mendirikan tenda di dekat pusat taman itu dan polisi mulai bergerak masuk.(m23)

WASPADA Senin 19 Maret 2012

The Associated Press

MOHAMMAD Mahmoud (kiri) dan Bashar Masri (kanan), bergabung dengan rekan senegaranya warga Syria dan para pendukung oposisi dalam rapat umum di depan Gedung Putih di Washington, Sabtu (17/3).

Dua Bom Hantam Damaskus, 27 Orang Tewas, 97 Cedera BEIRUT (AP): Bom ganda menghantam sejumlah sasaran pemerintahdiDamaskus,ibukota Syria,yangmenewaskan27orang dan 97 cedera dari pasukan keamanan dan warga sipil. Bom tersebut juga menyebabkan terjadinya genangan darah dan pembantaian di jalanan, demikian televisi pemerintah. Kekerasan itu terjadi ketika revolusisetahundinegeriitu,yang dimulai sebagian besar dengan protes damai, berubah menjadi perang saudara baru yang melibatkan serangan berskala besar pemerintah atas kota-kota yang dikuasai pemberontak. Rezim PresidenBasharAssadmenyalahkan ledakan di Damaskus pada ‘pasukan teroris’ yang menyatakan berada di belakang pemberontakan. Menurut kantor berita pemerintah SANA Sabtu (17/3), informasi awal menunjukkan ledakan itu disebabkan oleh bom mobil yang mengenai departemen intelijen penerbangan dan departemen kejahatan keama-

nansekitarpukul07:30pagiwaktu setempat. Penembakan terjadi segera setelah ledakan dan menyebabkan para penduduk dan lainnya melarikan diri, demikian menurut laporan seorang wartawan The Associated Press di lokasi kejadian. Pengeboman itu merupakan kejadianterakhirdariserangkaian serangan bunuhdiri di Syria, yang telahmenewaskanpuluhanorang sejak Desember. Belum ada yang mengakubertanggungjawabatas seranganSabtuitu.Namunrezim Syria mengatakan ledakan tersebut membuktikan bahwa pemerintahtelahmenjadisasaran‘teroris.’ Namun, oposisi menuduh pasukanyangsetiapadapemerintah berada di belakang pengeboman tersebut. Gambar-gambar dari tempat kejadian memperlihatkan apa yang kelihatan seperti jenazah yang hangus terbakar di dua kenderaan berbeda, satu mobil mini van yang bersimbah darah dan beberapa potongan tubuh di dalam karung. Sedikitnya 27 orang

tewas dan 140 cedera, demikian bunyi satu pernyataan kementrian dalam negeri. Serangan itu terjadi dua hari setelahperingatantahunpertama pergolakan, di mana lebih 8.000 orang tewas dan sekitar 230.000 terpaksa meninggalkan rumah mereka, menurut data PBB. Ledakan tersebut juga bersamaan dengna misi bersama yang dilaksanakan pemerintah Syria, PBB dan Organisasi Kerjasama Islam (OKI) yang akan mencatat kebutuhan kemanusiaan di kota-kota Syria yang dilanda kerusuhan. Sementara itu, Utusan Khusus Bersama PBB dan Liga Arab untuk Syria, Kofi Annan, Jumat mengatakanbahwadiamenjelaskan kepada Dewan Keamanan PBB bahwa “kita berbicara dengan Syria dan terus berbicara.” “Saya didorong oleh dukungan yang sangat kuat dan penentuan Dewan untuk bekerja sama, dan saya berharap Anda segeraakanmendengarsatusuara dari Dewan,” katanya kepada wartawan setelah menjelaskan

secara tertutup kepada Dewan Keamanan dengan video tentang misinya ke Syria. Mantan Sekjen PBB itu mengatakan dia akan mengirim satu tim ke Syria pada akhir pekan ini untuk melanjutkan pembicaraan dan usulan-usulan yang dibuat bagi pemerintah Syria, termasuk menghentikan kekerasan, mempercepat bantuan kemanusiaan danmembangunkredibilitasserta kepercayaan bagi proses politik ketika hal itu dimulai. Para menteri luar negeri Tunisia, Mesir dan Libya — yang berkumpul di ibukota Tunisia, Tunis—Jumat,mengatakankrisis Syria harus diselesaikan dalam kerangka kerja Arab, dan mengesampingkan campur tangan asing, demikian laporan kantor berita resmi TAP. “Kami semua menentang setiap campur tangan asing di Syria dan kami ingin melihat krisis tersebut diselesaikan dalam kerangka kerja Arab,” kata Menteri Luar Negeri Tunisia Rafik Abdessalem.(m23/m10)

SEOULonhap-OANA): Korea Utara (Korut) pada Minggu (18/ 3) menegaskan bahwa peluncuran satelit observasi bumi yang direncanakan bulan depan adalah hak berdaulat negaranya, dan menyangkal tuduhan bahwa itu adalah upaya untuk menyamarkan uji coba peluru kendali. Dalam komentar yang disiarkan oleh kantor berita negara Korut(KCNA),pihakPyongyangmengatakanbahwapasukanmusuh, termasuk Korea Selatan (Korsel), Amerika Serikat (AS), dan Jepang mengecam peluncuran satelit Kwangmyongsong-3 pada roket antariksa Unha-3 yang dijadwalkan itu sebagai uji coba rudal. Tuduhan tersebut merupakan perpanjangan dari sikap bermusuhan negara-negara itu yang diarahkan pada Korut dan bertujuan untuk menolak hak Pyongyang dan melemahkan rezimnya, kata KCNA. Selain itu, KCNA melansir, “Perkembangan damai dan penggunaan ruang adalah hak yang sah yang diakui secara universal negara yang berdaulat. Peluncuran satelit itu untuk penelitian ilmiah dan penggunaan ruang untuk pembangunan ekonomi yang tidak bisa lagi dimonopoli oleh beberapa negara.” Laporan itu muncul dua hari setelah Komite Korut untukTeknologi Antariksa mengatakan satelit dan roket akan meluncurkan dari stasiun peluncuran di Provinsi Pyongan Utara antara 12 dan 16 April. Pengumuman tersebut dibuat hanya setelah negara itu setuju untuk membekukan rudal dan tes nuklir dengan imbalan 240.000 ton bantuan pangan dari Washington. Media-media mengatakan bahwa Kwangmyongsong-3 adalah hasil penelitian ilmiah yang dilakukan oleh para ilmuwan dan teknisi di DPRK. DPRK adalah singkatan dari nama resmi Korut, Republik Demokratik Rakyat Korea. Dikatakan bahwa dua peluncuran sebelumnya satelit eksperimental dilakukan oleh Korut secara ketat mematuhi praktek peraturan internasional yang relevan.Negara komunis menunjukkan bahwa itu akan mengundang pakar dan jurnalis dari negara lain untuk melihat stasiun peluncuran tersebut. Keputusan untuk meluncurkan satelit ke orbit telah menarik serangan dari masyarakat internasional karena memandang Unha3 sebagai rudal yang kuat yang dapat membawa hulu ledak jarak jauh. AS mengatakan pekan lalu bahwa akan sulit untuk memberikan bantuan makanan jika Pyongyang bergerak ke depan dengan peluncuran.

Ribuan Orang Unjukrasa Serukan Penerapan Hukum Syariah Di Tunisia TUNIS (Antara/Xinhua-OANA): Ribuan pengunjukrasa berkumpul di luar Majelis KonstitusiTunisia dan menyerukanpenerapan hukum Syari’ah (hukum Islam), demikian laporan kantor berita resmi Tunisia, TAP. Aksi tersebut diselenggarakan oleh front perhimpunan Islam Tunisia, yang meliputi sebanyak 112 perhimpunan. Sambil meneriakkan slogan yang mendukung pembentukan khilafah dan menentang sistem sekuler, para demonstran juga mengibarkan bendera Salafi, kata laporan itu sebagaimana dikutip Xinhua —yang dipantau Antara di Jakarta, Sabtu (17/3) pagi. Jurubicara pengunjuk-rasa, Salman Briki, mengatakan demonstrasi tersebut bertujuan meyakinkan anggota Majelis Konstitusi untuk menerapkan hukum Syari’ah sebagai sumber unik perundangan dalam undang-undang dasar baru. Demonstran menyerahkan dokumen lima-pasal kepada Majelis Konstitusi, guna menyerukan penerapan hukum Syari’ah dan menetapkan kepala negara dan presiden harus beragama Islam, lakilaki, dan menikah dengan Muslimah.

Karzai Makin Marah, AS Pulangkan Tentara Pembantai Washington Tak Mau Berbagi Informasi Penyelidikan Kasus Pembantaian KABUL (AP/BBC/Antara/ AFP): Presiden Hamid Karzai kembali menyatakan kegeramannyaterhadapAmerikaSerikat yang tidak mau berbagi informasi tentang pembantaian 16 warga sipil Afghanistan, yang dilakukan seorang sersan Amerika, yang kemudiandiadikirimkankembali ke tanahairnya. Komentar Karzai itu makin mempertegas kemarahan yang amat mendalam di negara yang dicabik perang itu, sehari setelah diamengatakanpasukaninternasionalmestimeninggalkansemua desa, sehingga berpotensi membahayakan operasi NATO dua tahun sebelum pasukan tempur asing dijadwalkan meninggalkan Afghanistan. Washington makin memperumit situasi setelah melaporkan bahwatentarapembantaiitutelah dipulangkan ke AS. “Pemerintah Afghanistan tak menerima kerja sama dari AS mengenai penyerahan tentara AS kepada pemerintah Afghanistan. Korban sipil telah berjatuhan terlalu lama,” kata Presiden Karzai kepada wartawan. Tentara AS yang dituduh membantai 16 orang warga sipil Afghanistan diketahui bernama

Sersan Robert Bales. Pejabat seniorASmengungkapkanidentitas tertuduh kepada BBC ketika tersangka tengah diterbangkan ke AS untuk menghadapi tuntutan hukum. Dia diperkirakan akan segera mendarat di Fort Leavenworth, Kansas,setelahditerbangkanmelalui Kuwait. Pengacara prajurit tersebut, John Henry Browne, mengatakanbahwakliennyaadalah seorangpria38tahunyangterluka dua kali saat bertugas di Irak. Dia juga mengatakan terdakwa menyaksikan kaki temannya yang terluka parah akibat ledakan sehari sebelum pembantaian tersebut. Akibat pembantaian terhadap korban sipil yang sebagaian besar anak-anak dan kaum perempuan, Taliban membatalkan negoisasi lanjutan dengan AS. Tetapi Pemerintah AS mengatakan tetap akan memperjuangkan negosiasi untuk mendamaikan kelompok yang berperang di Afghanistan. Sehari sebelumnya Presiden Karzai juga menyatakan kemurkaannya sehubungan dengan pembantaianitu.Diamengatakan Kamis, AS harus menarik kembali pasukannya dari wilayah pedesaan dan meminta pasukan ke-

amanan Afghanistan memimpin operasi di lapangan agar dapat mengurangikematianwargasipil. Sementara itu, Sersan Bales sejauh ini belum resmi dituntut, tetapidiatelahdijadikantersangka kasus pembantaian tersebut. Menteri Pertahanan AS Leon Panetta sebelumnya mengatakan jika tentara itu terbukti bersalah dia akan diganjar dengan hukuman. Persidangan dalam kasus seperti ini akan memakan waktu bertahun-tahun,sebuahkenyataanyangbertolakbelakangdengan tuntutanAfghanistanyangmenghendaki pengadilan itu berlangsunglebihcepatdenganhukuman yang berat. Berbicara di Seattle, Kamis, tempat Sersan Bales semula bertugas,sangpengacaraJohnHenry Browne mengatakan kliennya “berwatak halus” dan bukanlah tipe orang anti Islam. Dia melukiskan kliennya itu sosok panutan diantara rekan-rekannya, sebelum ada kasus pembantaian. Ini benar-benar akhir “Ini sungguh menjadi akhir sampai di sini,” tambah Karzai — yang telah lama menyerukan diakhirinyaseranganASterhadap rumah warga sipil Afghanistan

danyangJumatmenghadapitekanan dari keluarga korban pembantaian agar melakukan perbaikan. Namun di tengah kata-kata marah tersebut, Presiden AS Barack Obama dan Karzai kembali menegaskan tentara AS akan meninggalkan Afghanistan paling lambat pada penghujung 2014, kendatiadaseruanbagipenarikan dini. Dalam percakapan telepon antara kedua pemimpin itu pada Jumat,Obamasepakatuntukmenyelesaikan keprihatinan Karzai mengenai serangan pada malam hari saat keduanya mengatakan merekaakanmembahaskeluhan mengenai tentara NATO di berbagai desa Afghanistan. Tentara pembantai AS berusia38tahunitutelahditerbangkan ke Kuwait pekan ini dan Jumat berada dalam perjalanan ke tahanannya dengan pengamanan maksimum di Fort Leavenworth, Kansas, AS, satu langkah sebelum menghadapi tuntutan. Seorang pejabat AS, yang tak ingin disebutkan jatidirinya, mengatakan, “Para penyidik memiliki alasan untuk percaya bahwa alkohol mungkin telah menjadi faktor peristiwa tragis ini.” (m10)


MENGANGKAT KERANJANG SAMA-SAMA. Para pekerja membawa satu keranjang yang penuh sayuran di satu pasar sayur di Kolkata, India, Jumat (16/3). Inflasi India akan mereda sampai kira-kira 6,5 persen menjelang akhir bulan ini dan akan terus melemah sampai kira-kira 6 persen atau di bawah itu, kata penasehat ekonomi PM India, C. Rangarajan, Jumat.


WASPADA Senin 19 Maret 2012


Motori Lagi Pesta Gol FC Hollywood

Robben Ilmu Padi BERLIN (Waspada): Winger Belanda, Arjen Robben, membukukan hatrik ketika memotori Bayern Munich menghancurkan tuan rumah Hertha Berlin dengan skor telak 6-0 pada spieltag 26 Bundesliga. Pesta gol FC Hollywood di Olympiastadion, Berlin, Sabtu (Minggu WIB) tersebut, menjadi yang ketiga dalam sepekan terakhir. Pekan lalu Bayern menggasak Hoffenheim 7-1, lantas mencukur FC Basel 7-0 pada leg kedua babak 16 besar di Liga Champions. “Anda mesti memaksimalkan kans Anda dan memastikan Anda mencetak gol. Inilah yang terjadi di dua laga sebelumnya, dan terjadi lagi hari ini,” ucap Phillip Lahm, kapten FC Hollywood. “Dalam tiga laga terakhir, kami telah melihat seberapa besar kualitas serangan yang kami miliki. Kami dapat memporak-porandakan nyaris semua tim,” ujatnya lagi, seperti dikutip dari Goal, Minggu (18/3). The Bavarians telah mencetak 20 gol dari tiga aksi ter-

akhirnya, semua dimotori Robben. Namun mantan pemain Chelsea dan Real Madrid itu tetap memakai ‘ilmu padi’ alias makin berisi makin menunduk. Robben mengklaim, masih harus bekerja keras untuk mencapai level permainan terbaiknya setelah beberapa kali dihantam cedera. “Kami main bersama dan untuk satu sama lain,” ujar Robben. “Saya pribadi belum mencapai level permainan saya sebelumnya. Saya belum kembali menjadi Arjen Robben yang dulu,” katanya menambahkan. Pesta gol FC Hollywood dibuka Thomas Muller menit sembilan. Robben membuka kran golnya menit 12, lantas menambahkan gol keduanya menit 19 sekaligus menutup babak pertama dengan keunggulan 3-0 bagi Bayern. Mario Gomez, penyerang

tersubur di Bundesliga dengan 22 gol dari 25 partai, menyarangkan gol keempat tim tamu melalui eksekusi penalti menit 50. Striker Jerman itu dengan demikian telah mencetak delapan gol dari tiga laga terakhir, sebelumnya empat gol ke gawang Basel dan tiga gol saat melumat Hoffenheim. Berselang semenit setelah gol Gomez yang sudah mencetak 35 gol di semua kompetisi, Toni Kroos menyarangkan gol kelima FC Hollywood. Robben kemudian menutup pesta pasukan Jupp Heynckes dengan tendangan dari titik 12 pas, setelah Franck Ribery dilanggar bek Hertha Alfredo Morales di kotak terlarang. “Saya bisa dan harus terus berkembang. Saya yakin segala sesuatunya akan menjadi lebih baik,” tekad Robben. Harapan bintang kelahiran 23 Januari 1984 itu sepertinya bakal mendekati kenyataan, karena Bayern bakal memperpanjang masa kontraknya dilengkapi dengan penambahan gaji. “Kami sedang berupaya

Blaugrana Menyerah Buru Madrid MADRID (Waspada): Entrenador Pep Guardiola bangga melihat Lionel Messi membukukan golnya yang ke-150 di liga, Sabtu (Minggu WIB), saat Barcelona mempecundangi Sevilla 2-0 pada jornada 27 La Liga Primera. Tetapi pelatih berusia 41 tahun itu mengaku, pasukannya tidak akan mampu memburu pemimpin klasemen Real Madrid. Dia bahkan menilai, Messi yang sangat hebat tidak dapat lagi membantu El Blaugrana memenangi gelar juara liga yang keempat kali secara beruntun. “Lupakan liga, kami tidak akan memenanginya. Tim ini telah melakukan segalanya, namun terdapat tim lain (Madrid) yang lebih bagus dan mendapatkan hasil-hasil yang lebih baik daripada kami,” papar Pep. “Tidak perlu memperhalus fakta yang ada. Kami memiliki jadwal sulit di putaran Liga Champions (melawan AC Milan), tapi kami tidak akan menahan liga dan mengistirahatkan para pemain,” ujarnya lagi, seperti dilansir AFP, Minggu (18/3). Dua gol El Blaugrana di Ramon Sanchez Pizjuan, Seville, disumbangkan playmaker Xavi Hernandez menit 18 dan gol indah Messi menit 25. Meski sudah menyerah memburu Madrid, Guardiola tetap menurunkan tim terkuatnya. Satu-satunya kejutan hanyalah absennya kapten Carles Puyol di lini belakang. Posisinya digantikan Javier Mascherano, yang berduet dengan Gerard Pique di jantung pertahanan.

BINTANG Bayern Munich Arjen Robben merayakan sukses menaklukkan kiper Hertha BSC Thomas Kraft di Olympiastadion, Berlin, Minggu (18/3) dinihari WIB.

Klasemen Bundesliga Dortmund 26 B Munich 26 Gladbach 26 Schalke 25 Leverkusen26 W Bremen 26 Stuttgart 26 Hanover 25 Wolfsburg 26 Nuremberg 26 Mainz 26 Hoffenheim26 Koeln 25 Hamburg 26 Augsburg 26 Freiburg 26 Hertha 26 K’lautern 25

18 5 3 17 3 6 15 6 5 15 2 8 11 7 8 11 6 9 10 6 10 8 11 6 10 4 12 9 4 13 7 9 10 7 9 10 8 4 13 6 9 11 5 11 10 6 7 13 5 8 13 3 11 11

53-16 64-17 39-16 54-33 39-34 40-39 43-34 30-35 34-47 25-37 38-41 29-37 32-46 30-48 27-40 33-53 26-47 16-32

mempertahankan Robben, dengan menawarkan gaji £170 ribu per pekan,” tutur Karl-Heinz Rummenigge, Presiden Bayern Munich. “Robben mampu membuat perbedaan dalam permainan tim. Itulah yang membuat kami berupaya mempertahankannya,” tambah mantan penyerang Timnas Jerman itu melalui The Mirror. (m15/goal/afp/mirror)

Senin, 19 Maret (GMT) Espanyol vs Santander 20:00 *tvOne live pkl 03:00 WIB

Minggu, 18 Maret Levante vs Villarreal


59 54 51 47 40 39 36 35 34 31 30 30 28 27 26 25 23 20

Rossoneri Langsung Fokus Juve ROMA (Waspada): AC Milan meraih kemenangan 2-0 atas AC Parma pada giornata 28 Liga Seri A, Sabtu (MingguWIB), sehingga mempertahankan keunggulan empat poin atas Juventus, yang menghancurkan tuan rumah Fiorentina 5-0.

Eksekusi penalti Zlatan Ibrahimovic menit 17 dan gol indah Urby Emanuelson menit 55, telah menambah beban bagi Juve untuk memburu sang juara bertahan. Tapi Massimiliano Allegri, pelatih terbaik Italia 2009 dan 2010, meminta anak asuhnya langsung mempersiapkan energi untuk melakoni laga super


Sabtu, 17 Maret Zaragoza vs Osasuna Getafe vs Sociedad Granada vs Gijon Sevilla vs Barcelona Vallecano vs Real Betis

1-1 1-0 2-1 0-2 3-0

Klasemen La Liga


LIONEL Messi selebrasi golnya ke gawang Sevilla.

Problem Catur

70 63 44 41 40 39 37 37 36 36 35 33 33 31 30 30 27 24 24 19


MESIN gol AC Milan Zlatan Ibrahimovic merayakan golnya ke gawang Parma dengan Sulley Muntari di Ennio Tardini.

terkalahkan secara beruntun. Catatannya menyamai rekor legenda hidup Madrid, Emiliano Butragueno, yang mengukirnya pada periode 1987 sampai 1989. Striker Real era 19841995 itu mencatatkan 34 kemenangan dan 16 imbang. Sedangkan Iniesta membantu Barca meraih 42 kemenangan, delapan sisanya imbang. Kekalahan terakhir Iniesta bersama Barca terjadi pada awal musim lalu, saat pasukan Pep dipecundangi tim promosi Hercules 0-2 di Camp Nou. (m15/afp/yahoo/espn)

MADRID (Waspada): Mesin gol Barcelona, Lionel Messi, ingin menghabiskan seluruh karirnya bersama juara Spanyol dan Eropa itu, yang dia yakini merupakan klub terhebat sepanjang masa. “Kebenaran pada benak saya adalah selamanya bertahan di Barcelona dan menghabiskan seluruh karir saya di sini,” ungkapnya kepada Sky Sports, yang dikutip Minggu (18/3). Messi menjadi motor sukses pasukan Pep Guardiola, yang dalam tiga tahun beruntun se-

lalu menjuarai La Liga Primera. Tendangan cungkilnya di Ramon Sanchez Pijzuan, Sabtu (Minggu WIB), membawa El Catalan menang 2-0 atas tuan rumah Sevilla. Itu gol liga ke-150 Messi selama berkarir di Barcelona. Sekaligus menjadi golnya yang ke31 di liga musim ini dan gol ke14 dari enam pertandingan terakhir. “Seperti yang selalu saya katakan, tidak seorangpun yang tahu apa yang dapat terjadi di masa depan. Tapi jika ini tergan-

tung keputusan saya, saya akan bertahan di Barcelona selama sisa karir saya,” beber Messi. Dia kemudian mengklaim, tidak pernah melihat tim memainkan sepakbola lebih baik daripada yang dipertontonkan pasukan Pep. “Saya tidak cukup tua untuk melihat tim-tim hebat yang dibandingkan dengan kami. Dari apa yang saya lihat, saya pikir (Barca) ini merupakan yang terbaik,” klaimnya. Bomber berumur 24 tahun itu juga memuji Guardiola, man-


Jawaban di halaman A2







1 A








tama dengan skor 2-0. Claudio Marchisio memantapkan keunggulan Juve menit 54, Andrea Pirlo menyarangkan gol keempat menit 67, dan pesta gol Bianconeri ditutup oleh Simone Pepe menit 72. “Bukan perkara mudah untuk menang di sini dan kembali ke jalur kemenangan setelah rentetan hasil imbang. Namun para pemain tampil profesional dan menunjukkan keyakinan akan kemampuan mereka,” ucap Conte. Skor 5-0 itu merupakan kemenangan terbesar yang pernah dicatat Nyonya Tua dalam lawatan ke Artemio Franchi. Gelandang Andrea Pirlo pun

mengaku sangat bahagia, apalagi itu berarti mengakhiri catatan buruk Bianconeri. “Kami memang sudah mengawali laga dengan sangat baik dan dalam posisi memimpin. Tapi kartu merah (Cerci) itu sedikit menguntungkan,” papar Pirlo. Kendati timnya kini hanya empat poin di bawah Milan, Pirlo sangat menjagokan mantan klubnya tersebut untuk mempertahankan gelar juara Seri A. “Scudetto, Milan adalah favoritnya. Sementara kami akan terus berusaha untuk tetap berada di jalur yang tepat,” pungkasnya.

akan berusaha terus berjuang sampai akhir. Yang terpenting adalah mengakhiri musim tanpa penyesalan apa pun,” tukas Conte. Pesta itu sekaligus mengakhiri catatan empat kali imbang di empat laga terakhir The Old Lady. Pesta gol Super Juve dibuka Mirko Vucinic menit 15. “Saya sempat merasa kami akan kembali mendapat kutukan ketika peluang pertama MirkoVucinic membentur tiang. Tapi setelah itu semuanya berjalan lebih baik. Kami membuat semuanya lebih mudah,” puji Conte. Nyonya Tua makin merajalela setelah gelandang Fiorentina Alessio Cerci kena kartu merah menit 20. Berselang delapan menit, ArturoVidal menggandakan keunggulan tim tamu sekaligus menutup babak pertan kapten Barca dan gelandang andal Timnas Spanyol. “Sejak kedatangannya, Guardiola mampu membuat tim bermain seperti ini. Ketika dia datang, dia membuat saya bermain lebih ke atas, lebih dekat dengan gawang agar saya dapat mencetak lebih banyak gol,” kenangnya. Messi memecahkan rekor Liga Champions ketika dia mencetak lima gol dalam satu partai, ketika Barca menggasak Bayer Leverkusen 7-1 awal bulan ini pada leg kedua babak 16 besar Liga Champions. (m15/sky/rtr)

BEK Juventus Martin Caceres mengalahkan bomber Fiorentina Carvalho Amauri (kiri) dalam duel di Artemio Franchi Stadium, Florence, Minggu (18/3) dinihari WIB.

25. BPDSU sekarang lebih dikenal dengan nama Bank _____. 26. Lemari besi tempat menyimpan uang.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan dalam waktu lima menit. Jawabannya di halaman A2 kolom 1.





Hitam melangkah, mematikan lawannya empat langkah.


“Saat Anda memilih pemain, mereka akan mendapat tambahan kepercayaan diri. Emanuelson bisa bermain baik di sisi kanan,dia juga bisa berperan sebagai bek sayap,” puji Allegri. “Saya menganggapnya sebagai pemain penting, karena mampu bermain di beberapa posisi. “Emanuelson punya teknik bagus dan tahu bagaimana cara memberikan umpan pintar dan ini sangat penting bagi kami,” katanya menambahkan. Emanuelson bahkan bisa memainkan peran sebagai treaquartista di belakang dua penyerang Milan, seperti yang diperlihatkannya ketika menaklukkan Parma. “Allegri memainkan saya sebagai treaquartista dan meminta saya untuk banyak bergerak ke depan dengan Ibra dan (Stephan) El Shaarawy.Saya senang dengan peran ini,” beber bintang berusa 25 tahun tersebut. (m15/goal/fi)

Nyonya Tua Dilarang Pikirkan Milan

ngan untuk Abidal. Kami ingin dia menjalani hidupnya dengan bahagia,” ucap Pique. “Kami selalu memikirkan dia sepanjang pertandingan. Kemenangan ini kami persembahkan untuk Abidal,” timpal kiper utama Barca, Victor Valdes. “Kami juga sedang menjalani situasi sulit, namun dengan kekuatan yang kami miliki, termasuk dari Abidal, kami semakin terinspirasi untuk meraih hasil terbaik,” tambah penjaga gawang cadangan Timnas Spanyol tersebut. Sukses di Seville juga ditandai dengan rekor manis Andres Iniesta. Gelandang Spanyol ini mencatatkan rekor 50 laga tak

STRIKER Barcelona Alexis Sanchez (atas) melewati tekel bek Sevilla Julien Escude di Ramon Sanchez Pizjuan.

Messi Selamanya Barca

26 23 1 2 88-23 27 19 6 2 77-19 26 12 8 6 40-31 27 12 5 10 38-37 26 12 4 10 37-37 27 9 12 6 32-41 26 9 10 7 42-34 27 11 4 12 40-43 26 9 9 8 36-31 26 10 6 10 32-35 27 9 8 10 28-35 27 9 6 12 30-37 27 8 9 10 27-31 27 9 4 14 24-38 26 7 9 10 26-32 27 9 3 15 31-41 27 6 9 12 27-41 26 4 12 10 21-37 27 6 6 15 25-50 27 4 7 16 22-50

ROMA (Waspada): Alle-natore Antonio Conte melarang anakanak Juventus memikirkan kemenangan 2-0 AC Milan atas Parma, Sabtu (MingguWIB), supaya fokus saat menjajal Fiorentina pada giornata 28 Liga Seri A. “Saya mengatakan kepada para pemain saya agar fokus pada diri sendiri dan tidak pada hasil lain. Sebab, terlalu penting bagi kami untuk meraih kemenangan,” kata ungkap Conte di Football Italia, Minggu (18/3). Hasilnya terbukti ampuh. Si Nyonya Tua pesta gol membantai tuan rumah La Viola 5-0 di Artemio Franchi Stadium, Florence. “Kami bangga bisa terus berpeluang meraih scudetto dengan sepuluh pekan tersisa dan


Buat Abidal Menurut Pique, seluruh pasukan El Catalan berdoa dan mendukung kesembuhan rekannya Eric Abidal. Mereka pun mendedikasikan kemenangan atas Sevilla buat Abidal, yang akan menjalani operasi transplantasi hati. Pique cs berharap, bek muslim Prancis itu bisa melawan penyakitnya lagi, seperti yang sudah dilakukannya musim lalu saat menjalani operasi pengangkatan tumor. “Kami harus memberikan cinta dan duku-

Real Madrid Barcelona Valencia Levante Malaga Osasuna Bilbao Vallecano Atl Madrid Espanyol Getafe Sociedad Sevilla Granada Mallorca Real Betis Villarreal Santander Gijon Zaragoza

penting menghadapi The Old Lady pada leg kedua semifinal Coppa Italia besok malam di Juventus Stadium. “Duel melawan Juventus akan sangat sulit, sebab mereka menang di San Siro. Jadi tak ada kata lain, kami mesti menang di Turin,” pinta Allegri, seperti dikutip dari Football Italia, Minggu (18/3). Dengan kekalahan kandang 1-2 pada leg pertama, I Rossoneri mesti menang minimal 2-0 untuk melaju ke final. Allegri berharap, sejumlah pemain kunci yang masih cedera bisa segera pulih untuk merilis kemenangan telak tersebut. “Kami berharap KevinPrince Boateng bisa segera pulih, karena mulai bulan ini hingga akhir musim nanti jadwal kami sangat padat. Saya membutuhkan kaki-kaki yang segar,” beber Allegri. Dia juga memberikan pujian kepada Emanuelson, yang mulai nyetel dengan permainan Rossoneri, setelah direkrut pada pertengahan musim lalu.


2. Bank sentral yang tujuan tunggalnya adalah mencapai dan menjaga kestabilan nilai rupiah (dua kata, tulis tanpa spasi). 6. Singkatan Bank Negara Indonesia, didirikan tahun 1946. 8. Bank swasta didirikan pada 21 Februari 1957, cabang Medan terletak di Jl Diponegoro (tiga kata, tulis tanpa spasi). 10. Bank gabungan BBD, BDN, Bank Exim dan Bapindo pada Juli 1999. 15. Singkatan Bank Rakyat Indonesia, awal berdirinya di Purwokerto, 16 Desember 1895. 16. Bank ketiga terbesar di AS yang mempunyai cabang di Jakarta (tiga kata, tulis tanpa spasi). 19. Bank swasta yang namanya sama dengan nama jalan di Medan. kini Jl. A. Yani. 21. Bank _____ Dharma, termasuk bank swasta nasional devisa berpusat di Medan. 22. Nama bank swasta nasional devisa lainnya, gabungan lima bank, termasuk Bank Bali, pada tahun 2002. 23. Nama bank Malaysia yang memperkuat saham BII.


1. Burung penghancur pasukan gajah pada zaman Nabi SAW. 2. Induk; Pimpinan. 3. Binatang bertulang belakang, bernafas dengan insang. 4. Sekolah swasta di Jl. SM Raja, Medan, menggunakan nama anggrek. 5. Ikatan antara dua negara atau lebih dengan tujuan politik. 7. Campur. 9. Persemakmuran (Inggris). 11. Lampu jauh mobil untuk memberi isyarat pada kenderaan dari arah berlawanan. 12. Sesuatu yang ada di dalam benda. 13. Kasihan. 14. Unsur. 17. Bahan pewarna. 18. Pengusaha bank. 19. Alat untuk mengibas. 20. Pulau bagian Sumut. 21. Panggung tempat berpidato. 24. Tidak jahat.

3 8 4 5 8 2 7 1 9 5

9 5 2 1 7 9 6 3 4 3 1 8 2

2 3 4 5 3 8 1 5 7 6 7

6 2 7 7 6 4 9 3 5 1 *224



WASPADA Senin 19 Maret 2012

Muamba Ingatkan Tragedi Puerta-Feher-Foe LONDON (Waspada): Tragedi kolapsnya gelandang Bolton Fabrice Muamba di tengah lapangan dalam laga perempatfinal Piala FA di markas Tottenham Hotspur, Sabtu (Minggu WIB), mengingatkan kembali pada tiga peristiwa tragis yang terjadi sebelumnya. Korbannya adalah Antonio Puerta, Miklos Feher dan Mark Vivien Foe, ketiganya tiba-tiba tak sadarkan diri di lapangan karena serangan jantung dan akhirnya meninggal dunia. Puerta pemain muda harapan Spanyol binaan Sevilla. Bakat besarnya telah membuat klub-klub besar tertarik, di antaranya Real Madrid, Manchester United dan Arsenal. Pemain kelahiran 26 November 1984 meninggal saat membela Sevilla menghadapi Getafe di Stadion Ramon Sanchez Pizjuan, 25 Agustus 2007. Kematiannya disebabkan Arrhythmogenic Right Ventricular Cardiomyopathy, dia meninggal dengan meninggalkan pacarnya yang sedang mengandung anak pertamanya. Feher pemain kelahiran Hungaria tahun 1979 meninggal saat membela klubnya SC Benfica melawan Vitoria Guimares

di Super Liga Portugal pada 25 Januari 2004. Kematiannya benar-benar tak terduga, karena Feher masuk sebagai pemain pengganti. Dia menerima kartu kuning saat injury time dan maju beberapa langkah ke depan, tapi tiba-tiba kesakitan dan terjatuh. Ambulans datang ke lapangan dan membawa Feher ke rumah sakit, tapi saat tengah malam dia menghebuskan nafasnya yang terakhir. Setelah diotopsi penyebab kematiannya adalah serangan jantung, padahal dia baru berusia 24 tahun. Vivien Foe pemain Kamerun kelahiran tahun 1975. Dia bermain di Olympique Lyonnais, West Ham United kemudian pindah ke Manchester City. Mendiang Foe menjadi pilar Kamerun di Piala Konfederasi 2003. Setelah menghadapi Brazil dan Turki, Kamerun menjajal Kolombia di semifinal pada 26 Juni 2003. Saat laga berjalan, dia tiba-tiba terjatuh tak sadarkan diri menit 72, hasil otopsi menyimpulkan penyebab kematiannya adalah Hypertrophic Cardiomyopathy. Muamba Kritis Kini Fabrice Muamba mengalami peristiwa serupa. Dia tiba-

Fabrice Muamba

Antonio Puerta

tiba pingsan saat laga baru berlangsung 41 menit dengan kedudukan 1-1. Tim medis sempat memberikan pernapasan buatan kemudian menggunakan alat bantu oksigen saat menangani gelandang asal Zaire itu di lapangan Stadion White Hart Lane, London. Tapi itu tak mampu membuatnya sadar. Tim medis akhirnya melarikan gelandang 23 tahun itu ke rumah sakit untuk menjalani pemeriksaan. Sedangkan laga Spurs-Bolton langsung dihentikan.

Miklos Feher

Mark Vivien Foe

Pihak Bolton menyatakan, Muamba mengalami serangan jantung dan sekarang masih dalam kondisi kritis. “Saat ini dia dalam kondisi kritis dan sedang mendapat perawatan intensif,” bunyi pernyataan resmi The Trotters sebagaimana dikutip Sky Sports, Minggu (18/3). “Belum ada informasi terbaru untuk saat ini. Klub meminta kepada media untuk menghormati privasi keluarganya,” tambah pernyataan tersebut. (m15/vvn/sky)

MU Sudah Pulih LONDON (Waspada): Manchester United mencatat kemenangan mudah saat melawan Wolverhampton Wanderers yang bermain dengan 10 orang sejak menit 39.


GELANDANG Bolton Fabrice Muamba ditandu tim medis saat di markas Tottenham Hotspur, White Hart Lane Stadium, London, Minggu (18/3) dinihari WIB.

Tetesan Air Mata Buat Muamba Chelsea Tembus Semifinal Piala FA LONDON (Waspada): Laga perempatfinal Piala FA antara Tottenham Hotspur melawan Bolton Wanderers, terpaksa dihentikan setelah gelandang tim tamu, Fabrice Muamba, pingsan dan dilarikan ke rumah sakit. Di Stamford Bridge London, Minggu (18/3), Chelsea mulus menembus semifinal dengan menaklukkan Leicester City 5-2. Gol-gol The Blues ke gawang klub divisi satu itu dicetak Gary Cahill menit 11, Salomon Kalou menit 16, Fernando Torres menit 66 dan 85, serta Raul Meireles menit 91. Ini merupakan kemenangan keempat beruntun Chelsea sejak Roberto Di Matteo menjadi caretaker, menggantikan tugas mantan bosnya AndreVillasBoas yang dipecat pada awal bulan ini. Sebelumnya John Terry cs mengatasi Napoli 4-1 di Liga Champions, Stoke City 1-0 di Liga Premier, dan Birmingham City 2-0 pada replay babak 16 besar Piala FA. Tetapi pekan ini FA Cup yang diklaim sebagai turnamen tertua di dunia, didominasi kesedihan. Tetesan air mata mewarnai tragedi Muamba, gelandang Bolton kelahiran Kinshasa berusia 23 tahun, yang terjatuh dan

tidak sadarkan diri diWhite Hart Lane, London. Beberapa petugas medis berupaya menyadarkannya, sebelum dia kemudian ditandu ke luar lapangan menit 41. Skor saat itu 1-1. Bolton memimpin lebih dahulu lewat gol bunuh diri Gareth Bale menit keenam, Spurs menyamakannya melalui gol Kyle Walker menit 11. Muamba mengenakan masker oksigen dan diapit beberapa paramedis dan staf medis The Trotters, ketika dia meninggalkan lapangan. Wasit Howard Webb memanggil para pemain untuk meninggalkan lapangan, sebelum kemudian diumumkan bahwa laga terpaksa dihentikan. Mantan pemain Timnas Inggris U-21 itu sempat mendapat penanganan di lapangan selama sekitar enam menit. Beberapa pemain dari kedua tim terlihat meneteskan air mata, ketika kondisi serius situasi itu menjadi nyata. Para penggemar menyanyikan nama Muamba saat dia sedang mendapat penanganan. “Berdoa untuk Anda, Fab. Mudah-mudahan dia baik-baik saja. Pikiranku melayang pada dirinya dan keluarganya,” tulis rekan setim Muamba di Bolton, Stuart


Button Rajai Seri Perdana MELBOURNE, Australia (Waspada): Jenson Button (foto), merajai seri perdana Formula 1 musim 2012 pada GP Australia. Dia mengatasi tantangan juara bertahan Sebastian Vettel yang harus puas menjadi runner-up dan rekan setimnya Lewis Hamilton di Sirkuit Albert Park, Melbourne, Minggu (18/3). Pebalap Inggris ini menjadi peserta terbaik dalam balapan sebanyak 58 lap dengan catatan waktu 1 jam 34 menit 9,565 detik. Vettel, juara GP Australia tahun lalu, finish kedua dengan selisih 3,4 detik dari Button setelah mengawali lombia di urutan enam. Teammate Vettel di Red Bull, Mark Webber, finish keempat disusul andalan Ferrari, Fernando Alonso. Mantan juara dunia yang comeback musim ini, Kimi Raikkonen (Lotus) menempati posisi ketujuh di belakang Kamui Kobayashi (Sauber). Button tampil sempurna dengan menyalip Hamilton yang meraih pole position di tikungan pertama dan terus mempertahankan posisinya. Legenda hidup F1, Michael Schumacher, sempat mendapatkan start bagus dengan menyodok ke peringkat tiga. Di barisan belakang, terjadi insiden senggolan di antara beberapa pebalap, termasuk Bruno Senna yang melintir di tengah lintasan akibat ditabrak Daniel Ricciardo. Driver tim Lotus yang start dari posisi ketiga, Romain Grosjean, disundul Pastor Maldonado di lap kedua sehingga tercecer ke gravel dan langsung out. Vettel cukup mulus dengan melakukan overtake Nico Rosberg ke posisi kelima di putaran kedua. Sang juara bertahan naik satu level di lap 10, setelah Schumacher melebar ke gravel, masuk pitstop, dan tidak melanjutkan perlombaan karena ada kerusakan pada gearbox. Safety car sempat masuk lintasan gara-gara Vitaly Petrov (Caterham) mogok di pinggir trek. Kesempatan ini dimanfaatkan Vettel dengan mengganti ban dan merapat di belakang Button dan Hamilton. Ricciardo mendapatkan poin pertamanya di F1 di kandang sendiri dengan finish di tempat kesembilan di belakang Sergio Perez (Sauber). Driver Inggris lain, Paul di Resta, menyumbangkan angka buat Force India dari pencapaiannya di posisi 10. (m47/ap)

Minggu, 18 Maret Chelsea vs Leicester Liverpool vs Stoke

5-2 -

Sabtu, 17 Maret Tottenham vs Bolton Everton vs Sunderland

tunda 1-1

Holden. Legenda Liverpool dan Timnas Inggris, John Barnes, berkomentar pada ESPN, “Dari reaksi para pemain di kedua kubu, kelihatannya hal ini telah menjadi sangat serius.” “Para pendukung sangat terkejut. Saya tidak pernah melihat kejadian seperti ini di lapangan sepakbola sebelumnya. Hati kami bersama keluarganya,” ungkap mantan pelatih Inggris, Kevin Keegan. Bintang-bintang Liga Premier model Rio Ferdinand (MU), Jack Wilshere (Arsenal), Jermaine Defoe dan Emmanuel Adebayor (Tottenham), serta David Luiz (Chelsea), lewat twitter mengajak berdoa bagi Muamba. Gelandang Juventus Andrea Pirlo bahkan mendedikasikan kemenangan 5-0 timnya atas Fiorentina buat pemuda keturunan Zaire tersebut. “Kami mendedikasikan kemenangan ini untuk Muamba, karena dia adalah kolega kami. Kami semua di sini berdoa untuknya,” tutur Pirlo dalam Football Italia. (m15/rtr/espn/fi)

Bertandang ke Stadion Molineux dalam lanjutan Liga Premier, Minggu (18/3) malam, Setan Merah menang telak 5-0 sekaligus memulihkan kepercayaan dirinya setelah tersingkir dari Liga Europa. Turun dengan duet Wayne Rooney dan Javier ‘Chicharito’ Hernandez di lini depan, MU langsung tampil dominan. Pergerakan impresif Rooney yang kerap menerobos masuk kotak terlarang kerap membahayakan lini pertahanan Wolves. MU membuka keunggulan kala pertandingan menginjak menit 21. Umpan Michael Carrick dari sepak pojok disambut sontekan Jonny Evans di muka gawangWolves. Setelah itu, MU sempat kesulitan menembus area pertahanan Woves akibat pertahanan berlapis Ronald Zubar cs. Sayang, Wolves harus ber-

STRIKER lincah Manchester United, Javier Chicharito Hernandez (kanan) tampil gemilang dengan mencetak dua gol ke gawang Wolverhampton Wanderers dalam lanjutan Liga Premier di Stadion Molineux, Minggu (18/3) malam. -APmain dengan 10 orang ketika Zubar dihadiahi kartu kuning kedua dari wasit setelah melanggar Danny Welbeck. Menit 43, MU kembali mencetak angka dari serangan balik. Di sini, Rooney mengirim umpan terobosan kepada Luis Valencia yang kemudian menembak bola dari sudut sempit.

GolWelbeck di masa injury time akhirnya menutup dominasi MU di babak pertama. MU tetap tak mengendurkan serangannya di babak kedua. Keunggulan jumlah pemain mereka manfaatkan untuk terus menekan pertahanan Wolves. Kali ini, Chicharito mencuri perhatian dengan me-

nambah gol timnya di menit 56. Chicharito menggandakan golnya tepat lima menit berselang dengan meneruskan umpan silang Valencia lewat sepakan kaki kiri. Sebenarnya, skuad Sir Alex Ferguson berpeluang mencetak gol lebih banyak, namun gawang Wolves berhasil diselamatkan Wayne Hennes-

sey. Kemenangan ini membuat United semakin mantap di puncak klasemen dengan torehan 70 poin. Saat ini, Setan Merah unggul empat angka dari rival Manchester City yang baru berhadapan dengan Chelsea, Kamis (22/3) dinihari WIB. (m15/m33/ap)

Tantowi/Butet Ulangi Sukses


GANDA campuran Indonesia, Tantowi Ahmad/Liliyana Natsir, mengantongi gelar kedua dalam waktu sepekan dengan menjuarai Swiss Terbuka Grand Prix Gold, Minggu (18/3).

BASEL, Swiss (Waspada): Ganda campuran Indonesia, Tantowi Ahmad/Liliyana Natsir mengulangi prestasi pekan lalu dengan menjuarai Swiss Terbuka Grand Prix Gold, Minggu (18/3). Pekan lalu, Tantowi/Liliyana merebut gelar juara di turnamen bulutangkis All England di Birmingham, Inggris. Ini merupakan gelar pertama Indonesia di All England setelah sembilan tahun. Di final Swiss Terbuka, Tantowi/Butet tampil tanpa cela dan mengatasi perlawanan ganda campuran Thailand, Sudket Prapakamol/Saralee Thoungthongkam.

