Page 1

Berastagi 19-300C

R. Prapat 25-330C

Parapat 19-29 0C

P. Siantar 18-280C

Sibolga 22-33 0C


Hujan guntur

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Senin Medan 23-320C

BMKG Polonia

SENIN, Wage, 16 Mei 2011/12 Jumadil Akhir 1432 H

No: 23508 Tahun Ke-65

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: Rp2.500,-

Israel Tembaki Pemrotes Palestina

Survei: Orba Lebih Baik

JERUSALEM (Waspada): Ketegangan yang menjurus kepada intifada baru terjadi di sekitar perbatasan Israel dengan beberapa negara tetangganya Minggu (15/5) untuk menandai hari ‘Nakba’ atau ‘Bencana,’ ketika pembentukan negara Israel tahun 1948 lalu. Ketegangan itu makin memuncak ketika pasukan Israel melepaskan tembakan ke arah pemrotes di lintasan perbatasan wilayah Palestina, Syria dan Lebanon. Laporan yang belum mendapat konfirmasi mengatakan beberapa orang tewas dan puluhan lainnya cedera dalam bentrokan itu. Sekurang-kurangnya 45 warga Palestina cedera ketika pasukan Israel menembaki satu kelompok dekat Erez yang menyeberang di Gaza, kata paramedis. Warga Palestina menandai ‘Nakba’ atau ‘Bencana, sebutan mereka pada pendirian

JAKARTA (Waspada): Survei nasional Indo Barometer bertajuk “Evaluasi 13 Tahun Reformasi dan 18 Bulan Pemerintahan SBY-Boediono” menunjukkan, 40,9 persen responden mempersepsikan bahwa Orde Baru lebih baik dibandingkan Orde Lama maupun Orde Reformasi. Hanya setengahnya atau 22,8 persen responden yang mengatakan bahwa Orde Reformasi lebih baik dibandingkan periode lainnya. Hasil survei ini dipaparkan Direktur Eksekutif Indo Barometer M. Qodari kepada wartawan di Jakarta, Minggu (15/5). Ia mengatakan, hasil ini merupakan pukulan bagi semua pihak yang menganggap reformasi sebagai momentum perubahan. “Ini ironi yang menunjukkan bagaimana rezim (Orba) yang ingin dikoreksi justru dipandang lebih baik,” katanya.

Lanjut ke hal A2 kol. 1

NAYEZ Muhammad (baju orange) dan Fazel Rahman (baju hijau), terdakwa pembom bunuh diri Afghanistan yang ditahan di Pusat Rehabilitasi Anak di Kabul, Afghanistan.


Lanjut ke hal A2 kol. 1

Anak-anak Direkrut Untuk Jihad Dibawa Dari Pakistan, Ditangkap Di Afghanistan

KABUL, Afghanistan (Daily Telegraph): Pemberontak Taliban diketahui telah merekrut anakanak untuk menjadi pelaku bom bunuhdiri di Afghanistan. Demikian suratkabar The Daily Telegraph memberitakan di situsnya, mengutip dari kantor berita AP, Minggu (15/5).

Anak-anak tersebut dibawa masuk ke Afghanistan dari Pakistan, diawali dari perintah guru agama kepada muridnya dengan mengatakan: pergilah ke Pakistan, pakai rompi bunuhdiri, bunuh pasukan asing dan kalian akan masuk surga. Dengan bekal itu, Ghulam

Farooq yang berusia sembilan tahun meninggalkan rumahnya di Pakistan bersama tiga orang anak lainnya calon pelaku pengeboman dan mereka menuju ke timur Afghanistan. Mereka diberitahu di sana ada dua anggota Taliban yang menunggu mereka di batas pe-

nyeberangan Torkham di provinsi Nangarhar. Namun sebaliknya, para anggota dinas intelijen Afghanistan yang telah diberi informasi mengenai rencana anak laki-laki itu menangkap mereka di perbatasan. “Mullah kami memberitahu kami bahwa bila

kami melakukan serangan bunuhdiri, semua orang di sekitar kami akan mati, namun kami akan tetap hidup,” kata Farooq yang mengatakan hal itu dengan lugunya pada hari Sabtu, sambil duduk di fasilitas tahanan anak-anak di Kabul. Dia merupakan salah satu

dari lima tersangka pengebom bunuhdiri — semuanya remaja laki-laki atau bahkan lebih muda lagi — yang telah dihadapkan oleh dinas intelijen Afghanistan ke depan para wartawan, jurufoto dan jurukamera pada satu temu pers 7 Mei dalam usaha mengubah

opini publik terhadap Taliban. Farooq dan anak lainnya ditahan di satu fasilitas tahanan yang menyerupai sebuah pusat pelatihan kejuruan. Tidak ada pengawal bersenjata di sana dan fasilitas itu Lanjut ke hal A2 kol. 6

Siswa MA Di Sumut Lulus 99.787 Persen Di Medan Tak Lulus 10 Orang MEDAN (Waspada) : 99.787 Persen dari 18.672 siswa Madrasah Aliyah (MA) di Sumatera Utara lulus Ujian Nasional (UN) tahun 2010/2011, sedangkan siswa tidak lulus 0,213 persen atau 40 siswa dari jumlah peserta UN 18.712 siswa. Untuk jurusan agama dinyatakan lulus 100 persen. Demikian disampaikan Antara

TERORIS SUKOHARJO: Kadiv Humas Mabes Polri Irjen (Pol) Anton Bachrul Alam menunjukkan dua foto terduga teroris Sukoharjo yakni Sigit Qurdowi (kanan), dan Hendro Yunianto di Mabes Polri, Jakarta, Minggu (15/5). Mereka tewas dalam sebuah penggerebekan.

Istri Anggota DPRD Sumut Diduga Tipu 15 Pelamar CPNS MEDAN (Waspada): Dua dari 15 orang mengadukan YS, 35, istri seorang anggota DPRD Sumut ke Polsekta Medan Helvetia, Minggu (15/5) sore, dalam kasus dugaan penipuan untuk menjadi CPNS. Kedua korban penipuan CPNS bernama Ardi Wiranata Surbakti, 19, penduduk Namu Ukur Selatan, Sei Bingai, Kab. Langkat, dan Donion M. Sima-

mora, 32, penduduk Jln. Kemiri Ujung, Tanjunggusta Deliserdang. Korban lainnya akan menyusul membuat pengaduan yang sama. Korban Ardi Wiranata didampingi penasehat hukumnya Lani Gustina, SH, dari Advokad Lukman Hakim dan bibiknya Arfian Jannah, kepada Waspada mengatakan, YS, 35, selaku kepala sekolah yaya-

san Al ‘M’ telah menipu dan menggelapkan uang miliknya dengan modus bisa memasukkan menjadi PNS di Pemko Medan dan Lapas Sumut dengan cara penyisipan. 22 September 2010, Ardi Wiranata Surbakti bersama bibiknya seorang guru bernama Arfian Jannah, 34, dan Lanjut ke hal A2 kol. 3

Pengumuman Jalur Undangan 18 Mei MEDAN (Waspada): Sebanyak 10.284 peserta calon mahasiswa telah melakukan pembayaran biaya pendaftaran ujian Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) ke Panitia Lokal (Panlok) Universitas Sumatera Utara (USU). Dari jumlah tersebut, 5.997 peserta sudah melakukan pendaftaran secara online dan 4.287 masih akan melakukan pendaftaran. Demikian disampaikan Ketua Panitia Lokal (Panlok) SNMPTN USU Prof. Ir. Zulkifli Nasution, M.Sc, Ph.D dan Pe-

nanggung Jawab Sosialisasi Prof. Dr. Ningrum Natsya Sirait, SH, MLI melalui Ka. Humas USU Bisru Hafi, S.Sos, M.Si, kemarin. Bisru menyebutkan, rincian jumlah peserta yang telah melakukan pendafataran online pada situs untuk Panlok USU berdasarkan kelompok ujiannya yaitu, untuk kelompok IPA 1.564 (lulusan 2009 & 2010), dan 454 orang (lulusan 2011), dengan jumlah pendaftar kelompok IPA sebanyak 2.018 orang. Lanjut ke hal A2 kol. 3


SEJUMLAH penumpang bus antar kota dalam provinsi bergegas keluar dari lokasi kejadian, menyusul tabrakan bus dengan mobil Avanza, di Jl. Medan-Lubuk Pakam, Minggu (15/5).

Bus Sejahtera-Avanza Tabrakan Di T. Morawa MEDAN (Antara): Sebelas orang luka-luka ketika bus angkutan umum “Sejahtera” yang datang dari arah Tebingtinggi bertabrakan dengan sebuah mobil Toyota Avanza di jalan lintas Sumatera Medan-Tanjungmorawa, tepatnya di Dusun 2 Desa Perdamaian, Kab. Deli Serdang, Minggu(15/5) sore. Para korban yakni tiga

orang penumpang Avanza dan delapan orang penumpang ‘Sejahtera’. Kabid Humas Polda Sumut AKBP Heru Prakoso yang dihubungi Minggu malam, membenarkan.’’ Akibat kecelakaan tersebut, 11 penumpang dari kedua kendaraan itu mengalami luka-luka,’’ katanya. Lanjut ke hal A2 kol. 1

Oleh: Prof Dr Syahrin Harahap, MA Tidak ada satu pun kebaikan yang dilakukan manusia yang luput dari catatan besar dan neraca kehidupan, dan tidak ada satu pun kejahatan yang lolos dari catatan kegiatan yang dikerjakan oleh auditor universal, Raqib dan ‘Atid. (Q.S. 17/al-Isra’: 13; 50/Qaf: 18).


DANIEL Perret menunjukkan koin China yang ditemukan di Kel. Danau Siombak, Medan Marelan, Sabtu (14/5).

Ribuan Benda Kuno Ditemukan Di Kota China MEDAN (Waspada): Ribuan benda kuno ditemukan di Situs Kota China dalam sebuah penelitian dan ekskavasi (penggalian arkeologi yang digelar selama tiga minggu oleh Ecole Francaise d’Extreme Orient (EFEO) Perancis.

Lanjut ke hal A2 kol. 3

MULAI hari ini, Senin 9 Mei selama sebulan, Harian Waspada menerbitkan polling pembaca terkait Pilkada Gubernur Aceh. Masyarakat Aceh dapat mengirim suaranya melalui polling ini dengan mengisi dan menggunting polling di atas serta mengirimkannya via pos/mengantar langsung ke Redaksi Harian Waspada Jl. Brigjend Katamso No. 1 Medan 20151 sebelum 10 Juni 2011. Ku p o n b e r h a d i a h diundi 1 Juli 2011. Hadiah Pertama Rp. 2.000.000 Hadiah Kedua Rp. 1.500.000 Hadiah Ketiga Rp. 1.000.000 Hadiah Keempat Rp. 500.000 Hadiah Kelima Rp. 500.000 Kupon polling di halaman A2.

Ada-ada Saja

Usia 101 Baru Berpolitik “TIDAK ada kata terlambat,” mungkin adalah salah satu falasafah yang dianut wanita bernama Josefine Villaverde. Nenek asal Spanyol ini tak ragu meluncurkan karir politiknya di usia 101 tahun. Ia akan bertarung sebagai calon Partai Sosialis di Cuntis, Desa Galicia di bagian baratlaut Spanyol, dalam pemilihan tingkat kotapraja pada 22 Mei mendatang. Villaverde, yang dilahirkan pada 19 November 1909, siap dan antusias. Ia mencari dukungan di jalan-jalan di kota kecil tempat tinggalnya dan mengumbar janji kampanye

Polling Pemilihan Gubernur Aceh

Dosa Dan Kegelisahan

Lanjut ke hal A2 kol. 6

Lanjut ke hal A2 kol. 6

Jumlah Pendaftar SNMPTN USU 10.284


SEMUA kejahatan yang kita rahasiakan, semua transaksi ilegal yang kita hanguskan, meskipun lolos dari penyelidikan, pemantauan, dan pengetahuan manusia, akan tetap diperhitungkan, dan hasil akhir perhitungan itu akan kita terima di hari pengadilan, suatu pengadilan yang bebas dari pengaruh kolusi dan tebang pilih (yaum al-mahsyar/ yaum al-hisab).

Kepala Kementerian Agama Wilayah Provinsi Sumatera Utara, Drs H Syariful Mahya Bandar MAP, dan Kabid Mapenda Drs H Yulizar MAg, Kasi Supervisi dan Evaluasi Khairul Amani dan Humas Drs Khairul Syam di Asrama Haji Medan, Minggu (15/5).

Waspada/Hasriwal AS

ABU Rizal Bakrie berdialog dengan Syamsul Arifin di Rutan Salemba, Sabtu (14/5) malam

Ical Minta Syamsul Tetap Di Garda Depan Golkar JAKARTA (Waspada) : Ketua Umum DPP Partai Golkar Abu Rizal Bakrie meminta, ketua DPW Sumut Golkar (non aktif) Syamsul Arifin tidak meninggalkan partai, dan tetap memberikan konstribusi pada partai berlambang pohon beringin itu. Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 2

erampang Seramp ang - Terlalu lembek pun salah - He...he...he...

Soeharto, Presiden Yang Paling Disukai Publik JAKARTA ( Waspada): Survei membuktikan, Soeharto adalah Presiden yang paling banyak disukai masyarakat Indonesia. Soeharto juga Presiden yang dianggap paling berhasil. Demikian survei yang dilakukan Indo Barometer, sebuah lembaga survei nanet sional. Direktur Indobarometer, M Qodari, merilis hasil survei tersebut di Jakarta, Minggu (15/5). Survei ini merupakan salah satu bagian dari hasil survei tingkat nasional bertajuk “Evaluasi 13 Tahun Reformasi dan 18 Bulan Pemerintahan SBY-Boediono”, yang dilaksanakan pada 25 April-4 Mei 2011. Dari survei yang melibatkan 1.200 orang, sebanyak 36,5 persen responden memilih almarhum mantan Presiden Soeharto sebagai presiden yang paling disukai. Selanjutnya, 20,9 persen memilih Presiden Susilo Bambang Yudhoyono, 9,8 persen memilih almarhum mantan Lanjut ke hal A2 kol 7

WASPADA Demi Kebenaran Dan Keadilan

SENIN, Wage, 16 Mei 2011/12 Jumadil Akhir 1432 H z No: 23508 * Tahun Ke-65

ISSN: 0215-3017

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

HUT Israel Dianggap Hari Bencana Di Palestina Sejumlah Pemprotes Tewas Dan Luka

Tingkat Kepuasan Publik Terhadap SBY-Boediono Di Bawah 50 Persen

Lanjut ke hal A2 kol 1

Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999)

Survei: Orba Lebih Baik JAKARTA (Waspada): Survei nasional Indo Barometer bertajuk “Evaluasi 13 Tahun Reformasi dan 18 Bulan Pemerintahan SBY-Boediono” menunjukkan, 40,9 persen responden mempersepsikan bahwa Orde Baru lebih baik dibandingkan Orde Lama maupun Orde Reformasi. Hanya setengahnya atau 22,8 persen responden yang mengatakan bahwa Orde Reformasi lebih baik dibandingkan periode lainnya. Hasil survei ini dipaparkan Direktur Eksekutif Indo Barometer M. Qodari kepada wartawan di Jakarta, Minggu (15/5). Ia mengatakan, hasil ini merupakan pukulan bagi semua pihak yang menganggap reformasi sebagai momentum perubahan. “Ini ironi yang menunjukkan bagaimana rezim (Orba) yang ingin dikoreksi justru dipandang lebih baik,” katanya. Hasil survei memperlihatkan, publik mempersepsikan Orba lebih baik di bidang politik, ekonomi, sosial, dan keamanan. Orde Reformasi hanya unggul di bidang penegakan hukum. Di bidang politik, 33,3 persen responden mempersepsikan Orba lebih baik. Sementara itu, hanya

Harian Umum Nasional Terbit Sejak 11 Januari 1947

Reuters TENTARA Israel dan polisi perbatasan menahan seorang pemrotes Palestina dalam satu rapat umum menandai ‘Nakba’ di desa Wallaje, dekat Bethlehem, Tepi Barat, Minggu (15/5). Pasukan keamanan Israel telah disiagakan karena adanya kekerasan Minggu, hari yang diperingati Palestina sebagai ‘Nakba’ atau ‘Bencana’ untuk memperingati pengusiran atau pelarian kirakira 700.000 warga Palestina dari rumah mereka dalam perang yang menyebabkan berdirinya negara Israel tahun 1948.

RAMALAH (Waspada): Ribuan warga Palestina dan aktivis berkumpul di berbagai wilayah untuk memperingati hari Nakba atau hari bencana, hari lahirnya negara Israel. Berbagai bentrokan antara para aktivis dengan tentara Israel mewarnai peringatan ini. Dilansir dari laman Aljazeera, Minggu (15/5), konsentrasi massa terbesar terjadi dekat kamp pengungsi di Qalandiya, dekat gerbang masuk Tepi Barat dari Israel. Kendati para aktivis menyerukan demonstrasi damai, namun kericuhan sempat terjadi saat tentara Israel menembakkan gas air mata ke arah demonstran. Kericuhan kecil juga sempat terjadi di beberapa daerah di Jerusalem Timur saat warga melempari tentara Israel dengan batu. Tindakan ini mereka lakukan karena tentara Israel menutup akses masuk menuju Masjid al-Aqsa. Belum dilaporkan adanya korban luka akibat insiden ini. Di Gaza, aksi memperingati hari Nakba diikuti oleh puluhan seniman d bawah bendera Serikat Seniman Palestina. Mereka mengibarkan bendera Palestina, membawa banner dan menyerukan slogan-slogan persatuan Palestina. Para seniman juga melakukan aksi teatrikal menunjukkan penderitaan warga Palestina setelah Israel terbentuk. Beberapa lainnya menggambar tembok perbatasan dengan gambargambar perjuangan. “Kami datang untuk memperkuat persatuan nasional Palestina dan untuk memberitahukan kepada dunia bahwa kami berhak untuk kembali (Ke tanah Palestina yang dicaplok Israel), yang merupakan hak suci dan kami tidak akan mundur,” ujar Sa’eed Kurayem, ketua serikat Seniman Palestina, dilansir dari laman Xinhua. Kurayem juga mengatakan bahwa warga Palestina akan Lanjut ke hal A2 kol 7

1.821 Siswa Tak Lulus Di Aceh Di Sumut, Siswa MA Tak Lulus 0,213 %

BANDA ACEH (Waspada): Hari ini (Senin, 16/5) hasil Ujian Nasional (UN) tahun 2011 untuk tingkat SMA/MA dan SMK diumumkan. Dari 63.021 siswa peserta UN SMA/MA/SMK di Aceh, 1.821 tidak lulus.

Kemdiknas: 99,22 Persen UN SMA/MA Lulus JAKARTA (Waspada): Kementerian Pendidikan Nasional (Kemdiknas) membeberkan, secara keseluruhan prosentase hasil kelulusan pada satuan pendidikan SMA/MA pada tahun ajaran 2010-1011 mengalami kenaikan dibandingkan dengan tahun ajaran sebelumnya. Dari seluruh 1.461.941 peserta UN SMA/MA, 1.450.498 atau 99,22 persen siswa lulus, sementara 11.443 atau 0,78 persen siswa lainnya dinya-

takan tidak lulus. Pada tahun ajaran sebelumnya (2009-2010), dari 1.522.195 peserta yang mengikuti ujian nasional, yang lulus hanya 1.368.938 atau 89,93 persen, dan 153.257 atau sama dengan 10,07 persen lainnya tidak lulus. Merujuk pada data di atas, hasil kelulusan nasional satuan pendidikan SMA mengalami kenaikan sekitar lebih dari sembilan persen. Lanjut ke hal A2 kol 7

Jumlah Pendaftar SNMPTN USU 10.284 Pengumuman Jalur Undangan 18 Mei MEDAN (Waspada): Sebanyak 10.284 peserta calon mahasiswa telah melakukan pembayaran biaya pendaftaran ujian Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) ke Panitia Lokal (Panlok) Universitas Sumatera Utara (USU). Dari jumlah tersebut, 5.997 peserta sudah melakukan pendaftaran secara online dan 4.287 masih akan melakukan pendaftaran.

Demikian disampaikan Ketua Panitia Lokal (Panlok) SNMPTN USU Prof. Ir. Zulkifli Nasution, M.Sc, Ph.D dan Penanggung Jawab Sosialisasi Prof. Dr. Ningrum Natsya Sirait, SH, MLI melalui Ka. Humas USU Bisru Hafi, S.Sos, M.Si, kemarin. Bisru menyebutkan, rincian jumlah peserta yang telah Lanjut ke hal A2 kol 5

Ketua Panitia Pelaksana UN 2011 Aceh, Drs. As’ari, M.Pd kepada wartawan, Minggu (15/5) di Banda Aceh menyebutkan hasil UN 2011 untuk tingkat SMA/MA/SMALB dan SMK diumumkan di se-

kolah masing-masing di seluruh Aceh, Senin (16/5). As’ari menyebutkan jumlah peserta UN tahun 2011 untuk tingkat SMA/MA/SMALB dan SMK 63.021 siswa. Persentase kelulusan untuk Aceh menca-

pai 97,11 persen atau 61.200 siswa dan yang tidak lulus hanya 2,89 persen atau 1.821 siswa. Ketua Panitia UN Aceh yang juga Kabid Dikdas pada Dinas Pendidikan Aceh ini merinci, tingkat kelulusan SMA/MA

jurusan IPA 98,37 persen, IPS 94,40 persen, Bahasa 98,18 persen dan SMK 96,32 persen. Namun As’ari belum mengungkap lebih rinci menyangkut tingkat kelulusan hasil UN tahun 2011 untuk

tingkat SMA/MA/SMALB dan SMK di Aceh, dibanding hasil UN tahun 2010. Peserta UN 2011 untuk tingkat SMA/MA/SMALB dan SMK di Aceh diikuti 64. 146 siswa, masing-masing SMA/

MEDAN (Antara): Pengamat politik Ahmad Taufan Damanik menilai, semangat pemekaran Provinsi Sumatera Utara yang dewasa ini sedang diusung para penggagas dapat menjadi sesuatu yang berbahaya. “Kita lihat semangatnya masih `pokok mekar` dan ini berbahaya, apalagi terlalu banyak aturan yang tidak dipenuhi,” ujar pengamat dari Universitas Sumatera Utara (USU) itu di Medan, Minggu (15/5).

JAKARTA (Waspada): Staf Khusus Presiden bidang Bantuan Sosial dan Bencana Andi Arief mengaku sangat sulit meyakinkan masyarakat bahwa ada potensi gempa 8,7 Skala Richter (SR) di ibu kota Jakarta. Termasuk meyakinkan Gubernur DKI Jakarta, Fauzi Bowo akan temuan hasil penelitian itu. “Tapi sekarang Fauzi Bowo sudah mulai meyakini hasil penelitian ahli gempa itu. Kini dia telah melakukan mikro zonasi,” kata Andi Arief dalam diskusi bertajuk ‘Bencana dan Sejarah Indonesia’ di Restoran Warung Daun, Cikini, Jakarta, Minggu, (15/5). Dalam kesempatan itu, Andi pun menampik penilaian banyak pihak mengenai ketidaksiapan Jakarta jika dilanda gempa. Mantan aktivis Solidaritas Mahasiswa Indonesia Untuk Demokrasi ini mengaku kini Jakarta sudah semakin meningkatkan persiapan dalam menghadapi kemungkinan bencana

SEORANG pejalan kaki terlihat sedang menggunakan kertas untuk menaungi kepalanya agar terhindar dari terik matahari.

Lanjut ke hal A2 kol 7

Lanjut ke hal A2 kol 7

Waspada/Sori Parlah Harahap

Cuaca Panas, Warga Diminta Waspadai Kebakaran GUNUNGTUA (Waspada) : Selama tiga hari terakhir, cuaca di wilayah Kabupaten Padanglawas Utara sungguh tidak bersahabat. Setiap harinya cuaca selalu panas baik malam dan sore hari. Udara yang cenderung panas dalam beberapa hari terakhir itu seakan menandakan musim kemarau segara tiba. “Oleh karena itu, diminta kepada masyarakat agar tetap mewaspadainya,” kata Kabag Humas Pe-

merintah Kabupaten Padanglawas Utara Abdul Majid Siregar, Minggu (15/5) di Gunungtua. Dikatakannya, cuaca yang panas seperti ini, warga harus menjaga lingkungan karena kemarau sangat rentan dengan bahaya kebakaran. “Kondisi cuaca seperti saat ini bisa mengakibatkan terjadinya kebakan,

BEKASI (Antara): Wakil Presiden Boediono mengatakan bangsa Indonesia saat ini tengah menghadapi tantangan yang tidak ringan, yakni arus globalisasi dan gerakan kelompok radikal yang mengancam eksistensi bangsa. “Selain arus globalisasi yang luar biasa, kita juga harus menghadapi gerakan kelompok radikal yang masih mengancam, eksistensi bangsa kita,” kata Boediono di Bekasi, Ming-

Memulai Karir Politik Di Usia 101

Jangan Sedih Oleh: H. Ameer Hamzah Engkau tak harus mengetuk pintu untuk meminta Ketika orang tak mau memberi garam dan sepotong roti Sebab kekikiran itu berasal dari uang yang haram Kalau uang yang halal, manusia tidak kikir

Waspada/Abdul Mukthi Hasan

KBO Sat Reskrim Polres Bireuen, Ipda Elisa Maharani, SE bersama anggota mengapit sopir dan kernet truk Hercules yang mengangkut 93 batang kayu ilegal jenis KRC di Mapolres, Minggu (15/5).

Polisi Tangkap Truk Angkut Illegal Logging

CUNTIS, Spanyol (Waspada): “Tidak ada kata terlambat,” mungkin adalah salah satu falasafah yang dianut wanita bernama Josefine Villaverde. Nenek asal Spanyol ini tak ragu meluncurkan karir politiknya di usia 101 tahun. Ia akan bertarung sebagai calon Partai Sosialis di Cuntis, Desa Galicia di bagian barat-laut Spanyol, dalam pemilihan tingkat kotapraja pada 22 Mei mendatang. Villaverde, yang dilahirkan pada 19 November 1909, siap Lanjut ke hal A2 kol 7

DPRD Sumut menyetujui usulan pembentukan tiga provinsi baru yang masing-masing adalah Provinsi Tapanuli, Provinsi Sumatera Tenggara dan Provinsi Kepulauan Nias melalui rapat paripurna di Medan, 9 Mei lalu. Dari 10 fraksi di DPRD setempat, tujuh fraksi mendukung, dua fraksi menolak memberikan pendapat dan satu fraksi lainnya menyatakan tidak keberatan. Lanjut ke hal A2 kol 1

Kelompok Radikal Masih Mengancam

Ada-ada Saja

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 4

Pemekaran Sumut Bisa Berbahaya

Jakarta Berpotensi Gempa 8,7 SR

Al Bayan

DALAM buku La Tahzan, DR. ‘Aidh Al-Qarni mengajak kita untuk jangan bersedih dalam berbagai hal. Sebab di balik cobaan hidup itu bertabur hikmah yang membawa kenikmatan. Untuk apa bersedih? Bukankah matahari masih terbit di sebelah timur? Selama matahari mengerwah sinarnya, harapan selalu ada. Energi datang bersama matahari.

MA/SMALB 54.206 siswa dan SMK 9.940 siswa. Di Sumut Sebanyak 18.712 siswa Madrasah Aliyah (MA) di


Dr. Daniel Perret menunjukkan beberapa jenis benda kuno berupa pecahan keramik dan gerabah yang ditemukan di sebuah kotak penggalian di kawasan Kelurahan Danau Siombak, Medan Marelan, Sabtu (14/5).

Ribuan Benda Kuno Ditemukan Di Kota China

BIREUEN (Waspada): Tim Opsnal Polres Bireuen menangkap dan mengamankan satu dump-truk Colt Diesel jenis Hercules yang diduga kuat mengangkut sekitar 93 batang Kayu Rimba Campuran (KRC) berbagai jenis dan

MEDAN (Waspada): Ribuan benda kuno ditemukan di Situs Kota China dalam sebuah penelitian dan ekskavasi (penggalian arkeologi yang digelar selama tiga minggu

Lanjut ke hal A2 kol 7

Lanjut ke hal A2 kol 4

gu, (15/5) pada pembukaan Seminar Internasional dalam rangka Tasyakur Milad Badan Kontak Majelis Taklim (BKMT) ke-30 Universitas Islam As Syafi`iyah, Bekasi. Menurut Boediono, meski menghadapi tantangan berat, Indonesia patut bersyukur karena masih tetap eksis dan tegak berdiri hingga saat ini. “Tapi, itu hanya mungkin jika kita semua teguh melanjutkan kesepakatan para pendiri bangsa bahwa Indonesia adalah rumah bersama bagi seluruh rakyat tanpa memandang kelompok, suku, golongan, maupun agamanya,” katanya. Boediono berbangga pada BKMT yang telah mengedepankan pendidikan untuk umat dan saat ini telah berkembang pesat baik di dalam maupun luar negeri. Boediono menyatakan, Islam adalah agama yang menaruh perhatian terhadap ilmu pengetahuan dan menekankan pentingnya menuntut ilmu tanpa mengenal jenis kelamin, tempat dan usia.

Serampang - Terlalu cepat meng-oke-kan pemekaran... - He.... he....he....

Berita Utama

A2 Pemekaran...

Tujuh fraksi yang mendukung adalah dari Partai Demokrat, PDI Perjuangan, PAN, PDS, Hanura, PPRN dan Gerindra, dua fraksi yang menolak memberikan pendapat PKS dan PPP, sementara Partai Golkar menyatakan tidak keberatan. Dua fraksi yang menolak beralasan, usulan pembentukan ketiga provinsi baru itu belum memenuhi persyaratan sesuai Undang-Undang (UU) Nomor 32 Tahun 2004 tentang Pemerintahan Daerah dan Peraturan Pemerintah (PP) Nomor 78 Tahun 2007 tentang Tata Cara Pembentukan, Penghapusan dan Penggabungan Daerah. Pelaksana Tugas (Plt) Gubernur Sumut Gatot Pujonugroho pun hanya menyatakan akan menyampaikan rekomendasi ke pemerintah pusat menyusul persetujuan DPRD tersebut. Ahmad Taufan Damanik sendiri mengaku sangat sependapat dengan dua fraksi di DPRD Sumut yang menolak usulan pembentukan tiga provinsi baru tersebut. “Karena memang banyak yang tidak dipenuhi dan tidak prosedural sesuai PP 78/2007. Akibatnya, kini mulai bermunculan pro dan kontra, bahkan penolakan dari sejumlah daerah,” katanya. Ke depan, ia meyakini akan semakin banyak sikap menolak karena memang ada upaya-upaya untuk ‘menelikung‘ aturan yang ada. Ia menunjuk salah satu aspek yakni tidak adanya sama sekali kajian-kajian akademis terkait usulan pemekaran, seperti yang pernah dilakukan


29,6 persen responden yang mempersepsikan Orde Reformasi lebih baik. Di bidang ekonomi, 56,3 persen responden mempersepsikan Orba lebih baik. Sementara itu, hanya 20,3 persen responden yang mempersepsikan bahwa Orde Reformasi lebih baik. Di bidang keamanan, sebanyak 53,7 persen responden mengatakan, Orba lebih baik. Hanya 20,6 persen responden yang menganggap Orde Reformasi lebih baik. Sementara itu, di bidang hukum, 27,6 persen menganggap Orba lebih baik. Sementara itu, 34,3 persen responden menganggap Orde Reformasi lebih baik. Hasil survei yang melibatkan 1.200 responden secara nasional dan dilakukan pada tanggal 25 April-4 Mei 2011 ini menunjukkan, masyarakat yang tinggal di perkotaan lebih banyak yang mempersepsikan bahwa Orba lebih baik dibandingkan periode kepemimpinan lainnya, yaitu sebanyak 47,7 persen. Angka ini lebih tinggi 12 persen jika dibandingkan dengan persentase masyarakat pedesaan yang mempersepsikan Orba lebih baik, yaitu 35,7 persen. Dari tingkat pendidikan, seluruh jenjang pendidikan menyatakan bahwa Orba lebih baik. Namun, secara persentase, semakin tinggi tingkat pendidikan responden, tingkat kepuasan terhadap Orba semakin rendah. Cita-cita belum tercapai Menanggapi survei ini,

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Me7+, Gd7. 2. MxG+, Rb6. 3. a5+mat.

Jawaban TTS: TTS Topik







Jawaban Sudoku: 7 9 6 5 4 2 1 8 3

5 1 4 8 3 6 2 7 9

2 8 3 9 7 1 4 6 5

1 6 2 7 8 9 5 3 4

3 7 5 6 1 4 8 9 2

9 4 8 2 5 3 6 1 7

4 2 7 3 6 8 9 5 1

8 3 9 1 2 5 7 4 6

6 5 1 4 9 7 3 2 8

Pemerintah Provinsi Sumut semasa pemerintahan Gubernur Tengku Rizal Nurdin. Ia juga menilai DPRD dan Plt Gubernur Sumut cenderung “buang badan” dan hanya mencari aman melalui sikap menyetujui dan kemudian merekomendasikan ke pemerintah pusat. “Seharusnya Pemprov Sumut terlebih dahulu membuat kajian, membuat pertimbangan-pertimbangan, lalu memutuskan, apakah setuju atau tidak sebelum diteruskan ke pemerintah pusat. Kajian-kajian dan pertimbangan-pertimbangan itu jelas sangat dibutuhkan pemerintah pusat dalam membuat keputusan akhir,” jelasnya. Namun demikian, Ahmad Taufan Damanik tidak sepenuhnya menyalahkan sikap yang diambil Plt Gubernur Sumut, meski terkesan lari dari tanggung jawab. “Tapi setidaknya kita pantas malu karena kita kemudian menyerahkan segala sesuatunya ke pemerintah pusat, padahal kita dapat menentukan dan mengatur sendiri apa yang kita inginkan,” katanya. Perlu Dipikirkan Matang Sementara pengamat Hukum Universitas Sumatera Utara, Dr Pedastaren Tarigan, SH menyarankan, mengenai usulan pemekaran Provinsi Sumatera Utara menjadi tiga provinsi baru perlu dipertimbangkan secara matang, jangan nantinya menimbulkan masalah yang meresahkan masyarakat. “Pemekaran ini perlu dikaji ulang secara mendalam, untung dan ruginya bagi provinsi yang baru dibentuk tersebut,”

katanya menjawab Antara di Medan, Minggu (15/5). Hal itu dikatakan saat diminta komentarnya mengenai rencana pemekaran Provinsi Sumut menjadi tiga provinsi baru di daerah itu, yakni Provinsi Tapanuli, Provinsi Sumatera Tenggara dan Provinsi Kepulauan Nias. Pedastaren mengatakan, dalam pemekaran provinsi baru tersebut tidak hanya memikirkan faktor ekonomi atau menerima aspirasi masyarakat saja, tetapi juga harus dipertimbangkan dari mana biaya untuk itu diperoleh nantinya. Menurut dia, pembentukan provinsi baru itu, jelas akan mengeluarkan biaya yang tidak sedikit jumlahnya.Tentunya dana ini akan diambil dari dana APBD atau APBN. “Jadi, hal ini juga perlu juga dipikirkan, jangan hanya menuntut untuk pemekaran. Apalagi, dalam keadaan ekonomi saat ini yang benar-benar memprihatinkan, belum lagi kehidupan rakyat yang semakin susah,” kata Kepala Laboratorium Fakultas Hukum Universitas Sumatera Utara (USU) itu. Selanjutnya, dia mengatakan usulan pembentukan provinsi baru ini, dinilai sahsah saja, asalkan telah memenuhi persyaratan sesuai dengan ketentuan Undang-Undang Nomor 32 Tahun 2004 tentang Pemerintahan Daerah dan Peraturan Pemerintah (PP) Nomor 78 Tahun 2007 tentang Tata Cara Pembentukan, Penghapusan dan Penggabungan Daerah. Selain persyaratan yang telah mencukupi, tentunya

aktivis reformasi, Ray Rangkuti mengatakan, ada banyak citacita reformasi yang belum tercapai. “Ini kritikan bagi Orde Reformasi yang belum mampu memenuhi cita-cita di bidang penegakan hukum dan HAM, pemberantasan KKN, dan lainnya. Jika tidak ada perubahan, maka masa lalu yang kelam tetap menjadi impian setiap orang,” katanya. Penanggap lainnya, ekonom Faizal Basri, menyoroti tingginya angka masyarakat pedesaan yang mempersepsikan Orba lebih baik dibandingkan Orde Reformasi. Ada banyak penyebab mengapa hal itu terjadi. “Penurunan angka kemiskinan lebih lambat di desa dibandingkan di kota. Sejak era reformasi, sektor pertanian semakin amburadul karena harga pangan tak lagi ditopang. Bulog semakin tak berperan sementara mekanisme pasar semakin berjalan. Produk impor semakin membanjiri tanah air sehingga produk lokal tak dapat bersaing,” katanya. Tak hanya itu, sejak era reformasi, menurutnya, tak ada penambahan bendungan. Banyak saluran irigasi yang rusak namun tak diperbaiki. Era reformasi, kata Faisal, lebih banyak fokus pada pembangunan jalan tol dan bandara. “Presiden juga jarang turun ke desa-desa. Presiden hanya rapat dari istana ke istana. Atau paling tidak (rapat) di bandara. Sekalinya turun ke desa, salah. Ada sebuah foto di Setneg di mana Presiden menggulung celana panjangnya hingga ke lutut ketika hendak panen bersama. Beliau tidak tahu kalau padi itu tanaman yang membutuhkan air. Presiden juga menanam padi segepok-segepok. Seharunya menanam padi itu harus satu per satu. Padahal, beliau doktor dari IPB,” kata Faisal. Dibawah 50 Persen Survei nasional Indo Barometer mengenai “Evaluasi 13 Tahun Reformasi dan 18 Bulan Pemerintahan SBY-Boediono” juga menunjukkan, ki-

nerja SBY-Boediono di bidang ekonomi buruk. Dari 1.200 responden yang dilibatkan dalam survei nasional, hanya 41,2 persen saja yang mengaku puas dengan kinerja SBY-Boediono di bidang perekonomian. Sebanyak 55,8 persen responden mengaku tak puas, dan 3,1 persen lainnya memilih tak menjawab. Sementara itu, di bidang penegakan hukum, hanya 46,7 persen saja yang mengaku puas. Lalu, 47,8 persen responden mengaku tak puas. Sebanyak 5,5 persen responden memilih tak menjawab. “Tingkat kepuasan publik terhadap Presiden Susilo Bambang Yudhoyono (SBY) dan Wapres Boediono tembus di bawah 50 persen. Ini merupakan ‘lampu kuning’ untuk perbaikan kinerja pemerintahan SBY-Boediono. Apalagi jika melihat trend approval rating terhadap kinerja SBY-Boediono yang tak kunjung melonjak sejak Agustus 2010,” kata M Qodari. Qodari menjelaskan, pada Mei 2007, tingkat kepuasan publik terhadap pemerintahan SBY mencapai 50,3 persen. Angka ini sempat anjlok pada bulan Juni 2008 ketika SBY mengeluarkan kebijakan menaikkan harga BBM, yakni 36,5 persen. Namun, angka ini kembali melambung menjelang Pilpres 2009, yaitu mencapai 83,8 persen. Pada bulan Mei 2011, tingkat kepuasan publik terhadap pemerintahan SBY berada pada angka 48,9 persen. Qodari mengatakan, survei nasional ini menggunakan metode multistage random sampling untuk menghasilkan responden yang mewakili seluruh populasi publik dewasa Indonesia. Pengumpulan data dilakukan dengan cara wawancara tatap muka secara langsung dengan menggunakan kuesioner. Tingkat kepercayaan survei ini mencapai 95 persen dan margin of error sebesar +/ - 3,0 persen. (kps)


Bersabarlah menghadapi kemiskinan, sebab orang-orang miskin itu dilihat oleh Rasulullah (waktu Mikraj) paling banyak menjadi penghuni surga, tetapi ketika beliau menjenguk dalam neraka, yang paling banyak adalah si kaya dan perempuan. Menurut syarah hadits, si miskin banyak masuk surga karena kesabarannya di dunia, biar miskin tetapi kecukupan. Karena tidak banyak harta, maka tidak banyak penyelewengan. Sebaliknya si kaya kadang-kadang, menilep harta Allah, tidak bayar zakat, infaq dan sedekah. Si miskin tidak wajib zakat dan naik haji, si kaya wajib tetapi tidak melaksanakannya, lalu mati. Masuk neraka. Jangan bersedih bila anakanakmu tidak ada yang cantik, sebab kebiasaan orang-orang yang cantik rupa sering lupa diri, jadi penyanyi, artis alias selebriti yang mendedah aurat, semua itu haram hukumnya dan menjadi fitnah dunia. Setiap orang tua wajib mempertanggungjawabkan tentang pendidikan anaknya. Sedangkan anda yang tak punya anak gadis cantik, akan selamat dari fitnah dunia.

Saudaraku, himpitan ekonomi mungkin penyebab utama manusia bersedih, saat anak-anak meminta uang jajan. Selanjutnya tak ada ikan, gula dan mungkin juga beras di rumah. Jangan bersedih sebab anda masih punya sudara. Ceritakanlah pada sudaramu hal-hal yang sangat fatal itu, Insya Allah jalan keluarnya akan dipikirkan oleh saudarasaudaramu. Saudaramu itu adalah seluruh kaum muslimin. Jangan bersedih bila ceramah-ceramahmu kurang mendapat tempat di telinga orang-orang yang derkat denganmu, atau tulisan-tulisan dakwahmu kurang dibaca teman-temanmu, sebab cahaya matahari memang sering tidak berguna bagi makhluk yang dekat dengannya, tetapi cahaya matahari sangat berfanfaat bagi penduduk bumi yang jauh. Semua manusia di bumi membutuhkan energi matahari. Jangan bersedih bila hidupmu masih di bawah garis kemiskinan, bila dalam keluargamu belum ada mobil atau motor buat anak-anakmu.

juga perlu dipikirkan potensi yang dimiliki oleh provinsi baru itu, kesedian masyarakat dalam menerima pemekaran tersebut “Jangan nantinya setelah dibentuk provinsi baru, setelah beberapa tahun kemudian menghadapi masalah. Ini jelas harus dibahas dan perlu juga disosialisasikan secara luas hingga ke masyarakat yang berada di pedesaan,” ujar Pedastaren. Dia mengatakan, kalau hal ini sampai terjadi, jelas akan menimbulkan kekecewaan di kalangan masyarakat dan siapa nantinya yang akan disalahkan. “Jadi, mau tidak mau provinsi yang dimekarkan itu, tentunya akan bergabung lagi dengan provinsi induk (provinsi asal,red),” tegas staf pengajar bidang ilmu hukum di USU itu. Lebih jauh Pedastaren mengatakan, pemekaran tiga provinsi baru ini, juga dinilai cukup banyak, hal ini juga dapat memancing bagi daerah lainnya di tanah air untuk mencontoh Sumut. Provinsi lainnya juga akan beramai-ramai untuk memekarkan daerah mereka.Sumut kenapa bisa, dan daerah lainnya tentu akan diberikan pula kesempatan untuk mengusulkan pemekaran tersebut. “Hal ini tentunya, juga akan menimbulkan permasalahan bagi pemerintah pusat dan jangan sampai terjadi perbedaan atau pilih kasih,” katanya. Oleh karena itu, diharapkan Kementerian Dalam Negeri, DPR RI, pemangku kepentingan lainnya perlu ekstra hati-hati dan selektif dalam meloloskan provinsi baru ini, sehingga dikemudian hari tidak terjadi permasalahan. “Pemerintah Pusat perlu lebih arif dan bijaksana untuk menyetujui pemekaran dan pembentukan provinsi baru.Jangan karena hanya demi menerima aspirasi masyarakat, suatu saat justru rakyat yang menjadi korban,” kata Pedastaren.


melakukan pendafataran online pada situs www.snmptn. untuk Panlok USU berdasarkan kelompok ujian-nya yaitu, untuk kelompok IPA 1.564 (lulusan 2009 & 2010), dan 454 orang (lulusan 2011), dengan jumlah total pendaftar untuk kelompok IPA sebanyak 2.018 orang. Untuk kelompok IPS jumlah pendaftar sebanyak 1.559 (lulusan 2009 dan 2010), 380 orang (lulusan 2011), dengan jumlah total pendaftar untuk kelompok IPS sebanyak 1.939 orang. Sedangkan jumlah total pendaftar untuk kelompok IPC sebanyak 1.609 dengan rincian, 1.218 orang (lulusan 2009 dan 2010) dan 391 orang (lulusan 2011). Diperpanjang Bisru menyebutkan, Panitia Pelaksana SNMPTN Tahun 2011 memutuskan memperpanjang masa Pendaftaran SNMPTN jalur ujian tertulis bagi lulusan SMU/SMK/MA sederajat tahun 2009 dan 2010. Perpanjangan masa pendaftaran tersebut yaitu untuk masa Pembayaran di Bank Mandiri hingga 24 Mei 2011 pukul 12:00 WIB (sama bagi lulusan 2011), sedangkan masa pendaftaran online pada website juga diperpanjang sampai dengan tanggal 25 Mei 2011. Dijelaskannya, seyogianya masa pendaftaran untuk lulusan tahun 2009 dan 2010 tersebut berakhir pada 10 Mei lalu, namun berdasarkan surat Panitia SNMPTN 2011 dengan nomor 098/SNMPTN/2011 yang ditandatangani Prof. Dr. Ir. Herry Suhardiyanto, M.Sc selaku Ketua Panitia Pusat SNMPTN 2011 telah memutuskan memperpanjang masa pendaftaran bagi lulusan SMU sederajat tahun 2009 dan 2010 tersebut hingga 25 Mei 2011 dan masa pembayaran di Bank Mandiri ditutup pada 24 Mei pukul 12:00. Keputusan perpanjangan masa pendafatran SNMPTN jalur ujian tertulis untuk lulusan SMU sederajat tahun 2009 dan 2010 diambil setelah panitia pusat menindaklanjuti permohonan dari Panitia Lokal

(Panlok) Palembang, Palu, Kupang, Bengkulu, Solo, Aceh, Jayapura serta beberapa panlok lainnya berkenanaan dengan permohonan para panlok tersebut yang meminta masa pendaftaran bagi lulusan SMU/SMK/MA dan sederajat tahun 2009 dan 2010 dapat diperpanjang. Segera mendaftar Menyangkut pendaftaran SNMPTN ini, Ketua Panlok USU mengimbau kepada para calon peserta SNMPTN, untuk lebih cepat melakukan pembayaran dan pendaftaran. Jangan menunggu pada hari terakhir pendaftaran karena berdasarkan pengalaman sebelumnya dikhawatirkan bila terjadi penumpukan/kepadatan pendaftar menjelang hari terakhir akan dapat menganggu server di pusat data. Bila terjadi penumpukan/ kepadatan pendaftaran dikhawatirkan terjadi kemacetan server sehingga sulit untuk online tentu hal ini akan merugikan pendaftar sendiri. Pengumuman Jalur Undangan Sementara itu Ketua Panlok USU juga menyampaikan, hasil ujian SNMPTN 2011 Jalur Undangan dijadwalkan akan diumumkan pada Rabu 18 Mei 2011. Pengumuman tersebut dapat diakses atau dilihat di website Bagi para peserta SNMPTN Jalur Undangan yang dinyatakan lulus atau diterima di USU diwajibkan untuk melakukan pelaporan pada tanggal 31 Mei dan 1 Juni 2011 di Gelanggang Mahasiswa Jl. Universitas Kampus USU (masuk dari Pintu I) mulai pukul 08:00 WIB. Kelengkapan yang harus dibawa pada saat melakukan pel a por a n a da l a h K ar tu SNMPTN 2011 Jalur Undangan asli, Rapor asli dan fotokopi dilegalisir rangkap 2, Ijazah asli dan fotokopi dilegalisir (lulusan 2009/2010)atau SKHUN (Surat Keterangan Hasil Ujian nasional) asli dilengkapi foto ukuran 3x4 cm (bagi yang belum keluar ijazah), dan surat ganti nama bagi yang pernah ganti nama. Untuk informasi lebih lengkap tentang pelaporan ini dapat dilihat di website (m41)


manik-manik, tulang belulang, kerang, peleburan besi, bata kuno, batu pecahan arca serta yang sangat menarik adalah ditemukannya serpihan lembaran emas kuno,” sebut Dr. Daniel Perret di dampingi Ery Soedewo, peneliti di Balai Arkeologi Medan seraya menyebutkan, seluruh temuantemuan ekskavasi tersebut akan diteliti dalam waktu satu minggu terakhir. Menanggapi hasil temuan tersebut, Kepala Pussis-Unimed Ichwan Azhari menyebutkan, ekskavasi ini menunjukkan apresiasi dan perhatian dunia internasional yang begitu penting terhadap penyingkapan misteri sejarah dan arkeologi di Kota China yang memiliki peranan penting pada abad ke 11 hingga 15 di Sumatera Timur. “Penelitian ini secara perlahan akan mengungkap misteri kota kuno di utara kota Medan yang situsnya kurang mendapat perhatian dari Pemerintah Kota (Pemko) Medan,” ujar Ichwan Azhari. Ichwan Azhari menyebutkan, penelitian dan ekska-

vasi ini didanai oleh pemerintah Prancis melalui Lembaga Kajian Prancis untuk Asia (EFEO) yang dilaksanakan sejak 28 April 2011 dan dipimpin Dr. Daniel Perret. Penelitian ini melibatkan 30 orang peneliti dan tenaga pembantu lapangan yang dilaksanakan secara kerjasama antara Pusat Arkeologi Nasional, Balai Arkeologi Medan, Pussis-Unimed dan Museum Kota Cina. Sementara itu, staf Pussis Unimed, Erond Damanik mengemukakan, hasil penelitian tersebut akan memperkuat hipotesis tentang peranan Kota China sebagai Bandar Perniagaan di Sumatra Timur pada abad 11 sebagaimana yang ditegaskan oleh Dr. Edwards Mc Kinnon dalam disertasi doktoralnya di Cornell University Amerika Serikat yang telah melakukan penelitian di Situs Kota China sejak tahun 1972-1977. “Atas dasar itu pula, kiranya Pemko Medan perlu mengambil tindakan berupa langkah-langkah penyelamatan Situs Kota China sebelum seluruhnya tergerus oleh masyarakat,” ujar Erond Damanik. (m41)

100 persen. Kota Tebing Tinggi, jumlah peserta 275 lulus 100 persen. Kota Tj Balai, peserta 370 lulus 100 persen. Kota Sibolga, peserta 179 lulus 100 persen. Kota Padangsidimpuan peserta 575 lulus 100 persen. Kota Gunung Sitoli pe-serta 69 lulus 100 persen. Ka-bupaten Deliserdang, peserta 932 tidak lulus 3 orang yakni peserta dari Program IPS. Kabupaten Langkat, peserta 1404 tidak lulus 2 orang yakni di Program IPS. Selanjutnya, sambung Mahya Bandar, untuk Kabupaten Simalungun, peserta 863 lulus 100 persen. Kabupaten Karo, jumlah peserta 93 siswa lulus 100 persen. Kabupaten Dairi, jumlah peserta 196 lulus 100 persen. Kabupaten Asahan, jumlah peserta 1502 tidak lulus 7 orang yakni dalam Program IPA sebanyak 3 orang dan Program IPS sebanyak 4 siswa. Kabupaten Labuhanbatu, jumlah peserta 927 peserta, tidak lulus 2 siswa dalam Program IPS. Kabupaten Tapanuli Utara, jumlah peserta 29 siswa lulus 100 persen, Kabupaten Tapanuli Tengah, jumlah peserta 473 lulus 100 persen. Kabupaten Tapanuli Selatan, jumlah peserta 634 tidak lulus 3 orang di Program IPS. Kabupaten Mandailing Natal, jumlah peserta 2.368 tidak lulus 2 orang dalam Program IPS. Kabupaten Humbahas peserta 18 orang, lulus 100 persen. Kabupaten Pakpak Bharat peserta 21 orang lulus 100 persen. Kabupaten Serdangbedagai, jumlah peserta 764 tidak lulus 3 orang dengan Program IPS. Kaupaten Batubara, jumlah peserta 1059 orang tidak lulus 3 orang Program IPA 2 orang, IPS 1 orang.

Kabupaten Padanglawas jumlah peserta 858 tidak lulus 1 orang, Program IPS. Kabupaten Padanglawas jumlah peserta 879 tidak lulus 1 orang, Program IPS. Kabupaten Labuhanbatu peserta 833 orang, tidak lulus 3 orang Program IPS. Kabupaten Labuhanbatu, jumlah peserta 895 lulus 100 persen. Kabupaten Nias Utara, jumlah peserta 10 orang lulus 100 persen. Terkait kelulusan siswa 100 persen Program Agama, Syariful Mahya Bandar MAP menilai hal ini sangat positif meskipun jumlah pesertanya lebih sedikit dibandingkan dengan program lainnya. Dia berharap program agama ini terus diminati para siswa MA, sebab tahun ajaran tahun 2009/2010 lalu program ini juga mencapai kelulusan 100 persen, meski tahun ini pesertanya menurun yakni hanya 162 siswa sedangkan tahun lalu mencapai 174 siswa. Kabid Mapenda Drs H Yulizar membenarkan jika tidak semua sekolah MA di Sumut memiliki program agama, hal ini diprediksi akibat adanya pemikiran bahwa program IPA dan IPS lulusannya lebih mudah memilih universitas lanjutan yang jumlahnya lebih banyak dibandingkan universitas juruasan agama yang lebih sedikit. “Namun kita selalu memberikan sosialisasi terkait program agama ini yang bisa pula diperkirakan sebagai jurusan bergengsi karena menitikberatkan pembelajaran keagamaan secara khusus. Bahkan pesantren yang ada di Sumut juga memilih mengedepankan program IPA dan IPS,” kata Yulizar kemarin. (b04/m37)

oleh Ecole Francaise d’Extreme Orient (EFEO) Perancis. Hal ini menunjukkan dan menegaskan arti pentingnya Situs Kota China sebagai salah satu Bandar Perniagaan Utama di Sumatera Timur pada abad ke-11. Penelitian ini memper-tegas kembali peranan Situs Kota China dalam segitiga arkeologi di Sumatera Utara yang menghubungkan Barus, Portibi dan Kota China sebagaimana yang ditegaskan oleh Daniel Perret dari Perancis dalam bukunya: Kolonialisme dan Etnisitas (2010). Daniel Perret di lokasi penggalian di Kelurahan Danau Siombak, Medan Marelan, Sabtu (14/5) kepada wartawan menyebutkan, pihaknya sudah melangsungkan ekskavasi tersebut selama tingga minggu dan membuka kotak ekskavasi sebanyak 6 unit di tiga titik yang berbeda dengan ukuran 5 x 5 meter dengan kedalaman 0,5 hingga 1,5 meter. “Hasil ekskavasi adalah ditemukannya dalam jumlah besar seperti fragmen keramik, fragmen gerabah, koin China,

1.821 Tak...

Sumatera Utara yang mengikuti Ujian Nasional (UN) tahun 2010/2011 berhasil lulus sebanyak 99,787 persen, atau 18.672 siswa dan tidak lulus hanya 0,213 persen atau 40 siswa dari jumlah total peserta mencapai 18.672 siswa, sementara untuk jurusan Agama dinyatakan lulus 100 persen. Demikian disampaikan Kepala Kementerian Agama Wilayah Provinsi Sumatera Utara, Drs H Syariful Mahya Bandar MAP bersama Kabid Mapenda Drs H Yulizar MAg, Kasi Supervisi dan Evaluasi Khairul Amani dan Humas Drs Khairul Syam di Asrama Haji Medan, Minggu (15/5). Mahya Bandar menyebutkan, untuk klasifikasi program kelulusan siswa Madrasah Aliyah yang ada di Sumatera Utara, Program Bahasa dengan peserta 85 orang lulus 100 persen. Program IPA dengan peserta 8.370 yang lulus 8.360 tidak lulus 10 siswa. Program IPS dengan peserta 10.095, siswa yang lulus 10.065 tidak lulus 30 siswa. Program keagamaan jumlah peserta 162 siswa yang lulus 162 siswa. Sementara untuk masingmasing kabupaten/kota, yakni Kota Medan dengan peserta 1.861 siswa tidak lulus 10 siswa, dengan klasifikasi Program IPA jumlah peserta sebanyak 918 tidak lulus 5 siswa. Program IPS jumlah peserta 882 tidak lulus 5 siswa. Program Bahasa dengan jumlah peserta 46 lulus 100 persen, Program Agama jumlah peserta 15 orang lulus 100 persen. Kota Pematang Siantar, peserta mencapai 323 lulus 100 persen. Kota Binjai jumlah peserta 338 lulus

WASPADA Senin 16 Mei 2011


alam yang belum bisa diprediksi kapan akan terjadi. “Kami sudah mulai menghitung rumah sakit dan daerah mana yang pantas untuk dijadikan lokasi evakuasi,” ungkapnya. Andi mengakui sulitnya meyakinkan sejumlah pihak akan kemungkinan gempa besar yang bisa terjadi di Jakarta karena minimnya pengetahuan dan informasi mengenai gempa. “Untuk meyakinkan ada potensi di selat Sunda itu tidak mudah. Scientific kebumian ini mirip dengan ilmu bawah tanah, sehingga untuk meyakinkan orang itu sangat sulit. Karena kesadaran akan gempa ini baru ada sejak 2004 saat tsunami di Aceh,” jelasnya. Hingga saat ini, menurut Andi, baru tiga lokasi titik rawan pusaran gempa bumi yang diteliti oleh peneliti Indonesia. Di antaranya patahan Sumatera, sesar Lembang, dan Selat Sunda. Sedangkan ratusan ribu lainnya belum diteliti, termasuk sesar Opak di Yogyakarta. (vvn)

HUT Israel...

menjaga rekonsiliasi antara Hamas dan Fatah tetap berjalan. Pemerintahan persatuan yang dijanjikan juga akan didukung dan dilindungi pembentukannya oleh rakyat. Aksi di Gaza ini juga diikuti oleh puluhan anak-anak. Mereka mengenakan pakaian khas Palestina untuk menunjukkan budaya yang tak lekang dimakan penderitaan. Anak-anak ini yakin suatu saat Palestina akan kembali damai ke masa ketika kakekkakek mereka masih hidup. Israel Tembaki Pasukan Israel telah melepaskan tembakan ke arah pemrotes di lintasan perbatasan wilayah Palestina, Syria dan Lebanon. Laporan yang belum mendapat konfirmasi mengatakan beberapa orang tewas dan puluhan lainnya cedera dalam bentrokan itu. Sekurang-kurangnya 45 warga Palestina cedera ketika pasukan Israel menembaki satu kelompok dekat Erez yang menyeberang di Gaza, kara para medis. Jon Donnison dari BBC, di Ramallah, satu kota di Tepi Barat Palestina, mengatakan protes Nakba tahun ini telah memberikan dorongan pergolakan di negara-negara Timur Tengah dan Afrika Utara. Di Ramallah ada bentrokan di perbatasan, di seberang Jerusalem Timur. Para pemrotes Palestina telah melemparkan batu ke arah pasukan keamanan Israel, yang menembaki mereka dengan gas airmata dan peluru karet. Militer Israel mengatakan pihaknya hanya melepaskan tembakan peringatan di Dataran Tinggi Golan ketika para pemrotes berusaha menerobos pagar. Namun laporan yang belum dikonfirmasi mengatakan empat orang tewas dan sekurang-kurangnya 10 orang cedera. Peristiwa itu terjadi dekat Majdal Shams. Israel menguasai wilayah strategis dari Syria pada tahun 1967. (m10/vvn)


Berikut adalah ringkasan perbandingan siswa lulus dan tidak lulus menurut jurusan pada satuan pendidikan SMA/MA tahun ajaran 2010/2011. Jurusan IPA dengan jumlah peserta 627.859 siswa, 625.924 atau 99,69 persen siswa lulus dan siswa yang tidak lulus sebanyak 1.935 atau 0,31 persen. Untuk jurusan IPS jumlah pesertanya 34.358, yang lulus sebanyak 33.860 atau 98,55 persen dan 498 siswa tidak lulus atau 1,45 persen. Sedangkan untuk jurusan Bahasa, dari 8.782 jumlah peserta, 8.610 atau 98,04 persen siswanya lulus dan 172 atau 1,96 siswanya tidak lulus. Khusus untuk jurusan Agama dengan jumlah peserta terbanyak, dari 790.942 jumlah peseta, 782.104 atau sama dengan 98,88 persen siswanya lulus dan sebanyak 8.838 atau sama dengan 1,12 persen siswa lainnya dinyatakan tidak lulus.(kps)


Presiden Soekarno, 9,2 persen memilih mantan Presiden Megawati Soekarnoputri, 4,4 persen memilih B.J. Habibie, 4,3 persen memilih almarhum mantan Presiden Abdurrahman Wahid. Selain itu, Indo Barometer juga menggali persepsi publik mengenai presiden yang paling berhasil. Lagi-lagi, almarhum mantan Presiden Soeharto dipersepsikan sebagai presiden paling berhasil. Sebanyak 40,5 persen responden mempersepsikan Soeharto sebagai pemimpin yang paling berhasil. Selanjutnya, 21,9 persen memilih Presiden Yudhoyono, 8,9 persen memilih almarhum mantan Presiden Soekarno, 6,5 persen memilih mantan Presiden Megawati Soekarnoputri, 2,0 persen memilih mantan Presiden B.J. Habibie, dan 1,8 persen memilih almarhum mantan Presiden Abdurrahman Wahid. (kps)


khususnya kebakaran hutan,” ucapnya. Abdul Majid berharap, masyarakat saat meninggalkan rumah, dipastikan dahulu tidak ada aktivitas masak di dapur dan waspada penggunaan lilin saat listrik sedang mengalami pemadaman. “Kalau meninggalkan rumah, pastikan dahulu kompor di dapur sudah tidak nyala lagi. Sikap waspada ini sangat penting untuk mengantisipasi kebakaran,” katanya. Sementara untuk yang beraktivitas di daerah perkebunan diharapkan agar memperhatikan aktivitas pembukaan hutan dan lahan tidak dilakukan dengan cara membakar. “Pasalnya, pembukaan hutan dan lahan yang dilakukan dengan cara membakar yang dilakukan pada suhu cuaca yang panas mengakibatkan api mudah menyulut dengan cepat dan mengakibatkan kebakaran besar,” jelasnya. (a35)


dan antusias. Ia mencari dukungan di jalan-jalan di kota kecil tempat tinggalnya dan mengumbar janji kampanye “Menang buat Cuntis”. Dengan rambut pendek warna putih dan senyumnya, ia mengenang saat pernah memberi suara dalam usia 24 tahun di sekolah setempat pada 19 November 1933, pemilihan umum pertama yang dibuka buat perempuan setelah parlemen memberi persetujuannya dua tahun sebelumnya. Suaminya telah memberi dia kertas suara di pintu sekolah itu sebagai formulir hadiah ulang tahun. “Ia memberi kertas suara itu kepada saya, saya masuk dan menaruhnya di tempat kertas suara. Itu lah untuk kali pertama perempuan memberi suara di Spanyol. Dan saya ada di sana,” kata Villaverde kepada harian El Mundo, seperti dikutip dari AFP, Minggu (15/5). Di antara politikus saat ini, ia mendukung Menteri Pertahanan Carme Chacon sebab ia seorang perempuan. “Perempuan memangku jabatan,” katanya. Chacon dapat jadi calon untuk mengambil-alih pimpinan Partai Sosialis dari Perdana Menteri Jose LUis Rodriguez Zapatero, yang telah memutuskan untuk tidak mencalonkan diri lagi dalam pemilihan umum mendatang pada 2012. Villaverde mengakui ia suka memilih Zapatero. “Ia tampan dan ia adalah orang baik. Yang paling buruk ialah ia pensiun.” Villaverde, janda sejak 1973 dengan tiga cicit dan seorang buyut, mengatakan ia telah jadi “seorang sosialis sejak dilahirkan” dan sangat “suka ngomong politik”. “Kamu mesti memberi suara bukan untuk teman mu tapi buat prinsip kamu,” ujar Villaverde kepada El Mundo. (yahoo/rzl)


ukuran di kawasan lintas Bireuen-Takengon, Km 25, Dusun Kamar, Mandi Desa Krueng Simpo, Kec. Juli, Sabtu (14/5) sekira pukul 14:00. Kapolres Bireuen AKBP HR Dadik Junaedi, SH melalui Kasat Reskrim Iptu Novi Edyanto didampinggi Kaur Bin Ops (KBO) Sat Reskrim Ipda Elisa Maharani, SE, kepada pers di Mapolres, Minggu (15/5) menerangkan, berhasilnya anggota Opsnalnya menangkap truk pengangkut kayu haram itu setelah menindaklanjuti laporan masyarakat yang mengabarkan ada satu truk mengangkut KRC ilegal dari kawasan perkebunan. Lalu anggotanya bergegas ke lokasi dan saat berada di Km 25 langsung ditangkap tanpa mendapat perlawanan sopir dan kernetnya. “Truk Hercules itu disopiri Ba, 36, dan kernet MY, 24, keduanya asal Kec. Juli,” jelasnya. Menurutnya, 93 keping kayu KRC itu baru dibawa turun dari kawasan perkebunan di Km 32, sampai Km 25 hendak dibawa ke suatu tempat, namun sebelum sampai tujuan berhasil diamankan. “Kasus ini masih dalam penyelidikan, sopir dan kernet ditahan,” tambah Sat Reskrim Ipda Elisa Maharani, SE. Sementara sopir truk yang ditanya wartawan di Mapolres mengatakan, kayu yang dibawanya adalah kayu limbah bekas patahan akibat kena alat berat untuk dibawa ke satu tempat. “Bukan kayu hasil illegal logging yang kami bawa, tapi kayu limbah patahan,” kilahnya.(amh)

Medan Metropolitan

WASPADA Senin 16 Mei 2011

Pemekaran Daerah Tunggu Revisi UU No.32 Waspada/ist

Prof Abdul Rauf didamping N. Akelaras dan Mahasiswa S3 Pertanian USU, memberi arahan kepada pengurus dan anggota KSM Lestari Alam Bandar Baru.

USU-Forum DAS Wampu Bina KSM MEDAN (Waspada): Program Pascasarjana (PPs) Pertanian USU bekerjasama dengan Forum DAS Wampu membentuk dan membina 10 Kelompok Swadaya Masyarakat (KSM) yang tersebar di Kabupaten Karo, Deli Serdang dan Langkat, baru-baru ini. “Pembentukan kelompok-kelompok swadaya masyarakat ini untuk peduli pada pelestarian lingkungan secara mandiri,” kata Prof Dr Ir Abdul Rauf, MP (Ketua Program Pascasarjana Pertanian USU/Ketua Forum DAS Wampu) di Medan, Minggu (15/5). Menurutnya, selain itu juga dibentukan jaringan antara sesama KSM untuk saling tukar menukar informasi dan pengalaman serta saling memberikan dukungan semangat. Hal tersebut, kata Prof Rauf, untuk memudahkan pelaksanaan program pelestarian lingkungan, hutan dan lahan agar berfungsi secara optimal dalam memenuhi kebutuhan pangan, papan dan sandang dengan tetap mengedepankan pelestarian lingkungan. Kegiatan pembentukan dan pembinaan KSM itu sebagai nara sumber Prof Dr Ir Abdul Rauf, MP, N. Akelaras, Ir T Irmansyah, Ir Benny Hidayat, Ir Hardi Guchi, Jamilah, SP, Ir Iwan Hasrizat dan Kemala Sari Lubis, SP. Sedangkan kelompok swadaya masyarakat yang mengikuti pembinaan itu terdiri dari KSM Cinta Alam Desa Cimbang Kec. Payung, KSM Sumbul Simbelin Desa Sumbul Kec. Barus Jahe. KSM Lestaria A l a m De s a Ba n d a r B a r u Kec.Sibolangit, KSM Mata Air Panas Desa Paria-ria Kec. Sibirubiru, KSM Mitra Lestari Desa Timbang Jaya Kec. Bahorok, KSM Jelutung Lestari Desa Turangi Kebun Kec. Bahorok, KSM Pakam Lestari Desa Bukit Lawang Kec. Bahorok dan KSM Bukit Bagunda Lestari Desa Batu Jongjong Kec. Bahorok. Ditambahkannya, kegiatan KSM harus berorientasi pada usaha yang mempertimbangkan keuntungan dari segi ekonomi dengan tetap mengedepankan kelestarian lingkungan. “Sebaiknya setiap usaha diupayakan pada semua aspek, dari aspek produksi, pemasaran, hingga aspek kesejahteraan sosial anggotanya, seperti masalah kesehatan, pendidikan, dan tukar menukar informasi,” sebut Rauf. (cwan)

MEDAN (Waspada): Pemekaran daerah termasuk rencana pemekaran tiga provinsi di Sumatera Utara seperti Provinsi Sumatera Tenggara, Kepulauan Nias dan Tapanuli dipastikan tertunda, karena masih harus menunggu revisi UU No.32 tahun 2004 yang sedang dilakukan Kementerian Dalam Negeri. “Sesuai dengan moratorium yang dilakukan Presiden bersama DPR RI bahwa pemekaran daerah itu untuk sementara ditunda sambil membenahi aturan yang bisa menjawab secara objektif kebijakan pemekaran daerah ke depan,” kata Kepala Biro Organisasi Kementrian Dalam Negeri Drs Eduard Sigalingging, MSi kepada wartawan usai seminar sehari yang bertema Otonomi Daerah dalam Persfektif Reformasi Birokrasi di Indonesia yang diselenggarakan alumni FISIP USU 1980, di Gedung Sidang FISIP USU, Jumat (13/5). Mengenai adanya usulan pemekaran provinsi di Sumatera Utara yang terancam kan-

das, Eduard Sigalingging menyebutkan, sesudah ada revisi maka akan ada aturan teknis dan kriteria-kriteria tertentu dalam pemekaran daerah dengan mempertimbangkan variabelvariabel yang lebih objektif untuk pemekaran suatu daerah. Sebab selama ini, lanjutnya, pemekaran daerah itu dipicu lebih kepada kepentingan politik daripada kepentingan ekonomi dan pembangunan daerah pemekaran itu sendiri. Pemekaran provinsi tidak hanya dilihat dari pertimbangan aspek daerah, tapi juga nasional. Disinggung berapa banyak daerah di Sumut yang sudah dimekarkan mendapat rapor merah, Eduard menjawab be-


KETUA panitia reuni alumni FISIP USU dan pembentukan Forum Alumni FISIP USU Angkatan 1980 Drs. Edward Sihombing menyerahkan cinderamata kepada Dekan FISIP USU Prof. Dr. Badaruddin usai kegiatan seminar di kampus tersebut, Jumat (13/5). lum bisa dipastikan karena belum ada pengaturan normatifnya. “Sebagaimana tertuang dalam PP No. 6/2008 dinyatakan akan ada evaluasi dalam waktu 5 tahun ke depan. Kalaupun mendapat rapor merah tidak langsung dihapuskan tapi dievaluasi, mana kekurangannya akan dibenahi dulu,” jelas alumni Fisipol USU ini. Sementara Dekan Fakultas Ekonomi USU John Tafbu Ritonga menanggapi persetujuan DPRDSU dan Plt Gubsu sudah onthetrackawalyangbagus.John mengatakan hal itu merupakan perwujudan visi ekonomi dan kesadaranekonomiberkonstitusi. Dalam seminar yang juga menghadirkan narasumber Asisten Deputi Badan Nasional Pengelola Perbatasan Kementerian Dalam Negeri Drs Tumpak Simanjuntak, MSi, turut dihadiri Dekan Fisip USU Prof Dr Badaruddin, MSi, Ketua panitia Drs Edward Sihombing dan beberapa alumni serta mahasiswa Fisip USU. Acara tersebut juga dirangkai dengan kegiatan reuni alumni Fisip USU dan pembentukan Forum Alumni Fisip USU Angkatan 1980. (m41)


Golkar Bantu Masjid Muslimin TS Mandala MEDAN (Waspada): Dharma Tama dan PK Partai Golkar Kecamatan Medan Denai dipimpin Ketua Zulkifli Iqbal menyerahkan bantuan tangki air dan mesin pompa untuk pengadaan air bersih kepada Masjid Muslimin di Kelurahan Tegal Sari Mandala III, yang sedang melakukan rehab dan pembangunan kamar mandi, Minggu (15/5). Penyerahan bantuan diserahkan Ketua PK Golkar Medan Denai melalui Wakil Ketua Badan Kenaziran Masjid Muslimin, Timbul Siregar didampingi Ketua Panitia Pembangunan Alizar ‘Bolon” Piliang, disaksikan sejumlah pengurus Golkar Medan Denai antara lain Syahpitra, Zauhari Hamdani, Sekretaris AMPI Medan Denai Juanda Ikbal, Ketua Subrayon AMPI TSM III dan Ketua Golkar Kelurahan TSM III Johan Arifin. Zulkifli mengatakan, program memberikan bantuan kepada rumah ibadah memang sudah menjadi program rutinitas Golkar Medan Denai bersama Rayon AMPI Medan Denai yang diketuai Uden Arby, seperti ratusan kaleng cat tembok, kuas, dan tiner dan beberapa tanaman hias bunga senilai Rp15 juta kepada masjid dan musholla yang ada di kecamatan Medan Denai. “Kedepan ini, kita akan terus membantu pembangunan fasilitas umum yang sangat vital untuk kepentingan masyarakat umum,” ujar Zulkifli. Sementara itu, Ketua Golkar TSM III Johan Arifin mengatakan, pihaknya sudah mendata beberapa masjid dan fasilitas umum yang segera dibantu sesuai kemampuan partai. “Kami juga sudah menggalakkan aksi gotong royong ke beberapa titik untuk membersihkan fasilitas umum tersebut,” katanya. Wakil Ketua Badan Kenaziran Masjid Muslimin Timbul Siregar didampingi Ketua Panitia Pembangunan Alizar ‘Bolon” Piliang menuturkan, masjid yang sedang dalam kondisi perluasan itu sangat membutuhkan dana bantuan dari para dermawan umat Muslim. (cwan)

Medan Metropolitan


WASPADA Senin 16 Mei 2011

Dinkes Intensifkan Pemberantasan Penyakit Berbasis Lingkungan Kantin Sekolah Jadi Perhatian MEDAN (Waspada): Pencanangan Komitmen Kesehatan oleh Walikota Drs. H. Rahudman Harahap dilanjutkan dengan Gerakan Kebersihan Medan Bebas Sampah merupakan salah satu upaya peningkatan derajat kesehatan masyarakat. “Kedua program ini sejalan dengan Perilaku Hidup Bersih dan Sehat (PHBS) yang sedang digalakkan Dinas Kesehatan Kota Medan,” kata Kadis Kesehatan Kota Medan dr. Edwin Effendi, MSc kepada Waspada, Minggu (15/5). Program lainnya yang telah dicanangkan Walikota Medan seperti car free day dan senam

bersama, juga membawa dampak positif untuk peningkatan kualitas kesehatan masyarakat. “Dengan adanya berbagai program itu, diharapkan kesadaran masyarakat tentang pentingnya kesehatan semakin meningkat,” ujar Edwin. Sebagai tindak lanjutnya, Dinas Kesehatan Kota Medan lebih mengintensifkan program

Tiga Vihara Dapat Bantuan Sembako Dari PDIP MEDAN (Waspada): Menyambut hari Tri Suci Waisak 2555, PDIP Madras Hulu memberikan bantuan sembako kepada tiga Vihara yakni Vihara Loka Shanti, Vihara Bodhi Gaya dan Vihara Asahan di kawasan Polonia Medan, Minggu (15/5). Bantuan diberikan langsung Ketua PDIP Madras Hulu Saman Sanu, kader PDIP Zakir Husen dan Gope Karo-karo berupa beras, susu, teh dan mie kering. Di Vihara Loka Shanti Jalan Karya Pembangunan Kel. Polonia II Medan, bantuan diterima ketua yayasan TT Ravi Kumar. Zakir Husen yang didampingi Saman Sanu kepada wartawan mengatakan, bantuan yang diberikan ini dalam rangka membantu perayaan hari Tri Suci Waisak. “Diharapkan bantuan ini berguna dan terus berkesinambungan,” kata Zakir. Bantuan itu bukti kepedulian PDIP terhadap perayaan harihari besar. “Bukan saja Waisak, kegiatan lainnya seperti lebaran, natal dan hari besar lainnya juga PDIP memberi bantuan,” jelasnya. Sedangkan TT. Ravi Kumar mengucapkan terima kasih kepada PDIP Madras Hulu yang peduli dengan perayaan Waisak bagi umat Budha. Dalam kegiatan Waisak yang jatuh pada Selasa 17 Mei 2011, dirayakan mulai pukul 06:00-20:30 diVihara Loka Shanti. Usai memberi bantuan di Vihara Loka Shanti, PDIP Madras Hulu kemudian memberikan bantuan di Vihara Bodhi Gaya di Jalan Karya Sejati, Polonia diterima R. Rageni dan Vihara Asahan Jalan Monginsidi I diterima Nasen. (m39)

Waspada/Rudi Arman

KADER PDIP Zakir Husen didampingi Ketua PDIP Madras Hulu Saman Sanu memberikan bantuan sembako secara simbolis diterima KetuaYayasanVihara Loka Shanti TT. Ravi Kumar, Minggu (15/5).

Bundo Kanduang Gelar Seminar Dan Hiburan MEDAN (Waspada): Yayasan Bundo Kanduang Tuanku Imam Bonjol Medan akan menggelar panel diskusi dan hiburan semalam di Ranah Minang, dalam memeriahkan peringatan 50 Tahun berdirinya Yayasan Wanita Minangkabau, di Hoterl Garuda Plaza, Selasa (17/5). Ketua Panitia Panel Dr Sitti Raha A Salin, M.Sc didampingi Sekretaris Ir.Meuthia F.Fachruddin, M.Eng.Sc, Kamis (12/5) mengatakan, panel diskusi yang bertemakan “Melestarikan NilaiNilai Budaya Minangkabau Melalui Pendidikan Informal Menghadapi Perubahan Sosial Dalam Penbentukan Karakter Bangsa”, dimaksudkan untuk mencari solusi terhadap pergeseran nilaim sosial yang terjadi pada kehidupan sehari-hari keluarga Minang perantauan. Pada pada panel itu, panitia akan menghadirkan pembicara kunci Prof Dr Fasli Jalal (Wakil Menteri Pendidikan Nasiona/Guru Besar FK-Universitas Andalas (Unand)| Padang. Sementara sebagai panelis dalam panel itu Prof Dr Chalida Fachruddin (Antropolog/ Guru Besar FISIP USU), Prof Dr Rer Soz. Damsyar, MA (Sosiolog/ Koordinator Kopertis Wilayah X) dan Prof Dr Amiur Nuruddin, MA dan Prof Dr Nawir Yuslem, MA (Guru Besar IAIN Sumatera Utara). Panel Diskusi ini bersifat terbuka untuk semua kalangan yang terdiri dari masyarakat Minang, pendidik, pemerhati budaya dan sosial serta Mahasiswa. Menurut Sitti, selain itu akan diadakan beberapa rangkaian kegiatan yaitu lomba mewarnai tingkat TK dan SD, kuis untuk tingkat SMP, kegiatan perlombaan yang berorientasi pada nilai budaya Minang yang bertujuan untuk menumbuh kembangkan pengenalan terhadap budaya, adat istiadat, keindahan alam Minangkabau pada generasi muda Minangkabau di perantauan. Pada Selasa malam, jelas ketua panitia, akan digelar Malam Seni Minangkabau yang menampilkan berbagai ragam kesenian tradisional Minang. Bagi peserta yang akan ikut seminar bisa mendaftar di Sekretariat panitia Jl.Sultan Iskandar Muda No.25 Medan atau HP:082165591228 (Meuthia). (m22)

pemberantasan penyakit berbasis lingkungan seperti demam berdarah dengue (DBD). Jadi, Gerakan Kebersihan Medan Bebas Sampah bukan hanya bertujuan menciptakan Medan Bersih, tapi mencegah berjangkitnya DBD. Selain itu, lanjut Edwin, Dinas Kesehatan Kota Medan memberi perhatian serius terhadap kebersihan kantin sekolah dan kesehatan jajanannya. Dalam hal ini, pemilik kantin bertanggung jawab penuh atas keamanandankesehatanjajanan anak sekolah yang dijualnya. “Jika para pelajar mengalami masalah kesehatan akibat

jajanan yang tidak bersih, maka pemilik kantin tidak boleh melemparkan tanggungjawab kepada pihak sekolah. Kemudian, pihak sekolah harus ikut mengawasi kantin guna mencegah terjadinya hal-hal yang tidak diinginkan,” tambahnya. Edwin juga mengingatkan para pedagang agar menjaga kebersihan wadah yang dijadikan tempat memasak dan menyajikan jajanan sekolah tersebut. Kemudian, wadah tersebut harus dicuci hingga benar-benar bersih dengan menggunakan sabun dan air yang mengalir. Bagi pedagang yang mengalami gejala demam, flu, batuk

dan bersin, Edwin meminta agar tidak berjualan untuk sementara waktu hingga penyakit tersebut sembuh. Jika para pedagang tetap berjualan dalam kondisi kurang sehat, dikhawatirkan akan terjadi penularan penyakit kepada para pelajar melalui produk jajanan sekolah yang dijualnya. “Masalah seperti ini sering kali diabaikan para pedagang. Padahal kebiasaan yang baik tersebut dapat mendatangkan manfaat besar terutama di bidang kesehatan dan mencegah terjadinya keracunan makanan yang disebabkan mikroba,” tegas Edwin. (m25)

Rahudman Optimalkan Direksi PD Tingkatkan PAD MEDAN (Waspada): Sebanyak 59 peserta ikuti fit and profer tes bagi calon Direksi Perusahaan Daerah (PD) di lingkungan Pemerintahan Kota Medan yang diadakan Pemko Medan bersama Universitas Sumatera Utara USU, di Pusat Administrasi USU, Kamis (12/5). Pelaksanaan fit and profer tes tersebut, dibuka oleh Walikota Medan Rahudman Harahap dihadiri Rektor USU Prof Syahril Pasaribu serta 59 orang peserta dari berbagai kalangan. Acara diadakan selama tiga hari berturut-turut, mulai Kamis, Jumat dan Sabtu. Rahudman dalam sambutannya mengatakan, ada tiga perusahaan daerah milik Pemerintah Kota Medan, masingmasing Perusahaan Daerah Pasar, Perusahaan Daerah Pembangunan dan Perusahaan Daerah Rumah Potong Hewan. Menurutnya, ketiga perusahaan tersebut akan dioptimalkan fungsinya dalam mendukung Pendapatan Asli Daerah (PAD). Untuk itu akan ditata dengan kinerja yang lebih profesional, agar benar-benar mampu meningkatkan PAD kota Medan. Karena itu dirasa perlu

memilih dewan direksinya melalui fit and profer test, sehingga dewan direksi terpilih nantinya benar-benar memiliki kapasitas teruji. Sementara itu, Prof Syahril Pasaribu mengatakan, terkait dengan ruang lingkup kerjasama antara USU dan Pemko Medan, tim seleksi USU telah pula mempersiapkan antara lain bahan materi ujian untuk fit and profer test.“Apa yang telah dilakukan Pemerintah Kota Medan bersama USU khususnya menyangkut fit and profer test ini merupakan satu langkah maju sekaligus sebagai satu perubahan bagi terwujudnya Good Governance sekaligus Good Corporate Governance,” ujarnya. Kegiatan Seleksi ini akan dibagi dalam dua tahap yaitu tahap tes psikologi serta tahap ujian tertulis (aspek hukum, teknik dan ekonomi). Para peserta merupakan orangorang yang datang dari berbagai kalangan, mereka antara lain adalah; SlametWidodo SE.MBA, Sahabudin Duha SE, Benny Sihotang SE, Syahrul Saragih SH, Mahadi Putra Pasaribu MM, Darman Saragih SH, Ali Hasan

Siregar ST, Machruzar SE, Hamdan SE, Bangun Tampubolon MS, Zulfan MBA, Erwan M Nainggolan SE, Martalena Sinaga SE, Haulian Siregar, Jonli Bena Masmur, Jayamuddin Barus SE, Syafrizal Lubis S.Sos, Muhammad Rum S.Ag, Sahron Siregar S.Ag, Marlon P.Siahaan SE, Mulia Soleman Harahap SH, YudiWidarto SE, Drs. Anwar Sanusi M.Si, Lely Amra Siregar, Usman SE M.Si, Muhammad Iskar S.Ag, Rufinus Simangunsong, Poniman S.Sos, Osman Manalu SP, Debora Tambunan SH, Herry Zein, Diddy Cemerlang SE, Parulian Siregar MA, Sahat Silitonga, Putrama Alkhairi, Musa Jasmen P, Abian Sufrizal Lubia, Robert Simanjuntak SE, Tanti SE, Sonni Fahrizal SE, Antoni Simamora SE, Ahmad Prayudi SE MM, Rafriandi Nasution SE MT, H. Nuzirwan Lubis MSP, M.Ichwan Husein Siregar, Rusdi Sinuraya, H.M Harmen Ginting S.Sos, Armand Hutasuhut, Arwin Harahap S.Ag M.Si, Richard Simanjuntak SE Ak, Nuzuliati SE, Sugito Hadi SE M.SI, Adi Avianto ST, Frans Pakpahan SE, Dedeng Indra Jaya SE, Mukhlis, Besri Nazir, Indra Mulya Lubis SP. (m41)

Walikota Sibolga Kunjungi Warganya Di RSU Pirngadi MEDAN (Waspada): Walikota Sibolga HM Syarfi Hutahuruk didampingi Kadis Kesehatan Sibolga Yusuf Batubara dan Ketua Komisi III DPRD Sibolga Jamil Jeb Tumori mengunjungi tiga pasien warga Sibolga di RSU dr. Pirngadi Medan, Sabtu (14/5). Kunjungan tersebut antara lain untuk menandatangani langsung surat rekomendasi Pengobatan Gratis dari Anggaran SKPD Dinas Kesehatan Sibolga. “Begitu mendengar kabar ada warga kita sini, kita langsung melihatnya untuk memberikan dukungan moril dan melengkapi berkas-berkasnya. Di Pirngadi ini, ada tiga warga Sibolga yang kita kunjungi,” kata Syarfi Hutahuruk. Sementara itu, Komisi III DPRD Sibolga Jamil Zeb Tumori mengatakan, kunjungan itu wujud kepedulian kepala daerah kepada warganya dan ingin memberikan yang terbaik. “Ini wujud kepedulian kita, dimana pun warga Sibolga berada kita tetap perhatikan dan memberikan yangg terbaik, karena kita terpilih karena doa dan dukungan masyarakat, maka kita akan berbuat dan memperhatikan kesehatan masyarakat,” ujarnya. Jamil memberikan apresiasi kepada walikota karena lang-


WALIKOTA Sibolga HM. Syarfi Hutahuruk menandatangani surat rekomendasi Pengobatan Gratis dari Anggaran SKPD Dinas Kesehatan Sibolga dihadapan warganya di RSU dr. Pirngadi Medan, Sabtu (14/5). sung datang menandatangani berkas-berkas yang diperlukan masyarakatyangkurangmampu. “Jarang ada kepala daerah yang langsung meneken surat di depan warganya,” ungkapnya. Pasien yang menderita adanya cairan di paru-paru Jefri Cuaca mengaku terkejut saat walikota langsung menjenguknya dan menandatangani surat rekomendasi tersebut. “Kami nggak pernah menyangka

walikota Sibolga menjenguk kami,” katanya. Sebelum surat rekomendasi ditandatangani, kata Jefri, dirinya sempat putus asa, karena tidak memiliki biaya lagi untuk membayar perawatan selama di RSU dr. Pirngadi Medan. Dia mengucapkan terimakasih kepada Ketua Komisi III DPRD Sibolgayangsudahbanyakmembantunya hingga sampai ke RSU dr. Pirngadi Medan. (h02)

Kader PP Silaturrahmi Ke Polsekta Medan Area MEDAN (Waspada): Kader Pemuda Pancasila telah merubah paradigma lama yang selalu diasumsikan dengan kekerasan, dengan cara menaati norma-norma hukum, menjaga kondusifitas lingkungan dan berbakti kepada negara. Ketua Pimpinan Anak Cabang Pemuda Pancasila (PAC PP) Medan Area KamaluddinTanjung mengatakan itu saat melakukan kunjungan ke Polsek Medan Area, Kamis (12/5) sore. Dia didampinggi sejumlah pengurus, seperti Sekretaris Afrijal, Bendahara Syamsul Asri, Hendra Wiguna, Buckhari, Mahmudin Lubis dan Dedi Syafitri. Kedatangan pengurus PAC PP Medan Area guna melakukan kerjasama menciptakan kondusifitas keamanan di masyarakat, khususnya di Medan Area, serta menyerahkan susunan kepengurusan PP Medan Area yang sah. Kamaluddin menjelaskan, maksud kedatangan mereka, selain silaturahmi sekaligus memperkenalkan pengurus PAC PP Medan Area. “Kami tidak ingin di belakang hari ada orang mengaku-ngaku sebagai pengurus PP Medan Area, karena kepengurusan yang sah diketuai Kamaluddin Tanjung,” katanya. Kunjungan mereka disambut Wakil Kapolsek Medan Area AKP Iskandar HR, yang menyatakan bangga dengan kerjasama yang dilakukan PP Medan Area, yang berkeinginan bekerjasama dengan pihak kepolisian menjaga kondusifitas wilayah Medan Area. “Memang sudah semestinya pihak kepolisian melakukan kerjasama dan bersama-sama menjaga kondusifitas wilayah hukum Medan Area ini. Sebab kita-kita inilah yang nantinya menjaga kenyamanan masyarakat di sini,” ujarWakapolsek. (m27)


Pengurus PP Medan Area bersama Wakapolsek Medan Area AKP Iskandar HR setelah melakukan pertemuan di Mapolsekta, Kamis (12/5).

Waspada/David Swayana

Kadis Kesehatan Kota Medan dr. Edwin Effendi, MSc berdialog dengan pemilik kantin di Perguruan Eria ketika melakukan pemeriksaan terhadap keamanan dan kesehatan jajanan sekolah di institusi pendidikan tersebut, belum lama ini.

Kapoldasu Resmikan Sekretariat Ikatan Alumni SMAN 3 Medan MEDAN (Waspada): Kapoldasu Irjen Pol Drs Wisjnu Ahmad Sastro yang merupakan alumni SMAN 3 Medan dipastikan menghadiri sekaligus menandatangani prasasti peresmian Sekretariat DPP Alumni SMAN 3 Medan Jln. Amir Hamzah No. 52 B Medan, Sabtu (21/5). Peresmian Kantor DPP Ikatan Alumni SMAN 3 Medan dirangkai dengan sejumlah kegiatan diantaranya syukuran atas pengangkatan atau penempatan Irjen PolWisjnu Ahmad Sastro sebagai Kapoldasu oleh Kapolri Jenderal Pol Timur Pradopo. Ketua Panitia Pelaksana Amin Thomas didampingi Sekretaris Jumono, Bendahara Sri Murniaty bersama unsur pengurus Nurdin Dahlan, Erwin Hidayat, Dipo Sumarno mengatakan kepada wartawan, Sabtu (14/5), sekretariat tersebut sebagai wadah bagi alumni SMAN 3 Medan untuk berkumpul, membangun kebersamaan dan solidaritas antara sesama alumni dalam menyikapi berbagai aspek kehidupan berbangsa, bernegara dan bermasyarakat. Saat ini, banyak alumni SMAN 3 Medan menduduki jabatan strategis di berbagai instansi pemerintah, swasta dan militer. Artinya, alumni SMAN 3 Medan memiliki skill sesuai yang

diharapkan banyak orang. Amin Thomas berharap kegiatan ini bukan hanya sebagai acara temu kangen dan silaturahmi saja, tapi bagaimana menciptakan pertemuan tersebut sebagai wadah komunikasi guna memberikan manfaat dan masukan untuk menunjang visi-misi Walikota menjadikan Medan sebagai Kota Metropolitan. Adapun alumni SMAN 3 yang dijadwalkan hadir pada acara tersebut yakni Chairuman Harahap (anggota DPR-RI), Abdul Wahab Dalimunthe (anggota DPR-RI), Ramadhan Pohan (anggota DPR-RI), Khairul Fuad (anggota DPRDSU), mantan Sekda Provsu Muchyan Tambuse, Elfachri Budiman (mantan Kepala BPN Sumut), Irjen Pol (Purn) Sisno Adiwinoto, Brigjend Pol Satria Sitepu, Laksamana Muda Herry Widjaya, Marsekal TNI AU Ken Chairuddin, Kol CPM Ujang Martenis, Erwin Nasution (Dirut PTPN I), Tamba Karo-Karo (Direktur SDM PTPN II ) Balaman Tarigan (Dirprod PTPN IV), R.Syamsul Rizal Lubis, Syafril, Kol Inf. Fachri Murad. “Kami harapkan kepada alumni agar dapat hadir pada acara ini. Informasi lebih lanjut dapat menghubungi sekretariat (061) 4558007, 0813 8312 3838 dan 08411613143,” katanya. (m50)

Perpustakaan Kota Medan Gelar Pertemuaan Pembaca Dan Penulis MEDAN (Waspada): Kantor Perpustakaan Kota Medan menggelar Pertemuan Pembaca dan Penulis Remaja Kota Medan di Garuda Plaza Medan, Kamis (12/5). Kegiatan bertema Be Smart Through Reading and Writing ini, diikuti 100 siswa didampingi para guru. Walikota Medan diwakili Kepala Kantor Perpustakaan Kota Medan Zulkarnain mengatakan, temu penulis dan pembaca remaja Kota Medan ini bertujuan menggali potensi melalui ideide yang disampaikan, kemudian menjadi masukan bagi Perpustakaan Kota Medan. Pertemuan ini juga sebagai forum silaturahmi antara penulis remaja dan penulis senior sehingga terjalin hubungan emosional yang bisa mengarah kepada kegiatan positif dengan membentuk komunitas penulis serta meningkatkan minat baca masyarakat Kota Medan. “Kita juga mencari bakat baru para penulis remaja untuk didukung menjadi penulis yang lebih produktif dan aktif ,” katanya sembari menambahkan temu penulis dan pembaca remaja mampu bertujuan mencerdaskan kehidupan bangsa. Zulkarnain berkeinginan mengembangkan perpustakaan lebih baik lagi. Dia telah mengusulkan kepada Dinas Perkim untuk memugar perpustakaan Kota Medan menjadi lebih besar dan memiliki ciri khas sendiri dengan memasang gapura di depan pintu masuk. Penulis senior Ali Murthado yang hadir sebagai pembicara pada acara tersebut mengatakan, menjadi penulis tidaklah sulit karena penulis yang baik adalah pembaca yang baik. Karena itu, bagi pelajar yang tertarik untuk terjun ke dunia kepenulisan, syarat utamanya adalah

harus rajin dan membiasakan diri membaca. “Silakan membaca apa saja yang bisa dibaca. Insya Allah, dengan banyak membaca akan menumpuk ide yang bisa dijadikan sebagai bahan tulisan,” katanya. Dia menyarankan kepada penulis pemula agar menulis tentang apa saja. “Jika senang puisi, tulislah puisi. Jika senang cerpen, tulislah cerpen. Jika senang menulis novel, tulislah novel. Kalau tidak senang menulis, minimal harus membaca. Kalau tidak senang membaca. Mohon maaf saya tidak bisa bilang apa-apa lagi,” ucap Ali. Ali Murthado menjelaskan untuk penulis pemula, langkah awal yang harus dilakukan memilih topik, membuat kerangka tulisan, menabung kosa kata, buat judul yang menarik dan pastikan subjudul. Sangat Berperan Sebelumnya, Kepala Seksi Pelayanan Perpustakaan Kota Medan Arriani Yusra mengatakan, perpustakaan sangat berperan terhadap tumbuh kembangnya kebiasaan dan kegemaran membaca di masyarakat. Perpustakaan, menjadi tolok ukur bagi kemajuan suatu masyarakat. Karenanya, memajukan perpustakaan merupakan keharusan bagi suatu masyarakat yang ingin mencapai tingkat peradaban maju. Sejumlah peserta yang hadir meminta kepada perpustakaan Kota Medan untuk lebih meningkatkan perannya antara lain pelayanan perpustakaan keliling hendaknya sampai ke sekolah-sekolah. Selain itu, perpustakaan juga diminta menjalin MoU dengan sejumlah perpustakaan sekolah maupun perpustakaan lainnya sehingga buku-buku yang ada lebih dikembangkan. (m50)

Cuci Tangan Cegah Banyak Penyakit MEDAN (Waspada): Cuci tangan mungkin masih dianggap sepele, apalagi bagi anak-anak. Inilah yang membuat kalau cuci tangan ini belum membudaya. Padahal banyak penyakit bisa dicegah dari cuci tangan ini. Salah satunya adalah penyakit cacingan dan diare. Jika cuci tangan masih dianggap sepele, jadi wajar saja saat ini, diperkirakan 30 persen dari 2 juta jumlah anak SD di Sumut menderita cacingan (Waspada, 25 Maret 2011). Siapapun orangnya, apapun pekerjaannya, kaya atau miskin, wajib hukumnya cuci tangan sebelum atau sesudah melakukan aktifitas. Aksi cuci tangan ini antara lain untuk memutuskan mata rantai infeksi. “Gerakan cuci tangan dengan sabun ini wajib hukumnya dilakukan oleh semua masyarakat,” Kata Praktisi Kesehatan dr. Azwan Hakmi Lubis, Sp.A, Mkes, Sabtu (14/5). Azwan menuturkan, tangan adalah media utama bagi penularan kuman-kuman penyebab penyakit. Akibat kurangnya kebiasaan cuci tangan, anak-anak merupakan penderita tertinggi dari penyakit diare dan cacingan. “Tanpa disadari tangan kita menyentuh sesuatu hal yang mengandung bakteri, debu dan lainnya. Terkadang seorang anak lupa mencuci tangan dengan sabun, lalu memasukkan

makanan ke mulutnya otomatis kotoran ditangannya ikut juga masuk ke dalam tubuhnya,” kata Direktur RSUP HAM ini. Bercerita tentang cacing, infeksi cacing pada anak akan berdampak pada pertumbuhannya, menurunkan kemampuan fisik, produktifitas belajar dan intelektualitas, dan pada akhirnya dapat mempengaruhi kualitas sumber daya manusia. Pada hari cuci tangan sedunia, sejumlah direksi dan karyawan RSUP H. Adam Malik Medan memeriahkan hari Cuci Tangan Sedunia di Lap. Parkir RS tersebut. Tema yang diambil pada peringatan tersebut, yakni Cuci Tangan perilaku Sederhana Berdampak Luar Biasa untuk memutus mata rantai penularan infeksi. “Cuci tangan ini begitu penting, sampai diperingati sedunia termasuk Indonesia,” kata Ketua Panitia Peringatan Hari Cuci Tangan Sedunia RSUP HAM Dr. Purnamawati,. Menurutnya, saat ini Indonesia, proporsi perilaku cuci tangan juga dimasukkan dalam satu dari 24 indicator untuk mengukur Indeks Pembangunan Kesehatan Masyarakat (IPKM) yaitu untuk menentukan satu daerah, provinsi atau kabupaten kota. “Apakah masuk daerah bermasalah kesehatan atau tidak,” sebut Purnamawati. (h02)

Medan Metropolitan

WASPADA Senin 16 Mei 2011


Polisi Tutup Paksa Diskotik LG Waspada/Ismanto Ismail

KANIT Reskrim Polsekta Sunggal AKP S Nainggolan SH, menginterogasi tersangka pencurian sepedamotor yang diapit seorang personel Sentral Pelayan Kepolisian Terpadu (SPKT), Kamis (12/5).