Di set pertama, ganda Indonesia yang diunggulkan di tempat pertama ini selalu unggul dari lawannya yang juga unggulan ketiga. Setelah kedudukan 14-11, Tantowi/Butet melaju 21-16. Di set kedua, situasi tidak berubah di mana Tantowi/Liliyana selalu unggul dan menutup pertandingan 21-14. Juara tunggal putri diraih Saina Nehwal (India) dengan mengalahkan Wang Shixian (China). Saina, unggulan ketiga dan pernah ditangani pelatih Atik Jauhari ini, menang 21-19, 21-16 dalam 48 menit. Tunggal putra China, Chen Jin, akhirnya meraih gelar se-

telah harus melalui pertarungan ketat saat menghadapi Le Hyun Il (Korsel). Chen Jin yang diunggulkan di tempat ketiga mengalahkan Hyun 14-21, 21-9, 21-17 dalam tempo 67 menit. Ini merupakan gelar kedua buat China setelah terjadi All Chinese Final di ganda putri antara Huan Xia/Tang Jinhua dan Bao Yixin/Zhong Qianxin. Huan/Tang pun menang 21-17, 21-10, sedangkan ganda putra Naoki Kawamae/Shoji Sato (Jepang) menjadi pasangan terbaik dengan mengalahkan Fang Chieh Min/Lee Sheng Mu (China Taipei) 21-13, 21-14. (m33/tsw)


WASPADA Senin 19 Maret 2012


Kongres PSSI Akui ISL PALANGKARAYA (Waspada): Kongres Tahunan PSSI 2012 di Hotel Aquarius, Palangka Raya, Minggu (18/3), menghasilkan beberapa putusan penting. Salah satunya, pengakuan terhadap kompetisi Indonesian Super League (ISL) yang selama ini dianggap ilegal. Tercatat ada 94 pemilik suara dari 97 yang diundang hadir, sedangkan peninjau sebanyak 354 anggota PSSI. Hal ini sempat menimbulkan kerepotan tersendiri bagi panitia pelaksana, terutama pembagian tas dan ID peseta kongres. “Membludaknya peserta membuat panitia kewalahan karena jumlah sebanyak ini di luar dugaan,” tutur Ketua

Umum PSSI Djohar Arifin Husin. “Akan tetapi saya merasa bangga dan senang melihat antusiasme dan semangat para peserta,” ujarnya lagi saat memberikan keterangan pers usai menutup kongres. Paling membahagiakan, lanjut Djohar, karena seluruh peserta mendukung sepenuhnya program yang dibuat PSSI,

PSSI Gugat KPSI PALANGKARAYA ( Waspada): Terus diganggu dengan urusan gugatan yang dilayangkan Komite Penyelamat Sepakbola Indonesia (KPSI) ke pengadilan arbitrase olahraga internasional (CAS), PSSI melayangkan tuntutan balik. Melalui kuasa hukumnya Patrick Mbaya, otoritas sepakbola nasional itu melayangkan gugatan ke CAS (Court of Ar-

britration for Sports) terkait keabsahan peserta Kongres Luar Biasa (KLB) yang digelar KPSI di Hotel Mercure, Jakarta, Minggu (18/3). Wakil Ketua Komisi Disiplin PSSI, Catur Saptono, mengatakan gugatan ini dilayangkan berdasarkan fakta yang dirilis panitia KLB KPSI dengan menyebutkan kegiatan mereka dihadiri oleh 81 voters (pemilik

termasuk mengakui kompetisi ISL sebagai upaya penyelesaian dualisme kompetisi sepakbola nasional. Seluruh peserta mendukung langkah penyelesaian dualsime kompetisi yang akan dilakukan PSSI. Peserta kongres juga secara aklamasi menyatakan memberi penguatan terhadap kebijakan yang dibuat oleh Komite Eksekutif (Exco) PSSI. Terkait rencana peleburan ISL dan Indonesia Premier League (IPL) menjadi satu, kata Djohar, PSSI tetap konsisiten dan komit membuka pintu kepada klub-klub ISL kembali bernaung di bawah PSSI sesuai amanat FIFA. Meski sejumlah langkah penyelesaian yang ditawarkan be-

lum juga mendapat respon, PSSI tetap akan terus melakukan upaya ke arah peneyelesaian dualisme kompetisi. Untuk masalah teknis, imbuh Djohar yang juga sesepuh olahraga Sumut, pihaknya pun selalu membuka kesempatan untuk membicarakan hal ini. “Mungkin nama dan pengelolanya harus kita ganti dengan yang baru, tidak apa-apa. Bahkan demi Merah Putih, saudara Widjajanto (CEO PT LPIS) bersedia diganti,” tegas Djohar. Jika klub ISL tidak juga bersedia menerima tawaran ‘rujuk’, menurutnya, itu justru akan merugikan mereka dan juga sepakbola nasional. “Tidak ada yang diuntungkan dari masalah yang terjadi saat ini,” dalih

Djohar. “Justru banyak yang dirugikan, terutama para pemain. Akibat bermain di kompetisi yang bukan dikelola federasi, sehingga mereka tidak bisa memperkuat tim nasional,” katanya lagi. Hal lain yang diputuskan pada Kongres Tahunan PSSI adalah penetapan program kerja PSSI di bidang pembinaan usia dini, serta model-model kompetisi yang akan digulirkan. “Syukur Alhamdulillah karena Kongres berjalan dengan baik dan menghasilkan putusan yang positif. Kita berharap hasil dari kongres ini bisa memberi kontribusi bagi perubahan demi kemajuan sepakbola nasional,”tandas Djohar. (yuslan)

hak suara) dan 415 anggota biasa non pemilik suara. Menurutnya, sangat tidak masuk akal jumlah peserta sebesar itu yang hadir di KLB dan merupakan anggota PSSI yang diklaim KPSI. Hal ini, menjadi alasan bagi PSSI melayangkan gugatan ke CAS terkait tindakan sejumlah orang yang mengatasnamakan PSSI dalam KLB KPSI tersebut. “Anggota PSSI yang punya mandat untuk menghadiri kegiatan Kongres itu ada berapa? Jumlahnya besar sekali, berarti

ada indikasi tindakan pengatasnamaan yang sudah pasti melanggar peraturan,” kata Catur seusai Kongres PSSI 2012 di Hotel Aquarius Palangkaraya, Minggu (18/3). Senada dengan itu, Ketua Komite EtikTodung Mulya Lubis mengatakan keputusan CAS terkait gugatan KPSI sudah final dan mengikat. Ada dua gugatan yang diajukan KPSI terhadap PSSI yang telah diputuskan ditolak oleh CAS, yaitu gugatan bernomor CAS 2012/A/2688 dan CAS 2012/O/2736 tanggal 16 Maret 2012. Kemudian gugatan CAS bernomor 2736 diajukan oleh 4 mantan Exco PSSI, Tonny Apriliani, Roberto Roew, Erwin Dwi Budiawan dan La Nyalla Mattalitti bersama tiga klub dan 28 Pengprov PSSI pada 8 Maret 2012. Mereka meminta CAS

mengeluarkan putusan sela guna membatalkan keputusan Exco PSSI yang menolak permintaan KLB dari 460 anggota PSSI. Untuk kasus gugatan nomor 2688 CAS, lanjut Todung, diajukan oleh tiga klub yakni Persisam Putra Samarinda, Deltras Sidoarjo, dan Pelita Jaya serta dua mantan Exco PSSI La Nyala dan Erwin Dwi Budiawan yang menuntut adanya pelanggaran statuta oleh PSSI. “CAS sudah memutuskan bahwa pihaknya tidak memiliki jurisdiksi untuk memeriksa, mengadili, dan memutuskan gugatan yang diajukan atas PSSI. Dalam suratnya, CAS juga menyebutkan gugatan ini sudah dihentikan dan tidak bisa diajukan upaya hukum apapun,” beber Todung. (yuslan)

PSMS IPL Belum Maksimal MEDAN (Waspada): Tuan rumah PSMS Medan gagal memetik poin penuh di kandang setelah ditahan Semen Padang 1-1 dalam lanjutan Indonesian Premier League (IPL) di Stadion Teladan Medan, Minggu (18/3). Meski lebih mendominasi jalannya pertandingan, tuan rumah tertinggal lebih dahulu melalui gol cepat kapten Semen Padang, Elie Aiboy. Setelah gol tim tamu pada menit keempat itu, PSMS membalas di menit 73 melalui tendangan bebas Ahn Hyo Yoen. Bagi kubu PSMS, hasil imbang tersebut sedikit mengecewakan karena sejak awal bertekad meraih hasil maksimal. Apalagi saat ini Ayam Kinantan

masih bercokol di papan paling bawah klasemen sementara. Pelatih PSMS IPL, Fabio Lopez, mengatakan timnya belum tentu meraih kemenangan kendati lebih mendominasi jalannya pertandingan. Kecolongan gol lebih dahulu di menit awal pun membuat timnya tersentak. “Pada 30 menit awal pertandingan, konsen-trasi anak-anak belum fokus apalagi dengan gol cepat tersebut. Namun, untungnya kami dapat membalas di babak kedua,” kata pelatih asal Italia tersebut. Meski hanya mendapat tambahan satu poin, dari sisi permainan ia mengaku cukup puas, apalagi lawan yang diha-

dapi merupakan tim papan atas yang juga diisi oleh beberapa pemain timnas. Sementara itu, Pelatih Semen Padang Nil Maizar mengatakan hasil imbang tersebut sudah cukup buat timnya, apalagi PSMS memang sulit dikalahkan di kandangnya. Namun, Nil Maizar juga memberi catatan mengenai kepemimpinan wasit yang dinilainya kurang tegas. “Kartu merah yang diberikan kepada pemain kami, Tomy Rifka, saya nilai tidak layak. Saya tidak melihat kesalahan fatal yang dilakukannya, namun ya sudahlah. Saya tidak mau terlalu mengomentari wasit karena memang begitu nyatanya,” katanya. (m33/ant)

pertama. Semoga penampilan impresif rekan-rekan bisa berlanjut hingga akhir kompetisi,” ungkap M Julianda, kapten Chaldera. Bagi De Bargeszt, kekalahan di laga pembuka kian memperkuat mitos juara bertahan sulit mempertahankan kejayaannya di tahun berikutnya. Selain langsung kalah, tercatat seluruh juara bertahan Liga STIKP gagal mempertahankan gelarnya, seperti Los Gaek SSos, Tampoeroeng FC, Keong FC, Bacok FC, dan Tim Sisa Dunia (TSD). Sebaliknya, nasib juara bertahan putri yang disandang B’Girlz justru berakhir manis. Pasalnya, Nurlimah cs mengawali usahanya merebut gelar kedua kali dengan menumbangkan Adulas Girls 3-0. Ketiga gol B’Girlz diborong Nining Sitorus, top skor tahun lalu. Di laga lain, Bacok FC harus mengeluarkan seluruh kemampuannya untuk menghentikan ambisi kejutan Adulas Men. Me-

lawan tim 2011 alias paling junior itu, Jafar Wijaya cs unggul 9-7. Pertandingan pun berlangsung seru tatkala terjadi duel antara Jafar (Bacok) dan Fiqih Prastia (Adulas). Kedua andalan tim masing-masing saling berbalas mencetak gol sepanjang permainan. Namun, enam gol cetakan Fiqih plus satu dari Andi Ahmad belum cukup menghindari Adulas Men dari kekalahan. Meski kalah satu gol dari juniornya itu, Jafar pun bisa bernafas lega karena Bacok FC melewati ujian perdana dengan tiga poin. Empat gol Bacok FC lainnya disumbangkan M Idris (2) dan Efdi Purnomo (2). Ketua Panpel Liga Futsal, Pran WH Hasibuan SSos, mengatakan pertandingan dilanjutkan Selasa (20/3) besok mempertemukan Peluru FC kontra Immortal FC, De Bargeszt melawan Bacok FC, dan Tim Sisa Dunia (TSD) meladeni tantangan Chaldera United. (m33)

Waspada/Austin Antariksa

PENJAGA gawang Semen Padang gagal menangkap bola saat duel di udara dengan penyerang PSMS Medan Julio Alcorse dalam lanjutan Indonesian Premier League (IPL) di Stadion Teladan Medan, Minggu (18/3).

Bintang Timur Pesta Gol Taufan Gama Simatupang Cup IV PULAURAKYAT, Asahan (Waspada): PS Bintang Timur menang telak 6-0 atas Padang Mahondang Club dalam lanjutan turnamen sepakbola Taufan Gama Simatupang Cup IV Grup A di Stadion Pulu Raja, Pondok Batu, Pulau Rakyat, Asahan, Minggu (18/3). Bintang Timur yang berambisi menuai poin penuh dari PMC langsung menggempur pertahanan lawan sejak kick off. Rapatnya pertahanan Padang Mahondang Club membuat serangan Bintang Timur selalu kandas. Namun, Surya akhirnya membawa Bintang Timur unggul di menit 39. Laga di babak kedua, Bintang Timur tak terbendung lagi dan berhasil unggul telak hasil tambahan dua gol masingmasing dari Sugi dan Surya, plus satu cetakan Wandi. Di laga lainnya, PS Gunung Sari menang 4-1 atas PS Tunggul 45 di Grup C. Gol Gunung Sari dicetak oleh Fran (2), Yusril, dan Indra, sedangkan gol balasan Tunggul 45 disumbangkan Jefri. Pada Senin (19/3) ini, PS PTPN III Kebun Bandar Selamat menghadapi Neo Star Club di Grup D dan Grup A melaga Persebap melawan PS Bintang Kedjora.(a31)

Berharap Bibit Berkualitas Sei Bejangkar Cup

Waspada/Arianda Tanjung

KETUA STIK-P Hj Ida Tumengkol BComm MHum melakukan tendangan pertama sebagai tanda dibukanya Liga Futsal STIK-P dalam rangka Dies Natalies ke-25 di lapangan De Futsal, Jl STM/Suka Aman Medan, Sabtu (17/3).

Lemkari Sumut Siap Tempur Karate Wali Kota Medan Cup MEDAN (Waspada): Pengprov Lemkari Sumut siap menghadapi Kejuaraan Karate Piala Wali Kota Medan 2012 di Gelanggang Remaja Medan, 2225 Maret nanti. “Kami menurunkan 55 atlet untuk bertanding di semua kelas. Lemkari sekaligus menjadikan event ini sebagai seleksi atlet menghadapi kejuaraan Lemkari zona Sumatera di Sumbar dan Kejurnas Lemkari 2012 di Bali,” ujar Ketua Dewan Guru Lemkari Sumut, Maryono, usai meninjau latihan gabungan atlet Lemkari di Gedung Dishub Sumut, Minggu (18/3). Didampingi Ketua Majelis

Sabuk Hitam (MSH), Ir Nazmi Al MSc dan Ketua Pengcab Lemkari Medan, Hasrul Benny Harahap SH MHum, Maryono, membenarkan kontingennya tampildengankekuatanbesar.Hal itu sesuai arahan Ketua Umum H Abdillah Ak MBA untuk membuktikan Lemkari tetap organisasi karate yang besar dan solid. Penyandang gelar DAN V ini menjelaskan dalam persiapan tim, dirinya sebagai koordinator pelatih dibantu pelatih lainnya seperti Mulyadi (DAN II), Anhar (DAN III),Wahyudi (DAN I), dan Ali Munthe (DAN I). Ketua Umum Pengcab Lemkari Medan, Hasrul Benny

Harahap, mengaku bersyukur karena karateka Lemkari Medan kembali memperlihatkan prestasi. Ini dibuktikan dengan keikutsertaan anak didiknya memperkuat Lemkari Sumut dan Forki Medan di Piala Wali Kota. “Selain memperkuat Lemkari Sumut, enam karateka kita juga dipercaya membela Forki Medan. Mereka adalah Uwais (kadet putra 62 kg), Alpi S (pemula putra 40 Kg), Anwar (kadet putra 52 Kg), Lidya Syafitri (U-21 55 Kg), Yeni Atika (U-21 +55 Kg),” ucap Hasrul yang juga dipercaya sebagai tim Manejer Lemkari Sumut di Piala Wali Kota Medan. (m42)

KPSI Tolak Utusan Persiraja La Nyalla Terpilih Ketum PSSI BANDA ACEH (Waspada): Persiraja Banda Aceh sepertinya ingin ‘bermain’ aman dalam kisruh dualisme kompetisi di Indonesia. Terbukti, klub berjuluk Laskar Rencong ini mengikuti Kongres Tahunan PSSI dan Kongres Luar Biasa (KLB) Komite Penyelamat Sepakbola Indonesia (KPSI), Minggu (18/3). Kongres Tahunan PSSI berlangsung di Palangkaraya, sedangkan KLB KPSI di Hotel Mercure, Jakarta. Sejumlah sumber yang dihubungi Waspada pun terkesan bungkam dan memilih tidak menanggapi isu tersebut. Ketua KPSI, Toni Aprilani, mengatakan pihaknya menolak utusan dari klub Indonesian Premier League (IPL), termasuk Persiraja. Seperti diketahui, KPSI mayoritas didukung klub-klub Indonesian Super League (ISL). Toni menjelaskan bahwa keputusan ini diambil bukan karena sentimen terhadap IPL dan ISL, namun untuk membuktikan bahwa KPSI tidak aji mumpung menggalang dukungan dengan melanggar kaidah yang berlaku. Padahal akan sangat menguntungkan bagi KPSI jika memanfaatkan kehadiran Persiraja. Pasalnya, selain anggota PSSI, mereka juga memiliki hak suara. Sesuai statuta PSSI, perwakilan anggota harus membawa surat mandat yang ditandatangani ketua dan sekretaris umum. “Persiraja dengan terpaksa kita tolak karena tandatangannya tidak lengkap. Surat mandat yang mereka bawa hanya ditandatangani oleh

sekretaris umum,” ujar Toni sebelum acara makan malam bersama di Hotel Mercure, Jakarta, Sabtu (17/3) malam. Untuk membuktikan KPSI tidak diskriminatif, Ketua KPSI menyebutkan sejumlah klub yang berkompetisi di divisi bawah yang berada dalam satu sistem kompetisi dengan IPL. “Ada Persikad Depok, Persikab Bandung, dan PSB Bogor. Itu yang saya tahu dari Jawa Barat. Dari Jawa Timur ada Persenga Nganjuk dan beberapa klub lagi,” lanjut mantan Ketua Pengprov PSSI Jabar itu. “Mereka tetap kami terima. Nggak ada masalah meski mereka klub (dari sistem kompetisi yang sama dengan) IPL,” tegasnya. Meski demikian, utusan dari Persiraja tetap diterima dalam kongres sebagai peninjau tanpa memiliki hak keanggotaan. KPSI menggelar KLB di lokasi yang sama untuk memilih pengurus baru PSSI. Dalam KLB itu, La Nyalla Mattalitti terpilih menjadi Ketua Umum PSSI didampingi Rahim Soekasah sebagai Wakil Ketua Umum PSSI. La Nyalla mendapat dukungan mutlak dengan koleksi 79 suara, sedangkan dua suara jatuh kepada Gusti Randa. Sebelumnya, Ketua Umum Persiraja, Ir Zahruddin, terkesan kaget saat ditanyai keikutsertaan klubnya di KPSI. Namun, dia mengaku hanya ikut Kongres PSSI di Palangkaraya. (b07)

Salomo Lanjut Pimpin POBSI Sumut

Semangat Chaldera Tiru Chelsea MEDAN (Waspada): Mengenakan kaus tim kandang serba biru milik Chelsea, semangat Chaldera United pun menyerupai The Blues kala meraih kemenangan dramatis di pentas Liga Champions pertengahan pekan lalu. Tampil di hari pembuka Liga Futsal Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan menyambut Dies Natalies ke-25, Sabtu (17/ 3), Chaldera menggapai kemenangan fantastis atas De Bargeszt yang juga juara bertahan. Dimotori Thomas Sembiring dan Adil Syahputra, Chaldera menang telak 5-1. Kelima gol tim stambuk 2010 ini disumbangkan Thomas (2), M Nauri (2), dan Adil. Sementara itu, gol penghibur De Bargeszt dicetak Andi Arispati. “Kami memang lagi tampil serba Chelsea tahun ini. Bahkan, semangat juang John Terry cs pun kami jadikan motivasi saat melawan juara bertahan di laga


MANTAN Anggota Komite Eksekutif (Exco) PSSI, La Nyalla Mahmud Mattalitti, terpilih sebagai Ketua Umum PSSI dalam Kongres Luar Biasa (KLB) yang digelar Komite Penyelamat Sepakbola Indonesia (KPSI) di Jakarta, Minggu (18/3).

SEI BALAI (Waspada): Dalam pidato pembukaan turnamen sepakbola Sei Bejangkar Cup U-21, Bupati Batubara H OK Arya Zulkarnain SH MM berharap ajang tersebut dapat melahirkan bibit sepakbola berkualitas untuk tim Kabupaten Batubara. Di hadapan 16 klub peserta turnamen yang memperebutkan piala bergilir Bupati Batubara di lapangan Desa Siajam Sei Balai baru-baru ini, OK Arya juga meminta pemain menjunjung tinggi sportivitas dan fair play. Bakhtiar Yus selaku panitia melaporkan turnamen diikuti 16 klub kecamatan se Kabupaten Batubara dan diprakarsai tokoh pemuda daerah Siajam, H Budiyanto yang juga Ketua Kadin Batubara. Selain itu, turnamen juga didukung Kacab BRI AsahanBatubara selama satu bulan ke depan. Ketua DPRD Batubara, Selamat Arifin, meminta peserta menampilkan permainan berkualitas, jujur, fair play, dan turut memberi apresiasi kepada H Budiyanto yang peduli terhadap pesepakbolaan di Batubara. Turut hadir di antaranya KONI Sumut yang diwakili Mukhtar Aritonang, Ketua KONI Batubara Hadi Suriono, Kacab BRI AsahanBatubara, dan Ketua Pengcab PSSI Batubara Ali Hatta. (a12)

Waspada/Dedi Riono

KETUA Dewan Guru Lemkari Sumut, Maryono, memimpin latihan gabungan anak didiknya jelang menghadapi Kejuaraan Karate PialaWali Kota Medan di Gedung Dishub Sumut di Medan, Minggu (18/3).

MEDAN (Waspada): Salomo TR Pardede SE secara aklamasi kembali dipercaya memimpin Pengprov POBSI Sumut periode 2012-2016 untuk kedua kalinya melalui Musorprov di Pardede Hotel Medan, 17-18 Maret 2012. Sekira 13 Pengcab POBSI se-Sumut dengan bulat mendukung Salomo kembali memimpin organisasi biliar Sumut untuk empat tahun ke depan. Seluruh Pengcab menilai Salomo mampu membangkitkan prestasi biliar Sumut dalam empat tahun terakhir. Musorprov POBSI Sumut sebelumnya dibuka resmi oleh Sekjen PB POBSI, Soedarianto, Sabtu (17/3). Dalam sidang pleno tentang laporan pertanggungjawaban Ketua Umum Pengprov POBSI Sumut periode 2008-2012, secara bergantian 13 Pengcab menerima sekaligus mendukung Salomo kembali memimpin POBSI Sumut. Beberapa prestasi telah diraih selama empat tahun kepengurusan, di antaranya meraih medali perunggu di PON XVII Kaltim 2008 lalu dalam

tiga bulan perdana pimpinan Salomo. Setelah itu, beberapa prestasi diraih di Kejurnas dan terakhir meloloskan delapan atlet ke PON 2012 di Riau. “Saya siap menjalankan amanah Musorprov POBSI Sumut tahun ini dan akan selalu komit meningkatkan prestasi biliar Sumut. Untuk itu saya mohon dukungan semua pihak, terutama Pengcab POBSI yang ada di Sumut untuk bersama meningkatkan pembinaan atlet,” ucap Salomo. “Saat ini, POBSI Sumut sedang konsentrasi mempersiapkan atlet ke PON Riau. Saya berharap pada PON nanti, Sumut bisa mencatat sejarah baru dengan meraih medali emas,” pungkas Salomo. Ketua Panitia Musorprov POBSI Sumut, Sunardi Ali BSc, mengatakan 13 Pengcab peserta Musorprov adalah Medan, Langkat, Tebingtinggi, Pematangsiantar, Labuhanbatu, Dairi, Binjai, Deliserdang, Tanah Karo, Labusel, Labura, Padanglawas, dan Pakpak Bharat. (m42)

Pelti Medan Realisasi Masukan Klub MEDAN (Waspada): Rapat Kerja (Raker) Pelti Kota Medan 2012 di Hotel Dharma Deli, Jl Balai Kota Medan, Minggu (18/3), dimanfaatkan pengurus klub dalam menyampaikan aspirasi dan berbagai masukan guna memajukan olahraga tenis di kota ini. Beberapa poin masukan dari pengurus klub yang dianggap penting di antaranya Pelti Medan harus melakukan kerjasama dengan instansi/ perusahaan sebagai bapak angkat dalam mendukung penyelenggaraan pembinaan. Poin berikutnya Pelti Medan diharapkan melakukan sosialisasi ke sekolah-sekolah dalam menjaring bibit atlet potensial di kalangan pelajar. Selanjutnya Pelti Medan meningkatkan sarana prasarana, khususnya lapangan indoor yang masih belum dimiliki. “Pada prinsipnya semua masukan dari rekanrekan pengurus klub sangat bagus. Dalam hal ini, Pelti Medan akan berupaya segera merealisasikan dengan baik, demi kemajuan olahraga tenis di Medan,” ujar Ketua Pengkot Pelti Medan, Ir Mamora Sirait. Dikatakan, setidaknya ada tiga poin penting yang patut dicermati, yakni soal kerjasama dengan instansi, road show ke sekolah-sekolah,

dan peningkatan sarana prasarana. Khusus kerjasama dengan instansi, pihaknya akan segera menjajaki terutama dalam mendukung penyediaan lapangan hard court (semen) yang memang sangat dibutuhkan. Mamora menjelaskan saat ini hampir semua event skala nasional menggunakan lapangan hard court, sedangkan Pelti Medan sendiri baru punya lapangan tanah liat milik Pemko Medan. Hal ini kerap menjadi kendala bagi atlet karena harus kembali beradaptasi dengan lapangan berbeda. “Kita sudah ajukan permohonan kepada Pemko Medan untuk alih fungsi lapangan hoki Kebun Bunga menjadi lapangan tenis hard court indoor. Izin sudah ada, namun yang jadi masalah pihak yang membangunnya. Namun, kita akan terus jajaki kerjasama dengan instansi-instansi agar pembangunan itu bisa terealisasi,” pungkasnya. Ketua Panpel Raker Pelti Medan, Taufiqurrahman, didampingi Maimun Masri (Sekretaris) mengatakan Raker yang dihadiri 17 utusan klub itu sesuai amanah AD/ART Pelti Medan yang mengharuskan digelarnya Raker minimal sekali dalam satu masa kepengurusan. (m42)

Coke Kicks Latih Bocah Delapan Desa MEDAN (Waspada): Permainan sepakbola sangat digemari masyarakat Indonesia terutama anak-anak, sehingga PT Coca-Cola Amatil Indonesia (CCAI) kembali memberi kontribusinya untuk kemajuannya di tanah air. Mengulang kesuksesan tahun lalu, CCAI kembali menyelenggarakan Coke Kicks Grass Root Soccer Development Program yang dilaksanakan pada Sabtu-Minggu (17-18/3) di Lapangan Rajawali Mabar, Kelurahan Mabar Hilir, Kecamatan Medan Deli. Sejumlah 240 bocah dan 16 pelatih dari delapan desa diundang mendapatkan pelatihan dibimbing pelatih profesional dan berpengalaman. Kegiatan dibuka Kadispora Kota Medan Drs Hanas Hasibuan didampingi Camat Medan Deli. “Coke Kicks adalah komitmen CCAI bagi tunas bangsa memaksimalkan potensi mereka dalam olahraga untuk menjadi bibit baru yang dapat mengharumkan nama bangsa di kemudian hari,” ujar Manufacturing Manager CCAI,Yustinus Suhartanto. Ahmad Nasoha, Corporate Affairs Manager CCAI, menjelaskan Coke Kicks adalah program CSR CCAI yang didesain membantu anak-anak mewujudkan mimpi lewat aktivitas yang men-

cerminkan gaya hidup aktif dan sehat. Program tahunan ini dilaksanakan secara nasional pada Januari-Juni 2012 di lebih dari 20 provinsi di Indonesia. “Tahun lalu, Coke Kicks telah melibatkan sekitar 2100 anak-anak usia 12-16 tahun . Untuk tahun ini, Coke Kicks akan melibatkan 4200 anak dan 280 pelatihnya dari 140 desa yang tersebar di seluruh nusantara,” ujarnya. CCAI bekerja sama dengan Asian Soccer Academy (ASA) dan Kelme yang telah berpengalaman lebih dari delapan tahun dalam pembinaan sepakbola. Nantinya, peserta akan dilatih pelatih bersertifikat dari ASA serta mendapatkan lima paket perangkat sepakbola dari CCAI, termasuk seragam Kelme. “Kami juga mengadakan coaching clinic untuk pelatih di setiap desa guna membekali mereka dengan dasar-dasar permainan sepakbola dan teknik melatih yang baik,” ujar Lee Hawkins, Manajer Yayasan ASA. Coke Kicks 2012 akan dilaksanakan berkesinambungan di Bekasi, Sumedang, Surabaya, Pasuruan, Bawen, Magelang, Semarang, Solo, Medan, Aceh (Langsa), Riau, Lampung, Balikpapan, Padang, Palembang, Bali, Lombok, Makassar, Ternate, Ambon, dan Papua. (h03)

Sport A12 Federer Dapat Tantangan Raksasa INDIAN WELLS, AS (Waspada): Sempat ditunda tiga jam karena hujan deras, Roger Federer akhirnya sukses mengalahkan Rafael Nadal 6-3, 6-4 di semifinal Turnamen Indian Wells, di California, Minggu (18/3). Dengan demikian, Federer akan menghadapi petenis raksasa tuan rumah, John Isner, di final pada Senin (19/3) ini. Menghadapi Federer, Nadal tidak kuasa membendung performa hebat petenis Swiss itu dalam pertemuan ke-28 antara mereka. Dari 28 duel tersebut, Federer menang 10 kali dan si kidal asal Spanyol menang 18 kali. MaestroSwissitumelepaskan forehand, backhand, drop shot, dankombinasivoliyangluarbiasa. Petenis peringkat tiga dunia itu pun mengakhiri perlawanan Nadal dalam 41 menit di set pertama dan 50 menit di set kedua dengan total 1 jam 31 menit. “Saya tahu betapa bagusnya permainan saya tadi. Saya sangat senang dengan performa saya. Secara fisik dan mental, saya sangat segar yang mana ini cukup mengejutkan,� kata Federer seusai laga. Nadal pun besar hati mengakui kekalahannya. Ini merupakan kekalahan kedua peraih 10 gelar grand slam tersebut dari enam pertemuan terakhirnya dengan Federer. Dengan sportif, Nadal mengakui Federer bermain fantastis dan persentase servisnya pun nyaris sempurna.

Dallas Penguasa Texas DALLAS, AS (Waspada): Juara bertahan Dallas Mavericks perlahan-lahan bangkit dengan membuktikan diri sebagai penguasa negara bagian Texas berkat kemenangan atas San AntonioSpurs106-99diAmerican Airlines Center, Minggu (18/3). Pahlawan kemenangan Mavericks adalah Dirk Nowitzki yang berhasilmengemas27poin.Point guard veteran Dallas, Jason Kidd, jugatampilluarbiasasetelahpemain berusia 38 tahun ini terlihat 10 tahun lebih muda berkat torehan 14 angka 10 assist atau doubledoubleke-486sepanjangkariernya. Laga sesama tim dari negara bagianTexas ini juga menjadi laga reguler ke-1.302 bagi Kidd sepanjang kariernya. Catatan ini menjadikannya sebagai pemain terbanyak ke-11 yang tampil di NBA. Kidd kini menjadi pemain aktif dengan penampilan terbanyak di NBA dan menyamai rekor milik Elvin Hayes. Kemenangan atas Spurs ini merupakan kemenangan ketiga Dallas berturut-turut setelah sebelumnya menekukWashington Wizards dan Charlotte Bobcats. Tiga kemenangan berturutturut ini menjadi tanda kebangkitan Dallas setelah dalam 12 hari sebelumnya mencatat rekor 2-7. Dengan hasil ini, Mavericks kini bersaing dengan Memphis Grizzlies untuk memperebutkan posisi kelimaWilayah Barat. Sementara itu, Spurs masih kokohdiposisikeduaklasemenWilayah Barat. Di United Center, absennya Derrick Rose tidak menyurutkan Chicago Bulls. CJ Watson yang menggantikan Rose tampil gemilang dan membawa Bulls menang atas Philadelphia 76ers 8980.Watson sukses membukukan 20 poin plus tiga assist dalam laga perdananya pascacedera engkel. Center Bulls, Joakim Noah, berhasil mencetak 13 angka 11 assist, sedangkan Carlos Boozer menyumbang 11 angka. Dari bangku cadangan, Kyle Korver dan Taj Gibson sama-sama menambah 11 poin. Kemenangan inipunmengokohkanposisiBulls di puncak Wilayah Timur, sedangkan Sixers masih tertahan di peringkat empat. Di Indianapolis, kehadiran Mike Woodson sebagai pelatih baru terus membawa New York Knicks menang. Kali ini, Knicks menang102-88atasIndianaPacers atau kemenangan ketiga Knicks berturut-turutdibawahWoodson. Sebelumnya,Knicksmenang115100 juga atas Indiana Pacers dan 121-79 atas Portland Trailblazers. Melawan Pacers, Jeremy Lin mencetak19angkaplusenamassist, dantujuhrebound.SelainLin,Amare StoudemiredanCarmeloAnthony juga tampil apik di mana masingmasing membuat 16 angka. Kini, Knicks masih berada di peringkatdelapanWilayahTimurdanPacers di posisi kelima. Hasil lain: LA Clippers vs Houston Rockets 95-91, Charlotte Bobcats vs Toronto Raptors 107-103, New Orleans Hornets vsNewJerseyNets102-94,Denver Nuggets vs Boston Celtics 98-91, dan Utah Jazz vs Golden State Warriors 99-92. (m33/ap)

Sementara itu, John Isner membuat kejutan besar dengan melaju ke final. Hebatnya, petenis Amerika Serikat (AS) ini mengamankan tiket partai puncak dengan menyingkirkan raja tenis duniaasalSerbia,NovakDjokovic. Isner sejatinya tidak diunggulkan saat bersua Djokovic, na-

mun petenis berusia 26 tahun mampu membalikkan semua prediksi dengan meraih kemenangan 9-7, 3-6, 7-6 (5). Kunci kemenangan petenis jangkung itu terletak pada servisnya di set ketiga. Di sini, Isner mengandalkan servis keras sebagai andalan dan mampu membuat Djokovic kewalahan.Tercatat, petenis yang sempat mencetak sejarah pertandingan terlama di ajangWimbledon ini sukses melakukan 20 ace dengan salah satu servisnya mencapai kecepatan 135km/jam. Layaknya Nadal, Djokovic juga menerima kekalahannya

dengan lapang dada. Petenis berusia 24 tahun ini bahkan secara terang-terangan mengakui bahwa servis keras Isner membuatnya tak bisa berbuat banyak dan frustrasi karenyanya. Di final putri,Victoria Azarenka akan bersua Maria Sharapova. Azarenka, unggulan utama asal Belarus, lolos dengan menyingkirkan Angelique Kerber (Jerman) 6-4, 6-3 dan Sharapova yang kini ditempatkan sebagai unggulan kedua meraih kemenangan setelah Ana Ivanovic (Serbia) mengundurkan diri di set kedua karena cedera dalam kedudukan 6-4, 0-1. (m33/ap)

WASPADA Senin 19 Maret 2012


PETENIS Swiss, Roger Federer (kanan), berusaha menghibur Rafael Nadal yang dikalahkannya pada semifinal Indian Wells, Minggu (18/3).

Laporan Khusus

WASPADA Senin 19 Maret 2012


Dubai Indah Mempesona Pembangunan Proyek Inovatif Dan Mercusuar Tercepat Di Dunia Laporan Waspada Dari Dubai, Uni Emirat Arab TANDA PANAH: Hasil pembangunan Pulau Palem berupa hotel dan perumahan, dilihat dari arah laut menghadap ke kota Dubai.

PULAU PALEM, TIDAK KHAWATIR DENGAN TSUNAMI: Pulau Palem di pantai Jumeirah, berisi hotel-hotel dan perumahan, dihubungkan ke kota Dubai dengan jembatan melalui batang pohon. Tampaknya, tsunami hanya akan numpang lewat untuk memusnahkan pulau buatan itu, tapi hal itu tidak menjadi kekhawatiran pemerintah dan para ahli. Secara seismik, Dubai berada di zona yang sangat stabil — jalur patahan seismik terdekat, Patahan Zargos, terletak 120 km dari UEA dan tidak mungkin memberi dampak apapun terhadap Dubai. Para ilmuwan juga memperkirakan bahwa kemungkinan tsunami di wilayah itu kecil karena perairan Teluk Persia tidak cukup dalam untuk membuat tsunami.

Toto, Juru Masak Hotel Mewah Di Dubai


Senang Tapi Tetap Ingin Pulang Toto Sunarto, 50, termasuk warga Indonesia yang beruntung bekerja di Hotel Burj Al Arab di Dubai, Uni Emirat Arab. Hotel bintang tujuh itu menjadi hotel terkenal di dunia selain karena arsitekturnya, juga karena tarifnya yang mahal dan kualitas layanannya yang luar biasa. Harga kamarnya (pesan lewat Agoda) termurah AS$2450 (Rp22juta lebih) dan termahal Rp45juta per hari. Seminggu di hotel itu sudah sama dengan harga mobil baru. Meski bergaji besar, Toto mengaku tidak pernah lupa akan Indonesia.’’Walau gaji besar, kita tetap akan pulang ke Indonesia,’’ terangnya saat berbincang dengan Waspada di apartemennya yang asri di kawasan properti Al Jumeirah. Dia beristrikan Eva Sari Muliati serta beranak dua, Silvia dan Reza Azakia Bagaimana sampai dia terdampar di negeri kaya itu?Toto pun bercerita.Tahun 1981, dia bekerja sebagai chef (juru masak) di Hotel Sari Pan Pacific, Jakarta. Tidak berapa lama kemudian pria asli Tasikmalaya, Jawa Barat itu pindah ke Sumitmas Building, juga sebagai chef di restoran Jepang. Dia mengaku tidak puas hanya bekerja di restoran, dia mulai mencoba keberuntungan di hotel Atlet Century Park, kawasan Senayan, Jakarta sebagai Japanese lokal chef tahun 19921995. Karena di Century bintang 4,Toto kemudian pindah ke Hotel Shangrila, posisi sama tetapi gaji berbeda karena bintang 4 ke bintang 5. ‘’Saya belum puas, kalau kita lihat perkembangan zaman, dengan gaji yang sedikit paspasan. Saya punya chef dari Italia namanya Luigi Girosa. Luigi pindah dari Indonesia tahun 1998 ke Dubai. Ternyata Luigi punya rencana, akan membuka restoran Jepang di sebuah hotel di Dubai. Dia kemudian menghubungi saya. Karena menurut saya dia chef yang baik, maka tahun 2000, saya bertekad harus ikut dia. Dan alhamdulillah ternyata gaji dibandingkan dengan Indonesia beda jauh, Jadi sudah 12 tahun saya di Dubai,’’ urai Toto. Toto mengaku, perbandingan pendapatan di Dubai sangat jauh dibandingkan saat bekerja di Indonesia. Tanpa menyebutkan jumlah gaji yang diterimanya, dia merasa senang bekerja di Dubai karena negara tidak mengutip pajak, punya akomodasi yang disediakan perusahaan berikut dengan perabotannya. Utility seperti air, listrik juga dibayar perusahaan termasuk transportasi ke tempat pekerjaan. Baginya hal itu sudah lebih dari cukup, apalagi kemudian, anak-anaknya bisa bersekolah di sana. Jadi hal itu membuatnya betah bekerja di Dubai. Di apartemennya, Toto memperoleh fasilitas dua kamar tidur. Anak-anak tidur di kamar sendiri, sesuai dengan peraturan. Dubai memiliki aturan yang ketat dalam keluarga. Jika satu keluarga memiliki anak, maka anaknya harus tidur terpisah dengan orangtuanya. Jadi anakanak harus memiliki kamar sendiri. Begitu juga dengan sekolahnya, anak-anak harus sekolah dan selepas usia 18 tahun sang anak harus memiliki pekerjaan sehingga tidak ada yang nongkrong duduk di pinggir jalan. Diakui Toto, pendidikan bagi anak-anaknya sangat membahagiakannya karena bisa bersekolah di sekolah yang baik di Dubai dan seorang putranya kini melanjutkan sekolah di Jakarta. Sementara putrinya yang cantik dan sudah mirip orang Arab, Silvia, sebentar lagi menyelesaikan bachelornya di Dubai University. Soal rindu suasana Indonesia, Toto menya-

takan, di Dubai para warga Indonesia membentuk persatuan Indonesia. Di sana beragam kegiatan dilaksanakan. Mulai dari arisan, pengajian, sepakbola, tidak ketinggalan untuk perayaan 17-an dengan pertandingan gaplek (domino). Disebutkan Toto, di Dubai sesuai mengikuti aturan pemerintah, maka jam kerja adalah 5 hari kerja dengan dua hari libur, Jumat dan Sabtu.’’Di situlah baru (warga Indonesia) berkumpul dan menikmati suasana Indonesia dengan minum kopi bersama di warung-warung Indonesia. Kita saling diskusi tentang apa saja dan kalau mau ngeban kita punya alat band. Dan kalau lebaran, khususnya tidak pulang kampung, kita semua lebaran di konsulat,’’ urai Toto. Namun bagi Toto, kerinduan akan kampung halaman tidak pernah padam walaupun bekerja dengan gaji yang sedap dan serba mendapat fasilitas. Kerinduan itu juga terkadang terobati manakala ada tamu dari Indonesia dibawanya singgah ke apartemennya. Seperti rombongan asal Medan yang datang ke apartemennya. Toto dan istri menyambutnya dengan nasi putih, mie instan yang dimasak secara ramai-ramai, ada tahu isi sebagai makanan pembuka dan juga nasi dan mie goreng. Semua makanan yang tersaji disantap habis rombongan asal Medan. Menurut Toto, kedatangan tamu seperti inilah yang bisa membuatnya melepas rindu kampung halaman. Namun terlepas dari itu semua, Toto punya niat kembali ke Indonesia jika anak-anaknya sudah menyelesaikan sekolahnya.’’Saya pingin pulang dan membuka restoran, itu saja untuk menikmati masa tua,’’ harap Toto. Itulah sebuah harapan mulia dari anak bangsa yang akan memberikan devisa bagi Negara sendiri. *Muhammad Zeinizen


JUTAAN ton batu disusun rapi sebagai bendungan dan benteng untuk Pulau Palem, sedang diperhatikan oleh Waspada. Uang APBN dan pinjaman luar negeri negara itu nampak hasilnya.


TAKSI DI DALAM MAL disediakan karena besar dan luas mal mencapai 2,1 juta m2, difoto bersama Bupati Sergai HT Erry Nuradi (kanan). Siapa capek jalan boleh naik.

BURJ KHALIFA (mengabadikan nama Presiden Uni Emirat Arab, Sheikh Khalifa bin Zayed Al Nahayan) berdiri di Dubai sebagai gedung tertinggi di dunia di banding gedung-gedung lainnya. Di dalamnya terdapat masjid tertinggi di dunia. Tinggi Makkah Clock Tower masih kalah tapi Arab Saudi tidak mau kalah karena sedang membangun Kingdom Tower setinggi 1.007 meter, siap tahun 2016.

INDAH, mempesona. Demikian kesan Waspada setelah dibawa jalan-jalan di kota Dubai dalam perjalanan pulang ke Indonesia dari negara kepulauan Seychelles, Afrika, pada minggu pertama bulan ini. “Ini lah kota wisata pantai pertama yang saya kagumi keindahannya dan kebersihannya. Mengalahkan kotakota wisata pantai di AS, Eropa dan Australia,” ujar Pemred Waspada H. Prabudi Said. Waspada berkunjung ke sana bersama rombongan Bupati Sergai HT Erry Nuradi, seusai menuai sukses dalam Carnaval International de Victoria 2012 di Victoria, Seychelles. Salah satu keistimewaan dan kemenangan Dubai terletak pada Palm Island, pulau buatan yang menjorok ke laut, sekitar 280 meter dari bibir pantai Jumeirah. Sesuai namanya, pulau buatan itu berbentuk pohon palem, dibuat dari timbunan pasir yang dikeruk dari dasar laut. Dibentengi juga oleh pulau buatan dimana daratannya dua meter lebih tinggi dari permukaan laut, sementara pinggiran luarnya diperkuat dengan susunan bebatuan sebagai penahan ombak besar. Hasil pembuatan pulau itu, digunakan untuk membangun sejumlah hotel, 2500 apartemen dan 1400 villa, dimana keluar masuk kenderaan bermotor dari pulau ke kota Dubai dan sebaliknya dihubungkan dengan jembatan dan terowongan bawah laut. Pemandangan di sekitar pulau terlihat indah sekali, terlebih jika kita berdiri di depan Hotel Atlantis menghadap ke laut Teluk Persia yang hijau dan tenang bersahabat. Pantainya putih bersih. Akan menyenangkan bagi setiap peminat wisata pantai. Bukan hanya Pulau Palem itu, Dubai juga membangun 300 pulau buatan dengan bentuk peta dunia, dinamakan The World (dunia) untuk diramaikan dengan berbagai pembangunan termasuk perhotelan dan perumahan. Di dalam kota Dubai sendiri, pusatpusat perbelanjaan yang kolosal berdiri megah, gedung-gedung pencakar langit menjulang tinggi dan infrastruktur berupa jalan yang besar, lurus dan mulus, menambah keindahan negeri itu. Gedung pencakar langit yang terkenal adalah Burj Khalifa, merupakan gedung pencakar langit tertinggi di dunia dan menjadi lokasi tertentu yang serba tertinggi dunia pula. Tingginya 824 meter, terdiri dari 158 lantai dimana di tingkat tersebut terdapat masjid tertinggi di dunia. Di lantai 143, sayangnya (karena berada di bawah masjid), terdapat night club tertinggi di dunia. Di lantai 124, dek observasi dapat melihat negara Iran sedangkan di lantai 76 terdapat kolam renang tertinggi di dunia. Rekor ketinggian gedung Burj Khalifa tersebut akan bertahan sampai bangunan yang lebih tinggi selesai dibangun tahun 2016 di Jeddah, Arab Saudi, dinamakan Kingdom Tower, setinggi 1007 meter. Berdekatan dengan Burj Khalifa, terdapat Dubai Mall, pusat perbelanjaan terbesar di dunia sebagai tempat shopping ekstravaganza, disebut juga sebagai“surga”nya tukang shopping (belanja). Bayangkan, luasnya mencapai 6,5 juta ft2 atau 2,1 juta m2, berisi pertokoan 2,4 juta ft2. Sangkin besarnya mal itu, pengunjung boleh naik taksi di dalam mal jika keletihan berjalan ke pintu keluar tempat parkir atau ingin pergi dari satu toko ke toko lainnya yang letaknya saling berjauhan. Di dalamnya terdapat berbagai toko barang beragam harga, restoran, akuarium raksasa, lapangan hoki es indoor untuk ice skating, dan lain-lain. Di luar mal-mal besar, agak sedikit ke pinggir kota, ada pasar murah dinamakan Global Village sebagai tempat festival shopping barang-barang kelontong produksi negara-negara Timur Tengah, Asia dan Eropa. Ramai masyarakat mengunjunginya karena harganya yang relatif murah tanpa harus pergi ke negara-negara tersebut. Di sana dapat dibeli tudung pashmina eksklusif produksi India, jaket kulit buatan Pakistan dan Turki serta suvenir-suvenir khas Mesir, disamping maduYaman, kurma Madinah dan barangbarang lainnya. Harga-harganya sangat terjangkau. Tidak kalah pentingnya bagi kami warga Indonesia, di kota itu terdapat beberapa restoran Indonesia berdiri di bangunan dan lokasi strategis dengan sajian makanan khas Indonesia. Saya merasa bagai berada di kampung halaman sendiri meskipun lingkungannya serba modern dengan gedung-gedung pencakar langit ala Manhattan di New York, AS. Masjid-masjidnya juga cantik-cantik, berada di lokasi yang tidak berdekatan. Itulah gambaran sekilas Dubai masa kini, pembangunannya demikian pesat dibanding sepuluh tahun lalu. Gurun pasir telah tersunglap jadi gedung-gedung mewah, kata Toto Sunarto, seorang WNI yang sudah menetap di sana selama 12 tahun, guide dan driver kami mengeliling Dubai di waktu siang dan malam hari. “Dulu ini padang pasir, pak, sekarang berdiri bangunan-bangunan bertingkat, baik perkantoran maupun pertokoan” katanya kepada Waspada menunjuk ke arah lokasi di depan hotel kami di tengah kota. Pembangunan kota itu melejit sejak Pemerintah Dubai memvariasikan pedagangan berbasis ekonomi minyak hingga layanan mengarah kepada pariwisata, membuat bisnis real estate maju pesat sejak tahun 2004-2006. Konstruksi dalam skala besar telah meletakkan Dubai sebagai salah satu kota dengan pertumbuhan tercepat di dunia. Pendapatan Uni Emirat Arab dari real estate dan konstruksi saja menyumbang 22.6 persen kepada ekonomi tahun 2005, Perdagangan 16 persen, sedangkan pendapatan minyak bumi dan gas alam kurang dari 6 persen (2006) dari total produk domestik bruto senilai AS$ 37 miliar (2005). Pada tahun 2011 anggaran belanja negara meningkat menjadi sebesar AS$ 41 miliar dari total $122 miliar hingga tahun 2013. Hingga saat ini Dubai adalah zona bebas pajak, tidak ada direct atau indirect taxes untuk mendukung biaya pembangunannya. Tidak pula ada kasino dan judi lotere untuk meningkatkan pendapatan negara sebagaimana dilakukan di banyak negara Barat. Semua proyek inovatif dan mercusuar di Dubai menjadi daya pikat tersendiri bagi dunia wisata, meningkatkan jumlah turis asing serta menggairahkan bisnis perdagangan dan properti/ real estate. Rata-rata sekitar enam juta turis asing berkunjung ke Dubai setiap tahun, empat kali dari jumlah penduduk Dubai sendiri, berdasarkan data tahun 2005-2006. Para turis asing itu keluar masuk bandara internasional Dubai yang besar dan modern, yang tercatat pada tahun berikutnya melayani 34 juta penumpang dengan 260.000 penerbangan. Keamanan turis pun terjamin, demikian pula dunia usaha aman dari preman, rampok dan pungli. Terlepas dari tunggakan utang luar negeri Dubai sebesar AS$26 miliar (sempat dibuat perjanjian refinancing pada pertengahan tahun 2011 akibat terjadinya booming real estate dan kredit macat), kemajuan pembangunan Dubai yang dilakukan oleh pemerintah PM Sheikh Mohammad Al Maktoum itu patut dipuji. Sebagai pemilik grup (Jumeirah) dari berbagai proyek inovatif dan mercusuar itu, Sheikh Al Maktoum tidak hanya memikirkan pembangunan untuk kepentingan golongan “the haves”. Dia mencoba memperkecil jurang pemisah dengan memberikan kesejahteraan sebagian rakyatnya/karyawannya, antara lain membangun kompleks-kompleks apartemen fully furnished sebagai tempat hunian gratis. Ada ribuan orang mendapat fasilitas apartemen gratis di kompleks itu Adalah Toto Sunarto, seorang WNI yang bekerja sebagai chef di hotel Burj Al Arab (milik grup Sheikh Al Maktoum), termasuk orang yang beruntung menikmatinya. Dia dan keluarganya menghuni sebuah apartemen dengan dua kamar tidur secara cumacuma. Demikian pula perabotan ruang tamu, tempat tidur, isi dapur termasuk kulkas dan televisi, semuanya sudah lengkap tersedia (fully furnished) tanpa beli. Pendidikan anak-anaknya digratiskan pemerintah sampai usia 18 tahun. Air dan listrik juga gratis. Transportasi ke tempat pekerjaan disediakan. Gaji yang diterima besar, lebih dari cukup sebagai tabungan masa depan. Bagi Toto, semua fasilitas ini, semua hasil pembangunan di Dubai masa kini, merupakan nikmat Allah di negeri muslim ini. “Alhamdulillah,” ujarnya mensyukuri. “Semuanya sudah ada disini, pak. Surga dunia sudah dapat nih, pak,” ujar Toto tersenyum. Memang, Toto hanya diantara sejumlah besar rakyat setempat dan tenaga kerja pendatang yang beruntung. Tentu sejumlah besar lainnya masih mengharap-harap pemerataan dan keadilan sebagaimana diberitakan media massa Barat di internet. Mereka menunggu giliran sejahtera dari pemerintah Sheikh Al Maktoum. Muhammad Zeinizen

Sumatera Utara

B2 Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:35 12:49 12:36 12:43 12:43 12:39 12:36 12:32 12:38 12:38

‘Ashar 15:44 16:00 15:44 15:54 15:53 15:44 15:44 15:39 15:47 15:48

Magrib 18:39 18:52 18:40 18:47 18:46 18:43 18:40 18:35 18:42 18:42



Shubuh Syuruq


19:47 20:00 19:48 19:55 19:54 19:51 19:48 19:43 19:50 19:50

05:05 05:18 05:06 05:13 04:12 05:09 05:06 05:01 05:08 04:08

05:15 05:28 05:16 05:23 05:22 05:19 05:16 05:11 05:18 05:18

L.Seumawe 12:42 L. Pakam 12:35 Sei Rampah12:34 Meulaboh 12:46 P.Sidimpuan12:34 P. Siantar 12:35 Balige 12:35 R. Prapat 12:31 Sabang 12:49 Pandan 12:36

06:29 06:43 06:30 06:37 06:37 06:33 06:30 06:25 06:32 06:32

Zhuhur ‘Ashar 15:54 15:45 15:45 15:57 15:40 15:44 15:43 15:39 16:02 15:43




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:45 18:39 18:38 18:49 18:37 18:38 18:38 18:35 18:52 18:39

19:54 19:47 19:46 19:58 19:46 19:46 19:46 19:43 20:01 19:47

05:12 05:05 05:04 05:16 05:04 05:05 05:04 05:01 05:19 05:06

05:22 05:15 05:14 05:26 05:14 05:15 05:14 05:11 05:29 05:16

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:36 12:37 12:47 12:40 12:37 12:43 12:32 12:42 12:35 12:34

18:39 18:41 18:50 18:43 18:40 18:47 18:35 18:45 18:39 18:38

19:47 19:49 19:58 19:51 19:48 19:55 19:43 19:54 19:47 19:46

05:05 05:07 05:17 05:10 05:07 05:13 05:02 05:12 05:05 05:04

05:15 05:17 05:27 05:20 05:17 05:23 05:12 05:22 05:15 05:14

Panyabungan 12:32 Teluk Dalam12:39 Salak 12:37 Limapuluh 12:33 Parapat 12:35 GunungTua 12:32 Sibuhuan 12:32 Lhoksukon 12:42 D.Sanggul 12:36 Kotapinang 12:30 AekKanopan 12:32

06:37 06:30 06:29 06:40 06:28 06:29 06:29 06:25 06:44 06:30

15:43 15:46 15:59 15:48 15:47 15:55 15:41 15:52 15:43 15:44

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Batangkuis Siap Ikuti MTQN Tingkat DS BATANGKUIS (Waspada): Kecamatan Batangkuis Kab. Deliserdang siap mengikuti Musabaqah Tilawatil Quran (MTQN) ke 45 serta FSN tingkat Kab. Deliserdang, yang akan digelar 22 Maret mendatang di Desa Sampali Kec. Percut Sei Tuan. Hal ini dikatakan Marjuki Hasibuan, S.Sos selaku ketua panitia kafilah Kec. Batangkuis, didampingi salah seorang pelatih Al Ustad Syaiful Nasution di kantor Camat Batangkuis, kemarin. “Kita berharap para peserta dapat mengikuti setiap kegiatan yang diperlombakan dengan sungguh-sungguh, dan menampilkan segala kemampuan yang dimiliki dengan hasil maksimal sehingga mengharumkan nama Kecamatan Batangkuis.” Hal sama dikatakan Kepala Kantor Urusan Agama (Ka. KUA) Kec. Batangkuis, Suhardi Harahap, SAg, MM. Menurutnya, guna memperoleh hasil membanggakan tentu harus banyak latihan. Ditambahkan, sesuai arahan Camat Batangkuis TM Zaki Aufa, S.Sos dalam rapat persiapan pembentukan susunan kapanitiaan, bahwa seluruh peserta yang mengikuti perlombaan di arena MTQN ini berasal dari Kecamatan Batangkuis.(crul)

Oknum PNS RS Tanjungpura Diboyong Ke Mapolres Langkat STABAT (Waspada): Oknum PNS Rumah Sakit Tanjungpura, NA, 26, warga Kwala Begumit Kec. Binjai, Kab. Langkat dibawa polisi ke Mapolres Langkat terkait pengutipan uang atas pinjaman di bank, Kamis (15/3) pagi. Korban yang merasa dirugikan, Mardiana Agustina, 36, merupakan istri anggota Polres Langkat, Doni. Menurut sang suami, korban meminjam uang di bank Rp124 juta, namun pihak rumah sakit meminta dua persen dari jumlah pinjaman tanpa alasan jelas. Saat korban memberikan uang sebagaimana jumlah yang diminta, NA selaku bendahara penerima uang langsung diringkus dan dibawa ke Mapolres Langkat. Pantauan Waspada, hingga Kamis siang NA belum juga membeberkan siapa yang menyuruhnya mengutip uang. Secara terpisah, Direktur RSTanjungpura SadikunWinarto yang dikonfirmasi karena namanya dikaitkan dengan kutipan tersebut, membantah. “Itu hanya urusan pribadi mereka, saya tidak tahu menahu,” katanya. Sementara Kasat Reskrim Polres Langkat AKP Aldi Subartono belum dapat berkomentar banyak, karena korban masih diperiksa. “Saya belum menerima laporan pengaduan,” ujarnya.(a03)

Lapak PKL Bandar Klippa Ditertibkan PERCUT SEITUAN (Waspada):Trantib bersama Muspika Percut Sei Tuan, Kabupaten Delisedang menertibkan lapak pedagang kaki lima(PKL)didepankantorPTPNII,Rabu(14/3)sore.Penertibandipimpin Kasi Trantib Kecamatan Percut Sei Tuan, HM. Irsyam, SH. Menurut Irsyam, keberadaan PKL melanggar Peraturan Daerah (Perda) Kabupaten Deliserdang. Selain itu dianggap merusak penataan serta berada di atas ruas jalan protokol. ‘’Percut Sei Tuan digaungkan sebagai bakal kota baru, sehingga akan terus-menerus dilakukan pembenahan di tiap jalan protokol dan kawasan rawan macat lalulintas, seperti di Simpang Jodoh, Pasar VII, Desa Bandar Klippa,’’ jelas Irsyam. Diajugamenyebutkan,ituprogramrutindisampingmemperindah kawasan yang dianggap menjadi perlintasan strategis. Kita berharap semua pihak dan elemen masyarakat mendukung Percut Sei Tuan menjadi wilayah aman dan rapi sesuai harapan masyarakat.(m34)

Satu Rumah Ludes Terbakar TANJUNGMORAWA (Waspada): Rumah Sugiarto, 52, di Jalinsum Medan-Lubukpakam Km 19, Dusun IV, Desa Tanjung Baru Tanjungmorawa ludes dilalap api, Kamis (15/3). Meski tak ada korban jiwa, namun kerugian mencapai ratusan juta rupiah. KepolisianSektorTanjungmorawamasihmencarikepastianpenyebab terjadinya kebakaran. Namun beberapa warga mengatakan api terlihat dari kamar Sugiarto. Dugaan sementara, terjadi korsleting listrik di AC. Petugas pemadam kesulitan menjinakkan api, dikarenakan lokasi rumah di gang sempit, sehingga petugas pemadam memarkirkan mobil di tepi Jalinsum. Sementara peristiwa itu sempat membuat macet lalulintas Tanjungmorawa - Medan. (a07)

BPN Sergai Targetkan 5.000 Bidang Sertifikat SEIRAMPAH(Waspada):BadanPertanahanNasionalKab.Serdang Bedagai (BPN Sergai) pada 2012 menargetkan penerbitan 5.000 bidang (persil) sertifikat tanah. DemikiandikatakanKakanBPNSergai,DaniSudiarta,STdidampingi Kasubsi Perkara Pertanahan, Sofyan Hadi Syam, SH kepada Waspada, Jumat (16/3), di kantornya Jl. Negara, Desa Firdaus, Kec. Sei Rampah. “Untuk 1.500 bidang sertifikat melalui program Proyek Nasional Agraria (Prona), sedangkan 3.500 bidang melalui Program Perubahan Agraria Nasional (PPAN),” kata Dani. Untuk peningkatan pelayanan pertanahan pada masyarakat, BPN SergaimenggalakkanLayananRakyatUntukSertifikasiTanah(Larasita), yang berarti kantor pertanahan bergerak dan terjadwal dengan satu unit mobil layanan . “Layanan Larasita juga diperuntukkan menangani konflik pertanahan serta sosialisasi pertanahan,” ungkap Dani.(c03)

Zhuhur ‘Ashar 15:38 15:45 15:46 15:43 15:44 15:39 15:38 15:54 15:44 15:38 15:41




Shubuh Syuruq

18:36 18:43 18:41 18:37 18:39 18:36 18:36 18:45 18:39 18:34 18:36

19:44 19:51 19:49 19:45 19:47 19:44 19:44 19:53 19:47 19:42 19:44

05:02 05:09 05:07 05:03 05:05 05:02 05:02 05:12 05:06 05:00 05:02

05:12 05:19 05:17 05:13 05:15 05:12 05:12 05:22 05:16 05:10 05:12

06:26 06:33 06:31 06:27 06:29 06:26 06:26 06:36 06:30 06:24 06:26

Pria Beristri Perkosa Dan Membunuh TEBINGTINGGI (Waspada): R, 23, warga Dusun VIII Bahtonang, Desa Penggalian, Kec. Tebing Syahbandar, Kab. Serdang Bedagai, nekad memperkosa dan membunuh karena cintanya pernah ditolak korban, Sri Julianti, 17, warga Desa Penggalian, Kec. Tebingtinggi, Kab. Sergai. Gadis itu ditemukan warga menjadi mayat di areal perkebunan PT. Paya Pinang, Kec. Tebingsyahbadar, Kab. Sergai, Rabu (14/3) lalu. Sementara tersangkaR,akhirnyaditangkappolisi dari tempat persembunyiannya di Besitang, Kabupaten Langkat, Sabtu (17/3) sekira pukul 02:00. Tersangka ditangkapTim SatuanPolresTebingtinggidipimpin Kapolres, AKBP Drs. Andi Rian Djajadi, S.Ik dari tempat persembunyian di rumah sepupunya trans Blok A, Besitang, Langkat. Pengakuan tersangka, perbuatan itu dilakukannya Senin (12/3). Saat itu ia sengaja lewat didepanrumahkorbanSriJulianti, saat hendak bekerja di Kota Tebingtinggi sebagai buruh bangunan. Karena korban juga hendak pergi bekerja di Kota Tebingtinggi, maka tersangka mengajaknya pergi bersama. Ajakan itu tidak ditolak korban, karena kenderaan yang biasa ditumpanginya sedang rusak. “Di tengah perjalanan di atas sepedamotorSuzukiSpinBK5017 XU, kami memutuskan tidak masuk kerja dan dia saya ajak jalanjalankePantaiPerjuangan(Pantai Jono) di Kuala Tanjung, Kab.

Batubara. Ajakanku tak ditolak sehingga kami berdua menuju arah tempat wisata pinggir laut itu,” kata R. Hingga sore, usai menikmati pemandangan alam pantai, mereka pulang. Namun keduanya tidak langsung pulang ke rumah, melainkanmemotongjalanlewat perkebunansawitPTPayaPinang. Karenacintanyapernahditolakoleh korban,timbuldendamtersangka. Niat jahat pun muncul. Sepedamotornya dibelokkan ke perkebunan kelapa sawit yang jauh dari pemukiman warga. Tersangka mulai beraksi dengan membujukrayukorbanagarmau disetubuhi.Tapi korban menolak bahkan melakukan perlawanan, sehingga tersangka marah lalu memukulkorbanhinggaterjatuh. Dalam kondisi lemah, tersangka mengambil obeng dari jok sepedamotor dan menikamkannyaberulangkaliketubuhdan leher korban. Itu dilakukan karena korban terus berontak dan berusaha berteriak. Meski sudah tak berdaya, namun R masih memukul bagian belakang dan wajah korban. Setelah korban benar-benar tak bergerak meski belum tewas, tersangka pun

menyetubuhinya hingga dua kali. Usaimelampiaskannafsubejatnya, tersangka meninggalkan korban dalam kondisi kejangkejang meregang nyawa. “Saya tinggalkan.Akukaburmengambil handphone dan uang di dompetnya Rp30 ribu. Tas dan handphonenya ku buang ke Sungai Bahilang,” aku tersangka. Kemudian Selasa (13/3) sekira pukul 10:00, tersangka yang sudah beristri dan baru sebulan menikah itu, mengajak Anisa, 21, ke rumah mertuanya di Kota Pematangsiantar.Alasannyakarena rindu dengan mertua.Tersangka sempat minta dikusuk oleh mertuanya, karena menurutnya, tangan kanannya terkilir terjatuh. Sementara Anisa, ketika dimintai keterangan di Mapolres Tebingtinggi, juga tidak mengetahui suaminya telah memperkosa dan membunuh gadis sekampungnya. Selama pelarian, Anisa juga sempat heran, kenapa setiap hari harus berpindah-pindah dari rumah kerabat yang satu ke rumah kerabat lainnya. Kapolres Tebingtinggi, AKBP Drs.AndiRianDjajadi,S.Ikmelalui Kasubag Humas AKP Ngemat Surbakti, mengatakan, kerja keras tim gabungan akhirnya berhasil menangkap tersangka R di rumah kerabatnya. “Kami mengganjarnya dengan pasal berlapis, yakni menghilangkan nyawa orang lain (pasal 338) dan pemerkosaan (pasal 228), dengan ancamanhukuman20tahunpenjara,” tegas Ngemat.(a11)

Lagi, 24 Anggota DPRD Jalan-jalan Ke Jakarta TEBINGTINGGI (Waspada): Lagi-lagi, 24 anggota DPRD Kota Tebingtinggijalan-jalankeJakarta. Kaliini,merekaberangkatdengan alasan bimbingan teknis alias Bintek atas undangan lembaga tertentu. Keberangkatan usai reses ke daerah pemilihan masing-masing. Keterangan yang dihimpun, jumlah anggota DPRD yang berangkat ke Jakarta 24 orang. Namun ada yang mengatakan hanya separuh dari total anggota DPRD yang berangkat. “Setahu saya cuma separuh yang berangkat,” ujar seorang staf Bagian

Keuangan, kemarin. Disebutkan, untuk setiap kegiatan Bintek, per anggota DPRD dibekali dana antara Rp8 juta hingga Rp10 juta per orang. Total anggaran berpergian anggota Dewan di APBD TA 2012 mencapai Rp3 miliar. Sedangkan total jumlah keberangkatan anggota dewan per tahun 2012, masing-masing 12 kali. Artinya, ada kegiatan bepergian setiap bulan. Beberapa warga yang diminta tanggapannya mengatakan, seharusnyapenghamburandana yang tak produktif bisa ditekan

dan itu tugas Sekretaris DPRD. Menurut Ketua Masyarakat Pemerhati Pemerintahan dan Korupsi (MPPK) Hasan Damanik, harusnyaSekwanbisamelakukan analisis atas setiap undangan bagi DPRD, apakah pantas atau tidak. “Jikaundangantidakurgen,harusnya tak usaha diikuti,” tegas dia. Sedangkan Ketua BKPRMI Kota Tebingtinggi Edi Suardi, menilaianggotaDPRDmengikuti kegiatan hanya untuk mencari dana tambahan. “Bepergian itu hak mereka, tapi semestinya bisa memilah kebutuhan sendiri,” tutur dia.(a09)

LPTQ DS Tidak Maksimal TANJUNGMORAWA (Waspada): Lembaga Pengembangan Tilawatil Quran (LPTQ) Kab. Deliserdang selama ini dianggap kurang maksimal, sehingga para qori/qoriahdariluarseringtampil dalam setiap pelaksanaan MTQ Deliserdang. “DalamsetiappelaksaanMTQ tingkat kabupaten sering kecolongandenganbanyaknyapeserta dari luar daerah yang tampil. Hal itu menandakan tidak adanya pembinaan dan pengembangan guna menghasilkan qori/qoriah

yang handal,” ujar Ketua LPTQ Kec.TanjungmorawaDrs. H.Ibnu Hajar, MPd, disela-sela pelaksanaan training center MTQ di SD Muhammadiyah, Tanjungmorawa, Sabtu (17/3). Diungkapkan, kurang berdayanya LPTQ Deliserdang ini juga telah disampaikan kepada Bupati Drs. H. Amri Tambunan ketika panitia dan LPTQTanjungmorawa mengadakan audiensi di kediaman bupati. “Bahkan LPTQ Deliserdang tidak pernah mengundang dan berkoordinasi

dengan LPTQ kecamatan guna menghasilkan program untuk kemajuan MTQ,” ungkapnya. Dikatakan, MTQ ke-34 Deliserdang yang akan dilaksanakan di Kec. Percut Seituan pada 22 hingga 27 Maret, agar kecamatan para peserta MTQ menghentikan imporqari/qariahdariluardaerahnya masing-masing, sebab hal itu bertentangandengantujuanMTQ. “Sebagaimana lambang MTQ, bahwamusabaqahharusdilandasi denganniatyangikhlasdankesucian hati,” kata Ibnu Hajar.(c02)

Honor Dikurangi Dan Disuruh Pindah terakhirkondisiituberubah,ketika Kepsek164524sebelumnyadigantikanyangbaru.Kepsekbarumengharuskan petugas kebersihan punya ijazah. Karena Poniah tak bisa menunjukkan ijazah SD, secara perlahan pekerjaannya berpindah ke orang lain. Honor BOS yang selama ini diterimanya berpindah kepada petugas baru. Pihak sekolah, tetap mempekerjakan Poniah, tapi hanya dibayar Rp100 ribu/bulan. Namun kemalangan itu tak cukup. Pihak sekolah menambah pula derita Poniah dengan meminta mereka pindah dari rumah yang ditempatisemula.Rumahitupun diberikan kepada petugas baru. “Saya sakit hati,” tutur Poniah, saat dipanggil sejumlah guru bertemu Waspada. Menurut perempuan yang mampu baca tulis itu, sebenarnyadiasekolahdantamat SD. Tapi ijazah SD itu hilang, sehingga tak bisa memenuhi tuntutan pihak sekolah. Terkait itu, beberapa guru dikonfirmasi, mengatakan alasan utama menggusur Poniah dari pekerjaannya, karena yang bersangkutan tak punya ijazah.

06:30 06:31 06:41 06:34 06:31 06:38 06:26 06:36 06:29 06:28

Gara-gara Cinta Ditolak

Tujuh Tahun Jadi Petugas Kebersihan SD

NASIB orang kecil kadang mengenaskan.Sepertidialami Poniah, 36, warga Kel. Tj. Marulak Hilir, Kec. Rambutan. Setelah mengabdi tujuh tahun di SDN 164524 dengan honor Rp325 ribu/bulan, hanya karena alasan tak ada ijazah, ibu tiga anak itu disingkirkan secara perlahan oleh pihak sekolah. Dari keterangan, Kamis (15/3), Poniah bersama suaminya Painok, 42, dipercaya menjadi petugas pembersih danpenjagaSDyangkelihatan mentereng itu. Tugas membersihkan sekolah dilakoni perempuan sejak 2005 dan mendapat SK pengangkatan dari Kepsek, dibiayai bantuan operasional sekolah (BOS) per tiga bulan. Berdasarkan SK Kepsek SDN 164524 No.800/14/13A/ 2006 tanggal 9 Januari 2006, selain honor, Poniah dan keluarga juga diberi kesempatan tinggal di rumah komplek sekolah. Alasannya, karena suaminya penjaga sekolah. Namun beberapa bulan

WASPADA Senin 19 Maret 2012

“Ini lembaga pendidikan, yang bekerja di sini mesti punya ijazah, palingtidakSD,”ujarseorangguru. Yang lain, mengatakan pekerjaan itu mestinya dilakukan laki-laki, karena tugas yang dilakukan Poniah selama ini kurang baik. LaindenganparagurudiSDN 164524 itu, Kepsek Ahmad, S.Pd, ketika dikonfirmasi terkesan enggan berkomentar. Dia malah menyuruh meminta keterangan kepada guru-guru di sekolah itu. Namun kepada wartawan, Ahmad mengatakan alasan yang sama,karenatakadaijazah.Padahal, Dinas Pendidikan selalu minta persyaratan agar ada ijazah. Selain itu, sang Kepsek juga berkilah tidak memecat Poniah, tapi tetap mempekerjakannya dengan membayar honor Rp100 ribu/bulan. “Itu saya usahakan dari kantong sendiri,” akunya. Sedangkan kepindahan Poniah dari rumah di komplek SD, sang Kepsek mengatakan, karena diisi petugas baru. Kasi Pendidikan Dasar Dinas Pendidikan Kota Tebingtinggi Sugiharto, SPd saat dikonfirmasi mengatakan, untuk petugas

Waspada/Rizaldi Anwar

PONTAS Effendi, SH saat menunjukkan sarana PN Lubukpakam kepadaWabup Deliserdang, Zainudddin Mars disaksikan Ketua DPRD DS, Hj. Fatmawati dan Sekda Sergai Haris Fadillah.

Ketika Ketidakadilan Teronggok Di Gedung Penegak Keadilan JUMAT (16/3) menjelang shalat Jumat, bagi karyawanPengadilanNegeriKlasIBLubukpakam, khususnya pimpinan barunya Pontas Effendi, SH merupakan hari bersejarah. Betapa tidak, bagi Pontas hari itu kesempatan bagus baginya menunjukkan betapa minimnya sarana di gedung penegak keadilan masyarakat yang dia pimpin itu. “Ini adalah bentuk ketidakadilan yang sudah lama saya pikirkan. Uniknya, ketidakadilan itu teronggok di gedung penegak keadilan,” sebutnya saat menyampaikan kata sambutan pada acara syukuran atas dilantiknya Pontas sebagai Ketua Pengadilan Negeri Klas I B Lubukpakam. Selain gedung PN yang pernah membooming saat menyidangkan kasus dukun jagal Ahmad Suradji beberapa tahun silam itu, ternyata menyimpan kisah miris. Bayangkan, meski dalam waktu Senin hingga Kamis menyidangkan perkara 60 hingga 70 kasus dan dengan ruang tahanan 3 x 5 bagi terdakwa, membuat PN yang sedang berjuang naik kelas menjadi I A itu, rentan berpotensi melanggar hak asasi manusia. “Ini jelas aneh, namun fakta. Seharusnya saat menanti sidang para tahanan wanita dan pria dipisah, namun mengingat ruang tak memadai jadi berjejal hingga tak bisa duduk, kan sudah jelasmelanggarHAM.Parahnya,sakingpenuhnya, ada tahanan yang di luar malah kabur. Sekitar 3 atau 4 kali ini terjadi,” ungkap Pontas di hadapan

Wabup Deliserdang Zainuddin Mars, Ketua DPRD DS Hj. Fatmawati, Sekda Serdang Bedagai, Haris Fadillah,KajariLubukpakam,KhairilAswanHarahap Kadisdukcapil, HY Siregar dan Kadis Infokom Drs. Neken Ketaren serta undangan lainnya. Sambutan Pontas itu, sebelumnya sempat ‘ditantang’ Wabup Zainuddin Mars, bahwa membangun daerah harus menjalin kebersamaan dari semua pihak. “Saya minta dengan beroperasinya Bandara Internasional Kualanamu dan sebelum masa jabatan saya berakhir, Ketua PN yang baru agar berjuang menaikkan kelas PN Lubukpakam menjadi kelas I A,” pintaWabup. Namun Pontas mengaku pihaknya sudah melakukan kebersamaan itu. “Meski tak bernilai, saya tekankan kepada jajaran saya bahwa walau itu hanya satu pot bunga, berikanlah untuk PN dan itu menjadi amat tak ternilai,” ujarnya sembari merinci pemberian rekan-rekannya di PN Lubukpakam tersebut. Nah, kini kita lihat, apakah onggokan ketidakadilan di gedung PN Lubukpakam tetap dibiarkan berdiri kokoh, atau dalam waktu dekat melebur bersama janji Pontas yang akan menjemput bola membantu masyarakat miskin Deliserdang untuk meraih penegakan hukum yangsepatutnyamemangdimilikimereka.Selamat bekerja Pak Pontas, semoga naik kelas... * Rizaldi Anwar

PKK Tanam Pohon Buah-buahan Di Lingkungan Kantor Pemkab DS LUBUKPAKAM (Waspada): Tim Pengerak PKK Deliserdang melakukan bakti sosial berupa penanaman pohon buah-buahan di lingkungan perkantoranPemkabDeliserdangdiLubukpakam, baru-baru ini. Kegiatan bakti sosial yang dirangkai dalam pertemuan bulanan organisasi wanita se Kabupaten Deliserdang dipimpin Ketua TP PKK Ny. Hj Anita AmriTambunan dihadiriWakil Ketua TP PKK Ny. Hj. Asdiana Zainuddin, Ketua Dharma Wanita Persatuan Ny. Hj. Fauziah Azwar, Ketua GOW Ny. Sri Rahmawati Barus bersama anggota. KetuaTP PKK Deliserdang Ny. Hj. Anita menjelaskan, selain pertemuan yang rutin dilaksanakan setiap bulannya, TP PKK juga melakukan berbagai kegiatan seperti memamerkan hasil kerajinan rumah tangga dan hasil bumi unggulan masingmasing daerah kecamatan sehingga diharapkan dapat menumbuhkan minat untuk melakukan inovasi baru.

Bahkan TP PKK Kab. Deliserdang, kata Ny. Hj. Anita telah melakukan kerjasama dengan instansi terkait dalam pengurusan izin mendirikan industri kecil dan menengah sehingga para pengrajin dapat berhasil mengembangkan usahanya. Dijelaskan, setiap kecamatan yang memamerkan hasil-hasil kegiatan industri rumah tangga maupun hasil bumi unggulan setiap bulannya terus dinilai dan diberi hadiah. Seperti pada 2011 yang mendapat nilai terbaik yaitu Kec. Hamparan Perak, Tanjungmorawa dan Kec. Percut Sei Tuan. Kegiatan seperti ini juga akan kita gelar nantinya pada pelaksanaan MTQ dan FSN tingkat KabupatenDeliserdang22Maret2012diLapangan Sampali Kecamatan Percut Sei Tuan. Menurut Ny. Hj. Anita, semua keberhasilan initugaspengabdiankitasebagaikaderPKK.“Untuk itu mari kita abdikan diri sebagai kader masyarakat dalam upaya meningkatkan pembangunan dan kesejahteraan masyarakat,” papar Hj. Anita.(a06)

Polres Dan Pemkab DS Simulasi Keamanan Jelang Kenaikan BBM LUBUKPAKAM (Waspada): Terkait jelang kenaikan Bahan Bakar Minyak (BBM), jajaran KepolisianResortDeliserdangmelakukansimulasi sistem pengamanan kota, Kamis (15/3), di halaman Mapolres Deliserdang, diikuti jajaran TNI, Dinas Perhubungan dan Satpol PP. Kapolres Deliserdang, AKBP H. Wawan Munawan, S.Ik, M.Si bertindak sebagai Irup Upacara,Danrup,IptuTedyNapitupulu,menandai upacara penyematan pita Sisipamkot. Kapolres mengatakan, wilayah hukum Polres Deliserdang terdapat beberapa organisasi politik, pemuda maupun Ormas lainnya, serta beberapa objek vital dan perkebunan, berpotensi menjadi sasaranunjukrasayang dapatberkembangmenjadi anarkis, akibat adanya provokasi dari kelompok

lainuntukkepentinganpribadimaupunkelompok. Antisipasihalitu,termasukmenjelangkenaikan harga BBM pada 1 April 2012, Polres Deliserdang bekerjasama dengan unsur TNI dan Pemkab Deliserdang melaksanakan latihan simulasi sistem penanganan kota. Latihan sebagai pedoman dalam penanganan aksi unjukrasa, sehingga tercapai keterpaduan tindakan unsur-unsur yang terlibat dalam operasi pengamanan kota di Kabupaten Deliserdang. Usai menyaksikan simulasi, Wabup H. Zainuddin Mars bersama Kapolres AKBP H.Wawan Munar, S.Ik, M.Si dan Ketua DPRD Hj. Fatmawati beserta unsur Muspida meninjau Pos Aju I di Jalan lintas Sumatera, perbatasan Deliserdang dan Serdang Bedagai.(a07)

DPP Partai Barnas Beri Mandat Mengurus Partai Di Sumut

Waspada/Abdul Khalik

PONIAH yang telah mengabdi tujuh tahun, hanya karena tak punya ijazah, digusur pihak sekolah. sekolah non PNS, sebenarnya tidak ada kewajiban harus punya ijazah. “Semua dilakukan dengan cara-cara kekeluargaan. Jadi tak perlu lah ijazah, apalagi hanya petugas kebersihan,” tegas dia. Kini, Poniah harus kembali mengempiskan perut, karena hanya bergantung dari pendapa-

tan suami Rp1 juta/bulan ditambah honor Rp100 ribu/ bulan yang belum diterimanya. Padahal, tiga anak Poniah semua bersekolah di SMP dan SMA. “Saya tak tau lagi harus bagaimana membiayai mereka,” keluhnya. * Abdul Khalik

TEBINGTINGGI ( Waspada): Dewan Pimpinan Pusat Partai Barisan Nasional memberi mandat kepada sembilan anggota DPRD kabupaten/kota, sebagai perpanjangan tangan untuk menangani berbagai persoalan partai di Sumatera Utara. Mandat itu diberikan pada acara Rapimnas Barnas 2-4 Februari 2012 di Jakarta. Demikian anggota DPRD Kota Tebingtinggi Christoph Munthe, Rabu (14/3) di ruang kerjanya kantor DPRD, terkait penerimaan mandat itu. Mandat DPP Partai Barnas No. 016/SMDPPP.BARNAS/III/2012 tanggal 3 Maret 2012 ditandatangani Ketua Umum H. Muhammad ArfandanSekretarisJenderalStevenRumangkang, memberi mandat kepada Christoph Munthe (anggota DPRD Kota Tebingtinggi), Pinto Padang (anggota DPRD Kab. Dairi), Natanail Ginting (anggota DPRD Kab. Karo), M. Parlaungan Nasution (anggota DPRD Kab. Madina) dan

Gunawan Siregar (anggota DPRD Kab. Tapsel). Kemudian, HM Idris Siregar (anggota DPRD Paluta), Mosir Simbolon (anggota DPRD Taput), SarudinGultom(anggotaDPRDKab.Simalungun) dan Arosokhi Arefa (anggota DPRD Gunungsitoli). Kepada sembilan penerima mandat, bertugas menginventarisir kepengurusan Partai Barnas Kab/Kota se Sumut. Sosialisasi keputusan kongres Partai Barnas April 2011 di Manado. Kemudian menertibkan kebijakan partai dalam hal dukungan terhadapPemilukada(PilgubdanPilkada)seSumut. Jugamengusulkanpenyempurnaankepengurusan DPC Barnas Kab/Kota se Sumut periode 20112016 untuk disahkan DPP Partai Barnas. “Kitaberharapdenganadanyamandatinisemua persoalan Partai Barnas di Sumut jadi satu pintu. Di luar itu, tak bisa lagi mengaku sebagai pengurus Partai Barnas,” ujar Christoph Munthe. DPP Partai Barnas ini juga mempersiapkan penerima mandat dalam menghadapi Pilgubsu.(a09)

Sumatera Utara

WASPADA Senin 19 Maret 2012


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi:

Polisi Bubarkan Pesta Sabu TANJUNGBALAI (Waspada): Satuan Narkoba Polres Tanjungbalai membubarkan pesta narkotika jenis sabu-sabu di Jalan Karya, Gg. Enggang, Kel. TB-Kota I, Kec. TB-Selatan, Sabtu (17/3), dinihari. Keterangan dihimpun Waspada, penggerebekan berawal saat dua lelaki AR alias Ipin, 35, warga Jalan Karya, Kel. TB-Kota I,Kel.TB-SelatandanFM,31,penduduk Jalan DI Panjaitan, Kel. Pasarbaru,Kec.SeitualangRaso,diketahuiwargakerapmengkonsumsi obat terlarang itu di sekiter TKP. Masyarakat yang resah dengan aktivitas kedua lelaki tersebut kemudian menginformasikanhalitukepadapihakberwajib. Mereka berharap agar polisi

menangkap para pelaku dan menjebloskan mereka ke penjara agar mendapat efek jera supaya tidak mengulangi perbuatan haram itu. Timkemudianturunkelokasi dan benar saja, dua lelaki ditemukan asyik berpesta sabu-sabu. Namun saat dilakukan penangkapan, FM mencoba melarikan diri begitu mengetahui kedatangan petugas. Namun polisi yang telahmengantisipasisebelumnya langsung membekuk tersangka

LIMAPULUH (Waspada): Komisi III DPR RI akan terus memantau kasus hilangnya dana kas Pemkab Batubara Rp80 miliar. Setiap minggu dipertanyakan perkembangan penyidikannya kepada Kejagung maupun Jampidsus. Demikian disampaikan anggota Komisi III DPR RI Edi Ramli Sitanggang di Desa Mangkei Baru, Kec. Limapuluh, Kab. Batubara, pada acara sosialisasi empat pilar kebangsaan yang menjadi perekat bangsa Indonesia yang dihadiri ratusan orang dari unsur guru honor, pelaku UKM dan tokoh masyarakat. Dikatakannya empat pilar itu

antara lain UUD 1945, dasar negara Pancasila, NKRI, dan semboyan BhinnekaTunggal Ika. Keempat pilar ini telah menjadi kuncidalammengelolakeutuhan bangsa. Mengenai kasus Rp80 miliar itu, dijelaskannya, konstruksi hukum kasus ini tidaklah perbuatan orang per orang. Proses hilangnya dana ini sistemik ada penanggungjawab, top manager, bawahan dan ada yang lakukan pencairan uang. “Artinya yang pegang angaran itukan Sekda. Tidak mungkin dana sejumlah itu hanyamelibatkanatasotoritas kepala dinas pendapatan dan kabagkeuanganitumustahil.Tapi

KISARAN (Waspada): Kenaikan Bahan Bakar Minyak (BBM) subsidi memberikan efek langsung ke masyarakat kelas bawah. Sebab, kata Ketua DPD GolkarAsahanBentengPanjaitan, kenaikan BBM akan diikuti juga dengan harga kenaikan bahanbahan pokok. Akibatnya, beban biaya hidup masyarakat semakin meningkat, sehingga daya beli masyarakat menurun. “Dari sisi pelaku usaha, kenaikanhargaBBMmenyebabkan naiknya biaya produksi. Kondisi sepertiinisemakinmenempatkan pengusaha kecil pada situasi sulit. Tapi situasi seperti ini bukan berartimembuatpengusahakecil kehilangan harapan dan semangat,” kata Benteng saat membuka Program Gerakan Ayo Bangkit (GAB) Partai Golkar di Sabty Garden Hotel Kisaran,

Minggu (18/3). Dalam menyiasati kenaikan BBM ini, para pengusaha kecil harus memperbaiki manajemen usaha yang sedang ditekuni, memperluas pasar, mau pun mengembangkan usaha secara horizontal dan vertikal, katanya. Terkait GAB dukungan H. Aburizal Bakrie dan DPD Golkar Sumut, Benteng Panjaitan mengatakan,DPDGolkarAsahan dan DPD Golkar Batubara kembali melanjutkan prakarsa memberdayakan usaha kecil melalui pelatihan dan pendampingan. Di Sumut sendiri, pelatihan ini pelatihan ke empat. “Prakarsa ini tanggapan sekaligus komitmen Partai Golkar terhadap pengusaha kecil, tulang punggung perekonomian Indonesia. Partai Golkar percaya memberdayakanpengusahakecil

� Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412.

Parkir Di SMKN 1 T. Balai Diduga Dikelola Secara Ilegal TANJUNGBALAI (Waspada): Lahan parkir kenderaan bermotor di SMKN 1 Kota Tanjungbalai diduga dikelola secara ilegal, karena hasilnya tidak disetor ke kas daerah. Buktinya, salah satu juru parkir merangkap penjaga sekolah SMKN 1 menyatakan, hasil parkir dari kenderaan bermotor para siswa tidak jelas kemana di setorkannya. “Terserah saya mau disetor kemana, itu bukan urusan anda,” ujar pria bermarga Hutahaean itu kepada Waspada, baru-baru ini. Pernyataannya itu berbeda saat dia memberikan keterangan kepada Waspada beberapa waktu lalu. Saat itu, dia mengungkapkan, parkir kenderaan bermotor para siswa SMKN1 dikelola warga bersama salah satu organisasi buruh, yaitu SBSI Tanjungbalai. Hasil parkir tersebut, menurut pria bermarga Hutahaean itu, bukan di setor ke kas daerah, melainkan kepada SBSI Tanjungbalai. “Satu baris parkir kereta ini yang megang SBSI bang, aku setor sama mereka Rp10 ribu perhari,” ujarnya ketika itu. Sementara, Sekretaris DPC FTA SBSI Kota Tanjungbalai Saut Sitorus dikonfirmasi Waspada melalui saluran telepon mengatakan, dari dua lahan parkir di SMKN 1 Tanjungbalai, satu di antaranya dikelola secara organisasi oleh SBSI. Menurut Saut, lahan parkir itu dikelola sejak 3 bulan lalu dengan modal Rp2,5 juta, dan hasil yang terkumpul baru mencapai Rp270 ribu. “Ada 2 lahan parkir, satu dikelola SBSI dan satunya lagi tidak jelas siapa pengelolanya. Mana lebih bagus parkir dikelola orang yang jelas atau tidak jelas,” kata Saut Sitorus. Sebelumnya, Wakil Ketua DPC FTA SBSI Tanjungbalai Ahmad FauzidanAminMargolangkepada Waspada,Rabu(14/3)mengatakan, organisasi mereka tidak pernah terlibat dalam pengelolaan lahan ataupun pengutipan biaya parkir kenderaan bermotor di kawasan SMKN 1. “Sampai hari ini, DPC SBSITanjungbalai tidak pernah mengelola ataupun menerima uang hasil parkir kenderaan bermotor di sekitar SMKN 1 Kota Tanjungbalai,” tegas Ahmad dan Amin. (a14/a32)

tidak perlu suuzhon kita tetap hormati azas praduga tak bersalah,” kata Edi. Lebih lanjut dikatakannya, Komisi III mengapresiasi Kejaksaan Agung yang bisa menangkap tokoh utama yang menyimpan uang ini. AR ini, menurut konstruksi hukumnya berhubungan dengan pejabat teras di Batubara. Namun Edi kembali mengingatkan tidak boleh mendahului proses penyidikan. Ia juga meyakini yang ditelah ditangkap ini hanyalah tingkat operator yang tak punya kewenangan dan hanya diperalat oleh pejabat tersebut. (c05)

BBM Naik, Pengusaha Kecil Jangan Kehilangan Semangat

� Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.

Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

sehingga tak sempat kabur. Dari tangan keduanya, disita barang bukti satu botol kecil berisi air terangkai dengan satu buah karet dot. Kemudian dua buah pipet,satubungkusanplastiktransparan berisi 35 lembar plastik kecil. Berikutnya satu buah pipet kaca bentuk ujungnya runcing, empat buahmancis, satu karet dot, sebuah jarum dan stoples. Kapolres Tanjungbalai AKBP EP Sirait melalui Kasat Narkoba AKP Novie Ardhie didampingi KasubbagHumasAKPYSinulingga membenarkan penangkapan itu. Dikatakan Novie Ardhie, kedua tersangka adalah terget operasi (TO) dan barang haram yang telah dipakai itu didapat dari warga Tanjungbalai. (a32)

Komisi III DPR RI Terus Pantau Kasus Rp80 M

KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan:



KETUA DPD Golkar Asahan, Benteng Panjaitan menyerahkan sertifikat kepada perwakilan peserta pada pembukaan Program Gerakan Ayo Bangkit (GAB) Partai Golkar di Sabty Garden Hotel Kisaran.

memberi dampak pada penciptaan lapangan kerja, penanggulangan kemiskinan dan pemberdayaan perempuan pengusaha.” Menurutnya, saat ini kondisi bangsa dengan Indeks Pembangunan Manusia untuk tahun 2011 menempatkan Indonesia di posisi yang masih rendah dan tertinggal dibanding beberapa negara di Asia Tenggara. “Hal ini makin memotivasi Partai Golkar untukmemberdayakanekonomi masyarakat. Sudah banyak program/bantuan yang diberikan pemerintah dan berbagai pihak namun hasil akhirnya bisa kita lihat bersama, belum seperti diharapkan,” tandasnya. “Program Pemberdayaan Usaha Kecil menekankan peningkatan wawasan dan skill usaha para pengusaha mikro dan tidak memberikan pelayanan keuangan. Karena, pelayanan keuangan seperti simpan pinjam telah banyak disediakan melalui program pemerintah seperti Kredit Usaha Rakyat (KUR), Program Nasional Pemberdayaan Masyarakat (PNPM), lembaga perbankan dan lainnya.” Tahun 2011, telah dilaksanakan 3 gelombang pelatihan di 10 propinsi di Indonesia. Pada 2012 ini komitmen ini terus berlanjut,ratusanpengusahakecil di Provinsi Sumatera Utara akan mendapatkan peningkatan skill usaha dan insentif pengembangan usaha. Para pengusaha kecil tersebut dinominasikan oleh berbagai kelompok masyarakat, sertadiseleksipanitiaindependen bentukan GAB.(h02)

Pembangunan Musholla Disdik Batubara Dimulai LIMAPULUH (Waspada): Pembangunan Mushola Dinas Pendidikan (Disdik) Kab. Batubara dimulai ditandai dilakukan peletakan batu pertama di halamankantorsetempatdiDesa Perupuk, Kec. Limapuluh, Jumat (16/3). ‘’Kita harapkan mushola ini nanti dapat memudahkan bagi kita melaksanakan sholat maupun ibadah Islam lain dalam upaya meningkatkan hubungan silaturahmi antar sesama,’’ tukas Kadisdik Kab. Batubara, Zainal Alwi, SPd disela-sela acara peletakan batu pertama pembangunan mushola. Panitia pembangunan, Drs. Muswardi dan Muslikh, SPd didampingi Kabid Dikdas Ainul Syafni S.Psi dan Ketua MKKS SMP, Armansyah, SPd kepada Waspada mengatakan, pembangunan mushola di atas tanah seluas lebih kurang 100 meter persegi sebagian merupakan infaq masyarakatpemiliklahan.Sedangkan luas bangunan 8 x 8 meter tahap

awal dana yang terkumpul sekitar Rp11 juta dari Rp96 juta ditargetkan di luar dari perlengkapan lain dibutuhkan. ‘’Ini semua diharapkan dari partisipasi infaq jajaran Dinas Pendidikan dan tidak menutup

kemungkinandaripihaklainkhususnyabagiummatIslamyangmau membantumemberikansumbanganinfaq,’’kataMuswardi.Acara pelatakan batu pertama juga diisi tausiah agama disampaikan Al Ustadz H. Suheri. (a13/c04)

Waspada/Iwan Has

BUPATI Batubara H.OK Arya Zulkarnain,SH,MM memberikan bantuan pada malam silaturahmi dan dialog masyarakat Desa Perupuk dan Gambus Laut, Kec Limapuluh.

SKPD Diminta Tanggapi Aspirasi Masyarakat Batubara LIMAPULUH (Waspada): Kepala SKPD diminta tanggap menyikapi aspirasi disampaikan masyarakat sekaligus menelusuri langsung melihat kondisi sebenarnya agar tepat sasaran. Bupati Batubara H. OK Arya Zulkarnain, SH, MM menyatakan itu dalam dialog dan silaturahmi bersama masyarakat Desa Perupuk dan Gambus Laut, Kec. Limapuluh, di halaman kantor Dinas PU setempat, Sabtu (17/3) malam. Mulai memberikan bantuan sampai membangun dapat menyertakan masyarakat. Salah satunya Desa Gambus Laut dalam pelaksanaan ADD nanti diarahkan kepada pembenahanjalandikawasanperladanganDusun VIII sebagaimana harapan petani dan diserahkan kepada mereka mengerjakan. Sedangkan rehabilitasi rumah warga yang tidak mampu dapat diselesaikan. Bantuan nelayan diberikan di laut agar tepat sasaran dan tidak berkedok belaka. “Jangan diberikan sepenuhnya di kantor karena di antara yang datang belum tentu nelayan tempatan. Sehingga Diskanla (Dinas Perikanan dan Kelautan)

perlu turun ke laut menyalurkan,” ujar OK. Nelayanditekankanmelengkapisyaratmelaut sampai menempelkan nomor selar di dinding sampan/boat sebagai pertanda agar mudah dikenal atau didata. Sisi kesehatan Pemkab Batubara berupaya membangun Puskesmas di pulau maupun pelayanan terapung sebagai langkah menjamin kesehatan nelayan selama menangkap ikan di tengah laut. “Tahun 2012 sarana kesehatan ini sudah dapat berjalan melalui petugas medis yang diturunkan,” ujarnya, sembari mengatakan langkah tersebut dilakukan mengingat hampir 30 persen penduduk Batubara adalah nelayan, patut di perhatikan sampai kearah Jamsostek. Sebelumnya tokoh masyarakat Abdul Hamid menegaskan, OK Arya membangun apa yang dicanangkan dulu sebelum menjabat bupati yakni merubah kawasan pesisir menjadi pusat pemerintahan dan siap mendukung mengantarkannya kembali menjadi bupati priode kedua kali.“Fakta ini menunjukan sosok OK Arya komitmen membangun daerah pesisir Batubara,” ujarnya. (a13)

Wakil Wali Kota Buka MTQ Kec. Teluknibung TANJUNGBALAI (Waspada):WakilWali Kota Tanjungbalai, Rolel Harahap membuka secara resmi Musabaqah Tilawatil Quran (MTQ) ke-44 tingkat Kec. Teluknibung, kemarin. WakilWali Kota (Wawa) dalam sambutannya menyampaikan apresiasi setingginya kepada Camat, Lurah, panitia dan masyarakat atas terselenggaranya MTQ itu dengan cukup meriah. Hal itu merupakan wujud kerja sama yang baik antara pihak kecamatan dengan masyarakat. Menurut Wawa, harus disadara bahwa kebesaran dan kemuliaan Alquran tidak akan hilang ditelan masa. Namun dalam era globalisasi

yang semakin tajam, akan mengikis sendi-sendi keyakinan umat Islam termasuk kita suci Alquran. “Tentunya tidak sekedar mengenal, namun lebih mengutamakan kebiasaan membaca, memahami, dan mengamalkan nilai-nilai yang terkandung dalam Alquran,” ujar Wawa. Camat Teluknibung Haykal Akmal mengucapkan terima kasih kepada panitia demi kesuksesan kegiatan bernuansa islami itu. Dalam kesempatantersebutdiajugamengatakanselamat bertanding dan berharap agar segenap peserta menjunjung tinggi sportifitas. (a32)

Dua Anak Tenggelam Saat Mandi Sungai INDRAPURA (Waspada): Dua anak ditemukan tewas saat mandi bersama sama teman temannya di Sungai Suka, Kec. Seisuka, Kab. Batubara. Sabtu (16/3) sekira pukul 02:00 jenazah keduanya baru ditemukan. Informasi yang diterima Waspada di tempat kejadian perkara (TKP) menyebutkan, siang itu lima orang anak, Wahyu, 12, Mhd Alparuzi, 14, Rizal, 12, Dimas, 11 dan Yoga, 12, kesemuanya warga Desa Tanjung Seri, Kac. Seisuka. Tidak diketahui bagaimana dua orang di antara mereka Wahyu dan Mhd Alparuzi tenggelam. Ketiga temannya yang menyadari dua orang temannya tenggelam langsung naik dari sungai dan memberitahukan kepada warga peristiwa yang menimpa kedua korban. Warga yang diberitahu langsung berupaya mencari keduanya dengan menyelam menyusuri sungai. Sekira pukul 17:45 jenazah Wahyu Putra

dari pasangan Kandar dan Butet ini ditemukan warga di sekitar keramba. Namun Alparuzi belum juga ditemukan. Meskipun hari mulai gelap warga masihterusberupayamelakukanpencarian,hingga pukul 02:00, ia berhasil ditemukan tanpa nyawa. Kapolres Asahan melalui Kapolsek Indrapura AKP MA Ritonga membenarkan peristiwa tenggelamnya dua bocah tersebut dan jenazahnya ditemukan dalam keadaan tak bernyawa. “Jenazahnya langsung diserahkan kepada kedua orangtuanya untuk dikebumikan sebagaimana mestinya,” ujar Ritonga. Kepala DesaTanjung Seri, Kec. Seisuka Saeran menjawab Waspada mengatakan, jarak antara tempat mandi-mandi anak - anak itu dengan lokasi ditemukannya jenazah korban tidak terlalu jauh, hanya sekitar 10 meter tapi sudah tertimbun pasir.“Siang tadi penguburannya telah dilakukan,” kata Saeran. (c05)

Polisi Ringkus Residivis LIMAPULUH(Waspada): Baru lepas dari Lembaga Pemasyarakatan (LP) 27 November 2011 yang lalu,TMML,17, warga lingkungan satu Perumnas Limapuluh, Kelurahan Limapuluh, Kab.BatubaraditangkappetugasPolsekLimapuluh, setelah diketahui sebagai pembongkar kios sembako. Kapolres Asahan melalui Kapolsek Limapuluh AKP. Bambang Rubianto, SH kepada Waspada, Kamis (15/3) menjelaskan, tersangka diringkus dari rumahnya Senin (12/3) sekira pukul 10:00 atas laporan korbannya Maryati br Simbolon Pasar Satu blok VIII, Lingkungan VI, Kel. Limapuluh. “Tersangka dan barang bukti saat ini kita amankan di RTP Polsek untuk pengusutan lebih lanjut, kepada tersangka kita kenakan pasal 363 KUHPidana,” kata Bambang.