Polisi Tangkap Pencuri Sepedamotor MEDAN (Waspada): Dua pencuri tertangkap tangan saat mencuri sepedamotor Yamaha Jupiter Z milik Darwin, 25, di Pasar III, Asam Kumbang, Rabu (11/5) sore. Diduga tersangka SL, 25, penduduk Jln. Kapten Muslim Gang Tin, Helvetia dan Yd, 25, penduduk Jln. Karya III Helvetia, sudah berulangkali melakukan pencurian sepedamotor di Medan. Namun, ketika diperiksa keduanya mengaku baru pertama kali melakukan pencurian sepedamotor itu. Kapolsekta Sunggal Kompol Sonny Marisi Nugroho, SH, SIK didampingi Kanit Reskrim AKP S Nainggolan, SH, dan Panit Reskrim Ipda B. Tarigan, SH, kepada Waspada mengatakan, kedua tersangka terperogok warga ketika mencuri sepedamotor. Dari kedua tersangka, disita barang bukti sepedamotor tanpa memakai nomor polisi (BK-red), kunci leter T dan lainnya. Tutup Dalam kesempatan itu, Sonny juga mengatakan, beberapa titik lokasi judi Samkwan di kawasan Polsekta Sunggal, tidak beroperasi. Tutupnya lokasi judi karena polisi dan aparat lainnya terus memerangi perjudian. Menurutnya, berdasarkan lidik personel Intel Polsekta Sunggal di lapangan, lokasi judi yang sudah tutup berada di Tunggul Itam (TI), Pasar V dan kawasan Asam Kumbang. “Namun demikian, polisi tetap memantau di lapangan,” jelas mantan Kasat Reskrim Polres Asahan itu. (m36)

Polresta Medan Kerahkan 462 Personel Pengamanan Waisak MEDAN (Waspada): Polresta Medan mengerahkan 462 personel untuk melakukan pengamanan hari Tri Suci Waisak 2555, Selasa (17/5). “Sedikitnya ada 462 personel Polresta Medan dan jajaran melakukan pengamanan hari Waisak,” jelas Kapolresta Medan Kombes Tagam Sinaga, Minggu (15/5). Menurutnya, para personel akan menjaga tempat ibadah seperti vihara yang dijadikan lokasi perayaan hari besar umat Budha tersebut. “Sejumlah vihara yang ada di Medan akan dijaga dua polisi berpakaian dinas,” jelasnya. Untuk wilayah Polsekta Medan Area, jelas Tagam, ada 20 vihara dan dijaga 20 polisi dengan perwira pengawas Kasat Pamobsus Kompol Bostang Simanjuntak. Kemudian Polsekta Medan Kota ada 14 vihara dengan kekuatan 31 polisi dengan perwira pengawas Kasat Narkoba Kompol Amry Siahaan. Kemudian, Polsekta Medan Timur ada 8 vihara dengan 9 polisi, perwira pengawas Kabag Sumda. Polsekta Medan Baru, 18 vihara dengan jumlah polisi 36 personel. Polsekta Percut Sei Tuan ada 9 vihara dan polisi yang bertugas 23 personel. Polsekta Patumbak ada 5 vihara dengan jumlah personel 10 orang. Setelah itu Polsekta Delitua, Pancurbatu, Sunggal, Helvetia dan Kutalimbaru. “Ada 107 vihara di wilayah hukum Polresta Medan dengan personel yang melakukan pengamanan 214 polisi. Selebihnya merupakan personel cadangan,” jelas mantan Kapolsekta Sunggal ini. Tagam juga mengimbau kepada umat Budha yang merayakan Waisak tidak membawa tas yang tidak perlu atau tas besar. “Masingmasing warga termasuk umat Budha yang merayakan Waisak agar meningkatkan kewaspadaan,” ujarnya. (m39)

Mayat Orok Terapung Di Kanal Mariendal MEDAN (Waspada): Sesosok bayi yang diduga hasil hubungan gelap ditemukan terapung di kanal Mariendal, Desa Mariendal I, Kecamatan Patumbak, Minggu (13/5) pagi. Mayat bayi berjenis kelamin perempuan itu selanjutnya dibawa ke instalasi jenazah RSU Dr Pirngadi Medan. Informasi yang diperoleh di lokasi kejadian, sekira pukul 07:30 seorang sopir angkot duduk-duduk di pool angkot perbatasan Desa Mariendal I, persis di sisi kanal tersebut. Sopir angkot tersebut melihat benda mirip kepala yang menyembul dari dalam plastik. Karena penasaran, dia mendekati bungkusan tersebut dan menariknya ke pinggiran kanal. Begitu plastik dibuka, ternyata berisikan bayi yang diperkirakan baru beberapa jam dilahirkan dan kemudian sengaja dibungkus dalam plastik dan dihanyutkan ke saluran air kanal tersebut. Petugas Polsekta Patumbak yang mendapat informasi penemuan mayat bayi tersebut segera mengevakuasinya ke RSU Dr Pirngadi Medan, namun tak seorangpun warga yang mau menjadi saksi penemuan mayat tersebut. “Bayi tersebut diduga hasil hubungan gelap, namun tak seorang pun warga yang mau diambil keterangannya atas penemuan bayi tersebut,” jelas Kanit Reskrim Polsekta Patumbak AKP P Samosir. (h04)

Dua Mayat Dirujuk Ke RSUPM MEDAN (Waspada): Dua mayat dalam kasus yang berbeda masuk ke RSU dr. Pirngadi Medan, Jumat (13/5), untuk keperluan otopsi. Mayat pertama bernama Renhat Tampubolon, 25, warga Pasar IV Gg. Makmur Desa Cinta Damai K. Lalang. Renhat menjadi korban amuk massa diduga melakukan pencurian. Menurut ibunya Rosdiana, 47, anaknya Renhat sudah dua hari tidak pulang ke rumah. Saat melakukan pencarian, dirinya mendapat kabar kalau Renhat sudah meninggal setelah dihajar massa karena diduga mencuri. “Anak saya sudah dua hari menghilang. Selama itu, kami sudah mencarinya. Kemudian kami mendapat kabar kalau anak saya sudah meninggal dan jenazah nya dibawa ke Pirngadi,” ujarnya. Dia menuturkan, anaknya, Kamis (12/5) lalu, bersama temannya melewati kawasan Simpang Suka Dono Desa Kelambir V sekitar pukul 14.00. “Warga disana bilang kalau daerah mereka sudah tiga kali kehilangan sepedamotor. Tibatiba saat lewat di jalan tersebut anak saya dipukuli karena dituduh mencuri sepedamotor,” ujarnya. Sementara itu teman anaknya berhasil menyelamatkan diri. Rodiana tidak menerima dengan kematian anaknya. “Kami nggak terima anak saya dibunuh seperti itu. Padahal dia nggak ada nyuri sepedamotor,” tuturnya. Pada hari yang sama, RSU dr. Pirngadi kedatangan mayat wanita bernama Mariani, 32, wargaDusun5KebunBaruHamparan Perak. Korban tewas akibat kecelakaan lalulintas di Jalan Raya Desa Hamparan Perak, Jumat sekitar pukul 10:30. (h02)

MEDAN (Waspada): Reskrim Unit Judi Sila dan Jahtanras Polresta Medan, Minggu (15/5) dinihari, menutup paksa diskotik Lee Garden (LG) di Jln Nibung II, Kecamatan Medan Baru karena beroperasi melewati batas waktu pukul 03:00. Dari tempat hiburan malam tersebut, polisi menyita barang bukti berbagai jenis minuman keras dan mengamankan seorang bartender A. Marpaung, 38, warga Jln. Binjai km 10,8. Sedangkan dua pengunjung yakni Edi, 18, warga Jln. Pertahanan Patumbak dan Rajit, 19, warga Jln Letjen Suprapto, Medan yang sempat diamankan karena tidak memiliki KTP, sudah dipulangkan. Kasat Reskrim Polresta Medan Kompol Fadillah Zulkar-

naen melalui Kanit Judi Sila AKP Hartono ketika dikonfirmasi Waspada mengatakan, sampai saat ini bartender masih menjalani pemeriksaan. Sedangkan dua pengunjung yang tidak memiliki KTP, sudah dipulangkan. Razia diskotik LG yang dipimpin Kanit Judi Sila ini dimulai pukul 03:00. Ketika polisi masuk ke dalam diskotik, dentuman musik masih terdengar. Kemudian polisi meminta operator menghentikan musik tersebut.

Setelah itu, polisi memeriksa pengunjung guna mencari narkoba dan senjata tajam. Dua pengunjung yang tidak bisa menunjukkan KTP diboyong ke Polresta Medan. Kemudian, polisi menuju ke bar dan menanyakan kepada A Marpaung selaku bartender tentang izin mencampur berbagai jenis minuman keras tersebut. Karena tidak bisa menunjukkan izin, polisi mengamankan bartender tersebut. “Namun saat A. Marpaung hendak dibawa ke Polresta Medan, sejumlah oknum aparat sempat menghalanginya. Setelah diberi penjelasan, akhirnya bartendertersebutdibawakePolresta Medanuntukmenjalanipemeriksaan,” jelas Hartono.(m39)

Perampok Telanjangi Legianto MEDAN (Waspada): Legianto, 23, pekerja salah satu restoran, menjadi korban perampo-kan di Jln. Ibus Ujung, Medan Petisah, Sabtu (14/5) malam. Selain kehilangan sepedamotor, uang Rp200 ribu dan handphone, pelaku menelanjangi korban. Saksi mata mengatakan kepada Waspada, peristiwa itu bermula ketika Legianto penduduk Jln. Banten Baru, Gg. Sejahtera Medan yang mengendarai sepedamotor singgah di sekitar pusat perbelanjaan Medan Plaza Jln. Iskandar Muda. Ketika duduk santai di atas sepedamotor-nya, tiba-tiba dua

pelaku menghampiri korban. Semula korban mengira pelaku ingin menanya-kan sesuatu. Ternyata, pria tidak dikenal itu menuduh korban sebagai pelaku perampokan terhadap kakak mereka bernama Lina. Merasa tidak bersalah, korban menolak tuduhan tersebut. Namun kedua pelaku memaksa korban naik ke atas becak bermotor untuk dipertemukan dengan Lina yang disebutnya sebagai korban perampokan. Setibanya di Jln. Ibus Ujung, pelaku bukan mempertemukan korban dengan Lina. Kedua pelaku menodongkan senjata tajam ke arah korban dan me-

nyikat uang Rp200.000, handphone dan lainnya. Tidak hanya itu, pelaku menelanjangi korban dan meninggalkannya di lokasi kejadian Setelah itu, pelaku kembali ke kawasan Medan Plaza dan mengambil sepedamotor Yamaha RX King BK 5524 GF milik korban. Kapolsekta Medan Baru AKP Dony Alexander, SH, SIK yang dikonfirmasi Waspada mengatakan, pihaknya sudah menurunkan personel ke lokasi kejadian guna melakukan penyelidikan. Hingga k i n i p e l a k u m a s i h t e r us diburon. (m36)

Waspada/Ismanto Ismail

Legianto, 23, korban perampokan dan ditelanjangi dua pelaku membuat pengaduan di Mapolsekta Medan Baru, Sabtu (14/5) malam.

Minta Korban Penganiayaan Dilepas

Warga Datangi Mapolsekta Medan Labuhan BELAWAN (Waspada): Merasa diperlakukukan tidak adil, puluhan warga Pasar 6 Desa Manunggal, Kecamatan Labuhan Deli, Deliserdang, mendatangi Mapolsekta Medan Labuhan, Minggu (16/5). Tidak ada keributan yang mewarnai kedatangan warga tersebut dan mereka bubar setelah permintaannya dikabulkan. Keterangan dari warga, kedatangan mereka ke Mapolsekta Medan Labuhan dipicu oleh penahanan Putra, 36, yang dilaporkan P Sijabat dengan tuduhan pelaku pengrusakan kafe miliknya, pada Sabtu (15/ 5). “Ini tidak adil, dia yang dipukul P Sijabat bersama temantemannya kok malah si Putra selaku korban pemukulan yang ditahan polisi,” kata Manik, seorang warga. Dijelaskan, permasalahan tersebut berawal dari pendirian kafe di sekitar pemukiman

warga Pasar 6 Desa Manunggal, sekitar dua bulan lalu. Padahal, pembangunan kafe itu telah dilarang warga bersama remaja masjid dan pemerintahan setempat. “Sijabat itu bandel, kami sudah berulangkali melarang dia jangan buka kafe tapi tetap buka,” lanjut Manik. Akibatnya, Jumat (14/5) malam, entah siapa yang menyulutnya, warga emosi merusak kafe tersebut. Pemilik kafe P Sijabat kemudian mencari tahu pelaku pengrusakan tersebut. Selanjutnya, dua pria diketahui bernama B Sijabat dan temannya mendatangi rumah Putra lalu membawanya ke kafe milik P Sijabat. Di kafe tersebut Putra dipukuli hingga bibir dan

rahangnya memar. Pemukulan itu berakhir setelah warga datang membebaskan Putra dari sekapan P Sijabat Cs. Atas pemukulan itu, putra didampingi keluarganya melaporkannya ke Mapolsekta Medan Labuhan. Setelah laporannya diterima, Putra malah ditahan polisi atas laporan P Sijabat. “Sekitar 15 menit dari pembebasan Putra, warga pulang. Namun entah apa sebabnya kafe itu tiba- tiba terbakar tanpa diketahui pelakunya,” terang Manik. Tidak ada petinggi Polsekta Medan Labuhan yang bisa diwawancari mengenai hal itu dan warga pulang setelah permintaannya dikabulkan petugas. (h03)

Waspada/Rudi Arman

Sejumlah pengunjung diskotik LG terlihat keluar dari lokasi tempat hiburan tersebut setelah dilakukan razia, Minggu (15/5) dinihari.

Polisi Diminta Tangkap Pelaku Penipuan Rp500 Juta MEDAN (Waspada): Korban penipuan meminta Polresta Medan bekerja secara profesional dan bersikap tegas dalam menangani kasus dialaminya dengan menangkap pelakunya. “Saya sangat menyayangkan kinerja pihak kepolisian yang menangani kasus penipuan Rp500 juta ini. Saksi serta bukti-bukti penipuan yang dilakukan GU sudah dilengkapi, tapi mengapa polisi tidak menahannya,” kata Ngo Huat Poh alias Apo, 60, warga Jalan AR Hakim Medan selaku korbannya, Sabtu (14/5). Apo mengaku kesal mengapa pihak kepolisian yang menangani kasusnya mengkomprontir pengaduannya. Menurutnya, komprontir yang dilakukan tak akan menyelesaikan masalah. “Terang saja penipu itu (GU) tak mengakui semua perbuatannya jika dikonfrontir, jika dia mau mengaku maka penuh lah penjara,” jelasnya. Bahkan Apo mensinyalir

ada oknum makelar kasus (Markus) yang berperan dalam kasus yang diadukan itu sehingga pelakunya tidak ditangkap. “Diduga, T mengurus tersangka GU, 56, warga Jalan Pasar III Medan, pelaku penipuan Rp 500 juta agartidakditahanpolisi,”jelasnya. Sementara itu, tersangka GU menjalani pemeriksaan setelah mangkir dari surat panggilan pertama yang dilayangkan pihak kepolisian. GU diperiksa polisi atas dasar pengaduan Ngo Huat Poh alias Apo yang mengaku menjadi korban penipuan Rp500 juta. Penipuan itu terjadi Juli 2010. Saat itu GU menemui Apo meminjam uang tunai Rp500 juta untuk mengurus tanah. Jika urusannya selesai, maka uang pinjaman tersebut akan dikembalikannya menjadi Rp1 milyar. Apo kemudian menyerahkan uang tersebut di Hotel Danau Toba, 16 Juli 2010. Sebelumnya antara Apo dan GU telah menandatangi surat perjanjian

yang berkuatan hukum atas uang tersebut. Namun, setelah urusan GU selesai dan di atas tanah yang diurusnya sudah berdiri bangunan, GU tidak merealisasikan janjinya alias ingkar janji. Berkali-kali dihubungi, GU selalu mengelak. Merasa ditipu, kasus ini dilaporkan ke Polresta Medan, 24 Maret 2011, sesuai dengan No Pol LP/783/III/2011/ SU/Resta Medan. Kasat Reskrim Kompol Fadillah Zulkarnaen yang dikonfirmasi mengatakan, GU diperiksa dalam kasus pengaduan Ngadirin. Bukan pengaduan Apo. “Soal pengaduan Apo dengan pelaku yang sama, polisi masih mendalami kasusnya. Kalau cukup bukti pasti kita tangkap,” jelas Fadillah. Mengenai adanya Markus, Fadillah menyebutkan, tidak kenal dengan inisal T. “Saya tidak kenal T dan setiap pengaduan dari warga tetap kita proses,” jelasnya. (m39)



HUT Zionis Israel

Jangan Seperti Tidak Punya Rencana


emerintah hari ini, Senin (16/5) secara resmi meliburkan para pegawai negeri sipil di seluruh instansi pemerintah dari pusat. Pengumuman libur itu terkait perayaan Waisak yang akan jatuh Selasa (17/5). Tentu saja hal ini disambut baik oleh kalangan PNS dan itu bisa terbukti dengan berbondong-bondongnya para warga mudik liburan memanfaarkan sisa waktu libur sejak Sabtu hinggá Selasa. Memang harus diakui begitu banyak yang bersukacita dengan datangnya musim liburan walau sebelumnya libur Senin (16/5) ini tidak termasuk dalam rencana cuti bersama yang sudah sejak lama dikeluarkan pemerintah. Jika kemudian sejak awal dimasukkan dalam daftar cuti bersama, tentunya tidak akan terjadi gelombang keluhan di kalangan aparatur pemerintahan. Namun yang menjadi pertanyaan mengapa pengumuman itu tidak masuk dalam rancangan cuti bersama. Hal ini semakin menunjukkan bagaimana bangunan perencanaan manajerial pemerintahan tidak semakin baik malah semakin tidak menentu. Namur kemudian yang ada ádalah bagaimana ketakutan terhadap moda kritikan khususnya terhadap kesiapan menghadapi statu kegiatan yang sebenarnya sudah ada sejak awal. Padahal kritik yang jujur dan rasional, tanpa ada sentimen dan sikap emosional kepada lawan politik, dipandang sebagai salah satu ciri politisi yang bermoral tinggi.Kritik tidak seharusnya menjadi upaya untuk menjelekkan, menyerang, apalagi menjatuhkan lawan politik. Namun kritik itu harus menjadi sebuah jawaban dari kebuntuan langkah-langkah yang ditawarkan kepada rakyat selama ini. Kritikus, oposisi, atau penyeimbang hanya merupakan bagian dari istilah namun lebih dari itu kalau kemudian bagian itu bisa menyelamatkan bangsa ini bukan hanya sekedar manut wae, tentunya akan semakin baiklah kondisi bangsa ini. Namun paling tidak kepemimpinan merupakan faktor dominan dalam implementasi prinsip-prinsip manajemen internal. Peningkatan kualitas produktivitas kinerja merupakan fungsi yang kontinium dari proses pemberdayaan (empowering), kepedulian (care) dan kemapuan mengarahkan (coaching) staf dalam pengelolaan sumbedaya manajemen Intisari pemerintahan secara efektif dan efisien. Kepemimpinan tidak memberikan Seharusnya jangan efek yang kuat untuk membangun atakademik kecuali melakui pesampai negara ini tidak mosfir nguatan manajemen internal, maka punya perencanaan yang proses pemertahanan produktivitas harus dibangun atas penguatan fungsibaik untuk rakyatnya. fungsi manajemen yang merupakan medium yang efektif untuk membangun atmosfer pembangunan. Transparansi, akuntabilitas, pemberdayaan berbasis kompetensi, merit sistem, sistem perencanaan yang menetapkan arah dan prioritas yang jelas serta mekanisme pengendalian yang handal dapat membangkitkan suasana pembangunan yang sehat. Namun dalam kajian kali ini jelas manajerial pembangunan yang tidak baik dan tentu saja hal ini menjadi sebuah fakta bagaimana tidak mendidiknya bangsa ini untuk para generasi muda di masa mendatang. Berdasarkan dimensi waktu, fakta itu seperti obat. Dimakan pada saat yang tepat, dengan cara yang tepat dan dengan dosis yang tepat pula. Jika salah satu saja tidak terpenuhi, maka dia berubah fungsi menjadi racun yang berbahaya bagi sekujur tubuh. Fakta yang dikeluarkan hanya akibat desakan pihak tertentu, bukan karena kebutuhan, pastilah mengundang kecurigaan. Dia menjadi multitafsir dan dapat menggelinding menjadi bola salju. Fakta harus dikeluarkan sesuai kebutuhan dan saat dibutuhkan. Fakta seperti ini akan dapat menjawab masalah dan bahkan dapat mengantisipasi berbagai kerumitan. Itulah fakta yang dapat mendidik rakyat. Dan kali in, pemerintah sudah mendidik rakyatnya untuk berperilaku tidak tertib, terburu-buru dan menghentikan namanya efektifitas pada pekerjaan rutin yang sebenarnya sudah dirancang jauh-jauh hari. Memang kalaupun tidak diumumkan hari libur resmi nasional, akan ada pegawai maupun aparat pemerintah yang akan dengan sendirinya libur, namun kalau sudah dikatakan wajib masuk, manalah mungkin aparatur pemerintah akan melakukan pemberontakan dengan melawan perintah atasan. Namun demikian, apapun fenomena dibalik fakta hanya ada satu fungsinya, yakni mendidik rakyat melalui hikmah yang diberikannya. Jika ada fakta yang telah merugikan karena mengandung kebohongan publik atau kegagalan dia akan mendidik semua pihak untuk tidak mengulanginya. Jika fakta itu sebuah keberhasilan maka dia akan mendidik rakyat juga untuk meyakini, keberhasilan bukanlah sebagai tujuan akhir tetapi sebuah perjalanan yang tak kunjung henti. Namun demikan, di atas semua fakta di atas ada kepentingan yang lebih besar untuk bangkit bersama menata negeri ini dengan tekad dan iktikad baik dari semua pihak. Jadi mulailah dari sekarang menata dengan lebih baik bukan dengan terburu-buru karena yang diurus ini adalah nasib negara.****


Faks 061 4510025


0818987xxx Sedih rasanya kalau melihat dunia pendidikan kita sekarang ini, saya punya anak yang baru saja selesesai mengikuti Ujian Negara tingkat SD, begitu dia pulang ujian saya tanyakan apakah bisa mengerjakan soal, dia jawab bisa, tetapi guru pengawas kami tadi memberikan jawaban. Malam harinya saya mengingatkan anak saya untuk sedikit membukabuka buku agar dapat menjawab soal ujian besok harinya, tetapi anak saya menjawab, untuk apa toh besok guru pengawas juga sudah berjanji untuk memberikan kunci jawaban, jadi untuk apa belajar. Ini membuat saya benar-benar miris mendengarnya, sudah sebegini parahkah dunia pendidikan kita? Apakah memang UN itu diperlukan? +628136236xxxx Yth Pak KAPOLDA...Ini ada kasus judi togel tukang tulis sama pembelinya. Tapi kenapa tukang tulisnya di tangkap sedang kan si pembeli bebas gak ditangkap. Tapi instruksi nya dari kepolisian biar penulis maupun pembeli tetap ditangkap.. Nyata nya.,. Omong kosong belaka. +6282161478xxx Lapor Pak Kapoldasu ... Kasus Korupsi Miliaran Rupiah Proyek NUSSP 2009 di Pematang Pasir Kota Tg.Balai tak juga kunjung dilimpahkan ke Kejaksaan. Pak Kapolda jangan mau terima laporan ABS, kasihani rakyat Pak ! Kunjungan Bapak ke Tg.Balai sia-sia apabila kasus korupsi macet dan koruptor ketawa terkekeh-kekeh. (Forum Kota Tg.Balai). +6285278662xxx Di Asahan,ada rumah makan jual merek orang kito (Pagaruyung).tetapi yang punya orang kita Nasrani.. He...he .,sekali umat Islam kecolongan.(khususnya suku Minang) ada hukumnya tidak yaa? Jual daerah suku lain demi keuntungan pribadi. Sementara Camat, Bupati Asahan, mondar-mandir melintas di depanya. +6281362317xxx Kepada yth Bpk Bupati Deliserdang mohon di aspal gang pipit dsn Xlll jln Sidomulyo (psr 9) Sei Rotan karna di gg pipit ada sekolah yayasan Madinatussal. +6285275021xxx Bagus jembatan timbang Sibolangit yang menerapkan tonase supaya jalan tidak rusak hidup Gubsu Pak Gatot.

WASPADA Senin 16 Mei 2011

Oleh Hasrul Harahap Untuk terkonsolidasinya negaraYahudi pada 1948, Zionis mengusir 750.000 warga Palestina dari tanah airnya dan tidak pernah mengizinkan mereka atau keturunan mereka untuk kembali.


ejarah Israel adalah sejarah kekerasan. Inilah satu-satunya negara di dunia ini yang secara sistematis memproklamirkan negaranya dengan menempuh segala macam cara kekerasan untuk mencapai tujuannya. “Kuasai dan Hancurkan” adalah doktrin yang sangat populer yang dianut oleh para petinggi pemerintahan Israel. Berkaitan dengan itu, Hari ulang tahun (HUT) Israel ke 63 diperingati di Jakarta Sabtu (14/05) . Inisiator perayaan hari ulang tahun Israel tersebut adalah Samuel Dahana atau kerap dipanggil Unggun Dahana beserta teman-temannya. Infonya panitia perayaan hari ulang tahun Israel hanya memerlukan waktu sebulan untuk perayaan ulang tahun tersebut. Agenda acara HUT Israel tersebut diselenggarakan dengan sangat sederhana dengan pengibaran bendera dan menyanyikan lagu kebangsaan Israel bahkan Unggun Dahana beserta komunitasnya mengungkapkan bahwa sangat setuju dengan konsep Zionisme yang didengungkan Israel dalam memproklamirkan negaranya. Bahkan Unggun sudah mempunyai program ke depan dalam memperingati hari ulang tahun Israel dengan cara mengundang orang-orangYahudi, Nasrani dan Islam. Lebih dari itu, ke depannya perayaan ulang tahun tersebut akan diselenggarakan di kota besar seperti Jakarta, Bandung, Semarang dan kotakota besar lainnya di seluruh Indonesia. Dengan diselenggarakannya hari ulang tahun Israel di Indonesia merupakan legitimasi bagi Indonesia mengakui keberadaan negara Israel bahkan ini akan membuka ruang dan kesempatan bagi negara Israel untuk menjalin hubungan

diplomatik dengan Indonesia. Tidak hanya itu saja, Unggun juga agar mendorong terjalinnya hubungan diplomatik antara Israel dan Indonesia. Unggun berargumentasi bahwa perayaan HUT Israel merupakan bentuk toleransi dalam beragama. Argumentasi yang disampaikan oleh Unggun di beberapa media online Jakarta menurut hemat penulis sangat keliru mengingat negara Zionis tersebut kerap kali melakukan kekerasan bagi umat Islam di negara Palestina dan ini merupakan bentuk kekerasan yang luar biasa (ekstraordinary crime) . Ditambah lagi ketika masyarakat Indonesia melihat secara langsung di media televisi bagaimana kekejaman negara Israel dalam menyerang dan menginvasi negara Palestina tanpa berprikemanusiaan. Apakah ini yang disebut toleransi dalam beragama? Siapa bangsa Israel? Benih munculnya Bani Israil di permukaan bumi itu sekitar 4000 tahun silam. Pada saat itu di sebuah kota Ur wilayah Khaldea hidup seseorang bernama Terah dan keluarganya yang masih menyembah matahari dan berhala. Kemudian Terah melahirkan seorang anak yang bernama Ibarahim (Abraham) pada tahun 2018 S.M. Pada masa kelahiran Ibrahim dan dewasanya. Khaldea dipimpin oleh seorang raja yang bernama Namrud (Namruz) . Antara

Namrud dan Ibrahim berbeda kepercayaan sehingga Ibrahim harus keluar Khaldea dan mengadakan perjalanan ke negeri Kan’an. Kemudian Ibrahim memperoleh putra pertama kali dari istri yang kedua yaitu Hajar. Dari istri kedua ini lahirlah Ismail yang menjadi leluhur bangsa Arab. Putra yang kedua Ibrahim adalah Ishaq dari istri yang pertama yaitu Sarah. Ishaq yang mempunyai seorang putra yang bernam Ya’qub yang menjadi leluhur Bangsa Bani Israil. Dari garis Ya’kub atau Israil inilah lahir dua belas putra yang masing-masing mempunyai putra dan keturunan yang banyak, sehingga dalam waktu yang singkat dua belas putra tersebut menjadi satu suku yang besar dan berpengaruh di wilayah mereka. Mereka hidup menjadi pengembara dan menduduki daerah yang subur sebagai wilayah kolonialnya. Bani Israil telah menduduki berbagai wilayah yang meliputi tanah leluhurnya yaitu: Ur, Babilonia, Mesopotamia, dan Aseria, kemudian menelusuri pegunungan Mediterania sampai ke Mesir. Namun sepeninggal Yusuf, keadaan Bani Israil berubah total karena pelindungnya telah tiada. Mereka terpisah dari bangsa Mesir dan dianggap sebagai bangsa asing oleh rakyat Mesir. Kemudian terbentuklah kesenjangan sosial yang pada akhirnya menjadi problema agama dan sosial dinegeri tersebut. dikatakan sebagai problema agama karena orang-orang Mesir pribumi menyembah berhala sedangkan Bani Israil yang dianggap sebagai orang asing mengikuti ajaran nenek moyang mereka yaitu Ibrahim, Ishak, Ya’kub. Dari segi sosial orang Mesir meng-

anggap Bani Israil sebagai budak dan dikerjapaksakan serta dibatasi perkembangannya dengan cara membunuh anak laki-laki dan membiarkan hidup anak perempuannya. Selama di Mesir dan sebelum datangnya Musa, mereka turut menyembah berhala orang-orang Mesir yaitu lembu betina yang mereka namakan “Apis”. Karena kebiasaan-kebiasaan yang secara turun temurun dilakukan inilah mereka masih selalu terkenang oleh dewanya. Tonggak berdirinya kerajaan Bani Israil ditegakkan oleh Musa setelah membebaskan kaummnya dari perbudakan kerajaan Mesir. Kekuasaan ini berdiri tegak berdasarkan syari’at dan peraturan yang lengkap. Musa yang dibantu oleh saudaranya Harun membebaskan Bani Israil dari kekuasaan dan kesewenangan Fir’aun untuk menuju tanah yang dijanjikan Tuhan. Sejarah panjang Israel Konflik Palestina dan Israel menurut sejarah sudah 31 tahun ketika tahun 1967 Israel menyerang Mesir, Yordania dan Syiria dan berhasil merebut Sinai dan Jalur Gaza (Mesir) , dataran tinggi Golan (Syiria) , tepi Barat danYerusalem (Yordania) . Namun sampai sekarang perdamaian sepertinya jauh dari harapan. Ditambah lagi terjadi ketidaksepakatan tentang masa depan Palestina dan hubungannya dengan Israel di antara faksi-faksi di Palestina sendiri. Nabi Musa AS memimpin bangsa Israel meninggalkan Mesir, mengembara di gurun Sinai menuju tanah yang dijanjikan asalkan mereka taat kepada Tuhan dikenal dengan cerita Nabi Musa AS membelah laut ketika bersama dengan bangsa Israel dikejar tentara Mesir menyeberangi laut Merah. Namun saat mereka diperintah untuk memasuki tanah Palestina sangat keras kepala dan membangkang kepada Nabi Musa AS. Pada tahun 1550 SM-1200 SM politik di Mesir berubah. Bangsa Israel dianggap sebagai masalah bagi negara Mesir. Banyak dari bangsa Israel yang lebih

(Bersambung ke hal A7)

Kamuflase Proyek Multikulturalisme Oleh Nirwansyah Putra Panjaitan Adanya MoU antara suku, bangsa dan agama, justru bisa menumbuhkan ketiadaan saling pengertian ataupun ketidaksepahaman antara dan intra suku, bangsa dan agama itu sendiri.Tidak pernah ada suku, bangsa dan agama yang mengajarkan permusuhan.


arrack Husein Obama, Presiden Amerika Serikat, memuji Bhinneka Tunggal Ika. Dalam kunjungannya ke Jakarta Nopember 2010, dia bilang, “BhinnekaTunggal Ika, unity in diversity. This is the foundation of Indonesia’s example to the world, and this is why Indonesia will play such an important part in the 21st century”. Kemudian, aplaus pun membahana di kampus Universitas Indonesia. Semua bergembira, Amerika Serikat, negara paling berkuasa saat ini, memuji Indonesia. Di tengah keterpurukan yang terusmenerus mulai dari kasus korupsi, perkelahian elit politik, kisruh di seputar bencana alam, sampai prestasi sepakbola Indonesia yang tak juara-juara, ah, Obama rupanya pandai betul ber-takziah; menghibur. Indonesia pun terbius, Obama kian melambung tinggi. Obama pantas menyebutkan soal Bhinneka Tunggal Ika. Sebabnya, salah satu proyek yang dibawa Obama ke Indonesia adalah multikulturalisme. Niat multikulturalisme gaya Amerika memang pantas disebarkan di Asia Pasifik dan terutama Indonesia. Indonesia sebagai negara berpopulasi Muslim terbesar di dunia, bersama India, secara geopolitik mempunyai pengaruh besar dalam menjaga stabilitas kawasan di Asia Pasifik. Bagaimanapun, pujian Obama terhadap Bhinneka Tunggal Ika, menjadi variabel antara untuk terus bersekutu dengan Amerika. Tak aneh pula kalau pasca kunjungan Obama itu, tiba-tiba kata “multikulturalisme” di Indonesia bergema kembali, walau Bhinneka Tunggal Ika sudah sering dikatakan dalam buku-buku sejarah Sekolah Dasar kita adalah merupakan warisan nenek moyang bangsa Indonesia. Multikulturalisme Vs Bhinneka Tunggal Ika Namun, jelas sekali bila multikulturalisme gaya Eropa dan Amerika, sangatlah berlainan dengan filosofi dasar Bhinneka Tunggal Ika. Sejarah republik sudah menyebutkan kalau kesepakatan untuk bernegara dalam bingkai negara kesatuan, dilandasi atas perjuangan dan pengorbanan dari seluruh orang dan berbagai latar belakangnya di Indonesia. Latar penderitaan dan persamaan nasib sepenanggungan itu begitu kuat terasa. Dan kesepakatan itupun, maaf saja, tidak dengan mudah dicapai. Sidangsidang Badan Penyelidik Usaha Persiapan Kemerdekaan Indonesia (BPUPKI) yang cukup panas, sampai-sampai membutuhkan dibentuknya Panitia kecil Panitia Persiapan Kemerdekaan Indonesia (PPKI) untuk menjembatani perbedaan yang terjadi waktu itu. Sejarah akhirnya mewartakan kalau bayi“Indonesia” nantinya disepakati untuk memakai Pancasila sebagai ideologi negara dan Bhinneka Tunggl Ika sebagai semboyan negara. Dus, dasar dari Bhinneka Tunggal

Ika adalah kearifan untuk saling menghargai dan menghormati perbedaan yang telah ada di Indonesia. Ini berbeda dengan proyek multikultularisme yang diimpor dari Eropa dan Amerika. Proyek Eropa dan Amerika didasarkan atas trauma berkepanjangan atas rasisme dan ketakutan yang bersangatan terhadap masuknya imigran-imigran ke Eropa dan Amerika. Stabilitas Amerika Serikat pernah sangat terguncang akibat rasisme kulit putih terhadap ras kulit putih. Apalagi, Amerika Serikat punya sejarah yang sangat buruk mengenai perbudakan orang kulit hitam. Hingga kini, itu masih terasa. Ucapan “neger” dimaknai sebagai penghinaan terhadap orangorang kulit hitam (negro) . Imigran dari Amerika Selatan (kelompok hispanik) juga masih merasakan diskriminasi terutama dalam hal lapangan pekerjaan, jaminan kesehatan dan pemukiman. Antusiasme warga kulit hitam memilih Obama dan keterkejutan Amerika terhadap terpilihnya Obama yang berkulit hitam itu sebagai Presiden, adalah contoh paling nyata bahwa benak rasialis dan diskriminasi masih nyata di Amerika Serikat. Namun kini, multikulturalisme di Amerika sendiri mendapat tentangan. John Kenneth Press, penulis buku Culturism: A Word, A Value, Our Future (2007) menegaskan “ ‘Culturism’ is the opposite of ‘multiculturalism.’ The West does have a core traditional culture to guide, protect, and promote.” (Kulturalisme adalah oposisi dari multikulturalisme. Bahwa “Barat” memang memiliki kebudayaan tradisional untuk dikembangkan, dilindungi dan dipromosikan) . Inggris dan Perancis pun sudah memutuskan menghentikan proyek multikulturalismenya. Mereka kini sadar, bahwa proyek multikulturalismenya justru malah dapat mengaburkan dan pelan-pelan akan menghilangkan “kebudayaan dan peradaban asli” mereka. Presiden Prancis, Nicolas Sarkozy menyatakan, “Kami telah terlalu peduli tentang identitas orang yang datang dan tidak cukup tentang identitas dari negara yang menerima dia.” Kamuflase politik Antitesis paling mengemuka dari proyek multikulturalisme adalah setiap suku, bangsa dan agama memiliki hak untuk mempertahankan, melindungi dan mempromosikan ke-suku-an, kebangsa-an dan ke-agama-annya masing-masing. Jadi, logis sekali bila perjanjian antar agama dalam satu proyek multikulturalisme adalah naif dan kamuflase semata. Karena perjanjian itu tidak akan pernah cocok dengan karakteristik multikulturalisme itu. Lagipula untuk apa? Kesepahaman antar sesama umat beragama, kelompok suku dan kebudayaan untuk saling menghormati sudah ada dalam bingkai Bhinneka Tunggal

Ika. MoU justru akan semakin menjauhkan Indonesia dari ke-bhinneka-annya sendiri. Lagipula, bukankah Indonesia tidak hanya memiliki Bhinneka Tunggal Ika semata untuk menghargai perbedaan itu? Konstitusi sudah menjamin hak-hak paling dasar itu untuk dilaksanakan di Indonesia. Adanya MoU akan mengerdilkan peran dari Pancasila, Bhinneka Tunggal Ika dan UUD 1945 itu sendiri. Seolah-oleh ketiga perangkat dasar Indonesia itu sudah tak berkuku lagi untuk mempererat dan membingkai perbedaan. Apalagi, negara sendiri sudah memagari perangkat dasar itu dengan peraturan perundang-undangan sebagai pengawasan, perlindungan dan penegakan hukum untuk menjamin itu terjadi di Indonesia. Di Sumatera Utara misalnya. Bila Anda bersuku Batak, maka perbedaan agama tidak pernah dipermasalahkan. Yang paling kentara adalah ketika Anda mengikuti pesta-pesta adat, di mana sudah ada kesepahaman tidak tertulis untuk saling menghormati dan menghargai mereka yang Muslim ataupun non-Muslim. Seandainya mereka yang non Muslim berpesta, maka sudah ada panitia dari saudara semarga yang Muslim untuk menangani makanan yang bisa dikonsumsi oleh mereka yang Muslim. Demikian juga misalnya ketika yang Muslim mengalami kemalangan, maka bisa dipastikan saudara semarga dan dongan sahuta akan menghadiri acara takziah. Anda tak akan menemukan rasa saling curiga di antara mereka. Filosofi suku bangsa Batak sudah menjamin adanya persaudaraan yang diikat dalam tungku “Dalihan Na Tolu”. Itu perjanjian yang sudah mengikat, mempunyai makna mendalam dan dipatuhi. Bila Anda melakukan perjanjian lagi antara Muslim-non Muslim intra sukubangsa Batak, maka itu justru menandakan Anda sama sekali tidak mempunyai kepercayaan lagi dan menumbuhkan kecurigaan terhadap persaudaraan antara sesama sukubangsa Batak. Oleh karena itu, dalam sejarah di Sumatera Utara, tidak pernah (ditemukan) terjadi perjanjian untuk melakukan perdamaian atau bekerjasama, misalnya antara orang Batak yang ada di Muhammadiyah atau Al-Washliyah Sumut dengan orang Batak yang tergabung di Huria Kristen Batak Protestan (HKBP) ataupun GKPI (Gereja Kristen Protestan Indonesia) . Demikian juga dengan MoU antar suku bangsa dan agama. Di Sumut, itu tidak lazim. Sumut bukan Amerika Serikat yang diskriminasi ras masih terjadi atau seperti di Bosnia ketika terjadinya pembersihan etnis yang begitu tragis oleh Serbia. Ingatkah Anda ketika terjadinya demonstrasi Protap yang berujung pembunuhan terhadap Ketua DPRD Sumut Azis Angkat? Di tengah situasi sosial politik yang sangat rentan dengan masalah SARA itu, Sumut menyelesaikan itu secara “adat” dengan semangat persaudaraan dan penegakan hukum. Usulan Protap kini malah sudah disetujui oleh DPRD Sumut dan tandatangan oleh Plt Gubernur Sumut, Gatot Pudjonugroho yang orang Jawa itu, tinggal soal waktu saja. Tak pelak, proyek multikulturalisme yang sedang dijalankan oleh kelompokkelompok beratas nama keagamaan di Indonesia dan Sumatera Utara akhirakhir ini, justru akan mengundang kecurigaan adanya motif-motif dan permain-

an politik dengan bungkus yang begitu manis: multikulturalisme. Modus mencari dukungan sebanyak-banyaknya dari kelompok agama, bukanlah hal yang baru. Namun, perbedaan yang signifikan dari konvensi yang terjadi selama ini adanya sikap ksatria dari kelompok pen-dukung dan mereka yang sedang meng-galang dukungan. Toh, dukungan dalam politik adalah hak dasar yang tak perlu ditutup-tutupi. Tapi, proyek politik dibungkus dengan proyek multikulturalisme, adalah motif yang tidak gentleman dan cenderung berbahaya. Ini proyek yang sesungguhnya perlu dipertimbangkan matangmatang dan harus ditolak. Penolakan terhadap hal ini, justru karena setiap suku, agama dan bangsa yang di Indonesia sudah mempunyai instrumennya masing-masing untuk saling mengerti, memahami, menghormati dan menghargai. Politik yang tidak sehat memang akan selalu memakai cara-cara machiavelis; menghalalkan segala cara yang diperlukan untuk memperoleh kemenangan dan kekuasaan. Prinsip melindungi dari mayoritas dan kebesaran jiwa dari minoritas sudah ada di daerah ini. Bila di daerah lain ada masalah, maka yang perlu disorot adalah peran dan ketegasan negara untuk menegakkan itu dan bukannya mengarahkan tudingan kepada suku-suku, bangsa dan agama-agama yang ada di Indonesia. Tidak pernah ada suku, bangsa dan agama yang mengajarkan permusuhan. Penulis adalah Staf Pengajar di FISIP Universitas Muhammadiyah Sumatera Utara Sekretaris Litbang PW Muhammadiyah Sumut.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Pemprovsu keluhkan lambatnya penetapan Sekda - Mungkin perlu pukul meja, he...he...he * Dana infrastruktur Sumut 2012 Rp4,2 triliun - Jalan tetap saja berlobang * 50 persen lahan sawit dikuasai asing - Nanti kena asap ribut


D Wak


WASPADA Senin 16 Mei 2011

Reuni Akbar Alumni FIB (FS) USU Keluarga Besar Alumni Bahasa dan Sastra Indonesia (KBABSI) Fakultas Ilmu Budaya (Fakultas Sastra) USU akan mengadakan acara Reuni Akbar yang diharapkan dapat mengumpulkan alumni setiap angkatan. Kegiatan yang mengangkat tema “Bersama, bernostalgia, berkarya, dan berjaya” ini direncanakan akan digelar pada tanggal 3 Juni 2011 di halaman Fakultas Ilmu Budaya USU, Jalan Universitas No. 19 Kampus USU, Medan. Sejak berdiri lebih kurang 46 tahun yang lalu, telah banyak orang yang singgah dan belajar di Departemen Bahasa dan Sastra Indonesia, Fakultas Ilmu Budaya USU. Seiring dengan itu, telah banyak alumni yang dihasilkan dan tersebar di mana-mana. Nah, untuk menghimpun alumni yang tersebar inilah salah satu alasan mengapa kegiatan ini dilaksanakan. Kegiatan reuni akbar ini bertujuan untuk (1) menjalin dan mempererat silaturahim antaralumni Bahasa dan Sastra Indonesia Fakultas Ilmu Budaya USU, (2) membina komunikasi dan kerja sama, baik antarsesama alumni maupun antara alumni dengan almamater, dan (3) menyosialisasikan Keluarga Besar Alumni Bahasa dan Sastra Indonesia (KBABSI) Fakultas Ilmu Budaya USU yang baru dibentuk ke masyarakat luas. Rangkaian acara yang akan dilaksanakan pada reuni alumni kali ini adalah urun rembuk alumni (mengumpulkan pokok pikiran, ide, dan saran alumni untuk disumbangkan ke almamater) , Pelantikan Pengurus KBABSI FIB USU Periode 2011—2013, malam keakraban, hiburan, dan hadiah lawang (lucky draw) . Kegiatan ini akan diikuti oleh alumni dari semua angkatan, civitas akademika Departemen Sastra Indonesia Fakultas Ilmu Budaya USU, dan para undangan. Ketua Panitia Anharuddin Hutasuhut Sekretaris Panitia Agus Bambang Hermanto

Penggusuran Padagang K5 Masalah klasik yang selalu terulang di negeri ini adalah persoalan penggusuran pedagang kaki lima (K5). Banak masyarakat yang masih berminat untuk bertransaksi dengan pedagang ini, tapi tidak sedikit juga yang merasa terganggu karena aktifitasnya. Tidak lain karena banyak pedagang K5 yang beroperasi di pinggir jalan bahkan tidak jarang mamakai badan jalan sehingga menyulitkan pengguna jalan. Tapi masalah ini diperparah dengan sikap pemerintah yang setengah hati dalam penanganannya. Lihatlah badan jalan yang dibangun untuk pengendara itu. Kanan kirinya akan dipasangi lapak-lapak pedagang yang mempersempit badan jalan. Jika masih sedikit dan belum besar masalah yang ditimbulkannya, sikap pemerintah cenderung mendiamkannya. Tapi baru sibuk menggusurnya ketika sudah bertahun-tahun lamanya dan sudah sangat banyak jumlahnya (sehingga tingkat kerugiannya pun juga besar). Lihatlah di sekitar Jalan Pancing Simpang Unimed. Di daerah ini pemerintah daerah telah melakukan penggusura dan semuanya telah bersih dari pedang K5. Tetapi seperti biasa, satu per satu tumbuh lagi dan sikap pemerintah mendiamkannya. Mungkin tunggu sampai banyak jumlahnya dan lebih sulit penanganannya baru dilakukan pendisiplinan. Mungkin begitu ya pa..?

Negeri Para Pencuci Uang Oleh Arfan Adha Lubis Rezim anti pencucian uang dibangun dengan filosofi sita dulu uang atau hartanya, baru bereskan orangnya.


ndonesia dikenal dunia sebagai “surga” pencucian uang kata Wakapolri Komjen Pol. Nanan Soekarna pada sosialisasi Pencegahan dan PemberantasanTindak Pidana Pencucian Uang dari Perspektif UU No. 8 Tahun 2010, di Medan (Waspada, 15/ 4/2011, hal. B 3). Suatu ungkapan jujur untuk mengakui betapa rentan dunia hukum dan perbankan dalam mengantisipasi serta mengeliminir Tindak Pidana Pencucian Uang (TPPU). Hal tersebut diperunyam ketika produk legislasi melahirkan deregulasi memberantas TPPU terkesan setengah hati. Tataran pensosialisasian UU No.8 Tahun 2010 baru sampai pada level atas. Banyak aparat penegak hukum bahkan keuangan akademisi belum memaknai lahirnya UU No. 8Tahun 2010 sebagai payung hukum (the umbrella act) baru TPPU, menggantikan UU No. 25Tahun 2003 jo UU No. 15 Tahun 2002. Rentannya sistim hukum ditambah kerahasiaan bank begitu ketat, mengakibatkan Indonesia sasaran empuk pelaku pencucian uang (money laundering). Notabene pelaku TPPU rata-rata mempunyai inteligensi tinggi didukung perangkat. TPPU merupakan kejahatan kerah putih (white collar crime) dan dilakukan secara terorganisasi (organized crime). TPPU dilakukan dengan memanfaatkan kecanggihan teknologi dari manual hingga extra sophisticated atau super canggihyangmemasukiduniamaya(cyber spa-ce) sehingga kejahatan kerah putih da-lam bidang pencucian uang disebut cy-ber laundering merupakan bagian dari cyber crime yang didukung pengetahuan tentangbank,bisnis,danelectronicbanking yang cukup (Adrian Sutedi, 2008: 100) Pengaturan TPPU Berdasarkan Pasal 1 angka 1 UU No. 8 Tahun 2010, definisi Pencucian Uang yaitu“segala perbuatan yang memenuhi unsur tindak pidana sesuai dengan


*** Jauh sebelum komputer tablet jadi teman bermain orang zaman sekarang, ada satu masa di mana hidup berjalan lambat. Kala itu di Medan masih banyak tempat belum tersentuh listrik. Malam jadi begitu klasik. Orang-orang tua satu-satu jalan ke masjid, ke pengajian ataupun sekedar bertandang ke rumah tetangga. Di ihat dari kejauhan, lampu senter di tangan seperti menarinari. Derap langkah dan gerakan lampu senter itu sudah cukup mengenali siapa yang datang. Si Polan dikenali karena kelincahannya memainkan senter di tangan, sedang si Anu punya cara berjalan yang khas. Betapa gelap itu memberi kemampuan lebih hebat bagi indera masyarakat kala itu. Pasangan muda-mudi bisanya menghabiskan malam dengan duduk-duduk di depan rumah yang umumnya masih berhalaman luas itu. Saya ingat, tidak jarang suasana apel berjalan kaku. Bukan cuma karena masih kentalnya budaya malu-malu, tapi pertemuan “sakral” itu sering dihadiri ibu, bapak, paman, bibi, termasuk anak-anak seperti saya. Sang cowok biasanya bermodalkan makanan ringan untuk sekedar membuat suasana yang kaku bisa lebih hidup. Tapi tak banyak pilihan untuk makanan ringan itu,

Ketentuan rahasia bank Pengertian rahasia bank menurut Pasal 1 angka 28 UU No. 10 Tahun 1998 tentang Perubahan Atas UU No. 7 Tahun 1992 tentang Perbankan adalah “Segala sesuatu yang berhubungan dengan nasabah penyimpan dana dan nasabahnya.” Pengertian ini meliputi unsur

Oleh Masrizal

Ketidakmapanan Salah satu gangguan dalam tidur kami adalah mati lampu di tengah malam. Bukan karena saya tidak nyaman tidur dalam gelap tapi karena reaksi anak-anak ketika terbangun. Mereka akan panik begitu mendapati berada dalam suasana gelap. Mereka akan histeris tapi tak berani beranjak dari tempatnya. Awalnya mereka berteriak-teriak, kemudian memanggil-manggil sampai akhirnya dua anak saya itu hanya saling menyemangati dalam ketakutan. Kamar mereka yang berseberangan dengan kamar kami membuat suara mereka jadi terdengar sayup-sayup. Pernah suatu ketika agak lama baru saya terbangun dan menyadari ada teriakan dari kamar anak-anak. ‘’Udah dek, jangan takut, kita di sini aja nunggu ayah,’’ kata si sulung dengan suara diselingi tangisan. ‘’Iya, kita di sini aja. Jangan nangis nanti ayah datang,’’ kata si adik juga sambil menangis tak kalah seru. Saya kemudian mendapati mereka di pojok tempat tidur berdua sambil berpegangan tangan. Merekapun berhamburan memeluk saya, sebelum akhirnya tidur lagi setelah cahaya pengganti dinyalakan. Suasana malam kembali tenang, tapi imajinasi saya melanglangbuana ke masa lalu.

ketentuan dalam undang-undang ini”. Tindak pidana asal (predicate crime) sebagaipemicuterjadinyapencucianuang menurut Pasal 2 ayat (1) UU No. 8 Tahun 2010 adalah korupsi, penyuap-an, narkotika, psikotropika, penyelundu-pan tenaga kerja, penyelundupan mig-ran, kejahatanbidangperbankan,pasarmodal, perasuransian, kepabeanan, cukai, perdagangan orang, perdagangan senjata gelap, terorisme, penculikan, penggelapan, penipuan, pemalsuan uang, perjudian, prostitusi, perpajakan, kehutanan, di bidang lingkungan hidup, dan kelautan serta perikanan. Pemberlakuan UU No. 8 Tahun 2010 merupakan langkah maju memperkuat rezim pemberantasanTPPU di Indonesia. Ada beberapa hal krusial diatur dalam TPPU seperti: redefinisi pengertian hal terkait dengan TPPU, penyempurnaan kriminalisasi TPPU, perluasan pihak pelapor, pemberian kewenangan kepada penyidik tindak pidana asal untuk menyidikdugaanTPPU,penataankembali kelembagaanPusatPelaporandanAnalisis Transaksi Keuangan (PPATK), serta penataan hukum acara pemeriksaan TPPU. UU No. 8 Tahun 2010 dikeluarkan menyempurnakan UU No. 25Tahun 2003 tentang Perubahan atas UU No. 15Tahun 2002 yang mempunyai kelemahan antara lain, kriminalisasi perbuatan pencucian uang multi interpretatif, banyaknya unsur harus dipenuhi atau dibuktikan, kurang sistimatis dan kurang jelas klasifikasi perbuatan yang dapat dijatuhi sanksi serta bentuk sanksinya, dan terbatasnya pihak pelapor.

selain warung terdekat berjarak lumayan jauh, pedagang yang melintaspun masih satu persatu. Kalaupun ada, hanya di jam tertentu saja. Ada satu penjual kacang koro yang saya ingat jadi favorit orang kampung kala itu. Pedagang keliling ini membawa sepeda yang diberi bak pada bagian boncengannya. Ada lampu minyak yang senantiasa hidup sepanjang perjalanannya berjualan. Semuanya berlangsung di dalam gelap yang meremangremang. Pada masa ini malam berlangsung singkat. Sekira jam 9 malam orang sudah tutup pintu dan naik ke peraduan. Banyak yang terbiasa tidur dalam kegelapan, atau paling tidak dalam suasana remang-remang. Lampu teplok yang menjadi alat penerang utama pada waktu itu cukup dikecilkan atau dilapisi kertas agar cahayanya tidak terlalu terang. Dalam kesederhanaan dan keakraban dengan gelap malam, orang malah bisa lebih menikmati cahaya bulan. *** Sunyi dan tenang itu adalah peristiwa sederhana. Kita tidak perlu teknologi atau berpikir keras untuk menemukannya. Tapi kesederhanaan itu pula yang sekarang ini identik dengan ketidaknyamanan atau kekurangmapanan bahkan penderitaan. Kalau Anda memilih bersepeda sebagai transportasi utama— maka Anda akan dianggap miskin atau pura-pura miskin—tidak peduli seberapa besar ketenangan yang Anda rasakan. Padahal, dalam ketenangan yang tidak tergesa-gesa itu orang bisa menemukan jalan bagi tumbuhnya imajinasi. Seperti Wilbur dan Orville Wright yang berimajinasi bisa terbang ketika melihat burung. Kedua bersaudara ini kemudian menciptakan pesawat terbang; Seperti Sir Isaac Newton yang menemukan hukum gravitasi ketika melihat apel jatuh; Seperti Ibrahim AS yang menemukan Tuhan Yang Maha Tinggi ketika mendapati bulan dan matahari terbenam. Bukankah untuk jadi pemain sepakbola kelas dunia, orang harus latihan ketat, seorang prajurit baru dikatakan elit ketika telah mengikuti latihan berat. Seorang pesenam profesional bahkan harus berlatih dari usia belia dengan berbagai pantangan. Mereka dengan sengaja memasuki suatu kondisi ketidaknyamanan untuk meraih prestasiprestasi yang menghidupkan. Begitulah rumusnya; ketidakmapanan itu akan menemukan jalan bagi tumbuhnya kekuatan-kekuatan. Sebaliknya kemapanan yang menyeluruh itu cenderung melenakan.(Vol.227, 16/5/2011)

Kolom foliopini dapat juga diakses melalui

subyektif, yaitu diri nasabah dan unsur obyektif, yaitu simpanan nasabah. Dengan demikian, pengertiannya meliputi segala sesuatu mengenai diri penyimpan dana dan simpanannya harus dirahasiakan oleh bank, misalnya nama nasabah, alamat, nomor rekening, nomor mobil, hobi, dan keluarga nasabah (Yunus Husein, 2010: 116). Kewenangan penyidik dalam TPPU dikaitkan dengan rahasia bank di atur dalam Pasal 72 ayat (1) dan ayat (2) UU No. 8 Tahun 2010. Ayat (1) berbunyi “untuk kepentingan pemeriksaan dalam perkara tindak pidana Pencucian Uang, penyidik, penuntut umum, atau hakim berwenang meminta Pihak Pelapor untuk memberikan keterangan secara tertulis mengenai Harta Kekayaan dari: a.Orang yang telah dilaporkan oleh PPATK kepada penyidik; b.Tersangka, atau; c.Terdakwa Ayat (2)“Dalam meminta keterangan sebagaimana dimaksud pada ayat (1), bagi penyidik, penuntut umum, atau hakim tidak berlaku ketentuan peraturan perundang-undangan yang mengatur rahasia bank dan kerahasiaan transaksi keuangan lain”. Kemampuan penegak hukum Banyak penegak hukum belum memahami secara komprehensif TPPU. Sebagian berasumsi TPPU kejahatan subsider atau kejahatan anak dari kejahatan utama. Kalau kejahatan utama misalnya, korupsi belum bisa dibuk-tikan, TPPU tidak bisa diperiksa terlebih dahulu. Asumsi ini berpendapat kalau harta orang belum jelas kejahatannya disidangkan, akan menimbulkan fitnah dan akan mengundang diajukan tuntutan pencemaran nama baik oleh tersangka. Padahal, rezim anti pencucian uang dibangun denganfilosofisitaduluuangatauhartanya, baru bereskan orangnya. Rezim ini berupaya merampas uang atau harta haram yang merupakan darah dari semua kejahatan.TPPU adalah tindak pidana yang dapat berdiri sendiri dan dapat diproses secara terpisah ataupun bersamaan dengan tindak pidana asal (Adrian Sutedi, 2008: 217). Dalam hal adanya dugaan aliran dana mencurigakan penyidik bisa mela-

kukan penyelidikan awal terlebih dahulu. Seperti kasus Adelin Lis dalam perkara illegal logging. Namun sayang Jaksa tidak menggunakan delik pencucian uang dalam kasus itu. Begitu juga kasus Bank Likuiditas Bank Indonesia (BLBI) atas nama Anthony Salim dan Sjamsul Nursalim sebesar Rp10,09 triliun (Yunus Husein, 2008: 167). Malahan kasus ini berakhir SP3 (Surat Perintah Penghentian Penyidikan), dengan alasan tidak diperoleh alat bukti yang cukup, dan perbuatan disangkakan bukan tindak pidana. Akhirnya SP3 dipraperadilankan, karena disinyalir adanya permainan Jaksa Urip Tri Gunawan dengan Samsul Nursalim serta pihak mengeluarkan SP3. Hal sama terjadi pada kasus Gayus Halomoan Tambunan. Walau jelas terindikasi harta kekayaannya berasal dari korupsi dan kejahatan di bidang perpajakan (vide Pasal 2 ayat (1) huruf a dan v UU No. 8 Tahun 2010), tidak diterapkan delik pencucian uang pada kasus tersebut. Penutup Kita berharap UU No. 8 Tahun 2010 sebagai payung hukum (the umbrella act) TPPU bisa berjalan lebih efektif. Walau disadari masih ada kelemahan, seperti Pasal 71 ayat (7) UU No. 8 Tahun 2010 berbunyi: “Harta kekayaan yang diblokir harus tetap berada pada pihak pelapor bersangkutan.” Lebih lanjut tidak jelas bagaimana sekiranya kalau setelah 30 hari pemblokiran rekening itu dibuka, ke mana harta itu perginya? Di dalam penjelasan Pasal 71 ayat (7) UU No. 8 Tahun 2010 hanya dikatakan cukup jelas. Kita berharap ke depan tidak ada lagi perbedaan penafsiran tentang TPPU antara Penyidik, JPU dan hakim karena kurangnya sosialisasi UU No. 8 Tahun 2010. Kita berharap tidak ada pihak-pihak mencoba mengkooptasi kepentingan mendesain produk legislasi sebagai“proyek” dan “bagi-bagi kue”. Celakalah produk legislasi kalau instrumennya bukan untuk mencapai masyarakat yang adil dan makmur. Penulis adalah Dosen STMIK LOGIKA Medan, Alumni FH-UMSU.

Saatnya Model Kesejahteraan Sosial

Dari Putra Jalan Pancing Medan

Dedi Sahputra


Strategi yang digunakan perlu mendapat perhatian dalam menghadapi era globalisasi ini meliputi dua dimensi, yaitu eksternal dan internal


isruh yang terjadi pada saat memperingatihariburuhsedunia tanggal1Mei2011lalutelahmembuktikan kepada kita semua bahwa Indonesiamerupakansalahsatunegarayang belumsepenuhnyamenjalankanprogram jaminan sosial. Hal ini bisa kita saksikan di berbagai media cetak dan media elektronik. Peringatan Hari Buruh Sedunia yang dilakukan ratusan ribu massa buruh, petani, nelayan, mahasiswa, dan kaum miskinkota,yangtergabungdalamKomite Aksi Jaminan Sosial (KAJS). Secara serentak aksiitudilakukandiberbagaiprovinsi(Jawa Timur, JawaTengah, Banten, Jogja, Kepulauan Riau, Sumatera Utara, Kalimantan Timur, Sulawesi Selatan, Gorontalo, dan daerah lain yang ada di Indonesia) mereka mendesak DPR dan pemerintah segera mengesahkan RUU Badan Penyelenggara Jaminan Sosial (BPJS), yang merupakan aturan lanjutan dari UU Sistim Jaminan Sosial Nasional (SJSN). Selanjutnya Mukhyir Hasibuan, Ketua Umum Pimpinan Daerah Konfederasi Serikat Pekerja Seluruh Indonesia (DP KSPSI) Sumatera Utara, mengatakan bahwa Jika upah yang diterima karyawan tidak dapat memenuhi kebutuhan sehari-hari baik sandang maupun papan apalagi pemenuhan pendidikan, lanjutnya, pasti karyawan akan mencari upah atau uang masuk sampingan (,12/05/2011). Hal ini membuktikan bahwa kesejahteraan buruh masih diabaikanolehpihakpenggunajasaburuh, padahal Undang-Undang Sistim Jaminan SosialNasionaldinegarainitelahdisahkan. Ketika berbicara jaminan sosial erat kaitannya dengan kesejahteraan sosial, karena Jaminan sosial bagian dari kesejahteraan sosial. Untuk di era sekarang, sering timbulpertanyaansiapayangbertanggung jawab, dan kapan dijalankan model sistim

kesejahteraan sosial? Pertanyaan ini sering muncul ke permukaan karena memang format penanganan masalah kesejahteraan di berbagai dunia sangat bervariasi. Jika dikaitkan dengan model sistim kesejahteraansosialdiberbagainegaradidunia, sedikitnya kita mengenal empat model sistim (yang didasarkan pada alokasi anggaran) untuk kesejahteraan sosial, yakni: Pertama,model universal yang dianut oleh negara-negara Skandinavia, seperti Swedia, Norwegia, Denmark dan Finlandia. Dalam modelini,pemerintah menyediakan jaminansosialkepadasemua warga negara secara melembaga dan merata. Anggaran negara untuk program sosial mencapai lebih dari 60% dari total belanja negara. Kedua, model institusionalyangdianut oleh Jerman dan Austria. Seperti model pertama, jaminan sosial dilaksanakan secara melembaga dan luas. Akan tetapi kontribusi terhadap berbagai skim jaminan sosial berasal dari tiga pihak (payroll contributions), yakni pemerintah, dunia usaha dan pekerja (buruh). Ketiga,modelresidualyangdianutoleh Amerika Serikat, Inggris, Australia dan Selandia Baru. Jaminan sosial dari pemerintah lebih diutamakan kepada kelompok lemah, seperti orang miskin, cacat dan penganggur. Pemerintah menyerahkan sebagian perannya kepada organisasi sosial dan Lembaga Swadaya Masyarakat (LSM) melalui pemberian subsidi bagi pelayanan sosial dan rehabilitasi sosial kepada swasta.


jalan menganggapYahudi yang diperlakukan sebagai warga negara kelas pertama. Agar tercipta dan terkonsolidasinya negara Yahudipada1948, Zionismengusir750.000 warga Palestina dari tanah airnya dan tidak pernah mengizinkan mereka atau keturunan mereka untuk kembali. Selain itu, pasukan Israel menghancurkan lebih 400 kampung bangsa Palestina dan membantai sekitar tiga lusin penduduknya. Pada 1967, orang-orang Israel memaksa 350.000 warga Palestina lainnya untuk melarikan diri ke Tepi Barat dan Gaza serta 147.000 Syria dari Daratan Tinggi Golan. Sejak 1967 Israel telah menempat-kan seluruh penduduk Palestina dari berbagai wilayah di bawah pendudukan militer. Akibat dari pengusiran warga Palestina dan Arab lainnya membuat rasa sakit umat Muslim di seluruh dunia. Tak bisa disangkal lagi ini merupakan alamat perang Barat melawan seluruh bangsa Arab dan Muslim di manapun. Salah satu aksi terorisme Israel yang paling terkenal terjadi selama perang 1948 tatkala pasukan-pasukan Yahudi, anggota gerakan bawah tanah LEHI (juga dikenal sebagai Stern Gang)

(Lanjutan dari hal A6) pintar dari orang asli Mesir dan menguasai perekonomian. Oleh pemerintah Fir’aun bangsa Israel diturunkan statusnya menjadi budak. Kemudian pada tahun 1967 IsraelmenyerangMesir, YordaniadanSyria selama 6 hari dengan dalih pencegahan, IsraelberhasilmerebutSinaidanJalurGaza (Mesir) , dataran tinggi Golan (Syiria) ,Tepi Barat dan Yerusalem (Yordania) . Israel denganmudahmenghancurkanangkatan udaramusuhnyakarenadibantuinformasi CIA (Central Intelligence Agency) . Sementara itu angkatan udara Mesir membalas serangan Israel, karena Menteri Pertahanan Mesir ikut terbang dan memerintahkan untuk tidak melakukan tembakan selama dia berada di udara. Dosa besar Israel Dosa besar Israel adalah Zionisme, ideologi yang menggantikan Palestina dengan negaraYahudi. Akar masalahnya adalah struktur eksklusif Zionisme dengan

Terakhir,model minimal yang dianut oleh negara-negara latin (Prancis, Spanyol, Yunani, Portugis, Itali, Chile, Brazil) dan Asia (Korea Selatan, Filipina, Srilangka). Anggaran negara untuk program sosial sangat kecil, di bawah 10 persen dari total pengeluaran negara. Dengan catatan, kecilnya anggaran kesejahteraan sosial untuk negara-negara Asia Tenggara dan Selatan nampaknya terkait erat dengan keterbatasan anggaran negara secara keseluruhan. Dari ke empat model kesejahteraan sosial di atas hendaknya bisa kita jadikan acuan dalam pembangunan kesejahteraan sosial. Sekarang bukan saatnya lagi kita mementingkan kepentingan pribadi dan kelompok, tetapi harus memikirkan nasib rakyat keseluruhan. Sungguh tidak bisa dibayangkan jika founding fathers negara kita melihatkeadaannegara yang dulu mereka perjuangkan dengan susah payah, kini telah disia-siakan. Sungguh ironis sekali hidup mereka, sebuah ideologi yang nyarissempurnadiinjakinjak oleh mereka yang tidak berkepentingan. Pancasila dan Undang-Undang 1945,yangdirumuskan dengan susah payah oleh pendahulu negara ini hanyalah tinggal wacana. Setiap bunyi dari silanya hanyalah tinggal wacana semata. Padahal telah jelas disebutkan dalam UU. 45 dalam pasal 27, 33, dan 34, yang berhubungan dengan prinsip keadilan sosial dalam mensejahterakan rakyat. Prinsip keadilan sosial di Indonesia terletakpadausahasecarabersamaseluruh komponen bangsa dalam mewujudkan kesejahteraan sosial. Sehingga tidak ada yang paling utama dalam pembangunan kesejahteraan sosial. Pembangunan sosial adalah tanggung jawab pemerintah, juga masyarakat, dunia usaha dan komponen lainnya. Konsekuensinya harus terjadi

saling sinergi dalam penanganan masalah sosial antara pemerintah, masyarakat, duniausahabahkankhususnyaperguruan tinggi sebagai pencetak kader bangsa. Indonesia telah memasuki pembangunanjangkapanjangtahapkedua(PJPTII),danakanmemasukieraglobalisasipada tahun 2020 mendatang. Strategi yang digunakanperlumendapatperhatiandalam menghadapi era globalisasi ini meliputi dua dimensi, yaitu eksternal dan internal. Ditinjau dari aspek eksternal, kita harus mampu berpartisipasi dengan memanfaatkan peluang-peluang yang ada sehingga dapat memasuki medan global itu sendiri. sedangkan ditinjau dari aspek internal, kita harusmempersiapkandiriuntukmengantisipasi dan mengambil manfaat yang sebesar-besarnya seiring dengan masuknya kekuatan-kekuatan global kedalam kehidupan kebangsaan, kenegaraan dan kemasyarakatan. Hal-hal yang perlu kita perhatikan adalah harus menghadapi globalisasi tersebut secara bersama, dan bersatu dengan semangat solidaritas. Dalam konteks ini kita harus melihat duasasaranyanghendakdicapaidansaling terkait, yaitu yang kuat harus berusaha untukdapatmemasukimedanglobaldengan memperbesarkan kekuatan dan meningkatkan kemampuannya. Sedangkan yang lemah dan masih tertinggal harus diperbesar keberdayaannya. Dengan demikian, timbul keterkaitan struktural-fungsionalstrategis antara upaya progresif untuk dapat memasuki era pertumbuhan global, dan upaya menjamin kelangsungan hidup bagi lapisan masyarakat lemah. Begitu juga dengan perguruan tinggi (PT) harus menyiapkan sumber daya manusia, bagaimana kita harapkan perguruan tinggi di Indonesia harus adanya kerjasama dengan pemerintah dan legislatif sebagai lembaga yang mengontrol kinerja pemerintah bisa menjalankan fungsi dan perannya dengan baik. Sehingga kesejahteraan sosial akan terwujud di Indonesia, dan dalam menanganinya selalu bersama (antar stakeholder) saling bersinergi. Semoga!

yang membunuh Pangeran Swedia Folke Bernadotte, mediator PBB. Bernadotte dibunuh pada 17 September 1948 sehari setelah dia menawarkan rencana mediasi kedua yang di antaranya menyerukan kompensasi bagi pengungsipengungsi Palestina. Dosa besar negara Israel yang paling nyata adalah dengan membubarkan negara-negara Arab. Rencana strategis Israel untuk membubarkan negara Arab tersebut salah satunya adalah dengan menghancurkan kedalam unit-unit sektarian yang lebih kecil dijelaskan secara gamblang oleh Oded Yinon seorang ahli strategi Israel. Oded menunjuk kepada “perang sipil sesungguhnya” yang terjadi sekarang ini antara mayoritas Sunni dan minoritas Syiah yang berkuasa di Syria.

mengatasi persoalan yang menyangkut perpecahandiantaraumatberagama.Hari ulang tahun Israel yang akan diperingati oleh Unggun Cs secara sederhana diharapkan tidak menjadi pemicu disintegrasi bangsa. Semua elemen bangsa harus terlibat menyoroti semua persoalan di tengah masyarakat.Tetapiyangperludiperhatikan dari ini semua adalah bagaimana hak-hak rakyat dapat diakomodir dan difasilitasi oleh penyelenggara negara tanpa merugikan kelompok lain dalam melakukan kegiatan yang beraroma agama. Mudahmudahan apa yang direncanakan Unggun Cs untuk memperingati HUT Israel dapat dipikir ulang mengingat resistansi masyarakat Indonesia khususnya umat Islam sangat rentan dengan negara yang tidak punya toleransi terhadap ummat Islam tersebut. Sudah cukup persoalan Palestina dan negara Arab lainnya menjadi cermin bagi kita semua dalam melihat konflik agama diantara negara tersebut.

Penutup Di Tengah distorsi fungsi negara persoalan yang sangat serius yang menimpa bangsa ini adalah rapuhnya peran negara dalam melakukan kontrol terhadap halhal yang menyebabkan konflik horizontal diantara masyarakat. Diharapkan kemudian agar pemerintah secara preventif bisa

Penulis adalah Dosen Sosiologi FISIP Universitas Syiah Kuala Banda Aceh.

Penulis adalah Mahasiswa Pascasarjana Universitas Negeri Jakarta Jurusan Linguistik Terapan dan Peneliti di Candidate Center


A8 07:30 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Seputar Peristiwa 13.00 Sinema Siang Cewek Cantik Di Kandang Itik 15.00 Kabar-Kabari 16.00 Rumah Gokil 17.00 Seputar Indonesia 17:30 SILET 18.30 Mega Sinteron Putri Yang Ditukar 20.15 Mega Sinetron Anugerah 22:30 Mega Sinema 13 Gaun Pengantin Indah


07.15 Inbox 09:00 Liputan 6 Terkini 09:03 Halo Selebriti 10:00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12.30 SCTV FTV 14:00 SL Liputan 6Terkini 14:30 Status Selebriti 15:00 Uya Emang Kuya 16:00 Cinta Juga Kuya 16:30SCTVRealitySensasi Artis 17:00SLLiputan6Petang 17:30 Istiqomah 18:00 Islam KTP 21.00 Pesantren & Rock n Roll 22:33 SCTV FTV Utama

07:00 Animasi Spesial 08:30 Layar Pagi 11:30 Lintas Siang 12:00 Layar Kemilau 13.30 Cerita Siang 15.00 Upin & Ipin 16:00 Lintas Petang 16:30 Aksi Juara 17.00 Zona JUara 18.00 Animasi Spesial 19.00 Upin & Ipin 20:00 Panggung Bintang Spotlight 23.00 Demi Bangsa 23:30 Lintas Malam

07.00 The Adventure Of Little Carp 09.30 Sinema Pagi 10.00 Acak Acak 11.30 Topik Siang 12.00 Klik! 13.00 Sinema Siang 15.00 Seleb Ngamen 17.00 Topik Petang 17.30 Katakan Katamu 18.35 Dokumenter 19.30 Kembali Bergoyang 21.00 Penghuni Terakhir 22.00 Topik Kita 22.30 Black In News 23.00 Ripley’s Believe It Or Not Season 00.00 Topik Malam

07.00 Sensasi Artis 07.30 FTV Pagi 09.30 FTV Drama 11.30 Patroli 12.00 DongYi, Jewel In The Crown 13.00 Bad Boy 15.00 KiSS Sore 15.30 Fokus 16.30 Cruel Temptation 17.00 Artis Sahabat 18.00 Dia Anakku 19.00 Nada CInta 20.00 Antara Cinta Dan Dusta 21.00 Cahaya CInta 22.00 Mega Asia : Once A Time In China 01.00 Fokus Malam

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Pippa Middleton Versus Chelsy Davy Sarah Ball dari Vanity Fair menulis ulasan sedikit lucu mengenai perbedaan dua perempuan yang kini paling sering disandingkan dengan Pangeran Harry dari Kerajaan Inggris. Kedua perempuan muda itu adalah Pippa Middleton, adik Kate Middelon, istri yang baru saja dinikahi pewaris tahta Kerajaan Inggris, Pangeran William. Perempuan satunya lagi siapa lagi kalau bukan Chelsy Davy kekasih Pangeran Harry, adik Pangeran William. PENAMPILAN: Pippa: Selalu ingin tampil prima dan menghabiskanwaktu45menithanyauntukmerias bulu matanya. Adik Kate Middelton ini bak adonan kue karamel. Lengannya kokoh. Chelsy: Bodinya semlohay, mata birudan rambutpirangbergelombang. Selalumengenakan busana yang mengesankan dipakai terburu-buru, alias awut-awutan. Pavoritnya adalah bikini, rokok, blus jeans pendek ketat, dan kacamata ber-frame gede. BIOGRAFI: Pippa: Philippa Charlotte Middleton (27) lahir pada 1983 dan dibesarkan di Bucklebury, Inggris, di sebuah rumah indah dengan angsaangsa bertebaran di berandanya. Seperti Kate dan abangnya yang lain, James, Pippa bersekolah di Marlborough College di Wiltshire. Chelsy: Sementara Chelsy Davy (25) lahir pada 1985 di Zimbabwe dari satu keluarga kaya raya. Ayahnya adalah pemilik perusahaan safari. Sejak bertemu Pangeran Harry di CapeTown pada 2004, Davy bolak balik antara London dan Afrika. PROFESI: Pippa: Menggeluti perusahaan keluarga. Pippa yang menawan adalah perancang pesta yang profesional. Dia juga editor mingguan online, The Party Times. Dia juga pekerja paruh waktu untuk Table Talk, perusahaan perancang pesta mewah berbasis di London. Chelsy: Sedangkan Chelsy adalah pengacara yang memulai karir pada Allen & Overy, sebuah firma hukum terkenal di London. Davy adalah lulusan fakultas hukum Universitas Leeds, yang jelas termasuk kampus serius.

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Metro Xin Wen 11.05 e Lifestyle 13.05 Zero to Hero 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Prime Interview 21.05 Top Nine News 22.05 Economic Challenges 23.05 Metro Realitas 23.00 Metro Sports

WASPADA Senin 16 Mei 2011

07.30 Rangking 1 08.30 Derings 10.00 Suami Suami Takut Istri 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Online (Olga & Jeng Kellin) 14.30 Extravaganza 15:30 Tangan Di Atas 16.00 Gong Show 17.00 Reportase Sore 18.00 Jika Aku Menjadi 18.45 Big Brother Indonesia 20.00 Go GO Girls 21.00 Bioskop TRANS TV 23.00 Bioskop TRANS TV 01.00 Reportase Malam 23.30 Metro Sports

06.30 Apa Kabar Indonesia 09.30 Kabar Pasar Pagi 10.00 Coffee Break 11.30 Kabar KEadilan 12.00 Kabar Siang 13.30 Mutumanikam 14.00 Yang Terlupakan 14:30 Jendela Usaha 15.00 Kabar Pasar 16.00 Bang One Show 16.30 Tahukah Anda 17.00 Kabar Petang 19.30 Suara Keadilan 20.30 Apa Kabar Indonesia Malam 22.30 Tokoh 23.30 Kabar Arena

JAKARTA bagai magnet Setelah Justin Bieber, Jason Mraz, Bruno Mars, Santana dan Avril Lavigne akan menggelar konser di Jakarta; kini giliran Kylie Minogue bakal menyambangi publik pecinta musik di tanah air. Pippa Middleton/ sang ibu, aktif di acara-acara penggalangan dana, dan pesta-pesta pernikahan di desanya. Chelsy: Chelsy menyukai melancong, dugem,dan merokok. Ketika di London, dia sering terlihatberadaditempat-tempatsepertiklubBoujis, Public,andMahikidimanateman-temannyaadalah Putri Eugenie dan Putri Olivia dari Kerajaan Inggris.

SKANDAL Pippa: Dia menggelar pesta dansa beberapa hari setelah acara pernikahan kerajaan usai. Lalu, sebuah foto Pippa tanpa pakaian atas yang memperlihatkan dia mengenakan beha berwarna ungu tersebar secara online. Dia ternyata tidak seanggun penampilan saatnya acara pernikahan KEGIATAN AKHIR PEKAN: kakaknya tersebut. Chelsy: Baru-baru ini Chelsy sedang berduaan Pippa: Dia senang sekali berbelanja dengan dengan Pangeran Harry di sebuah klub di London dan meloncat ke Jaguar-nya demi menghindari bidikan kamera paparazzi. Naas baginya, itu malah kejepret kamera dan fotonya tersebar sebelum acara pernikahan kerajaan digelar. PERCINTAAN: Pippa: Konon Pippa menyukai pria tinggi, tampan, terkenal dan kaya. Saat ini dia menggandeng alumnus kampus elite Eton College yang juga mantan bintang kriket Alex Loudon, yang dibawanya saat pernikahan William-Kate. Meski begitu, media tak bisa memalingkan muka dari kecocokannya dengan Pangeran Harry, yang ketika di balkon Istana Buckingham saling melempar guyonan dan berbalas senyum saat duasaudaramerekayangtengahmenikahmenyihir dunia. Penampilan mereka bahkan menjadi pergunjingan hebat di Twitter, apakah mereka saling mengirim isyarat asmara. Chelsy: Sebaliknya, Chelsy sudah terkenal karena menjadi kekasih Pangeran Harry sejak kencan pertama mereka tujuh tahun lalu pada 2004. PadamalampernikahanWilliam-Kate,Chelsy dikabarkan keluar sendiri tanpa didampingi Chelsy Davy/ Pangeran Harry.(ant)

07.30 U2 (Uje Dan Udin) 08.00 Guruku Selebrity 08.30 Rahasia 10.30 Jalan Jalan Selebriti 11.00 Asli ENak 11.30 Redaksi Siang 12.00 Selebrita Siang 13.30 Cita Citaku 14.30 Dunia Binatang 15.00 Koki Cilik 15.30 Asal Usul Fauna 16.00 Jejak Petualang 16.30 Redaksi Sore 17.30 Orang Pinggiran 18.00 Beritawa 18.30 Hitam Putih 19.30 On The Spot Malam 20.00 OVJ 22.00BukanEMpatMata 23.30 Jam Malam **m31/G

Kylie Akan Sambangi Jakarta bagi selebriti musik dunia.

BUSANA PADA PERNIKAHAN KERAJAAN Pippa: Sebagai pengiring pengantin wanita, Pippa mengenakan busana berbahankan sutera berwarna krem yang dirancang Sarah Burton dari Alexander McQueen. Busananya lebih serasi dikenakan ketimbang gaun kakaknya sendiri. Rancangannya cukup sederhana, menutupi kedua bahunya dan tak memperlihatkan sedikit pun batas jahitan. Di atas rambutnya terselip bunga berwarna putih. Chelsy: Sementara itu untuk acara serupa -pernikahan Kate-Pangeran William— Chelsy mengenakan stelan warna hijau rancangan Alberta Ferretti, yang tingginya tiga atau empat inchi di atas lututnya. Busananya agak memperlihat bahu, padahal di acara kerajaan seperti itu adalah tidak boleh memperlihatkan bahu.

08.00 Naruto 09.30 Obsesi 10.30 Juice 11.00 Abdel Temon Bukan Superstar 12.00 Awas Ada Sule 13.00 Main Kata 13.30 Global Siang 14.00 Petualangan Panji 14.30 Denny Manusia Ikan 15.00 Hand Made 15.30 Fokus Selebrity 16.30 Berita Global 17.00 Chalkzone 18.30 Mong 19:00 Super Hero Kocak 20.00 27 Dresses 22.00 Diplomat

Kylie Minogue (

Diva pop dunia Kylie Minogue akan menggelar konser bertajuk The Show Girl Returns - Kylie Minogue Aphrodite Tour 2011 di Sentul International Convention Center (SICC), Sentul, Bogor pada Senin (27/6). Karina Suwandi, General Manager Marketing

Electronic City Entertaintment mengatakan konser pada bulan depan termasuk dalam rangkaian tur Kylie Minogue bertajuk (Aphrodite Live 2011) di seluruh dunia dan Indonesia sudah termasuk di dalamnya. “Manajemen Kylie Minogue sudah mengkonfirmasi akan tampil di Indonesia,” katanya dalam jumpa pers di Electronic City SCBD, Jakarta pada Selasa (10/5). Konser diselenggarakan promotor Electronic City Entertainment (ECE) dan MP Entertainment mengambil tempat di SICC untuk memberikan kenya-manan maksimal kepada penonton. “Sentul memiliki tempat yang megah dan tata artistik yang bagus sekaligus untuk memenuhi kenyamanan penonton,” katanya.

Menurut Karina, mendengar nama Aphrodite pasti pikiran kita akan tertuju dengan mitologis Yunani dan konser itu nanti akan dihiasi dengan semua hal yang berkaitan dengan Yunani seperti ada sebuah patung Pegasus dari emas setinggi 4,3 meter (14 feet) dan kereta kuda emas, 5 layar, dan sekelompok penari di udara. “Konsepnya Yunani banget, dan juga ada panggung hydroliknya,” katanya. Sang Diva itu akan me-nyanyikan 24 lagu hitsnya selama 2 jam seperti lagu All the lovers, Get Outta My Way, Put Your Hands Up, Everything is Beautiful dan Aphrodite sendiri. Kylie Minogue dalam laman resminya mengatakan, “Ini melebihi sebuah konser, konser ini benar spektakuler.” (ant)

FDJ Claudia dan Zico Meriahkan La Mafia

‘ SETELAH Sukses dengan event Heaven Sent, kali ini bekerjasama dengan MG Creative, PT NTI Indonesia- Clasmild menggelar La Mafia di Entrance Music Temple akhir pekan lalu menghadirkan FDJ Claudia Margarita Jaramilo dan DJ Zico Yunoki. Claudia juga pernah menikmati aktivitasnya di dunia Modelling di Colombia sejak umur 12 tahun, kini menggeluti dunia Spinning Turn Table, yang sudah lama menjadi obsesinya. Berduet dengan DJ Zico, merupakan kelahiran Pematang Siantar 31 Tahun lalu, mereka menghibur para clubber Medan. Menurut Sulianto-Branch Manager Clasmild Medan, di harapkan dengan nuansa berbeda dari yang biasanya mengangkat Clasmild Menthol dengan cool n’ smooth, kini mencoba mengangkat Clasmild dengan tag line talk less do more di dunia clubbing. Mudah-mudahan nuansa baru ini juga bisa menambah citarasa dari para penikmat clubbing. Perwakilan dari MG Creative, Andi juga menyambung, bahwa pihaknya bekerjasama dengan sponsor, akan terus update mencari apa yang menjadi keinginan para clubber kota Medan.(m19)

FDJ Claudia

Amat Kulok, Wak Uteh Goyang Warga Binjai

Grup Wak Uteh

GRUP roncah asal Tg Balai yang sudah tak asing lagi lewat lagu-lagu kocaknya ‘Wak Uteh’ tampil memikat dan menggoyang pengunjung saat mengisi acara perayaan HUT Ke-139 Kota Binjai Sabtu (14/5) malam. Walaupunhujanturuncukup lebatsampaipukul22.30,tapisaat Wak Uteh Group naik panggung sekitar pukul 23.00, pengunjung yang tadinya sepi sontak kembali ramai setelah mendengar alunan musik maupun dendang Wak Uteh dan kawan-kawan. Wak Uteh menghibur warga Binjai yang lagi merayakan Hari Jadi Kotanya sampai Sampai pukul 00.00, namun penonton tidak beranjak dari tempatnya di Lapangan Merdeka Binjai. Selamahampirsatujamlebih penampilan Wak Uteh mem-

bawakan lagu yang memang sudah cukup dikenal antara lain Burung Kenek-kenek, Angin Koncang, Wak Uteh dan Jadi Presiden. Album Baru Grup Wak Uteh dengan personel Syafii Panjaitan, Azlina, Saini, Caca, danYuni Akhir bulan ini juga akan merilis album barunya berjudul ‘Amat Kulok’. Menurut Wak Uteh, lagu Amat Kulok mengangkat kisah seorang pemuda melayu yang baik hati, bertaqwa tetapi kocak. Selain mengandalkan lagu AmatKulok,WakUtehjugamengangkat kisah pegawai negeri yang masih hidup pas-pasan dituangkan dalam lagu Baju dan Dasi serta satu lagu lainnya yang tak kalahkocaknyayaituAnakPantai.

Lagu Baju dan Dasi tetap dikemasWakUtehdalambalutan khas mereka dan sesuai karakter lagu-lagunya menggabungkan musik Melayu, Batak dan Jawa dengan lirik-lirik yang kocak dan menggelitik. Karena menurut penglihatan mereka, pegawai negeri ini terkadang bergaya mentereng pakai dasi, tapi gaji tak memadai, terpaksalahtiapbulanmengutang ke bank. Selain merilisalbumbarunya, grupWak Uteh juga akan merayakan HUT-nya ke-12. Menandai berdirinya grup ini di usianya keduabelas, mereka akan memberikan bonus kepada penggemarnya melalui album karaoke. “Biar penggemar kami bisa berkaraoke lah”, tutur Wak Uteh.(m19)

Luar Negeri

WASPADA Senin 16 Mei 2011


Parlemen Pakistan Marah Pada AS Karena Bunuh Osama ISLAMABAD, Pakistan (AP): Para anggota parlemen Pakistan marah terhadap AS karena menyerang dan membunuh pemimpin al Qaida Osama bin Laden di daratan Pakistan. Mereka juga menuntut satu komisi independen menyelidiki kejadian tersebut. Resolusi parlemen tersebiut dikeluarkan Sabtu (14/5) menyusul satu pertemuan langka dengan para pejabat senior militer yang dimulai Jumat dan berlangsung sampai lepas tengah malam. Selama pertemuan itu, kepala intelijen Pakistan Letjen Ahmed Shuja Pasha menunjukkan keinginannya mengundurkan diri jika para anggota parlemen menuntut tindakan itu. Kenyataannya, tampaknya para anggota parlemen dari pemerintah sipil yang lemah dan oposisi merapatkan barisan di

belakang pembentukan militer yang dipermalukan oleh serangan 2 Mei oleh pasukan khusus Navy SEAL di kompleks bin Laden di kota garnisun barat laut Abbottabad. Pemimpin Pakistan bersikeras mereka tidak tahu bin Laden tinggal di kota tersebut. Sebagian anggota parlemen berkeinginan untuk membahas rincian dari sesi rahasia, tapi jam-jam untuk itu tertutup. Kepala intelijen Pasha berbicara panjang lebar dan membela catatan militer dalam peperangannya melawan gerakan

ekstrimis Islam, yang sebagian telah melakukan serangkaian serangan maut di daratan Pakistan. Pasha mengakui kelalaian dalam melacak bin Laden, namun dia juga menjelaskan bahwa Pakistan telah bekerjasama dengan AS untuk membantu pembunuhan atau penangkapan sejumlah sekutu bin Laden. Bin Laden seperti “orang mati meskipun hidup,” kata

Menteri Informasi Federal Firdous Ashiq Awan kepala intelijen yang mengatakan. Ketika ditanya mengapa CIA dapat melacak bin Laden, kepala mata-mata mengatakan lembaga AS telah berhasil memperoleh lebih banyak sumber manusia di Pakistan dari lembaga Pakistan karena mereka membayar informan jauh lebih baik, menurut seorang anggota parlemen yang menghadiri sesi. “Bila kita membayar 10.000

rupee (kira-kira AS$118), mereka membayar AS$10.000,” kata anggota parlemen yang menirukan pernyataan Pasha. Anggota parlemen itu tidak ingin disebutkan namanya karena pertemuan itu rahasia. Pasha jarang sekali bicara kepada media mengenai rekord militer. Kepala AD Jend. Ashfaq Parvez Kayani, yang juga hadir, namun tidak ada catatan untuk pidatonya. Kepala AU Marsekal Udara

Waspadai Keamanan, Para Awak Carl Vinson Dilarang ‘Bicara’

Rao Qamar Suleman mengungkapkan bahwa pesawat tak berawak AS menggunakan pangkalan udara Shamsi di baratdaya provinsi Baluchistan, namun mengatakan pesawat-pesawat tersebut digunakan hanya untuk pengintaian. Pangkalan udara itu sejak lama telah didesas-desuskan menjadi rumah bagi pesawat yang digunakan untuk serangan misil di beberapa daerah kesukuan Pakistan. (m10)

Bos IMF Ditahan Karena Pelecehan Seks NEW YORK (Antara News): Kepala Dana Moneter Internasional (IMF) Dominique Strauss-Khan ditahan Sabtu waktu AS (Minggu 15/5 WIB) di Bandar Udara Internasional New York dan ditanyai sehubungan dengan serangan seksual yang dilakukannya, kata jurubicara Kepolisian New York Paul Browne. Paul Browne mengatakan, perempuan yang diserang dan mengajukan keluhan terhadap Strauss-Khan, 62, adalah petugas kebersihan kamar berusia 32 tahun dan melarikan diri dari kamar Strauss-Khan setelah peristiwa tersebut.Strauss-Khan yang mungkin menjadi calon dari kubu Sosialis dalam pemilihan presiden Prancis April tahun depan, meninggalkan hotel itu setelah peristiwa tersebut dan naik pesawat Air France yang dijadwalkan bertolak menuju Paris, kata jurubicara polisi. Pesawat itu ditahan di bandar udara dan para petugas dari New York/New Jersey Port Authority menaiki pesawat untuk menahan Strauss-Khan dan menyerahkannya kepada detektif New York Police Department, sambung juru bicara itu.Polisi menyatakan peristiwa itu diduga terjadi di hotel Sofitel di West 44th Street, dekat Times Square. New York Times melaporkan para detektif NYPD sedang menyelidiki serangan brutal terhadap seorang perempuan pegawai Hotel Sofitel, New York, Sabtu pagi waktu setempat. StraussKhan memimpin IMF sejak November 2007. Sebelumnya, dia adalah anggota Majelis Nasional Prancis dan dosen ekonomi pada Institut d‘Etudes Politiques de Paris. Oktober 2008, Strauss-Khan meminta maaf atas “kekeliruan penilaian” dalam urusan dengan seorang bawahan, tapi membantah telah menyalahgunakan jabatannya. Strauss-Khan meminta maaf kepada dua perempuan yang memiliki hubungannya, yaitu bawahan perempuannya itu yang bernama Pirosky Nagy dan istrinya yang menjadi ikon televisi Prancis Anne Sinclair, atas masalah yang ditimbulkannya itu.

Warga Zurich Tolak Larangan Bunuhdiri


SEORANG pemrotes anti-pemerintah menunjukkan satu kartun yang menggambarkan para pemimpin Arab sebagai bayi-bayi dalam satu rapat umum menuntut penggulingan Presiden Yaman Ali Abdullah Saleh, di Sana’a Minggu (15/5). Baris atas (dari kiri ke kanan) Presiden Aljazair Abdelaziz Bouteflika, pemimpin Libyan Moammar Khadafi, Raja Maroko Mohamed dan Raja Jordania Abdullah. Barisan bawah (dari kiri ke kanan) Presiden Yaman Ali Abdullah Saleh, mantan Presiden Mesir Hosni Mubarak dan mantan Presiden Tunisia Zine al-Abidine Ben Ali. Di atas sekali Raja Abdullah dari Arab Saudi.

NATO Didesak Perluas Sasaran Serangan Di Libya LONDON, Inggris (Waspada): NATO harus memperluas sasaran pengebomannya di Libya atau its range of bombing targets in Libya atau menghadapi risiko pemimpin Libya Moammar Khadafi tetap pada kekuasaannya, demikian menurut kepala staf pertahanan Inggris Minggu (15/5). Jend. David Richards menyarankan dalam wawancaranya bahwa NATO harus menyerang infrastruktur Libya, yang belum masuk dalam daftar sasaran serangan. NATO mengebom Libya sesuai dengan mandat PBB untuk melindungi warga sipil dan mengatakan serangannya hanya pada sasaran militer saja. Para pemimpin Inggris, Prancis dan


PARA aktivis Partai Komunis India (CPI) berdiri di dekat satu skuter yang terbakar yang mereka sulut dengan api dalam satu protes terhadap kenaikan harga bahan bakar di Hyderabad, kota sebelah selatan India, Minggu (15/5). Harga bahan bakar telah dinaikkan kira-kira 8,6 persen atau 5 rupees perliter, satu rekor kenaikan yang akan mendorong inflasi di negara ekonomi ketiga terbesar dunia itu.