Tersangka Togel Selain itu Polsek Limapuluh juga menangkap dua pria yang melakukan kegiatan menjual dan membeli kupon judi jenis makau di belakang rumah tersangka Amrin,36, di Dusun V Desa Simpang Gambus, Kec. Limapuluh Kab. Batubara sebagai penulis dan Nurmansyah alias Aman, 49, warga Dusun VI Desa Simp Gambus, Kec. Limapuluh, Kab.Batubara sebagai pembeli. Juga ikut diamankan, uang tunai Rp166.000, satu unit HP merk Nokia warna hitam yang berisikannomorpasangan,satuunitsepedamotor merk Honda BK 2480 LG milik pembeli, satu buah buku block notes yang berisikan angka pasangan, dua pulpen warna biru dan pink, serta satu lembar kertas yng berisikan angka yang sudah direkap dari blok notes. (c05)

Membunuh Dan Mencuri, Holmes Dihukum 13 Tahun


KADISDIK Batubara Zainal Alwi, SPd melakukan peletakan batu pertama pembangunan mushala.

RANTAUPRAPAT (Waspada): Terbukti secara sah dan meyakinkan bersalah melakukan tindak pidana pencurian dengan kekerasan yang mengakibatkan orang lain meninggal dunia, terdakwa Holmes Manurung alias Junjung alias Jubel dijatuhi hukuman 13 tahun penjara dalam persidangan di Pengadilan Negeri Rantauprapat, Kamis (15/3). Sebelumnya, Jaksa Penuntut Umum (JPU) Sulisyadi, SH dalam tuntutannya meminta kepada majelis hakim yang diketuai Nelson Angkat, SH, Arsul Hidayat, SH, Darma, SH agar menghukum terdakwa 17 tahun penjara sebagaimana dalam Dakwan Kesatu pasal 365

ayat (4) KUHP. Menurut JPU dalam tuntutannya, Holmes juga terbukti secara sah bersalah melakukan tindak pidana secara tanpa hak menguasai, membawa atau mempergunakan senjata api sebagaimana dalam dakwaan kedua, pasal 1 ayat 1 UU No.12 tahun 1951. Barang bukti berupa 1 butir selongsong peluru jenis FN, 1 proyektil peluru FN, 2 pasang sandal, 1 pucuk senjata api jenis FN merk Bareta dengan magazinnya dirampas untuk dimusnahkan, dan mengembalikan kepada ahli waris korban 1 unit HP dan 2 plat BK 3015 ZF. (a18)

Sumatera Utara B4 Banjir Muarasipongi Surut, Warga Bersihkan Lumpur PANYABUNGAN (Waspada): Luapan Sungai (Aek) Simpang Kawah dan Simpang Mangalo, yang merendam sebagian pemukiman penduduk dan pesantren di Desa Muara Kumpulan dan Koto Boru Kec. Muarasipongi Kab. Mandailing Natal, Jumat (16/3) malam, kini sudah surut. Santri dibantu warga dan aparat kecamatan berupaya membersihkan lingkungan pondok pesantren dan rumahrumah yang kemarin sempat terendam banjir. “ Sejak Sabtu (17/3) pagi, banjir sudah surut. Aktivitas masyarakat berjalan normal. Hubungan lalulintas Medan-Padang juga kembali normal,” kata Camat Muara-

sipongi Muhammad Gandi Hasibuan, Minggu ( 18/3). Menurutnya, beberapa rumah penduduk yang rerendam akibat terjangan Sungai Simpang Kawah di Desa Muara Kumpulan Jumat ( 16/3) malam, terus dibersihkanpemiliknya. “Saatini,secara bersama-samakamidibantusatu unit mobil kebakaran dari Pemkab Madina sedang member-

sihkan sisa banjir berupa lumpur dan sampah kayu dari kompleks Pondok PesantrenTarbiyah Darul Azhar ,” ujarnya. Sisalumpurdankayu-kayuan yang menimbun badan jalan lintas sumatera terdapat di kawasan itu, sudah dibersihkan dengan menggunakan alat berat sehingga tidak lagi mengganggu arus lalu lintas.” Alat berat pemerintah daerah sudah diturunkan membersihkan lumpur dan batang-batangkayuitu,termasuk aliran sungai yang banjir, tidak lagi dibiarkan mengalir di badan jalan,” terangnya. Keterangan dihimpun di lokasi kejadian menyebutkan, sebelum terjadinya banjir, kecamatanpalingselatanprovinsi

Sumut itu diguyur hujan deras hampir dua jam. Usai diguyur hujan, tiba-tiba Sungai ( aek ) Simpang Kawah di Desa Muara Kumpulan dan Rura Simanlango di Desa Koto Baru mengamuk. “Secara mengejutkan, kedua anak sungai itu ‘mengamuk’ sehingga terjadi banjir bandang yang menghantam rumahrumah dan sawah warga di kedua desa. Masyarakat saat itu tidak menduga akan ada banjir bandang,karenakeduasungaiselama ini hanya kecil,” sebut Latif Nasution, 45, salah seorang warga yang ditemui di lokasi banjir. Luapan sungai yang membawa lumpur dan potonganpotongan kayu dari hulu, membuatsaturumahditempatiseorang

gurubernamaInahdankantinyang berdampingan dengan masjid pesantren terancam ambruk. Lingkungan pesantren Darul Azhar dimasuki air sehingga membuat mobiler dan asrama santriterendam.“Padasaatbanjir, kebanyakan warga dan santri lebih memilih menyelamatkan jiwa ke rumah-rumah penduduk dinilai aman, sementara barangbarang ditinggalkan dalam rumah,” jelasnya. Plt.Kadis PU Madina, Parlaungan Lubis bersama Kepala Dinas Perhubungan Harlan Batubara dan Sekretaris Kantor BadanPenanggulanganBencana (BPBD), Risfan Hutasuhut langsung turun ke lokasi sesaat setelah kejadian. (a28)

Antisipasi Kumungkinan Huru-hara Kenaikan BBM 250 Personil Polisi Disiagakan

Waspada/Saut Boangmanalu

BUPATI Remigo Yolando Berutu, MBA (Tengah) didampingi dr. Pintar Manihuruk Direktur RSUD Salak saat meninjau langsung pelayanan dan kelengkapan fasilitas di RSUD Salak beberapa waktu lalu.

Pelayanan RSUD Salak Ditingkatkan PAKPAK BHARAT (Waspada): Kualitas pelayanan Rumah Sakit Umum Daerah (RSUD) Salak terus ditingkatkan. Ini dilakukan seiring dengan rencana besar Pemkab Pakpak Bharat untuk menjadikan RSUD Salak menjadi pusat kesehatan di sekeliling kabupaten/kota yang terdapat di kawasan tersebut. Bupati Pakpak Bharat Remigo Yolando Berutu, MBA saat dihubungi wartawan, Minggu (18/8), terkait rencana pengembangan RSUD Salak menyampaikan, pihaknya akan terus melakukan berbagai terobosan untuk memenuhi standar pelayanan rumah sakit yang benar-benar mampu menarik perhatian publik serta memberikan kepercayaan dalam hal pelayanan kesehatan. “Kamiakanterusmelakukanpembenahandisemuabidangpelayanan termasuksaatinikitamengupayakanRSUDSalakakanmendapatstandar ISO9001:2008.Dansayakirainiakanmenjadisalahsatupenentukepercayaan publik kepada RSUD Salak,” ungkap bupati. AmbisimenjadikanRSUDSalakmenjadiikonpelayanankesehatan di kawasan Selatan Provinsi Sumatera Utara dan Provinsi Aceh itu cukup beralasan mengingat geografis dan pertumbuhan pembangunan serta grand desain Pembangunan Kabupaten Pakpak Bharat yang digulirkannya membuka diri kepada setiap lintas di sekeliling kawasan tersebut. Bukanhanyaitu,RemigoYolandoBerutu,MBAlulusanpascasarjana negeri kanguru itu juga menyampaikan mimpinya menjadikan Kab. PakpakBharatmenjadikabupatenterpesatpembangunannyamengingat daerah tersebut memiliki jumlah penduduk yang relatif sedikit dan dengan luas wilayah tersempit di antara kabupaten se Sumatera Utara. Direktur RSUD Salak dr. Pintar Manihuruk di RSUD Salak saat ditemui, Minggu (18/3) mengaku, RSUD Salak dalam waktu yang tidak terlalu lama akan mendapat perkembangan signifikan. (csb)

Minibus Terbalik, 9 Luka BERASTAGI (Waspada): Sebuah minibus BintangTani Jaya (BTN) jenis Mitsubishi L300 nomor polisi BK 1175 LG yang mengangkut sebelas penumpang terbalik di Simpang Pekong Desa Sempajaya Kec. Berastagi, Sabtu (17/3) sekira pukul 04:00. Dalam insiden itu, sembilan penumpang mengalami luka-luka. Kesembilan penumpang yang luka luka masing-masing Nurmina Br Batu Bara, 70, warga Perumahan Badar Indah Kec. Badar Kab. Aceh Tenggara, Rospita Br Simangunsong, 56, warga Desa Batu Duaratus Kec. L. Sigala-Gala Kab. Agara, R. Br Sianturi, 48, warga Kutacane Bunga Melur Kec. Deleng Perkisen Kab. Agara dan Lukman Manurung, 46, warga Desa Cinta Makmur Kec. Babul Makmur Kab. Agara. Kemudian, Haryono S, 42, warga Desa Kutacane Lama Kec. Babus Salam Kab. Agara, Eti Br Harahap, 45, warga Perum Badar Indah Kec. Badar Kab. Agara, Putri, 16, warga Badar Indah Kec. Badar Kab. Agara, Arif, 10, warga Perum Badar Indah, Kec. Badar Kab. Agara dan Irpan, 24, warga Desa Kandang Mbelang Kec. Lawe Bulan Kab. Agara. Dua penumpang lainnya yang selamat, Erwin Nasution, 45, warga Desa Pulo Latong Kec. Babusalam Kab. Agara dan Raihan, 5, warga Perum Badar Badar Indah Kec. Badar Kab. Agara. Salah seorang penumpang mengatakan, sebelum kejadian sopir mengemudikanbusdalamkecepatantinggidandidugadalamkeadaan mengantuk.SaatitumobildatangdariarahKabanjahemenujuMedan. Setibanya di tikungan, tiba-tiba mobil oleng dan langsung terbalik. Kapolres Tanah Karo melalui Kasat Lantas AKP Radu Sembiring yangdikonfirmasimelaluiponselnya,Sabtu(17/3)sore,membenarkan peristiwa tersebut. “Kasus tersebut masih diusut untuk menyelidiki sebab-sebab peristiwa kecelakaan,” katanya. (cal/a36)

579 Santri/wati Dikhatam SIBUHUAN (Waspada): Sebanyak 579 santri/wati Ponpes Syekh Muhammad Dahlan Aek Hayuara dikhatamkan, termasuk 197 santri Madrasyah Aliyah (MA), 320 santri MTs dan 62 santri MDA Tahun Ajaran (TA) 2011-2012. Demikian pantauan Waspada, Kamis (15/3) di Ponpes Aek Hayuara Sibuhuan Kab Padanglawas pada acara penghkhataman santri/watiyangdihadiriunsurMuspida,KemenagPalas,paraorangtua murid, sejumlah pimpinan Ponpes se Kab. Padanglawas. Pimpinan Ponpes Syekh Muhammad Dahlan H. Nukman Hasibuan diwakiliWildan Ansori Hasibuan, S.Ag, mengatakan, bahwa santri yang dikhatamkan tahun ini sebanyak 579 orang, termasuk tingkat MA, MTs dan tingkat MDA. Para santri diingatkan agar tetap mengamalkan ilmu yang telah diterima selama menuntut ilmu di Ponpes Syekh Muhammad Dahlan ini, dan kepada para santri juga diharap tetap berjuang mengembangkan dan memajukan syiar Islam. (a33)

Waspada/Idaham Butar butar

579 Santri Ponpes Syekh Ahmad Dahlan Aek Hayuara Sibuhuan Kab. Padanglawas saat acara pengkhataman atau penamatan.

P E M ATA N G S I A N TA R (Waspada):Untukmengantisipasi kemungkinan terjadi huru-hara akibat aksi unjukrasa masyarakat memprotes kenaikan harga bahan bakar minyak (BBM) yang akan dilaksanakan pemerintah dalam waktu dekat, 250 personil anti huru-hara dari Polres dan Brimob Ki 2 Den B Kota Pematangsiantar disiagakan. Apelsiagapasukanpengamanan anti huru-hara itu dilaksanakan di Mako Brimob Ki 2 Den B, Jalan Jend. Ahmad Yani, Pematangsiantar, Sabtu (17/3) dengan Irup Kapolres AKBP Alberd TB Sianipar, S.Ik, MH dan Danup Danki Brimob Ki 2 Den B AKP B. Zega. Menurut Kapolres, pasukan anti huru-hara itu akan ditempatkan di delapan SPBU yang ada

di Pematangsiantar mulai Sabtu (17/3) untuk melakukan penjagaan dengan sistem terbuka. Personil yang ditugaskan memakai pakaian seragam lengkap dan sistem tertutup, dimana personil yang ditugaskan hanya memakai pakaian sipil serta semuanya dilengkapi dengan persenjataan dan alat pengamanan lainnya. Selain mengamankan huruhara yang mungkin terjadi, Kapolres menyebutkan pasukan anti huru-hara itu di bawah pimpinan Kapolsek setempat akan melakukan pemeriksaan terhadap mobil tanki saat memindahkan BBM ke tanki penimbunan SPBU. Pasukan anti huru-hara itu, menurut Kapolres, akan turut memantau oknum-oknum yang hendak melakukan penimbunan

BBM sebelum harga BBM dinaikkan pemerintah dan bila ditemukan oknum-oknum yang hendak menimbun BBM akan dilakukan tindakan dan diproses sesuai ketentuanperundang-undangan. “Sudah kami lakukan rapat dengan instansi terkait termasuk dengan pihak Pertamina, Selasa (13/3) guna mengantispasi kemungkinan yang akan terjadi akibat kenaikan harga BBM dan kesimpulan rapat serta sudah menjadikomitmenpeserta rapat, agar tidak ada oknum yang melakukan penimbunan BBM dan akan diberi sanksi bila ada yang melakukan. Guna mengantisipasi penimbunan BBM, warga yang hendak membeli BBM dengan menggunakan jeregen akan dibatasi hanya 10 liter per warga,” tegas Kapolres. (a30)

Masyarakat Purbatua Minta Pemkab Membangun Sekolah Lanjutan TARUTUNG (Waspada): Warga Kec. Purbatua mengharapkan Pemkab Tapanuli Utara (Pemkab Taput) mendirikan sekolah lanjutan atas, baik SMA maupun SMK. Karena, ketidaktersediaan sekolah dimaksud di daerah itu, siswa/i yang melanjutkan sekolah harus bersekolah ke SMA/SMK yang ada di Kec. Pahae Jae, Tarutung dan lainnya. “Pak Bupati, tolanglah di kecamatan ini, didirikan sekolah lanjutan. Karena anak-anak kami yang telah menamatkan pendidikannya dari SMP, terpaksa harus melanjutkan SMA/SMKnyakedaerahlain.Padahal,seusia mereka masih harus dalam bimbingan orangtua dan belum

saatnya untuk berkos di daerah lain. Kami bersedia memberikan lahan untuk pendirian sekolah lanjutan tersebut,” ujar A Harianja warga Kecamatan Purbatua/ embriodariKecamatanPahaeJae, baru-baru ini, dalam temu pendidikandanpemberangkatansiswa/ i kelas IX menyongsong ujian nasional (UN), bertempat di SMP Negeri 1 Purbatua. Bupati Taput Torang Lumbantobing dalam kesempatan tersebutmengatakan,sangatsetuju dengan keinginan yang baik dari warga setempat yakni, bersedia memberikan lahannya untuk mendirikan sekolah lanjutan. “Memang lahanlah yang menjadi penghambat selama ini,

kalau ada rencana-rencana pembangunan sekolah, puskesmas. Sebab, petunjuk dari pemerintah pusat, daerah tidak dibolehkan membeli lahan untuk pendirian sekolah dan puskesmas. Niat tersebut sangat kita apresiasi dan nanti dinas pendidikan Taput akankitatugasiuntukmenelusuri hal itu,” ujar Toluto panggilan akrab Bupati Taput itu. Pada hari yang sama, Bupati Taput memberangkatkan siswa/ i SMA se-Kecamatan Simangumban, bertempat di SMA Negeri 1 Simangumban. Bupati dalam kesempatan itu mengajak, sekaligus menekankan siswa/i kelas XII, agar mempersiapkan diri untuk menyongsong UN. (a21)

Bupati Tapsel Tantang Orang Sipirok Bangun Kampung Halaman SIPIROK (Waspada): Bupati Tapanuli Selatan, Syahrul M. Pasaribu, menantang semua warga Kec. Sipirok yang berada di dalam dan luar daerah untuk membangun kampung halaman mereka yang telah ditetapkan menjadi ibukota Kab. Tapsel. Pasalnya, sejak akhir masa jabatan Almarhum Raja Inal Siregar sebagai Gubernur Sumatera Utara, Sipirok secara keseluruhan seperti daerah yang ‘tidur’. Tidak ada perkembangan yang signifikan,baikdarisegipembangunan maupunpengembanganwilayah. “Ayo semua yang mengaku dan merasa dirinya orang Sipirok. Daerah ini kaya akan potensi sumber daya alam dan sumber daya manusia, saya tantang Anda semua untuk membangun daerah ini,” tegasnya dengan lantang

pada peresmian bangunan Pasar Tradisional Sipirok, baru-baru ini. Bupati Tapsel meminta sebagianmasyarakatSipirokyang berada di luar daerah dan rataratamemilikiintelektualitastinggi, agar tidak hanya melontarkan kritik kepada pemerintah daerah. Tapi beri jugalah kontribusi pembangunan ke Sipirok sebagai kampung halaman. “Kritikitusah-sahsaja,karena merupakan suatu dinamika dalam berdemokrasi.Tapi harusnya diseimbangkandengankontribusi pembangunan. Bukankah GunungSibualbualimemilikipotensi sumber daya alam berupa gas bumi, kenapa dari dulu hingga sekarang tidak ada orang Sipirok yang berbuat untuk memberdayagunakannya,” ujarnya.

Bupati Syahrul M. Pasaribu mengaku mengenal banyak orang Sipirok yang memiliki intelektualitas tinggi dan punya jaringan banyak dengan para pejabat dan pengusaha besar di negara ini. Tapi sayangnya tidak banyak yang mau mempromosikan Sipirok sebagai kampung halamannya untuk mendapat bantuan pembangunan dan penanaman investasi. Pada kesempatan itu Syahrul juga menegaskan bahwa dirinya tidak pernah mengingkari atau membantah bahwa Sipirok adalah ibukota Kab. Tapsel, karena status itu telah ditegaskan dalam dua Undang Undang sekaligus. Yakni UU No.37 dan 38tahun2007tentangpemekaran Kab. Padanglawas Utara dan Padanglawas. (a27)

Pemkab Paluta Diminta Buat Perda Peralihan Fungsi Lahan GUNUNGTUA (Waspada): Pemerintah Kabupaten PadanglawasUtaradimintaserius dalam menjaga alih fungsi lahan pertanian terutama areal persawahan di sekitar kompleks perkantorankantorbupatiPaluta, Jalan Raya Gunungtua-Padangsidimpuan tepatnya di Tobat, sehingga areal persawahan itu tidak tergerus investor pariwisata yang sangat masif. “Tentunya sangat tidak kita inginkan terjadi konversi lahan akibat rakusnya investor untuk mencari lahan yang digunakan untuk membuat hotel dan perumahan,” ujar Ketua Komisi II DPRD Paluta, Gusman Efendi Siregar kepada Waspada, di Gunungtua, baru-baru ini. Dikatakannya, sawah di samping sebagai mata pencaharian masyarakat Padanglawas Utara,

juga sebagai tempat yang memiliki nilai budaya dan sosial, walaupun harga tanah pasca pemekaran di Gunungtua yang juga pusat ibukota Paluta sangat mahal. Akan tetapi perlu kiranya ketegasan Pemkab Padanglawas Utara untuk membuat Peraturan Daerah (Perda), sebutnya. “Menurut pengamatan saya, yang mampu menghalangi terjadinya transaksi jual beli areal persawahan,PemkabPalutaperlu kiranya membuat Perda yang bertujuan melindungi petani dari mata pencahariannya. Karena jika lahan pertaniannya terjual, maka petani akan tercabut dari akar sosial budayanya yang bermata pencaharian petani,” ucap Gusman. Dijelaskannya, ketersediaan pangan sangat ditentukan oleh ketersediaan lahan. Karena hasil

panendisampingditentukanoleh intensifikasi juga ditentukan seberapa luas lahan yang dijadikan areal persawahan. Penambahan areal persawahan sangatlah tidak mudah karena pasti mengorbankan areal lain yang jugahijaudalamhalinihutanyang sangat penting dalam menjaga iklim dan ekosistem. Namun demikian, kita minta agar Pemkab Paluta membuat langkahbriliandenganmembuat peraturanbupati(Perbup)atauperaturandaerah(Perda)untukmelindungi areal persawahan di sepanjangKompleksPersawahanTobat Indah,sehinggakebutuhanpangan di Paluta dapat terjaga dengan ketersedianlahanpersawahanyang memadai. dan masyarakat Paluta dapat menjangkau harga pangan karena tidak perlu impor dari luar daerah, jelasnya. (a35)

WASPADA Senin 19 Maret 2012

Waspada/Munir Lubis

SALAH seorang warga kelihatan sedih menyaksikan ruang kelas, asrama santri, perumahan guru dan kantin Pondok Pesantren Ma’ad Tarbiyah Darul Azhar Muarasipongi diterjangan banjir bandang.

Laksanakan Konsep Rasulullah TAPSEL (Waspada) : H Akrim Ashal Lubis, SE, MA menyampaikan konsep hidup Nabi Muhammad SAW. Disebutkan, ada lima konsep hidup agar selamat di dunia dan akhirat. “Pertama, memahami agama Islam berdasarkansunnahdankitabsuciAlquran,kedua siddiq (juran), ketiga amanah sebagai pemimpin, keempat tablig dimana kebenaran itu harus ditegakkan walaupun pahit, dan kelima adalah fatonah,” ujar Akrim Ashal Lubis. Berbicara sebagai penceramah dalam pengajian akbar warga Muhammadiyah di Desa Panobasan Dolok, Kec.Angkola Barat Kab. Tapanuli Selatan (Tapsel), Minggu (18/3), al ustad mengajak ribuan jamaah yang hadir agar melaksanakan konsep Rasulullah. Sebelumnya, pagi itu, ratusan anak-anak sekolah Muhammadiyah mulai tingkat SD hingga SMA melakukan pawai keliling menggunakan merching band dan arak-arakan sepedamotor

di kecamatan itu untuk memeriahkan pengajian akbar yang dihadiri enam pengurus pimpinan cabang dari seluruh Tapsel, yaitu PC Sipirok, Angkola Timur, Tano Tombangan, Simatorkis, Batangtoru dan Parsorminan. Penceramah yang juga Dosen Universitas Muhammadiyah Sumatera Utara (UMSU) ini mengungkapkan, kecerdasan bukan saja didapati di bangku sekolah formal, namun di dalam pengajian akbar seperti ini juga salah satu jalan untuk mendapatkan fatonah. ‘’Maka mari kita galakkan mengaji untuk menghindari perpecahan sesama umat muslim yang satu keyakinan,’’ ajak H Akrim kepada ribuan warga Muhammadiyah Tapsel yang hadir. Turut hadir dalam pengajian akbar itu,Wakil Ketua DPRD Sumut, Ir H Kamaluddin Harahap MSi, Ketua MUI Angkola Barat, H Syarifuddin Ritonga, Ketua PC Muhammadiyah Simatorkis, Zulkarnain Hasibuan, Ketua Panitia, Drs H Syarifuddin Simbolon, Pengajian Ibu-ibu Aisyah dan lainnya. Kamaluddin Harahap memacu warga Muhammadiyah agar lebih meningkatkan peningkatanpola-polaamalusahauntuk mencerdasakan umat, baik di tingkatanakranting,hinggasecara nasional. ‘’Bentuk amal usaha Muhammadiyah itu berupa sekolah Muhammadiyah, mulai tingkat SD hingga perguruan tinggi, rumah sakit, panti asuhan. Untuk memacu perkembangan amal usaha itu dimotori oleh Waspada/Ahmad Cerem Meha WAKIL Ketua DPRD Sumut, Ir H Kamaluddin Harahap MSi umat Muhammadiyah dengan dari kiri makan siang bersama pengurus Muhammadiyah cara berinfaq, sedekah dan amal Tapsel pada acara pengajian akbar di Desa Panobasan Dolok, jariyah lainnya,’’ ujar politisi PAN Kec. Angkola Barat, Kab. Tapsel. itu. (c13)

UGN P. Simpuan Wisuda 678 Sarjana P. SIDIMPUAN (Waspada): Universitas Graha Nusantara (UGN) Padangsidimpuan mewisuda 678 sarjana periode ke-20 Tahun Ajaran 2011-2012, pada sidang senat terbuka dipimpin Rektor UGN, Prof.Dr.Ir.Erwin Masrul Harahap MS, di kampus III komplek Asrama Haji Tapsel, Sabtu (17/3). Rektor UGN, Prof Erwin Masrul Harahap, dalam sambutannya menyebut para wisudawan/wisudawati periode ke-20 TA 20112012 ini sudah mendekati kualitas standar sesuai yang diinginkan pasar. “Kita sudah layak berbangga atas kualitas wisudawan/ti ini, karena telah sesuai dengan yang diinginkan pasar. Semoga ke depan, prestasi ini dapat terus dipertahankan dan tingkatkan,” harapnya. Disebutkan, hingga hari ini UGN Padangsidimpuan terus berbenah diri dalam menyongsong perubahan status menjadi perguruan tinggi negeri.Yakni mulai dari sisi kualitas tenaga pengajar, sara prasarana, proses belajar mengajar, hingga manajemen dan promosi

Jumlah mahasiswa UGN saat ini sekitar 8.000 orang dan terbagi dalam 5 fakultas dan 13 Program Studi (Prodi). Perkuliahannya tersebar di tiga kampus, yakni Kampus I di Tor Simarsayang, Kampus II di Jalan DR Soetomo, dan Kampus III di Asrama Haji Tapsel. Bupati Tapsel H. Syahrul M Pasaribu diwakili Asisten I, Aswad Daulay, mengajak para wisudawan/ti untuk mempertahankan titel kesarjanaannya.Yakni dengan cara mengabdikan semua ilmu yang diperoleh selama perkuliahan di tengah masyarakat. Ketua Panitia juga Pembantu Rektor III, A Rafii ST, dalam laporannya mengatakan, wisuda periode ke-20 ini dilakukan dalam dua gelombang dan pada hari yang sama. Wisuda dirangkai dies natalis tersebut diisi dengan penyerahan ijazah sarjana dan cenderamata kepada wisudawan/ti terbaik, antara lain Muhammad Arif dari Prodi ADM dengan IPK 3,46. Zoel Vernandes dari Fakultas Ekonomi Prodi Managemen (IPK 3,57), dan Fatma Hasanah dari Fakultas Teknik dengan IPK 3.07. (a27)

Penderita Gizi Buruk Butuh Bantuan SIBUHUAN (Waspada). Kisah pilu penderita gizi buruk, yakni Balita dua tahun di DesaTanjung Botung Kec. Barumun, Kab. Padanglawas, Torkis, putra ke-10 pasangan Habib dan Eni Rawati ini, sungguh memilukan. Dia membutuhkan uluran tangan dermawan.

Waspada/Idaham Butar butar

TORKIS, bocah berusia dua tahun, penderita gizi buruk di Desa Tanjung Botung,Kec.Barumun, Kab. Padanglawas.

Menurut keterangan Rawati, ibu kandung korban kepada wartawan, Minggu (18/3), bocah kelahiran 21 Desember 2010 ini sudah satu tahun menderita gizi buruk ditambah lagi menderita penyakit batu ginjal. Karena faktor ekonomi, keluarga ini hanya mampu membawa anaknya berobat gratis di PuskesmasTanjung Botung sekali dalam satu mingu. Dikatakannya, lima bulan lalu setelah anaknya dibawa ke Puskesmas, ketika itu suhu badannya panas. Setelah diperiksa,Torkis divonis tim medis menderita gizi buruk dan penyakit batu ginjal. “Kata dokter Puskesmas saat itu, Yuni Nasution, anak saya mengalami gizi buruk dan harus menjalani pengobatan secara rutin dan menyarankan supaya dirujuk ke rumah sakit,” kata Rawati. Dikatakannya, anaknya sering sakit-sakitan ketika memasuki usia delapan bulan, suhu badannya sering naik secara tiba-tiba. Selain itu, dari dalam perut Torkis kerap terdengar suara keroncongan. Kondisi terparah dialamiTorkis dengan tinggi 77 cm dan hanya memiliki berat badan 6,2 kilogram, atau setengah dari berat anak-anak normal seusianya. Ia tidak hanya menderita gizi buruk, juga menderita penyakit paru-paru, tubuhnya tampak semakin lemah. Meskitelahberusiaduatahun,anaknyabelum mampu berjalan maupun merangkak, seharihari hanya mampu berbaring dan telungkup. Untuk itu ia sangat berharap bantuan dermawan yang mau mengulurkan tangan untuk meringankan beban demi penyembuhan anaknya. (a33)

Ekonomi & Bisnis

B5 Tinjauan Ekonomi

WASPADA Senin 19 Maret 2012

Jhon Tafbu Ritonga Pengamat Ekonomi

Banyak Mampu Menjadi Gubsu Bu k u e k o nomi memberi tahu, kemauan manusia selalu lebih besar daripada ketersediaan barang dan jasa atau sumber daya yang diinginkannya. Oleh karena masalah keterbatasan sumber daya itulah dibutuhkan ilmu mengatur atau mengelola. Supaya sumber daya yang terbatas dapat digunakan secara efisien. Setiap orang harus bekerja keras untuk memenuhi kebutuhan dan kemauannya. Jika tidak bekerja keras, karena keterbatasan sumber daya dengan kemauan yang lebih besar, maka seseorang akan kehilangan peluang mendapatkan keinginannya. Sebab, keburu sudah diambil atau direbut orang lain. Semangat mendapatkan keinginan dengan kerja keras itulah yang menjiwai sistem ekonomi pasar. Penjelasan di atas mengingatkan, pemimpin tak cukup bermodal kemauan tanpa kemampuan. Dalam konteks Pilgubsu 2013, jika seseorang mampu dan mau menjadi Gubsu 2013-2018 maka dia boleh dicalonkan. Tetapi sangat tak bagus jika mencalonkan seseorang yang mau tapi tidak punya kemampuan. Niscaya ada konsekuensi yang memberi manfaat, atau merugikan masyarakat. Mencalonkan seseorang yang sangat berhasrat tapi tidak punya kemampuan adalah tindakan penjerumusan yang memelaratkan rakyat. Sekaitan dengan kemauan dan kemampuan menjadi Gubsu 2013-2018, saya menyarankan Partai Politik di Sumut mulai mencatat nama seperti Amri Siregar dan Dahlan Harahap untuk diajukan sebagai Calon Gubsu 2013-2018. Alasan saya mengajukan dua nama itu ialah karena melihat kemampuan kedua mantan Dirut PTPN itu selama ini. Kemampuan mereka yang luar biasa sudah terbukti membuat kinerja PTPN3 dan PTPN4 paling hebat. Tapi kemampuan yang hebat itu ternyata tidak membuat keduanya dipertahankan oleh pemerintah sebagai Dirut BUMN. Sebabnya ialah karena “kemauan”, bukan karena kemampuan keduanya. Dahlan Harahap diberitakan sudah tak mau lagi. Dia memilih pensiun menikmati usia menjadi Ompung. Sedangkan Amri Siregar jelas bukan karena tidak mampu, melainkan karena Meneg BUMN tidak mau lagi. Apakah karena Amri sangat getol membangun industri hilir sawit dan karet di proyek Big Bang Kawasan Ekonomi Khusus (KEK) Sei Mangkei? Kemampuan Amri sebagai CEO ternyata tidak menggoda hati Meneg BUMN Dahlan Iskan yang sudah dicangkok di China dengan lever entah siapa. Dahlan Iskan yang banyak dielu-elukan sebagai menteri peduli kinerja itu tidak mempertahankan keduanya. Padahal Amri dan Dahlan sudah terbukti sebagai ujung tombak Kementerian BUMN. PTPN3 dan PTPN4 sudah menghasilkan laba yang terus

meningkat dan menjadi contoh BUMN yang sangat maju. Melihat kemampuan mereka yang hebat membuat saya sampai pada kesimpulan, jika mencari contoh orang yang mampu ialah Amri Siregar dan Dahlan Harahap. Apakah mereka mau dicalonkan? Itu tugas para penyeleksi di semua partai yang ada di Sumut. Saya percaya kedua sosok tersebut tidak mau mencalonkan diri baik melalui partai maupun jalur independen. Oleh karena itu pemimpin politik harus menantang mereka. Daftar nominasi yang saya susun dan sedang analisis menunjukkan banyak tokoh di Sumut yang pantas dimasukkan dalam Daftar Calon Gubsu 2013-2018. Kriteria yang saya gunakan sederhana, yakni mampu. Namanama tokoh yang masuk kategori mampu tapi belum tentu mau dicalonkan dan apalagi mencalonkan diri disusun dengan abjad. Mereka ada sepuluh tokoh yang dicatat di sini yakni Abdul Wahab Dalimunthe, Amri Siregar, Amri Tambunan, Chairuddin P. Lubis, Dahlan Harahap, Imral Nasution, Muhyan Tambuse, RE Nainggolan, Rudolf M. Pardede, dan Sofyan Raz. Masalahnya, kesembilan tokoh tersebut bukan tipe ambisius mencalonkan diri dengan cara yang lazim sejak reformasi. Oleh karena itu harus partai yang proaktif. Sumut pernah punya banyak Gubernur yang hebat yang dikenang kepemimpinannya. Seperti Abdoel Hakim Harahap, Marah Halim Harahap, EWP Tambunan, Raja Inal Siregar, dan T. Rizal Nurdin. Pada level nasional juga banyak, seperti AH Nasution, Adam Malik Batubara, M. Panggabean, Akbar Tanjung, Cosmas Batubara, Anwar Nasution dan Darmin Nasution. Artinya Sumut punya banyak tokoh, dulu, sekarang dan bahkan yang akan datang. Mereka semua, dan banyak lagi yang lain, sudah mengukir prestasi. Mereka adalah pembuat sejarah nama baik Sumut sebagai gudang pemimpin yang tak diragukan oleh siapa pun. Dengan demikian, yang dibutuhkan sekarang ialah kejujuran dan keikhlasan dalam membuat Daftar Nominasi Calon Gubsu 2013-2018. Bahwa daftar nama yang dinominasikan belum cukup. Karena yang dimasukkan dalam nominasi ialah berdasarkan analisis rekam jejak atas kemampuannya. Belum tentu mau dicalonkan, apalagi mencalonkan diri sendiri. Oleh sebab itu, menjadi tanggung jawab para elit politik di partai-partai mengutamakan pertimbangan atas kemampuan. Para penyeleksi di partai-partai diharapkan menginsyafi, untuk mewujudkan visi dan misi partai dibutuhkan pemimpin mumpuni. Lihat kabinet yang didukung oleh koalisi dengan Sekgabnya. Biar pun koalisi besar, nyatanya banyak program pembangunan yang seret dan bahkan tercecer. Jadi, jujur dan ikhlaslah memilih Calon-calon yang baik, supaya nanti terpilih Gubsu terbaik. Supaya Sumut maju.

Pembangunan Pelabuhan Ekspor– ImporKruengGeukuhPerluDipercepat BANDA ACEH (Waspada): Pembangunan pelabuhan Krueng Geukuh di Lhokseumawe, yang akan menjadi pelabuhan ekspor–impor berstandar internasional, perlu dipercepat. Demikian salah satu rekomendasi dari Konferensi Kakao dan Kopi yang digelar di Banda Aceh. Butiran rekomendasi ini dibacakan Ketua Tim Perumus Konferensi Kakao dan Kopi Aceh, Giri Arnawa, sebelum penutupan acara, Jumat (16/3). “Pembangunan perluasan pelabuhan Krueng Geukuh Lhokseumawe yang diperkirakan menghabiskan dana Rp1,25 triliun ini, dijadwalkan akan selesai tahun 2014 mendatang,” ujarnya Pelabuhan ini, kata Giri, diharapkan dapat menjadi pintu ekspor komoditas unggulan Aceh seperti kakao dan kopi sehingga memberi dampak signifikan terhadap peningkatan ekonomi Aceh. Selain itu, konferensi ini juga merekomendasikan agar pemerintah Aceh segera mendorong pengintegrasian komoditas kakao dan kopi sebagai aktivitas

utama, dalam koridor ekonomi Sumatera pada Master Plan Percepatan Perluasan dan Pembangunan Ekonomi Indonesia (MP3I), selaras dengan salah satu butir dari draf RPJM Aceh untuk pemantapan ketahanan pangan dan nilai tambah produk pertanian. Karena itu, konferensi yang merupakan bagian dari kegiatan program Fasilitas Pendanaan Pembangunan Ekonomi (EDFF) ini juga mengharapkan agar Kementerian Pembangunan Daerah Tertinggal (KPDT), sebagai badan pelaksana program perlu lebih konkrit di dalam mendukung PRUKAB ( Produk Unggulan Kabupaten ). “Utamanya pada komoditas kakao dan kopi di beberapa kabupaten di Aceh,” lanjut Giri. Rekomendasi lainnya, pemerintah diharapkan dapat menfasilitasi perlindungan hukum Indikasi Geografis kakao dan kopi, melalui program sertifikasi. Forum Kakao Aceh dan Forum Kopi Aceh juga diminta sebagai jembatan kerjasama kemitraan antara petani dengan

pemerintah, sektor swasta dan lembaga internasional. Hal ini diperlukan untuk perluasan pengembangan dan nilai tambah komoditas kakao dan kopi di Aceh dan sertifikasi di pasar internasional. Pada bagian akhir rekomendasi, konferensi meminta Multi Donor Fund (MDF) yang memberikan dana hibah untuk kegiatan EDFF, dapat melanjutkan pendanaan program pengembangan masyarakat. “Pergeseran orientasi pendekatan program yang dilakukan MDF pascatsunami di bidang development program, dipandang penting mengacu pada pengembangan komoditas unggulan,” ungkap Giri seraya mengharapkan semua rekomendasi ini dapat menjadi upaya bagi peningkatan produktivitas dan profitabilitas komoditas kakao dan kopi Aceh ke depan. Asisten Deputi (Asdep) Urusan Investasi Kementerian PDT, DR Rusnadi Padjung M.Sc, pada penutupan konferensi meminta semua stakeholder yang terkait kakao dan kopi saling bersinergi. (b04)

Petani Sei. Bingei Langkat Masih Andalkan Tanaman Jagung L ANGKAT( Waspada): Banyaknya lahan dijadikan tanaman sawit, tidak mempengaruhi petani di Namuukur Utara Kec. Sei.Bingei, Kab. Langkat bertahan dengan tanaman padi dan jagung. Beberapa kelompok tani mengaku Sabtu( 17/3) saat panen perdana tanaman jagung benih Pertiwi2 di Desa Namuukur Utara Kec.Sei.Bingei. “ Kita berharap pemerintah menaikkan harga padi dan jagung, sehingga petani tidak terpengaruh merubah lahannya dijadikan tanaman sawit. Panen perdana benih jagung Pertiwi2 dilahan milik Haris Gurusinga dihadiri kelompok tani dari Namutrasi, Bandar Meriah, Kwala Mencirim dan Kota Binjai, hasilnya cukup baik. Diperhitungkan hasil panen mencapai 10 ton/perhektar. Surahman Ilyas menjelaskan, tanaman dari benih Pertiwi- 2 mempunyai batang besar, sehingga kokoh . Saat panen warna daun dan batang masih hijau, sehingga bisa dimanfaatkan untuk makanan ternak. PT Agri Makmur Pertiwi

Waspada/Riswan Rika

Perwakilan PT Agri Makmur Pertiwi Haryanto bersama Haris Gurusinga saat panen perdana jagung hibrida benih Periwi-2 di Namuukur. Sumut Hariyanto dan Maryono Karo,Deli Serdang dan Sergai. Haris Gurusinga mengakui mengemukakan benih Pertiwi2 merupakan karya anak bangsa tanaman jagung Hibrida desendiri untuk memberikan ngan benih Pertiwi-2 ditanambenih terbaik bagi petani jagung nya selama 101 hari dan ketika di Indonesia. Haryanto menye- dilakukan panen perdana dibutkan PT Agri Makmur Pertiwi perhitungkan hasilnya mencaselain menyediakan benih pai 10 ton/hektar.” Hasil panen jagung hibrida Pertiwi-2,juga masih bisa ditingkatkan,jika peada jagung manis Talenta. Benih makaian pupuk lebih terajagung Hibrida Pertiwi-2 dan tur”ujar Haris yang kini juga jagung manis Talenta sudah sedang menanam jagung manis diminati petani di Tanah Talenta di lahan seluas 5 rante. (a.04)

Waspada/Abdul Mukthi Hasan

CONGKEL KELAPA: Tiga warga kawasan Simpang Cot Ijue, Peusangan, Bireuen, Kamis (15/3) mencongkel kelapa untuk dijual ke pasar. Harga kelapa congkel di Bireuen sekarang ini dibeli pedagang dari petani Rp2.500 per kg. Harga tersebut dinilai petani kelapa masih rendah dibanding harga barang lain yang terus melambung.

Menperin-Mendag Sepakat Tinjau Kembali Perdagangan Bebas BANDUNG (Waspada): Menteri Perindustrian MS Hidayat dan Menteri Perdagangan Gita Wirjawan sepakat untuk melakukan dialog internal secara berkesinambungan untuk menyamakan persepsi terkait kerja sama perdagangan bebas (free trade agreement / FTA). “Ini sudah saya kemukakan. Saya sudah berikan semua angkanya. Jadi kita, Menperin dan Mendag, sepakat lakukan internal dialogue terus menerus untuk menyamakan persepsi maupun figures atau angkaangka yang ada di Kemenperin dan Kemendag. Seharusnya bisa jadi satu, karena kita menggunakan data-data resmi,” kata MS Hidayat usai workshop Kemenperin bertema “Pendalaman Kebijakan Industri” di Bandung, Jawa Barat akhir pekan lalu. Dia menegaskan, pihaknya tidak bertujuan untuk menghalangi atau memberhentikan FTA. Namun, FTA memang harus dikaji terlebih dahulu sebelum diimplementasikan. “Kemenperin agak kritis mengenai masalah FTA atau

Comprehensive Economic Partnership Agreement (CEPA). Maksudnya bukan menghalangi atau men-stop FTA, tetapi kalau ada perjanjian FTA baru harus dikaji dari semua sektor,” lanjut dia. Selain itu, menurut Hidayat, harus diketahui apa saja keuntungan dan kerugian yang didapatkan dari setiap sektor industri sehingga mengutamakan industri nasional. “Diberi gambaran dari masing-masing sektor apa benefit dan loss-nya, untung dan ruginya. Kita minta itu tidak hanya dilakukan oleh kementerian bersangkutan, tetapi di semacam komite di Menko Perekonomian, sehingga dibahas secara bersama-sama baru ditetapkan untuk berunding,” paparnya.

Menakertrans Optimis Mampu Stop Kirim TKI 2017 J A K A RTA ( Wa s p a d a ) : Kementerian Tenaga Kerja dan Transmigrasi optimistis bisa mencapai target untuk menghentikan pengiriman Tenaga Kerja Indonesia (TKI) pada 2017 mendatang. Hal tersebut tertuang dalam Roadmap Domestic Worker 2017 yang merupakan bagian dari upaya perbaikan kualitas kompetensi kerja masyarakat Indonesia yang hendak bekerja di luar negeri. Penghentian Penempatan TKI Domestik Worker pada tahun 2017 ini tidak bisa dilakukan secara mendadak melainkan harus dilakukan secara bertahap dan harus dipersiapkan secara matang dan komprehensif. “Dalam roadmap domestic worker tahun 2017, kita memang targetkan pengiriman TKI sektor domestik worker yang bekerja sebagai Penata Laksana Rumah Tangga (PLRT) bisa sampai ke titik `zero`atau tidak ada pengiriman,” kata Menteri Tenaga Kerja dan Transmigrasi Muhaimin Iskandar di Jakarta, Minggu (18/3). Muhaimin mengatakan sebenarnya saat ini pemerintah ingin segera menghentikan penempatan TKI domestik worker. Namun kita harus bersikap realistis dengan kondisi masyarakat yang masih butuh bekerja di luar negeri. “Pemerintah tidak berhak melarang warga negara Indonesia untuk bekerja ke luar negeri, karena akan melanggar Hak Azasi Manusia (HAM). Apalagi hak untuk bekerja dilindungi oleh Undang-undang Dasar 1945,” kata Muhaimin. “Sebagai solusinya kita harus menyediakan lebih banyak lapangan kerja di dalam negeri sehingga para pekerja perempuan yang bekerja ke luar negeri dapat beralih profesi untuk bekerja di dalam negeri,” tambahnya. Kalaupun sangat terpaksa bekerja di luar negeri di sektor domestik, maka posisinya harus jelas dan harus diakui oleh ne-

gara penempatan yang bersangkutan. Harus ada pengakuan kerja berdasar jabatan dan profesi dari negara penempatan yang meminta. “Jadi pilihannya adalah harus ada pengakuan kerja berdasarkan jabatan dan profesi. Negara-negara penempatan harus mengakui sebagai pekerja dengan jabatan dan profesi tertentu dengan memiliki hakhak normatif seperti hak jam kerja, hak libur, hak pendapatan sesuai standar minimal, standar upah atau asuransi jaminan sosial seperti pekerja formal lainnya,” urai dia. Sebagai pilot project, Muhaimin merujuk penempatan TKI Domestik Worker ke Malaysia yang patut ditiru oleh negara negara penempatan TKI lainnya di seluruh dunia. “Nantinya TKI domestic worker yang berkerja di Malaysia harus berbasis pada 4 jabatan kerja yaitu house keeper (pengurus rumah tangga), cooker(tukang masak), baby sitter (pengasuh bayi/ anak), caregiver (perawat jompo),” papar Muhaimin. Penempatan TKI domestic woker ke Malaysia yang rencananya bisa dimulai pada bulan Maret ini, tertunda sampai awal April nanti. Penundaan ini disebabkan adanya kesepakatan Pemerintah Indonesia dengan Pemerintah Malaysia bahwa untuk Calon TKI yang akan bekerja pada sektor domestik ke Malaysia harus mengikuti pelatihan minimal 200 jam pelajaran dengan berbasis empat jabatan kerja tadi. Muhaimin menambahkan jika selama ini, pemerintah telah melakukan pembenahan sistem penempatan dan Pelindungan TKI sejak pra, selama dan purna penempatan. Pemerintah telah melakukan memberlakukan pengetatan dalam penempatan TKI, terutama untuk sektor domestic worker. Jadi saat ini tidak semua calon TKI yang ingin bekerja di luar negeri bisa berangkat. (okz)

Dirjen Kerjasama Industri Internasional Kemenperin Agus Tjahajana di tempat yang sama manambahkan Indonesia harus menyiapkan sejumlah langkah guna mengantisipasi dampak dari sejumlah kerjasama ekonomi. Bahkan, renegosiasi bisa menjadi alternatif untuk merundingkan kembali sejumlah FTA yang malah menimbulkan defisit bagi Indonesia. “Ada yang disebut klausul temporary suspended. Kita bisa memanfaatkan itu untuk

memperjuangkan industriindustri yang mengalami injury akibat defisit perdagangan yang semakin dalam,” kata Agus. Namun, Indonesia harus mendapatkan persetujuan dari ASEAN atau negara-negara menjalin kerja sama dengan Indonesia sebelum mengajukan klausula tersebut. “Pada ujungnya, memang menjadi persaingan industri antarnegara,” ucapnya. Selama periode 2007-2011, ddijelaskan Agus, ada 12 sektor industri yang mengalami kesu-

litan akibat gempuran produk impor sejenis yang naik lebih dari 50 persen. Padahal, pemerintah telah berupaya untuk melindungi pasar dalam negeri. “Kita mengharapkan, ke depan, untuk setiap rencana kerjasama, negosiator Indonesia harus memahami kondisi, kebutuhan, dan kekuatan industri nasional. Kerjasama itu harus fair. Soal kalah menang itu biasa. Tapi, jangan sampai membunuh peluang bertumbuh di masa depan,” tandas Agus. (okz)

Semen Di Aceh Utara Duluan Naik Dari BBM KRUENG GEUKUEH (Waspada): Harga semen di pasar Aceh Utara duluan naik dari rencana kenaiknya BBM 1 April mendatang. Jenis semen di pasar Aceh seperti Semen Andalas dan Semen Padang masingmasing mengalami kenaikan sebesar Rp 1.500 per sak. Karena mendesak, permintaan meningkat. Pantauan Waspada, Sabtu (17/3) di sejumlah gudang semen di kawasan pasar Krueng Geukueh Aceh Utara, penjual semen disibukkan melayani konsumen, begitu juga truk bongkar semen. Menurut pemilik toko M Rizal, kendati harga merangkak naik tapi stok semen

masih stabil, begitu juga pembeli tidak kalah mundur. Tambah Rizal, kebutuhan semen di Aceh Utara saat ini terus meningkat, karena banyak permintaan untuk pembangunan toko dan infrasruktur di pedesaan. Hal itu kata Rizal berdasarkan cerita pembeli kepadanya. Karena kebanyakan mereka mengambil bon atau DO (delivery order), dan selanjutnya mengambil semen secara bertahap. Me l a m b u n g y a h a r g a tersebut terjadi sejak sepekan terakhir, sebelumnya harga Semen Andalas Rp 42.000 per sak, naik menjadi Rp 43.500 per sak. Kemudian Semen Padang

dari Rp 40.500 ribu per sak naik menjadi Rp 42.000 per sak. “Walaupun harga naik, permintaan saya lihat makin meningkat, mungkin karena mendesak. Biasanya sekitar seratusan sak per hari, kini mencapai 200 sak per hari,” ucapnya. Pemerhati sosial yang juga konsumen, Saifuddin, SSos mengharapkan pada pemerintah dapat menstabilkan harga kebutuhan masyarakat di pasar, salah satunya semen atau alat bangunan lainnya. Bahkan rencana kenaikan BBM 1 April mendatang itu akan merusak semua harga barang di pasar. Ujung-ujungnya perekonomian masyarakat terhempit dan tertindas. (cmk)

Hingga Akhir Desember 2011 Bank Mandiri Salurkan CSR Rp347,2 M MEDAN (Waspada) : Hingga akhir Desember 2011 Bank Mandiri Kantor Wilayah 1 Medan telah menyalurkan dana corporate social responsibility (CSR) sebesar Rp347,2 M. Dimana program kemitraan sebesar Rp Rp109,1 miliar dan Bina Lingkungan sebesar Rp238,1 miliar. Hal itu diungkapkan Regional Manager Bank Mandiri Kantor Wilayah 1 Medan Djoko Warsito disela-sela acara penyerahan bantuan hibah berupa satu unit Perahu Karet berikut peralatan dan perlengkapan tanggap darurat bencana banjir senilai Rp100 juta kepada PMI Sumatera Utara di Medan, kemarin. “Untuk akhir Desember 2011 bantuan CSR kita telah mencapai Rp347 M lebih, dan untuk 2012 belum ditargetkan namun akan lebih dari tahun sebelumnya,” ujarnya seraya menyatakan bahwa bantuan tersebut untuk membantu PMI Sumatera Utara untuk meningkatkan kualitas sarana/prasarana tanggap darurat bencana alam di Sumut khususnya di Medan. Dia juga menyebutkan bahwa bantuan tersebut juga sebagai implementasi program Corporate Social Responsibility (CSR) atau PKBL Bank Mandiri. “Seperti biasa program tersebut dilaksanakan melalui tiga pilar utama yaitu Pembentukan komunitas mandiri melalui pelaksanaan program Mandiri Bersama Mandiri yang bertujuan untuk membina kelompok masyarakat/komunitas secara terintegrasi dalam hal kapasitas, infrastruktur, kapabilitas dan akses,” ujarnya.