Ibu-ibu India Dituduh Bunuh 2 Pengantin Demi Kehormatan NEW DELHI, India (AP): Dua ibu-ibu Muslimah di satu kota India Utara telah ditahan atas tuduhan mereka membunuh putriputrinya karena tidak menghormati keluarga dengan melakukan kawin lari dengan pria Hindu, demikian menurut kepolisian Minggu (15/5Z). Pengantin baru Zahida, 19, dan Husna, 26, dicekik ketika mereka pulang ke rumahnya setelah menikah pada pria pilihan mereka, kata Anil Kumar Kusan, seorang perwira polisi. Perkawinan antara Hindu dan Muslim tidak biasa dilakukan di India dan tidak disukai kedua kelompok masyarakat, walaupun ada contoh lebih dari pernikahan antar-agama di kalangan penduduk perkotaan yang berpendidikan lebih maju. Di seluruh India, banyak perkawinan yang masih diatur oleh keluarga. Namun dengan kemajuan ekonomi dan makin banyaknya kaum wanita yang masuk dalam angkatan kerja, tradisi itu lambat laun terkikis oleh perkawinan yang didasari oleh percintaan. Namun, kasta yang telah mengakar berabad-abad dan hambatan tradisi masyarakat masih memainkan peranan dan telah terjadi lonjakan ‘pembunuhan demi kehormatan’ dalam beberapa tahun terakhir di seluruh India Utara. Zahida dan Husna adalah dua wanita bertetangga di Baghpat, satu kota di negara bagian Uttar Pradesh, ketika mereka jatuh cinta dengan dua pria pekerja bangunan. Mereka lari dan menikah pekan lalu sebelum kembali pulang ke rumahnya untuk membuat perdamaian dengan keluarga mereka, kata Kusan. KeduanyaberasaldarikeluargaMuslimdanibumereka,keduanya janda, marah, kata Kusan. Penyelidikan awal menunjukkan bahwa ibu-ibu itu saling membantu untuk mencekik putri mereka. “Kami bunuh dia karena mereka membawa malu ke lingkungan masyarakat kami. Mengapa mereka lari dengan pemuda Hindu? Mereka siap untuk mati,” kata Khatun, salah seorang dari kedua ibu tersebut dikutip suratkabar Indian Express setelah penangkapan mereka Jumat. (m10)

DI ATAS KAPAL USS CARL VINSON (AP): Petugas Amerika yang berdinas di atas kapal perang USS Carl Vinson, di mana dilakukan pemakaman Osama bin Laden ke laut setelah pembunuhannya di Abbottabad, Pakistan, menolak untuk membahas tentang pemimpin al Qaida itu. Para pelaut Amerika yang bertugas dalam misi bersejarah mereka sejarah Minggu (15/5) menolak untuk membicarakan tentang serangan yang mereka lakukan yang menewaskan bin Laden dan tindakan itu mencerminkan kecemasan akan kemungkinan pembalasan. Para pejabat pertahanan AS yang mengambil langkah-langkah untuk menjamin keamanan operatif tersebut yang melibatkan serbuan 2 Mei atas benteng di Abbotabad, teristimewa tim Navy SEAL yang berhasil membunuh teroris yang paling di cari di dunia. Kapal induk itu menjatuhkan jangkar di Teluk Manila yang dikawal ketat Minggu, pada hari pertama persinggahan empat harinya di Filipina. Persinggahan di Filipina itu merupakan istirahat pertama bagi Carl Vinson bersama 5.500 pelaut, pilot dan awak kapalnya setelah berbulan-bulan perang di Irak dan Afghanistan yang diakhiri dengan dukungan mereka dalam serangan komando yang menewaskan bin Laden di Pakistan. Semua yang ada di kapal itu diperintahkan untuk tidak membahas rincian operasional yang menewaskan bin Laden ketika mereka melakukan kontak dengan publik untuk pertama kalinya sejak serangan terselubung itu, kata sejumlah pejabat. Presiden Benigno Aquino III, yang ditemani oleh sejumlah anggota senior Kabinet dan kepala staf militernya, telah diterbangkan ke kapal Carl Vinson Sabtu pada saat kapal itu melakukan pelayaran di Laut China Selatan menuju Filipina, satu sekutu penting anti-terorisme AS. Kemudian satu kelompok wartawan diundang ke kapal itu hari berikutnya. Membicarakan tentang pembunuhan pemimpin al-Qaida Osama bin Laden merupakan tabu dalam kunjungan itu. Sebelumnya, jurubicara Presiden Aquino berharap kunjungan kapal induk AS USS Carl Vinson yang mengubur jenazah pemim-pin al Qaida itu, tidak akan menyebabkan agitasi dari simpatisan Osama. Aquino dan beberapa anggota kabinetnya melakukan kunjungan mendadak ke kapal induk bertenaga nuklir itu, selagi kapal tersebut masih ada di perairan internasional Sabtu, kata para pejabat. Mereka menambahkan, kapal induk tersebut dijadwalkan merapat ke dermaga Manila dari Minggu hingga Rabu. (m10)

Amerika Serikat mengatakan mereka tidak akan menghentikan kampanye pengeboman sampai Khadafi meninggalkan kekuasaannya. Richards mengatakan kampanye militer itu untuk sekarang ini telah menunjukkan satu‘sukses luar biasa’ bagi NATO, namun masih perlu dilakukan tindakan lebih dari itu. “Jika kami tidak bangkit sekarang ada risiko bahwa konflik bisa mengakibatkan Khadafi terus berada pada kekuasaan,” kata suratkabar Minggu Telegraph.“ “Saat ini, NATO tidak menyerang sasaran infrastruktur di Libya. Namun jika kami ingin meningkatkan tekanan pada rezim Khadafi kemudian kami perlu pertimbangan yang serius

untuk meningkatkan sasaran yang dapat kami bom.” Pemberontak telah berjuang selama tiga bulan menentang kekuasaan Khadafi dan kendali kota Benghazi dan daerah penghasil minyak. Perang nampaknya telah mencapai satu jalan buntu, dengan pertempuran terbaru terpusat di kota pelabuhan Misrata di sebelah barat dan di wilayah Pegunungan Barat. Richards dikutip mengatakan NATO tidak menyasarkan langsung Khadafi, “namun jika itu terjadi karena dia berada di komando dan pusat pengendalian yang telah dihantam oleh NATO dan dia terbunuh, maka itu ada dalamn aturan PBB tersebut.

“Jika NATO menarik pasukannya dengan Khadafi masih berkuasa, maka di sana ada risiko luar biasa yang akan meluncurkan serangan baru terhadap pemberontak,” katanya. Jenderal itu mengatakan sulit sekali untuk menemukan korban sipil sebagai akibat serangan NATO karena serangan bom dilakukan dengan memilih sasaran pengeboman.” Pemerintah Libya menuduh NATO membunuh 11 warga sipil, termasuk sembilan imam anak sekolah dalam satu serangan udara atas satu wisma tamu di timur kota Brega Jumat. NATO mengatakan gedung yang dihantam bom NATO adalah satu pusat komando dan pengendalian. (m10)

Istri Mubarak Masuk RS Setelah Terima Surat Perintah Penahanan SHARM EL-SHEIKH, Mesir (AP): Suzanne Mubarak, istri presiden terguling Mesir Hosni Mubarak, telah dimasukkan ke ruang perawatan darurat rumah sakit setelah menderita sakit dada setelah mendengar berita bahwa dia telah diperintahkan untuk ditahan atas dugaan korupsi. Direktur rumah sakit mengatakan dia mengalami gangguan jantung dan berada dalam kondisi yang tidak stabil di rumah sakit di komunitas kota wisata di LautMerahitu,dimanasuaminya juga dimasukkan ke rumah sakit. Perintah penahanan Jumat dikeluarkan sehari setelah mantan ibunegara berusia 70 tahun itu diperiksa untuk pertama kalinya sejak dia dituduh mengaut keuntungan dari posisi suami-

nya untuk memperkaya diri sendiri. Pasangan Mubarak itu dan anggota lain mantan rezim tersebut telah menjadi sasaran penegakan hukum untuk menyeret mereka ke depan pengadilan sejak mantan presiden itu digulingkan 11 Februari setelah satu pergolakan rakyat. Seorang pejabat keamanan mengatakan Ny. Mubarak akan tetap di rumah sakit selama beberapa waktu dan kemudian dipindahkan ke satu penjara wanita di Kairo. Ibunegara yang dikenal karena fokus perjuangannya untuk wanita dan hak anakanak , Ny. Mubarak pada dasawarsalalumenjadidikenalsebagai seorang penggerak kekuatan dalam dunia politik Mesir. Dia diyakini jadi seorang pen-

dukung kuat bagi usaha putranya Gamal untuk menggantikan ayahnya sementara putranya yang lain, Alaa’ melakukan kegiatan bisnis. Perintah penahanan Ny. Mubarak muncul ketika ribuan warga Mesir kembali ke LapanganTahrir Kairo, pusat pergolakan 18 hari yang menyebabkan penggulingan suaminya. Ny. Mubarak diperintahkan untuk ditahan sementara menunggu penyelidikan atas tuduhan bahwa dia dan suaminya menumpuk harta, kata laporan kantor berita MENA. Katanya, dia telah ditanyai tentang dana 20 juta pound Mesir (kira-kira AS$3,3 juta) yang berada atas nama dia di salah satu bank Kairo serta sejumlah villa mewah. Ny. Mubarak diinterogasi di

rumah sakit di Sharm el-Sheikh di mana suaminya yang berusia 83 tahun, juga disebut-sebut menderita gangguan jantung, ditahan. Suaminya telah menjalani pemeriksaan beberapa kali. Ketika diberitahu Jumat bahwa dia akan menjalani tahanan selama 15 hari untuk menjalani penyelidikan lebih lanjut, dia pingsan, kata direktur rumah sakit, Dr. Muhammad Fatahallah. Dia kemudian mengatakan dia tampaknya menderita angina tak stabil, yang menyebabkan sakit parah dadanya. (m10)

ZURICH, Austria (Waspada):Warga kota Zurich, Swiss, menolak usulan larangan membantu bunuhdiri dan ‘wisata bunuhdiri.’ Proyeksi awal menunjukkan pemilih menolak prakarsa tersebut, demikian laporan kantor berita Swiss SDA. Sekitar 200 orang melakukan bunuhdiri setiap tahun di Zurich, termasuk orang asing yang bertandang ke kawasan ini. Di Swiss bunuhdiri dinyatakan sah sejak 1941 jika tidak dilakukan dokter tanpa kepentingan akan kematian tersebut. Euthanasia atau ‘pembunuhan karena belas kasihan’ juga legal dilakukan di Belanda, Luxemburg, Belgia dan negara bagian Oregon di AS. Banyak orang asing yang sakit parah khususnya dari Jerman, Prancis dan Inggris datang ke Swiss untuk melakukan bunuhdiri, memanfaatkan undang-undang di Swiss. Namun bertambahnya orang asing untuk mengakhiri hidup di Swiss dan meningkatnya orang yang ingin bunuh diri dengan bantuan tanpa penyakit parah menimbulkan perdebatan panas. Kelompok pendukung hak mati Exit menyetujui aturan dalam membantu bunuh diri dengan jaksa Zurich sebagai dasar yang mungkin menjadi aturan nasional.

Spesies Baru Dinosaurus Ditemukan Di China Timur JINAN, China (Antara/Xinhua-0ANA): Para ilmuwan China mengatakan bahwa mereka telah menemukan spesies baru dinosaurus raksasa theropoda di provinsi timur Shandong. Spesies baru itu, digambarkan sebagai salah satu kerabat dekat Tyrannosaurus rex (T. rex), telah diberi bernama magnus Zhuchengtyrannus. Ahli paleontologi telah menemukan tulang rahang atas yang unik setelah memeriksa tengkorak dan rahang yang ditemukan di kota Zhucheng, menurut laporan kantor berita China Xinhua Sabtu (14/5).Hewan raksasa itu diperkirakan panjang sekitar 11 meter dan tinggi empat meter, beratnya mendekati tujuh ton. “Kami menemukan dua jenis fosil tyrannosaurus di sini dan identitas yang lain masih belum jelas,” kata Xu Xing, seorang peneliti di Institute of Vertebrate Paleontology dan paleoantropologi di bawah Akademi Ilmu Pengetahuan China. “Kami telah menamakan genus baru itu magnus Zhuchengtyrannus, yang berarti ‘Tyrant dari Zhucheng’, karena tulangnya ditemukan di Zhucheng,” kata Xu. Tulang-tulang itu adalah beberapa sentimeter lebih kecil dari tulang yang sama di T. Rex spesimen terbesar, sehingga tidak ada keraguan bahwa Zhuchengtyrannus adalah tyrannosaur besar, kata Xu.

Raja Arab Saudi Resmikan Universitas Khusus Perempuan RIYADH, Arab Saudi (Antara/Xinhua-OANA): Raja Arab Saudi Abdullah bin Abdul-Aziz, Minggu (15/5), secara resmi dijadwalkan membuka universitas khusus perempuan pertama milik negara di negara Islam konservatif itu, demikian laporan kantor berita resmi Arab Saudi, SPA. Princess Noura bin Abdel-Rahman University for Girls di Riyadh, tentu saja, akan menawarkan mata kuliah seperti medis, farmasi, manajemen, ilmu komputer dan bahasa. Kaum perempuan di negara tersebut menghadapi kesulitan untuk masuk fakultas di universitas normal, di mana pemisahan gender diberlakukan secara ketat. Kampus itu meliputi bangunan administrasi, rumah sakit dengan 700 bangsal yang dilengkapi dengan instalasi canggih, laboratorium, daerah permukiman yang meliputi akomodasi buat mahasiswa, serta dua klub olah raga, pusat konferensi dan pertokoan komersial. Universitas yang ramah lingkungan tersebut juga meliputi sistem transportasi berteknologi tinggi yang dilengkapi dengan kendaraan otomatis berpemandu komputer yang menghubungkan semua instalasi penting. Negara yang kaya akan minyak itu memiliki sekolah negeri khusus perempuan dan beberapa perguruan tinggi swasta khusus perempuan.

India Dan Pakistan Saling Tembak Setelah Satu Tewas JAMMU, India (Waspada): Pasukan Indian dan Pakistan saling tembak di perbatasan Minggu (15/5), kata sejumlah pejabat keamanan, sehari setelah seorang tentara India terbunuh oleh pasukan Pakistan saat berpatroli di salah satu perbatasan yang paling dijaga ketat di dunia. Kedua belah pihak saling tembak dengan senjata ringan selama 30 menit Minggu dinihari di satu pos perbatasan 30 km dari Jammu, ibukota musim dingin wilayah Kashmir yang

dipertikaikan di India Utara. “Tentara Pakistan melepaskan tembakan tanpa diprovokasi ke pos kami di Umra Wali,” kata seorang jurubicara paramiliter Pasukan Keamanan Perbatasan India. “Kami merespon tembakan mereka.” Seorang pejabat keamanan perbatasan Pakistan membenarkan bentrokan itu, namun membantah telah memulainya. Tiga tentara paramiliter Pakistan cedera, katanya. Seorang tentara India tewas di rumah sakit Sabtu malam

akibat cedera tembakan yang dialaminya setelah tentara Pakistan melepaskan tembakan dalam satu patroli rutin di kawasan yang sama, kata pihak India. Dia adalah tentara India pertama yang tewas oleh pasukan Pakistan dalam satu tahun ini. Kedua negara bersenjata nuklir itu setuju gencatan senjata di Kashmir tahun 2003 dan pada saat gencatan senjata tersebut bertahan, tembak menembak singkat terjadi hampir setiap bulannya. (bbc/ap/m10)


PARAMEDIS Israel mengevakuasi seorang pria yang cedera dari lokasi di mana sebuah truk menabrak sejumlah kendaraan dan pejalan kaki di Tel Aviv, Israel, Minggu (15/5). Truk itu menewaskan satu pria dan mencederai 17 lainnya pada hari protes Palestina.Polisi menyebutkan pengemudi itu seorang pemuda berusia 22 tahun penduduk desa Kafr Qassem, desa Arab di Israel Tengah. Pasukan keamanan Israel meningkatkan kesiagaan untuk mengantisipasi kekerasan selama aksi protes tersebut.



WASPADA Senin 16 Mei 2011

Pesona Pesta Rossoneri MILAN (Waspada): Alenatorre AC Milan Massimiliano Allegri terpesona dengan kemeriahan pesta scudetto timnya sepanjang Sabtu sampai Minggu dinihari waktu Italia. “Sangat luarbiasa bagi saya dan pengalaman pertama merasakan hal seperti ini. Jadi saya sangat terpesona dan terkejut,” ungkap Allegri. “Saya ingin para pemain mengakhiri musim dengan cara yang terbaik bersama fans dan presiden (Silvio Berlusconi) di sini bersama kami,” katanya lagi, seperti dilansir Football-Italia, Minggu (15/5). I Rossoneri yang sudah memastikan gelar Liga Seri A sejak pekan lalu dengan menahan AS Roma 0-0, merayakannya bersama para tifosi sebelum menjamu Cagliari di San Siro Milan. Seluruh anggota tim diarak keliling kota menggunakan bus atap terbuka sebelum menuju stadion. Turut hadir Wakil Presiden Adriano Galliani yang mengibarkan bendera Italia. Para pemain menggunakan jas hitam dipadu dengan dasi berwarna merah. Begitu sampai di San Siro, para pemain ditemani anak dan istri masing-masing berkumpul di lapangan dan tepuk tangan bersama puluhan ribu fans. Laga lawan Cagliari pun menjadi sangat emosional bagi Allegri, yang meraih penghargaan Pelatih Terbaik Seri A musim lalu bersama tim tamu. Namun pilihan Milan terhadap Allegri sangat tepat, terbukti kehadirannya langsung menghadikan Lo Scudetto. “Sejak diangkat saya langsung menyatakan pada tim untuk berlatih dengan intensitas, mungkin itu yang perlu disiapkan untuk berlaga,” beber Allegri. “Itu juga etika kerja Milan satu dekade lalu bersama Arrigo Sacchi. Saya meminta mereka untuk bekerja bagi tim dan itulah

yang mereka lakukan untuk saya dan yang lainnya,” tegasnya lagi. Rossoneri memetik hasil dari prinsip Allegri tersebut. Il Diavolo malah melengkapi selebrasi mereka dengan menekuk Cagliari 4-1 di San Siro. Aksi Robinho menit 22 yang mengawali pesta gol Milan. Berselang dua menit, gelandang Genarro Gatusso memantapkan keunggulan tuan rumah. Robinho mencetak gol keduanya menit 35 dan Andrea Cossu membalas satu gol menit 39 untuk menutup babak pertama dengan skor 3-1. Clarence Seedorf menambah gol Milan menit 77, sehingga menyempurnakan pesta Rossoneri. “Rasanya selalu menyenangkan bisa meraih suatu tujuan. Sekarang kami berharap bisa terus melalukan selebrasi lainnya,” tekad bek veteran Gianluca Zambrotta. “Semua pemain dan pelatih bekerjasama. Mulai dari Alexandre Pato sampai Clarence Seedorf dan Zlatan Ibrahimovic juga Thiago Silva,” katanya lagi. Penyerang veteran Italia Filippo Inzaghi ikut larut dalam perayaan, setelah kembali merumput menjelang akhir babak kedua. Keberadaannya bahkan cukup mengejutkan, sebab Inzaghi sempat divonis lebih cepat mengakhiri musimm ini akibat cedera lutut parah ketika melawan Palermo, 10 November lalu. “Saya harus berterima kasih kepada pelatih, klub, rekan setim dan fans yang membuat saya merasa hampir menjadi pemain bola lagi malam ini,” tutur Inzaghi. “Saya berharap bisa bertahan untuk tahun selanjutnya, memalukan untuk berpisah sekarang setelah menunjukkan ikatan emosional menakjubkan. Saya punya peluang sangat bagus untuk bertahan,” tekad bomber 37 tahun tersebut. (m15/fi/goal/espn)


PARA pemain AC Milan merayakan sukses menjuarai Liga Italia buat ke-18 kali di Stadion San Siro, Minggu (15/5) dinihari WIB.

Tinggal Udinese, Lazio ROMA (Waspada): Perebutan tiket keempat Liga Seri A untuk babak kualifikasi Liga Champions musim mendatang, tinggal menyisakan Udinese dan SS Lazio sebagai pemburunya.


BEK Catania Ciro Capuano mengalahkan kapten AS Roma Francesco Totti (kanan) di Stadion Angelo Massimino, Minggu (15/5).

Sedangkan harapan AS Roma dan Juventus kandas, setelah kedua klub raksasa Italia itu sama-sama mengalami kekalahan, Minggu (15/5). Roma yang menghuni posisi keenam dipecundangi tuan rumah Catania 2-1. Memimpin lebih dahulu lewat gol Simone Loria menit 14, Il Lupo akhirnya pulang tanpa poin akibat kebobolan gol Gonzalo Bergessio menit 78 dan Alejandro Gomez pada injury-time. Di Ennio Tardini, Juventus mengalami kebuntuan meng-

Duka Dua Tuan Rumah LONDON (Waspada): Dua tuan rumah pada lanjutan Liga Premier, Minggu (15/5), yakni Liverpool dan Arsenal, dipaksa menuai malu setelah dikalahkan tim tamu di kandang masingmasing. Asa Liverpool mengamankan tiket Liga Eropa kembali terancam usai ditekuk Tottenham Hotspur 0-2 di Anfield. Berlaga di hadapan pendukungnya, The Reds tampil dengan kepercayaan diri demi mengokohkan posisinya di peringkat lima besar. Nyatanya, gawang The Reds terpaksa lebih dulu kebobolan lewat tembakan spekluasi Rafael Van der Vaart di menit delapan. Unggul satu gol, Spurs tampil kian pede. Umpan pendek dari kaki ke kaki mengalir lancar dari anak-anak Spurs. Memasuki paruh kedua, Liverpool coba mengambil inisiatif permainan cepat. Masuknya Andy Carroll dan David Ngog kian menambah daya gempur tim besutan Kenny Dalglish. Namun, tepat di menit 56 mental punggawa Liverpool kembali remuk oleh keputusan kontroversial wasit Howard Webb yang menghadiahi penalti untuk Spurs. Keputusan Webb diambil usai John Flanagan menjegal Steven Pienaar di kotak terlarang.

Modric yang ditunjuk menjadi eksekutor mampu mengkonversi hadiah penalti itu menjadi gol. Selepas gol ini, Liverpool tetap mencoba melancarkan serangan, tetapi kondisi tak berubah banyak. Skor 0-2 bagi keunggulan Spurs bertahan. Alhasil, langkah Liverpool mengamankan tiket zona Eropa kembali terancam pasalnya kini mereka terlempar dari lima besar dan digeser

Spurs yang unggul satu poin. Dengan tersisa satu laga di kompetisi, Liverpool harus menang atas Aston Villa sembari berharap Spurs gagal mengatasi Birmingham City pekan depan. Di Emirates Stadium, strategi perangkap offside yang kurang sempurna mengakibatkan Arsenal menelan pil pahit dari Darren Bent. Pasalnya, striker Aston Villa itu mengoyak jala Gunners dua kali dalam kurun

hadapi AC Parma. Kendati lebih mendominasi laga, Si Nyonya Tua kemudian takluk 0-1 akibat gol mantan pemainnya Sebastian Giovinco menit 64. Saat bersamaan, Udinese justru merajalela di markas Chievo Verona. I Friulani sukses menuntaskan dominasinya dengan kemenangan 2-0 hasil sumbangan gol Mauricio Isla menit 28 dan Kwadko Asamoah menit 75. Tambahan tiga poin dariVerona membuat Udinese kembali bertengger di posisi empat,

Hasil Liga Premier Blackburn vs Man United 1-1 Blackpool vs Bolton 4-3 West Brom vs Everton 1-0 Sunderland vs Wolverhampton 1-3 Chelsea vs Newcastle 2-2 Arsenal vs Aston Villa 1-2 Birmingham City vs Fulham 0-2 Liverpool vs Tottenham 0-2 Wigan Athletic vs West Ham 3-2 waktu lima menit untuk menjadikan Villa unggul 2-1. Gol semata wayang Arsenal dicetak RobinVan Persie semenit jelang laga bubaran. (m15/m33/rtr)

GOL yang dicetak Rafael van der Vaart (kiri) mengawali duka Liverpool dalam usahanya merebut tiket Eropa musim depan, setelah Tottenham Hotspurs menang 2-0 di Anfield, Minggu (15/5). -AP-

Dua Ledakan Sambut Okto Cs LEMBANG ( Waspada): Pembangunan karakter bagi pemain timnas U-23 memasuki fase baru. Karena itu, sejak Minggu (15/5) hingga tiga hari ke depan, pemain timnas junior yang sedang dipersiapkan tampil di SEA Games 2011 akhir tahun ini menjalani latihan di area latihan tempur hutan Pusat Pendidikan Pasukan Khusus TNI AD di Danau Situ Lembang, Kabupaten Bandung. Menariknya, kedatangan Oktavianus Maniani cs langsung disambut dua ledakan keras, datang dari arah rimbunan po-

hon dan semak belukar sempat membuat beberapa pemain kaget. Meski begitu, semuanya tampak enjoy menjalani sesi latihan perdana di kawasan tersebut dengan berendam di air dingin selama 10 menit sembari menyanyikan lagu mars ‘Patriot Olahraga’ di aliran sungai dekat danau antara kaki Gunung Tangkuban Parahu dan Gunung Burangrang. “Itu cuma ledakan dari petasan saja dan merupakan bagian dari latihan di sini. Semua pemain timnas juga sudah kami

beritahu, jika sesekali akan terdengar suara ledakan keras selama berada di area latihan perang pasukan komando,” ujar Komandan Latihan Satlak Prima Letkol Inf Richard Tampubolon. Menurut Richard, sebanyak 71 calon atlet SEA Games dari berbagai cabang olahraga mulai ditempa di Situ Lembang. Semua atlet akan mengaplikasikan materi teori dan praktek yang diberikan di Pusdikpassus Batujajar, seperti mengatasi rintangan darat maupun air secara individu maupun kelompok.

Pelatih Timnas U-23 Rahmad Darmawan mengaku cukup optimis mental pemain timnas junior benar-benar akan tangguh setelah keluar dari barak militer. Dengan begitu, tidak ada lagi sifat egois pemain yang selama ini menjadi kendala dalam membentuk timnas. Masih kata Rahmad, selama berada di barak militer, pemain timnas nyaris tidak belatih sepakbola. Kalau pun ada sesi main sepakbola, itu hanya untuk menghindari kejenuhan dan menjaga pemain tidak kehilangan sentuhan. (yuslan)

dua angka di atas Lazio yang membuka harapannya menuju Liga Champions dengan melibas Genoa 4-2 sehari sebelumnya di Olimpico Roma. Gelandang asal Brazil Hernanes mencetak dua gol, Giuseppe Biava dan Tommaso Rocchi masing-masing menambah satu gol buat I Biancoceleste. Tim tamu mempertipis kekalahannya melalui Rodrigo Palacio dan Antonio Floro Flores. “Kami memenuhi komitmen dan kini tinggal menunggu dan menyaksikan apa yang terjadi. Setelah itu kami baru memikirkan Liga Champions,” jelas Hernanes. “Setelah kalah beruntun tiga

kali, kami baru dapat memenangi pertandingan. Kami dipecundangi lawan sehingga tampil tidak 100 persen, tetapi pada babak kedua semangat kami bangkit,” katanya lagi. Sedangkan alenatorre Lazio Edy Reja mengaku, timnya butuh dukungan moral dan semangat setelah kalah dari Inter Milan, Juventus dan Udinese. “Kami mengalami kekecewaan besar karena kami khawatir tidak dapat memenuhi keinginan untuk mengikuti Liga Champions. Tapi kini kami memiliki keyakinan besar dapat melakukannya,” tegas Reja. “Kami melakukan apa yang kami inginkan dan kemenangan

Klasemen Liga Seri A

Minggu, 15 Mei Fiorentina v Bologna Bari v US Lecce Catania v AS Roma Cesena v Brescia Chievo v Udinese Parma v Juventus Sampdoria v Palermo

2-2 0-2 2-1 1-0 0-2 1-0 1-2

Sabtu, 14 Mei SS Lazio vs Genoa AC Milan vs Cagliari

4-2 4-1

ini memberi inspirasi bagi kami. Kami memiliki 63 poin dan kami berharap pada akhirnya ikut di kompetisi Eropa,” tambahnya. (m15/m33/espn/uefa)

AC Milan Inter Milan Napoli Udinese Lazio AS Roma Juventus Palermo Fiorentina Genoa Catania Parma Cagliari Chievo Cesena Bologna Lecce Sampdoria Brescia Bari

37 24 9 4 65-24 36 22 6 8 65-40 36 21 5 10 56-36 37 20 5 12 65-43 37 19 6 12 51-37 37 17 9 11 56-51 37 15 12 10 55-45 37 17 5 15 57-60 37 12 14 11 47-42 37 13 9 15 42-45 37 12 10 15 39-49 37 11 12 14 38-46 37 12 8 17 43-50 37 10 13 14 35-39 37 11 10 16 36-47 37 11 12 14 35-48 37 11 8 18 44-62 37 8 12 17 32-46 37 7 10 20 32-50 37 4 9 24 23-56

81 72 68 65 63 60 57 56 50 48 46 45 44 43 43 42 41 36 31 21

Lille Bahagia Akhiri Penantian 56 Tahun PARIS (Waspada): Ludovic Obraniak mencetak gol tunggal lewat tendangan penalti menit 90 untuk memenangkan LOSC Lille 1-0 atas juara musim lalu Paris St Germain. Sukses pada final Piala Prancis di Saint Denis, Sabtu (Minggu WIB) tersebut, mengakhiri penantian gelar Lille selama 56 tahun terakhir. “Kami bahagia. Anda harus menghargai fans Lille yang menunggu 56 tahun untuk juara,” ucap pelatih Lille Rudi Garcia, seperti dikutip dari Goal, Minggu (15/5). “Kini kami menghadirkan momen tersebut. Kami sempat berpikir laga akan berlanjut ke babak tambahan (waktu), tapi kami senang itu tak terjadi,” tambah Garcia. Menurut kapten Rio Mavuba, kemenangan ini tidak mudah diraih. “Sangat sulit, PSG memberikan perlawanan sengit. Sebuah partai final baru bisa dikatakan indah ketika Anda memenangkannya. Kami baru saja melakukannya,” ungkap

Mavuba. Kiper PSG Gregory Coupet salah mengantisipasi bola tendangan Obraniak, sehingga kena kepalanya dan masuk ke dalam gawang sendiri. Coupet memperbaiki kesalahannya dengan meredam tendangan penalti Mathieu Debuchy pada injurytime. “Akhirnya kami dapat menjebol gawang mereka. Kaki kiri Ludo (Obraniak) amat berbahaya, apalagi bila dia mendapatkan bola mati,” puji Rudi Garcia. Mavuba cs akan menambah gelarnya dari arena Ligue 1 untuk pertama kali sejak 1954 jika mampu menekuk Sochaux, Rabu (18/5) malam. Itu akan menjadi juara ganda kali pertama sejak 1946 bagi Lille. “Kami mesti mengucapkan selamat pada Lille. Tidak ada yang harus kami sesali,” papar pelatih PSG Antoine Kombouare. “Kami nyaris unggul melalui Guillaume Hoarau. Dia seharusnya bisa mencetak gol, sayang gagal dan Lille membobol


PARA pemain Lille merayakan sukses menjuarai Piala Prancis setelah mengalahkan Paris SG pada final di Stade de France, Saint Denis, utara Paris, Minggu (15/5) dinihari WIB. gawang kami di waktu yang sangat buruk,” katanya lagi. Kombouare mengakui para pemainnya kecewa berat, tetapi mereka harus bangkit demi target lolos ke Liga Champions musim mendatang. “ Sekarang saatnya me-

Porto Jawara Tak Terkalahkan LISBON (Waspada): FC Porto menjadi tim pertama dalam 33 tahun terakhir yang menyelesaikan Liga Super Portugal tanpa terkalahkan. Sabtu malam waktu setempat atau Minggu (15/5) dinihari WIB, Porto pun menyempurnakan pesta juaranya dengan menang tandang 2-0 atas Maritino. Gol tim tamu disumbangkan winger SilvestreVarela menit 21 dan striker Walter menit 32. Porto sudah memastikan gelarnya yang ke-25 bulan lalu dan jadi jawara tak terkalahkan

musim ini dengan raihan 84 poin. Sukses itu menyamai rekor Benfica pada musim 1972/1973. Benfica pimpinan Eusebio saat itu tidak terkalahkan di liga domestik dan berlanjut pada 1978. Catatan gol Porto juga sensasional, memasukkan 73 gol dan hanya kebobolan 16 bola. Juara Piala UEFA 2003 dan Liga Champions 2004 itu berarti jadi tim tersubur dan paling sedikit kebobolan musim ini. Sukses Porto semakin lengkap karena mesin golnya Givanildo Vieira de Souza atau akrab disapa Hulk, ber-hasil menya-

bet gelar top skor dengan 23 gol. “Malam ini kami mene-rima sebuah penghargaan ya-ng diraih dengan sangat sulit. Ini akan tersimpan dalam memori kami selamanya,” jelas pelatih Andre Villas-Boas, yang masih berusia 33 tahun. Pasukan Villas-Boas ma-sih berpeluang menyabet dua gelar lagi dalam sepekan ke depan. Porto akan menjajal Braga di final Liga Europa pada 18 Mei dan melawan Vitoria de Guimaraes pada final Piala Portugal 22 Mei mendatang. (m15/ant/rtr/uefa)

ngembalikan fokus. Satu-satunya hal yang bisa mengobati rasa kecewa itu adalah lolos ke Liga Champions. Saya harap mereka bisa meraih kemenangan pada laga penting melawan Bordeaux,” kata Kombouare. (m15/goal/ant/rtr)

Klasemen Super Liga Porto Benfica Sporting Braga Vitoria Nacional Pacos Rio Ave Maritimo Leiria Olhanense Vitoria Beira-Mar Coimbra Portimonense A Naval

30 27 3 30 20 3 30 13 9 30 13 7 30 12 7 30 11 9 30 10 11 30 10 8 30 9 8 30 9 8 30 7 13 30 8 10 30 7 12 30 7 9 30 6 7 30 5 8

0 7 8 10 11 10 9 12 13 13 10 12 11 14 17 17

73-16 61-31 41-31 45-33 36-37 28-31 35-42 35-33 33-32 25-38 24-34 29-42 32-36 32-48 29-49 26-51

84 63 48 46 43 42 41 38 35 35 34 34 33 30 25 23


WASPADA Senin 16 Mei 2011


PSMS Di Ujung Tanduk Kalah 1-3 Atas Mitra Kukar Waspada/Austin Antariksa

STRIKER PSMS Medan, Gaston Castano, merenung kekalahan timnya dari Mitra Kukar dalam laga grup B babak delapan besar Divisi Utama Liga Indonesia 2010/2011 di Stadion Madya Aji Imbut, Tenggarong, Minggu (15/5).

Ayam Kinantan Masih Miliki Kans TENGGARONG (Waspada): Manajer Tim PSMS Medan, Idris SE, menganggap skuad Ayam Kinantan masih bisa bernafas untuk maju ke semifinal Divisi Utama Liga Indonesia 2010/ 2011. Optimisme itu disampaikan kepada Waspada usai PSMS kalah 1-3 dari tuan rumah Mitra Kukar dalam pertemuannya di Stadion Madya Aji Imbut Tanggarong, Minggu (15/5). Idris juga menilai kepemimpinan wasit tidak becus, di mana seharusnya PSMS mendapat ten-

dangan penalti di menit-menit awal pertandingan. “Keputusannya tidak menganggap pelanggaran terhadap Gaston Castano bukan satusatunya kesalahan wasit,” ujar Idris berang menanggapi kepemimpinan Prasetyo Hadi dalam laga tersebut. “Seharusnya PSSI tidak menunjuk wasit sekelas Prasetyo Hadi kalau mau persepakbolaan Indonesia maju,” katanya didampingi Asisten Manajer, Drs Benny Tomasoa. Di lain pihak, Asisten Pelatih

Sananta, PLN Juara Proliga 2011 JAKARTA (Waspada): Tim putra Jakarta Sananta juara Sampoerna Hijau Voli Proliga 2011, setelah mengalahkan Palembang Bank Sumsel 3-1 (25-23, 15-25, 25-22, 25-21) pada Final Four di Hall Basket Gelora Bung Karno, Jakarta, Minggu (15/5). Sananta sebelumnya sudah memetik kemenangan keempat dan memastikan diri ke final, sedangkan Bank Sumsel menunggu hasil pertandingan antara Surabaya Samator melawan Jakarta Electric PLN yang baru akan bermain. Untuk putri, Jakarta Electric PLN menjadi tim terbaik dengan mengalahkan Jakarta Popsivo Polwan 3-1 (25-13, 25-27, 27-25, 25-23). Sebenarnya, PLN mempunyai nilai yang sama dengan Popsivo (11). Namun, rata-rata poin PLN lebih unggul, yakni 1,19 berbanding 1,12. Kedua tim memang saling mengalahkan di babak empat besar ini. Sebagai yang terbaik di babak empat besar, PLN berhak mendapatkan Rp30 juta. Pekan depan, kedua tim akan kembali berjumpa di final yang digelar di Istora Gelora Bung Karno. “Ini seperti simulasi final, kita sudah melihat kekurangan dan kelebihan, baik pada kita maupun lawan,” kata pelatih Popsivo, Ansori. (yuslan)

PSMS H Edy Syahputra juga mengakui kepemimpinan wasit tidak terlepas menjadi salah satu poin kekalahan PSMS. Namun, Edy tidak membantah rapuhnya pertahanan PSMS tanpa Vagner Luis turut membuat Mitra Kukar mudah membobol gawang Andi Setiawan. Sementara itu, pengurus PSMS Julius Raja mengakui penampilan The Killer kurang fanatik dan terlalu banyak memainkan bola di lapangan tengah, sehingga Gaston Castano cs mengimbangi lawan. (m17)

TENGGARONG (Waspada): Kekalahan 1-3 PSMS Medan atas Mitra Kukar pada penyisihan grup B putaran 8 Besar Divisi Utama Liga Indonesia di Stadion Madya Aji Imbut, Tenggarong, Minggu (15/ 5), membuat peluang Ayam Kinantan lolos ke Liga Super Indonesia (LSI) di ujung tanduk. Tim asuhan pelatih Suharto yang akan menghadapi Persiba Bantul di Stadion Segiri Samarinda, Rabu (18/5) nanti, tidak memiliki pilihan lain selain menang. Namun untuk memastikan lolosnya PSMS juga ditentukan hasil laga antara tuan rumah Mitra Kukar melawan PSAP Sigli di Stadion Aji Imbut pada waktu bersamaan, yakni pukul 16.30 WITA. Menghadapi Mitra Kukar yang difavoritkan lolos, PSMS menerapkan permainan keliru karena lebih banyak menampilkan satu dua sentuhan di lapangan tengah. Akibatnya,

Mbom-mbom Julien cs mudah merebut bola dan cepat mengalirkan serangan ke pertahanan The Killer. Lemahnya pertahanan PSMS setelah absennya Vagner Luis akibat kartu merah yang diterimanya di laga pertamanya membuat penjaga gawang Andi Setiawan harus bekerja ekstra keras. Putra Habibi yang mengisi posisi libero asal Brazil itu kerap kewalahan. Apa yang dikhawatirkan kubu Ayam Kinantan terjadi di menit sembilan, setelah mantan pemain PSMS Boy Jati Asmara membobol gawang Andi Setia-

Lemkari Medan Menuju Prestasi Nasional Peresmian Dojo Suka Maju MEDAN (Waspada): Pengurus Cabang Lemkari Kota Medan terus berupaya memaksimalkan pembinaan dan peningkatan jumlah atlet dengan mendukung pembentukan dojo-dojo baru sebagai wadah penjaringan karateka berbakat di Kota Medan. Demikian Ketua Pengcab Lemkari Medan, Hasrul Benny Harahap, saat meresmikan sekaligus mengukuhkan kepengurusan Dojo Lemkari Sukamaju, Jl Suka Bumi/STM Ujung Medan, Minggu (15/5). Dikatakan, selain mening-

katkan pembinaan atlet dan mengembangkan perguruan dengan pembentukan dojodojo, Lemkari Kota Medan juga mempersiapkan atlet untuk mengikuti berbagai event nasional. “Awal Mei nanti, 28 atlet kita akan memperkuat Lemkari Sumut di Kejurda Forki Sumut

yang merupakan ajang seleksi atlet tampil di Kejurnas Piala Mendagri dan Mendiknas pada 23-25 Juni mendatang di Kalimantan Selatan,” ucapnya. Lebih lanjut, Benny mengatakan apa yang dilakukan Lemkari Medan dalam meningkatkan prestasi juga sudah mulai berbuah hasil. “Pada awal Mei,

Atlet Medan Rampungkan Tes MEDAN (Waspada): Atletatlet binaan KONI Medan merampungkan tes fisik dan psikologi yang digelar atas kerja sama dengan Universitas Negeri Medan (Unimed) di kampus tersebut, mulai Sabtu (14/5) dan berakhir Minggu (15/5). Sebanyak 378 atlet mengikutinya dari 400 atlet yang diundang. Pada hari pertama Sabtu pagi, mereka mengikuti tes psikologi disusul dengan tes fisik sore harinya. Ketua Umum KONI Medan Drs H Zulhifzi Lubis mengatakan, tes memang merupakan program pihaknya dalam upaya

mendata kemampuan atlet. “Kita berharap, lewat tes ini, KONI Medan bersama Pengcab Olahraga mendapat masukan soal kondisi kebugaran para atlet, dan kesiapan mental mereka,” ucap Zulhifzi, didampingi pengurus KONI Medan Drs Bambang Riyanto, Suryadi SE, serta Drs Suharjo MPd dari Unimed. “Kepada yang tidak ikut, masih diberi kesempatan mengikuti test serupa yang dijadwalkan pada 20 dan 21 Mei,” timpal Bambang Riyanto, Ketua Panpel. Suharjo mengungkapkan, tes fisik dan psikologi KONI

wan. Ketinggalan angka ini membuat M Affan Lubis, Faisal Azmi, Alfian Habibi, dan Donny Siregar berupaya mengejar angka guna mendukung Gaston Castano dan Almiro Valadares di lini depan. Buruknya kepemimpinan wasit Prasetyo Hadi (Surabaya) yang terlalu memihak kepada tuan rumah pun membuat konsentrasi anak-anak Ayam Kinantan terpecah, khususnya Donny Siregar yang terlalu sering protes wasit. Menit 28, Mitra Kukar menggandakan keunggulan melalui striker dan kapten tim asal Argentina, Franco Hita. Alhasil, Suharto menarik Alfian Habibi dan Almiro untuk memasukkan TriYudha Handoko dan Rinaldo. Skuad asuhan Benny Dollo pun memperbesar kemenangannya menjadi 3-0 di babak kedua. Gol yang tercipta dari

Medan melibatkan 180 tenaga instrukstur di lapangan. “Ada 19 item yang di tes, di antaranya tekanan darah, lari 30 m, flexibility, audio/visual, kelincahan, keseimbangan, daya tahan, dan lainnya. “Test yang menguji sekian banyak item ini bisa terlaksana, karena Unimed baru saja memperoleh bantuan alat test dari Mennegpora. (m47)

Waspada/Dedi Riono

KETUA Lemkari Kota Medan, Hasrul Benny Harahap, menyerahkan tali asih kepada salah satu atlet peraih medali emas pada turnamen KKNSI Tebingtinggi, Minggu (15/5).

tendangan keras Junaidi Tagor itu sebelumnya diawali pengawalan lemah anak-anak PSMS. PSMS hanya mampu mencetak satu gol melalui tendangan penalti Gaston Castano pada menit 82. Penalti diberikan wasit setelah striker asal Negeri Tango itu dilanggar Anderson Da Silva di kotak terlarang. Tambahan tiga poin ini membuat Mitra Kukar sementara memimpin klasemen Grup B dengan torehan empat poin.

PSMS sendiri menghuni posisi juru kunci dengan nilai satu hasil menahan imbang PSAP Sigli 1-1, Jumat (13/5) lalu. PSAP sendiri gagal menuai kemenangan saat berhadapan dengan Persiba Bantul. Dalam laga keduanya, PSAP hanya bermain seri tanpa gol. Torehan satu poin ini menjadikan PSAP menduduki runner-up grup B dan Persiba menempel di peringkat tiga. (m17)

Waspada/Riswan Rika

WALIKOTA Binjai HM Idaham didampingi Pimpinan Bank Sumut Cabang Binjai Syahmirdan Siregar, Sekdako Iqbal Pulungan dan Kadispora Djanu Asmadi, foto bersama pemenang lari 5 K SMP Putra.

atlet kita meraih juara umum pada turnamen karate terbuka KKNSI Tebingtinggi dengan 6 medali emas, 2 perak dan 7 perunggu,” ujar Benny yang juga menyerahkan tali asih kepada atlet Lemkari Medan berprestasi. Peresmian Dojo Lemkari Sukamaju dirangkai dengan latihan bersama yang diikuti tidak kurang dari 150 atlet asal Kota Medan, Binjai dan Langkat di Lapangan Suka Surya STM dengan tujuan meningkatkan kemampuan atlet jelang menghadapi ujian kenaikan tingkat (UKT) Kyu Lemkari Sumut, 29 Mei nanti.’ Ketua Dojo Lemkari Sukamaju Zulkarnain SH MAP dan Ketua MSH Lemkari Kota Medan H Aidil Fitri menyatakan tekadnya memaksimalkan pembinaan di Dojo Sukamaju yang kini membina 28 atlet. “Dojo Sukamaju menggelar latihan setiap Jumat dan Sabtu malam. Dojo ini terbuka untuk umum dan saat ini dilatih tiga pemegang sabuk hitam masingmasing Mariana (DAN III), Surya (DAN I), dan Widhi (DAN I),” ucapnya. (m42)

BINJAI (Waspada): 1320 Pelajar SD dan SMP mengikuti lari 5 K Bank Sumut Cabang Binjai yang dilepas Walikota Binjai HM Idaham, Sabtu (14/5) di lapangan Merdeka. Idaham ketika membuka lomba mengaku, tidak menduga pesertanya membludak. Dia pun mengharapkan pelajar SD maupun SMP Binjai mampu melahirkan prestasi terbaik. “Prestasiku , Tabunganku,” ujar Idaham sembari mengibaskan bendera start disaksikan unsur Muspida dan pejabat Pemko Binjai. Pimpinan Bank Sumut Cabang Binjai Syahmirdan Siregar yang juga Ketua PASI Binjai mengemukakan , lomba lari 5 K sengaja diprogram guna menggali potensi atletik Kota Rambutan. “Melalui olahraga, kita juga memberikan pendidikan menabung, Maka hadiah Lari 5 K berbentuk Tabanas Tabunganku dari Bank Sumut Cabang Binjai,” tambah Syahmirdan. Hasil lomba katagori SD putra; juara I Ramadhana, II Yudi, III Bewari Sujarwo, IV Suhendri, V Riko, VI M Chandra, VII Hafiz Al Azhari, VIII Ramadhani, IX Ridho dan X Yogi. Putri juara I Umi Erianti, II Idfitri Dayanti, III Yohana Rizki, IV Halimah Sitepu, V Khairunisa Lbs, VI Tamara Blesenki, VII Novita Sari, VIII Salma Maulisa, IX Emiyana Tasya dan X Salwa. SMP Putra juara I M Basyir Harahap, II M Syahputra, III M Rezeki Andika, IV Dimas Prasetyo, V Dwi Kurnia Putra, VI M Bima Akbar, VII Sofian R, VIII Fahrurozi, IX M Alpin Rusidi dan X Syawal Fitri. Putri juara IWahyu Zatiah, II Nia Ramadana, III Larita Zuliarosa, IV Gusti Nasari,V Putri,VI Sri Ayu Aditia,VII Isfani,VIII Rari Syahpitri, IX Nurisnaini, dan X Novita. (a04)



1320 Pelajar Lari 5K Bank Sumut Binjai

SSB Gajahruku Bina Usia Dini LABUHANRUKU (Waspada): Sekolah Sepakbola (SSB) Gajahruku Labuhanruku Batubara giat membina pemain usia dini. Menurut Ketua SSB Gajahruku, Juan da Nast, pembinaan sepakbola usia 8, 10, 12, 14, dan 16 tahun di Labuhanruku sekitarnya dilakukan dalam upaya kembali menggalakkan persepakbolaan. Pada Minggu (15/5), SSB Gajahruku menggelar pertandingan persahabatan melawan SSB Jampalan Asahan di lapangan Labuhanruku. Dikatakan, tim U-8 Gajahruku bermain imbang tanpa gol. Sementara itu, tim U-12 Gajahruku unggul 2-1 hasil dua gol tendangan dari Alfan sebelum diperkecil oleh Iwan. Lalu, skuad U-16 SSB Jampalan sukses merebut kemenangan ketika mengalahkan tuan rumah 3-1. (a12)

Aditya Masuk Tim Sumut U-13 TANJUNGGADING (Waspada): Pemain PS Aldas Prima Inalum Tanjunggading, Kecamatan Seisuka, Batubara, Aditya Prakoso, lolos seleksi dan terpilih untuk memperkuat Tim U-13 Sumut. Tim Sumut ini dipersiapkan untuk ambil bagian pada Festival Sepakbola U-13 Piala Yamaha Road to ASEAN di Jakarta, 2-6 Juni mendatang. Aditya pun menjadi satu-satunya pesepakbola dari Batubara yang lolos seleksi. Putra dari Junaidi yang juga karyawan PT Inalum Kualatanjung itu kini duduk di bangku kelas 1 SMP Negeri 1 Seisuka. Bagi rekannya setimnya di Aldas Prima, Aditya merupakan pemain handal dan penyerang kebanggaan tim binaan Inalum itu. (c04)

Problem Catur Putih melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2.


UMUM Mendatar

1. Ilmu tentang bahasa; Telaah bahasa secara ilmiah. 5. Waktu; Masa. 8. Kamus dalam bentuk yang ringkas. 9. Tali kalung kuda. 12. Timbul; Muncul. 13. Ungkapan atau kalimat berisi perbandingan, perumpaan, nasihat atau aturan tingkah laku. 16. Tautan pikiran yang menimbulkan nilai rasa pada seseorang ketika berhadapan dengan sebuah kata. 17. Kehalusan dan kebaikan budi pekerti; Akhlak. 21. Berisi penuh (ttg butir padi); Banyak isinya (ttg pidato dsb) 23. Modal; Makanan/uang untuk perjalanan. 24. Jenderal Belanda yang terbunuh di Sumut. 25. Gerbang cukai jalan. 26. Sikap dan langkah; Perbuatan; Gerak-gerik (dua kata, tulis tanpa spasi). 28. Senjata berisi bahan peledak untuk menimbulkan kerusakan besar. 30. Lapisan tipis kulit. 32. Bau-bauan yang harum. 33. Kehidupan yang dapat muncul dari benda yang tidak hidup.

1. Mengandung air/hawa (ttg udara); Tidak kering benar (ttg tanah). 2. Baik, bagus (Inggris populer). 3. Pemberontak yang sebelumnya penguasa di Afghanistan. 4. Perbendaharaan kata. 6. Lulusan sekolah (terutama sekolah menengah tingkat atas). 7. Jenjangan kepangkatan pada Angkatan Laut; Laksamana. 10. Sejenis gado-gado dari bahan sayuran mentah. 11. Barang bekas. 14. Cara pendekatan terhadap suatu masalah dengan memandangnya sebagai suatu kesatuan yang utuh. 15. Begitu/Jadi (Inggris). 18. Lawan muka/depan. 19. Upacara yang dilakukan dengan cara mandi air suci (pada penobatan raja atau pejabat tinggi). 20. Kelas masyarakat dari golongan menengah ke atas (biasanya dipertentangkan dengan rakyat jelata). 21. Liar (tentang pandangan mata). 22. Terbebas dari bahaya. 27. Ruang di dalam istana; Keraton; rumah pemujaan (agama Hindu). 28. Surat kecil pinjaman uang. 29. Panggilan kepada pria yang agak tua. 30. Atas nama. 31. Nada ke-2 pada urutan tangga nada diatonik.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan hari ini: sangat mudah (*), bisa diselesaikan dalam waktu tak sampai empat menit. Jawabannya lihat di halaman A2 kolom 1.