Regional Manager Bank Mandiri Kantor Wilayah 1 Medan Djoko Warsito ketika menyaksikan karyawan Bank Mandiri sedang melakukan donor darah. “Kedua adalah pencapaian yang diterima oleh Wakil Ketua kemandirian edukasi dan Bidang Penanggulangan Benkewirausahaan melalui pelak- cana Ir. H Benny Yuswar, disaksanaan program Wirausaha sikan oleh Deputy Regional Muda Mandiri dan Mandiri Manager Abdul Latif dan Jacob Pe d u l i Pe n d i d i k a n y a n g J Maitimu, PIC CSR, Mula serta bertujuan untuk menciptakan para pengurus PMI Sumatera pemimpin di masa depan yang Utara. Seusai acara penyerahan siap dengan persaingan global,” bantuan tersebut dilanjutkan lanjutnya. Sedangkan ketiga adalah dengan pelaksanaan kegiatan penyediaan fasilitas ramah donor darah yang diikuti oleh lingkungan melalui pelaksa- + 100 orang lebih karyawan/ti naan enam program utama Bank Mandiri di Kanwil 1 yaitu penyediaan sarana penun- Medan, pada Rabu (14/3). “Melalui bantuan hibah dan jang pengadaan air bersih, pengembangan energi terbaru- kegiatan donor darah ini, kami kan, penanaman pohon pada ingin memastikan bahwa kehalahan kritis, penanaman dan diran Bank Mandiri di tengahpemeliharaan tumbuhan tengah masyarakat dapat benarbakau, pengadaan taman kota benar dirasakan. Terlebih untuk dan pengembangan eco wisata. bidang kesehatan dan tanggap Penyerahan yang diserah- darurat bencana alam, sehingga kan langsung oleh Regional masyarakat yang membutuhManager Bank Mandiri Kantor kan darah dan yang terkena Wilayah 1 Medan DjokoWarsito bencana akan dapat segera kepada PMI Sumatera Utara tertolong,” kata Djoko. (m38)


WASPADA Senin 19 Maret 2012


Sisingamangaraja Pernah Berkunjung Ke Istana Banten JAKARTA (Waspada): Kesultanan Dua Banten Hj Tubagus Abbas Wasse, SH menegaskan, sejak jaman dahulu hubungan antara masyarakat Batak dan Banten sudah ada. Sebab menurut cerita leluhur kesultanan, Sisingamangaraja pernah berkunjung ke Istana Banten dengan hanya menggunaan kelopak daun kelapa. Karena itu, kesultanan memperhatikan dan menjaga masyarakat Batak yang ada di Banten, dan selalu meningkatkan komunikasi untuk mempererat hubungan Batak dengan Banten. Dengan tulus Hj Abbas mengatakan masyarakat Batak yang ada di Banten tidak dibedabedakan, sebab orang Batak juga sebagai warga negara Indonesia. “Permintaan saya, masyarakat Batak di Banten, bukan lagi Batak, tetapi adalah bangsa Indonesia yang menjadi warga Banten,” harap Hj Tubagus Abbas Wasse saat menerima kunjungan silaturahmi masyarakat Batak yang diwakili mantan Hakim Agung Humala Simanjutak, pengacara JS Simatupang, SH, Sitangang, dan mantan kepala Anjungan Sumatera Utara Taman Mini, Manik di Banten, kemarin. Menurut JS Simatupang, dalam pertemuan yang bernuansa kekeluargaan itu, masyarakat Batak meminta komitmen Tubagus Abbas untuk

menjaga komunitas masyarakat Batak yang ada di Banten, dan permintaan itu disambut baik dimana Tubagus meminta agar masyarakat Batak dan Banten saling menghormati dan menjunjung nilai-nilai kandungan Pancasila sebagai dasar negara. Dan lebih penting lagi adalah, toleransi sesama harus betul-betul dijaga. Usai silaturahmi keluarga Kesultanan Banten diberikan ulos sebagai tanda rasa saling keterikatan untu membina hubungan kekeluargaan yang lebih erat dan Tubagus, sangat berterimakasih telah menerima ulos Batak sebagai pertanda, agar Tuhan terus melindungi dan memberi kehangatan dalam keluarga Kesultanan. Rombongan masyarakat Batak perantau ini juga menampilkan Tor-tor tujuh cawan yang dibawakan Boru Simbolon. Sedangkan kelompok Kesultanan Banten yang terdiri dari tiga orang anak lengkap dengan para keluarga dan para kerabat lainnya menampilkan debus dengan mengupas kelapa menggunakan gigi dan dari dalam kelapa yang sudah dikupas, dikeluarkan sehelai kain yang bertuliskan ”Silaturahmi Raja Batak Dengan Kesultanan Banten. (aya)

BKKBN Sumut Tingkatkan Sosialisasi KRR JAKARTA (Waspada): Hingga akhir 2011, Badan Koordinasi Keluarga Berencana (BKKBN) Sumut telah memiliki 964 Pusat Informasi dan Konseling Kesehatan Reproduksi Remaja (PIKKRR). Targetnya 2012 sudah ada penambahan hingga menjadi 988 unit PIKKRR. Kepala Bidang Advokasi dan Informasi BKKBN Sumut Datang Sembiring di sela acara Rapat Koordinasi Nasional Kemitraan Program BKKBN dengan TNI, tim Penggerak PKK Pusat, PP Aisyiyah serta DPP Muslimat NU, di Jakarta, Rabu (14/3) mengatakan, PIKKRR sebagian besar ada di sekolah menengah, perguruan tinggi, klinik KB serta sejumlah RS bersalin. Dikatakan Datang, fungsi PIK bagi remaja sangat penting. Pasalnya, remaja saat ini sangat rentan terjerumus dalam pergaulan yang negatif. Tiga hal yang paling mengancam adalah perilaku seks bebas, nakotika dan HIV/AIDS. “Apalagi sekarang semakin banyak orang tua yang sibuk, jarang di rumah dan tidak sempat memperhatikan anak-anaknya yang telah remaja, sehingga perilaku dan pergaulan tidak terkontrol,” tambah Datang. Selain mening-

katkan jumlah PIKKRR, kerjasama dengan pihak terkait juga tengah digalakkan kembali guna pembentukan keluarga sakinah. Salah satunya adalah dengan DPW Aisyiyah Sumut. Ketua DPW Aisyiyah Sumut Nursukma Surip dalam kesempatan yang sama mengatakan, salah satu bentuk kepedulian pihaknya dalam mendukung program BKKBN adalah dengan mengadakan pengajian kesehatan reproduksi. “Pesertanya ribuan di seluruh Sumut. Di dalam pengajian, ibu-ibu diberi penjelasan tentang kesehatan reproduksinya serta anak gadisnya. Jadi jangan sampai ibu tidak paham mengenai kondisi fisik dan psikis anak remajanya. Nanti malah timbul kesalahpahaman dan ketidak-harmonisan dalam keluarga,” imbuh Nursukma. Selain itu, pelayanan KB juga akan diberikan di berbagai klinik bersalin milik DPW Aisyiyah Sumut. “Harapannya, tenaga medis dan dokter yang menangani KB jumlah dan kualitasnya ditingkatkan. Mudah-mudahan tahun ini semua klinik bersalin Aisyiyah sudah ada pelayanan KB dan konseling balita dan remaja,” tandas Nursukma. (dianw)

Ketua DPD Dukung T Amir Hamzah Nama Bandara Kualanamu JAKARTA ( Waspada): Ketua Dewan Perwakilan Daerah mendukung nama T Amir Hmzah menjadi nama Bandara Kualanamu. Tengku Amir Hamzah nama yang tak asing lagi dan sebagai penyair bukan saja di Sumatera Utara, tetapi sudah dikenal jauh di negeri ini. “Sepanjang nama Tengku Amir Hamzah yang diusulkan masyarakat Sumut, saya mendukung,” ujar Ketua DPD Irman Gusman kepada Waspada di DPD RI Jakarta, Rabu (14/3). DPD, kata Irman, akan mendukung

pembangunan bandara bertaraf internasional di semua provinsi dalam rangka meningkatkan sektor ekonomi, pariwisata dan perdagangan. Khusus pembangunan bandara Kualanamu, DPD melalui para anggotanya di komisi-komisi sering menyuarakan agar pembangunannya dipercepat. Mengenai nama bandara, DPD sepenuhnya mendukung aspirasi masyarakat. Jika masyarakat menginginkan nama T Amir Hamzah, kami akan mendukung, kata Irman Gusman. (j07)


H.FADLY Nurzal, SAg (tiga kiri) bersama Wali Kota Sibolga Drs HM Sarfi Hutahuruk pada acara Pelantikan PC Angkatan Muda Ka’bah (AMK) Kota Sibolga di Gedung Nasional Kota Sibolga, Sabtu (17/3).

Fadly Nurzal: Potensi Pesisir Luar Biasa SIBOLGA (Waspada): Bakal calon Gubernur Sumatera Utara H. Fadly Nurzal, S.Ag mengatakan wilayah pesisir memiliki potensi yang sangat luar biasa. Karena itu, berbanggalah tinggal di wilayah pesisir pantai, seperti di Kota Sibolga. “Saya lahir dan dibesarkan di wilayah pesisir Tanjung Balai, dan saya bangga menjadi masyarakat wilayah pantai,” katanya saat memberikan sambutan pada acara Pelantikan PC Angkatan Muda Ka’bah (AMK) Kota Sibolga dirangkai dengan tabligh akbar, di Gedung Nasional Kota Sibolga, Sabtu (17/3). Dijelaskan Fadly, potensi yang dimiliki wilayah pesisir sangat besar jika mampu dikelola dan dikembangkan secara baik. Oleh karena itu ke depan, kata Fadly, dibutuhkan kerjasama dan kekompakan untuk mensinergikan antara potensi yang dimiliki wilayah pesisir dihubungkan dengan cita-cita mewujudkan kesejahteraan masyarakat. Ke depan PPP telah berketetapan hati untuk mengembangkan program pembangunan, pemberdayaan dan penyelamatan masyarakat wilayah pesisir pantai. Ini penting dilakukan karena memang wilayah pesisir merupakan tonggak pembangunan bangsa dan negara. “Kita di Sumut punya sumber daya yang komplit, mulai dari pertanian, perkebunan hingga perikanan. Tinggal bagaimana kita mengelolanya secara baik demi kepentingan masyarakat,” ucapnya. Pada kesempatan itu, Fadly yang juga Ketua DPW PPP Sumatera Utara menyampaikan PPP adalah partai Islam. PPP tidak pernah terpikir berubah menjadi partai terbuka. Untuk itu kepada seluruh kader PPP diminta untuk menampilkan program kerja dan kebijakan yang benarbenar mencerminkan partai Islam. “Tampilkan PPP benar-benar partai Islam, sehingga umat tertarik untuk bergabung bersama PPP,” ucapnya. Di bagian lain, Wali Kota Sibolga Drs HM Sarfi Hutahuruk menegaskan wilayah Pantai Barat terkesan dianaktirikan, jika dibandingkan dengan wilayah Pantai Timur. Padahal, seperti disampaikan H Fadly Nurzal, potensi wilayah pantai barat sangat besar. “Berdasarkan indikator penerimaan Bantuan Daerah Bawahan (BDB), untuk daerah pantai barat khususnya

Kota Sibolga, masih sangat minim. Seakan daerah kami ini, tidak masuk bagian dari wilayah NKRI,” tegas wali kota. Oleh karena itu, kata Syarfi, terkait Pilgubsu mendatang kami dari wilayah Pantai Barat akan sangat selektif dan ketat dalam menentukan pilihan. Sosok calon pemimpin yang memiliki program, visi misi pembangunan untuk wilayah Pantai Barat dan yang mempunyai konsep masyarakat pesisir yang akan kami dukung. “Permintaan kami tak banyak, sekolah kami dibangun, kesejahteraan dan kualitas guru ditingkatkan, fasilitas dan gedung rumah sakit kami diperbaiki dan infrastruktur dibenahi. Ini curahan hati kami untuk diperhatikan,” imbuhnya. Pada kesempatan itu, wali kota juga menitipkan berbagai persoalan pembangunan di Kota Sibolga kepada kader-kader PPP yang ada di DPRD Sumut, untuk diperjuangkan. Sebab, untuk di DPRD Sibolga, antara Pemko dengan PPP sudah terjalin kerjasama yang baik, dan itu bagian komitmen untuk mewujudkan kesejahteraan masyarakat. Sebelumnya Ketua PW AMK Sumut Aswan Jaya SH, usai melantik PC AMK Kota Sibolga menegaskan, setelah dilantik tugas pertama yang harus dituntaskan adalah memenangkan H Fadly Nurzal, S.Ag sebagai Gubsu. Seiring dengan itu, lakukan konsolidasi internal dan melakukan kegiatan yang menyentuh kepentingan pemuda Islam. Di bagian lain, Ketua DPC PPP Kota Sibolga Kamil Gulo mengatakan PPP Kota Sibolga siap bekerja maksimal untuk memenangkan H. Fadly Nurzal sebagai Gubsu. Sebab ke depan, kita membutuhkan pemimpin yang memahami seluk beluk Sumut dan menurut kami itu dimiliki H Fadly Nurzal sebagai ketua DPW PPP Sumut,” ucapnya sembari menegaskan pada Muswil dan Mukerwil PPP telah diputuskan mendorong Fadly Nurzal menjadi Gubsu pada Pilgubsu 20132018. Juga hadir pada acara itu, Wakil Bupati Tapteng H Syukran Tanjung, SE, Kakan Kemenag Kota Sibolga, pejabat di jajaran Pemko Sibolga, tokoh agama, masyarakat, partai politik, ormas, keluarga besar PPP dan AMK Kota Sibolga, juga pengurus Tim PPP Mengabdi. (m07/rel)


PETUGAS mengevakuasi mobil Suzuki Carry bernomor polisi Z951W yang tertabrak Kereta Api Pasundan Jurusan Bandung Surabaya, di perlintasan rel tanpa palang pintu di Kampung Sindangkasih, Kelurahan Sukanegara, perbatasan Kecamatan Cibeureum-Purbaratu, Kota Tasikmalaya, Jabar, Minggu (18/3). Tabrakan itu menewaskan 10 dari 14 orang penumpang Carry.

Tabrakan KA Di Tasikmalaya 10 Orang Tewas TASIKMALAYA (Antara): 10 Orang tewas dalam tabrakan Kereta Api Pasundan di perlintasan rel tanpa palang pintu Kelurahan Sukanagara, perbatasan Kec. PurbaratuCibeureum, Kota Tasikmalaya, Jawa Barat, Minggu (18/3) sekitar pukul 09:35. Peristiwa tabrakan tersebut berawal ketika mobil Carry nomor polisi Z951W diduga mogok saat badan mobil masih berada di jalur rel kemudian datang Kereta Api Pasundan dari arah stasiun Tasikmalaya menuju Surabaya. Mobil yang ditumpangi satu keluarga itu langsung terpental

beberapa meter hingga berhenti di areal persawahan dengan kondisi mobil rusak berat. Informasi yang dihimpun dari kepolisian resort Kota Tasikmalaya, 10 korban tewas tersebut merupakan keluarga warga Perum Griya Setia Asri, Kel. Setiamulya, Kec. Tamansari, Kota Tasikmalaya. Berikut nama korban tewas tertabrak Kereta Api: Zaki lakilaki usia (6 bulan), Fadil laki-laki usia 6 tahun, Vina perempuan, 5, Debi, 9, Epul laki-laki usia, 20, Aci alias Yedi laki-laki, 35, Febi laki, 18, Iin perempuan, 35, Uum perempuan, 40, Kiki, 23. Selain menimbukan korban jiwa, penumpang mobil tesebut

Tidak Semua Media Bicara Kebenaran JAKARTA (Waspada): Ketua DPR RI Marzukie Alie mengatakan tidak semua media berbicara mengenai kebenaran dan melaksanakan fungsinya dengan benar seperti pendidikan, entertaiment. Untuk itu, masyarakat diharapkan tidak menelan mentah-mentah seluruh informasi yang dibaca dan disampaikan media. “Kita bisa lihat sendiri penayangan hal-hal yang tidak baik.Tidak semua media menjalankan fungsinya, bahkan cenderung memprovokasi. Jadi informasi apapun dicerna dengan benar, jangan ditelan mentah-mentah,” ujar Ketua DPR RI Marzuki Alie, di gedung DPR, Rabu (14/3), menanggapi pertanyaan siswasiswa SMA Taruna Nusantara mengenai opini yang terbentuk tentang buruknya citra DPR di masyarakat. Marzuki juga menyayangkan media yang justru lebih senang mengungkapkan hal-hal buruk tanpa menyelidiki lebih lanjut kenapa itu terjadi. “Contohnya ketika rapat paripurna digelar dan anggota banyak yang telat hadir, media hanya menuliskan hal itu, tanpa menyelidiki penyebabnya. Banyak anggota tidak hadir itu disebabkan juga karena mereka habis rapat menyelesaikan RUU, pembahasan rapat yang sampai pagi tidak pernah diungkapkan oleh media,” jelasnya. Media menurutnya juga kerap menuliskan apa yang sebenarnya tidak dikatakan oleh narasumber. Dirinya pun menceritakan bagaimana polemik seputar penggunaan rok mini dilingkungan DPR. “Saya tidak pernah katakan hal mengenai rok mini. Saya hanya mengatakan bahwa DPR lembaga terhormat dan sudah sepantasnya orang-orang yang masuk ke lingkungan DPR itu menggunakan pakaian yang sesuai dengan norma yang ada. Pakaian kan juga ada tempat-tempatnya,” tambahnya. Namun, Marzuki mengakui tidak akan mengambil langkah hukum atau melakukan somasi terhadap media yang bersangkutan. “Media itu diatur oleh UU Pers, kalau ada kekeliruan kita hanya diberi hak jawab. Capek kita kalau hanya mengurusi hak jawab atas pemberitaan yang salah,” ujarnya. (aya)

Ketua DPR Usulkan Pemotongan Anggaran 20% JAKARTA (Waspada): Untuk mengurangi tekanan hidup rakyat akibat dari kenaikan harga BBM dunia, yang juga ikut menekan APBN, Ketua DPR RI Marzuki Alie mengusulkan adanya pemotongan anggaran sebesar 20 persen yang diakomodir untuk rakyat. Pemotongan 20 persen anggaran diakuinya merupakan solusi, apalagi tingginya anggaran untuk program pembangunan terbukti sangat rentan bocor dan dikorupsi. “Tingginya anggaran selama ini untuk program-program pembangunan pemerintah membuat anggaran rentan bocor dan dikorupsi. Dari pada dikorupsi lebih baik semua anggaran program pembangunan pemerintah dipotong 20 persen dari yang ada saat ini, “ ujar Marzuki kepada wartawan usai memberikan pembekalan kepada siswa-siswi SMA Taruna Nusantara di Gedung DPR, Jakarta, Rabu(14/3). Namun, kata Marzuki, langkah itu belum bisa dilaksanakan saat ini, sementara menaikkan BBM nampaknya langkah yang harus ditempuh karena waktu yang sudah mendesak dan harga BBM dunia yang sudah tinggi. Politisi Partai Demokrat ini mengakui tidak efisiennya pengelolaan anggaran dan banyaknya kebocoran anggaranlah yang membuat langkah menaikan BBM harus dilakukan dan selama ini program-program pembangunan pemerintah membuat anggaran rentan bocor dan dikorupsi. ”Misalnya program pembangunan infrastruktur dan pembangunan fisik lainnya. Itu masih bisa dipotong 20 persen dari anggaran yang disediakan. Gedung dan jalan masih bisa dibangun dengan pemotongan anggaran sesuai dengan standar yang ada. Syaratnya cuma satu, anggaran itu tidak dikorupsi. Saat ini anggaran yang ada memang membuat rentan dikorupsi,” jelasnya. Untuk itu menurut Marzuki diperlukan kesepakatan dari pengelola anggaran untuk berkomitmen untuk tidak korupsi. (aya)

ada yang selamat namun mengalami kritis sehingga harus mendapatkan perawatan medis di Rumah Sakit Umum Daerah (RSUD) Tasikmalaya. Korban tersebut adalah Reihan laki-laki, 4, Setia perempuan, 14, Yudi laki-laki, 30 supir mobil, Yani

perempuan, 30. Salah seorang saudara korban, Yana, mengatakan mobil ditumpangi saudaranya yang dikemudikan Yudi rencananya akan menjemput anak korban Aqual yang sekolah di Pondok Pesantren Cintapada

untuk diajak berwisata mengisi hari libur akhir pekan. Pihak kepolisan dari Polresta Tasikmalaya masih melakukan olah tempat kejadian perkara, berikut memeriksa kondisi bangkai mobil yang masih berada di lokasi kejadian.

Penembak Wartawan TVRI Gunakan Jaket Army JAKARTA (Waspada): Polisi masih memburu pelaku perampok yang menembak mati wartawan yang juga produser TVRI, Djuli Elfano,47, di depan rumahnya, Sabtu (17/3). “Pelakunya ada dua orang, yang memegang senjata itu ciricirinya berbadan tegap, pakai topi dan jaket warna Army,” kata Kabid Humas Polda Metro Jaya Kombes Pol Rikwanto di Jakarta, Minggu (18/3). Menurut Rikwanto, polisi telah memeriksa beberapa saksi yang menyatakan pelaku penembakan berbadan tegap

dengan menggunakan jaket bercorak dan warna Army (seperti jaket tentara). Sementara seorang pelaku lainnya, kata Rikwanto, menunggu di sepeda motor dengan ciriciri berambut gondrong, berbadan kurus, dan memakai kaos serta wajahnya ditutupi sapu tangan. “Polisi tengah memburu keduanya, ciri-cirinya sudah kami kantongi. Semoga cepat tertangkap,” terang Rikwanto. Dari empat saksi yang dimintai keterangan termasuk seorang anak korban bernama Kenang Jenaya, polisi terus

melacak keberadaan kedua pelaku penembakan itu. Sebagaimana diwartakan, Djuli Elfano tewas ditembak perampok saat mempertahankan sepeda motor Suzuki Satria B 6481 WEP yang akan dibawa anaknya untuk bermain futsal. Peristiwa itu terjadi di depan rumah korban di Jalan Kalimantan Villa Bintaro Indah RT 07/ 011 Blok B4/2A, Jombang, Ciputat, Tangerang Selatan. Korban tewas saat dalam perjalanan ke rumah sakit akibat luka tembakan yang menembus bagian dada kirinya. (j02)


KETUA Umum PMI Jusuf Kalla menyaksikan serah terima naskah MoU PMI Sumut dari DR H Rahmat Shah kepada Rektor USU Prof.DR.dr.Syahril Pasaribu, Sabtu (17/3).

Jusuf Kalla: PMI Bukan Tempat Dagang MEDAN (Waspada): Kesadaran masyarakat Sumut untuk melakukan donor darah semakin tumbuh, padahal dahulu Sumut, khususnya kota Medan termasuk yang paling rendah, sehingga butuh pasokan dari daerah lain. Demikian Ketua Umum Palang Merah Indonesia (PMI), Jusuf Kalla saat memberikan sambutan dalam acara penandatanganan naskah kesepahaman PMI Sumut dengan Lima Perguruan Tinggi di Ruang Rapat Senat Akademik Universitas Sumatera Utara (USU) Medan, Sabtu (17/3). Kelima Perguruan Tinggi yang turut menandatangani naskah kesepamahan tentang kerjasama bidang kepalangmerahan tersebut adalah Universitas Sumatera Utara (USU), Universitas Negeri Medan (Unimed), Institut Agama Islam Negeri Sumatera Utara (IAIN-SU), Universitas Islam Sumatera Utara (UISU), dan Universitas Muhammadiyah Sumatera Utara (UMSU). Sebelum MoU ditandatangani, Rektor USU Prof.DR.dr. Syahril Pasaribu selaku tuan rumah menyampaikan, sebenarnya USU sudah rutin melakukan kerjasama dengan PMI

terutama dalam hal kegiatan donor darah dimana dalam setiap kegiatan kampus tetap ada aktivitas donor darah. Apalagi setelah adanya penandatanganan MoU ini, jelas akan lebih baik karena sudah ada “payung” hukum. “Perlu kita jiwai, bahwa donor darah amat penting, untuk itu mari sama-sama kita sukseskan, terutama bagi mahasiswa-mahasiswa baru nantinya”, ujarnya mengajak kalangan perguruan tinggi yang hadir, di antaranya Ketua MWA USU Ir.H.Joefly J.Bahroeny. Sementara itu DR.H. Rahmat Shah, selaku ketua PMI Sumatera Utara mengucapkan terimakasih atas kesediaan perguruan tinggi untuk bekerjasama dalam hal pelaksanaan kepalangmerahan di lingkungan kampus. “Alhamdulillah, hari ini PMI Sumut bisa menanda-tangani naskah kesepahaman dengan USU, Unimed, IAIN, UISU dan UMSU, serta sebelumnya dengan Organisasi DPP Aceh Sepakat Sumut. Ini tentunya menambah semangat kita semua dalam rangka tugas kemanusiaan, dimana sebelumnya juga telah dilakukan MoU serupa dengan Kodam I/

BB, Poldasu, Korpri Sumut, Kosek Hanudnas, dan BPD HIPMI Sumut, yang juga disaksikan oleh Bapak Jusuf Kalla”, ujarnya. Dalam kata sambutannya, Jusuf Kalla juga menyatakan kebahagiaannya untuk samasama beramal, karena PMI bukan tempat dagang, tetapi adalah untuk mengabdi. Donor darah sangat dibutuhkan oleh masyarakat, semakin makmur suatu negara semakin tinggi kebutuhannya terhadap darah. Lebih lanjut dikatannya bahwa PMI ditugaskan oleh negara sejak tahun 1950. Darah tidak boleh diatur secara komersial. Dengan MoU ini ke depan, Sumut tidak hanya mampu memenuhi kebutuhan darahnya, akan tetapi juga mampu membantu daerah lain. “Saudara Rahmat telah menebarkan amal, ujar Kalla. Jusuf Kalla hadir didampingi Ketua Bidang Pelayanan Kesehatan dan Sosial, Rumah Sakit dan Transfusi Darah PMI Pusat dr. Farid Husain, Sp.Bd, dan tokoh-tokoh nasional lainnya seperti, Prof.Dr.Bachtiar Ali, Ferry Mursidan Baldan, Hamid Awaluddin, Anggota DPD RI Aksa Mahmud dan Sofyan Jalil. (m08)

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000

7 CM 8 CM

Rp. 91.000 Rp. 104.000

SUZUKI SIDEKICK 96 BK Mdn Asli. Hijau met. AC, Tape, Full musik, PS, SL, Cantik, Nego. HP. 0812 6424 995

BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

Bursa Automotive

SUZUKI Escudo 2.0 Matic Thn. 2001, Hitam, BK Mdn Rp. 92Jt. Hub. 77863981



New Avanza, Innova, Rush, Fortuner, dll. Bunga ringan & hadiah menarik Hub. Ginting - 0853 1098 8164

DAIHATSU Taruna CSR - EFI Thn. 2001/ 2000. Hitam met (Over Kredit). Terawat, Plat BM. DP 43Jt (Nego). Angs: 2,5Jtx25 bln (sdh byr 11 kali) Hub. 0852 9775 0771 - 77756757 Jl. SM. Raja/Sebelum Polda

Ready: Dyna, Innova, Avanza, Fortuner, Yariz, hadiah special, Bonus, proses cpt. Hub. 061-77875227 atau 0812 6508 8835


AUTOMOTIVE Informasi Pembaca



: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

Dapatkan New XENIA dgn Cicilan 2 Jutaan TERIOS Cicilan 3 Jutaan, PICK UP DP 7 Jt-an Hub. ANANDA 0853.6165.8235 24 Jam siap melayani


All New Xenia angs 2,8Jt-an (4 thn). Grand Max Pick Up Angs. 1,8Jt-an (4 thn). Terima Tukar Tambah. Hub. DIKA 0852 7074 7744 DAIHATSU BARU

Terios DP 24 Jt-an Pick Up DP 8 Jt-an New Xenia DP 20 Jt-an Luxio DP 19 Jt-an Syarat dan ketentuan berlaku Hub. 0821 6299 9733 VIRTHON ASTRA


Terios DP 24 Jt-an Pick Up DP 8 Jt-an New Xenia DP 20 Jt-an Luxio DP 19 Jt-an Syarat dan ketentuan berlaku Hub. 0821 6299 9733 VIRTHON ASTRA


New Pick Up Gran Max DP 7Jt. Angs. 2 Jt-an All New Xenia DP 20Jt Angs. 3Jt-an New Terios DP 22Jt Angs. 4Jt-an Dapatkan segera mobil impian Anda, Proses Cepat & Akurat. Hub. Ahmad Arif Nasution HP. 0812 60052 465 (24 jam)

DAIHATSU Taft GT 4x4 Thn ‘93, W. Hitam, AC dingin, CD DVD/ Free lock, Velg cobra, Ban Rad, Body kaleng², Mesin gardan, Porsneling sangat baik Hub. 0812.6025.8795 NB. Lihat mobil dijamin tdk kecewa ISUZU Panther 96 (BU) Hijau, Sound Sistem, Power Steering, Velg Racing cantik, Power Window, Jok kulit baru. Mesin sehat. Stiur racing. Assesoris lengkap, pemilik H. 64Jt (Nego). HP. 0821 6888 8284.


Discount Kandas, Proses Cepat LINA.S

0812 6947 2909

NISSAN READY STOCK Nissan March DP Murah 26Jt-an atau Angsuran 2 Jt-an + Kredit s/d 5 tahun Hub. 0813 7711 3935

NISSAN XTRAIL XT MATIC Thn. 2004. Coklat met, BK Mdn Rp. 145Jt. Hub. 91327433 NISSAN Livina XR Manual Thn. 2008. Biru Met, BK Irit BBM Rp. 129Jt. Hub. 0853 6161 5977 # NISSAN PROMO #

X-Trail. G. Livina, March, Juke. Disc + Bonus + Hadiah ALDY: 0813 8300 3509 - 061.7509 0395



TOYOTA New Vios, Yaris, Altis, Fortuner, Dyna, Bisa Tukar Tambah. Hub. Khadafi. 0812 6029 0887 TOYOTA BARU


PURBA : 0813 9789 4633

TOYOTA Kijang Krista Diesel Thn. 2003. Hitam, BK Medan Rp. 152Jt. Hub. 0852 7538 3218 TOYOTA Innova V Bensin Matic Thn. 2005. Hitam, BK Mdn Hub. 0853 5944 6599

Pencairan 1Juta - 10 milyar. Tanpa Usaha. Proses Max. 1 Hari Cair, Jaminan: SHM, SK Camat, HGB. BPKB Mobil, Spd. Mtr, Truk (Bantu Pelunasan BPKB). Hub. RAY 0813 7044 6633, 0813 7044 6668


Jaminan, SHM, SK Camat, dll. Proses 1 hari paling lambat bisa bantu over bank & pinjaman 1 jt s/d 500Jt. Hub. 0813 7675 1553



DIJUAL CEPAT WILYS CJ7 (The Legend Jeep) Thn. 1981, Warna biru, siap pakai. Hub. 0813 7675 1553

BURSA BUTUH DANA BUTUH DANA Jaminan BPKB mobil, Pick-Up, truck, intercooler, data lengkap. Proses cepat. Hub. 0853 597 11000


Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.


- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954




Carry PU 1.5 FD Rp. 10 Jt-an Angs. 2.663.000 APV PU Rp. 16 Jt-an Angs. 2.743.000,Pesan Suzuki Ertiga Sekarang Juga! Hub. 0812 654 0809 / 77722121


1 (Bh) DVD Merk Philips Second Komplit. Harga Rp. 1.300.000 Nego. Hub. IYAN Jl. D. Singkarak Gg. Amal No. 129 Mdn. NB: Hanya Yang Serius





Hadiah TV MOBIL + PARKING SENSOR Cash Back 12 JUTA Ka ca Sola r G Film ua rd

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000


TOYOTA Kijang LX 1.8 Bensin Thn. 2004, Silver, AC, VR, PS, CL, Jok kulit, Plat BM Rp. 102Jt. Hub. 0812 6594 2789

1,6Jt (acer 1xJt) Projector=1,9Jt LATOP TOSHIBA= PTcom-0812-636-1967 Jl. Rantang 20s (Gatsu)

Coi5-acer+VGA320Gb=3,6Jt-(Coi3=2,99Jt) - Co2 +vga 1xJt

-P4-2 8cas-new=685rb-P4-2.8+MB=299rb (hdd160=3xxrb) CPU -P4LGA3,0+MB (599rb)-LCD 15” 17” 20” 23” mulai 5xxRb”? Tukar + brg lama anda (LCD ke LCD-tv=3xxrb (Mon 17” ke LCD485Rb)

Pelanggan Yang Terhormat


Apabila anda mencurigai sesuatu, silahkan hubungi kami di



BPKB Spd. Motor Honda BK 5460 GU a/n. Yon Hendri. Alamat Jl. Karya Jaya No. 6 Polonia Medan. No. BPKB: C59315

HILANG Surat Tanah SK Lurah Sitirejo - II Dengan Surat Keterangan Nomor No. 5942 / 3 / SKT/ST-II/II MA/2012. A/n. H. ISHAR IBRAHIM yang terletak di SM. Raja Km. 4,5 No. 28 Kel. Sitirejo Kec. Medan Amplas Luas +/- 94,5M2.


Asli Surat Tanah atas nama: Abdul Rahman Terletak di Jl. Pelita IV Gg. Serayu II No. 8 Medan. Ukuran 12 x 30M2. Tercecer antara Jl. Pancing sekitarnya. Bagi yang menemukannya Hubungi YUSRI 061 6640863, ERNA 0812 60071 276 Tidak akan dituntut dan akan diberikan hadiah sepantasnya.


Surat Tanah Alm. Muhammad Idris Nst. Jl. Gurilla 69 Langgar No. 5 di seputar Jl. Gurilla dan Jl. Pimpinan. Hubungi: Yahya HP. 0852 7780 9319 TERCECER

1 (satu) Buah STNK + Kunci mobil, BK 437 RI, A/n. Yetriana, tercecer disekitar pusat pasar Hub. 4566.264 (UD. Jaya) 733.0045 (Tri Jaya) Tidak akan dituntut dan diberi hadiah


Surat Tanah yang diketahui kepling dan Lurah Rengas Pulau, A/n. M. Jusma Selamet, luas 3069m², tercecer tgl. 15 Feb 2012, disekitar Jl. Kapt. Rahmat Budin s/d Jl. Marelan Raya, bagi yg menemukan hub. 0812.6343.4482, akan diberi hadiah sepantasnya



Hubungi Daeler SUZUKI


JL. JEND. G. SUBROTO 18-20-22 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN * Jl. GURU PATIMPUS 11-D Simpang Jl. Kelapa TEL. 4151018 - 4535762 MEDAN


845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F




GPS TRACKER Bisa Liat Mobil Bisa Matikan Mobil Bisa Sadap Suara Hrg. 1.650.000 HP.0853 6010 8350 0813 6117 7319 BURSA MESIN

Dijual: Mesin Cetak Double Folio, mesin sehat, hasil bagus, pasti untung, merk Hamada Star 800 DXN Jepang, Hrg. Nego. Hub. 0853 6097 8797 / 0821 6174 1314



Lele Pyton, Nila, Gurami, Bibit Karet/Green Budding, Lada, Gaharu, Buah, Kambing PE. Hub. KOP. SUARSA HP. 0852 7759 0338




HOTEL MADINAH : AL-HARAM / DALLAH TAIBAH HOTEL MAKKAH : SARAYA AJYAD / MAKARIM HOTEL JEDDAH : AL AZHAR Penerbangan Via Singapore *Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis DAFTAR SEGERA

Kantor: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4/18 Medan





1. 2. 3. 4. 5. 6.

Merawat kejantanan secara alami (tidak ada efek samping) besar dan panjang, permanen dan cukup sekali datang Alamat: Jl. SM. Raja masuk Jl. Sempurna No. 18 (samping UISU SM. Raja) HP. 0821.6287.2748 No. Izin Kejaksaan, Nomor: B12/DSP.5/01/2012 Metode: Penanganan dari ujung kaki sampai pada pangkal alat vital untuk membetulkan urat yang tersumbat dan melancarkan peradaran darah membetulkan aliran sperma. kemudian dikusuk/ terapy untuk penambah ukuran besar dan panjang tidak ada efek samping, permanen, bebas pantangan dan untuk semua agama.

PRIA - Panjang: 10 - 12 - 14 - 16 - 18 - Besar: 3 - 4 - 5 - 6 - 7 - Sperma encer - Lemah syahwat - Ejakulasi dini - Impotensi

WANITA: - Memperindah payudara - Menjadikan G-spot, seperti perawan kembali - keturunan

DIJAMIN BERGARANSI KONSULTASI UMUM: - Susuk semar asih - Ajian tali raga - Susuk Ratu Malam - Bedak aura kinasih - Ajian pemutus & penyambung cinta - Pelet tuyul

Tempat manasik Mesjid Agung Medan Jl. P. Diponegoro DAFTARKAN SEGERA KE:

KANTOR PUSAT MULTAZAM MEDAN Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6495.8456 KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI


Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benar-benar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria jangan sampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANIT A: ANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333






Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.1222




Garansi 10 Hari Sembuh Tanpa Operasi HUBUNGI: SPECIALIST WASIR

(±50m dari Simpang Pelangi) Hubungi: 0852.9751.4253 0812.6050.0881


Umroh Reguler 9hr, 12/ 13 bulan Maret 1x Seminggu Umroh dan Arbain di Madinah 20hr Umroh Plus Turkey - Awal Mei, Juni Umroh Plus Mesir - Bulan Mei Umroh Plus Jordan Aqsha - Bulan May Umroh Ramadhan awal - tengah - akhir 1 bln 2 minggu - 9 hari (Hotel - Apt)

Manasik Haji Multazam: Setiap hr Sabtu Pkl. 14.00-16.00Wib hr Minggu Pkl. 09.00-11.00 Wib




Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput



Jl. Brigjend. Katamso No. 683C Medan




Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488 Website:




IKLAN KHUSUS 6x1,5 kolom Rp. 120.000



11 CM Rp. 165.000 12 CM Rp. 180.000

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms TI-HA TI untuk membeli produk anda, dan HA HATI-HA TI-HATI apabila anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab


TOYOTA Corolla DX Thn. 82/83 Warna Biru Tua. AC/Tape/Velg, Racing. HP. 0813 7525 6991 Ready Stock Yaris Terbaru 2012, Avanza G Innova, All Tipe. Fortuner, Putih, Hitam, Rush, Hilux, Bisa Tukar Tambah. Semua Mobil. Hub. 0813 6120 1719 / 68783325

9 CM Rp. 126.000 10 CM Rp. 140.000

Senin, 19 Maret 2012


Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat


Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari


WASPADA Senin 19 Maret 2012

07.00 Go Spot 07.30 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14.30 Kabar Kabari 15.30 Tom & Jerry 16.00 Silet 17.00 Seputar Indonesia 17.30 Target Operasi 18.00 Mega Sinetron : Yusra Dan Yumna 22.30 D’Journey 23.00 Box Office Movie 00.00 Seputar Indonesia Malam


07.00 Inbox 09.00 Halo Selebriti 10.00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 Liputan 6 Siang 12.30 SCTV FTV 14:00 Liputan 6 Terkini 14:30 Status Selebriti 15.00 Cinta Dan Uya Sama Sama Kuya 17.00 Liputan 6 Petang 17.30 SCTV FTV Istimewa 19.30 SCTV Sinetron : Putih Abu Abu 20.30 Cahaya Gemilang 21.30 SCTV SInetron : Anissa Dan Anissa 22.30 Liputan 6 Terkini 22.03 SCTV FTV Utama

07:00 Disney Club 08.00 Cerita Pagi 10.30 Di Antara Kita 11.00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 13.30 Cerita Siang 15.00 Starlite 15:30 Lintas Petang 16:00 Animasi Spesial 17.45 Animasi Spesial The Owl 18:00 Filler Didi Tikus 18.10 Shaun The Sheep 19:00 Fathiyah 20.00 Tendangan Si Madun 21.00 Si Miskin Dan Si Kaya 22.00 Dewi Dewi Show 00.30 Lintas Malam

07:30 Bo On The Go 08:30Dink,TheLittleDinosaurus II 09:00 New Chhota Bheem Aka Bima Sakti 09:30 New Chhota Bheem Aka Bima Sakti 10:00 Properties In HarmonyMinggu 10:30 Foody With Rudy 11:00 BRI Indonesia 11:30 Topik Siang (Live) 12:00 Klik ! Weekend 13:00 Kampiun Sepakbola Nasional 13:30 Total Football 14:00 Mantap (Live) 15:00 Divisi Utama 2011-2012 17:30 Topik Petang (Live) 18:00 Indonesia Super League 2011-2012 20:30 Kembali Bergoyang 22:30 Sinema Aksi

07:00 - KISS Pagi 07:30 - Sinema TV Pagi 09:30 - Hitzteria 11:30 - Patroli 12:00 - Drama Asia (Korea): Dong Yi 13:30 - Drama Asia (Korea): Pink Lipstick 15:00 - KISS 16:00 - Fokus 16:30 - Drama Asia (Korea): Miss Ripley 18:00 - Drama Asia: Return Of The Condor Heroes 19:00 - Satria 20:00 - Tutur Tinular 22:00 - Buaya Show 23:00 - Mega Asia

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Metro Xin Wen 11.05 e Lifestyle 13.05 Zero to Hero 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Prime Interview 21.05 Top Nine News 22.05 Economic Challenges 23.05 Metro Realitas 23.00 Metro Sports


07:30 Ranking 1 08:30 Bioskop Indonesia 10:30 IBU 11:00 Insert 12:00 Go Go Girls 13:00 Jelang Siang 13:30 Reportase Siang 14:00 New Happy Family 14:30 Keluarga Minus 15:00 Sketsa 16:00 Show Imah 17:00 Reportase Sore 17:30 Insert Sore 18:00 Jika Aku Menjadi 19:00 Comedy Project 20:00 Bioskop TRANSTV Spesial 22:00 Bioskop TransTV : Never Say Never Again 00:00 Kakek-Kakek Narsis 01:00 Bioskop TransTV : Falling Down 03:00 Reportase Malam

06.30 Apa Kabar Indonesia 09.30 Kabar Pasar Pagi 10.00 Coffee Break 11.30 Kisah Sukses UMKM 12.00 Live News Kabar Siang 13.30 Satu Jam lebih Dekat 14:30 Live News Kabar Pasar 15.00 Best Match La Liga 17.00 Live News KAbar Petang 19.30 Apa Kabar Indonesia Malam 21.00 Live News Kabar Malam 22.00 Live News KAbar Arena 23.30 The Legend

08:00 Penguin Of Madagascar 08:30 Pat & Stan 09:00 Super Hero Kocak 10:00 Obsesi 11:00 Hot Spot 12:00 Awas Ada Sule 2 13:00 Sketsa Tawa 13:30 Main Kata 14:30 Petualangan Panji 15:00 Berita Global 15:30 Fokus Selebriti 16:00 Top Banget 16:30 Tamu Gokil 17:00 Pat & Stan 17:30 Spongebob Squarepants 18:45 Indonesian Premier League 21:00 Big Movies 23:30 Movies

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Aktor Peraih Oscar George Clooney DanAyahnya Ditahan


AKTOR George Clooney (tengah), anggota Kongres AS Jim Moran (belakang) dan ayah Clooney, Nick Clooney (kanan) ditahan dan diborgol dalam satu unjukrasa di luar Kedubes Sudan di Washington, Jumat (16/3). Unjukrasa bertujuan memprotes peningkatan krisis kemanusiaan di Sudan yang mengancam kehidupan 500.000 jiwa.


Dibutuhkan Tenaga Kerja untuk Restoran sebagai : 1. Waiter/ Waitress 2. Steward Persyaratan: a. Berpenampilan baik dan menarik b. Mau bekerja keras c. Dapat berkomunikasi dengan baik d. Mau menerima tantangan Antarkan lamaran Anda langsung ke:

- OFFICE SDM: Jl. Sei Batang Hari No. 43 RM. Waroenk Nenek, atau ke Cabang JOKO SOLO terdekat


LOWONGAN DICARI: Pria Tukang Pangkas Rambut Hub. Rully 0813.7545.7734 Lokasi: Tj. Anom - Medan

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda


Dibutuhkan Tenaga kerja Wanita untuk ditempatkan bekerja pada perusahaan Elektronik Multi Internasional di Bayan Lepas P. Pinang Malaysia



ADMINISTRASI WANITA Kriteria: 1. Usia 17 s/d 29 tahun 2. Jujur 3. Bertanggung jawab 4. Min. tamatan SMA 5. Tidak sedang kuliah 6. Bisa berbahasa Hokkian/ Mandarin 7. Langsung di Interview Hub. langsung, Ibu Yuliani No Telp. (061) 6995.9490 paling lambat 1 minggu sejak iklan ini diterbitkan


Perusahaan elektronik VISTA POINT TECHNOLOGY SDN. BHD yang berada di Shah Alam, Selangor, Malaysia, memerlukan beberapa pekerja perempuan sebagai Operator Produksi. Dengan persyaratan sebagai berikut: Perempuan berumur antara 19 - 35 tahun 1. Pendidikan minimal SMP, SMU/ sederajat 2. Kontrak kerja minimal 2 tahun 3. Mendapat izin dari orang tua/ keluarga Fasilitas dan Gaji: 1. Gaji memuaskan 2. Tunjangan kehadiran & shift disediakan 3. Asrama, transport dan Rumah sakit disediakan 4. Levi (Pajak Pekerja Asing) disubsidi oleh perusahaan 5. Biaya pemberangkatan disubsidi oleh perusahaan dan hanya dipotong sebesar RM. 900 (dipotong RM 150x 6 bulan) 6. Dilindungi oleh asuransi selama bekerja Pendaftaran dilaksanakan mulai 17 Maret sampai dengan tanggal 19 Maret 2012 Testing & Interview dilaksanakan pada tanggal 20 Maret 2012 Jika berminat segera mendaftar dengan membawa foto copy Ijazah, KTP dan pasphoto masing-masing 2 lembar dapat diantar langsung ke alamat berikut: PT. SAHARA FAJARINDO CORP JALAN KANGKUNG NO. 61 MEDAN 20153 (BELAKANG GEDUNG BUMI PUTERA DI JLN ISKANDAR MUDA) TELP: 415.7621 - 455.1305

(Direct Company/ tidak melalui Outsourcing) Syarat-syarat untuk pendaftaran/ Seleksi: 1. Wanita, umur 18 s/d 35 tahun 2. Pendidikan minimal SMP/ sederajat 3. Membawa fotocopy Ijazah dan KTP masing-masing 1 lembar 4. Membawa pasphoto berwarna ukuran 3x4 = 2 lembar Pendapatan gaji: - Gaji basic : RM 540.00/ bulan - Tunjangan Makan : RM 75.00/ bulan - Tunjangan Shift : RM 147.00/ bulan - Tun. Produksi : RM 120.00/ bulan Belum termasuk lembur (over time) Fasilitas-fasilitas lain yang akan diterima TKI sbb: - Asrama dan perlengkapannya disediakan perusahaan Gratis - Transportasi dari asrama - kilang asrama disediakan perusahaan Gratis - Perlindungan asuransi kecelakaan kerja 24 jam - Klinik kesehatan - Pajak/ Levy ditanggung majikan sepenuhnya => Berangkat ke Malaysia naik Pesawat Terbang ~ SELEKSI DILAKSANAKAN HARI KAMIS, 22 MARET 2012 ~ Untuk informasi selengkapnya hubungi:

PT. KARYATAMA MITRA SEJATI SIUP No: KEP 645/MEN/2006 Jl. William Iskandar/ Jl. Pancing No. 41-42 Medan Telp: (061) 735.9868 (Hunting) Flexi: (061) 7754.3399 HP. 0852.6146.4473



Syarat: 1. Wanita maksimal 25 thn, berpenampilan menarik 2. D-3 Perhotelan/ sederajat 3. Mampu berbahasa Inggris 4. Tinggi badan minimal 165 cm Lamaran ditujukan ke alamat




Ukuran 18x30, Luas: 535m², Jl. Asrama Komplek Bumi Asri Hubungi 0812.6004.2711, TP

Wanita (17 - 45 thn) sbg Perawat anak, Gaji 900 Rb/ bln Hub: “Bpk. Ridho” Jl. Ayahanda 73C Medan 0812.7552.3457 - (061) 453.1124

Dan siap ditempatkan, ikutin program 6 bln Hub: Jl. KH. Wahid Hasyim 92 Medan, Tp. 7623.5314 - 9158.3487 - 4533.875 - 456.9269


Karyawan Pria Muslim dan Wanita Berjilbab di Perusahaan BMJ Jl. Serdang Gg. Belimbing No. 2D Medan, Lulus Training, Gaji 2 Jt/ bln

CP: (061) 415.4711 - 0853.6244.9148 - 0852.7024.5660 - 0852.7509.5349



Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu


Perumahan Citra Mandiri Jl. Karya Jaya Blok M No. 4 (depan DIM) Hub. 0812.6402.4004 (4 hari) RUMAH DIJUAL CEPAT

Rumah Permanen Siap huni, Jalan AR. Hakim Gg. Kolam No. 16 Medan, Fasilitas: 3 KT, 2 KM, Garasi, PLN, PDAM, Telp, Full keramik, SHM, LT: 115m², Hub Telp. (061) 732.2919 HP. 0821.6396.2568 Tanpa perantara/ Agen, Harga damai



Ruko 3 Lantai, Ada Kost² an, Internet 15 KM Jl. Gedung Arca Gg. Sehat HP. (061) 6872.1968 / 0812.6021.0202


Di VILLA GADING MAS 1, Luas Tanah 142m², 2 K. Tidur, 2 K. Mandi, Full keramik, Lokasi aman, Security 24 jam, Harga Rp. 350 Jt/nego Hub. 0812.6408.1758


1 (satu) unit Rumah Lantai 2, 5 KT, 6 KM LT. 1300m² (36x36) LB. 600m² Sertifikat Hak Milik (SHM), IMB, PAM, PLN,Garasi muat 2 mobil Jl.Aluminium, Gatot Subroto No. 60B, Komplek Bank Indonesia, Sei Sikambing - Pondok Kelapa - Medan Hub. 0853.6109.4525 Tanpa perantara


LT. 295m², LB. 170m², SHM, KT 4, RT, RM, KM 2, GR, PAM, PLN, Lantai keramik, Skllg pagar b. bata/ besi di Jl. Amaliun Gg. Amal Bakti No. 7 Medan Telp. (061) 736.1092



Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?

SHM, Luas ± 570 m², terletak di Jalan Amal/ Jalan Darussalam (dekat Berastagi Supermarket), Cocok bangun Ruko, Harga Rp. 1,6M/ nego Hub. 0831.9413.9204, TP (No. SMS)


Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243


Tanah & Bangunan Seluas 4367m² di Jl. Setia Gang Buntu Desa Mulia Rejo, Kec. Sunggal, Kab.Deli Serdang, Provinsi Sumatera Utara (TP) Hub (061) 7715.2888


(TEMPAT KURSUS TERBAIK DI MEDAN) Word + Excel............................................................. 200 Rb (2 minggu) Word + Excel + Internet..................................... 300 Rb (3 minggu) Ms. Office + Internet............................................... 450 Rb (1 bulan) Design Grafis (Komplit)........................................ 600 Rb (1 bulan) Autocad 2D, 3D.......................................................300 Rb (10 hari) Merakit komputer/ Installing............................ 400 Rb (6 hari) Bhs Mandarin............................................................ 500 Rb (Paket) Bhs Inggris................................................................... 400 Rb (Paket) Daftarkan lsg belajar, waktu bebas, Tanpa batas usia Jl. Sei Batang Hari No. 170 Medan Telp. (061) 844.2158 - Website:
















Jl. Letjen. Jamin Ginting No. 348 (samp. Pajus), P. Bulan Telp. 7757.1852 HP. 0813.6211.5550 - 0852.7768.2268 Mdn Menerima murid baru: 1. Mengemudi mobil, SIM A - A Umum 2. Sepeda motor + SIM C 3. Mengurus STNK sepeda motor / mobil 4. Mekanik mobil bensin/ diesel



Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

RUMAH DIJUAL CEPAT Di Jl. Menteng VII Medan Denai Komp. Citra Menteng No. D6, 2 KT, 2 KM, Lokasi AMan, Security 24 Jam, Bebas banjir, Harga nego Hub. 0813.9680.3777, TP




Rumah Tipe 45/ 96 Perum. Pertiwi Residence di Jl. Pertiwi Ujung No. 19A Bandar Slamat Ujung Medan sdh renov, PLN, PAM, Pagar, Keramik, Harga nego Hubungi 0816.3666.555 - 0882.6199.7788

Wulan Guritno Selektif Pilih Siaran TV

GEORGE Clooney ditahan bersama ayahnya, wartawan Nick Clooney, pada saat mereka ambil bagian dalam unjukrasa di luar Kedubes Sudan di Washington. Meski dibebaskan beberapa jam kemudian, Clooney dan ayahnya serta beberapa tokoh lainnya sempat merasakan tahanan. Kedua anak beranak itu serta tahanan tokoh lainnya sebelum ditahan sempat diberikan peringatan tiga kali oleh pihak berwajib Jumat (16/3) agar tidak melintasi garis polisi di luar Kedubes Sudan. Selain Clooney dan ayahnya Nick, siapa saja yang ditahan? Tiga tokoh lainnya adalah Presiden NAACP Ben Jealous, Martin Luther King III, dan aktor komedian Dick Gregory. Penahanan atas Clooney, ayahnya dan sejumlah aktor dan tokoh lainnya terjadi setelah peraih hadiah Oscar itu, bertemu minggu ini dengan Presiden Barack Obama, memberikan kesaksian di depan sidang Senat AS dan menghadiri jamuan makan malam kenegaraan untuk PM Inggris David Cameron. Para pemrotes ketika itu meneriakkan tuduhan atas Presiden Sudan Omar al-Bashir, menyebabkan terjadinya krisis kemanusiaan dan menghambat pengiriman bahan makanan serta bantuan lainnya masuk ke Pegunungan Nuba, perbatasan negara itu dengan negara yang baru merdeka Sudan Selatan. Clooney kemudian dibebaskan beberapa jam kemudian hanya setelah dia membayar denda AS$100. “Apa yang telah kami usahakan hari ini adalah berusaha untuk mengundang perhatian pada satu situasi darurat yang sedang berlaku,” katanya kepada para wartawan menyusul pembebasannnya. “Tugas kami saat ini adalah untuk mengundang perhatian orang pada masalah di Sudan dan salah satu caranya itulah, dan kami ditahan.” “Kami berharap masyarakat memahami di sana ada masalah yang amat darurat dan kita perlu segera bergerak,” katanya menambahkan. “Di sana ada kemajuan luar biasa pada saat ini. Ada beberapa langkah besar, tetapi di sisi lain, masih banyak sekali keganjilan yang terjadi.” (ap/cbs/mujo)




Sejak 1979

UMROH (9 HARI) = 16,..... JT

Since 1952



Start Belajar: Senin, 23 April 2012

My Residence in Medan

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106



Kualitas,Keunggulan,KepastianMasa Depan Berpengalaman Lebih dari 32 Tahun Agar LULUS ke PTN Ikuti......





PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

07:30 Selebrita Pagi 08:00 Ups Salah 08:30 Karaoke Keliling 09:00 Pelangi 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-Citaku 14:00 Dunia Air 14:30 Koki Cilik 15:00 Browniess 15:30 Asal Usul Flora &. 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Indonesiaku 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata **m31/G

Atau hubungi/ SMS ke: - Ir. Tagor Silalahi (0812.649.3252) - Nurliathy Haloho, S.P (0852.9636.0959) - Berdaulat Bakara, S.S (0853.6261.2687)

E-mail BT/ BS Medica: website BT/BS Medica:

* Boleh boking tempat terlebih dahulu untuk menentukan group belajar, nomor bangku, dan lokasi belajar

TELP: 082169696868 - (061) 69696868

Wulan Guritno, mengaku sangat selektif memilih hiburan bermutu. “Saya tidak semata-mata pasang parabola untuk bisa mendapatkan beragam hiburan karena tidak mempunyai fungsi Parental Lock”,ujarnya. Wulan yang juga menulis buku dongeng untuk anak-anak tentunya tidak mau ada hiburan kurang sehat atau tidak bermutu masuk dalam rumah untuk anakanaknya. Seringkali dia ditawari berlangganan TV berbayar, namun karena kesibukan ke luar kota lumayan padat, maka Wulan merasa kurang diuntungkan, karena dia harus membayar biaya langganan padahal tidak menikmati acara TV selama masa tersebut. Wulan mengungkapkan merasa pemborosan bila harus langganan TV berbayar, memang decorder diberikan gratis sebagai imbalan berlangganan, misalnya paket basic yang ditawarkan adalah Rp149ribu/bulan, maka dalam waktu dua tahun menghabiskan biaya sekitar Rp3.6 jutaan, padahal seringkali dia tidak menikmati saluran-saluran yang termasuk dalam paket harus dia bayar. Saat ini Wulan sudah tidak perlu pusing lagi karena telah menjatuhkan pilihan pada parabola plus plus Orange TV mempunyai banyak kelebihannya, yaitu gratis nonton siaran TV nasional, sama seperti parabola lainnya tetapi punya kelebihan parental lock. Selain itu, parabola ini mempunyai banyak premium channel, terutama channel untuk anak-anaknya komplit mulai dari Disney, cartoon network, kids Co, Nicholodeon. Yang terpenting adalah Wulan tidak perlu bayar biaya langganan. “Saya cukup beli voucher Orange TV, pembayaran bisa transfer via ATM, juga bisa electronic di gerai-gerai seperti Carefour, Family Mart, Giant, Hypermart.(rel/m19)





Mengawal KPK Jilid-3


i tengah isu perpecahan dalam internal pimpinannya Komisi Pemberantasan Korupsi (KPK) sudah merencanakan memeriksa Anas Urbaningrum terkait penyelidikan dugaan korupsi dalam proyek Pusat Pendidikan dan Pelatihan Olahraga di Kabupaten Bogor, Jawa Barat. Walaupun waktunya belum diketahui pasti, namun Busyro Muqaddas menyatakan tak sampai

dua bulan. Anas yang juga Ketua Umum DPP Partai Demokrat akan diperiksa terkait proyek Hambalang, di mana mantan Bendahara Umum Partai Demokrat Nazaruddin berulangulang menyebut nama Anas menerima ‘’fee’’ dari berbagai proyek pemerintah itu, termasuk Wisma Atlet Palembang. Nazaruddin sendiri sudah dijadikan tersangka dan dia merupakan aktor lapangan, sedangkan Anas dan sejumlah petinggi parpol lain disebutnya menerima sejumlah aliran dana illegal karena posisinya disebut-sebut sebagai aktor intelektual. Logika berpikirnya memang dapat dibenarkan. Tidak mungkin Nazaruddin dapat leluasa mendapatkan proyek-proyek besar tanpa ‘’backing’’ dari petinggi partainya. Oleh karena itulah kita harapkan KPK proaktif melakukan pemeriksaan terhadap sejumlah pihak yang namanya sudah disebut-sebut oleh para tersangka maupun terdakwa dan juga terpidana dalam kasus tersebut. Jika saksi-saksi kunci mengarah pada Anas rasanya tidak sulit untuk menjerat dan ‘’menggantung’’ Anas di Monas sebagaimana ikrar yang diutarakannya kepada wartawan. Memang untuk menjatuhkan hukuman gantung rasanya mustahil karena hukum Indonesia tidak mengenal hukuman mati di tiang gantungan, seperti di negara Arab. Begitu juga kalau dikaitkan dengan nilai korupsi. Anas menyebut andai dia korupsi Rp1 bersedia digantung. Tentunya itu klise. Bukan pembuktian sekecil itu, dan KPK jangan sampai terkecoh dengan berbagai argumentasi dari para calon tersangka dan terdakwa. Namun begitu asas praduga tak bersalah jangan juga diabaikan. Kita dan semua elemen bangsa kiranya wajib mengawal kinerja KPK agar jangan sampai menurun di tengah maraknya isu perpecahan di internal lembaga paling diharap dan dibanggakan masyarakat saat ini. Kalaupun benar adanya perpecahan itu jangan sampai menjadi antiklimaks dan berdampak buruk bagi tekad pemberantasan korupsi. Masalahnya, kita harus belajar dari KPK jilid1 dan KPK jilid-2, di mana para koruptor tak Intisari henti-hentinya melakukan upaya serangan balik untuk melemahkan dan mengkriminalkan KPK. Bisa jadi perpecahan dalam internal peMari mengawal KPK tinggi KPK pimpinan Abraham Samad saat agar tetap berjalan di rel, ini juga skenario jahat atau serangan balik lebih tegas dan berani dari para koruptor. Justru itu, para petinggi KPK nan-lima orang jangan mau dilaga-laga pro-rakyat yang meng- oleh pihak luar. Jalankan saja kerja sesuai SOP Operasional Prosedur) KPK. Acuaninginkan korupsi benar- (Standar nya jelas berdasarkan hukum dua alat bukti benar diberantas di ne- sah sebagaimana sudah diatur dalam perundangan KPK, bukan masalah politik. Kalau geri ini politik sudah ikut campur, sebaiknya pimpinan KPK jangan segan-segan mengutarakannya pada publik. Siapa saja yang bermain. Hal seperti itu tidak boleh didiamkan. KPK bisa dicap pengkhianat bila mempermainkan hukum atau pilih kasih dan takut memeriksa para petinggi dan elite politik serta pejabat tinggi negara, seperti terkait Muhaimin Iskandar yang namanya juga disebut-sebut terkait kasus ‘’commitment fee’’ ataupun ‘’uang THR’’ Rp1,5 miliar yang diserahkan Dharnawati sebagai syarat mendapatkan proyek program Percepatan Pembangunan Infrastruktur Daerah (PPID) Transmigrasi. Hemat kita, kasus-kasus yang melibatkan Anas, Muhaimin dan petinggi parpol maupun Banggar DPR dll tidak akan dapat diusut tuntas bila KPK tidak kompak. Sudah jelas dan terang benderang modus kasus-kasus korupsi di sejumlah kementerian. Hanya saja para pimpinan departemen pintar bermain di belakang layar dengan membiarkan anak buah sebagai pelaku terkait proyek, sehingga kalau KPK tidak jeli dan hanya terpaku pada alat bukti seperti kuitansi tanda terima tentunya bakal mengalami kegagalan. Di sinilah pimpinan KPK harusnya kompak. Berbeda pendapat boleh-boleh saja, tapi jangan sampai melemahkan kinerja pemberantasan korupsi yang semakin merajalela di semua lini di pusat, provinsi maupun kabupaten-kota. Terkait dengan karakteristik pimpinan KPK jilid-3 memang berbeda-beda. Ada yang pemberaninya luar biasa, seperti Abraham Samad dan Bambang Widjojanto. Ada yang tipikal ‘’low profile’’ dan biasa saja. Sayang Bambang belakangan ini terlihat kurang agresif setelah kalah dalam pemilihan pimpinan KPK. Selayaknya di atas kertas Bambang lah yang layak memimpin KPK (ketua), bukan Abraham. Hanya saja, ketika ‘’fit and proper test’’ di DPR Abraham Samad tampil memukau dengan ucapan dan janji-janjinya walaupun dalam ranking panitia seleksi berada di urutan kelima.Kalau digunakan urut kacang Abraham hanya cadangan. Tapi, begitulah kualitas DPR kita. Tidak mampu memilih yang benar-benar berkualitas, berjiwa pemberani, dan memiliki kompetensi, serta rekam jejak terukur. Begitupun, kita masih tetap optimis KPK jilid-3 dapat bekerja profesional jika masingmasing individu mengacu pada SOP. Pimpinan KPK harus menjauhi ‘’vested interest’’ dan tegas menolak revisi UU KPK karena akan melemahkan kinerja. Di sinilah masyarakat harus ikut mengawal KPK agar tetap berjalan di rel yang benar, lebih tegas dan berani pro-rakyat yang menginginkan korupsi benar-benar diberantas di negeri ini.+


Faks 061 4510025

Facebook Smswaspada

+628972955682 Ada 2 alam yg disediakan Tuhan utk makhluknya, yaitu : 1) Alam Dunia, tempat para makhluknya bertebaran menjalani hidup. Di alam fisika ini ada makhluk yg diberi akal, iq, hati (manusia), insting (hewan). Bagi penghuni dunia yg diberi akal dikenakan padanya suatu larangan oleh Khaliknya; “janganlah kamu berbuat kerusakan di muka bumi” ok jangan rusak pohon2an, bakar hutan/ buang limbah sembarangan, bunuh burung2 & hewan2 yang tak berdosa, polusi udara, terlebih melampaui ambang batas normal. Sesungguhnya kita jualah yg menanggung akibatnya, mis banjir, longsor, udara kotor, dsb. 2) Alam Akhirat, bagi yang berakal tentu saja yakin alam gaib itu ada, tapi ada juga yang tidak yakin, ada yang ragu2. Tapi ketahuilah bahwa kelak pada “hari itu” semua manusia akan dihisab, dimintai pertanggung-jawaban. Dan keputusan akhir ada dalam genggamanNya, dimasukkan ke surga atau ke neraka. Semoga surga. Waspada 65 Tahun. +6281263191734 Assalamu’alaikum.W.W. Bila benar-benar anggota DPR-RI adalah wakil rakyat & memang memperjuangkan kesejahteraan rakyatnya, seharusnya semua anggota DPR-RI Tegas “MENOLAK” dan “KATAKAN TIDAK” untuk kenaikan BBM yang diusulkan penguasa. Sang penguasa sampai detik ini bersama semua aparaturnya masih tetap kurang puas & mobil mewah serta laptop & pulsa gratis, kini penguasanya mau semua warganya yang“MISKIN” harus di” MISKINKAN” lagi. NAUZUBILLAH MIN ZALIK +6281263191734 Assalamu’alaikum Warrahmatullahi Wabarakaatuh. Belum pernah terjadi dinegara Indonesia yang telah “67 Tahun Merdeka” hingga dimasa kedua Pemerintahan reformasi SBY, ada pejabat negara di Indonesia yang “JUJUR & MUNDUR DARI JABATANNYA” karena terindikasi berbuat salah atau berbuat curang & ironisnya banyak yang pendidikan para pejabat kita sangat mumpuni bahkan ada yang Professor. Mau tau kenapa pejabat negara kita tak “JUJUR DAN TAK MAU MUNDUR” dari jabatanya bila sudah berbuat salah, karena “SUDAH PUTUS URAT MALU NYA”. Sejarah mencatat dalam “TINTA EMAS” hanya pernah ada dua orang anak bangsa ini yang mundur dari jabatannya karena berbeda prinsip & mereka hanya mempertahankan kebenaran dan kejujuran bukan karena korup, dia adalah bapak, 1. Drs. H. Muhammad Hatta, (Bung Hatta), 2. Prof. H. Abdul Malik Karim Amarullah, (HAMKA). Semoga info ini dapat menjadi ilmu yang berguna & dapat mencerdaskan pengetahuan generasi muda kita serta kedua Tokoh Nasional ini kita jadikan panutan. Ir.Zulkifli AM Medan. Wassalam. +6282165293457 Banyak pejabat2 mengetauhi perbuatan itu tidak baik, pandangan mereka sudah berubah. Yang baik dikiranya buruk dan yang buruk diduganya baik. Dan siapa yang di dunia ini (hatinya),maka ia di akhirat akan lebih buta lagi dan lebih sesat dari jalan yang benar. Dan sesungguhnya banyak manusia yang lalai dari ayat-ayat kami. +626245741871 Kakanwil Kemenag Prov,Sumut. Pak rupanya di Kab,Labuhanbatu masih ada juga guru RA yang belum menerima honor insentip bulan Januari sampai Juni 2011 yg lalu, +6287869705814 Kadang saya geram melihat geng motor yang kerap meresahkan kami minta kepada bapak polisi tolong tangkap geng motor kalau gag kami bakalan bakar hidup-hidup anggota geng motor.

WASPADA Senin 19 Maret 2012

Oleh M Ridwan Lubis ... setiap tenaga pengajar hendaklah menjadikan etos keilmuan sebagai dasar utama dalam melaksanakan tugas-tugas akademisnya.


ekitar tahun 1964, menjelang peralihan dari orde lama ke orde baru, muncul ide visioner dari tokoh-tokoh ulama di Tapanuli Selatan antara lain Syekh Ali Hasan Addari, Syekh Jafar Abdul Wahab, Tongku Imam Hasibuan, Syekh Muchtar Muda Nasution, Yahya Harahap dan lainnya. Ide itu adalah mendirikan lembaga pendidikan tinggi keIslaman di Padangsidimpuan yang diberi nama Perguruan Tinggi Nahdlatul Ulama disingkat PERTINU. Sesuai dengan namanya, ide pendirian dari perguruan tinggi ini adalah dimotori tokoh-tokoh ulama yang tergabung di dalam Jam’iyah Nahdlatul Ulama—sekalipun tujuannya adalah untuk pengembangan studi keislaman secara universal guna mendidik caloncalon ulama yang intelektual dan intelektual yang ulama. Fakultas pertama didirikan adalah Fakultas Syariah kemudian menyusul Fakultas Tarbiyah dan terakhir Fakultas Ushuluddin. Setelah berdiri tiga fakultas maka lembaga pendidikan tinggi ini berubah nama menjadi Universitas NU Sumatera Utara disingkat UNUSU. Berturutturut tahun 1968 Fakultas Tarbiyah ditetapkan pemerintah menjadi fakultas negeri sebagai cabang jauh dari IAIN Imam Bonjol Padang. Fakultas Ushuluddin. juga dinegerikan tahun 1969, selanjutnya disatukan dengan tiga fakultas yang ada di Medan yang kemudian bergabung menjadi IAIN Sumatera Utara. Sesuai kebijakan Departemen Agama untuk menjadikan fakultas cabang menjadi mandiri, maka Fakultas Tarbiyah yang semula menjadi bagian dari IAIN Imam Bonjol kemudian berdiri sendiri dan diberi nama Sekolah Tinggi Agama Islam Negeri (STAIN) Padangdisimpuan. Perkembangan STAIN Padangsidimpuan sudah jauh lebih maju ditandai jumlah mahasiswanya jauh lebih banyak sekarang yang mencapai jumlah ribuan dibanding ketika penulis menjadi mahasiswa perdana pada Fakultas Ushuluddin UNUSU Padangsidimpuan. STAIN telah memiliki kampus sendiri di Sihitang dibanding dahulu pada tahun 1960-an perkuliahan harus menumpang pada sore hari dengan meminjam lokal SMPN

2 yang terletak di Jalan Ade Irma Suryani Nasution. Tenaga pengajar sekarang ini rata-rata telah bergelar S2 bahkan sudah banyak yang meraih gelar S3 sekalipun belum memiliki tenaga pengajar yang mencapai derajat Guru Besar sementara dahulu dosennya hanyalah bergelar Syekh, Tuan Guru. Namun, di balik berbagai kemajuan itu, disadari bahwa sebagai lembaga pendidikan tinggi, STAIN haruslah berbenah diri tidak memadakan pada prestasi yang dicapai sekarang. Karena sebuah lembaga pendidikan tinggi sangat terkait keberadaannya dengan kemampuannya menempatkan diri sebagai agen perubahan dan agen pembangunan. Sebagai agen perubahan, maka STAIN harus menjadi pelopor untuk mengubah cara berpikir (mindset) masyarakat terutama di bidang wawasan keberagamaan. Demikian pula sebagai agen pembangunan, STAIN hendaknya mampu menjadi penggerak untuk memotivasi masyarakat dalam pembangunan dengan mendorong mereka sebagai manusia-manusia yang dinamis, kreatif dan inovatif. Sehingga Tapanuli Selatan yang pada masa lalu memperoleh julukan sebagai Serambi Madinah tidak hanya sekedar kebanggaan masa lalu tetapi juga menjadi tumpuan harapan masa depan. Apabila STAIN tidak mampu menempatkan dirinya sebagai agen perubahan dan agen pembangunan maka akan semakin sulit bagi STAIN untuk menunjukkan keberadaannya sebagai lembaga pendidikan tinggi. Atas dasar itu, pihak STAIN perlu melakukan berbagai langkah persiapan untuk menjemput masa depan. Pertama, STAIN hendaknya dapat merajut kembali visi dan misi pendirian PERTINU pada tahun 1960-an yang menempatkan soliditas ukhuwah Islamiyah sebagai dasar kegiatan. Sebagai kumpulan dari masyarakat ilmuwan maka baik pengelola maupun tenaga pengajar STAIN dapat mendorong seluruh keluarga besar STAIN memiliki pola berpikir untuk memajukan seluruh umat Islam dan umumnya seluruh masyarakat Tapanuli Bagian Selatan. Adanya pengelompokan organisasi hendaklah dijadikan hanya

sebagai sarana untuk mencapai tujuan. Apalagi sekarang ia telah menjadi STAIN berarti adalah milik negara dan milik semua warga negara. Kedua, sebagai bagian dari komunitas keilmuan maka seluruh kebijakan manajemen kampus diarahkan kepada pengembangan wawasan keilmuan. Pengertian keilmuan tidak hanya berkenaan dengan ilmu keislaman yang dipahami masyarakat secara tradisional akan tetapi seluruh bidang keilmuan yang diperlukan untuk pembangunan daerah dan nasional. Oleh karena itu, maka setiap tenaga pengajar hendaklah menjadikan etos keilmuan sebagai dasar utama dalam melaksanakan tugas-tugas akademisnya. Bukan sebaliknya yaitu menjadikan etos keilmuan hanya sebagai kegiatan sekunder sementara kegiatan primer adalah yang tidak berkaitan dengan kegiatan akademis. Untuk itu, maka perlu diperbanyak berbagai kegiatan yang berkaitan dengan wacana pengembangan keilmuan mencakup pendidikan dan pengajaran, penelitian, seminar, lokakarya, diskusi, penerbitan jurnal, buku, publikasi tulisan di berbagai media massa dan lain

sebagainya. Ketiga, manajemen pengembangan STAIN ke depan diarahkan kepada upaya membangun opini masyarakat terhadap keberadaan STAIN minimal di kalangan masyarakat Tapanuli Bagian Selatan. Keempat, hakikat keberadaan pendidikan tinggi adalah sumbangannya bagi pembangunan daerah sekitarnya. Oleh karena itu, manajemen STAIN hendaklah membangun jaringan kolaborasi dengan beberapa Pemerintah Daerah guna membangun berbagai kerjasama yang saling menguntungkan bagi kedua pihak. Terlebih lagi, bentuk kolaborasi dengan Pemda ini menjadi bagian dari bentuk lain pengabdian pada masyarakat yang menjadi bagian penting tridharma pendidikan tinggi. Dengan demikian, mengharapkan pengembangan STAIN menjadi IAIN bukanlah sesuatu yang tidak mungkin asalkan tersedia sejumlah potensi yang menunjukkan STAIN memiliki keunggulan yang dipersaingkan (competitive advantage).. Penulis adalah Dosen UIN Syarif Hidayatullah Jakarta.

Vote Untuk Sentralisasi Guru Oleh Paridul Azwar, S.Pd Kalau ujug-ujug presiden melemparkan gagasan mengembalikan sistem pendidikan termasuk guru menjadi sistem sentralistik, maka hemat kita pastilah ada sesuatu kurang tepat dengan sistem yang berlaku sekarang.


etika wacana sentralisasi guru digulirkan ke ruang publik, ada hal-hal menarik yang bisa dianalisa di balik usulan tersebut. Pertama sumber wacana itu sendiri. Menjadi menarik karena usulan tersebut merupakan permintaan langsung dari presiden Republik Indonesia Susilo Bambang Yudhoyono kepada Kemendikbud. Logikanya, ketika seorang presiden menyampaikan sebuah usulan tentulah sudah didasarkan pada pertimbangan matang dan komprehensif serta dikuatkan berbagai analisa dan temuan-temuan di lapangan. Karena sebagaimana yang kita fahami sentralisasi guru sebenarnya bukan isu baru. Prakteknya sudah pernah diterapkan pada zaman orde baru dahulu. Ketika itu meski peringkat pendidikan kita tidak terlalu baik di mata dunia dan mutunya juga masih di bawah negara-negara tetangga seperti: Malaysia dan Singapura tetapi paling tidak dari aspek tertib administrasi dan jenjang karir terkesan lebih rapi dan teratur. Sementara di era reformasi sekarang, berbekal semangat undang-undang otonomi daerah, khususnya no.32 tahun 2004 tentang pemerintahan daerah—pemerintah dan lembaga legislatif mengganti sistem tersebut menjadi desentralisasi. Artinya wewenang dalam menentukan kebijakan pendidikan seperti: pengangkatan guru, distribusi guru, serta tingkat kesejahteraan guru tidak lagi dimonopoli pusat melainkan sudah dilimpahkan ke daerah. Sehingga maju mundurnya pendidikan di suatu daerah sangat bergantung pada kebijakan dan perhatian pemerintah daerah itu sendiri. Dalam hal ini bupati atau wali kota bekerjasama dengan lembaga terkait lainnya. Hasilnya, alih-alih mutu pendidikan kita bisa di upgrade, yang ada malah kesimpangsiuran penataan pendidikan di hampir semua daerah. Ja d i k a l a u k e m u d i a n u j u g ujug presiden melemparkan gagasan untuk mengembalikan sistem pendidikan termasuk guru menjadi sistem sentralistik, maka hemat kita pastilah ada sesuatu yang kurang tepat dengan sistem yang berlaku sekarang. Di satu sisi boleh jadi usulan itu merupakan bentuk keprihatinan beliau terhadap kualitas pendidikan kita yang belum juga memenuhi standar yang diharap-

kan. Atau boleh jadi juga presiden melihat sistem desentralisasi yang diterapkan selama ini sangat menyulitkan pusat dalam memperoleh data yang akurat tentang problematika pendidikan yang terjadi di daerahdaerah. Sebagai contoh, terkait angka kecukupan riil guru di daerah. Ada daerah yang setiap tahunnya melaporkan kalau daerahnya banyak kekurangan guru. Padahal setelah dicek ternyata jumlah guru sudah proporsional dengan jumlah sekolah yang ada. Ternyata masalahnya bukan pada ketimpangan tenaga pengajar melainkan pada distribusi guru yang tidak merata. Contoh lain, tentang kesenjangan mutu pendidikan antara satu daerah dengan daerah lainnya. Jangankan antar kabupaten atau provinsi, untuk satu kabupaten sendiripun perbedaan itu cukup kentara. Penyebabnya ternyata karena banyak guru yang berkualitas enggan atau tidak mau bertugas di daerah-daerah pelosok. Akibatnya, anak-anak yang bersekolah di desa terpaksa di ajar dan dididik oleh “guru asal-asalan”. Sudah barang tentu kalau anak dididik dan diajar oleh guru yang tidak qualified maka out put nya juga asal jadi. Selain itu, tidak bisa dinafikan iklim demokrasi yang sekarang kita nikmati ikut berkontribusi negatif terhadap dunia pendidikan di daerah-daerah. Betapa tidak, bukankah kepala pemerintahan setingkat kabupaten kota kini dipilih langsung oleh rakyat lewat jalur yang disebut Pilkada? Calon-calon kepala daerah yang bersaing bisa saja berasal dari berbagai profesi dan latar belakang yang beragam, baik pendidikan, culture maupun skill. Dan dunia pendidikan adalah satu dari lumbung suara yang “menggiurkan” bagi kandidat yang bertarung karena bisa mendongkrak perolehan suara secara signifikan. Ini tentu membuat mereka berjuang habis-habisan meraih suara dari sector ini. Dan ketika satu di antaranya berhasil memenangkan pertarungan, tentunya setelah melalui perjuangan menguras segenap daya dan dana—sering kali dunia pendidikan kemudian diintervensi dengan berbagai policy dan kebijakan yang nuansanya cenderung kepada political reveange.Akibatnya proses reposisi dan promosi jabatan kerapkali terjadi di

luar kebiasaan. Seorang kepala sekolah yang baru menjabat dalam hitungan bulan karena “berseberangan“ secara politik dengan kepala daerah terpilih harus rela dilengserkan dan pindah menjadi guru biasa di sekolah lain. “Hukuman “ itu tentu menimbulkan beban psikis yang berat bagi yang bersangkutan apalagi dari sudut kualitas kepala sekolah yang baru belum tentu lebih baik dari yang digantikan. Dan sebaliknya karena dekat dengan lingkungan “istana” dan memiliki andil dalam pemenangan kepala daerah, seseorang bisa saja dipromosikan menduduki jabatan penting meskipun kualitas dan kapabilitasnya masih belum teruji. Apa yang dikemukakan di atas secara jujur diamini Sekretaris Bagian Penelitian dan Pengembangan (Balitbang) Kemendikbud, Hendarman, sebagai bagian dari faktor yang mendorong pemerintah untuk mengevaluasi penerapan sistem desentralisasi. Di samping faktor lainnya seperti minimnya perhatian pemerintah daerah terhadap peningkatan keahlian guru. Terbukti dengan jarangnya para guru mendapatkan pelatihan-pelatihan yang mampu mengupgrade skill dan wawasan mereka dalam mendidik dan mengajar. Inilah ironi yang terjadi di dunia pendidikan kita sekarang, utamanya di daerah-daerah. Kepentingan politik telah merambah dunia pendidikan yang semestinya steril dari politik-politikan. Karena kita tahu sekali saja wilayah ini terkontaminasi oleh kepentingan-kepentingan sesaat, maka yang pertama kali menjadi korban adalah anak didik. Seorang kepala daerah yang notabene adalah jabatan politis bisa dengan mudah memutasikan guru atau kepala sekolah yang dianggap “tidak sepaham” tanpa mempertimbangkan prosedur atau regulasi yang ada. Sementara dinas pendidikan kabupaten selaku instansi yang seyogyanya paling tepat mengurusi masalah tersebut tidak bisa berbuat banyak karena lembaga ini juga berada di bawah kontrol kepala daerah. Akibatnya program kerja yang sudah disusun akan terbengkalai. Karena adagium “kepala baru kebijakan baru“ merupakan hal lazim kita temukan saat terjadi pergantian pucuk pimpinan. Dan sekali lagi siswalah yang akan menjadi korban karena tidak memperoleh haknya memperoleh pendidikan secara optimal. Oleh karena itu, menurut hemat saya, ada benarnya usulan presiden SBY yang ingin mengembalikan pendidikan kita dari sistem desentralisasi menjadi sentralisasi. Setidaknya dengan kembalinya kekuasaan ke pusat akan efektif melenyapkan “raja-raja kecil di daerah“ yang kerap berlaku ti-

dak adil terhadap para guru. Maka lewat tulisan ini saya mengajak rekan-rekan guru untuk bersamasama mendesak pemerintah serta lembaga terkait agar segera merealisasikan usulan tersebut. Bahkan bila memungkinkan dukungan dapat kita lakukan dalam bentuk vote via SMS seperti saat bangsa ini mendukung Pulau Komodo masuk menjadi New Seven Wonders. Mengapa? Karena pendidikan kita rasanya akan sulit maju sepanjang praktisi pendidikan di lapangan seperti: kepala dinas, Kacabdis, kepala sekolah dan guru masih selalu was-was dicekam ketakutan dituduh berseberangan dengan pimpinan daerah. Sehingga fokus utama mereka bukan tentang bagaimana membangun dan merancang sistem pendidikan yang bermutu dan memiliki kearifan lokal bagi murid, tetapi lebih kepada mencari “posisi aman” agar tidak “terpelanting” dari jabatan yang disandang. Bagaimana? Penulis adalah Guru SMK PGRI-15 Rantauprapat, e-mail:

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Tarif obat tunggu keputusan Menkes - Kalau sampai naik, betulbetul ampunlah! * Pemprovsu jangan sibuk mikirkan nama bandara - Lebih baik fokus Pilgubsu, he...he...he * Produksi Inalum capai 6 juta ton aluminium - Pantesan berat mengembalikannya


D Wak


WASPADA Senin 19 Maret 2012


Mandeknya Regenerasi Kepemimpinan Proyek Siluman Dinas P Dan P Dongeng pembangunan seperti kisah “Roro Jongrang” yang selesai dalam waktu singkat terjadi di dunia nyata. Pembangunan beberapa Sekolah Dasar di Kab. Langkat diduga adalah “proyek ijon”segelintir rekanan yang disodorkan terkondisikan oleh oknum Dinas P dan P Kabupaten Langkat. Hal ini saya sampaikan selaku Ketua Asosiasi Kontraktor Kontruksi Indonesia (AKSI) Langkat yang juga Sekretaris LSM Relawan Pemantau Pembangunan (Relepan) Langkat. Pada bangunan fisik ruangan yang terdapat dibeberapa SD di Kecamatan Stabat telah rampung 100% yang dikerjakan oleh rekanan pada November 2011. Namun kegiatan tersebut belum dibayarkan, sebab tidak adanya dana pada APBD Langkat Tahun 2011, dan baru di anggarkan pada APBD Langkat Tahun 2012. Hal ini mungkin saja dilakukan untuk menghindari pelelangan umum secara terbuka dan meniadakan persaingan usaha yang sehat di kalangan rekanan. Para rekanan yang berminat/mempertanyakan paket pekerjaan pada Dinas P dan P Langkat, selalu saja diberikan angin surga untuk bersabar dengan alasan, pekerjaan 2011 adalah proyek yang telah direncanakan tahun 2010. Begitu juga mungkin alasan mereka dengan modus yang sama untuk 2012 ini adalah proyek 2011. Sebelumnya, para rekanan yang melaksanakan pekerjaan tersebut terlebih dahulu disodorkan surat pernyataan tidak keberatan melaksanakan pekerjaan oleh oknum dinas P dan P Kab. Langkat, dan tak jarang pula mereka dimintai sejumlah dana pendahuluan kepada beberapa calon rekanan yang tak ingin disebutkan identitasnya. Di sini ingin disampaikan penulis, kepada pembaca setia Waspada, sesuai haknya yang terdapat pada Perpres 54 Tahun 2010 tentang Pengaduan atas penyimpangan dimaksud, tertuang dalam Pasal 117, yang berbunyi antara lain : (1) Dalam hal Penyedia Barang/Jasa atau masyarakat menemukan indikasi penyimpangan prosedur, KKN dalam pelaksanaan Pengadaan Barang/Jasa Pemerintah dan/atau pelanggaran persaingan yang sehat dapat mengajukan pengaduan atas proses pemilihan Penyedia Barang/Jasa. (2) Pengaduan sebagaimana dimaksud pada ayat (1), ditujukan kepada APIP K/L/D/I yang bersangkutan dan/atau LKPP, disertai bukti-bukti kuat yang terkait langsung dengan materi pengaduan. (3) APIP K/L/D/I dan LKPP sebagaimana dimaksud pada ayat (2) sesuai dengan kewenangannya menindaklanjuti pengaduan yang dianggap beralasan. (4) Hasil tindak lanjut pengaduan yang dilakukan oleh APIP sebagaimana dimaksud pada ayat (3), dilaporkan kepada Menteri/Pimpinan Lembaga/Kepala Daerah/Pimpinan institusi, dan dapat dilaporkan kepada instansi yang berwenang dengan persetujuan Menteri/Pimpinan Lembaga/Kepala Daerah/ Pimpinan Institusi, dalam hal diyakini terdapat indikasi KKN yang akan merugikan keuangan negara, dengan tembusan kepada LKPP dan BPKP. (5) Instansi yang berwenang dapat menindaklanjuti pengaduan setelah Kontrak ditandatangani dan terdapat indikasi adanya kerugian negara. Mengapa hal ini bisa luput dari berbagai media, padahal sangat jelas didepan mata dan dapat dilihat bukti fisiknya. Siapakah yang paling bertanggung jawab atas kegiatan tersebut? Pertanyaan lain, dimanakah fungsi pengawasan kinerja Aparatur Pemkab Langkat dan kenapa luput dari BPKP (Badan Pengawas Keuangan dan Pembangunan)? Padahal pelaksanaan pembangunannya juga melibatkan instansi lain (pengawas harian) dari Dinas Pekerjaan Umum Kabupaten Langkat. Dan rasanya tak ingin lagi kita dengar pejabat dinas P dan P Langkat menjadi pesakitan atas apa yang menimpa pejabat sebelumnya. Semoga hal senada tidak terulang kembali dan segera dilakukan evaluasi pembenahan kinerja dinas terkait agar tidak mencemari nama baik Pemkab Langkat pada khususnya. AKHMAD ZUHRI ADDIN Ketua Asosiasi Kontraktor Kontruksi Indonesia (AKSI) Langkat


Dedi Sahputra

Anakku Ikut Lomba Mewarnai Salah satu misteri hubungan orang tua dengan anak-anaknya adalah perasaan yang tersambung sedemikian rupa. Orang tua akan serta sumringah bahagia ketika melihat anaknya merasa gembira. Setiap kali anaknya menunjukkan prestasi, atau kepandaian barunya setiap kali pula si orang tua merasakan surga menghampirinya. Sebaliknya ketika si anak mengalami kondisi tak menyenangkan, ketika dia disakiti temannya atau ketika dia luka dan berdarah, maka orang tua merasakan kepedihan itu berlipat-lipat kali rasanya. Orang tua bisa hilang kendali dan melabrak habishabisan orang yang menyakiti anaknya. Energi kemarahannya itu telah dilambari kesakitan yang merasak ke dalam dirinya. Maka begitulah, sewaktu di masjid dekat rumah kami diadakan berbagai perlombaan seperti lomba mewarnai. Anakku ada di antara peserta lomba itu. Di antara rasa senang menyaksikan anak-anak itu, ada ketegangan yang kurasakan. Betapa aku tak akan sanggup menyaksikan kekalahan anakku di lomba itu. Wajahnya akan lesu karena hatinya yang mengecil. Aku tahu benar kemampuan anakku. Dia punya daya estetika dalam menorehkan warna-warni. Tapi kecenderungannya adalah melukis secara abstrak. Alirannya berbeda dari aliran mainstream lomba mewarnai yang lazim terjadi. “Anakku bakal kalah,” aku membathin. Apalagi ketika kulihat para pesaing yang ikut dilomba itu. Mereka adalah anak-anak profesional. Mereka telah mengikuti pendidikan formal kursus mewarnai sekian lama. Mereka telah malang melintang mengikuti berbagai perlombaan di sana sini. Mereka kini mengoleksi tropi sebagai sumber kebanggaan dan mengejar hadiah yang kadangkala lumayan jumlahnya. Lihatlah ibu itu. Dia mengabaikan peringatan panitia untuk tidak mencampuri saat anaknya berlomba. Sedari tadi dia mengomeli anaknya untuk menggunakan warna yang ia sukai. Ia seperti Roberto Mancini yang memberi instruksi anak buahnya dari pinggir lapangan. Ini jenis orang tua yang akan melabrak juri dan panitia kalau anaknya dinyatakan kalah. Maka jelas sudah. Harapan anakku, atau tepatnya harapanku untuk anakku jadi juara tipis adanya. Tapi aku tak mau kehabisan akal. Kuatur siasat, kudekati panitia kuminta mereka menetapkan anakku sebagai juara favorit dan menyerahkan hadiah yang kubeli sendiri. Deal. Mereka setuju. Akupun merasa terselamatkan. *** Ketika kemarin anakku kembali ditunjuk mewakili sekolah dalam lomba mewarnai

antar sekolah, aku kembali merasa disodorkan pilihan; mengintervensi kemenangan anakku atau membiarkan saja perlombaan dengan risiko menerima pahitnya kekalahan. Pada akhirnya aku tak memilih satu di antara keduanya. Karena aku lebih memilih dua alternatif yang lain: menerima dengan suka cita ketika kemenangan itu datang atau menikmati ketika kekalahan yang hadir. Karena dalam hidupku juga banyak diwarnai kekalahan. Dari mulai kalah dalam pertandingan kiyam, sampai kalah bersaing merebut hati wanita pujaan hati. Saya memang merasakan kesakitan dari kekalahan itu. Tetapi hari ini, kekalahan-kekalahan itu telah berubah menjadi modal bagi kekuatan saya. Di hadapan diri yang dipenuhi pengalaman kalah, maka kekalahan lainnya yang datang belakangan tak akan berdaya menyakiti. Ini adalah diri yang tak punya waktu merasa sakit di hadapan kekalahan. Maka jika kekalahan itu mendatangkan manfaat sebaik ini, betapa kelirunya berprasangka jelek terhadap kekalahan anak saya. Maka akupun mulai membiasakan anakku menerima kekalahan yang datang— dengan “nikmat”. Tapi aku tak pernah menyangka, ternyata anakku secepat itu menghayatinya. “Yee.., Ayuk Hira belum juara,” teriaknya dengan senyum sumringah sambil mengangkat kedua tangannya dengan jari terkepal. *** Sikap superior di hadapan kekalahan itu ternyata menjalar cepat kepada si bungsu. Dia yang suka bermain game di komputer jadi terlalu sering berteriak: Yee.., menang... bahkan pada saat perminannya game over. Aku merenung. Saat kelak aku mungkin akan berbuat sesuatu yang menyakitkan bagi mereka. Aku tak akan mengerjakan PR kalian supaya mendapat nilai tinggi. Aku juga tak akan membela dari kesalahan yang mungkin kalian buat. Aku juga tak akan melakukan kolusi dengan kepala sekolah favorit untuk menerima kalian sebagai murid. Kelak ketika pendidikanmu telah rampung, engkau tidak bisa mengharapkan aku mencarikan kerja untuk kalian. Karena bibirku tak akan terucap untuk meminta tolong kepada orang yang kukenal untuk mempekerjakan kalian. Aku tidak akan menyelesaikan masalah yang kalian hadapi karena kalian sendirilah yang harus menyelesaikannya. Maafkanlah aku anak-anakku. Mandatku sebagai orang tua adalah mempersiapkan engkau menjadi pribadi-pribadi yang kuat menghadapi apa saja. Mandatku bukan membuat engkau seolah tampak menang menghadapi dunia ini.(Vol.299, 19/3/2012)

Kolom foliopini dapat juga diakses melalui

Oleh H.Irham Taufik Umri, SH, MAP Fenomena tokoh tua yang menjadi pilihan rakyat sebagai calon presiden pada Pemilu Presiden/Wapres, juga memperlihatkan mandeknya proses regenerasi kepemimpinan nasional di negeri ini.