7 5 9 8 4 8 9 7 4 6 1 2 6 8 3 9


6 4 2 5 8 7 2 1 9 3 5 8 6 1 3 2

2 3 6 8 5

8 6 5 9 1 9 5 7 2 6 8 ve204



WASPADA Senin 16 Mei 2011

Le Mans Milik Stoner LE MANS, Prancis (Waspada): Casey Stoner (foto) melengkapi dominasi Honda di sepanjang akhir pekan MotoGP Prancis setelah tampil sebagai juara di Sirkuit Le Mans, Minggu (15/5) malam. Sukses Stoner diikuti rekan satu timnya di Repsol Honda, Andrea Dovisioso, yang merebut posisi runner-up dengan memenangkan duel dengan andalan Ducati, Valentino Rossi. Hasil di Le Mans menjadi kemenangan kedua Stoner musim ini dan pertama di Le Mans sepanjang karirnya. Bagi Dovizioso dan Rossi, hasil ini merupakan podium pertama ke-

duanya tahun ini. Stoner, menguasai sesi free practice dan meraih pole position, mendominasi 28 putaran balapan dan finish dengan catatan waktu 44 menit 3,955 detik. Rider asal Australia itu unggul 14 detik di depan Dovizioso dan Rossi. MotoGP Prancis awalnya berjalan ketat dan menarik. Namun, Stoner berhasil melepas-

kan diri meninggalkan pesaingnya memasuki paruh kedua. Di akhir-akhir lomba, giliran Dovizioso, Rossi dan juara dunia Jorge Lorenzo berebut posisi podium. Lorenzo, catatan waktunya terpaut 21 detik, finish keempat disusul Marco Simoncelli yang kembali harus melupakan podium pertamanya tahun ini akibat terkena ride through penalty. Simoncelli dihukum atas manuvernya yang berbahaya di lap ke-20 saat mencoba melewati Pedrosa yang kemudian terjatuhnya. Atas kejadian ini, Pedrosa

mengalami cedera pada bahu kanannya. Ketika bertarung dengan Simoncelli, pembalap Spanyol itu tergelincir dengan bahu kanannya menghantam trek. Pedrosa pun gagal melanjutkan balapan dan berjalan sambil memegangi bahunya. Kemenangan membuat Stoner mempertipis selisih angka di perebutan gelar juara dunia, di mana dengan total poin 66 kini hanya terpaut 12 angka dari peringkat pertama yang masih diduduki Lorenzo (78). Pedrosa ada di urutan ketiga (61) diikuti Dovizioso (50) yang menggeser Rossi (47). (m47/ap)

Sharapova Tambah Cantik ROMA (Waspada): Kemenangan di atas tanah liat terbaik dicapai Maria Sharapova (foto) dengan menjuarai turnamen Roma Masters di Foro Italico, Minggu (15/5). Sebelumnya, laga puncak sempat tertunda hujan selama tiga jam. Di final, Sharapova tampil lebih baik dan mengalahkan petenis Australia Samantha Stosur 6-2, 6-4. Mengawali laga sehabis hujan, mantan ratu tenis dunia asal Rusia itu langsung merebut empat game perdana. Penampilan gemilang unggulan ketujuh ini pun sulit diimbangi Stosur yang bermain tanpa mengenakan kacamata hitam sebagaimana ciri khasnya. Stosur, unggulan keenam, memimpin 2-1 di set kedua sebelum Sharapova bangkit dan memperbaiki performanya. Usai mematahkan servis lawan, Sharapova terus melaju sebelum menutup turnamen dengan kemenangan historis dalam kariernya. Sebelumnya, Masha -sapaan akrabnya- lolos ke final dengan mengejutkan

Pedrosa Cedera LE MANS, Prancis (Waspada): Nasib Dani Pedrosa benarbenar sial. Belum pulih sepenuhnya dari cedera tulang selangka kiri, Pedrosa mengalami patah tulang selangka kanan setelah kecelakaan di MotoGP Prancis akibat manuver berbahaya Marco Simoncelli. Pedrosa mengalami kecelakaan saat balapan di Le Mans, Minggu (15/5), menyisakan 11 lap dalam perebutan posisi kedua dengan rider Honda Gresini, Marco Simoncelli. Pedrosa terjatuh setelah menyenggol bagian belakang motor Simoncelli yang melakukan manuver berbahaya dengan memotong jalan dari sisi luar. Setelah kecelakaan, Pedrosa terlihat masih ingin berusaha menghampiri motornya dan melanjutkan balapan. Namun, rider asal Spanyol itu merasa kesakitan dan terus memegang bahu bagian kanan. Pedrosa akhirnya memutuskan untuk tidak melanjutkan balapan. Cedera ini membuat Pedrosa terancam absen di MotoGP Catalunya, yang notabene kandang Pedrosa, 5 Juni mendatang. (m33/auto)

petenis terbaik putri asal Denmark, Caroline Wozniacki di babak empat besar. Kini, Sharapova tinggal membutuhkan titel di Prancis Terbuka guna melengkapi koleksi gelar grand slam miliknya. Tak hanya itu, kesuksesan di Roma ini dipastikan memasukkan nama Sharapova sebagai salah satu kandidat juara tahun ini di Roland Garros, 22 Mei nanti. (m33/ap)


Hasil MotoGP Prancis Casey Stoner Andrea Dovizioso Valentino Rossi Jorge Lorenzo Marco Simoncelli Ben Spies Nicky Hayden Hiroshi Aoyama Hector Barbera Karel Abraham Toni Elias Alvaro Bautista Colin Edwards

(Australia/Repsol Honda) (Italia/Repsol Honda) (Italia/Ducati Marlboro) (Spanyol/Yamaha Factory) (Italia/Honda Gresini) (AS/Yamaha Factory) (AS/Ducati Marlboro) (Jepang/Honda Gresini) (Spanyol/Aspar Ducati) (Rep Ceko/Cardion Ducati) (Spanyol/LCR Honda) (Spanyol/Rizla Suzuki) (AS/Yamaha Tech 3)

44:03.955 44:18.169 44:18.519 44:25.030 44:35.200 44:35.564 44:39.521 44:55.457 45:07.686 45:07.840 45:08.023 45:08.147 2 lap



Berita Utama

WASPADA Senin 16 Mei 2011

Pengamanan Kelulusan UN

Siswa Berbuat Kriminal Ditindak

(kupon polling di hal. B10)

Survei: Orba Lebih ... Hasil survei memperlihatkan, publik mempersepsikan Orba lebih baik di bidang politik, ekonomi, sosial, dan keamanan. Orde Reformasi hanya unggul di bidang penegakan hukum. Di bidang politik, 33,3 persen responden mempersepsikan Orba lebih baik. Sementara itu, hanya 29,6 persen responden yang mempersepsikan Orde Reformasi lebih baik. Di bidang ekonomi, 56,3 persen responden mempersepsikan Orba lebih baik. Sementara itu, hanya 20,3 persen responden yang mempersepsikan bahwa Orde Reformasi lebih baik. Di bidang keamanan, sebanyak 53,7 persen responden mengatakan, Orba lebih baik. Hanya 20,6 persen responden yang menganggap Orde Reformasi lebih baik. Sementara itu, di bidang hukum, 27,6 persen

Israel Tembaki ... negara Israel pada tahun 1948. Ratusanribu warga Palestina melarikan diri atau terpaksa keluar dari rumah mereka dalam peperangan setelah pembentukan negara baru itu. Jon Donnison dari BBC, di Ramallah, satu kota di Tepi Barat Palestina, mengatakan protes Nakba tahun ini telah memberikan dorongan pergolakan di negara-negara Timur Tengah dan Afrika Utara. Di Ramallah ada bentrokan di perbatasan, di seberang Jerusalem Timur. Para pemrotes Palestina melempari pasukan keamanan Israel dengan batu, yang kemudian membalas dengan menembaki mereka dengan gas airmata dan peluru karet.

Bus Sejahtera-Avanza ... Korban cedera, menurut Heru, tiga penumpang Avanza, delapan penumpang bus Sejahtera. Heru mengatakan, peristiwa tabrakan antara bus Sejahtera dan mobil pribadi tersebut terjadi di sekitar UPT Balai Benih di Kec. Tanjungmorawa Deliserdang. Mobil pribadi yang menuju Lubukpakam dikemudikan Agus Umar Dani, warga Kel. Sei Putih Timur membawa dua penumpang.Sedangkan bus Sejahtera datang dari arah Tebingtinggi. Akibat kecelakaan itu, istrinya Nilawati dan mertuanya Rabiani mengalami luka-luka sehingga harus dirawat di RS Medistra Lubukpakam. Peristiwa tabrakan itu juga menyebabkan delapan pe-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Me7+, Gd7. 2. MxG+, Rb6. 3. a5+mat.

Jawaban TTS: TTS Topik








Jawaban Sudoku: 7 9 6 5 4 2 1 8 3

5 1 4 8 3 6 2 7 9

2 8 3 9 7 1 4 6 5

1 6 2 7 8 9 5 3 4

3 7 5 6 1 4 8 9 2

9 4 8 2 5 3 6 1 7

4 2 7 3 6 8 9 5 1

8 3 9 1 2 5 7 4 6

6 5 1 4 9 7 3 2 8

menganggap Orba lebih baik. Sementara itu, 34,3 persen responden menganggap Orde Reformasi lebih baik. Hasil survei yang melibatkan 1.200 responden secara nasional dan dilakukan pada tanggal 25 April-4 Mei 2011 ini menunjukkan, masyarakat yang tinggal di perkotaan lebih banyak yang mempersepsikan bahwa Orba lebih baik dibandingkan periode kepemimpinan lainnya, yaitu sebanyak 47,7 persen. Angka ini lebih tinggi 12 persen jika dibandingkan dengan persentase masyarakat pedesaan yang mempersepsikan Orba lebih baik, yaitu 35,7 persen. Dari tingkat pendidikan, seluruh jenjang pendidikan menyatakan bahwa Orba lebih baik. Namun, secara persentase, semakin tinggi tingkat pendidikan responden, tingkat kepuasan terhadap Orba semakin rendah. (vvn) Militer Israel mengatakan pihaknya hanya melepaskan tembakan peringatan di Dataran Tinggi Golan ketika para pemrotes berusaha menerobos pagar. Namun laporan yang belum dikonfirmasi mengatakan empat orang tewas dan sekurang-kurangnya 10 orang cedera. Peristiwa itu terjadi dekat Majdal Shams. Israel menguasai wilayah strategis dari Syria pada tahun 1967. Cedera dalam penembakan di perbatasannya dengan Israel. Lebih ke selatan, di Erez, lintas batas antara Israel dan Gaza, pasukan Israel melepaskan tembakan dengan tank dan senapan mesin, yang mencederai sekurang-kurangnya 15orang, demikian kata para pejabat Palestina. (m10) numpang bus Sejahtera mengalami luka ringan dan mendapatkan perawatan di RS Medistra. Kedelapan penumpang yang merupakan warga Kab. Samosir itu adalah Emuli Siregar, Rugun Situmorang, M Minar, J Sinaga, Benget Parhusip, Intauli Sinaga, D Purba, S Manik. Pihak kepolisian belum dapat mengetahui penyebab terjadinya tabrakan tersebut karena sopir bus Sejahtera melarikan diri tanpa peduli terhadap nasib para penumpangnya yang menjerit-jerit histeris. Pihaknya masih melakukan penyelidikan untuk mengetahui identitas dan keberadaan sopir us tersebut. “ Sedang diselidiki untuk dilakukan penangkapan,” kata Heru.

Ada-ada Saja ... “Menang buat Cuntis”. Dengan rambut pendek warna putih dan senyumnya, ia mengenang saat pernah memberi suara dalam usia 24 tahun di sekolah setempat pada 19 November 1933, pemilihan umum pertama yang dibuka buat perempuan setelah parlemen memberi persetujuannya dua tahun sebelumnya. Suaminya telah memberi dia kertas suara di pintu sekolah itu sebagai formulir hadiah ulang tahun. “Ia memberi kertas suara itu kepada saya, saya masuk dan menaruhnya di tempat kertas suara. Itu lah untuk kali pertama perempuan memberi suara di Spanyol. Dan saya ada di sana,” kata Villaverde kepada harian El Mundo, seperti dikutip dari AFP, Minggu (15/5). Di antara politikus saat ini, ia mendukung Menteri Pertahanan Carme Chacon sebab ia seorang perempuan. “Perempuan memangku jabatan,” katanya. Chacon dapat jadi calon untuk mengambil-alih pimpinan Partai Sosialis dari Perdana Menteri Jose LUis Rodriguez Zapatero, yang telah memutuskan untuk tidak mencalonkan diri lagi dalam pemilihan umum mendatang pada 2012. Villaverde mengakui ia suka memilih Zapatero. “Ia tampan dan ia adalah orang baik. Yang paling buruk ialah ia pensiun.” Villaverde, janda sejak 1973 dengan tiga cicit dan seorang buyut, mengatakan ia telah jadi “seorang sosialis sejak dilahirkan” dan sangat “suka ngomong politik”. “Kamu mesti memberi suara bukan untuk teman mu tapi buat prinsip kamu,” ujar Villaverde kepada El Mundo. (yahoo/rzl)

Waspada/Ismanto Ismail

KANIT Reskrim Iptu Zulkifli Harahap, SH, sedang menginterogasi Ardi Wiranata Surbakti, 19, dan Donion M.Simamora, 32, korban penipuan CPNS, usai membuat pengaduan yang diterima Ka Sentral Pelayanan Kepolisian (SPK) Polsekta tersebut Aiptu J. Simangungsong, SH, Minggu (15/5) sore.

Istri Anggota DPRD ... suaminya (bibiknya-red) M. Aliaman Tarigan penduduk Jalan Nenas, Binjai Barat, datang ke rumah YS sambil membawa uang Rp120 juta. Setelah uang itu diserahkan, YS menawarkan CPNS yang dibutuhkan adalah di Lapas. YS menjanjikan apabila tidak diterima sebagai CPNS, uang akan dikambalikan tanpa ada potongan apapun. Sebulan kemudian, Ardi mengikuti ujian pemberkasan di kantor Kementerian Hukum dan HAM di depan Deli Plaza Medan. Ujian fisik di Jalan Gaperta Medan, lulus. Ujian di lokasi

Ical Minta Syamsul ... “Terutama pada hal-hal kinerja Golkar ke depan yang telah diputuskan dalam Munas maupun Musda partai,” kata Abu Rizal Bakrie yang datang ke Rutan Salemba membesuk Syamsul Arifin, Sabtu (14/5) malam. Hal tersebut diungkapkan Syamsul Arifin kepada Waspada, Minggu (15/5), tentang kedatangan Abu Rizal Bakrie Ical. Menurut Syamsul pertemuan dengan Ketum DPP Partai Golkar khusus membicarakan Golkar di Sumut pasca penonaktifan dirinya dari Ketua DPW Golkar. “ Ketum Golkar minta saya tetap berada di barisan terdepan dalam menggerakkan Partai Golkar di Sumut. Memang sudah ada pelaksana DPW Golkar Sumut, tapi pak Abu Rizal Bakrie meminta saya untuk terus berada di garis partai dalam memperjuangkan amanat partai untuk rakyat, khususnya rakyat

Jumlah Pendaftar ... Untuk kelompok IPS jumlah pendaftar sebanyak 1.559 (lulusan 2009 dan 2010), 380 orang (lulusan 2011), dengan jumlah total pendaftar untuk kelompok IPS sebanyak 1.939 orang. Sedangkan jumlah total pendaftar untuk kelompok IPC sebanyak 1.609 dengan rincian, 1.218 orang (lulusan 2009 dan 2010) dan 391 orang (lulusan 2011). Diperpanjang Bisru menyebutkan, Panitia Pelaksana SNMPTN Tahun 2011 memutuskan memperpanjang masa Pendaftaran SNMPTN jalur ujian tertulis bagi lulusan SMU/SMK/MA sederajat tahun 2009 dan 2010. Perpanjangan masa pendaftaran tersebut yaitu untuk masa Pembayaran di Bank Mandiri hingga 24 Mei 2011 pukul 12:00WIB (sama bagi lulusan 2011), sedangkan masa pendaftaran online pada website juga diperpanjang sampai dengan tanggal 25 Mei 2011. Dijelaskannya, seyogianya masa pendaftaran untuk lulusan tahun 2009 dan 2010 tersebut berakhir pada 10 Mei lalu, namun berdasarkan surat Panitia SNMPTN 2011 dengan nomor 098/SNMPTN/2011 yang ditandatangani Prof. Dr. Ir. Herry Suhardiyanto, M.Sc selaku

Ribuan Benda Kuno ... Hal ini menunjukkan dan menegaskan arti pentingnya Situs Kota China sebagai salah satu Bandar Perniagaan Utama di Sumatera Timur pada abad ke-11. Penelitian ini mempertegas kembali peranan Situs Kota China dalam segitiga arkeologi di Sumatera Utara yang menghubungkan Barus, Portibi dan Kota China sebagaimana yang ditegaskan oleh Daniel Perret dari Perancis dalam bukunya: Kolonialisme dan Etnisitas (2010). Daniel Perret di lokasi penggalian di Kelurahan Danau Siombak, Medan Marelan, Sabtu (14/5) kepada wartawan menyebutkan, pihaknya sudah melangsungkan ekskavasi tersebut selama tingga minggu dan membuka kotak ekskavasi sebanyak 6 unit di tiga titik yang berbeda dengan ukuran 5 x 5 meter dengan kedalaman 0,5 hingga 1,5 meter. “Hasil ekskavasi adalah ditemukannya dalam jumlah besar seperti fragmen keramik, frag-

stadion Teladan, gugur. Karena tidak ada kejelasan, pihak korban berusaha menemui pelaku.’’ Pada Mei 2011, pelaku mengembalikan uang Rp105 juta dalam dua tahap yakni tahap pertama Rp100 juta dan tahap kedua Rp5 juta, ‘’ ungkap korban. Sedangkan pada 20 Januari 2010 Donion M.Simamora akan yang akan disisipkan menjadi CPNS di kantorWalikota Medan memberikan uang Rp115 juta kepada pelaku YS di rumahnya. Tetapi, tunggu punya tunggu tidak ada kejelasan. Korban mencoba menemui pelaku dan tidak ada jawaban yang pasti. Merasa ditipu, korban meneruskan kasus ini kepihak berwajib. Lani Gustina, SH, selaku pe-

nasehat hukum kedua korban mengatakan, pihaknya akan terus menindaklanjuti dan mendampingi kleinnya. Kapolsekta Medan Helvetia Kompol Sutrisno Hady Santoso, SH,SIK melalui Kanit Reskrim AKP Zulkifli Harahap, SH, mengatakan, korban penipuan CPNS sebanyak 15 orang. Dua korbannya sudah membuat pengaduan resmi di Polsekta Medan Helvetia. Zulkifli mengatakan, kita akan proses dan membuat panggilan saksi selesai diperiksa, setelah itu memanggil pelakunya. “Dalam kasus ini, pelaku mengaut uang sekitar Rp1,5 miliar dari para korbannya,” kata Zulkifli. (m36)

Sumut,” terang Syamsul membuka isi pembicaraan khusus kepada Ketum DPP Golkar itu kemaren malam. Dikatakan Syamsul, Ketum DPP Golkar datang ke Rutan Salemba tempat dia ditahan dalam kasus dugaan tindak pidana korupsi APBD Pemkab Langkat, didampingi sejumlah pengurus teras DPP Golkar, diantaranya, Setya Novianto dan Aziz Syamsuddin. Selain meminta Syamsul Arifin tetap berada di garda terdepan, dalam pertemuan khusus tersebut lanjut Syamsul, Abu Rizal Bakrie berharap proses hukum yang tengah dihadapinya berjalan sesuai hukum dengan mengedepankan praduga tak bersalah serta menggunakan fakta-fakta di persidangan. Mengenai penonaktifan dirinya dari ketua DPD Partai Golkar Sumut, agar Syamsul Arifin fokus dalam proses hukum yang tengah berlangsung. “ Itu dikatakan Pak Abu Rizal, penonaktifan ini agar saya fokus tanpa

mengganggu pikiran lainnya. Tapi saya diminta untuk terus aktif dan berperan di Golkar,” kata Syamsul. Permintaan Ketum Golkar itu tidak bisa ditolak oleh Syamsul, karena konsistenitas dan konsekwensi Golkar yakni ‘Suara Golkar, Suara Rakyat’, sama halnya dengan dirinya yang lebih mengutamakan kepentingan rakyat di atas segalanya. “Suara Rakyat tidak bisa dibohongi, itulah kenapa saya tidak bisa menolak permintaan Ketum Golkar untuk tetap eksis memperjuangkan rakyat,” katanya. Syamsul mengatakan, Ketum Golkar menegaskan, agar seluruh kader Golkar tetap profesional fokus pada urusan kerakyatan dan dilarang menghujat, memfitnah apalagi mensyukuri atas musibah orang lain. “Ada penegasan Abu Rizal, agar kader tidak Golkar tidak ikutikutan menghujat dan mensyukuri atas musibah orang lain,” katanya. (j02)

Ketua Panitia Pusat SNMPTN 2011 telah memutuskan memperpanjang masa pendaftaran bagi lulusan SMU sederajat tahun 2009 dan 2010 tersebut hingga 25 Mei 2011 dan masa pembayaran di Bank Mandiri ditutup pada 24 Mei pukul 12:00. Keputusan perpanjangan masa pendafatran SNMPTN jalur ujian tertulis untuk lulusan SMU sederajat tahun 2009 dan 2010 diambil setelah panitia pusat menindaklanjuti permohonan dari Panitia Lokal (Panlok) Palembang, Palu, Kupang, Bengkulu, Solo, Aceh, Jayapura serta beberapa panlok lainnya berkenanaan dengan permohonan para panlok tersebut yang meminta masa pendaftaran bagi lulusan SMU/SMK/MA dan sederajat tahun 2009 dan 2010 dapat diperpanjang. Segera mendaftar Menyangkut pendaftaran SNMPTN ini, Ketua Panlok USU mengimbau kepada para calon peserta SNMPTN, untuk lebih cepat melakukan pembayaran dan pendaftaran. Jangan menunggu pada hari terakhir pendaftaran karena berdasarkan pengalaman sebelumnya dikhawatirkan bila terjadi penumpukan/kepadatan pendaftar menjelang hari terakhir akan dapat menganggu server di pusat data. Bila terjadi penumpu-

kan/kepadatan pendaftaran dikhawatirkan terjadi kemacetan server sehingga sulit untuk online tentu hal ini akan merugikan pendaftar sendiri. Pengumuman Jalur Undangan Sementara itu Ketua Panlok USU juga menyampaikan, hasil ujian SNMPTN 2011 Jalur Undangan dijadwalkan akan diumumkan pada Rabu 18 Mei 2011. Pengumuman tersebut dapat diakses atau dilihat di website Bagi para peserta SNMPTN Jalur Undangan yang dinyatakan lulus atau diterima di USU diwajibkan untuk melakukan pelaporan pada tanggal 31 Mei dan 1 Juni 2011 di Gelanggang Mahasiswa Jl. Universitas Kampus USU (masuk dari Pintu I) mulai pukul 08:00 WIB. Kelengkapan yang harus dibawa pada saat melakukan pelaporan adalah Kartu SNMPTN 2011 Jalur Undangan asli, Rapor asli dan fotokopi dilegalisir rangkap 2, Ijazah asli dan fotokopi dilegalisir (lulusan 2009/2010)atau SKHUN (Surat Keterangan Hasil Ujian nasional) asli dilengkapi foto ukuran 3x4 cm (bagi yang belum keluar ijazah), dan surat ganti nama bagi yang pernah ganti nama. Untuk informasi lebih lengkap tentang pelaporan ini dapat dilihat di website (m41)

men gerabah, koin China, manik-manik, tulang belulang, kerang, peleburan besi, bata kuno, batu pecahan arca serta yang sangat menarik adalah ditemukannya serpihan lembaran emas kuno,” sebut Dr. Daniel Perret di dampingi Ery Soedewo, peneliti di Balai Arkeologi Medan seraya menyebutkan, seluruh temuan-temuan ekskavasi tersebut akan diteliti dalam waktu satu minggu terakhir. Menanggapi hasil temuan tersebut, Kepala Pussis-Unimed Ichwan Azhari menyebutkan, ekskavasi ini menunjukkan apresiasi dan perhatian dunia internasional yang begitu penting terhadap penyingkapan misteri sejarah dan arkeologi di Kota China yang memiliki peranan penting pada abad ke 11 hingga 15 di Sumatera Timur. “Penelitian ini secara perlahan akan mengungkap misteri kota kuno di utara kota Medan yang situsnya kurang mendapat perhatian dari Pemerintah Kota (Pemko) Medan,” ujar Ichwan Azhari. Ichwan Azhari menyebutkan, penelitian dan ekskavasi

ini didanai oleh pemerintah Prancis melalui Lembaga Kajian Prancis untuk Asia (EFEO) yang dilaksanakan sejak 28 April 2011 dan dipimpin Dr. Daniel Perret. Penelitian ini melibatkan 30 orang peneliti dan tenaga pembantu lapangan yang dilaksanakan secara kerjasama antara Pusat Arkeologi Nasional, Balai Arkeologi Medan, Pussis-Unimed dan Museum Kota Cina. Sementara itu, staf Pussis Unimed, Erond Damanik mengemukakan, hasil penelitian tersebut akan memperkuat hipotesis tentang peranan Kota China sebagai Bandar Perniagaan di Sumatra Timur pada abad 11 sebagaimana yang ditegaskan oleh Dr. Edwards McKinnon dalam disertasi doktoralnya di Cornell University Amerika Serikat yang telah melakukan penelitian di Situs Kota China sejak tahun 1972-1977. “Atas dasar itu pula, kiranya Pemko Medan perlu mengambil tindakan berupa langkahlangkah penyelamatan Situs Kota China sebelum seluruhnya tergerus oleh masyarakat,” ujar Erond Damanik. (m41)

MEDAN (Waspada): Polda Sumut menurunkan tim pengamanan guna mengantisipasi hal-hal tidak diinginkan saat pengumuman Ujian Nasional (UN) Sekolah Menengah Atas (SMA) di Medan dan wilayah lainnya di Sumut. Kabid Humas Polda Sumut AKBP Heru Prakoso mengatakan, pengamanan dilakukan guna menjaga suasana di Medan serta daerah lainnya di Sumut tetap kondusif. Kepolisian, kata dia, akan mengawasi sekolah-sekolah yang mengumumkan kelulusan, juga mengawasi para siswa yang merayakan kelulusan dengan aksi coret-coret. Dia mengimbau agar para siswa yang lulus tidak meluapkan kegembiraannya di luar kewajaran, semisal minum minuman keras dan kebut-kebutan. “Polisi akan melakukan

tindakan jika menemukan itu,” sebutnya ditanya Waspada, Minggu (15/5).. Meski melakukan pengamanan selama pengumuman UN, tetapi kata Heru, pengamanan dilakukan polisi tidak seperti pengamanan saat terjadi demo atau saat-saat hari besar. “Biasa saja kok, pengamanan dilakukkan anggota yang sudah ditunjuk,” kata dia. Mengenai jumlah personil, akan disesuaikan dengan kebutuhan di lapangan. Heru mengatakan, pengamanan dilakukan anggota Polsek dibantu Polres. “Polda hanya berkoordinasi saja dengan Polres,” jelasnya. Sementara, Kapolresta Medan Kombes Pol. Tagam Sinaga ditanya hal sama mengatakan, pengamanan akan dilakukan jajaranPolsektadiMedan.“Mereka yang akan memonitor di masing-masing sekolah,” sebutnya.

Tagam mengimbau seluruh siswa yang lulus di Medan tidak merayakannya dengan tindakan di luar batas. Patroli polisi akan disiagakan di setiap persimpangan jalan untuk mengawasi kemungkinan aksi kebutkebutan yang dilakukan para siswa yang merayakan kelulusan. “Mereka yang kedapatan ngebut akan ditindak,” sebutnya. Dia berharap para siswa yang tidak lulus agar tidak“patah arang” dengan melakukan perusakan atau tindakan kriminal lainnya. “Selain kepada siswa yang lulus agar tidak merayakan kegembiraan secara berlebihan, kami juga mengimbau siswa yang tidak lulus untuk tidak melakukan tindakan anarki, semisal melakukan perusakan, karena polisi akan tegas terhadap persoalan hukum seperti itu,” kata dia.(m27/m39)

Pengawas Cafe Mengamuk, Satu Tewas 3 Luka MEDAN (Waspada): Satu tewas dan tiga lainnya menderita luka tusuk ketika seorang pengawas di cafe New Citra Jalan Setia Indah, Dusun Sunggal Kanan, Kec. Sunggal, Deliserdang, mengamuk dan menikam empat pengunjung tempat hiburan tersebut, Minggu (15/5) dinihari. Korban tewas Rico Marciano Malau, 30. Korban ditikam di bagian leher dan tewas di RS Bina Kasih Jalan TB. Simatupang Sunggal. Tiga temannya yakni Ronaldo Abed Nego, 25, luka pada lengan sebelah kanan, Jhen Sen Han, 23, luka pada jari tangan kanan, Eghy Trisakti, 20, luka pada lutut sebelah kanan. Para korban dirawat di rumah sakit di Sunggal. Sedangkan tersangka pelaku A alias Pian, 16, ditangkap ketika mencoba me-

larikan diri. Informasi Waspada peroleh di lapangan, peristiwa itu terjadi pukul 02:00 dinihari, ketika ke empat korban sedang minum-minuman keras di cafe New Citra. Karena sudah dipengaruhi minuman keras terjadi pertengakaran antara keempat korban dengan penggunjung lainnya di cafe tersebut. Saat itulah tiba-tiba datang A alias Pian, 16, disebut-sebut sebagai pengawas cafe itu dan mengusir ke empat korban keluar dari dalam cafe. Sehingga ke empat korbanpun keluar. Setelah keluar, Pian pun keluar hingga mereka bertemu dan terjadi pertengkaran. Dalam suasana yang memuncak, Pian mengeluarkan senjata tajam. Rico yang mengetahui hal ini

berusaha merebut pisau tersebut tetapi meleset dan terhunjam ke leher Rico. Melihat Rico berlumuran darah, ketiga temannya berusaha mengamankan Pian. Tetapi, Pian mengamuk dan membabibuta menghunjamkan pisaunya kepada tiga korban teman Rico. Kapolsekta Sunggal Kompol Sonny Marisi Nugroho Tampubolon, SH, SIK, yang mendapat informasi turun ke lapangan bersama Kanit Reskrim AKP Sanggam Nainggolan, SH, Panit Reskrim Ipda B. Tarigan, SH, dan sejumlah personelnya dan mengevakuasi para korban ke rumah sakit. Sedangkan, Pian ditangkap di Jalan TB. Simatupang, Sunggal. Polisi menyita barang bukti sebilah pisau. (m36)

Anak-anak Direkrut ...

Taliban membantah tuduhan itu. Dalam satu pernyataannya yang dikeluarkan seminggu lalu, jurubicara Taliban Qari Yousef Ahmadi mengatakan kode etik pemberontak melarang orang-orang muda tinggal di pusat-pusat militer bergabung dengan para pejuang. Sebaliknya, dia menduga anak-anak muda itu bekerja untuk kepolisian Afghanistan serta perusahaan keamanan umum dan swasta. “Anak-anak itu telah bergabung dengan jajaran musuh atas bujuk rayu musuh yang memikat, mereka mengambil keuntungan dari kebodohan anakanak itu dan kurangnya pengetahuannya, “ katanya. Dalam beberapa bulan terakhir, katanya, serangan bom bunuhdiri anak-anak telah melakukan dua serangan maut. Penangkapan Farooq dan tiga anak-anak lainnya yang diduga akan melaksanakan serangan bunuhdiri terjadi awal bulan ini. Mashal mengatakan pihak berwenang menahan anak kelima yang akan melaksanakan pe-

ngeboman namun dia memutuskan untuk menentangnya. Farooq, yang mengenakan pakaian hijau tua dan kemeja gaya Afghanistan, mengatakan dia telah dibujuk menjadi pelaku serangan bom bunuhdiri oleh seorang mullah di satu masjid dekat Peshawar, Pakistan. Ceritanya tidak dapat diverifikasi secara independen. “Dia memberitahu kami bahwa ada pengkhianat di Kabul dan kami harus melakukan serangan bunuhdiri terhadap mereka,” kata anak-anak itu.“Kami diajari bagaimana menggunakan rompi bunuhdiri di Masjid Spin di Kher Abad dekat Peshawar di mana kami tinggal.” “Saya ingin pulang,” katanya menambahkan. “Saya rindu keluarga saya.” Serangan bom bunuhdiri paling akhir dilakukan oleh seorang anak yang terjadi pada 1 Mei. Polisi mengatakan seorang anak 12 tahun meledakkan dirinya sendiri di satu pasar di distrik Barmal, provinsi Paktika di timur Afghanistan, yang menewaskan, empat sipil dan mencederai 12 lainnya.

275 lulus 100 persen. Kota Tj Balai, peserta 370 lulus 100 persen. Kota Sibolga, peserta 179 lulus 100 persen. Kota Padang Sidempuan peserta 575 lulus 100 persen. Kota Gunung Sitoli peserta 69 lulus 100 persen. Kab. Deliserdang, peserta 932 tidak lulus 3 orang yakni peserta dari Program IPS. Kab. Langkat, peserta 1404 tidak lulus 2 orang yakni di Program IPS. Kab. Simalungun, peserta 863 lulus 100 persen. Kab. Karo, jumlah peserta 93 siswa lulus 100 persen. Kab. Dairi, jumlah peserta 196 lulus 100 persen. Kab. Asahan, jumlah peserta 1502 tidak lulus 7 orang yakni dalam Program IPA sebanyak 3 orang dan Program IPS sebanyak 4 siswa. Kab. Labuhanbatu, jumlah peserta 927 peserta, tidak lulus 2 siswa dalam Program IPS. Kab. Tapanuli Utara, jumlah peserta 29 siswa lulus 100 persen, Kab. Tapanuli Tengah, jumlah peserta 473 lulus 100 persen. Kab. Tapanuli Selatan, jumlah peserta 634 tidak lulus 3 orang di Program IPS. Kab. Mandailing Natal,

jumlah peserta 2.368 tidak lulus 2 orang dalam Program IPS. Kab. Humbahaspeserta18orang,lulus 100 persen. Kab. Pakpak Bharat peserta 21 orang lulus 100 persen. Kab. Serdangbedagai, jumlah peserta 764 tidak lulus 3 orag dengan Program IPS. Kab. Batubara, jumlah peserta 1059 orang tidak lulus 3 orang Program IPA 2 orang, IPS 1 orang. Kab. Pa-danglawas jumlah peserta 858 tidak lulus 1 orang, Program IPS. Kab.Padanglawasjumlahpeserta 879 tidak lulus 1 orang, Program IPS. Kab. Labuhanbatu peserta 833 orang, tidak lulus 3 orang Program IPS. Kab. Labuhanbatu, jumlah peserta 895 lulus 100 persen. Kab. Nias Utara, jumlah peserta 10 orang lulus 100 persen. Sebelumnya Kadis Pendidikan Kota Medan, Drs Hasan Basri MM menyampaikan siswa SMA dan SMK di Medan, yang lulus tahun ini untuk SMA dengan peserta 22.579 yang tidak lulus 56 siswa atau 0,25 persen. Sedangkan untuk siswa SMK jumlah peserta mencapai 14.886 dan yang tidak lulus hanya 43 siswa atau 0,29 persen. (m37)

memiliki ruang kelas dan taman bermain. Pada saat kunjungan ke fasilitas tersebut, Farooq tampak senyum dan mengatakan dia pergi sekolah dan bahwa dia bersama anak lainnya diberikan kesempatan untuk belajar menganyam karpet, bertukang dan kerajinan lainnya. Fasilitas tersebut menampung puluhan anakanak, sebagian besar ditahan dalam kasus kejahatan. Para pejabat intelijen Afghanistan mengatakan Taliban berpaling pada para remaja karena mereka lebih mudah direkrut dibanding orang dewasa dan cenderung lebih mudah dipercaya tentang apa yang ditugaskan perekrut kepada mereka. “Taliban merekrut anakanak dan menggunakan mereka untuk melakukan serangan bunuh diri di Afghanistan, “ kata Latifullah Mashal, seorang jurubicara dinas inelijen Afghanistan kepada para wartawan. “ Anak-anak yang tak berdosa itu telah tertipu dan dikirimkan ke Afghanistan.”

Siswa MA Di Sumut ... Mahya Bandar menyebutkan, untuk klasifikasi program kelulusan siswa Madrasah Aliyah yang ada di Sumatera Utara, Program Bahasa dengan peserta 85 orang lulus 100 persen. Program IPA dengan peserta 8.370 lulus 8.360 tidak lulus 10 siswa. Program IPS dengan peserta 10.095, siswa yang lulus 10.065 tidak lulus 30 siswa. Program keagamaan jumlah peserta 162 siswa yang lulus 162 siswa. Sementara untuk masingmasing kabupaten/kota, yakni Kota Medan dengan peserta 1.861 siswa tidak lulus 10 siswa, dengan klasifikasi Program IPA jumlah peserta sebanyak 918 tidak lulus 5 siswa. Program IPS jumlah peserta 882 tidak lulus 5 siswa. Program Bahasa dengan jumlah peserta 46 lulus 100 persen, Program Agama jumlah peserta 15 orang lulus 100 persen. Kota Pematang Siantar, peserta mencapai 323 lulus 100 persen. Kota Binjai jumlah peserta 338 lulus 100 persen. Kota Tebing Tinggi, jumlah peserta

Dosa Dan Kegelisahan ... Barangkali dalam perjalanan hidup kita, banyak sudah dosa yang kita perbuat, boleh jadi banyak pelanggaran yang kita “sulap” dan opinikan menjadi seakan-akan legal, semua menjadi rahasia yang ditata apik dan rapi, seolah-seolah kita tidak pernah melakukannya. Memang manusia sering kali penuh kebohongan, penyimpangan, dan kepura-puraan, yang semua itu menjadi jalan dosa. Dosa merupakan limbah dari suatu pelanggaran yang dilakukan manusia, baik dalam kaitannya dengan komunikasi vertikal (hablum minallah), maupun komunikasi horizontal (hablum minannas). Ada orang yang menjaga secara sungguhsungguh agar dirinya tidak terjebak dalam dosa dan pelanggaran vertikal, tetapi pada saat yang sama ia melakukan dosa-dosa terhadap sesama manusia dan kemanusiaan. Sebaliknya ada orang yang memoles prestise dan penampilannya di depan banyak orang, tetapi ia menyimpan sejumlah perilaku dan sikap yang selalu menyalahi dan bahkan melecehkan perintah-perintah Tuhan. Disadari atau tidak oleh manusia, kedua dosa dan kesalahan (vertikal dan horizontal) itu sama-sama menyebabkan kesulitan dan kegelisahan dalam kehidupan mereka. (QS. 3/ Ali ‘Imran: 112).

Memang banyak manusia yang belum menemukan hakikat hidupnya, meskipun sudah setengah baya atau bahkan sudah tua. Hidupnya tidak pernah kukuh, sikapnya elementer, perilakunya tidak mendasar, sehingga integritasnya tidak menggambarkan penampilan jasadnya. Manusia semacam itukah yang akan kita andalkan sebagai penyangga pembangunan masyarakat yang kita cita-citakan, dan pribadipribadi seperti itukah yang kita maksudkan sebagai partisipan cita-cita perbaikan dalam semua sektor kehidupan? Dosa adalah beban melilit dan menyesakkan. Semakin banyak sesorang melakukannya akan semakin “sumpek” kehidupannya. Bila ia berkelanjutan maka manusia akan “gedek” jalannya dalam melaksanakan pembangunan, perbaikan, dan perubahan. Sulit diajak pada kebenaran, bahkan sering menjadi beban dalam transisi dan perubahan. Tanpa kita sadari tiba-tiba kita menemukan manusia seperti ini dalam jumlah yang banyak di tengah masyarakat kita. Oleh karenanya salah satu upaya percepatan pembangunan bangsa kita diperlukan upaya kolektif untuk menyadari segala dosa yang kita lakukan dan segera mohon ampun secara tulus kepada Tuhan, agar kita dapat menjadi partisipan dalam perbaikan dan pembangunan bangsa yang kini kita lakukan bersama. Wa Allahu A’lamu bi al-Shawab.

Sumatera Utara

B2 Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, Rizaldi Anwar, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Rama dhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Anggota DPRD Sumut Reses, Kunjungi Beberapa Desa Di Dairi SIDIKALANG (Waspada): Anggota DPRD Sumut, Richard Edy Lingga,SE mengunjungi beberapa desa di kabupaten Dairi,setelah melakukan kegiatan yang sama di Kab.Karo dan Pakpak Bharat,Rabu (11/5). Richard mengatakan, kunjungan itu dalam rangka Reses bersama tiga temannya dari Komisi E,(Dapem X), yakni Ir Taufan Agung Ginting,Dermawan Sembiring dan Layari Sinukaban. Tujuan kunjungan itu, menurut Richard, untuk menerima aspirasi masyarakat serta ingin melihat secara langsung tingkat pereknomian warga dan skala prioritas apa yang paling dibutuhkan,yang nantinya dibawakan dalam sidang DPRD-SU dengan agenda RPAPBD Pemprovsu 2011 yang dijadwalkan Juli. Dalam kunjungan kerjanya ke desa Pegagan Julu VI dan desa DolokTolong,kecamatan Sumbul, Richard mengadakan pertemuan dengan warga di pusatkan di dusun Lae Tanggiang.Kemudian dilanjutkan ke desa Onan Lama kecamatan Pegagan Hilir.Sedangkan temannya menurutnya, berada di Karo dan Pakpak Bharat. Pada pertemuan itu, Kepala desa Pegagan JuluVI,Parat Simamora memaparkan tentang ketertinggalan desa di berbagai pembangunan.Salah satu di antaranya sama sekali belum memiliki sarana kesehatan.Baik Puskesma, Pustu dan Poskesdes belum ada. Selainitu,infrastruktur jalanjugasangatmemprihatinkan terutama jalan dari pemukiman ke sentra produksi pertanian, disamping sarana air minum yang belum tersedia. Sehingga warga kesulitan untuk mendapatkan air sebagai kebutuhan sehari-hari. Kepala Desa Dolok Tolong,Hebron Pintubatu menjelaskan, sebahagian besar warganya belum menikmati sara penerangan, karena jaringan listrik belum masuk.Sedangkan permohonan ke PLN sudah berulang kali dilakukan,namun tidak mendapat realisasi.(a20)

Senin 16 Mei 2011

Pemkab Karo Galakkan Kebersihan Obyek Wisata Gundaling


Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Edisi Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: H.T. Donny Paridy. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan).


KABANJAHE (Waspada) : Bupati Karo Kena Ukur Karo Jambi SurbaktibersamaWakilBupatiTerkelinBrahmanasertaunsurMuspida menggalakkan gerakan kebersihan dan penghijauan di ObyekWisata Bukit Gundaling, Berastagi, Kabupaten Karo, Jumat (13/5). Gerakan ditandai dengan gotong-royong kebersihan dan penanaman 360 pohon pinus di Puncak Bukit Gundaling. Hadir dalam acara itu Kapolres Tanah Karo AKBP Ig Agung Prasetyoko, Dandim 0205 Tanah Karo Letkol Kav. Prince Meyer Putong dan lainnya. Gerakan kebersihan dan penghijauan dengan fokus utama dari perbatasaan Kabupaten Karo – Kab. Deliserdang hingga Berastagi, Obyek Wisata Bukit Gundaling dan jalan protokol Kabanjahe Berastagi. Kapolres Karo AKBP Ig Agung Prasetyoko mendukung gerakan kebersihan dan penghijauan yang digalakkan Bupati Karo,kaitannya dengan peningkatan pelayanan kunjungan wisata ke Kabupaten Karo itu. (c09)

Sepedamotor Hilang Saat Di Parkir Waspada/Zulfan

WARGA bahu membahu memadamkan api yang melalap rumah milik Jahar Panggabean, Minggu (15/5) sekitar pukul 00:30 di Jalan P. Sidimpuan Km 6,2, Kel. Sibuluan Nalambok, Kec. Sarudik, Tapteng.

P. SIANTAR (Waspada) : Satu unit sepedamotor Suzuki SkyWave UW 125 SC milik korban Evi Maimunah, 31, warga Jalan Pelopor, Pematangsiantar hilang ketika diparkir di samping rumahnya. Dalam pengaduannya di Polres Pematangsiantar, Kamis (12/ 5) korban menyebutkan sepedamotornya itu hilang, Selasa (10/ 5) saat korban bermaksud membeli keperluan anaknya dan ke luar dari dalam rumah dan hendak mengambil sepedamotornya. Korban menjadi sangat terkejut ketika tidak melihat lagi sepeda motornya di tempatnya diparkirkan. Korban sudah berupaya mencaricari sepedamotornya itu, namun tetap tidak ditemukan, lalu korban mengadu ke Polres. (a30)

Rumah Terbakar, Mobil Damkar Tapteng Diamuk Massa Miliki Ganja Dihukum 6 Tahun PANDAN (Waspada): Satu unit rumah milik Jahar Panggabean, Minggu (15/5) sekitar pukul 00:30 musnah dilalap si jago merah di Jalan P. Sidimpuan Km 6,2, Kel. Sibuluan Nalambok, Kec. Sarudik, Tapteng. Menurut keterangan anak korbanTutiPanggabean,sebelum peristiwa kebakaran terjadi dirinya berada di ruang tamu selepas menyaksikan acara konserdiKotaSibolgadansecaratibatiba dirinya mencium bau sesuatu yang terbakar. Selanjutnya dirinya bergegas keluar rumah

danditemukanternyataapimulai membesardariarahbawahpapan penutup toko grosir milik orangtuanya. Secepat mungkin dirinya menjerit meminta pertolongan kepada warga dan warga pun bergotong royong membantu memadamkan api secara manual,namunkarenaketerbatasan air,kobaranapipuntidakmampu diredam. “Saya baru pulang dari nonton konser, tapi nggak berapa lama waktu saya di ruang tamu mencium bau terbakar, saya pun keluar ternyata api udah besar dari bawah papan penutup grosir punya orangtua saya, nggak tahu bang apa penyebabnya,” ujarnya Di lokasi kejadian, warga

sempat menduga terjadinya kebakaran itu akibat hubungan arus pendek yang membuat rumah yang terbuat dari dinding papan tersebut di lalap si jago merah. “Kami rasa terjadi kebakaran itu karena arus pendek atau korsleting pak,” kata warga. Tidak ada korban jiwa dalam musibah kebakaran itu namun seluruh harta benda korban musnah dilalap si jago merah sedangkankerugiandiperkirakanratusan juta rupiah. Sementara amuk massa terjadi kepada mobil pemadam kebakaranmilikPemkabTapanuli Tengahkarenamenurutsejumlah warga satu jam kemudian setelah api berhasil dipadamkan secara manual oleh warga mobil pema-

dam kebakaran (Damkar) milik Pemkab Tapteng baru tiba di lokasi kejadian. Melihat mobil Damkar yang datang terlambat akhirnya warga kecewadanemosidanmelempar mobil damkar itu dengan batu sehingga kaca depan pecah. Melihat emosi warga memuncak perugas pemadam kebakaran langsung membawa mobilnya melarikan diri dari amukan warga menuju ka Polres Tapteng guna meminta peng-amanan. Kapolres Tapanuli Tengah, melalui Kaurbin Ops Reskrim Ipda Sofyan Helmi Nasution kepada Waspada di lokasi kejadianmengatakanpihaknyamasih melakukan penyelidikan apa penyebab kebakaran.(a23)

Pedagang Pasar Horas P. Siantar Terancam Digusur P. SIANTAR (Waspada) : Sejumlah pedagang yang selama iniberjualandidepanPasarHoras di Jalan Imam Bonjol, Kelurahan Dwikora, Kecamatan Siantar Barat, Kota Pematangsiantar merasa resah atas adanya kebijakan dari Dinas Pasar dan meminta mereka membawa pulang peralatan dagang mereka usai berjualan. Ada kekhawatiran pedagang yang umumnya menjual makanan dan minuman itu akan digusur dari lokasi itu. Menyikapi itu, 39 pedagang di Jalan Imam Bonjol itu mengadukan permasalahan itu kepada PerhimpunanMahasiswaKatolik Republik Indonesia (PMKRI) Pematangsiantar, Jumat (13/5), karena ada kekhawatirkan, pedagang diminta membawa pulang peralatan dagang dengan alasan kebersihan dinilai skenario penggusuran yang direncanakan Dinas Pasar.