endatipemilihanpresidendan wakil presiden masih lebih kurang 2,5 tahun lagi, tetapi gaungnya telah menggema ke seluruh penjuru tanah air. Gaung Capres ini digebyarkan hasil survei yang dilansir mediamassabaikmediaelektronik(televisi, radio dan internet) maupun media cetak surat kabar dan majalah. Fenomena ini terlihat dari kiprah lembaga survei yang ada di negeri ini. Bahkan lembaga survei yang ada seakan berlomba melakukan jajak pendapat kepada khalayak masyarakat Indonesia. Survei yang dilakukan itu memang berkesinambungan untuk melihat sejauh mana pendapat publik mengenai calon yang akan memimpin pemerintahan pasca Susilo Bambang Yudhoyono. Pengalaman yang lalu, survei ini makin marak menjelang digelarnya pemilihan presiden dan wakil presiden. Lembaga Survei Indonesia (LSI) yang dipimpin Saiful Mujani telah melakukan polling mencari calon Presiden ideal 2014. Berdasarkan survei yang dilakukan tersebut telah memunculkan 10 nama calon presiden yang populer. Di antara 10 nama terdapat tokoh nasional: Megawati SoekarnoPutri,mantanPresidendanWakil Presiden (22,2 %), disusul Prabowo Subianto (16,8 %). Berikutnya Abu Rizal Bakri (10,9%)danWiranto(10,6%).SaifulMujani mengemukakannamacalonpresidenhasil polling itu memang populer tapi jauh dari ideal. Artinya dari aspek integritas dan jati diri calon tersebut, masih dipertanyakan track record yang baik, bersih dan tidak mempunyai cacat. Berbeda dengan survei yang dilakukan oleh CSIS menetapkan tingkat popularitas Jusuf Kalla (mantan Wapres) menempati peringkat pertama, terpaut sedikit dengan Ketua Partai Golkar Abu Rizal Bakri (Ical) yang memperoleh 81, 6 % (Waspada, 26-02-12). Kalau ditelaah lebih dalam ternyata pilihan masyarakat terhadap merupakan tokoh lapisan kedua rezim orde baru. Kondisi tersebut terjadi akibat negeri ini terlalu lama dicengkeram rezim orde baru. Mereka menerima kekuasaan dan berusaha mempertahankannya. Mereka rata-rata berusia 60 tahun ke atas bahkan ada yang sudah berumur kepalatujuh.Yang menarik, tokoh yang muncul itu sudah pernah menjabat Presiden danWapres (Megawati Soekarno Putri), Jusuf Kalla (mantanWapres), Abu Rizal Bakri (mantan Menko Ekuin dan Kesra). Bahkan mereka sebelumnya sudah pernah berkompetisi pada Pemilihan Presiden/Wapres tahun 2009 lalu. Idola Merujuk hasil survei LSI dan CSIS ternyata tokoh tua tetap eksis dalam peta percaturan politik nasional. Misalnya sosok MegawatiSoekarnoPutri,mantanPresiden ke-5RepublikIndonesia.Putriproklamator Bung Karno ini merupakan tokoh idola pada waktu bergulirnyareformasidinegeri ini. Bersama tiga tokoh lainnya yaitu Amin Rais, AbdurrahmanWahid dan Sri Sultan

HamengkubuwonoX,merekamenggerakkan rakyat terutama mahasiswa dan pemudamelakukanreformasidisegalaaspek kehidupan masyarakat. Jargon yang diusung memberantas korupsi, kolusi dan nepotisme.Namun tujuan akhir adalah menurunkan rezim orde baru yang sudah berkuasa selama 32 tahun di negeri ini. Karena Mega merupakan Ketua Partai Demokrasi Indonesia Perjuangan(PDIP)partaiyangmemenangkan pemilihan umum legislatif 1999 popularitasnya sungguh luar biasa. Hanya karena kompromi politik ia tidak berhasil memenangkan pemilihan presiden yang waktu itu masih dipilih MPR. Ia hanya terpilih sebagai wakil presiden mendamping AbdurrahmanWahid (Gus Dur). Tapi dua tahun kemudian Mega dilantik sebagai Presiden RI kelima, setelah Gus Dur diimpeachment (diberhentikan) MPR karena terlibat skandal Bulog. Selama 3 tahun memegang tampuk pemerintahan kepopuleran Mega mulai menurun setelah tampilnya Jenderal (Pun) Susilo BambangYudhoyono figur yang“dizalimi”. Demikian juga Jusuf Kalla, mantan Wapres yang mendampingi SBY periode 2004–2009dikenalluasdinegeriini.Selama menjadiWapres,PutraMakassarinidikenal lugas dan bicara ceplas ceplos serta banyak melahirkan gagasan baru terutama dalam bidangperekonomian.AkanhalnyaPrabowo Subianto di samping mantan menantu Soeharto,padaeraordebaru,putraSumitro Joyohadikusumo itu juga seorang militer murni yang pernah menjabat Danjen Kopasus dan Panglima Kostrad. Walaupun ia diindikasikan terlibat peristiwa Mei 1998, tetapi popularitasnya cukup tinggi, setelah memimpin partai Gerindra dan berpasangan dengan Megawati Soekarno Putri memperebutkan RI 1 dan RI 2 pada Pilpres 2009. Masih tingginya tingkat popularitas Megawati Soekarno Putri, Jusuf Kalla, Prabowo Subianto dan Ical tidak terlepas dari absennya SBY pada Pilpres 2004 yang akan datang. Kita ketahui bahwa SBYtidak dapat mencalonkan lagi, karena sudah menjabat sebagai Presiden selama dua periode. Mandek Fenomenatokoh tua yang menjadi pilihan rakyat sebagai calon presiden pada Pemilu Presiden/Wapres, juga memperlihatkan mandeknya proses regenerasi kepemimpinan nasional di negeri ini. Alih generasielitkepemimpinandipartaipolitik sebagaiwahanamelahirkancalonpemimpin nasional tidak berjalan baik karena budaya politik kita masih mengutamakan figurtuasebagaipatron.Kalaupunadaregererasi, pemimpin muda masih dalam bayang-bayang tokoh tua. Citra tokoh tua sangat kuat, sehingga rakyat sulit berpaling dari mereka. Kiprah dan eksistensi mereka terus tertanam dalam benak masyarakat karena hanya diingat dan dikenang pada sisi tertentu yang mengesankan. Ada beberapa faktor terbatasnya calon pemimpin muda muncul di pentas politik nasional:Pertama:tokohtuadipartaipolitik

ditenggaraibelumrelaataungganmenyerahkan tongkat estafet pada generasi muda. Hal ini tercermin pada setiap Pemilu Presiden, tidak ada partai politik ataupun koalisi partai politik mengusung figur muda sebagai Capres maupun Cawapres. Semuanya didominasi tokoh tua. Hal ini tercerminpulapadapucukpimpinanpartai politik. Tokoh tua bertengger sebagai ketua umum ataupun ketua dewan pembina. Artinya tokoh tersebut mempunyai wewenang besar mengendalikan partainya. Kecuali Partai Demokrat Anas Urbaningrum dan Partai Kebangkitan Bangsa Muhaimin Iskandar, partai lainnya dipimpin tokoh tua seperti Abu Rizal Bakri (Golkar), Prabowo Subianto (Gerindra), Wiranto (Hanura), Surya Dharma Ali (PPP), Hatta Rajasa (PAN) dan sebagainya. Kedua: Ada kesan pemimpin muda ewuh pakewuh (sungkan dan segan) kepada tokoh tua. Figur muda ini sangat hormat kepada orang tua, merasa kikuk karena miskin pengalaman dan juga minim finansial.Ketiga:Khawatir terjebak kepada politik transaksional yang korup, banyak politisi muda yang enggan masuk ranah politik karena merasa takut tersandera dengan masalah hukum yang saat ini sedang gencarnya dilakukan aparat penegak hukum. Keempat:Terpengaruh dan larut dalam lingkaran gaya hidup (perilaku) hedonis. Nafsu ingin cepat kaya, banyakhartamengambiljalanpintasyang merugikan negara. Sehingga tokoh muda tersebuttergusursebagaicalonpemimpin nasional. Figur muda Kalau di tingkat nasional tokoh tua masih mendominasi, beda dengan kepemimpinan di tingkat regional provinsi maupun lokal kabupaten/kota. Proses regenerasi di level bawah ini lebih dinamis karena tokoh muda bermunculan ibarat jamur tumbuh di musim hujan. Secara realita kita melihat figur muda telah tampil menguasai kepemimpinan, baik menjadi kepala daerah maupun wakil kepala

daerah. Di tingkat provinsi, figur muda adalah Gubernur Jawa Barat Hendrawan, H. Gatot Pujo Nugroho, ST (Plt Gubernur Sumatera Utara), Rusli Zainal (Gubernur Riau), Syaifullah Yusuf (Wagub Jawa Timur), Rano Karno (Wagub Banten) dan lain-lain. Mereka telah membuat debut gemilang dipercaya rakyat memimpin pemerintahan. Demikian pula pada tataran lokal kabupaten/kota figur muda termasukdariperempuanjugatelahmerajai kompetisi Pilkada di wilayahnya masing-masing. Banyaknya figur muda yang muncul di level provinsi dan kabupaten/ kotadiuntungkandengandibukanyajalur independenyangsecaraformaldilegalkan ikut sebagai calon pada Pilkada. Calon alternatif Untukmengatasimandeknyaregenerasi kepemimpinan nasional, rakyat perlu bersama-sama mendorong munculnya pemimpin alternatif. Berhubung partai politik lazimnya akan mengusung Ketua UmumpartaiataupunketuaDewanPembina yang berasal dari tokoh tua, jalan menampilkan pemimpin alternatif adalah melakukan perubahan regulasi tentang pemilihan umum presiden/wakil Presiden.Artinyajalurindependenmerupakan solusiuntukmenampilkancalonalternatif diluar partai politik. Pra pelaksanaan Pilres tahun 2009 lalu upaya judicial review (uji material)terhadapregulasiPilpresdengan memasukkan jalur independen sudah pernah dilakukan aktifis Fajrul Rahman dan kawan-kawan. Tetapi Mahkamah Konstitusi yang diketuai Prof. Dr. Mahfud MD menolak judicial review itu, sehingga gugatan Fajrul cskandas.Memanganehdankontradiktif, regulasi memilih pemimpin formal di negeri ini. Di tingkat nasional jalur independen tidak diperbolehkan, tapi tingkat provinsi, kabupaten/kota malah dilegalkan. Penulis adalah Dosen Sekolah Tinggi Ilmu Tarbiah Al Hikmah Kota Tebingtinggi.

Mencari Pemimpin Di Negeri Carut Marut Oleh Akmal AZ Pemimpin harus berani. Karena tidak lucu bila seorang pemimpin tidak memiliki keberanian. Secara lebih khusus keberanian itu ditunjukkan dalam komitmen berani membela yang benar, memegang teguh pada pendirian yang benar, tidak takut gagal, berani ambil resiko dan berani bertanggungjawab.


ndonesia hari ini adalah Indonesia yang masih penuh carut marut. Indikatornya banyak. Pertama, korupsi terus merajalela walaupun pemberantasan korupsi katanya dilaksanakan tidak dengan tebang pilih. Kedua, kenyamanan dan keamanan warga selalu terganggu karena preman terus beraksi di mana-mana. Ada preman wangi dan berdasi tetapi ada preman basi bau terasi. Ada preman gedung ada preman kampung. Ketiga, pemerintah belum mampu menyediakan lapangan pekerjaan sehingga angka pengangguran terus meningkat di segala strata. Keempat, kondisi ekonomi rakyat semakin memburuk walaupun pemerintah mengklaim pertumbuhan ekonomi semakin membaik. Kelima, bentrok horizontal kalangan bawah selalu timbul akibat kasus-kasus yang ditangani selalui tidak tuntas. Contoh yang paling aktual adalah masalah pendirian gereja Yasmin di tengah-tengah komunitas Islam di Bogor. Masih ada indikator yang keenam, ketujuh dan seterusnya yang tak mungkin dirinci satu persatu untuk membuktikan bahwa negara ini masih penuh dengan carut marut. Lalu yang menjadi persoalan saat ini adalah siapa yang dapat diharapkan untuk menyelesaikan semua carut marut tersebut? Kemudian kapan waktunya? Jika melihat situasi saat ini maka rasa-rasanya sudah tak mungkin lagi mengharapkan waktu jangka pendek untuk dapat mengurai carut marut tersebut. Sebab, lihatlah para pemimpin hari ini pada sibuk dengan kepentingannya sendiri atau kepentingan kelompoknya.

Satu-satunya jalan yang legal adalah menunggu Pemilu Presiden pada 2014. Cuma siapakah yang kita pilih saat itu? Rakyat harus berhati-hati menjatuhkan pilihannya kalau tidak ingin membeli kucing dalam karung. LSI (Lembaga Survei Indonesia) belum lama ini membeberkan beberapa nama calon presiden paling populer Mereka adalah Megawati Soekarnoputri, Prabowo Subianto, Aburizal Bakrie, Wiranto Jusuf Kalla, Sultan Hamengkubuwono X, Boediono, Surya Paloh, Hatta Rajasa dan sejumlah nama lain. Menurut LSI, nama-nama calon presiden yang menjadi pilihan masyarakat adalah nama-nama politisi tua yang sudah berkiprah sejak era reformasi bergulir. “Para politisi tua itu memang populer, tapi jauh dari ideal,” kata Direktur Eksekutif Lembaga Survei Indoesia (LSI) Saiful Mujani. Peneliti senior LSI ini menilai, integritasnya masih jauh dari ideal, apakah mereka memiliki rekam jejak yang baik, bersih, dan tidak memiliki cacat. Mujani juga menyatakan, kecewa karena sampai saat ini belum muncul nama-nama politisi muda sebagai calon presiden alternatif. Jika para politisi muda tidak berbuat sesuatu dan popularitasnya tidak naik hingga akhir 2012, Mujani memperkirakan politisi tua yang tetap lebih populer hingga 2014. Soal politisi muda yang disinggung-singgung LSI tadi, ada pernyataan menarik dari kalangan Partai Demokrat. Wakil Ketua FPD Sutan Batoeghana membenarkan survei itu hanya menampilkan tokoh-tokoh era masa

lalu. “Anda kan tidak tahu kita menyiapkan tokoh muda, yang BBM Bersih Berani dan Merakyat,” kata Sutan belum lama ini kepada wartawan di gedung DPR RI, Senayan, Jakarta pusat. Perlukah usia jadi ukuran seorang pemimpin? Perlu!Tetapi usia bukan pula segala-galanya. Usia tua namun mempunyai persyaratan (track record) yang cukup adalah lebih baik dibandingkan yang muda. Begitu pula kebalikannya. Namun apa sesungguhnya yang menjadi syarat seorang pemimpin? Untuk mengetahui itu ada baiknya kita juga mendengar suara generasi muda dari kalangan mahasiswa FISIP Universitas Hasanuddin. Dalam blognya mereka (Asmar Riandy, Darwis, La Ode M. Aynul Ikhsan dan Dian Furqani) menuliskan bahwa kepemimpinan atau leadership adalah kemampuan seseorang untuk mempengaruhi orang-orang lain agar bekerjasama sesuai dengan rencana demi tercapainya tujuan yang telah ditetapkan sebelumnya. Di dalam kenyataan, tidak semua orang yang menduduki jabatan pemimpin memiliki kemampuan untuk memimpin atau memiliki ‘kepemimpinan’. Sebaliknya banyak orang yang memiliki bakat kepemimpinan tetapi tidak pernah mendapat kesempatan untuk menjadi pemimpin dalam arti yang sebenarnya. Sementara itu karena seorang pemimpin bertugas menggerakkan orangorang yang dipimpinnya, maka sudah barang tentu ia harus memiliki sifat-sifat yang lebih dari orang-orang yang dipimpinnya. Banyaknya sifat-sifat ideal yang dituntut bagi seorang pemimpin berbeda-beda menurut bidang kegiatan, jenis atau tipe kepemimpinan, tingkatan dan bahkan juga latar belakang budaya dan kebangsaan. Seorang pemimpin semestinya memiliki bekal-bekal minimal sebagai berikut: a. kharisma, b. keberanian, c. kemampuan mempengaruhi orang lain, d. mampu membuat strategi, e. moral yang tinggi, f. mampu menjadi mediator, g. mampu menjadi motivator dan h.

memiliki rasa humor Dalam menghadapi kondisi negeri Indonesia yang carut marut seperti sekarang ini, kita menggarisbawahi tentang keberanian, moral yang tinggi dan rasa humor. Pemimpin harus berani. Karena tidak lucu bila seorang pemimpin tidak memiliki keberanian. Secara lebih khusus keberanian itu ditunjukkan dalam komitmen berani membela yang benar, memegang teguh pada pendirian yang benar, tidak takut gagal, berani ambil resiko dan berani bertanggungjawab. Sedangkan tentang moral yang tinggi yakni banyak orang berpendapat bahwa moralitas merupakan ukuran berkualitas atau tidaknya hidup seseorang. Apalagi seorang pemimpin yang akan menjadi panutan. Seorang pemimpin adalah seorang panutan yang secara moral dapat dipertanggungjawabkan. Banyak tanda-tanda seorang pemimpin yang bermoral tinggi di antaranya tidak mau memiliki yang bukan haknya dan perilakunya mampu dijadikan contoh. Begitu pula dengan rasa humor. Akan lebih mudah seorang pemimpin melaksanakan tugas kepemimpinannya jika didukung memiliki humor yang tinggi. Kata orang humor lebih penting dari kenaikan gaji. Apalagi mengingat kondisi Indonesia yang carut marut, rakyat banyak stress maka rasa humor dari pimpinan dapat memberi suasana yang berbeda. Dari bandingan-bandingan yang diuraikan tampak betapa tinggi sifatsifat atau syarat-syarat yang dituntut bagi seorang pemimpin. Di dalam kenyataan memang tidak mudah bagi seorang pemimpin untuk memenuhi sifat-sifat tersebut secara sempurna. Kemudian seorang pemimpin sejati tidak pernah mengutamakan pencitraan yang semu. Dan yang paling perlu diingat bagi seorang pemimpin adalah kalau negeri ini carut marut maka itu adalah akibat carut marutnya kinerja pemimpinitusendiri.Kata-katabijakmenyebutkan, ikan busuk mulai dari kepala. Penulis adalah Ka.Litbang HarianWaspada.



WASPADA Senin 19 Maret 2012

Pengelolaan Dana BOS Di SDN 4 Pantonlabu Tidak Transparan

Lubang Maut Bungkaih Tunggu Korban KRUENGMANE (Waspada) : Lubang maut di jembatan Bungkaih, Kecamatan Muara Batu, Aceh Utara terkesan dibiarkan begitu saja. Keberadaan lubang ukuran 50 x 150 centimeter itu sangat berbahaya bila terperosok pengguna jalan, karena posisinya persis di tengah jalan Medan-Banda Aceh yang sempit. Warga Desa Bungkaih Ilyas, 50, Jumat (16/3) mengatakan, lubang di tengah jembatan Bungkaih tersebut sudah terhias sekitar satu bulan lalu. “Kerusakan jembatan itu memang dimakan usia, sebab itu kondisi pondasi persis di kaki jembatan mulai ambruk,” papar Ilyas, tokoh masyarakat desa itu. Selain itu, lanjut Ilyas, lubang itu semula kondisinya kecil. Secara perlahan truk-truk berbadan besar sering terperosok, maka makin hari lubang menjadi besar seperti saat ini. Hal itulah yang menyebabkan sering terjadi kecelakaan sepedamotor, karena terperosok ke lubang itu. Tak terkecuali siang hari. “Rencana kami, kalau belum ditangani pemerintah daerah, maka kami akan menanam kayu di lubang itu agar pengendara sepedamotor tidak terperosok. Apabila tidak, kami khawatir ada korban selanjutnya. Mudah-mudahan jangan sampai terjadi,” ucap Ilyas.(cmk)

Warga Temukan Mayat Bayi Dalam Selokan NIBONG (Waspada): Sesosok bayi laki-laki berusia sekira 7 bulan ditemukan warga sudah tak bernyawa dalam kardus di selokan Poin A, Desa Sumbok, Kec. Nibong, Aceh Utara, Sabtu (17/3) sekitar pukul 08:15. Jenazah bayi seberat 1,7 kilogram itu sudah dikebumikan pada hari yang sama di Desa Sumbok. Sementara status dan identitas orangtuanya masih dalam penyelidikan Kepolisian Sektor (Polsek) Nibong. Kapolres Aceh Utara AKBP Farid BE melalui Kapolsek Nibong Ipda Jafar G Pase menjelaskan, mayat bayi malang itu dilihat pertama kali oleh Rusdi, 42, warga setempat. Dia kemudian melapor ke Polsek dan polisi lalu membawa bayi itu ke Puskesmas Nibong untuk otopsi. “Hasil otopsi, usia bayi itu sekira 7 bulan. Di tangan dan matanya ditemukan luka lecet. Sementara status bayi serta identitas orangtuanya masih kita lidik. Dugaan sementara, bayi itu hasil hubungan tidak sah,” tutur Kapolsek.(b19)

447 Bidan Rebut 93 Formasi PTT BIREUEN (Waspada): Sebanyak 447 orang peserta seleksi calon bidan Pegawai Tidak Tetap (PTT) di Kabupaten Biteuen mengikuti ujian tulis untuk merebut 93 formasi yang disediakan pemerintan melalui Dinas Kesehatan Kabupaten Bireuen. Uji kemampuan secara tertulis ini dilaksanakan panitia dari Dinas Kesehatan di SMA Negeri 2 Bireuen, Minggu (18/3). Penanggungjawab ujian ini, Said Abdullah mengatakan, materi soal ujian hanya seputaran ilmu kesehatan. Lebih lanjut, katanya, 93 formasi yang tersedia itu dibagi dua kategori yaitu formasi PTT kabupaten 30 orang dan formasi PTT pusat 63 orang. Namun, katanya, sebagian dari peserta tidak hadir pada ujian tulis dimaksud. Menurutnya, selain itu peserta juga akan dijajal ujian praktek di Dinas Kesehatan Bireuen yang pelaksanaannya secara bertahap, dengan demikian diharapkan akan terjaring bidan PTT yang handal serta memiliki kompetensi yang baik. (b17)

Dandim Dan Polres Bireuen Prakarsai Terbentuknya Seuramoe Art BIREUEN (Waspada): Dandim 0111/Bireuen, Letkol Inf Muhammad Arfah dan Kapolres Bireuen AKBP Yuri Karsono, SIK memperkarsai terbentuknya Lembaga Bireuen Seuramoe Art (LBSA), satu wadah untuk mengembangkan minat dan bakat di bidang seni anak muda di kabupaten itu. Letkol Inf Muhammad Arfah kepada wartawan, Sabtu (17/ 3) mengatakan, diprakarsainya lembaga itu melahirkan kreativitas remaja, anak muda dan masyarakat umumnya dalam bidang seni, sehingga karya seni mereka dapat ditampilkan melalui Bireuen Seuramoe Art sehingga menjadi hiburan bagi masyarakat. “Bireuen Seuramoe Art akan menjadi wadah bagi remaja atau masyarakat Bireuen dalam mengembangkan bakat seni, baik itu seni musik, seni tari, seni lukis dan karya seni lainnya yang bernilai positif dan bermasyarakat, karena dengan seni dapat menjauhkan masyarakat dari pergaulan bebas dan narkoba,” katanya. (cb02)

Remaja Harus Merealisasikan Kehidupan Nabi Dalam Pergaulan LHOKSEUMAWE (Waspada): Al Ustad Fauzan Hasan, MA dari Sekolah Tinggi Agama Islam Negeri (STAIN) Malikussaleh Lhokseumawe mengingatkan pentingya mengetahui sejarah kehidupan Rasulullah. Sehingga dalam setiap pergaulan para remaja bisa merealisasikan kehidupan Nabi dan tidak terjerumus ke dunia maksiat. Hal itu dikemukakannya dihadapan seribuan siswa dan guru pada peringatan Nabi Muhammad SAW di SMP Negeri-5 Lhokseumawe, Sabtu (17/3) Sepanjang ceramahnya, dia selalu mengingatkan para siswa untuk mencontoh kehidupan Nabi Muhammad. Berbagai penyimpangan dalam pergulan remaja saat ini, menurutnya, akibat sejarah kehidupan Rasulullah mulai dilupakan di kalangan remaja. Kepala SMP Negeri-5 Lhokseumawe A.Rahim mengingatkan, peringatan Maulid Nabi bukan hanya untuk sekedar makan saja. Namun momen yang lebih penting, mengingat kembali sejarah kehidupan Rasulullah sehingga bisa diterapkan dalam kehidupan sehari-hari. (b15)

Waspada/Mustafa Kamal

PENGENDARA sepedamotor berhati-hati melewati lubang maut di jembatan Bungkaih, Kecamatan Muara Batu, Aceh Utara, Jumat (16/3). Saat ini kerusakan jalan itu belum ditangani oleh pemerintah.

Lahan Tak Dibayar, Warga Segel Kampus UTU MEULABOH (Waspada) : Warga empat desa yakni Peunaga Pasi, Gunung Klieng, Ujung Tanoh Darat dan Desa Langung di Kecamatan Mereubo, Kabupaten Aceh Barat, memblokir kampus Universitas Teuku Umar (UTU) di kecamatan itu, Minggu (18/ 3) pagi. Pemblokiran dilakukan setelah berbagai upaya pelunasan lahan yang dituntut warga yang tergabung dalam Serikat 16, 23 dan 8 tersebut tidak membuahkan hasil. “Sudah capek kami menunggu sejak tahun 1982, ke bupati, DPRK dan gugat ke pengadilan, tapi tidak ada hasil,” kata ketua kelompok Serikat 16, Syarief Basyah, Minggu (18/3). Aksi pemblokiran dilakukan warga yang berjumlah sekitar

20 orang dengan menutup pintu masuk menuju kampus kebanggaan masyarakat di pantai barat itu dengan ranting dan kayu. Para pemilik tanah juga menempatkan warga untuk menjaga agar blokade tidak dibuka. “Sebelum ada kepastian tentang pembayaran lahan kami proses belajar mengajar tidak boleh berlangsung,” kata Syarief Basyah dan anggota serikat lainnya. Menurut Syrief, total lahan yang belum dilunasi Pemkab Aceh Barat untuk pendirian kampus tersebut seluas 114 ha. Dikatakan, saat Malik Ridwan badai menjabat Bupati Aceh Barat, seluruh pemilik tanah dijanjikan akan mendapat ganti rugi. “Serikat 16 luas lahannya 40 ha, kalau serikat 23 luasnya 50 ha dan 24 ha lahan serikat 8. Janjinya dulu dibayar, tapi sampai hari ini kami belum menerima,” kata Syarief Basyah.

Rektor UTU Meulaboh Malik Ali yang dihubungi terpisah mengatakan tidak mengetahui banyak permasalahan lahan kampus tersebut. Namun sepengetahuannya, ganti rugi pernah dilakukan tahun 2006 dan 2007 oleh Pemkab Aceh Barat dan Yayasan Pendidikan Teuku Umar Johan Pahlawan (Yapentu Jopah). “Sudah pernah ada peunayah (ganti rugi) sekitar Rp7 juta per hektare. Namun ada yang menerima dan ada yang tidak. Ini yang kemudian menjadi persoalan,” kata Malik Ali. Ia berharap para anggota serikat menempuh cara yang bijaksana untuk menyelesaikan masalah tersebut dan tidak mengganggu proses pendidikan, karena dikhawatirkan menimbulkan preseden buruk. “Masalah ini kewenangan yayasan, kami pengelola pendidikan berharap anggota serikat tidak mengganggu proses belajar mengajar,”papar Malik. (cb06)

50 Rumah Di Sarah Sirong Masih Gunakan Lampu Teplok BLANG BLADEH Bireuen (Waspada): Sebanyak 50 warga petani desa pegunungan terpencil Sarah Sirong dan Bivak, Kec. Jeumpa Bireuen sudah puluhan tahun hidup dalam kegelapan belum nikmati listrik dan masih menggunakan lampu teplok. Selama ini warga desa pegunungan terpencil Sarang Sirong dan Bivak yang berlokasi di kaki gunung Goh sangat merana. Pasalnya, salin harga minyak tanah mencekik leher mencapai Rp12 ribu per liter ke-

tersediaan minyak tanah semakin langka diperoleh, jika malam hari tiba terpaksa hidup dalam gelap gulita. Geuchiek Gampong Sarang Sitong Mukhlisin mengemukakan hal itu kepada Waspada di Blang Bladeh, Minggu (18/3). Dikatakan, akibat belum adanya penerangan listrik kegiatan pengajian anak-anak malam hari di Desa Sarah Sirong dan Bivak masih mengalami kendala. Warga Desa pegunungan terpencil sangat berharap agar pemerintah untuk memasang

jaringan listrik ke desa pegunungan terpencil, agar pengajian anak-anak di malam hari dapat berjalan dengan baik. Manager PLN Rayon Bireuen Ridwan Adam dalam keterangannya kepada Waspada mengatakan, masukkan jaringan listrik ke desa pegunungan terpencil Sarah Sirong kendati butuh biaya besar akan dipenuhi. Masyarakat diminta agar memotong pepohonan disepanjang jalur jalan agar pemasangan jaringan listrik tidak terhalang. (b12)

PANTONLABU, (Waspada): Pengelolaan dana Biaya Operasional Sekolah (BOS) tahun 2012 di SDN 4 Pantonlabu (lokasi Keude Alue Ie Mirah), Kec. Tanah Jambo Aye, Aceh Utara, terindikasi tidak transparan. Kepala SDN Syamsidar terkesan mengelak untuk memberi keterangan. “Saya tidak ingat untuk apa saja penggunaan dana BOS tahun ini, karena RKAS (Rencana Kegiatan Anggaran Sekolah) terkait sudah kami kirim ke Disdikpora Aceh Utara,” ujarnya ketika dihubungi Waspada via telepon selular, Sabtu (17/3). Diakui, dana BOS triwulan I tahun 2012 sebesar Rp25 juta sudah diterima secara utuh, Januari 2012. Total dana BOS tahun 2012 untuk sekolah ini sebesar Rp99.180.000, dasar kalkulasi dari jumlah murid 171 orang dengan nilai Rp 580.000 per murid per tahun. Pada kesempatan terpisah, Ketua Komite Sekolah SDN 4 Pantonlabu, H Muchtar Ibrahim juga tidak mengetahui untuk apa saja penggunaan dana BOS tahun ini. “Saya tidak ikut, ketika kasek menggelar rapat penyusunan RKAS tahun 2012. Kendati, RKAS itu sudah saya tanda tangani. Nanti, ketika rekapitulasi pembelian kebutuhan sekolah tidak sesuai item dan standar harga, saya tidak akan menanda tangani daftar formulir BOS medel 04,” katanya. Manager BOS Dinas Pendidikan Pemuda dan Olahraga (Disdikpora) Aceh Utara, Razali,

SPdI. MSP yang dihubungi pada jam berikutnya mengatakan, ia tidak dapat menerima kalau alasan Kasek SDN 4 Pantonlabu, Kec. Tanah Jambo Aye, berdalih RKAS tidak ada lagi sebagai pegangannya karena sudah dikirim ke Disdikpora kabupaten. “RKAS itu dibuat dalam beberapa rangkap, cuma satu rangkap yang dikirim ke Disdikpora, satu rangkap tinggal di Unit Pelaksanaan Tugas Dinas Pembinaan Kependidikan (UPTD-PK) Kec. Tanah Jambo Aye dan satu rangkap sebagai pertinggal di sekolah bersangkutan,” tandas Razali. Kalau alasan ketua komite sekolah pihaknya tidak ikut pada rapat penyusunan RKAS. “Itu sih, sah-sah saja. Sebab, sesuai Permendikbud No. 51 Tahun 2011 sebagai petunjuk pelaksanaan (Juklak) dana BOS. RKAS itu yang penting harus ditandatangani ketua komite sekolah,” ujarnya. Kendati demikian manager dana BOS Disdikpora Aceh Utara, menyesalkan juga kalau ketua komite sekolah tidak hadir dalam penyusunan RKAS. Terlepas dari sebab apakah tidak diundang kasek, atau sebaliknya ikut diundang, tapi tidak hadir. “Apa salahnya ketua komite sekolah itu, meluangkan waktu cuma satu hari dalam satu tahun, guna menghadiri rapat penyusunan RKAS itu , karena itu merupakan tanggungjawab moral dirinya yang sudah dipercayakan oleh masyarakat lingkungan sekolah,” sebutnya.(b13)

ASG Antarabangsa Bangun Rumah Masyarakat Miskin Tanpa Kutip Biaya BIREUEN (Waspada): Lembaga Aceh Security Group (ASG) Antarabangsa dalam menyalurkan rumah bantuan kepada fakir miskin di Aceh tidak mengutip biaya pada pihak yang menerima bantuan. Karena bantuan yang diberikan itu berbentuk hibah dari pihak donatur dari luar negeri. Demikian ditegaskan Ketua Asugrep Grup Internasional yang juga perwakilan UNDP Asia Tenggara, Ramlan bin Bardan dalam wawancara khusus dengan Waspada Sabtu (17/3) malam di Meuligoe bupati Bireuen, terkait kabar ada lembaga yang membantu rumah untuk masyarakat miskin di Aceh, namun mengutip uang dari pihak yang menerima bantuan. Menurut Ramlan, ASG Antarbangsa yang bermarkas besar di Kuala Lumpur, Malaysia dan Vietnam dan Kantor Pusat Indonesia di Jakarta membangun rumah untuk masyarakat miskin di Aceh merupakan bantaun pihak donatur luar negeri. Oleh karena itu, kata Ramlan, pihaknya perlu memberitahukan kepada masyarakat di Bireuen supaya bila ada pihak yang memberi bantuan, namun mengutip biaya itu bukan atas nama ASG Antarbangsa melainkan ada lembaga lain. “Jadi saya tegaskan lagi di sini, ASG Antarabangsa tidak pernah meminta uang kepada masyarakat, bila ada pihak lain yang meminta uang bukan atas nama ASG Antarabangsa jangan dilayani, namun bila ada pihak membantu

lalu meminta uang itu saya no comment,” katanya. Ramlan menyebutkan, ASG Antarabangsa akan membangun rumah tipe 3 x 6 meter untuk kaum fakir miskin di seluruh Aceh sekitar 20.000 unit termasuk untuk Bireuen 5.032 unit . Rumah itu, katanya rencananya akan dibangun pada tahun 2012 dan sekarang pihaknya sedang melengkapi datanya di seluruh Aceh sambil mensosialisasikan kepada masyarakat. Ultah dan Maulid Dalam kesempatan itu, Ramlan mengaku datang ke Bireuen bersama Ketua Umum ASG Antara Bangsa dari Jakarta, Saed Jamaluddin, SE. MBA, Sekjen Tgk Marzuki dan Bendahara Pusat Nurmiati, Koordinator ASG Antara Bangsa wilayah pantai timur Cek Dahri Muhammad serta unsur terkait lainnya, dalam rangka mengadakan kenduri maulid sekaligus memperingati ultah ASG Antarabangsa pertama di kompeks lapangan Futsal Calacticos, Cot Gapu, Kota Juang, Bireuen, Sabtu (17/3) yang ikut dihadiri ribuan undangan. Pimpinan ASG Antarabangsa Said Jamaluddin mengatakan, maulid yang dirangkai dengan acara maulid yang mengundang penceramah Tgk M Salem, juga diisi dengan acara santunan kepada anak yatim sekaligus sosialisasi program ASG Antarabangsa kepada masyarakat. (cb02)

BLT Tidak Akan Menjadi Solusi Bagi Keluarga Miskin LHOKSEUMAWE (Waspada): Bantuan Langsung Tunai (BLT) yang merupakan kompensasi bagi rakyat miskin atas kenaikan harga BBM, sama sekali tidak akan membantu apalagi menjadi solusi. Nilai BLT jauh lebih rendah bila dibandingkan dengan sejumlah harga barang yang ikut-ikutan mengalami kenaikan harga pasca kenaikan BBM. “Lagi pula, berapalah uang BLT itu? Belum lagi masalah pembagian dan penyunatan, serta sejumlah masalah lain yang menyertaianya,” ucap Syarifah Rahmah, aktivis dan pemerhati masalah perempuan di Lhokseumawe, Minggu (18/3). Imbas dari kenaikan BBM dan sejumlah barang lainnya, dialami secara langsung oleh perempuan dan cukup berpengaruh pada mereka, terutama ibu-ibu rumah tangga. Hal itu dapat dipahami dari kenyataan bahwa perempuanlah yang berbelanja untuk menyediakan kebutuhan keluarga sehari-hari. Tentu saja para ibu-ibu merasa tertekan dengan uang belanja yang diberikan suami sebagaimana nilai biasa, tidak mungkin meminta lebih ataupun memaksa sang suami, sedangkan gaji atau pendapatan suami belum tentu bertambah. Terlebih lagi bagi kaum petani, biasanya merekalah yang menjadi korban, sebab kenaikan BBM tidak diikuti dengan kenaikan harga

hasil tani. Malah ironinya lagi, harga hasil tani justru turun begitu malamnya diumumkan kenaikan harga minyak. Semisal harga pinang yang sebelumnya mencapai Rp7 ribu per kg, sekarang malah jatuh ke harga Rp4 ribu. “Coba saja bandingkan, apa artinya BLT yang cuma Rp300 ribu. Kadang satu keluarga cuma dapar Rp50 ribu per bulan. Malah banyak keluarga miskin yang tidak kebagian sedikit pun,” kata Syarifah. BLT sama sekali tidak akan menjadi solusi, justru akan semaking menambah banyaknya masalah di dalam kampung. Sebagaimana program ini sudah diluncurkan pertama sekali, sampai sekarang pun tidak ada rakyat miskin yang betul-betul terbantu apalagi menjadi sejahtera. Syarifah menuding penguasa telah kehilangan hati nurani. Rakyat menangis, mereka tertawa. Dia mempertanyakan, bagaimana nasib kaum perempuan yang mengalami kurang gizi, terlebih mereka yang tinggal di perkampungan, baik sebagai buruh tani, pekerja kasar yang dalam beberapa hari hanya mampu menghasilkan beberapa rupiah uang saja. “Belum lagi sejumlah anak-anak yang kekurangan gizi. Kalau pemerintah sendiri malah membuat mereka menderita, habis siapa lagi yang akan membantu?” tandasnya.(b14)

Kerusakan Alam Di Lhokseumawe Mengundang Bencana Besar

Waspada/Zainal Abidin

AL USTAD Fauzan Hasan, MA dari STAIN Malikussaleh Lhokseumawe sedang menyampaikan tausiyah pada peringatan Maulid Nabi Muhammad SAW di SMP Negeri-5 Lhokseumawe, Sabtu (17/3).

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


JANGANKAN membuat pertahanan, orang malah sengaja merusak benteng dan perisai yang sudah ada. Adanya bukit-bukit yang menjulang tinggi di pesisir Lhokseumawe ini bukanlah terjadi dengan sendirinya. Tak banyak yang mengetahui bahwa alam membangun pertahanannya sendiri untuk menghadapi bencana yang bakal menyusul kemudian. Ihwal semacam itu memang tidak pernah terbetik di benak. Entah itu ucapan seseorang yang sudah saya lupakan, ataukah itu suara hati saya sendiri manakala melihat maraknya galian tanah yang terjadi hampir di semua tempat di wilayah Kota Lhokseumawe. Hampir di sepanjang Jalan Raya Medan – Banda Aceh, di sebelah utaranya, adalah proyek galian C, pengerukan tanah besarbesaran dan tanpa ampun. Kota Lhokseumawe sendiri adalah daratan rendah. Konon, wilayah itu merupakan bagian dari laut dangkal yang kemu-

dian menjadi perkampungan. Kata-kata“lhok” yang bermakna “dalam” atau “rendah” sudah menunjukkan arah atau keadaan yang sesungguhnya. Hal ini semakin memperkuat bukti pribadi, manakala suatu waktu saya terlibat gotong-royong dalam membuat pondamen dasar masjid di Meunasah Mee, Kemukiman Kandang. “Memang Lhokseumawe ini terdiri dari lautan. Dulunya pernah terbentuk pulau kecil di dekat Pusong yang merupakan pelabuhan milik kakek kami. Saya masih memiliki bukti yang merupakan surat kepemilikan tulisan tangan dari Pemerintah Kolonial Belanda. Cuma saja kemudian menjadi laut lagi oleh perubahan alam,” tutur Said Dahlan, salah seorang sejarawan Aceh di Lhokseumawe, Minggu (18/3). Memang tanah galian yang ada di pesisir, terdapat sejumlah bunga karang laut serta banyak kulit kerang, bahkan fosil tulang dan kepala ikan yang sudah mengapur. Bukti serupa juga bisa ditemukan di bukit-bukit yang bekas galian, berikut beberapa jenis batu akik yang oleh pencinta batu permata diyakini mengandung kekuatan atau sema-

cam khasiat bagi si pemakai. Oleh sebab Lhokseumawe yang menurut peneliti dari Belanda bahwa daratannya lebih rendah dari permukaan laut, maka bukit-bukit yang terdapat di Kecamatan Muara Satu, Muara Dua, dan sebagian kecil Kecamatan Blang Mangat dikeruk, diangkut untuk menimbun pusat kota yang kebetulan dipusatkan di Kec. Banda Sakti. Dari dulu, pun sampai sekarang, proses penimbunan itu terjadi tanpa henti. Setiap kali ada pembangunan rumah, kedai dan toko-toko tidak luput dari kebutuhan tanah timbun dengan alasan untuk menghindari banjir, sedangkan banjir terus saja terjadi. Sementara wilayah yang berhampiran dengan laut tidak terhindar dari banjir dan terjangan ombak pasang purnama, sampai akhirnya batu-batu gajah yang ada di sejumlah tempat ditimbun ke pantai. Sesungguhnya, kata Said, bila saja air gelombang raya laut, sebagaimana yang pernah menghantam Kota Banda Aceh, Meulaboh dan wilayah lainnya pada 24 Desember tujuh tahun lalu, niscaya keadaan Kota Lhokseumawe bakal lebur han-

cur. Kampung-kampung yang berjauhan dengan laut pun akan rata, sebab tidak tidak ada lagi pertahan alam, sebuah pertahanan kokoh yang tak perlu campur-tangan manusia. Betul memang, tsunami yang sudah berlalu tidak terlalu membawa pengaruh bagi Lhokseumawe, selain di wilayah Pusong saja. Namun, bila melihat pertahanan yang dibangun alam sedemikian kuat dan ini menjadi pertanda, bukan tidak mungkin lima puluh atau seratus atau mungkin seribu tahun mendatang, bencana serupa akan beralih ke kota ini untuk membinasakan penduduknya yang tidak pernah berpikir panjang. Sayangnya, bukan gerombolan manusia perusak saat ini yang menjadi korban, melainkan anak-cucu mereka yang tidak tahu apa-apa. Orangorang yang sedang merusak alam saat ini nantinya sudah mati, mereka akan mewariskan alam yang sudah rusak luyak ini kepada generasi berikutnya. Orang-orang sekarang seperti mewariskan mala petaka, karena mereka hanya memikirkan dan mementingkan diri sendiri saja.

Said mengatakan, bahwa kerusakan alam dengan pengerukan tanah secara besar-besaran ini sudah melampaui batas yang tidak wajar. Kota ini sudah terlanjur dibangun dalam kubangan, yang dulunya merupakan rawa-rawa tepi pantai. “Tidak dapat dielakkan memang, setiap bangunan yang dirikan memang membutuhkan tanah tambakan. Kalau tidak, maka terlihat rendah, janggal, dan sangat tidak mungkin dijadikan ruko,” ujarnya. Dilema semacam inilah yang menjadi dalih pengrusakan alam itu terjadi secara terusterusan di Lhokseumawe. Maka barisan bukit yang membatasi lahan kebun dan persawahan di sebelah utara, terus direnggut. Jika saja laut mengamuk, maka air akan menerjang sampai ke sejumlah perkampungan yang berjauhan dengan pantai. Namun, entah juga kalau Tuhan punya rencana lain, entah bencana apa yang akan datang. Perihal semacam ini bukanlah kekhawatiran yang tidak beralasan, bahwa bumi ini memang sudah renta. Sejumlah bencana, mulai dari angin punting beliung, banjir yang tak terelakan, gempa bumi yang sering

sekali berulang-ulang, angin topan, terjangan ombak purnama, longsor, abrasi, dan wabahwabah sudah kerap terjadi.“Jadi, sebaiknya, alam jangan lagi dimusuhi,” ucap Zulfadli, seorang aktivis pencinta alam. Maka tidak salah, Tuhan sengaja memberikan akal kepada manusia agar bisa berpikir dan membaca tanda-tanda alam. Bukit-bukit yang terbentuk di seputar lingkup Kota Lhokseumawe bukan tidak punya tujuan. Apakah ada manusia yang berpikir bahwa Tuhan suka bertindak sembarangan? Tuhan pun tidak salah berfirman, bahwa manusia memang suka membuat kerusakan. Merusak alam sama dengan mengundang bencana, itulah faktanya. Semakin besar alam yang dirusak, semakin besar pula bencana yang yang akan diundang. Sementara ini, galian C terus marak terjadi di manamana. Bukit-bukit telah hilang, di pindahkan ke lubang-lubang untuk kemudian didirikan bangunan. Apakah ini bukan sebuah bukti bahwa kita begitu rajin mengundang bencana untuk segera datang menimpa kota ini? Arafat Nur


WASPADA Senin 19 Maret 2012

Rencana Kenaikan BBM Resahkan Nelayan

Pj Bupati Gayo Lues

Jaga Kedamaian BLANGKEJEREN (Waspada) : Pj Bupati Gayo Lues Cipta Hunai membuka apel hari Kesadaran Nasional yang dihadiri unsur Muspida Plus dan jajaran SKPD Kabupaten Gayo Lues di lapangan samping Puja Sera, Sabtu (17/3). Cipta Hunai mengajak seluruh masyarakat agar membangkitkan kesadaran nasional dengan mengingat dan merenung terhadap NKRI. Selain itu, sejak habis masa jabatan Bupati Ibnu Hasim, sehingga oleh Pj Gubernur ditunjuk seluruh Pj Bupati terhadap kabupaten/ kota yang kekosongan kepala daerah. Dalam kesempatan itu pula, Cipta Hunai mengulang bahwa Gayo Lues telah genap berumur 10 tahun yang jatuh pada 11 Maret, mengingat Pilkada Aceh sudah di ambang pintu, maka kita akan menunda ulang tahun Gayo Lues yang ke-10, setelah pilkada usai pada April nanti,” ujar Cipta Hunai. Ia,mengajak kepada seluruh masyarakat Gayo Lues agar dapat menjaga kedamaian dan ketenteraman menjelang pilkada mendatang. (cjs)

Ibu Rumah Tangga Siapkan Kayu Bakar

Baru Sebulan Rampung, Saluran Irigasi Ambruk SIGLI (Waspada) : Kendati baru sebulan rampung dibangun, namun sepanjang 600 meter bangunan saluran sekunder di Alue Bangkeh, Kecamatan Geumpang, Kabupaten Pidie ambruk kembali. Kondisi ini sangat memprihatinkan. Pasalnya, masyarakat tidak bisa mengairi air ke persawahan. “Jika tidak segera diperbaiki kembali, dikhawatirkan masyarakat tani akan gagal panen padi musim tanam ini, karena kesulitan mengairi persawahan dan tanaman padi,“ ungkap beberapa petani, Sabtu (17/3). “Kami menilai pembangunan saluran sekunder yang dibangun kontraktor itu dikerjakan asal jadi tanpa mengutamakan kualitas. Buktinya, baru sebulan rampung sudah hancur bahkan ambruk,” ujar Mahyiddin, tokoh masyarakat Geumpang. Menurut Ketua Panitia Khusus (Pansus) IV DPRK Pidie Tgk Saibon, saluran irigasi yang dibangun dengan anggaran 2011 lalu, dalam usia satu bulan sudah rusak parah dan ambruk. Diduga, kontraktornya bekerja asal jadi. “Melihat kondisi saluran yang ambruk itu untuk menghindari kerugian para petani, sebaiknya bangunan itu segera direhabilitasi. Dalam hal ini kontraktor dan Dinas Sumber Daya Air setempat diminta bertanggung awab atas kerusakan itu dan harus membangun kembali,“ ujarnya. (b09)

Kobar-GB Aceh Sarankan 24 Siswa Per Kelas BANDA ACEH (Waspada) : Koalisi Barisan Guru Bersatu (KobarGB) Aceh menyarankan Dinas Pendidikan, Kanwil Kemenag, Lembaga Penjamin Mutu Pendidikan (LPMP) dan Majelis Pendidikan Daerah (MPD) Aceh untuk membatasi jumlah siswa minimal 24 orang per kelas. “Kami menyarankan ini karena sesuai data yang ada pada empat lembaga tersebut, rasio perbandingan antara guru dan murid di Aceh saat ini adalah 1 berbanding 18. Jadi jumlah 32 siswa per kelas seperti yang diterapkan selama ini, kami nilai terlalu besar,” ujar Ketua Dewan Presidium Kobar-GB Aceh, Sayuthi Aulia, Sabtu (17/3). Sedangkan untuk sisa para siswa dari hasil pecahan kelas tersebut, kata dia, dapat diatasi dengan membuka kelas-kelas baru pada sore hari, dengan penentuan jam mengajar sesuai kesepakatan dewan guru dengan kepala sekolah. “Saran ini kita sampaikan agar para siswa dan guru memiliki kesempatan yang cukup untuk berinteraksi secara tenang dan nyaman dalam proses belajar mengajar di kelas,” papar Sayuthi. Selain itu, menurut dia, pembatasan sisa sebagaimana yang disarankan tersebut juga dapat membuka peluang bagi sekolahsekolah swasta dan sekolah pinggiran untuk memiliki siswa yang cukup sehingga dapat membuka lapangan pekerjaan baru bagi para guru honorer yang ingin mengabdikan dirinya. (b04)

Prioritaskan Pemenuhan Belanja Wajib Dari Hibah Dan BS SUBULUSSALAM (Waspada) : Hibah dan Bantuan Sosial (BS) diberikan setelah pemenuhan belanja urusan wajib diprioritaskan. Prinsipnya memperhatikan asas keadilan, kepatutan, rasionalitas dan manfaat untuk masyarakat. Tujuan hibah menunjang pencapaian sasaran program dan kegiatan pemerintah yang secara spesifik telah ditetapkan peruntukannya, sedangkan BS melindungi dari kemungkinan terjadinya resiko sosial. Kadis Pendapatan, Pengelolaan Keuangan dan Kekayaan Daerah Kota Subulussalam, Salbunis belum lama ini di ruang kerjanya mengatakan, fakta integritas penerima BS untuk menggunakan bantuan sesuai aturan menjadi salah satu syarat dan SKPK terkait melakukan monitoring dan evaluasi. Ditegaskan, penentuan hibah/BS dan besaran anggaran adalah hasil sidang DPR dan keputusan kepala daerah. Soal pos bantuan selain yang telah disahkan dalam APBK, diakui tidak ada. “Kepala daerah menetapkan daftar penerima dan besaran bantuan dengan keputusan kepala daerah berdasarkan peraturan daerah tentang APBD dan peraturan kepala daerah tentang penjabaran APBD,” urai dia. (b28)

Waspada/Didit Arjuna

RATUSAN bidan mendatangi Kantor Dinas Kesehatan Nagan Raya, Sabtu (17/3). Kedatangan para bidan tersebut untuk mengambil nomor melengkapi ketentuan penerimaan Bidan PTT.