Salah seorang pedagang, Ferry Lumbantobing menyebutkan sebelumnya ada pertemuan di Kantor Dinas Pasar di Gedung III Pasar Horas, Rabu (11/5), dimanapihakDinasPasarmeminta mereka untuk membawa pulang peralatan berjualan. Menurut Ferry, kebijakan itu jelas merepotkan pedagang, karena selama ini tidak pernah membawa pulang peralatan dagangan dan selalu ditinggal di Balairung di Jalan Imam Bonjol. “Kami menilaialasankebersihan itu mengada-ada, karena selama ini kami selalu dikutip retribusitermasukuangkebersihan. Jelas merepotkan jika setiap hari, kami harus membawa pulang peralatan berdagang,” keluh Ferry. KetuaPMKRIJunusSitioyang dihubungi Sabtu (14/5) menilai ada upaya pemaksaan terhadap para pedagang. “Buktinya, adanya batas waktu dari Dinas Pasar,

jika Senin (16/5) pedagang tidak bersedia memenuhi permintaan Dinas Pasar itu, peralatan berdagangmerekaakandiangkutDinas Pasar. Ini jelas menimbulkan keresahan bagi pedagang dan semacambentukpenekanan.Kami menolak segala cara yang meng-

kangkangi hak pedagang dan meminta jangan ada tekanan dalam bentuk apapun,” tegas Junus. Plt Kadis Pasar SM Ulinasari Girsang yang hendak dikonfirmasi langsung melalui telefon selulernya tidak ada jawaban. (a30)

rajaan Purba tersebut akan meningkatkan, sehingga masyarakat yang ada di sekitar lokasi ini dapat terbantu perekonomiannya. “Jika adanya akses jalan yang menghubungkan lokasi ini dengan DanauToba yang juga salah satu tujuan wisata di daerah ini, diharapkan akan mampu untuk memajukan objek wisata Rumah Bolon ini, karena ini merupakan tempat bersejarah di Kabupaten Simalungun pada masa lalu,” tandas Saragih. Menurutnya, pembukaan jalan ini diperkirakan mencapai dua kilometer dan pembukaannya direncakan melalui kegiatan TentaraMenunggalMembangun

Tiga Bulan Raskin Tak Disalurkan Di Karo KABANJAHE (Waspada) : Terlambatnya selama tiga bulan penyaluranberasmiskin(raskin)diKecamatanKabanjahe,disebabkan Kansilog Kabanjahe belum menyalurkannya ke kecamatan. Camat Kabanjahe Lesta Karokaro, Kamis (12/5) mengatakan, penyaluran raskin ke kecamatan ditentukan Kansilog Kabanjahe. “Proses penyaluran beras raskin bukan kita yang menentukan, namun Kansilog yang berhak menentukan kapan dibagikan,” katanya. Dikatakan, beras miskin dijual kepada warga sesuai dengan HET yaitu 1.600 per kg. Soal berapa bulan dalam setahun disalurkan kepada warga, tidak bisa menetapkannya. Bahkan, bisa dalam setahun pembagian raskin hanya 10 bulan, dan pernah juga setahun baru disalurkan. Kansilog Kabanjahe Lukman P Silitonga yang membidangi tiga kabupaten yakni Kab. Karo, Pakpak Barat dan Dairi saat dikonfirmasi tidak berada di tempat. (c19)

Pemko P.Siantar Libur Senin 16 Mei

Panitia Jubelium 150 Tahun HKBP Dikukuhkan

P. SIANTAR (Waspada) : Gara-gara hari terjepit libur Minggu (15/5) dan Hari RayaWaisak Selasa (17/5), Pemko Pematangsiantar menyatakan Senin (16/5) sebagai hari libur dengan istilah cuti bersama. Kabag Humas dan Protokoler Pemko Daniel H Siregar, Sabtu (14/5) menyatakan, hari libur itu sebagai efisiensi dan efektivitas hari kerja, hari libur dan cuti bersama, dipandang perlu ditata kembali pelaksanaannya. “Untuk itu, Senin 16 Mei 2011 dinyatakan sebagai Cuti Bersama.” Dengan demikian, pemerintah mengizinkan sebagian PNS untuk libur pada Senin (16/5) yang terjepit dua hari libur yakni Minggu (15/5) dan Selasa (17/5) untuk memperingati Hari Raya Waisak, sebut Daniel. (a30)

P. SIANTAR (Waspada) : Panitia Jubelium 150Tahun HKBP Distrik V Sumatera Timur dikukuhkan Praeses HKBP Distrik V Sumatera Timur Pdt. Pieter Hutapea, STh, MTh.di Gereja HKBP Jl. DI Panjaitan, Rabu (11/05). “Pengukuhan Panitia Jubileum 150 HKBP Distrik V Sumatera Timur dikukuhkan di Geraja HKBP,” kata Kabag Humas dan Protokoler Pemko Danial H Siregar. Hadir saat itu, Walikota Pematangsiantar Hulman Sitorus. Panitia dikukuhkan di antaranya Ketua Umum Rudolf M Hutabarat, Sekretaris Umum Pdt. HAM. Panggabean dan Bendahara Kalbiner Lumbantungkup. Kemudian posisi Ketua antara lain Donver Panggabean, MSi, Eliakim Simanjuntak dan Dontes Simatupang. Panitia dilengkapi dengan seksi-seksi. (a30)

Pemkab Simalungun Buka Jalan Menghubungkan Rumah Bolon Dengan Danau Toba SIMALUNGUN (Waspada): Untuk meningkatkan kunjungan wisatawandiobjekwisataRumah Bolon di Kecamatan Purba, PemerintahKabupatenSimalungun dalam waktu dekat akan membuka akses jalan yang dapat menghubungkan dengan lokasi objek wisata Danau Toba. Rencana pembukaan jalan menghubungkan kedua lokasi wisata tersebut dikemukakan Bupati Simalungun JR Saragih saat melakukan peninjauan ke objek wisata Rumah Bolon, di Kecamatan Purba, baru-baru ini. Dia berharap dengan dibukanyajalanitumakaaruskunjungan wisatawan ke Rumah Bolon Ke-

BERASTAGI (Waspada) : Pengadilan Negeri (PN) Kabanjahe memvonis Alansyah Putra, 21, warga Peceren Berastagi, Kabupaten Karo enam tahun penjara, dalam sidang yang digelar, Kamis (12/ 5). Dalam amar putusan yang dibacakan hakim terdakwa dinyatakan terbukti secara sah, melanggar pasal 114 undang-undang No 35 Tahun 2009 tentang Narkotika. Mengenai barang bukti satu bungkus kecil ganja dan biji ganja 1 gram, dirampas untuk dimusnahkan. Atas putusan yang telah ditetapkan majelis hakim, terdakwa yang hanya mengecap pendidikan kelas tiga SD menerima, menyesali perbuatanya, dan berjanji tidak akan mengulangi perbuatan melawan hukum. (c19)

Desa (TMMD). Disamping itu, Bupati juga meminta kepada camat untuk lebihmeningkatkanperhatiannya di daerah wisata ini, misalnya mengadakan kegiatan-kegiatan keseniandankebudayaandaerah, sehinggasaatadawisatawanyang berkunjung di lokasi ini selain melihat tempat berjarah ini mereka juga dapat langsung melihat kesenian dan kebudayaan Simalungun. Dalam menjaga ketertiban arus wisata yang berkunjung di objek wisata rumah bolon ini, Bupati yang didampingi Kakan PIT Sudiahman Saragih, Kakan Satpol PP Janter Purba, Kabag

Humas Pimpinan dan Keprotokolan JhonryWilson Purba serta CamatPurbaJamesSiahaanSSTP, bersama masyarakat, mengharapkan agar kendaraan tidak masuk di lokasi Ruimah Bolon karena ini tempat yang sakral dan harus dijaga kebersihannya. Camat Purba James Siahaan mengatakan, pihaknya bersama masyarakatakanterusmelakukan perhatian terhadap objek wisata ini. Terkait akan dilaksanakan pembukaan jalan dari Objek Wusata Rumah Bolon menuju Danau Toba, James mengatakan pihaknya sangat mendukung rencanainidemiuntukkemajuan daerahwisatadiwilayahnya.(a29)

Berselingkuh Dengan Istri Orang Dihajar P. SIANTAR (Waspada) : Pria IS, 24, warga Jalan Udang, Kelurahan Pardomuan, Siantar Timur diduga berselingkuh dengan isteri orang sehingga dipukuli. Keterangan dihimpun, Kamis (12/5) korban diduga dipukuli suami perempuan selingkuhannya, RP, 26, warga Jalan Bawal Siantar Timur dan kawan-kawannya di Kelurahan Nagapita, Senin (9/5). Pemukulan terhadap korban dimulai ketika korban baru turun dari satu angkutan kota yang ditumpanginya. Saat membayar ongkos, datang seorang pria dari arah belakangnya dan langsung memukul wajah korban. Ternyata pria itu RP hingga korban berusaha melarikan diri. Namun, RP mengejar korban dan berhasil menangkap dan menarik korban. Beberapa saat kemudian, muncul teman RP bernama MP dan langsung memukul wajah korban dengan kepalan tangannya. “Akibat pemukulan yang dialaminya, korban terpaksa mendapat perawatan dan akhirnya memutuskan mengadukan perbuatan RP ke Polres Pematangsiantar,” kata Kapolres Pematangsiantar AKBP Alberd TB Sianipar, Jumat (13/5). (a30)

Surya Paloh Bantu Nelayan Sergai PANTAICERMIN (Waspada): Ketua Umum Dewan Pimpinan Pusat Nasional Demokrat (DPP Nasdem) Surya Paloh memberikan bantuan 4 unit perahu boat beserta jaring bawal kepada kelompoknelayanDesaPematang Gunung, Kec. Pantai Cermin, Kab. Serdang Bedagai, pada acara temu ramah keluarga besar NasdemdenganNelayanSergai,Sabtu (14/5)dilokasiobjekwisataPantai Pematang Gunung di Desa itu. Surya Paloh dalam sambutannya mengatakan, lahirnya Ormas Nasdem 1 Februari 2010 dalam usia yang masih belia, ada pertanyaanbesaruntukapasebenarya Nasdem ini dilahirkan di negeri ini, itulah pertanyaan dari berbagai kalangan masyarakat, ungkapnya. “Anggota masyarakat sebagai warga negara ini fasilitas yang manyangkut sandang, pangan, papan,pendidikandankesehatan belum kita dapatkan selayak yang kitaharapkan,”sebutSuryaPaloh.

Semua itu imbuh Surya Paloh, tidak mungkin kita serahkan kepadawaktuyangberjalan,tidak mungkin kita pasrahkan dengan nasib semat-mata tanpa upaya dari kita sendiri, apa lagi kita berharap mengharap belas kasihan dari bangsa lain untuk datang ke negeri ini untuk membantu kita, itu tidak mungkin. “Yang mungkin adalah kita harus melakukan upaya-upaya aktivitas dan kegiatan yang berubah dan yang mengubah nasib kita dari keadaan yang lebih baik menjadi ke arah yang lebih baik dan inilah jawaban bagi masyarakat Indonesia arti kelahiran Ormas Nasdem,” ketus Surya Paloh. Menurutnya Nasdem lahir memang untuk berupaya, bagai sebutirpasir,setetesairtapidatang dengan sikapikhlasdantulusmeringankan beban rakyat Indonesia ini yang memang mempunyaikekuatanpadadirikitasendiri dengan budaya kegotong

royongan. Wilayah laut di negara kita cukup luas dan baik namun kenyataannya hidup para nelayannya masih berada di bawah garis kemiskinan, berarti ini ada yang salah.Namunkitajanganmenyalahkan siapa, mari ke depan kita benahi bersama dengan semangat kegotongroyongan dan kebersamaan dan saya yakin kehidupannelayandinegarakitakhususnya di Sergai ke depan akan meningkat, jelas Surya Paloh. “Kiranya bantuan ini dapat dipergunakan sebaik-baiknya dan dapat menjadi semangat hidup dan menjadi motivasi untuk tidak mudah menyerah dan bangkit sebagai nelayan yang tangguh,” harap Surya Paloh. SebelumnyaKetuaDPWNasdemSumut,HAliUmrimengatakan,kedatanganKetumDPPNasdem, Surya Paloh sudah dinantikan dan dirindukan yang akhirnya sangat membahagiakan warga nelayan Kab. Sergai karena

bisa bertatap muka langsung dan datang tanpa pamrih langsung memberikan bantuan 4 unit boat nelayan lengkap dengan jaring bawal. “Diharapkan ke depan bantuaninidapatmenghasilkansampan-sampan lainnya sehingga kehidupan para nelayan khususnya di Pematang Gunung akan lebih meningkat,” harap Ali Umri. Perwakilan kelompok nelayan Desa Pematang Gunung, Jalil mengucapkan rasa terima kasih atas bantuan 4 boat nelayan lengkap dengan jaring bawalnya yang selama ini tidak sanggup untuk membelinya karena harganya yang mahal tetapi hari ini impian itu terwujud dan akan dimanfaatkan sebaik-baiknya, ujarnya. Temu ramah itu dihadiri pengurus teras DPP Nasdem, Laksamana Johadi, Laksamana Irawan, Mayjen Purn IGK Manila, Rojzek,Yosef Prawira, Ketua DPW Nasdem Nanggroe Aceh Darus-

Waspada/Edi Saputra

KETUA Umum DPP Nasdem, Surya Paloh didampingi Ketua DPW Nasdem Sumut H Ali Umri menyerahkan bantuan 4 unit boat nelayan lengkap dengan jaring bawalnya kepada Nelayan Desa Pematang Gunung di objek wisata Pantai Pematang Gunung, Kec. Pantai Cermin. Foto direkam, Sabtu (14/5). salam (NAD) Tengku Pribadi, Wilayah Nasdem Riau, Tengku Iskandar, DPW Nasdem Jawa

Tengah, serta unsur pengurus Nasdem Sergai dar ratusan nelayan Sergai. (c03)

Sumatera Utara

WASPADA Senin 16 Mei 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:24 12:37 12:25 12:32 12:31 12:28 12:25 12:20 12:27 12:27

‘Ashar 15:43 15:55 15:44 15:50 15:50 15:48 15:44 15:40 15:46 15:45

Magrib 18:32 18:48 18:33 18:42 18:41 18:34 18:32 18:28 18:35 18:36



Shubuh Syuruq


19:43 19:59 19:44 19:53 19:52 19:44 19:43 19:39 19:46 19:47

04:46 04:57 04:47 04:52 04:52 04:53 04:48 04:43 04:49 04:48

04:56 05:07 04:57 05:02 05:02 05:03 04:58 04:53 05:08 04:58

L.Seumawe 12:30 L. Pakam 12:23 Sei Rampah12:22 Meulaboh 12:34 P.Sidimpuan 12:22 P. Siantar 12:22 Balige 12:22 R. Prapat 12:19 Sabang 12:37 Pandan 12:24

06:14 06:25 06:14 06:20 06:20 06:20 06:15 06:11 06:17 06:15

Zhuhur ‘Ashar 15:48 15:42 15:41 15:53 15:42 15:42 15:42 15:39 15:55 15:44




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:40 18:31 18:31 18:43 18:27 18:30 18:29 18:26 18:48 18:30

19:51 19:42 19:42 19:54 19:38 19:41 19:40 19:36 19:59 19:40

04:50 04:45 04:44 04:56 04:47 04:45 04:46 04:43 04:56 04:48

05:00 04:55 04:54 05:06 04:57 04:55 04:56 04:53 05:06 04:58

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:23 12:25 12:35 12:28 12:25 12:31 12:20 12:30 12:23 12:22

18:30 18:32 18:45 18:34 18:33 18:40 18:27 18:38 18:29 18:30

19:40 19:43 19:56 19:45 19:44 19:51 19:38 19:49 19:40 19:41

04:48 04:48 04:55 04:51 04:47 04:52 04:43 04:52 04:47 04:45

04:58 04:58 05:05 05:01 04:57 05:02 04:53 05:02 04:57 04:55

Panyabungan 12:20 Teluk Dalam12:27 Salak 12:25 Limapuluh 12:21 Parapat 12:23 GunungTua 12:20 Sibuhuan 12:20 Lhoksukon 12:29 D.Sanggul 12:24 Kotapinang 12:18 AekKanopan 12:20

06:18 06:13 06:12 06:23 06:14 06:13 06:14 06:11 06:24 06:15

15:44 15:45 15:53 15:47 15:44 15:50 15:39 15:49 15:43 15:41

06:15 06:16 06:22 06:19 06:14 06:20 06:10 06:20 06:14 06:12

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Mandor PML Pertamina Ditangkap

PT Tolan Tiga Indonesia Gelar Baksos

DPC PDI P Sergai Silaturahmi Dengan Kapolres SEI RAMPAH(Waspada): Pengurus Dewan Pimpinan Cabang PartaiDemokrasiIndonesiaPerjuangan(DPC-PDIP)SerdangBedagai bersilaturahmi dengan Kapolres baru AKBP Arif Budiman di Mapolres, Selasa(10/5). Ketua DPC PDIP Sergei Khary A Zulmi SH, mengatakan , kedatangan Pengurus DPC PDIP Sergei adalah untuk melanjutkan hubungan baik yang selama ini sudah terjalin dengan Kapolres sebelumnya dan jajaran Polres Serdang Bedagai. Kapolres Sergai AKBP Arif Budiman SIK,MH pada pertemuan itu menyambut baik silaturahmi itu dan menyampaikan terimakasih serta mengharapkan kerjasama yang baik. Kapolres didampingi staf bagian Humas, sementara dari DPC PDIP Sergai antara lain Kairy A Zulmy SH, Ir Rusmadi, Aris Sam, Aswin Nasution, Rut Damayanti dan Drs Eddy Warman Saragih. (a08)

Anggota DPRD SU Reses Ke Binjai Utara BINJAI (Waspada) anggota DPRD Sumut Ferry Suando Kaban berkunjung ke Kelurahan Cengkeh Turi, Kec Binjai Utara dalam tugas reses, Rabu( 11/5). “Kedatangansaya,selainagendakerjakhusus,inginmempererat tali silaturahim dengan masyarakat, “ ujar Ferry Suando asal Partai Bulan Bintang (PBB) Dapem XI Binjai Langkat. Amril Amin, selakutokohmasyarakat mengemukakan, kegiatan tatap muka tidak terkait kepentingan politik dan bersifat silaturahmi. Walaupun yang hadir kader PBB dan anggota DPRD Binjai, Ismail Hasan, kita ingin membaur dengan masyarakat untuk menampung aspirasi. (a04)

Kinerja SKPD Akan Dievaluasi Secara Rutin STABAT (Waspada): Rapat Koordinasi Pemerintahan (Rakorpem) di jajaran Pemkab Langkat merupakan agenda rutin sebagai forum menyamakan gerak langkah roda pemerintahan agar proses pembangunan terarah dan teratur sehingga visi bersama dapat terwujud secara efektif dan efisien. Berbagai kendala dan permasalahan di masyarakat menjadi indikator berhasil tidaknya Pemda dalam memberikan pelayanan kepada masyarakat sekaligus mencari solusi upaya pemecahannya. Bupati Langkat dalam arahannya pada acara pembukaan Rakorpem yang berlangsung di ruang pola kantor bupati di Stabat, Selasa(10/5) menitikberatkanpelayanankesehatanpadamasyarakat dalam program puskesmas 24 jam, jaminan persalinan (Jampersal) dan evaluasi pelaksanaan jaminan kesehatan masyarakat (Jamkesmas). (a01)

Waspada/Edi Saputra

DUA unit alat berat tampak tengah melakukukan pembongkaran jembatan Nonang, sementara di samping kanan dan kiri puluhan antrian kendaraan melintasi jembatan darurat di Jalinsum Dusun I, Desa Sei Buluh, Kec. Teluk Mengkudu. Foto direkam Sabtu (14/5).

TANJUNGBALAI (Waspada): Dewan Perwakilan Rakyat Kota Tanjungbalai didesak secepatnya menggelar rapat paripurna keberadaan patung Amithaba di atas Vihara Tri Ratna yang menjadi perdebatan panjang antar umat beragama di kota itu. “Selama ini persoalan patung Budha Amithaba hanya dirapatkan di tingkat komisi DPRD dan hasil keputusan tidak begitu kuat sehingga Pemko Tanjungbalai terkesan memandang sebelah mata dan mengacuhkan hasil rapat tersebut dan hingga hari ini, patung masih berdiri tegar,” ujar aktifis LSM AE Sibarani kepada Waspada, Minggu (15/5). Menurut Sibarani, DPRD sebagai wakil rakyat hendaknya tidak memandang sebelah mata persoalan itu karena menyangkut

isusensitifkeagamaanyangdapat mengakibatkanpergesekanantar masyarakat. Ketegasan DPRD lanjut Sibarani sangat diharapkan rakyatTanjungbalai untuk menghindari terjadinya konflik horizontal yang berujung pada kerugian masyarakat itu sendiri. Dikatakan, rapat persoalan penurunan patung itu sebelumnya telah digelar beberapa kali bahkan masyarakat juga kerap berunjukrasaterhadapkeberadaan patung, namun sepertinya tidak memberikan solusi bagi masyarakat. “DPRD dan Pemko sepertinyatidakseriusmenangani hal ini. Kita hanya berharap ketegasan untuk diturunkan atau tidak,” pungkas Sibarani. Dijelaskan,enambulansebelumnya telah digelar rapat antara Pemko Tanjungbalai, DPRD, Kodim 0208 Asahan, Polres Tanjungbalai, Kejari, Kantor Kementerian Agama, Majelis Ulama Indonesia (MUI), Forum Kerukunan Umat Beragama (FKUB) dan pengurusYayasanViharaTri Ratna, tentang kebaradaan patung




Shubuh Syuruq

18:25 18:32 18:32 18:29 18:30 18:26 18:25 18:39 18:30 18:24 18:27

19:36 19:43 19:43 19:40 19:41 19:37 19:36 19:50 19:41 19:35 19:38

04:46 04:53 04:49 04:44 04:46 04:45 04:45 04:50 04:48 04:43 04:44

04:56 05:03 04:59 04:54 04:56 04:55 04:55 05:00 04:58 04:53 04:54

06:13 06:20 06:16 06:11 06:14 06:12 06:12 06:18 06:15 06:10 06:11

TELUKMENGKUDU (Waspada): Pekerjaan pembangunan jembatan Nonang di Dusun I Simpang Tanah Raja, Desa Sei Buluh, Kec. Teluk Mengkudu, Kab. Serdang Bedagai menyebabkan kemacetan arus lalulintas di Jalur Lintas Sumatera (Jalinsum) hingga mencapai 5 kilometer. Irwan, 50, sopir pick-up warga Tebingtinggi mengaku dari Pasar Bengkel, Kec. Perbaungan harus antri sampai 1,5 jam untuk dapat melalui jembatan itu disebabkan banyaknya kendaraan yang macat, keluhnya kepada Waspada, Sabtu (14/5) saat melintasi jembatan darurat menuju Tebingtinggi. Hal senada juga dikeluhkan sopir truk peti kemas jurusan Medan Pekan Baru, Darwin, 48, warga Medan, harus antri hampir 2 jam untuk melintasi jembatan yang menjadi penyebab kemacetan, tuturnya. “Akibat kemacatan ini jadwal sampai ketujuan terlambat hampir satu jam lebih dalam tiga hari terakhir,” imbuh sopir bus KUPJ jurusan

Medan-Pasir Mandoge D. Butar-Butar, 56, warga Medan Amplas kepada Waspada. Sementara itu Badrul Helmi, 40, warga Tanjung Beringin yang akan menuju Perbaungan bersama keluarganya juga harus rela antri hingga satu jam lebih untuk mencapai jembatan itu. “Kurang rapinya jembatan alternatif (darurat) menyebabkan terjadinya kemacatan ini,” keluhnya kepada Waspada. Warga sekitar Suci Adelia, 35, menuturkan, jembatan mulai dikerjakan hampir satu minggu tetapi kemacatan terparah terjadi dalam tiga hari terakhir terlebih pada jam-jam sibuk, jelasnya. Kapolres Sergai melalui Kasubbag Humas AKP ZN Siregar membenarkan kemacatan arus lalulintas disebabkan pekerjaan pembangunan jembatan itu dan sebagai antisifasi pihaknya akan segera mendirikan pos jaga di sekitar lokasi, selain itu mengarahkan kendaraan melalui jalan-jalan alternatif yang ada, jelasnya ketika dihubungi Waspada. (c03)


Dalam hasil rapat itu, posisi patung Budha Amithaba di atas Vihara Tri Ratna Tanjungbalai dipindahketempatlainyangtetap terhormat tanpa mengurangi penghormatan terhadap keberadaan patung itu. Kesepakatan bersama itu dikeluarkan dengan pertimbangan kepentingan kerukunan hidup umat beragama di Tanjungbalaisekitarnya,sertakeberadaan patung di atas Vihara Tri Ratna menimbulkan keresahan dan perdebatan panjang antar umat beragama. Namun, hingga kini patung masih berdiri dan belum ada iktikad baik dari pengurus yayasan Vihara Tri Ratna untuk memindahkan ke tempat lain tanpa mengurangipenghormatanterhadap keberadaannya. PihakVihara beberapa waktu lalu belum memindahkan patung karena mereka harus meminta persetujuan umat Budha di seluruh dunia, sebab patung itu bukan milik perorangan melainkan seluruh umat. (a32)

Kaburnya Tersangka Curanmor , Polisi Dinilai Lalai STABAT (Waspada): Kaburnya tersangka pencuri sepeda motor dengan tangan diborgol, hinggakinibelumdapatditangkap kembali oleh kepolisian. Sementara, Kapolres Langkat AKBP Mardiyono belum juga dapatdimintaikonfirmasinyaterkait kemungkinan sanksi yang diberikan kepada anggota yang lalai hingga SU alias Ateng dengan mudah kabur dengan tangan diborgol 6 Mei 2011. Sementara itu menyikapi kaburnya tersangka dalam pengawalan polisi saat pengembangan berlangsung di Dusun Slemak Desa Pertumbukan Kc.Wampu, anggota DPRD Langkat dari Fraksi PBB, M Jamil, Sabtu (14/

5), menilai ada unsur kelalaian aparatkepolisian.‘’Mudah-mudahan tersangka secepatnya dapat diringkus kembali untuk membongkar jaringan pencurian kendaraan bermotor selama ini,’’ harap M Jamil seraya menambahkan,kemungkinanpolisijugatidak menginginkan tersangka kabur. Tersangka SU alias Ateng mencuri sepeda motor milik Fitri Yanti depan RM ACC Jaya di Kel. Stabat Baru, Kec. Stabat. Saat mendorong Honda Supra Fit BK 3625 UK , aksinya tertangkap basah oleh warga hingga dikejar dan berhasil diamankan. Beberapa saat kemudianaparatPolresLangkatdatang menjemputnya untuk pengem-

bangan dan penyidikan lebih lanjut. DalampengembangandiDusun Slemak untuk menggrebek kediaman tersangka lain, Ateng kabur dengan tangan diborgol yang ketika itu ditinggal sendiri dalam mobil. Sehari-hari tersangka bekerja sebagai mekanik di Bengkel CRS 212 Jalan KHZ. Arifin Stabat. Kini, pencurian terus meningkat dua di antaranya terjadi 12 Mei 2011 di Kel. Perdamaian Stabat dengan sasaran mobil Suzuki pick up BK 8296 PI milik Sastra Ginting, dan sehari sebelumnya di Kel. Pekan TanjungpuraYamahaMioBK6406 PAD milik M Arif, juga raib. (a03)

Minta Pemerintah Salurkan Bantuan Guru Honor Melalui Satu Rekening Bank kan terkait komposisi kepengurusan DPD AGBI yang merupakan asosiasi guru yang ke-6 dan dibentuk oleh salah satu Dewan Pendiri Partai Demokrat yakni Prof KH Ahmad Mubarok. Diakui Veronika sebutan akrab Santa Sembiring, pihaknya mengaku berterimaksih atas kepedulian pemerintah selama initerhadapnasibparaguru swasta di Nusantara, termasuk bantuan insentif dan lainnya. Namun demikianselakupengurusasosiasi guru swasta maupun negeri, sesuai misi selain memperjuangkannasibmenjadiPNSjugadapat mempersatukan persepsi para guru baik yang mengajar di negeri maupun di swasta, untuk tetap menjadipahlawantanpajasadan ikut mencerdaskan anak didik bangsa ini sebutnya. Oleh karena itu, sebutnya AGBI Langkat yang dalam waktu dekat akan mendeklarasikan di

15:41 15:48 15:45 15:40 15:43 15:40 15:40 15:48 15:43 15:38 15:40

DPRD Didesak Paripurnakan Soal Patung Amithaba

AGBI Audiensi DPRD Langkat

MEDAN (Waspada): DPD Asosiasi Guru Bersatu Indonesia (AGBI) Langkat berharap kiranya pemerintah dapat mengangkat nasib para guru honor baik yang mengajar di sekolah swasta maupun negeri. Selain untuk meningkatkan taraf hidup tenaga pengajarselamainijuga salahsatumendukung program pemerintah dalammeningkatkankecerdasan sumber daya manusia anak didik sebagai harapan bangsa . Demikian harapan para guru tergabung dalam AGBI Langkat yang disampaikan saat beraudiensi dengan Ketua DPRD Langkat H Rudi Hartono Bangun,SE di ruang kerjanya, Kamis (12/5). Kedatangan DPD AGBI Langkat dipimpin Ketua Penerima Mandate, Santa Sembiring, SPd dan Sekretaris Raden Roro Sri Hendrawati, SPd danWakilSekretarisYunsyah beraudinesi Ketua DPRD Langkat meminta masu-

Zhuhur ‘Ashar

Bangunan Jembatan Macetkan Jalinsum Sergai

PANGKALANSUSU (Waspada) : Setelah empat bulan kabur dansempatmelalangbuanakeBandaAceh,MandorPMLKonstruksi SP VIII PT Pertamina EP Field Pangkalansusunsusu yang diduga terlibat dalam kasus menggelapkan valve ditangkap Reskrim Polsek Pangkalansusu, Minggu (15/5) dinihari, saat pekarya perusahaan migas itu kembali ke rumahnya di Dusun III Kampungbaru, Kel. Pangkalanbatu, Kec. Brandan Barat. Sebelum membekuk buronan yang masuk dalam Daftar Pencarian Orang (DPO) sejak 10 Februari 2011 itu, pihak kepolisian telah menangkap Welder I Fungsi PML di PT Pertamina EP Field Pangkalansusu berinisial Ir. Saat ini, berkas perkara Ir telah bergulir sampai ke Pengadilan Negeri Stabat dan disidangkan. Dengan tertangkapnya Ir dan MS, diharapkan, kasus penggelapan dalam jabatan yang merugikan perusahaan milik negara mencapai ratusan juta rupiah ini dapat terbongkar sampai ke akar-akarnya. Kapolsek Pangkalansusu melalui Kanit Reskrim Iptu Iswanto dikonfirmasi menyatakan, proses penyelidikan masih berjalan dan tak menutup kemungkinan ada tersangka lainnya yang bakal menyusul. (a02)

GALANG (Waspada) : PT Tolan Tiga Indonesia (TTI) Kebun Bandar Pinang, Timbang Deli, Bukit Maradja, Kerasaan dan Pabrik Bukit Maradja menggelar bakti sosial di Kampung Serutu, Desa Timbang Deli, Galang, Deliserdang, baru-baru ini. Baksos yang dihadiri GM HRAD Johny Tobing dan tokoh masyarakat terdiri pembagian sembako dan pengobatan gratis bekerjasama dengan Dinas Kesehatan Deliserdang melalui Puskesmas Galang. Warga antusias mengikuti dibuktikan dengan tingginya partisipasi masyarakat sekitar. Tercatat 240 warga mengikuti pengobatan gratis maupun untuk mendapatkan sembako. GM HRAD JohnyTobing menyebutkan, baksos tersebut sebagai bentuk kepedulian para kaum hawa di PT TTI berpartisipasi aktif menjalin tali silaturrahim antara perusahaan dan masyarakat sekitar yang merupakan bagian dari Corporate Social Responsibility (CSR). (c02)


Langkat nantinya, berharap kepadapemerintahkiranyabantuan seperti selama agar ditransfer melalui satu wadah rekening bank sehingga tidak mengharuskan para guru penerima bantuan selama ini membuka rekening bank bank lainnya. Ketua DPRD Langkat H Rudi Hartono Bangun, SE dalam sambutannya mengaku sangat mendukungkeberadaanAsosiasiGuru Bersatu Indonesia Langkat, selain organisasi tersebut nantinya dapat tetap bersatu, dirinya juga yakin dengan kepemimpinan pengurus DPP Prof Ahmad Mubarok selaku pendiri Partai Demokrat, yang seperti selama ini memiliki komitmen yang kuat dalam memperjuangkan nasib rakyat. Mengenai komposisi kepengurusan Rudi Hartono Bangun yang juga Ketua DPC Partai Demokrat Langkat itu,mengaku tidak mau mengintervensi siapa


KETUA DPRD Langkat H Rudi Hartono Bangun, SE fotp bersama dengan DPD AGBI Langkat usai melakukan audinesi, Kamis (12/ 5). yang bakal duduk maupun ingin mendudukan nama tertentu di kepengurusan itu. Akan tetapi Rudi Meminta kepengurusan tersebut nantinya bila besar agar

bersatu dan tidak mengganti kepengurusan yang telah ada dan merupakan pejuang pendiri organisasi itu sendiri, sebutnya.(m43)

Waspada/Eddi Gultom

KAPOLDASU Irjen Pol Drs Wisjnu Amat Sastro, SH didampingi Bupati Sergai HT Erry Nuradi dan Kadisdik Drs H Rifai Bakri Tanjung, MAP sedang menyalami para guru dan kepala sekolah pada acara penyuluhan hukum di jajaran Dinas Pendidikan Kab. Sergai yang diselenggarakan di halaman kantor Disdik belum lama ini.

Kadisdik Sergai:

Mari Bekerja Keras Untuk Menjadikan Kab. Sergai Terbaik SERBAJADI (Waspada): Kadisdik Serdang Bedagai Drs H Rifai BakriTanjung MAP mengatakan, sesuai visi dan misi Bupati Sergai HT Erry Nuradi mari kita bekerja keras untuk menjadikan kabupaten ini menjadi salah satu kabupaten terbaikdiIndonesia.Sebabtanpakitamaubekerja keras apa yang kita harapkan tidak mungkin bisa terjadi. Hal itu ditegaskan Kadisdik dalam arahannya saat memimpin apel pagi putaran kedua yang dilaksanakandihalamanKantorCamatSerbajadi, Jumat (13/5) pagi. Usai apel pagi sebagaimana biasa dilanjutkan dengan rapat koordinasi yang diselenggarakan di aula kantor camat itu. Turut hadir dalam apel pagi dan rapat koordinasi itu staf ahli Bupati Bidang Politik dan Hukum Hotman Hutajulu, Sekretaris Disidik Eddi Syahputra, Kabid Sarana dan Prasarana Disidik Sergai Hasrul Sani Dalimunthe, Camat Serbajadi Sariful Azhar, KCD Serbajadi Nasum, Kepala Puskesmas Kec. Serbajadi dr Cut Putri Elna, UPT pertanian, para kepala desa, kepala dusun, para kepala sekolah, SD, SMP, SMA, para sekretaris desa serta undangan lainnya. DikatakanKadisdik,Sergaisebagaikabupaten pemekaran yang baru berusia 7 tahun sudah banyak meraih keberhasilan, baik itu di bidang pembangunan sarana dan prasarana sekolah juga sistem alat untuk memberikan pelajaran juga telah terjadi perubahan. Bila kita kenang beberapa tahun yang lalu guru memberikan mata pelajaran dengan memakai kapur tulis yang digoreskan di papan tulis. Namun hasil dari kemajuan itu sistem tersebut saat ini tidak terlihat lagi. Saat ini guru menerangkan mata pelajaran sudah memakai alat infokus. Kalau dulu guru mengerjakan laporan kegiatansekolahhanyamemakaimesinketik,sekarang sudah menggunakan komputer atau laptop. Maka sesuai dengan perkembangan kemajuan zaman itu, kata Kadisdik guru juga dituntut untuk pandai menggunakannnya. Justru itu Kadisdik mengharapakan agar guru walaupun sudah tua tidak malu-malu untuk belajar, sebab bila tidak mau belajar bisa ketinggalan zaman, katanya. Demikianjuga,kataKadisdikbilamengenang sepuluh tahun yang lalu semua jalan ke desadesa tidak ada yang bagus. Tetapi Alhamdulillah semenjak Kab. Sergai dipimpin Bupati HT Erry Nuradi semua jalan yang menghubungkan dari desa ke desa sudah bagus sehingga masyarakat pengguna jalan sangat bahagia menikmatinya. Seperti jalan dari dusun ke dusun di Desa PulauGambar,Kec.Serbajadisaatinisudahsemua beraspal hotmix. Padahal sebelum jalan besarnya saja tidak beraspal. Ini semuanya berkat kepemimpinan Bupati Sergai HT Erry Nuradi yang harus banyak kita syukuri, katanya. Bukan itu saja, selain membangun sarana danprasaranauntukkepentinganduniawiBupati Serdang Bedagai HT Erry Nuradi juga sangat peduli untuk membangun sarana hubungan antara manusia dengan Allah SWT. Hal itu dapat dibuktikan dengan banyaknya kegiatan kegiatan yang bernuansa keagaamaan. Seperti yang baru saja dibentuk Bupati HT Erry Nuradi kepengurusan Majelis Zikir Tazkira Kab. Sergai yang pelantikan pengurusnya dilaksanakan di stadion mini Erry-Soekirman Dolok Masihul, Sabtu(9/4) yang baru lalu, kata Kadisdik. “Jadi Bupati Sergai HT Erry Nuradi bukan hanyamementingkankepentinganduniasemata,

tetapi juga tidak lupa melaksanakan kepentingan akhirat,” kata Kadisdik. Begitu juga agar para guru tidak melanggar hukum Bupati Sergai HT Erry Nuradi telah mengupayakan tentang penyuluhan hukum yang langsungdisampaikanKapoldasuIrjenPolWisjnu AmatSastro,SHyangdiselenggarakandihalaman kantor Disdik Sergai di Sei Rampah belum lama ini. Dengan adanya penyuluhan tentang hukum kepada para guru sehingga guru nantinya tidak lagi tersandung hukum, kata Kadisdik. PNS Harus Disiplin Pada kesempatan itu staf Ahli Bupati Bidang Politik dan Hukum Hotman Huatajulu, SH dalam paparannya menegaskan, semua pejabat struktural diminta untuk harus disiplin dalam melaksanakan segala hal. Baik itu disiplin tentang kehadiran bekerja dan juga disiplin tentang menggunakan helm pengamanan. Hal itu dituntut sesuai PP No. 53 tahun 2010 tentang disiplin pegawain negeri sipil. Disiplin itu berlaku bukan hanya kepada bapak dan ibu saja, tetapi juga terhadap diri saya sendiri,kataHotman.“Sayatidakbisamenganjurkan kedisiplinan kepada orang lain bila diri saya sendiri belum bisa diisiplin. Justru itu sebelum saya menyuruh orang untuk disiplin, maka diri saya sendiri juga harus disiplin, kata Hotman. Pada kesempatan itu Hotman menanyakan secara jujur dan meminta kepada para kades yang hadir untuk mengangkat tangan bila tidak menggunakan helm. “Siapa tadinya yang datang kemari tidak menggunakan helm pengaman,” kata Hotman. Kebetulan pada saat itu hampir semua kades angkattanganbahwamerekatidakmenggunakan helm pengaman. Untuk itu Hotman mengharapkan ke depan harus menggunakan helm. Karena tidak masuk akal bila membeli sepeda motor bisa, tetapi tidak bisa membeli helm, katanya. Dikatakan Hotman, perlunya melaksanakan disiplin karena kita sebagai PNS setiap tanggal 1 menerima gaji, begitu juga beberapa tahun sekali menerima tentang kenaikan pangkat. Kita harus jaga nama baik Sergai, sebab Sergai di mana saja saat ini telah tenar termasuk juga di Jawa Barat. Justru itulah baru-baru ini, kata Hotman rombongan DPRD Provinsi Jawa Barat bersama beberapa kabupatennya datang melakukan kunjungan kerja ke Kab. Sergai untuk mengetahui secara dekat bagaimana acaranya pemerintah Serdang Bedagai yang merupakan kabupaten baru bisa membangun daerahnya dengan begitu cepat dan akurat. “Jadi Kab. Sergai jangan dianggap remeh, sebab hampir semua daerah di Indonesia sudah mengenal yang namanya Kab. Serdang Bedagai di bawah kepemimpinan HT Erry Nuradi sangat maju, kata Hotman. Untuk itu mari terus kita dukung program-program yang akan dilaksanakan bupati kita ke depan, katanya. Sebelumnya Camat Serbajadi Sariful Azhar dalam laporannya yang pertama mengucapkan selamat datang kepada Kadisdik Drs H Rifai Bakri Tanjung, MAP bersama rombongan yang datang dari Kab. Sergai. Sebab dengan datangnya Kadisdik dan Staf Ahli Bupati bisa memberikan masukan kepada kami semua tentang segala hal baik pembangunan yang telah dicapai begitu juga rencana pembangunan yang akan dilaksanakan. (a08)

Sumatera Utara

WASPADA Senin 16 Mei 2011

Kotapinang Semrawut, DPRD Sumut Kecam Kinerja Pemkab Labusel

Pedagang Berjualan Di Trotoar Minta Ditertibkan T.TIRAM (Waspada) : Tidak jelas instansi mana yang bertanggungjawab untuk menertibkan para pemilik ruko, pedagang memajang barang jualannya di trotoar dan pinggir jalan di Tanjungtiram Batubara. “Entah instansi mana bertanggung jawab yang menertibkan pemilik ruko menutup trotoar, pinggir jalan sebagai tempat memajang dagangan,” ujar warga Tanjungtiram Batubara, Minggu (15/5). Warga mempertanyakan hal itu, Minggu (15/5) pihak pemerintahan desa, kecamatan, kabupaten belum mampu menertibkannya. Seharusnya pemilik ruko memahami bahwa trotoar/kaki lima toko digunakan ba gi warga/pembeli, bukan dijadikan tempat berjualan Ada juga pemilik toko (HJ) di Jl.Mer deka Tanjungtiram mungkin kekurangan tempat semaunya memajang da gangan elekronik ke pinggir jalan. Selain merusak pandangan keindah an kota terkesan pengusaha/ pemilikrukomenganggapentengimbauanatauketentuanpemerintah setempat. (a12)

Spanduk Gemkara Batubara Hilang T.TIRAM (Waspada) : Spanduk Gemkara Batubara yang menghujat pejabat Pemkab Batubara yang dituduh merampok uang rakyat Rp80 miliar yang dipasang di persimpangan Jl.Merdeka Jl. Rakyat Tanjungtiram, hilang, Sabtu (14/5) dini hari. Kamarudin TH, aktivis/pejuang pemekaran Batubara, Minggu (15/5) menyesalkan tindakan orang-orang yang tak bertanggungjawab melakukan pencopotan spanduk diTanjungtiram dan Labuhanruku. Padahal maksud spanduk itu tak lain isi hati nurani rakyat Batubara yang prihatin atas perbuatan oknum pejabat Pemkab Batubara yang tega merampok uang rakyat Batubara se banyak Rp80 miliar. Didugahilangnyaspandukdilakukan‘ninja-ninja’suruhanoknum ter tentu menimbulkan kesan seakan kelompok mereka merasa terusik, risih kurang nyaman dengan kehadir an spanduk tersebut. (a12)

Festival Anak Shaleh Limapuluh Dapat Sambutan Meriah LIMAPULUH (Waspada) : Festival Anak Shaleh (FAS) Kecamatan Limapuluh, Batubara berlangsung di Perguruan Alwashliyah Kedai Sianam di Desa Guntung, Minggu (15/5) mendapat sambutan cukup antusias dan meriah dari masyarakat disana. Sekitar seribu pengunjung memadati komplek perguruan itu. Demikian pula peserta yang ikut ambil bagian pada event yang diasuh Kementrian Agama itu cukup membludak melebihi jumlah yang ditargetkan. Ketua panitia pelaksana Muhadri dalam laporannya mengatakan, FAS diikuti 186 peserta berasal dari berbagai desa di Kec. Limapuluh. Delapan cabang yang diperlombakan, yaitu Azan dan Iqomah, Tartil Quran, Puisi, Cerdas Cermat Quran, Melukis, Pidato, Nasyid serta Membaca Ikrar Santri. Muhadri yang juga Sekretaris Majelis Ulama Indonesia Kecamatan Limapuluh menuturkan, FAS perdana di Limapuluh ini berlangsung satu hari penuh dibuka resmi oleh Kepala Kantor Urusan Agama (KUA) Limapuluh, Ahamad Syofian. (c04)

Pelantikan Pejabat Struktural Dan Fungsional RANTAUPRAPAT(Waspada): Pelantikan para pejabat struktural maupun fungsional terutama para kepala sekolah bukan diukur dengan adanya materi yang diberikan kepada pimpinan, melainkan karena kemampuan yang dimiliki para pejabat yang dilantik, jika semua diukur dengan uang maka omong kosong pendidikan di daerah ini akan maju. Hal itu ditegaskanWakil Bupati Labuhanbatu Suhari Pane, ketika melantik para pejabat struktural dan puluhan kepala sekolah di Aula SMK 2 Rantau Utara, Jumat (13/5), “kemampuan para PNS yang dilantik harus bisa ditunjukkan dengan adanya prestasi kerja,” tegas Suhari. Pelantikan ini dihadiri, Asisten Administrasi Umum. Ahmad Muflih, SH, Kadis Pendidikan, Drs. Iskandar, Ka BKD Labuhanbatu, Aswad, SE, Kabag Humasy Abdurrahman Hasibuan.(c07)

Dua Pelaku Pembakar Perumahan Perkebunan Balakka Diringkus KOTAPINANG (Waspada): Kasus pembakaran perumahan karyawan Perkebunan Balakka yang dilakukan warga Dusun Tapian Nadenggan, Desa Batang Nadenggan, Kec. Sei Kanan, Labusel, Senin (9/5) lalu mulai terungkap. Polres Labuhanbatu berhasil meringkus dua dari 60-an warga yang diduga terlibat dalam aksi itu. Namun hingga kini belum ada penjelasan resmi mengenai penangkapan itu. Kapolsek Sei Kanan, AKP H Amir Husin Siregar yang dikonfirmasi Waspada, Minggu (15/5)enggan memberikan penjelasan. Husin mengaku, pihaknya belum ada menangkap tersangka pelaku pembakaran tersebut. "Kita belum ada menangkap, tapi nggak tahu kalau Polres," katanya. Kapolres Labuhanbatu AKBP Hirbak Wahyu Setiawan yang dikonfirmasi membenarkan adanya penangkapan tersebut, namun dia tak bersedia membeberkan penangkapan itu. "Sudah dua tersangka yang diamankan. Silahkan ke pak Tito untuk info lengkapnya ya," kata Wahyu yang dikonfirmasi melalui telepon seluler. Sayangnya Kasat Reskrim Polres Labuhanbatu, AKP Tito Travolta Hutauruk yang ditelepon berkali-kali tak bersedia mengangkat ponselnya. Pesan singkat yang dikirimkan juga tak dibalas. Seperti diketahui, ditengarai karena dendam, puluhan warga, Senin (9/5) malam menyerang pemukiman karyawan Perkebunan Balakka di Dusun Tapian Nadenggan, Desa Batang Nadenggan, Kec. Sei Kanan, Labusel. Dalam insiden itu, 14 unit rumah karyawan, dua unit mobil, dan satu sepeda motor hangus terbakar. (c18)

Waspada/Rasudin Sihotang

BEBERAPA pulau tidak berpenghuni diklaim Pemkab Asahan dan Pemko Tanjungbalai sebagai pemilik. Beberapa anak bermain di aliran sungai Asahan di Desa Sungai Pandau, Kec. Seikepayang, Kab. Asahan dan di seberangan merupakan pulau yang disengketakan. Foto direkam belum lama ini.