Ratusan Pelamar Bidan PTT Serbu Dinkes NAGAN RAYA (Waspada) : Ratusan bidan mendatangi Kantor Dinas Kesehatan Nagan Raya, Sabtu (17/3) untuk mengambil nomor melengkapi ketentuan penerimaan Bidan PTT (Pegawai Tak Tetap). Kepala Dinas Kesehatan Nagan Raya Mansuriadi mengatakan, jumlah pelamar PTT mencapai dua ratusan orang. Sementara PTT yang dibutuhkan saat ini di Nagan Raya hanay 25 orang. Bagi para pelamar PTT sendiri nantinya akan mengikuti ujian seleksi yang dilakukan mulai 20 Maret 2012. Selain ujian, mereka juga nantinya diberikan waktu guna dilakukan tes wawancara. Mansuriadi juga mengatakan, jumlah penerimaan PTT di setiap kabupaten tidak sama, yakni penerimaan tergantung pada kebutuhan di setiap kabupaten. Seperti di Aceh Barat yang dikabarkan hanya membutuhkan sembilan bidan PTT. Tingginya minat untuk menjadi Bidan PTT yang ditempatkan di pedalaman atau daerah terpencil berimbang dengan angka honorium mencapai angka Rp3.000.000. Kiranya hal tersebut menjadi salah satu motivasi tingginya minat untuk menjadi bidan PTT. (cda)


Waspada/Muhammad Riza

DUA ibu rumah tangga asal Desa Blang Pandak, Kecamatan Tangse, Pidie, Sabtu (17/3) mengangkut kayu bakar untuk dibawa pulang ke rumah.Warga di daerah itu merasa terpukul dengan rencana pemerintah menaikkan harga BBM.

Mobil Dibakar

Terkait Penipuan Oknum Dosen BANDA ACEH (Waspada): Sebuah mobil yang terparkir di depan rumah oknum dosen yang dituding melakukan penipuan terhadap pengusaha rental, di Gampong Mulya, Kec. Kuta Alam, Minggu (18/3) dinihari hangus terbakar. Belum diketahui penyebab kebakaran mobil jenis VW bernomor polisi BL 544 NC itu, kepolisian masih melakukan penyelidikan untuk mengetahui penyebab kebakaran. “Bukan pembakaran tapi terbakar, karena tidak ada saksi yang melihat. Kami masih penyelidikan dan sudah memintai keterangan seorang saksi yang melapor,”kata Kapolsek Kuta Alam AKP Agus Wahyudi kepada Waspada, Minggu (18/3). Agus Wahyudi mengatakan pihaknya masih mencari tahu pemilik mobil karena mobil dimaksud merupakan mobil tua yang sudah 5 bulan terparkir. Polisi kata Agus, juga menemukan 1 unit mesin genset yang ikut hangus di dalam mobil. “Belum tahu apakah karena genset itu. Kita juga akan menanyakan kepada mereka yang buka posko apakah itu milik mereka. Mobil diketahui terbakar setelah 10 menit,” kata Agus

Wahyudi. Agus Wahyudi juga belum dapat memastikan apakah terbakarnya mobil berkaitan dengan kasus utang piutang Ir Fr dengan pemilik rental yang sejak Kamis membuka posko di kawasan itu. Meski demikian, Agus mengaku telah menerima laporan dan telah berupaya memfasilitasi namun belum membuahkan hasil. “Dua Minggu lalu, ke kami sudah ada 4 orang yang melapor ditipu, termasuk 15 orang juga sudah melapor ke Poltabes. Kendalanya Ir, Fr tidak pernah di tempat. Alasannya di luar kota,” kata Agus Wahyudi. Agus juga menyayangkan sikap Ir Fr yang tidak memenuhi panggilan kepolisian yang berupaya memediasi pihak yang bersengketa. Padahal kata, pasti ada jalan keluar menyelesaikan kasus utang piutang itu jika Ir Frmemenuhi panggilan polisi. “Karen korban juga bersedia di mediasi. Kalau diperkarakanpun mereka takut uang tidak kembali,”kata Agus Wahyudi. Nisful salah satu pengelola rental mobil CV Rizkie Rental yang menjadi korban penipuan mengatakan, para korban penipuan Ir Fr tidak terlibat dalam pembakaran. Menurut Nisful mobil terbakar saat posko yang didirikan para korban dalam kondisi kosong. “Saya ditelpon kawan katannya mobil dekat pos terbakar, sekitar pukul 03:00. Kejadian dini hari dan saat kejadian kami tidak ada yang tidur di pos itu

karena menerima ancaman dari orang dekat Ir Fr,”kata Nisful. Menurut Nisful, keputusan tidak bermalam di posko pada malam terbakarnya mobil, setelah para korban melakukan rapat, karena sebelumnya mereka menerima ancaman. Ancaman yang menurut Nisful diperoleh dari orang dekat Fr meminta para korban membubarkan aksinya di depan rumah milik Ir Fr. “Jadi setelah rapat kami pulang dan posko kosong Minggu malam. Kalau tidak bubar akan ada insiden. Jadi kami putuskan tidak tidur di situ,” kata Nisful. Seperti diberitakan, sejumlah warga dan pengusaha rental mobil membuka posko dan sempat menggelar yasinan di depan rumah megah milik Ir Firdaus. Para korban berharap aksi yang digelar sejak Kamis kemarin itu, menggugah Fr untuk melunasi utangnya yang disebut-sebut mencapai Rp2,5 miliar. Jumlah itu merupakan total dari biaya rental 24 dan 15 unit mobil rental dari dua perusahaan rental mobil. Para korban mengaku meski berbagai upaya telah ditempuh termasuk melapor kepada kepolisian namun masalah tersebut tidak kunjung selesai sehingga korban berinisiatif membuka posko. Hingga Minggu siang, Waspada belum memperoleh konfirmasi dari Ir Fr. Nomor Hp miliknya yang berulangkali dihubungi tidak aktif.(cb06)

PA Resmi Berhentikan Basyaruddin, Edi Aryansyah Pengganti Antar Waktu BANDA ACEH (Waspada): Basyaruddin, anggota DPRK Banda Aceh dan juga menjabat Wakil Ketua mewakili Partai Aceh resmi diberhentikan, Jumat (16/3). Sebagai pengganti antar waktu (PAW), Partai Aceh menunjuk Edi Aryansyah. Prosesi pelantikan dan pengambilan sumpah Edi Aryansyah dilakukan Ketua DPRK Banda Aceh Yudi Kurnia dalam sidang paripurna istimewa di gedung DPRK Banda Aceh. Ketua DPRK Banda Aceh Yudi Kurnia mengatakan, dengan dilantiknya Edi Aryansyah,

maka di pundaknya telah terpikul tanggungjawab yang sangat berat, berupa amanah dan kepercayaan seluruh warga Kota Banda Aceh. Amanah tersebut harus diaplikasikan dalam wujud kerja nyata di lembaga terhormat ini, hingga berakhirnya periode masa bhakti dewan ini. Kecuali itu, lanjutYudi, sebagai anggota dewan yang merupakan wakil rakyat dari daerah pemilihan yang telah mempercayakan amanatnya, pada hakikatnya melekat dua peran utama yakni sebagai pejabat

politis yang memiliki fungsi merencanakan atau memformulasikan kebijakan sesuai tugas hak dan wewenang serta kedua sebagai representasi dari wakil rakyat yang mengemban aspirasi masyarakat. Sekdakot Banda Aceh Ramli Rasyid mengatakan, adanya mekanisme pergantian antar waktu merupakan bukti bahwa semua jabatan dan posisi di dunia ini adalah amanah, baik itu amanah dari rakyat, partai, bangsa dan negara yang sifatnya sementara. (b02)

Golkar Aceh Diminta Kembali Ke AD-ART BANDA ACEH (Waspada): Ketua DPD II Partai Golkar Kota Banda Aceh Muntasir Hamid mengingatkan kepada DPD I Partai Golkar Provinsi Aceh agar segera kembali kepada AD-ART Partai Golkar. “Kita perlu mengingatkan, karena selama ini banyak kewenangan yang seharusnya menjadi tugas DPD-II justru dicaplok DPD-I,” ungkap Muntasir Hamid usai membuka Pendidikan dan Pelatihan Kader Penggerak Teritorial (Diklat Karakter) Kecamatan Kuta Alam, di Banda Aceh, Sabtu (17/3). Tak hanya itu, dia juga menyebutkan selama ini DPD-II kurang mendapat informasi yang lengkap tentang program dan isu strategis dari DPD-I, salah satunya yang paling penting adalah kepada kandidat gubernur mana dukungan Partai

Golkar dalam Pilkada mendatang. “Sampai saat ini, kita belum mendapat informasi kepada kandidat gubernur mana para kader Partai Golkar akan memberikan dukungan pada Pilkada Aceh 9 April nanti. Inikan sangat membingungkan?”tutur Muntasir. Sementara menyangkut isu nasional, Muntasir kembali mengulang hasil pertemuan Forum DPD II Partai Golkar se-Indonesia yang meminta DPP Partai Golkar agar koordinator wilayah (korwil) dikembalikan ke masing-masing daerah. Karena selama ini DPP terkesan telah membonsai tokoh-tokoh lokal di tingkat nasional. “Kita ingin Korwil untuk Aceh diberikan kepada tokoh Aceh, bukan kepada tokoh dari

luar Aceh. Begitu juga untuk daerah-daerah lainnya,” tegasnya. Terkait kondisi keamanan Aceh, Ketua DPD-II Partai Golkar Kota Banda Aceh ini secara tegas menyatakan masih banyak senjata ilegal yang beredar di Aceh dan pernyataan ini bisa dipertanggungjawabkan. “Karena itu kami minta Polda Aceh dan Kodam Iskandar Muda lebih pro aktif dalam menuntaskan peredaran senjata ilegal ini,” katanya. Diklat Karakter Partai Golkar Kecamatan Kuta Alam ini diikuti sekitar 100 peserta yang merupakan kader-kader muda Partai Golkar, salah satu tujuannya untuk menciptakan kader-kader tersebut menjadi pemimpin bangsa di masa mendatang. (b04)

SIGLI (Waspada) : Rencana pemerintah menaikan harga bahan bakar minyak (BBM) telah membuat rakyat kecil di Kabupaten Pidie dirundung panik. Amatan Waspada, di Kecamatan Tangse, Mane, Geumpang, Tiro, Kabupaten Pidie, Sabtu (17/3) banyak ibu rumah tangga di beberapa desa di pedalaman Tangse mulai sibuk mempersiapkan kayu bakar untuk menyambut naiknya harga BBM yang dinilai tidak berpihak kepada rakyat. Sedangkan beberapa abang becak dan nelayan di daerah itu mulai resah terhadap rencana pemerintah pusat tersebut. “Kami sekarang ini mulai siap-siap mengumpulkan kayu untuk memasak. Karena dalam waktu dekat ini pemerintah akan menaikan harga minyak,” kata Khatijah, 34, salah seorang ibu rumah tangga asal Desa Blang Pandak, Tangse, Pidie. Menurut ibu empat anak ini, dengan harga BBM seperti sekarang ini saja, kehidupan ekonomi mereka susah tidak karuan, apalagi kalau harga BBM dinaikkan, sudah pasti akan menyebabkan kehidupan mereka kian sulit. “Karena itu mau tidak mau, kami harus

membantu suami mencari kayu bakar di hutan supaya bisa meringankan beban suami dalam mencari nafkah, yang sehari-hari berprofesi sebagai buruh kebun,” keluh Khatijah. Kata dia, untuk mencari kayu bakar dalam hutan Khatijah bersama beberapa kaum ibu se kampung bisa menghabiskan waktu sehari karena karena kayu dalam hutan tidak boleh ditebang, jadi yang mereka potong adalah kayukayu yang sudah mati atau ranting-ranting pohon yang sudah kering dan bisa dimanfaatkan sebagai kayu bakar pengganti BBM. Di tempat terpisah, beberapa abang becak di Kota Sigli mengungkapkan rencana pemerintah yang sebentar lagi menaikkan harga BBM menyebabkan keresahan. Tgk Aiyub, salah seorang tukang becak bermotor mengungkapkan usaha pemerintah menaikkan harga BBM memang sangat memukul mata pencaharian mereka, yang seharihari berharap dari mengantar orang. Dengan pendapatan per hari senilai Rp50 ribu akan sulit menyekolahkan anak-anaknya serta membeli kebutuhan sembako.(b10)

Tata Ruang Pidie Tak Jelas, DPR Minta Ditinjau Ulang SIGLI (Waspada) : Sejumlah kalangan menilai Tata Ruang di Kabupaten Pidie, terutama ibukota kabupaten (Kota Sigli) amburadul dan bahkan membingungkan. Pasalnya, lokasi larangan membangun pertokoan justru bermunculan bangunan toko. Beberapa pengamat pembangunan dan lingkungan, Minggu (18/3) mengatakan, kondisi itu terjadi akibat pemerintah setempat tidak tegas terhadap aturan tata ruang, bahkan pertokoan yang dibangun di tempat larangan itu disinyalir tanpan Izin Mendirikan Bangunan (IMB). Disebutkan, banyak bangunan pertokoan di Pidie tidak memiliki IMB. Namun Pemkab terkesan diam saja, seakan Pidie milik preman dan oknum kelompok tertentu, pemerintah tidak berani mengambil tindakan tegas terhadap pemiliknya. Kondisi tersebut membuat tata ruang kota amburadul dan semrawut. Kesemrawutan pembangunan pertokoan dan diduga tanpa IMB seperti juga terjadi di seputaran kota dagang Beureunuen, Kecamatan Mutiara. Di kawasan Kota Dagang ini, juga disinyalir banyak pembangunan pertokoan baru yang tidak mengindahkan aturan tata ruang. Panitia Khusus (Pansus) II DPRK Pidie mendesak pemerintah daerah setempat segera meninjau ulang tata ruang di daerah itu. Pasalnya, hasil Pansus yang dilakukan anggota dewan ternyata tata ruang di Kabupaten Pidie masih amburadul dan tidak jelas. Ketua Pansus II DPRK Pidie Muhammad dalam laporannya jelang pembukaan sidang RAPBK Pidie 2012 di Gedung Dewan setempat beberapa waktu lalu mengatakan, hasil kunjungan Pansus ke lapangan di sejumlah kecamatan menemukan ketidakwajaran dalam tata ruang Kabupaten Pidie yang terkesan amburadul dan tak jelas. “Ini perlu ditinjau ulang agar Pidie memiliki tata ruang yang jelas,“ katanya. Selain itu, Muhammad menyarankan SKPK memperjelas Poksi kerjanya masing-masing,

jangan mencampuradukkan tanggungjawab. Terlebih Dinas Bina Marga dan Cipta Karya (BMCK) dan Kantor Pusat Pelayanan Terpadu Satu Pintu (P2TSP) yang sama-sama memiliki hak tentang IMB. Ketua Badan Perencanaan Pembangunan Daerah (Bappeda) Kabupaten Pidie Maddan membantah tata ruang Kabupaten Pidie dinilai amburadul dan membingungkan. “Pemkab Pidie tetap memperhatikan kelestarian lingkungan dan tata ruang dalam memberikan IMB,” katanya. Maddan mengakui, yang terjadi terhadap tata ruang sedikit kurang rapi. Pemkab sedang berupaya merancang kembali tata ruang yang jelas sehingga bisa mengantisipasi bencana banjir. (b09)

Ir H Azmi Abdullah Imum Mukim Juli Utara JULI (Waspada): Ir H Azmi Abdullah terpilih kembali kedua kalinya sebagai Imum Mukim Juli Utara periode 2012 – 2018 dalam pemilihan di Meunasah Jok, Kecamatan Juli, Sabtu (17/ 3). Dalam pemilihan itu H Azmi Abdullah pensiunan Kadis Pertanian Peternakan Perkebunan dan Kehutanan Kabupaten Bireuen unggul meraih 47 suara menyisihkan rivalnya H Zainal Fitri yang hanya memperoleh 12 suara. Acara pemilihan itu turut dihadiri unsur Muspika Kecamatan Juli, para Geuchiek dalam kemukiman Juli Utara dan sejumlah tokohtokoh masyarakat setempat. Tu Adi Djuli salah seorang tokoh masyarakat Juli Utara mengatakan, masyarakat Kemukiman Juli Utara sangat menyambut baik atas terpilihnya kembali Ir H Azmi Abdullah sebagai Imum Mukim untuk memimpin kembali pemerintahan Mukim Juli Utara periode mendatang ke arah yang lebih baik. (b12)

Kritisi Persoalan Lingkungan, Pemkab Abdya Boikot Acara Walhi BLANGPIDIE (Waspada) : Tanpa alasan yang jelas, tidak ada satu orang peserta yang datang ketika Wahana Lingkungan Hidup (Walhi) Aceh membuat kegiatan pendampingan hukum lingkungan untuk seluruh Satuan Kerja Perangkat Daerah (SKPD) Pemkab Aceh Barat Daya, Jumat (16/3). Koodinator kegiatan Walhi Aceh, Agus Ariyanto, Sabtu (17/3) mengaku sangat kecewa dengan sikap boikot dari Pemkab Abdya terkait kegiatan ini. “Justru kegiatan yang dibuat Walhi Aceh di Abdya ini merupakan dukungan materi bagaimana melakukan pendampingan hukum terhadap kasus-kasus lingkungan,” kata Agus. Ia mengatakan, sebelumnya Walhi Aceh melakukan kegiatan yang sama kepada semua keuchik atau kepala desa dan SKPD serta Polsek Babahrot di Abdya 6 Februari 2012 lalu. Kegiatan ini sebelumnya tanpa diketahui Bupati Abdya Akmal Ibrahim, tapi semua peserta datang mengikuti acara tersebut. Agus bersama kawan-kawan Walhi yang lain, Yusri dan Eva menambahkan, kegiatan yang sama yaitu pendampingan hukum terhadap kasus-kasus lingkungan di Abdya pada Jumat kemarin justru mendapat dukungan dari Bupati Abdya Akmal Ibrahim. Tapi anehnya tidak ada seorang peserta pun yang datang. “Bahkan SKPD terkait, seperti Dinas Kehu-

tanan dan Perkebunan Abdya yang terlibat dalam kasus pembangunan pabrik kelapa sawit di Abdya juga diundang, tapi juga tidak datang dan tidak ada konfirmasi,” kata Agus sembari mengatakan kegiatan yang dibuat Walhi justru membantu mereka yang terlibat dengan kasuskasus lingkungan. Dimana dalam kasus tersebut sudah tiga orang ditetapkan sebagai tersangka oleh pihak kepolisian. Kasubbag Bappeda Abdya, Siti Ridwan mengaku merasa aneh dengan tidak ada satu orang pun yang datang untuk kegiatan yang digagas Walhi Aceh ini. “Tidak seperti biasanya,” kata Siti Ridwan. Heri dari lembagaYayasan Ekosistem Sigom Aceh (YeSA)mengakui semua surat untuk kegiatan tersebut sudah diberikan kepada 26 SKPD di Abdya dan sudah dimasukkan dalam buku agenda SKPD masing-masing. Namun. Rabu (14/3) sekitar pukul 08:00, Heri sempat dipanggil Bupati Abdya Akmal Ibrahim untuk mendiskusikan maksud dari kegiatan Walhi Aceh ini. Kemudian Bupati Akmal Ibrahim langsung merespon agar mendistribusikan surat-surat itu ke SKPD terkait. Namun anehnya hingga acara puncak justru tidak ada satu orangpun peserta yang hadir, sedangkan panitia dan narasumber sudah bersiap-siap dalam ruangan di aula Bappeda Abdya. (cb05)

Pemimpin Aceh Harus Mampu Implementasikan UUPA BANDA ACEH ( Waspada) : Undangundang nomor 11 tahun 2006 tentang Pemerintahan Aceh (UUPA) yang menjadi salah satu dasar utama bagi berlanjutnya perdamaian Aceh, hingga kini masih terkesan seperti macan ompong. Jika hal tidak mendapat perhatian serius dari semua pihak, termasuk para pemimpin Aceh, bukan mustahil UUPA akan kembali melahirkan kekecewaan, bahkan pemberontakan. “Potensi timbulnya kekecewaan akibat mandegnya implementasi UUPA sangat besar. Pasalnya, hingga 6 tahun usia UUPA, masih banyak aturan pelaksana yang belum selesai, mulai dari PP, Qanun, Pergub dan lain-lain,” ujar Ketua Independent Research Institute (IRI), Mulyadi Nurdin, di Banda Aceh, Sabtu (17/3). Karena itu, Mulyadi meminta para kandidat Gubernur dan Wakil Gubernur Aceh yang ikut bertarung dalam Pilkada Aceh 2012 untuk memasukkan program menuntaskan seluruh aturan pelaksana UUPA sebagai prioritas kerja jika terpilih nantinya. “Jadi, jika ingin perdamaian Aceh tetap langgeng, maka Gubernur Aceh ke depan harus mampu menjalankan Undang-undang nomor 11 tahun 2006 tentang

Pemerintahan Aceh,” katanya Menurut dia, banyak hal krusial belum tuntas, seperti pelabuhan bebas Sabang, pertanahan, bendera daerah Aceh, hymne Aceh, wali nanggroe dan lain-lain. “Semua payung hukum harus segera dituntaskan supaya rakyat Aceh tidak bosan menanti,” imbuhnya. Mulyadi Nurdin juga mengingatkan supaya gubernur terpilih nanti tidak mengecewakan rakyat Aceh karena UUPA tidak berjalan, sehingga harus serius menuntaskan semua regulasi terkait UUPA. “UUPA sudah memberikan wewenang yang sangat besar kepada Aceh untuk mengurus dirinya, tapi kalau aturan pelaksanan tidak dibuat, UU tersebut tidak ada artinya, untuk itu kerja keras pemimpin Aceh sangat diperlukan,” kata dia. Selanjutnya Mulyadi Nurdin mengingatkan supaya semua kewenangan yang diberikan oleh UUPA dapat dimanfaatkan untuk kesejahteraan rakyat Aceh. Yang masih diurus Pemerintah Pusat hanya politik luar negeri, pertahanan, keamanan, yustisi, moneter, fiskal dan agama, yang lain semua menjadi kewenangan Pemerintah Aceh. “Untuk itu, Pemerintah Aceh harus berlari kencang agar semua regulasi tuntas sesegera mungkin,” ucap Mulyadi Nurdin. (b04)



Ratusan Warga Aceh Timur Sambut Pj Bupati Di Perbatasan

Umat Muslim Diminta Komit Jaga Perdamaian Aceh JULOK (Waspada) : Melalui momentum Maulid Nabi Muhammad SAW dan dalam memaknainya, umat muslim di Aceh diharapkan komit dan terus memupuk perdamaian Aceh yang sudah dicapai dengan susah payah. Hal itu penting untuk generasi mendatang agar tetap hidup dalam situasi yang aman. “Mari sama-sama kita jaga perdamaian ini sehingga kelak kedamaian tetap menjadi milik masyarakat Aceh,” ujar Ketua Himpunan Ulama Dayah Aceh (HUDA) Tgk H Ibrahim Berdan yang akrap disapa Abu Panton dalam ceramah Maulid Akbar di Dayah Bustanul Huda Paya Pasi, Kecamatan Julok, Aceh Timur, Minggu (18/3). Abu Panton menjelaskan, menjaga perdamaian Aceh merupakan hal yang paling penting dalam bermasyarakat sehingga tatanan kehidupan masyarakat tidak terusik, terutama dalam menjalankan ibadah kepada Allah SWT. “Jika damai terjaga, otomatis akan terus terjaga perdamaian Aceh dan aktivitas pengajian agama di dayah-dayah akan berlangsung aman,” katanya. Perayaan Maulid Nabi Muhammad SAW yang berlangsung di Dayah Bustanul Huda Paya Pasi Julok dihadiri 7.000 jamaah dari berbagai majelis taklim, santri/wati dayah dari seluruh Aceh. Bahkan turut dihadiri Tgk H Muhammad Daud (Abu Daud) Lueng Angen, Muzakir Manaf, Calon Wakil Gubernur Aceh dari Partai Aceh dan Hasballah M Thaeb (Rocky) sebagai Calon Bupati Aceh Timur serta para ulama dayah lain yang tersebar di Aceh Timur. (b24) Waspada/Musyawir

PJ BUPATI Aceh Timur Nasrullah memeluk salah seorang tokoh masyarakat yang menyambutnya di Tanjong Minjei, Madat, Sabtu (17/3).

Muhammad Rapyan/Waspada

180 ANAK yatim yang disantuni pengajian Udeep Saree Simeulue di acara Maulid Akbar di Komplek Baru Pengajian Masyarakat Aceh Perantauan di Jalan Kolok—Kota Batu Sinabang saat menikmati makanan.

2000-an Anggota Udeep Saree Simeulue Gelar Maulid Akbar SIMEULUE (Waspada) : Organisasi perkumpulan masyarakat Aceh Daratan Sumatera di Kabupaten Simeulue—Udeep Saree, Sabtu (17/3) menggelar peringatan hari lahir Nabi Besar Muhammad SAW. Selain panitia memberikan jamuan makan pada undangan dan malamnya menggelar ceramah agama yang disampaikan Ustadz Tengku Fahruddin, Udeep Saree menyantuni 180 anak yatim. Ketua Panitia Maulid Udeep Saree, Abu Bakar menuturkan, acara itu merupakan tradisi tahunan yang dilakukan Udeep Saree 8 tahun belakangan guna mengkaji ulang, memahami dan mendalami sejarah kelahiran dan perjuangan Rasulullah Muhammad SAW dalam menegakkan agama Tauhid/Islam khususnya kepada anggota Udeep Saree dan umumnya kepada ummat Islam. Pimpinan Pesantren Tengku Chik Umardian, Aceh Besar, Ustadz Tgk Fakhuddin yang diundang menyampaikan tausyiah mengupas tuntas sejarah perjalanan dan misi utama Nabi Muhammad diutus oleh Allah ke muka bumi untuk memperbaiki ahlak manusia yang begitu jahilliyah masa itu. Bupati Simeulue Darmili memberikan apresiasi tinggi kepada pengajian Udeep Saree yang turut mempelopori dan mendukung pelestarian Maulid Nabi Muhammad dan juga perayaan hari besar Islam lainnya. (cb04)

Pengawas Sekolah Lokomotif Penggerak Dunia Pendidikan LANGSA (Waspada): Pengawas sekolah merupakan lokomotif penggerak dunia pendidikan. Jika pengawas tidak bekerja, pembelajaran di sekolah-sekolah dapat dipastikan akan mandeg alias jalan di tempat. Karena itu untuk menakar kinerja para pengawas salah satu caranya bisa dilihat pada output pendidikan yang dihasilkan apakah berkualitas ataupun tidak. Demikian Sekretaris Kelompok Pengawas Sekolah Kota Langsa Drs Suharianto, MT kepada Waspada, Sabtu (17/3). Hal itu merasa perlu disampaikannya untuk menanggapi tudingan miring yang menuduh banyak pengawas sekolah di Kota Langsa malas bekerja. Menurutnya, kinerja para pengawas tidak bisa ditampik akan berdampak pada kinerja kepala sekolah dan para guru. Kemudian akan berujung dampaknya pada pembelajaran. Jika kinerja baik dampaknya akan menjadi baik dan juga sebaliknya jika kinerja pengawas buruk dampak yang dihasilkan pun tentu saja menjadi buruk. Sistem kerja pengawas sekolah itu, kata dia, antara lain melakukan penilaian terhadap cara mengajar guru mulai dari pembukaan, pertengahan, penutup, sampai pada tindak lanjut pengajaran. Karena tugas pokok pengawas melakukan pengawasan akademik dan manajerial..(b20)

2.848 Peserta Kemenag Siap Ikuti UN 39 Titik MTs/MA, Lokasi UN Dirampingkan Jadi 17 Titik IDI (Waspada) : Akibat tidak siap, 15 Madrasah Tsanawiyah (MTs) dan 7 Madrasah Aliyah (MA) di lingkungan Kantor Kementerian Agama Aceh Timur merampingkan pelaksanaan Ujian Nasional (UN) di 17 titik. “Jumlah peserta UN di jajaran Kemenag Aceh Timur tahun 2011/2012 mencapai 2.848 peserta. Rinciannya, 1.977 peserta MTs dan 871 peserta MA. Seluruhnya sudah siap mengi-kuti UN, tapi ada semacam perampingan karena sebagian madrasah tidak siap m e n y e - l e n g g a ra k a n U N dengan berba-gai kendala,” ujar Kepala Keme-nag Aceh Timur Faisal Hasan melalui Kasi Mapenda Fadli, Minggu (18/3). Berdasarkan data di Kemenag Aceh Timur, titik penye-

lenggara UN tingkat MTs yakni MTsN Madat, MTsN Simpang Ulim, MTsN Kuta Binjei, MTsN Idi Cut, MTsN Model Idi Rayeuk, MTsN Kuta Baroe, MTsN Peureulak, MTsN Ranto Peureulak, MTsN Alue Lhok, MTsS Nurul Ulum, dan MTsS Taman Fajar. Sementara titik MA yakni MAN Simpang Ulim, MAN Idi Rayeuk, MAN Ranto Peureulak, MAN Peureulak, MAS Idi Cut dan MAS Al Widyan. Sementara data MTs yang bergabung yakni MTsS Lueng Sa, MTsS Buket Bata, MTsS Istiqamah, MTsS Nurussalam, MTsS An Nur Bugeng, MTsS Dama Puteh, MTsS Darussa’adah, MTsS Monisa, MTsS Gampong Beusa, MTsS Seuneubok Johan, MTsS Darul Muta’alimin, MTsS Darul Huda, MTsS AlueTeh, MTsS Alue Seuntang, dan MTsS Darul Fata. Sedangkan 7 MA yang bergabung adalah MAS Madat, MAS Lueng Sa, MAS Kuta Binjei, MAS Darun Naja, MAS Nurul Ulum dan

MAS Nurul Huda serta MAS Nurul Fata. Fadli mengatakan, faktor utama yang menyebabkan 7 MA dan 15 MTs harus bergabung ke titik penyelenggara terdekat antara lain karena jumlah peserta kurang dari 20 orang. “Selain itu, mengingat sarana dan prasarana yang belum memadai untuk menyelenggarakan UN, baik MTs ataupun MA, sehingga harus bergabung ke madrasah yang dekat seperti MTsS Lueng Sa bergabung ke MTsN Madat,” jelas Fadli. Fadli juga menyebutkan, secara serentak pelaksanaan UN madrasah akan berlangsung 16-19 April 2012 untuk tingkat Madrasah Aliyah (MA) dan 23-26 April untuk Madrasah Tsnawiyah (MTs). “Dan 26-28 Maret pihak Kemenag akan melaksanakan Ujian Akhir Madrasah-Berstandar Nasional (UAM-MN) MA. Sedangkan UAM-BN MTs dilaksanakan 1921,” tandas Fadli. (b24)

Ancaman Bahaya Narkoba Di Langsa Capai Stadium Tinggi LANGSA (Waspada) : Para alim ulama, tokoh masyarakat dan seluruh elemen lainnya terutama para kepala keluarga masing-masing rumah tangga di Kota Langsa agaknya tidak lagi bisa menganggap remeh tentang bahaya narkoba. Ancamannya sudah mencapai stadium tinggi. Jika hanya mengharap pada polisi untuk melakukan pemberantasan peredarannya, penjara perlu segera diperluas. Karena tiap hari jumlah tersangka yang tertangkap menyangkut kasus narkoba sudah tidak lagi bisa ditampung dalam LP.

“Sekarang penghuni penjara Langsa sudah berjejal, muatannya sudah mencapai dua kali lipat dari kapasitasnya secara normal,” ujar Kapolres Langsa AKBP Hariadi saat melakukan ramah tamah dengan para wartawan di aula Mapolres setempat, Jumat (16/3) malam. Dalam pertemuan perdananya dengan insan pers sejak dia bertugas sebagai Kapolres Langsa sekitar dua pekan lalu itu, Hariadi berharap semua pihak di Kota Langsa berperan aktif memberantas jaringan pengedar narkoba. Menurut Kapolres, pembe-

rantasan narkoba tidak bisa dilakukan hanya oleh polisi saja. Jika semua elemen lain tidak ikut membantu hasilnya pasti tidak akan maksimal. Dan yang sangat diharapkan tentunya bukan hanya pemberantasan, tetapi lebih utama pencegahan. Maka itu, para alim ulama, tokoh masyarakat dan berbagai elemen lain terutama para orangtua dalam rumah tangga agar mau menjaga masingmasing orang yang berada di bawah tanggungjawabnya supaya jangan pernah bersentuhan dengan barang haram tersebut. (b20)

Gigih Mencari Peminat Di Kota Petro Dolar

Suhu panas terasa pedih seakan membakar kulit ari di badan. Dari kejauhan tampak uap panas bergelombang di atas permukaan aspal di Jalan Merdeka, Kec. Banda Sakti Kota Lhokseumawe. Pria tadi menyeberang jalan setempat dari celah-celah mobil dan sepedamotor yang melintas sambil melihat kiri dan kanan. Sang pria baru menghentikan perjalanan ketika menemukan sebuah tempat berteduh yang sejuk, di mana terdapat anak-anak bermain bersama teman-temannya, sebagaimana halaman Masjid Baiturrahman yang saat itu dia singgahi. Setelah merenggang badan dan meletakkan barang bawaannya, pria yang mengaku bernama Doni ini, mengeluarkan bungkusan yang berisikan banyak mainan dengan berbagai bentuk. Doni langsung memperagakan setiap jenis mainan yang bisa mengeluarkan bunyi mer-

du atau bisa bergerak sendiri, hal itu untuk memancing reaksi minat anak-anak yang melihatnya. Kalau soal hiburan, tentunya anak-anaklah yang paling doyan dan sangat mudah tertarik untuk memilikinya. Doni menjajakan barang sejumlah mainan anak-anak yang masih tergolong tradisional, seperti gasing, putar suara, angklung, seruling dan jenis lainnya. Termasuk juga menjajakan sejumlah barang replika ukuran mini menyerupai alat klasik seperti perahu, mobil dan sepedamotor antik. Barang-barang itu merupakan hasil kerajinan tangan yang terbuat dari bahan baku yang mudah dicari seperti kayu dan bambu. Bila bahan baku mudah didapat, tentu tidak segampang dalam membuat atau merangkainya menjadi mainan bagus. Karena untuk menciptakan karya tangan yang unik dibutuhkan keahlian dan keterampilan khusus untuk bisa menghasilkan barang yang memuaskan. Kualitas barang mainan ini sudah diakui secara umum di nusantara. Tidak mudah rusak dan tetap bisa tahan lama kendati anak-anak mencoba untuk merusaknya. “Barang dagangan saya tidak terbuat dari plastik atau atom yang bentuknya modern. Tapi yang ada semuanya

MADAT (Waspada): Ratusan warga Aceh Timur menyambut rombongan Pj Bupati Nasrullah Muhammad di Tanjong Minjei, Kecamatan Madat, kawasan perbatasan Aceh Timur dan Aceh Utara, Sabtu (17/3) sore. Rombongan Pj Bupati berangkat dari Banda Aceh sekitar pukul 09:00 dan tiba di Tanjong Minjei dengan mobil dinas Lexus SUV BL 1 D, sekitar pukul 16:30. Satu mobil dengan Pj Bupati juga terlihat sejumlah anggota keluarganya, termasuk Ny Nilawati Nasrullah. Mantan Kepala BKPP Aceh ini disambut sejumlah tokoh, antara lain tokoh muda Aceh Timur Auzir Fahlevi, tokoh masyarakat Aceh Utara Abdullah AW, Kepala Baitul Mal Aceh Timur Tgk H Iqbal Bth, Wakil Majelis Permusyawaratan Ulama (MPU) Aceh Timur Tgk Azhar dan Asisten III Abdul Munir. Seusai beristirahat sejenak sembari menikmati secangkir kopi di salah satu warung ternama di Tanjong Minjei, sebagian besar warga yang menyambut Pj Bupati ikut mengantar rombongan hingga ke pendopo Bupati Aceh Timur di Langsa. “Kami sangat terharu disambut seperti ini. Terimakasih semuanya. Kami berjanji akan memberikan yang terbaik untuk masyarakat Aceh Timur,” kata Nasrullah Muhammad,

sesaat sebelum bertolak ke Langsa. Di Langsa Sementara itu, kedatangan Penjabat Bupati Aceh Timur Nasrullah Muhammad beserta istri dan keluarganya mendapat sambutan hangat dari pejabat dan masyarakat di Pendopo Meligou Aceh Timur di Langsa, Sabtu (17/3) sore. Kedatangan Pj Bupati Aceh Timur itu merupakan kedatangan perdana sekaligus melaksanakan tugas selaku kepala daerah di Kabupaten Aceh Timur pasca dilantik, Rabu (14/3) oleh Pj Gubernur Aceh Tarmizi Karim di Anjong Mon Mata Banda Aceh. Para penyambut tersebut terdiri dari jajaran Muspida Kabupaten Aceh Timur, Sekretaris Daerah Syaifannur, para asisten, Kabag, Kepala SKPK, camat serta istri, pejabat dan pengurus PKK. Suasana pendopo Meuligo Aceh Timur saat itu tampak ramai dan puluhan karangan bunga menghiasi halaman pendopo. Usai menyalami satu persatu pejabat dan tamu yang menunggu di halaman pendopo, Pj Bupati Nasrullah langsung beristirahat sambil berbincang santai di ruang utama pendopo bersama jajaran Muspida, di antaranya Ketua DPRK Tgk Alauddin, Dandim 0104 Letkol Mohamad Hasan, Kapolres AKBP Iwan Eka Putra, Sekda Syaifannur dan lainnya. (b19/b20)

Mantan Petinggi GAM Kecam Aksi Pembakaran Mobil Timses PEUREULAK (Waspada): Mantan petinggi Gerakan Aceh Merdeka (GAM) Wilayah Peureulak mengecam aksi teror yang dilancarkan sekelompok orang dengan membakar mobil Tim Sukses (Timses) Muslim H- Marwi U di Bintah, Kecamatan Madat, Aceh Timur, Minggu (18/3) dinihari. Mengingat kondisi politik yang semakin memanas di Kabupaten Aceh Timur, petugas kepolisian diharapkan mengusut tuntas aksi teror itu. Bahkan, aksi pembakaran mobil Timses Muslim H-Marwi U adalah bukan yang pertama kali terjadi di Aceh Timur, tetapi aksi serupa juga menimpa salah satu Timsesnya di Desa Beusa Seubrang, Kecamatan Peureulak Barat, pekan lalu. “Kita meminta polisi mengusut tuntas kasus pembakaran mobil di Madat dan di Peureulak serta aksi pembakaran mobil di Idi Rayeuk. Ini aksi kriminalitas yang harus diusut, karena jika tidak maka akan merajalela,” papar mantan petinggi GAM Wilayah Peureulak Tgk Sanusi Muhammad yang akrab disapa Abu Sanusi (foto) kepada Waspada, Minggu (18/3). Menurut Abu Sanusi, kondisi tersebut perlu ketegasan dalam pengusutan oleh pihak kepolisian, sebab selain sudah mengancam orang lain dengan melancarkan teror, juga telah mengganggu perdamaian antara Pemerintah RI – GAM. Abu Sanusi mengatakan, perdamaian

adalah milik rakyat yang harus dijaga secara bersama-sama. Melalui perdamaian yang diperjuangkan selama 32 tahun, sekarang Aceh sudah aman tanpa letusan senjata api (senpi) lagi. “Jadi untuk apa lagi aksi teror dan semacamnya. Mari kita berfikir jernih dan berpolitik secara demokrasi sehingga lahir pemimpin yang memiliki wawasan kenegaraan dan disiplin dalam menjalankan amanah rakyat serta memiliki visimisi yang mampu mensejahterakan rakyat,” tuturnya. Di sisi lain, lanjut Abu Sanusi, pihaknya menyesalkan tindakan dan aksi pembakaran mobilmobil Timses calon bupati/wakil bupati ataupun cagub/cawagub, sebab dengan aksi tersebut menimbulkan ketakutan dan keresahan di masyarakat sehingga kesan yang timbul di masyarakat awam bahwa menjelang Pilkada Aceh bakal banyak aksi teror. “Jadi kita harap polisi mengusut tuntas aksi-aksi teror di Aceh. Tak hanya di Aceh Timur tapi di seluruh Aceh,” tandas Abu Sanusi, mantan Ketua DPW Partai Aceh, Aceh Timur itu. Calon Bupati Aceh Timur Periode 2012-2017 nomor urut 1 Muslim Hasballah secara terpisah juga mengatakan hal yang sama. Dia juga meminta aparat kepolisian mengusut tuntas kasus pembakaran mobil milik timsesnya di Peureulak dan Madat. “Jika tidak diungkap, maka aksi-aksi serupa akan merajalela di Aceh Timur dan akan merambah ke seluruh Aceh,” papar Muslim. (b24)

564 Siswa MI Se-Kota Langsa Ikut Try Out LANGSA (Waspada): Sejumlah 564 siswa Madrasah Ibtidaiyah Se-Kota Langsa ikut try out secara serentak yang dipusatkan di gedung MIN Paya Bujok Tunong, Minggu (18/3). Kegiatan itu diselenggarakan untuk persiapan menghadapi UAN supaya dapat ketahui sudah sejauhmana kemampuan mereka. Ketua Kelompok Kerja Kepala Madrasah (K3M) tingkat MI se-Kota Langsa, Muzakkir, SPdI kepada Waspada mengatakan, kegiatan itu dapat terlakasana atas kerjasama pihaknya dengan para kepala MI. Dalam pelaksanaan itu, katanya, dilakukan persis seperti UAN baik lembaran soal maupun cara menjawab tidak ada bedanya dengan UAN nanti.

Para guru yang ditugaskan untuk menjadi pengawas juga dilakukan secara secara silang, sistem penomoran tempat duduk dan tata tertib lainnya pun persis seperti UAN. Hal itu dilakukan persis dengan UAN sesungguhnya, katanya, agar anak-anak tidakmengalami kesulitan ketika nantinya menghadapi UAN yang sebenarnya. Try out ini merupakan yang pertama kali dilakukan tahun ini, rencananya setelah diketahui hasilnya akan dilakukan sekali lagi untuk penyempurnaan. Untuk memotavasi anakanak kepada para peserta try out juga disediakan sejumlah hadiah, baik hadiah menurut masingmasing sekolah maupun hadiah secara umum.(b20)

Jalan Gampong Keunee Belum Pernah Diaspal SIGLI (Waspada) : Sejak Indonesia Merdeka, sepanjang tiga kilometer jalan Keunee yang melintasi lima gampong hingga kini belum pernah terjamah aspal sehingga membuat warga yang tinggal di kawasan itu belum bisa menikmati mulusnya jalan melintasi desa mereka. “Padahal jalan utama Usaha Tani (UT) ini menghubungkan lima desa di pedalaman Kecamatan Geumpang. Selain itu jalan ini juga sarana utama bagi warga setempat untuk mengeluarkan hasil komoditi pertanian dan kebun ke Pasar Geumpang,“ ujar beberapa tokoh masyarakat setempat, Minggu (18/3). Sepanjang tiga kilometer Jalan Usaha Tani itu hingga kini rusak yang melintasi kawasan Gampong Keunee, Lutueng, Blang Dalam, Lupueng dan Gampong Bangkeh. Warga yang sehari-hari berprofesi sebagai petani sulit meng-

Doni Penjaja Mainan Tradisional

SIANG itu, di bawah teriknya pancaran sinar matahari, seorang pria menjinjing beban bawaan dipundaknya sedang berlari kecil seiring gerak bayangan mengikuti langkahnya.

WASPADA Senin 19 Maret 2012

angkut hasil bumi, apalagi di musim penghujan jalan menjadi lincin dan berdebu ketika kemarau. “Kondisi ini sudah berlangsung lama, puluhan tahun karena sejak saya kecil hingga sekarang, kami tidak pernah merasakan jalan aspal di desa kami ini. Padahal, sejak ruas jalan tersebut berlubang banyak memakan korban dalam insiden kecelakaan, tapi belum ada perhatian dari pemerintah daerah,“ kata mereka prihatin. Camat Geumpang Saiful Zuhri mengatakan, selama 67 tahun Indonesia Merdeka, jalan di Gampong Keunee belum pernah terjamah aspal. Jalan menghubungkan Gampong Lutueng- Blang Dalam- Lupueng- dan Bangkeh, kondisinya sangat memprihatinkan. Warga kesulitan mengangkut hasil alam lebih-lebih ketika musim hujan. (b09)

Polisi Kembangkan Kasus Tertangkapnya Pengedar Ganja Waspada/Zainuddin Abdullah

DONI (berkemeja petak) melayani seorang ayah yang membeli sebuah mainan tradisional untuk putrinya di Jalan Merdeka, Kecamatan Banda Sakti, Lhokseumawe, Jumat (16/3). barang tradisional yang terbuat dari bambu hasil kerajinan tangan orang di Kota Medan,” papar Doni. Sedangkan harga jualnya juga bervariasi dan relatif murah, serta terjangkau dengan daya beli masyarakat lapisan menengah ke bawah. Harga pun beragam, tergantung bentuk mainan yang diminta, berkisar antara Rp2.000 hingga Rp30 ribu untuk tiap jenis mainan.

Doni mengaku sudah hampir dua bulan menjajakan mainan ini dari Kota Medan, hingga sekarang berada di Kota Lhokseumawe yang berjulukan kota Petro Dolar. Julukan kota setempat juga yang membuat penasaran hingga membawa Doni bisa memasuki wilayah Aceh guna mencari peminat mainan klasik. “Saya pikir Kota Petro Dolar itu bermakna daerah yang

banyak orang kaya dolar tanpa rupiah. Ternyata Lhokseumawe tidak jauh beda dengan Medan karena sama-sama masih pakai rupiah,” papar Doni melawak. Doni sangat gigih dalam mengais rezeki dari usaha yang bermodal kecil, karena yakin masih ada penggemar mainan tradisional yang menunggu kehadirannya. Zainuddin Abdullah

PEUDAWA (Waspada) : Pasca ditangkapnya seorang pengedar ganja di Kota Idi, jajaran Satuan Narkoba Polres Aceh Timur bersama Polsek Idi Rayeuk masih terus mengembangkan kasusnya. “Kita menduga tersangka MR bin MD memiliki jaringan yang lebih luas, karena ganja yang kita temukan tidak mencapai 1 kilogram di rumah tersangka pekan lalu,” ungkap Kapolres Aceh Timur AKBP Iwan Eka Putra melalui Kasat Narkoba Iptu Agus Sunandar, Minggu (18/3). Dia menjelaskan, penangkapan tersangka berawal dari informasi masyarakat bahwa di rumah tersangka di Desa Tanoh Anoe, Kecamatan Idi Rayeuk kerap didatangi pria-pria luar Idi Rayeuk. Mendapat laporan, petugas melalukan pengintaian, namun beberapa kali diintai aksi korban tidak terkuak, sebab dugaan polisi kedatangan petugas tercium tersangka.

“Tapi penggerebekan kali ini berhasil kita ungkap, dari tangan tersangka kita temukan 1 kilogram ganja kering. Bahkan di hadapan polisi tersangka mengaku memiliki jaringan di Idi Rayeuk,” kata Agus Sunandar seraya menambahkan, berdasarkan pengakuan tersangka sehingga polisi akan mengembangkan kasus tersebut untuk menangkap sejumlah pengedar lainnya di Idi dan sekitarnya. Sebagaimana diketahui, Mr bin Md, 34, warga Desa Tanoh Anoe, Kecamatan Idi Rayeuk ditangkap dalam sebuah penggerebekan khusus yang dilancarkan personel Opsnal Polres Aceh Timur, Jumat (16/3) dini hari. Tersangka Mr bin Md tidak melakukan perlawanan, karena polisi menemukan bungkusan ganja yang dibalut dengan kantong plastik di bawah tempat tidur tersangka di rumahnya. Kini tersangka masih mendekam di sel Polres Aceh Timur. (b24)

Waspada, Senin 19 Maret 2012  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you