Asahan Dan T. Balai Jangan Saling Klaim 10 Pulau Pemprovsu Diminta Turun Tangan TANJUNGBALAI (Waspada): Pemkab Asahan dan Pemko Tanjungbalai diharapkan jangan saling klaim keberadaan 10 pulau yang masih menjadi pesoalan, namun hendaknya menyerahkannya kepada Pemprovsu sebagai mediator. “Persoalan tapal batas masih penjadi perdebatan panjang dan jika kedua wilayah tetap saling klaim, tidak akan ditemukan solusiyangtepatmalahsebaliknya menjadikan keadaan semakin rumit,” ujar anggota DPRD Kota Tanjungbalai Hakim Tjoa Kian LiemenanggapipernyataanPemkab Asahan dan PemkoTanjungbalai yang saling klaim pemilik 10 pulau kecil di aliran Sungai Asahan, Minggu (15/5). Dikatakan, pengakuan dari keduapemerintahdaerahtentang kepemilikan pulau-pulau kecil merupakanhalwajar,namunun-

tukmenentukanmasukkedalam wilayah mana tentunya harus dapat dipertanggungjawabkan secara peraturan dan ketentuan yang berlaku. Akan tetapi, hingga saat ini kepastian tapal batas wilayah tidak jelas karena Pempropsu belum pernah turun tangan secara langsung. Untuk itu kata Hakim, Pemprovsu dalam hal ini Plt Gubsu Gatot Pujo Nugroho merupakan pihak yang paling berwenang sebagai mediator untuk menyelesaikan persoalan tapal batas antara kedua pemerintah karena jika masing-masing tetap ngotot sebagai pemilik justru akan menambah rumit keadaan. “Perlu ketegasan Pemprovsu untuk secepatnya melakukan pengukuran ulang batas wilayah danmenetapkanpemilik10pulau di aliran Sungai Asahan yang belum berpenghuni, dan apapun hasilnya, kedua kepala daerah hendaknya berlapang dada menerima keputusan itu,” kata Hakim. Jika tidak kata Hakim, aksi

saling klaim itu bisa berdampak buruk terhadap hubungan kedua daerah dan merugikan masyarakat yang berada di sekitar perbatasan, padahal sebagaimana diketahui Asahan dan Tanjungbalaimemilikihubungankekeberabatan dan keluarga yang tidak dapat dipisahkan dari kehidupan masyarakatnya. Menurut Hakim, keberadaan pulau-pulau kecil itu tidak perlu dipersoalkan karena akhirnyaakanmenimbulkankeretakan hubungan kedua pemerintahan, namun kedua kepala daerah bisa duduk bersama, memikirkan secara arif dan bijaksana langkah yang ditempuh terhadap keberadaan pulau-pulau tersebut demi perkembangan pembangunan dan kesejahteraan masyarakat. Sebelumnya,PemkabAsahan dan Pemko Tanjungbalai saling klaim sebagai pemilik 10 pulau yakni, Pulau Buaya di Kec.Teluknibung, Pulau Tuan Thahir, Besusen, Serindan,Tualang, Baru atau Simulkan, Langgei, Daun atau Amid, Nyiur dan Siatan di Kec. Datukbandar Timur. (a32)

Soal Dana Daerah Rp 80 M Di Bank Mega Bupati Batubara Lapor Ke DPRD LIMAPULUH (Waspada): Bupati Batubara HOK Arya Zulkarnain melaporkan perihal bobolnyadanadaerahRp80miliar ke DPRD Batubara sekaligus menjelaskan kronologis sebenarnya. ‘’Ini segera disampaikan Bupati H OK Arya Zulkarnain kepada DPRD Kab Batubara, Rabu (18/5),’’tukas Kabag Humas Pemkab Batubara Efrianis, SH kepadaWaspadamelaluitelepon, Minggu (15/5). Pada penyampaian masalah itu nanti, jelas Efrianis, bupati didampingiWa-Ode Nur Zinab, SH selaku kuasa hukum Pemkab yang menangani kasus tersebut. Kuasa hukum Pemkab, katanya, sengaja diundang dating ke Batubara sekaligus menerangkan kepada wakil rakyat tentang kronologis dana daerah yang didepositokan di Bank Mega Cabang Jababeka Bekasi. Keterkaitan kedua pejabat, lanjutnya, yakni Kadispenda dan Bendahara Umum YR dan FK merupakan korban dari permainan mafia perbankan yang kini

dalam proses pemeriksaan Kejagung. ‘’Ini dikuatkan dengan penjelasan keduanya mengaku tidak ada melakukan pencairan danayangdidepositokan.Apalagi sampai menandatangani,’’ katanya. Dalam kaitan ini Bank Mega dilaporkan kepada Mabes Polri atas dugaan raibnya dana daerah yang didepositokan Pemkab Batubara, karena saldonya kini tersisa Rp3 miliar. Selainituditemukanindikasi kejanggalan, sebut Efrianis lagi, dalam penempatan tersangka kepada kedua pejabat sebagaimana dituduhkan dalam kaitan bobolnya kas daerah Rp 80 miliar. Sedangkan indikasi kejanggalandalamproseskasustersebut sudah disampaikan kepada Komisi III dan XI DPR RI dengan harapan dapat membantu daerah. ‘’Kedua pejabat merupakan korban kejahatan perbankan dilakukan oleh Bank Mega Cab Jababeka Bekasi,’’katanya. Bahkan, katanya, sudah

menyiapkan dokumen maupun saksi untuk melaporkan Bank Mega atas dugaan raibnya dana daerah mencapai Rp 77 miliar dari Rp 80 miliar yang didepositokan. Semula dana tersebut disimpan di Bank Sumut dengan cara mentransfer lima tahapan pada tahun 2010/2011 (September, Oktober,November, Januari dan April) dalam rekening Pemkab Batubara. Dispenda, katanya, salah satu SKPD di Pemkab Batubara mempunyai kewenangan untuk menempatkan dana kas daerah ke bank umum sebagaimana prosedur, sepanjang dapat dipertanggungjawabkan. Termasuk memindah bukukannya tidak perlu harus ada izin dariatasanmaupunbupatikarena telahmenerimalimpahankekuasaan pengelola keuangan pada SKPD dimaksud. Sebagaimana juga PP No. 58/ 2005 tentang pengelolaan keuangan daerah dan Permendagri No.13/ 2006.(a13)

Hj Winda Fitrika Taufan Gama Simatupang

Dampingi Suami Berbuat Terbaik Untuk Asahan MELAKUKAN yang terbaik untuk rakyat Asahan khususnya ibu rumah tangga merupakan tujuan dan ciri-ciri dari Hj Winda Fitrika Taufan Gama Simatupang (foto) yang dikenal sebagai Ketua Tim Penggerak PKK Asahan. “Meskipun saya bukan lahir dan besar di Asahan, namun saya menginginkan masyarakat Asahan baik di bidang agama, pendidikan, ekonomi, kesehatan sertamemilikibudayayangsesuai dengan keberagaman suku di Asahan” ujar ibu yang menamatkan SMA di SMA Negeri 3 Pontianak, Kalimantan Barat. Kegiatan tersebut telah dimulai sejak 2002 manakala untuk kepentingan sosial kemasyarakatan,WindaFitrikamelakukan kunjungan ke desa-desa melalui

kegiatanpengajiandanperwiritan bersama MajelisTa’lim Adz dzihniyah Daar Ulum Asahan, yang dibina Ketua UmumYayasan Pesantren Modern Daar Ulum Asahan Buya H Taufan Gama Simatupang. Ketua Umum Majelis Ta’lim Adz dzihniyah Daar Ulum ini bersama anggota terus melakukankegiatan-kegiatankeagamaan,


mulai dari pembinaan perwiritan kaum ibu, sunnat massal, pelatihan Imtaq (Iman dan Taqwa), dan kegiatan tahunan Dzikir Akbar untuk mewujudkan visi pemahaman keimanan dan ketaqwaan pada kaum ibu seAsahan. Ibu dari empat putri dan satu putra ini, dengan pergerakan politik di Kabupaten Asahan menjadikan HjWinda Fitrika istri dari orang nomor satu di Asahan yakniBupatiAsahan.Sudahseharusnya mendukung cita-cita suamiyaknimewujudkanAsahan yang Religius, Sehat, Cerdas dan Mandiri. Untuk mewujudkan Asahan yang Religius diarahkan pembentukan perwakilan Majelis Ta’lim Adz dzihniyah Daar Ulum tingkat kecamatan dan desa. Setiap tiga bulan sekali mengadakan pengajian dan Dzikir Akbar di kecamatan. Pengajianpengajian di kecamatan dan di desa dibina oleh PKK Asahan. KetuaYayasan Kanker Indo-

nesia cabang Asahan ini, melakukan kerjasama dengan dinas terkait dengan berbagai kegiatan yakni deteksi dini kanker rahim melalui Puskesmas dengan terbentuknya Yayasan Kanker Indonesia cabang Asahan membantumeringankanbebanpsikologisbagipenderitabibirsumbing, bahkan mencanangkan program Asahan Bebisum (Bebas Bibir Sumbing) sampai tahun 2015. Menbina Posyandu sekaligus mendukung terciptanya Posyandu yang terintegrasi dengan PAUD di setiap kecamatan, serta mensosialisasikan gerakan cuci tangan pakai sabun dan gosok gigiuntukanakusiaSekolahDasar se- Asahan demi terwujudnya Asahan yang sehat. Untuk menjadikan Asahan yang cerdas, akan dilakukan pembinaan dan sosialisasi ke desa-desa tertinggal dan desa/ kelurahan maju. Kegiatan dilakukan TP PKK Asahan agar ibuibu di pedesaan menjadi lebih terampil dan cerdas dalam me-

ngelolah rumah tangga dan sebagaianggotamasyarakatdesa. “Melakukanpembinaanketerampilan yang dapat meningkatkan perekonomian keluarga serta mendukung terbentuk Pra Koperasi dan Koperasi bekerjasama dengan BRI cabang Kisaran, dengan memfasilitasi pinjaman kepada anggota TP PKK dengan biaya rendah dan prosedur yang mudah dan cepat, sehingga terbentuk usaha-usaha kecil baik perorangan maupun kelompok. Demi terwujudnya Asahan yang mandiri, pinta Winda Fitrika, kelahiran 21 Oktober 1974 ini. Ketua Penasehat Dharma WanitaPersatuanAsahaniniyang selalu berpesan “Berbuat kebaikan walau sekecil apapun nilainya,asalikhlasuntukmencari RidhoAllah,InsyaAllahtidakakan berat dijalani, karena apapun yang kita laksanakan sekarang ini, pasti akan ada pertanggungjawaban dikemudian hari kelak”. Bustami Chie Pit

KOTAPINANG (Waspada) : DPRD Sumut mengecam kinerja Pemkab Labusel yang dinilai kurang becus dalam mengelola Kotapinang sebagai ibukota kabupaten. Padahal, ketertiban dankeindahanKotapinangmerupakancerminan keberhasilan Labusel sebagai daerah yang baru mekar. Pernyataan tersebut diutarakan Abu Bokar Tambak, anggota DPRD Sumut asal daerah pemilihan V, saat melakukan reses di Labusel, Sabtu (14/5) malam. Dia menilai, hingga kini belum ada tandatanda yang menunjukkan Kotapinang sebagai pusat pemerintahan. Politisi Partai Bintang Reformasi (PBR) itu mencontohkan,saatmelintasdiJlProfHMYamin, dia mencium bau menyengat yang bersumber dari tempat pembuangan sampah sementara (TPS) dan sampah pasar yang mengendap di dalam parit. Menurutnya, bau tersebut sangat mengganggu kenyamanan masyarakat. Padahal Pemkabmemilikidinasyangbertanggungjawabterkait masalahtersebut.“Tadisayameninjaukekawasan pasar, saat berada di depan lembaga pemasyarakatan, saya merasakan bau yang sangat me-

nyengat. Kok Pemkab bisa tahan dengan kondisi ini ya,” kata Bokar. Menurutnya, Kotapinang penuh sampah karena pemerintah tidak maksimal membersihkan khususnya di kawasan pasar. Tak hanya masalah kebersihan, Bokar juga mengkritisi kondisi Pasar Inpres Kotapinang yangtaktertatadenganbaik.Menurutnya,kondisi pasar saat ini tak mencerminkan pelayanan yang baik, sebab selain banyak pedagang kaki lima, lorong-lorong yang ada di dalam pasar kini sulit dilintasi, sebab pedagang sesuka hati meletakkan barang dagannya hingga ke badan jalan, sehingga warga tak dapat leluasa melintas saat berbelanja. Bokar juga menyebutkan, kondisi pusat perkotaan tidak kalah semrawutnya, berbagai bus dan truk parkir dan melakukan bongkar muat sesuka hati sehingga memicu kemacetan di inti kota. Padahal lanjut Bokar, banyak lahan kosong di Labusel yang dapat dimanfaatkan sebagai penampungansementarasebelumdibangunnya terminal yang refresentatif. “Inikan kondisi yang nggak benar. Harusnya bus dan truk dibuat pool-nya agar jangan sesuka hatinya masuk kota,” katanya. (c18)

MPC PP L. Batu Mandiri Bersama Andi Suhaimi Dalimunthe RANTAUPRAPAT (Waspada) : Peran dan eksistensi generasi muda adalah salah satu motor penggerak pembangunan yang telah diakui sejak negara ini berdiri. Dalam perjalanannya, beberapa organisasi kepemudaan seperti Pemuda Pancasila (PP) ataupun Angkatan Muda Pembaharuan Indonesia (AMPI) menjadi salah satu bukti generasi muda begitu eksis menjalankan roda organisasi didalammenopangjalannyarodapembangunan. Namunposisigenerasimudasempattersudut ketika selalu diidentikkan dengan kekerasan dan kerusuhan serta penyalahgunaan narkoba dan obat-obat terlarang, padahal, itu adalah sebagian kecil dari anak-anak broken home yang kurang mendapat perhatian dari orang tua. “Kami mencoba menciptakan Generasi Pemuda Pancasila yang mandiri dan berwibawa, tidak akan ada lagi pemuda yang memamerkan kekuatan fisik ataupun otot, karena kami punya skil yang cukup untuk menciptakan lapangan pekerjaan guna memajukan organisasi,” ujar kader militan PP Labuhanbatu Andi Suhaimi Dalimunthe, 39, baru-baru ini dengan segudang pengalamannya dalam bergelut di bidang organisasi kepemudaan sebagai wakil sekretaris PP pada 2002, sebagai bendahara PP sejak tahun 2006 hingga 2010, serta ketua DPK DAPKINO Labuhanbatu periode 2011 hingga 2015. Pria berkulit sawo matang yang menjabat sebagai Direktur PT Andardo Ramadana ini akan

sebagai calon ketua MPC PP Labuhanbatu dalam muscab X yang bakal digelar dalam waktu dekat ini. Dalamkesempatanini,priakelahiranRantauprapat 19 Mei 1972 menyebutkan tentang pencalonannya sebagai ketua MPC PP adalah dengan adanyadukungandansuportdarihampirseluruh kader militan PP Labuhanbatu, selain itu, sebagai putra daerah memiliki semangat dan keinginan untuk membina para generasi muda di kampung halamannya itu. “Sebagai putra daerah, saya punya tanggung jawabyangbesaruntukmembinadanmengarahkan para generasi muda untuk berfikir positif danmulaimenggerakkanlangkahagarbisamembangun daerah kampung halamannya sendiri,“ ujar Alumni Institut Teknologi Medan (ITM). Untukmenjadiseorangpemimpinorganisasi tentu saja tidak hanya cukup pandai berbicara dan memiliki banyak uang akan tetapi harus dibarengi dengan latar belakang pendidikan yang cukup, berbicara tentang pendidikan, tentu saja pengusaha yang berjiwa sosial tinggi ini tidak diragukan lagi, karena calon ketua MPC PP Labuhanbatu ini telah menyandang gelar S2. “Andi Suhaimi MT Dalimunthe adalah sosok putra daerah yang berhasil dan bakal membawa wajah cerah bagi kemajuan MPC PP Labuhanbatu,” ujar Ahmad Sofyan atau yang lebih dikenal Ucok Pasada yang juga kader PP Labuhanbatu dan calon sekretaris MPC PP. (c07)

Satu Malam Tenggelam, Bocah Ditemukan Mengambang TANJUNGBALAI (Waspada) : Setelah selama satu malam tenggelam di Sungai Silau, bocah siswa Sekolah Dasar ditemukan tidak bernyawa, Sabtu (14/5) sekira pukul 06:00. InformasidihimpundiPosBasarnasTanjungbalai-Asahan, korban Fahrul Azhari, 8, warga Jalan DTM Abdullah, Gg.Kesturi, Ling.VIII, Kel. Tanjungbalai Kota III , Kec. TB Kota III, Kota Tanjungbalai, ditemukan oleh masyarakat mengambang dan tersangkut di tiang bangunan (beting) milik warga di pinggiran Sungai Asahan. Lokasi penemuan berjarak sekitar satu kilometer dari tempat kejadian perkara (TKP). Sebelumnya, korban bersama beberapa temannya mandi di Sungai Silau dekat rumahnya pulang belajar mengaji, Jumat (13/5) sekira pukul 18:00. Namun,didugaakibatkuranghati-hati,ditambah lokasi yang cukup licin menyebabkan korban

tergelincir dan tenggelam terbawa arus. Orang tua bocah yang mengetahui kejadian itu langsung melakukan pencarian dibantu warga sekitar, serta regu penolong dari Search And Rescue (SAR) dengan menyusuri sepanjang aliran Sungai Silau. Namun pencarian tersebut belum membuahkan hingga malam berakhir. Keesokan harinya, warga akhirnya melihat mayat korban terapung dan tersangkut diantara tiang rumah warga yang ada di pingiran sungai Asahan. Korban lalu dievakuasi untuk selanjutnya dibawa ke rumah duka. Kapos Basarnas Tanjungbalai-Asahan Agus Wibisono didampingi petugas Kesbang Kota Tanjungbalai Bambang membenarkan bahwa anak tersebut telah ditemukan masyarakat, namun dalam kondisi tidak bernyawa lagi. (a32)

Agama Jangan Dianggap Tameng, Simbol Dan Pengakuan TANJUNGBALAI (Waspada) : Banyak orang saatinimenjadikanagamabukanlagialatpemacu terhadap perbuatan baik dan penangkal sesuatu yang dapat merusak citra kemanusiaan, melainkan hanya sebatas slogan, tameng, simbol dan pengakuan semata. Demikian dikatakan Dr Achyar Zein pada seminar nasional ‘Peran Dunia Pendidikan Membina Karakter Ummat’ dalam memperingati HUT ke-63 Yayasan Madrasah Pendidikan Islam (YMPI) Seitualang Raso, Kota Tanjungbalai, Sabtu (14/5). Achyar Zein merupakan alumnus perguruan Islam tertua di kota kerang itu. Menurut Zein, hal itu terbukti banyaknya tindak pidana korupsi, kriminal, tawuran antar warga, teror, perampokandanlainnyayangmenunjukkanbahwaajaran agama belum‘mendarah daging’ dalam kehidupan masyarakat. Sehingga, tidak heran jika seseorang berbalik menggunakan simbol agama dengan tujuan kepentingan pribadi sebagai tempat berlindung agar kesalahannya tidak dipersoalkan. “Di satu sisi, institusi pendidikan agama semakin bertambah, namun prilaku anak bangsa merosot tajam sehingga peran pendidikan agama kurang signifikan dalam membina karakter generasi penerus yang religius sebagai ciri khas bangsaIndonesia,”kataZeinmengulaskontradiksi antara ajaran agama dengan prilaku masyarakat

Waspada/Rasudin Sihotang

Dr Achyar Zein, MA dalam paparannya menjelaskan peranan pendidikan agama Islam sangat signifikan dalam menghadapi tantangan globalisasi dan dekadensi moral. Foto direkam Sabtu (14/5). yang terjadi saat ini. Untuk itu, keberadaanYMPI sebagai lembaga yang sudah berkiprah bidang ilmu keagamaan sangat strategis untuk membina masyarakat religius dan hendaknya konsisten untuk menjalankan ilmu-ilmu keagamaan. (a32)

Dalam Sehari, 2 Tewas Korban Laka Lantas Di Simalungun PEMATANGSIANTAR (Waspada): Dalam sehari di dua tempat terpisah, dua orang tewas dan satu luka berat korban kecelakaan lalu lintas (laka lantas) di jalan umum di wilayah hukum Polres Simalungun. Korban tewas terdiri Budi, 22, warga Purba Sinombah, Simalungun dan Putra, 20, warga Ujung Ban, Simalungun, sedang korban luka berat yakni Rahmat, 14, warga sama dengan Budi. Budi dan Rahmat menjadi korban laka lantas di jalan umum, Km 60-61, jurusan Pematang-

siantar-Seribudolok, Simpang Huta Tano, Kecamatan Purba, Simalungun pada Sabtu (14/ 5) pukul 21:45. Sedang Putra mengalami laka lantas di jalan umum, Km 25-26, jurusan PematangsiantarMandoge, Nagori Buntuturunan, Kecamatan Hatonduhan, Simalungun pada Sabtu (14/5) pukul 21:00. KapolresSimalungunAKBPMarzuki,Minggu (15/5) menyebutkan laka lantas di dua tempat terpisah itu masih dalam penyelidikan. (a30)

Sumatera Utara


WASPADA Senin 16 Mei 2011

Keputusan DPRDSU Cacat Hukum

Dukungan Pembentukan Protap Belum Memenuhi Syarat SIBOLGA (Waspada) : Gerakan Masyarakat Peduli Tapanuli Sibolga-Tapteng (GEMAPETA) menyatakan keputusan DPRD Sumutyangmenyetujuipembentukan ProvinsiTapanuli dianggap cacat hukum dan belum memenuhi syarat sesuai UU nomor 32 tahun 2004 serta PP nomor 78 tahun 2007. Demikian ditegaskan Sekretaris Gemapeta Kota Sibolga Hendra Sahputra, Sabtu (14/5) di Sekretariat Gemapeta jalan SM Raja Sibolga. Dikatakan Hendra, hasil RapatParipurnaDPRDSumatera

Utara pada 9 Mei 2011 yang memutuskan menerbitkan Surat Rekomendasi pembentukan Provinsi Tapanuli perlu disikapi secara rasional agar tidak menjadi polemik dan mengarah kepada konflik bagi masyarakat Kota Sibolga, karena sesuai data – data sertapembuktianyangadabahwa hingga kini masyarakat maupun DPRD Kota Sibolga melalui Surat Keputusan nomor 15 tahun 2006 menyatakanmenolakbergabung dengan Protap, hal ini sesuai dengan aspirasi maupun kemauan politik masyarakat. Berdasarkan penjelasan

diatasjelasbahwakeputusanyang diambil oleh DPRD Sumut telah melanggar hak – hak demokrasi dan kemauan masyarakat Kota Sibolga serta mengangkangi kewenangan DPRD Kota Sibolga. DPRD Sumut seharusnya menyahuti aspirasi dan kemauan politik dari masyarakat terkait adanya pernyataan melalui LSM, organisasi politik yang menyatakan menolak pembentukan ProvinsiTapanulikarenaterbuktiselama ini pemekaran bukan aspirasi masyarakat,melainkanhanyakepentingan elit partai dan kepentingan para pejabat. (a23)

PAN Dukung Pembentukan Provinsi Sumteng P.SIDIMPUAN (Waspada) : Untuk pemekaran Tapanuli Bagian Selatan untuk menjadi Provinsi Sumatera Tenggara, Partai PAN sudah siap mendukung sepenuhnya. Ketua Fraksi PAN DPRD Sumatera Utara Parluhutan Siregar dalam kegiatan reses tahun 2011 memaparkan itu di kediaman Ketua DPD PAN (Dewan PimpinanDaerahPartaiAmanatNasional) Kota Padangsidimpuan Erwin Nasution, Kamis (12/5), sore. Katanya, sudah membahas sebanyak dua kali dalam sidang resmi untuk pembahasan provinsi baru di Tabagsel, untuk itu dirinya mengharapkan kepada

seluruh masyarakat untuk bersama-sama mendukung DPRDSU agar segera bisa direalisasikan dandiusulkankepadapemerintah pusat. Kemudian meminta kepada masyarakat untuk mewaspadai segelintir oknum yang tidak menginginkan kemajuan daerah inidenganmenghasutmasyarakat sehingga pembentukan provinsi ini terganggu. Dengan terbentuknya provinsi baru maka diharapkan akan sejalan dengan kemajuan pembangunandankesejahteraanmasyarakatnya di 5 daerah ini, Kabupaten Tapanuli Selatan, Padanglawas/Utara, Kota PadangsidimpuandanMandailingNatal.

“Jangan pula kita beranggapan dengan adanya provinsi baru maka akan muncul korupsi baru dan rakyat tetap begitu-begitu saja, karena jangankan karena pemekaran toh yang sekarang juga korupsi dan bukan karena pemekaran tetapi lebih kepada pribadi manusianya’’, paparnya. Ketua DPD PAN Kota Padangsidimpuan Erwin Nasution didamping Sekretaris Erpi J Samudera Dalimunthe mengungkapkan, reses ini juga dirangkai dengan silaturahim pengurus harian PAN Kota Padangsidimpuan periode 2010-2015 yang baru saja menerima SK kepengurusan. (c13)

Pelabuhan Sibolga Peroleh Dana Pembangunan Rp8,4 Miliar SIBOLGA (Waspada) : Demi menjaga dan meningkatkan perekonomian masyarakat Kota Sibolga yang selama ini turut ditopang oleh keberadaan Pelabuhan Sibolga, Komisi D DPRD Sumut berhasil memperjuangkan dana pembangunan infrastrukturPelabuhanSibolgahingga ditampung dalam APBD Sumut Tahun 2011 sebesar Rp8,4 miliar. Yang mana, pembangunan berupa penambahan dermaga dan beberapa bangunan pendukung lainnya akan dilaksanakan pada 2011 ini. DemikiandisampaikanKetua Komisi D DPRD Sumut H Maratua Siregar dalam acara pertemuan anggota DPRD Sumut dalam rangka reses persidangan tahun 2011 dengan masyarakat

KelurahanAekManis,Kecamatan Sibolga Selatan, Kota Sibolga, Kamis (12/5) di Sekretariat DPD PAN Kota Sibolga bersama Ketua DPD PAN Kota Sibolga Syafruddin Lubis serta ratusan warga Kelurahan Aek Manis dan Kecamatan Sibolga Selatan. Pelabuhan Sibolga selama ini menjadi salah satu tulang punggung pendukung perekonomian masyarakat Kota Sibolga. Masyarakat pendatang, khususnya masyarakat dari Pulau Nias setiap tahun selalu melewati pelabuhan ini, sehingga berbagai usaha masyarakat bisa dilakukan. “Bila Pelabuhan Sibolga ini tidakkitabenahiinfrastrukturdan pelayanannya, kita khawatir masyarakat Nias akan memilih jalurudaradantidaklagimenggu-

nakan jalur Pelabuhan Sibolga untukpulangmaupunkeluardari Nias. Atas dasar inilah, maka saya selaku Ketua Komisi D DPRD Sumut yang membidangi infrastruktur pembangunan bersama dengan rekan-rekan Komisi D lainnya mengusulkan dan memperjuangkandanapembangunan Pelabuhan Sibolga ini supaya ditampung di APBD Sumut TA 2011. Dan alhamdulillah, usulan kami diterima,” jelasnya. Mantan Ketua DPRD Tapteng ini menambahkan, tujuan dari resesnya untuk mendengarkan secara langsung keluhan, saran dan aspirasi masyarakat terhadaprencanamaupunpelaksanaan pembangunan yang saat ini sedang berjalan untuk kemudian akan dibawa dan dibahas di DPRD Sumut. (a23)

Warga Tobasa Minta Jalan Dan Jembatan Timbang Dibangun BALIGE (Waspada) : Ketua Komisi D DPRD Sumut yang membidangi infrastruktur H Maratua Siregar mengunjungi Toba Samosir, Kamis (12/5) siang. Kunjungan itu dilakukan dalam rangka reses. “Kehadiran saya di Tobasa melihat secara langsung kondisi infrastruktur sekaligus menampung aspirasi masyarakat Toba Samosir,” kata Maratua Siregar di sekretariat DPD PAN Tobasa. Mendengar hal itu, masyarakatTobasayangmemadatikantor DPD PAN Tobasa menyambut baik kunjungan itu. Karena ba-

nyak hal yang perlu disampaikan untuk kiranya mendapat perhatian pemerintah ke depan. Seperti persoalan yang diutarakan warga Toni Pardede misalnya. Dikatakan, Jalan Lintas Sumatera, mulai Porsea hingga Tampahanbanyakyangrusakdan berlubang. Menurutnya, salah satu penyebab kerusakan itu adalah kapasitas mobil yang diduga melebihi kapasitas. Oleh karena demikian, Toni mengusulkan agar kedepan jalan itu diperbaiki. Kemudian jembatan timbang dibangun. Warga lainnya Marimbun

Marpaung mengusulkan DPRD Sumutmemberimasukankepada Pemprovsu melalui Dinas PemudaOlahargaagar mengalokasikan anggaranpembangunandibidang olahragasebagaibentukperhatian terhadapperkembanganolahraga di daerah, terutama bagi atlet berprestasi yang selama ini dinilai kurang mendapat atensi. Ketua DPD PAN Tobasa Zevrin Alam Harahap mengatakan, pihaknya berterima kasih kepada H Maratua Siregar yang telah memberikan perhatiannya ke Toba Samosir. (a22)

385 Siswa SMK Istiqlal Delitua Perpisahan DELITUA (Waspada): Sebanyak 385 siswa kelas XII SMK IstiqlalDelituayangterbagidalam jurusan Akuntansi, ADM Perkantoran,Teknik Komputer Jaringan, Multimedia dan Teknik Kendaraan Ringan (Otomotif) melaksanakan perpisahan di sekolahnya, Sabtu (14/5). Hadir pada kesempatan itu KetuaYayasan Pendidikan Istiqlal Prof Dr H Jumino Suhadi, MA, KepalaSMKIstiqlalDraRosmidar, parakepalasekolahdilingkungan Istiqlal dan guru serta siswa. Kepala SMK Istiqlal Dra Rosmidar dalam sambutannya mengatakan, ilmu yang didapat di bangku sekolah selama tiga tahun kiranya dapat dijadikan modal dasar bagi siswa. Karena alumni SMK diciptakan sebagai tenaga-tenaga trampil yang siap pakai untuk mengisi dunia pekerjaan di mana saja. Jadi tidak ada kata tidak bisa bagi alumni SMK, seperti slogan yang selama ini dicetuskan ‘SMK bisa!’ “Untuk itu, rebut peluangpeluang yang ada di dunia usaha atau bila perlu ciptakan lapangan kerja sendiri agar benar-benar berdaya guna pendidikan yang telah didapat selama tiga tahun di SMK,” kata Rosmidar. Rosmidar pada kesempatan itu berharap seluruh siswa SMK Istiqlaldapatlulus100persenpada pengumuman UN, Senin (16/5).

Bersambung ke hal. B5


SALAH satu penampilan siswa SMK Istiqlal ketika menyemarakan perpisahan di sekolahnya, Sabtu (14/5). “Apabila pengumuman itu berisikan hasil kelulusan yang baik, janganlupabersyukurkarenajalan kalian masih panjang. Namun apabila tidak lulus jangan berkecil hati dan putus asa, karena masih ada kesempatan untuk mengulang kembali,” sebutnya. Sementara Ketua Panitia dan PKS Kesiswaan Drs. Rudi Sartono menjelaskan, ada perasaan sedih dan bahagia melepas anak-anak yang luar biasa ini. Bahagia, karenasebagiandarimerekayang akan menyelesaikan pendidikannya di SMK Istiqlal ini sudah ada yang akan dikontrak untuk bekerja di Jakarta, Pekan Baru dan Sumatera Utara.

“Ini membuktikan bahwa pendidikan yang kita lakukan selamainikepadasiswadibangku sekolah ternyata dapat diterima oleh pelaku dunia usaha,” sebut Rudi. Bagi siswa yang sudah bekerja, sebut Rudi lagi, kiranya dapat terus melanjutkan pendidikannya ke bangku kuliah agar ilmu yang didapat terus berkesinambungan, sehingga dapat kiranya menjadi penopang bagi karirnya ke depan. Acara perpisahan dimeriahkan penampilan berbagai kreativitas siswa meliputi, drama, tari-tarian, vocal grup, band, puisi dan lain-lain. (m43)

Agustus 2011, DS Terapkan KTP Elektronik LUBUK PAKAM (Waspada): Pemerintah Kabupaten Deliserdang akan menerapkan Kartu Tanda Penduduk Elektronik (eKTP) pada Agustus 2011 sebagai tindak lanjut Peraturan Presiden No 35 Tahun 2010 tentang perubahan atas Perpres No.26/2009 yaitu penerapan KTP Elekteronik paling lambat akhir 2012. Hal itu dikemukakan Bupati Deliserdang Drs H AmriTambunan melalui Sekdakab Drs H Azwar S MSi, pada rapat persiapan pelaksanaan KTP Elektronik yang diterapkan secara nasional, di Aula Cendana kantor bupati

Deliserdang di Lubuk Pakam, Senin (9/5). Didampingi Asisten I H Syafrullah S.Sos,MAP, Asisten II Drs Agus Ginting,MSi dan Kadis Kependudukan dan Capil Drs H M A Yusuf Siregar MAP serta dihadiriKadisInfokomDrsNeken Ketaren,parapimpinanSKPDterkait serta Camat se- Kab Deliserdang, Sekdakab menjelaskan penerapan KTP Elekteronik (eKTP)menjaditanggungjawabkita bersama terutama dalam upaya kelancaran operasional di lapangantermasukpenyediaanruang pelayanan yang memadai di

kantor kecamatan termasuk kelengkapan ruang tunggu, catu daya listrik, operator yang terampil dan penerapan peraturan serta prosedur pembuatan KTP Elekteronik tersebut. Kadis Kependudukan dan Catatan Sipil Drs HM A Yusuf Siregar MAP mengatakan tahap pertamapenerapane-KTPsecara nasional dilaksanakan di 197 Kabupaten/Kota di Indonesia. Yusuf menjelaskan e-KTP merupakan KTP nasional yang sudah memenuhi semua ketentuan diatur dalam UU No 23 Tahun 2006 dan Perpres No 26

Tahun 2009 dan Perpres No 35 Tahun 2010 sehingga berlaku secara nasional. Dan dapat mempermudah penduduk untuk mendapatkan pelayanan dari lembaga pemerintah dan swasta karena tidak lagi memerlukan KTP setempat. Untukkelancaran penerapan e-KTP, Pemkab Deliserdang telah mempersiapkan perangkat keras dan lunak untuk tempat pelayanan di kantor Dinas Kependudukan dan Catatan Sipil. Sedangkan yang menjadi kewajiban masyarakat adalah memenuhi pemanggilan ke tem-

pat pelayanan e-KTP (tidak boleh diwakilkan-red)untukmelakukan verifikasi/pencocockan biodata, pengambilan dan perekaman paspoto, tandatangan dan sidik jari penduduk. Selanjutnya verifikasi melalui pemadanan sidik jari penduduk 1:1 pada saat pengambilan e-KTP yang waktunya ditentukan kemudian. Sedang perhitungan kebutuhan sarana pendukung se-Kabupaten Deliserdang disediakan alat elektronik KTP 111 buah, operator 222 orang dengan jumlahwajibKTPsaatini1.389.465 orang, papar HM AYusuf Siregar. (a06)

WASPADA Senin 16 Mei 2011

Sumatera Utara


Jalan Lingkar Kotanopan Harus Dilanjutkan

Sambungan dari hal. B4

PANYABUNGAN(Waspada): Pembangunan jalan lingkar (ring road) Kotanopan Kabupaten Mandailing Natal yang memanjangmulaidarikawasanSabaPasir hingga Muarasoro harus dilanjutkan. Kalau terhenti,jalan tidak akandapatdimanfaatkanmasyarakat dan proyek terkesan mubazir. Lokot Husda Lubis, tokoh masyarakat Kotanopan, Minggu (15/5) mengatakan,keberadaan jalan lingkar tersebut hingga saat ini belum juga dapat dimanfaatkan warga dengan baik,akibat pekerjaannya belum tuntas. “Jalan tersebut bisa menjadi

alternatif transportasi keluar dan masuk kawasan Kotanopan, apalagi Kotanopan adalah sebuah wilayahyangdikelilingilahanpertanian dan perkebunan cukup luas,tentunyasangatmembutuhkan banyak jalan alternatif,” ungkapnya. Kata dia, selama ini pintu masuk dan keluar Pasar Kotanopan, tidak ada, sedangkan kepadatan penduduk semakin bertambah.”Kalau ada kegiatan masyarakatdipusatPasarKotanopan seperti peringatan HUT RI transportasi macet total berjam-jam, sehingga dengan terbangunnya jalan alternative tersebut, para

pengendara sudah bisa melanjutkan perjalannya, apalagi kawasan Kotanopan merupakan jalur lintas Sumatera yang banyak dilalui berbagai jenis kendaraan,” harapnya. Lokot lebih jauh mengungkapkan,selain mempermudah distribusi barang dan manusia, dengan adanya jalan lingkar tersebut, Kotanopan akan menjadi kota kecil yang indah, sehingga menjadi pilihan bagi wisatawan untuk berkunjung.”Oleh karena itu pembangunannya perlu dipercepat,sehingga bisa cepatdimanfaatkanmasyarakat,” ujarnya. (a28)

Penetapan Sekdakab Madina Setelah Pelantikan Bupati Terpilih Madina Bebas Dari NII PANYABUNGAN (Waspada): Kawasan Kabupaten Mandailing Natal sejauh ini masih bebas dari gerakan Negara Islam Indonesia(NII).“Sampaikini tidak ada menerima laporan dari masyarakat tentang kehilangan anggota keluarganya karena diduga terlibat gerakan NII,” kata Kabag Humas dan Protokol Pemkab Madina M Taufik Lubis, Minggu (15/5). Kata dia, dalam upaya penanganan gerakan NII ini, pihak Pemkab Madina telah mengimbau anggota masyarakat, terutama para pondok – pondok pesantren agar tidak terpengaruh terhadap ajaran – ajaran maupun doktrin – doktrin dari organisasi itu. “Pemkab Madina mengucapkan terima kasih kepada seluruh masyarakat yang tidak terlibat pada NII, karena jelas – jelas bahwa jaringan itu menyimpangdarihaluannegaraRepublik Indonesia,” katanya. Untuk itu,Taufik tetap mengimbau para orang tua untuk tetap melakukan pengawasan terhadap anak – anaknya agar tidak terlibat gerakan itu. (a28)

PANYABUNGAN(Waspada): Penetapan Pejabat Sekretaris Daerah (Sekdakab) Kabupaten Mandailing Natal diharapkan dapatdilakukansetelahpelantikan bupati dan wakil bupati terpilih. Pengharapantersebutdisampaikan anggota DPRD Madina AliHanafiahdiPanyabungan,Minggu (15/5), terkait isu berkembang bahwa Pj.Bupati Madina Aspan Sofian telah mengajukan nama-namacalonSekdakabMadina kepada Gubsu.

Menurut politisi PDI-P itu, kalau memang Plt Gubsu Gatot Pudjo Nugroho tetap melakukan proses penetapan pejabat Sekdakab Madina, prosesnya harus melalui mekanisme yang ada. “Pada 2010,sebenarnyatelah adapejabatyangdiajukanmenjadi Sekdakab, bahkan sudah mengikuti fit and proper test.Jadi kita berharap agar pejabat Sekdakab Madina berasal dari lingkungan Pemkab Madina, bukan berasal atau diangkat dari pejabat dari

luar daerah,” ungkapnya. Ketua Fraksi Perjuangan Reformasi DPRD Madina itu menjelaskan, langkah yang paling baik untuk penetapan Sekdakab Madina harus menunggu pelantikan bupati/wakil bupati terpilih hasil pemungutan suara (oblos ulang) 24 April 2011 lalu. Hal ini, katanya, dikarenakan bupati dan wakil bupati terpilih yang akan memilih siapa dari pejabat yang ada di lingkungan Pemkab Madina yang pas. (a28)

Tiga Notaris Di Madina Datangi Kantor BPN PANYABUNGAN(Waspada): Terkait adanya pilih kasih terhadap pengajuan setifikasi tanah yang diajukan oleh setiap notaris dan PPAT, tiga notaris atau pejabatpembuatanaktatanah(PPAT) berkantor di Panyabungan Madina mendatangi kantor BPN (Badan Pertanahan Nasional ) di perkantoran Perbukitan Payaloting Panyabungan, baru-baru ini. Ketiga notaris itu Fitrisna Borotan, Elinajjah Pulungan dan Sondang Matiur Hutagalung. “Pihak BPN Madina selalu mempersulit bahkan pilih kasih dalam menjalankan program pemerintah untuk sertikasi tanah yang kita ajukan,” ucap ketiga notaris dan PPAT itu saat berada di kantor BPN Madina, Rabu (11/5). Ketiganya juga mengklaim telah memenuhi segala

persyaratan dalam pengajuan sertifikasiyangdiamanahkanoleh masyarakat. Namun pembuatan sertifikasi yang diajukan mulai dari pendaftaran hingga selesai memakan waktu tiga bulan. Sementara ada notaris/PPAT lain bisa mengajukan sertifikasi tanah dan dalam jangka waktu dua sampai tiga minggu sudah bisa selesai. “Kami tidak mau ada pilih kasih di antara sesama notaris danPPATdariBPN.Jikatidakdiberikan hak dan pelayanan yang sama setelah kita lakukan protes serta kritik saran, tidak tertutup kemungkinan kita akan mendatangi kantor ini kembali,” kata mereka. Mereka juga mengatakan, tidak terima kalau klien mereka lari akibat adanya dugaan kolusi

yang pihak pejabat BPN bersama istrinya yang juga seorang notaris dan PPAT, sebab pengajuan yang mereka lakukan diduga selalu dipersulit. Kepala BPN Madina Jouharnel melakukan klarifikasi atas kedatangan tiga notaries tersebut. Menurutnya, masalah yang terjadi hanya kesalahpahaman. Ia beralasan, ada gangguan pada sistem komputer, sehingga pengurusannya agak lambat. Selain itu, petugas operator untuk sistem online ini juga cuma satu. “Selamainikita masihmanual dalam pengisian data, sehingga waktunya juga bisa cepat. Kedatangan para notaries/PPAT ini menjadi sebuah kritik saran yang baik dalam peningkatan pelayanan kinerja kami,” sebutnya. (a28)

B6 150 Siswa SMA Di Madina Ikuti Olimpiade Sains PANYABUNGAN(Waspada):150Siswadari19SekolahMenengah Atas (SMA) mengikuti olimpiade sains dilaksanakan Dinas Pendidikan Kabupaten Mandailing Natal selama empat hari di gedung SMA Negeri 1 Panyabungan, baru-baru ini. Materi pelajaran yang diujikan Bahasa Inggris, Bahasa Indonesia, fisika, biologi, IPS, kimia, matematika, astronomi, diikuti 150 peserta dari 19 SMA. “Olimpiade ini merupakan program nasional untuk mencari bibit-bibit dalam dunia pendidikan di Madina dan ini dilaksanakan setelah adanya seleksi pada tingkat kecamatan,” kata Kadis Pendidikan Madina Imron Lubis, Sabtu (14/5). Imron berharap agar setiap peserta kegiatan dengan sungguhsungguh, sehingga dapat mengharumkan nama sekolah dan keluarga. “Bagi pemenang yang sampai ke tingkat Nasional akan mendapat beasiswa dari Pemkab Madina dan bebas memilih perguruan manapun di seluruh Indonesia,” terangnya. (a28)

Pasar Khusus Karet Akan Dibangun Di Madina PANYABUNGAN (Waspada) : Pasar khusus penampungan karet bakal dibangun di berbagai kecamatan di Kabupaten Mandailing Natal.Pembangunan itubertujuan mendukungpeningkatan maupun menstabilkan harga komoditi karet yang merupakan salah satu produksi petani di daerah itu. “Kami saat ini sedang melobi dana ke pemerintah provinsi untuk anggaran pendiriannya. Anggaran Pemkab Madina sangat terbatas dan mudah-mudahan dalam waktu dekat sudah bisa dimulai pembangunannya,” ucap Kadis Perindag, Koperasi, UKM dan Pasar Madina A Ansari Nasution, Sabtu (14/5). Diamenjelaskan,selamainipetanikaretdiMadinatetapmengeluh akibat kondisi harga yang naik turun,sehingga dengan adanya pasar khusus penampungan produksi karet itu,harga karet bisa berlangsung stabil maupun menguntungkan masyarakat petani. Berdasarkan hasil pantauan di lapangan, lanjut kadis,tidak menentunyahargakomoditaskaretdiMadina,salahsatupenyebabnya diakibatkan oleh belum adanya fasilitas pasar khusus, sehingga dengan terbangunnya pasar khusus harga akan bias dikoordinir dan harganya bisa bersaing dengan para pedagang pengumpul. Menurutnya, pasar khusus karet yang direncanakan dapat terbangun tahun 2011 ini dialokasikan di beberapa pasar kelas rendah yaknidiPasarKotanopan,PasarMalintangdanPasarGunungBaringin. (a28)

Sumatera Utara Warga Hutaraja Adukan PT SKL Ke DPRD Tapsel MUARA B.TORU (Waspada): Puluhan warga Kelurahan Hutaraja, Kecamatan Muara Batangtoru, Kabupaten Tapanuli Selatan mengadukan PT SKL ke KomisiIVDPRDTapanuliSelatan. Rombongan perwakilan warga diterima anggota Komisi IV H Darwis Sitompul. Dalam pertemuan tersebut warga yang dipimpinIsmailSiregarmemberikan ultimatum terhadap PT SKL (Samukti Karya Lestari) untuk memberikan surat kepemelikan lahan yang sah ataupun surat kerjasama yang diketahui oleh warga yang terdaftar dalam keanggotaan KoperasiTondi Bersama (TBS) di Hutaraja, Sabtu (14/5) sore. Warga Hutaraja, kata Ismail, sudah bosan dengan cara-cara PTSKLyangbersembunyidibalik ketua koperasi Tondi Bersama H Jusar Nasution yang diduga sekongkol dengan tidak memberikan surat kerjasama yang falid atas lahan PIR (Perkebunan Inti Rakyat) kepada anggota koperasi, namun yang diberikan hanya sertifikat keangotaan saja, yang lemah dasar hukumnya. Ungkap Ismail, Koperasi TBS yang didirikan mulai 2007 hingga saat ini anggota koperasi tidak pernah diajak mufakat ataupun rapat bagaimana perkembangan kerjasama dengan pihak perusahaan yang melebarkan sayapnya di bidang perkebunan kelapa sawit itu. Padahal dari informasi

Waspada/Ahmad Cerem Meha

PULUHAN warga Kelurahan Hutaraja, Kec. Muara Batangtoru, Tapsel temui anggota Komisi IV DPRD Tapsel H Darwis Sitompul, terkait kepemilikan lahan PIR yang tidak jelas surat kerjasamanya antara anggota Koperasi Tondi Bersama dengan PT SKL (Samukti Karya Lestari), Sabtu (14/5) sore. yang didapat setiap anggota koperasi mendapat lahan satu hektare per kepala keluarga (kk). Dari ribuan hektare lahan PT SKL diantaranya adalah lahan milik warga yang diduga dicaplok dan tanah ulayat Hutaraja, makanya dibentuk kesepakatan agar perusahaan itu dapat beroparasi dengan baik dengan pola kerjasama membentuk PIR (Perkebunan Inti Rakyat). Sementara, Politisi Partai Demokrat itu menyayangkan sikap ketua koperasi tersebut dengan PT SKL, harusnya mereka itu ter-

buka terhadap masyarakat, agar tidak ada gejolak yang tidak diharapkan semua pihak ke depan. ‘’Kami dari Komisi IV, akan memperjuangkan nasib rakyat yang diduga dizhalimi oleh perusahaan perkebunan kelapa sawit itu, nantinya PT SKL akan kami panggil agar mereka mengeluarkan surat kerjasama kepemilikan lahan PIR terhadap anggota KoperasiTBS,’’ tegas Sitompul. (c13)

WASPADA Senin 16 Mei 2011

Dugaan KKN Di PU Madina Kian Menggurita TEKAD pemerintah memberantas korupsi di negeri ini kian nyata. Ini ditandai dengan banyaknya pejabat maupun mantan pejabat yang masuk bui, tidak terkecuali mereka yang berasal dari legislatif, pebisnis dam lainnya. Tim KPK serta jajaran penegak hukum lainnya terusmenggebraktanpapandangbulu,tidakperduli keluarga atau sahabat, jika bersalah mendapat ganjaran hukuman sesuai yang diamanatkan undang-undang. Tohbegitugencarnyapenindakan,begitubanyak orang-orang terpandang yang masuk kerangkeng, sebagai penebus dosa, terkesan tidak menjadi pelajaran bagi pejabat daerah, sehingga praktek korupsi makin menggurita dan menganga. Seperti yang diuangkapkan Waspada pekan lalu tentang dugaan praktik KKN di Dinas PU Madina yang di pimpin Nasrin Lubis makin terbuka lebar tidak hanya karena indikasi staf PU terlibat dalam penyiapan dokumen lelang, tapi juga dalam peninjauan (anwejing) lapangan. Informasi ini disampaikan Ketua DPK Aspekindo Madina Erik Kantona Parlindungan Lubis didampingi Sekretaris MhdYakuf Borotan, Selasa (10/5) di Panyabungan. Dijelaskan, kecurigaan mereka terkait peninjauan lapangan perbaikan jalan menuju Pelabuhan Sikara-kara di Kecamatan Natal, Senin (9/5) lalu. Seharusnyasaatpeninjauan,rekanandanpanitia didampingi kepala desa bersama-sama ke lapangan. Namun sampai pukul 17:00 rekanan dan kepala desa menunggu, panitia dari Dinas PU tidak ada yang datang sehingga rekanan pulang karena tidak tahu lokasi proyek yang mau dikerjakan.

Kepala Desa Sikara-kara Amrin dan Mhd.Yakup dari CVWidya Dwi Utama dalam surat pernyataannya tanggal 9 Mei 2011 menyatakan, panitia pekerjaan Dinas PU tidak berkehendak melaksanakan penjelasan lapangan tanpa alas an yang jelas. Adanya indikasi KKN dalam tender Dinas PU juga terlihat pada peninjauan lapangan proyek bantaran di Desa Sihepeng. Pihak rekanan dari CV Natalindo EK Parlindungan merasa ada kesalahan dalam memahami gambar yang hanya membuat sketsa peta tanpa didukung gambar detail. Misalnya, kedalaman dan panjang saluran yang akan digali. Kemudian, bekas galian sepanjang 250 meter yang sangat banyak tidak diketahui mau dibuang kemana. Sementara lokasi galian berada di areal perumahan padat penduduk dan tidak ada tempat untuk pembuangan bekas galian. Atas dasar adanya kejanggalan dalam anwejing dan gambar rincian proyek yang kurang jelas, CV Natalindo pada tanggal 10 Mei 2011 dan CVWidya Dwi Utama pada tanggal 9 Mei 2011 langsung menyurati unit layanan pengaduan (ULP) di Dinas PU Kabupaten Mandailing Natal. Informasi berkembang di lapangan, sebelum tender, oknum Sekretaris Dinas PU diduga menerima uang dari sejumlah rekanan dengan jumlah bervariasi. Nominal setoran rekanan di tentukan jumlah nilai anggaran paket proyek. Sebenarnya kasus KKN di PU Madina sudah merupakan informasi lama, tapi jarang ada yang mau mengungkapkannya, sebelum masuk penawaran, hingga pelaksanaan pekerjaan para pengusaha menjadi sapi perahan.Karena itu tidak heran jika kontraktor di Madina sangat sedikit yang berkembang, jika tidak boleh dibilang pada hancur, mereka bisa berkibar hanya sekitar satu dua tahun, kemudian namanya akan tenggelam. (tim)


WASPADA Senin 16 Mei 2011


Seluruh Desa Di Kecamatan Leuser Agara Tertinggal KUTACANE (Waspada): Seluruh desa di Kec. Leuser Aceh Tenggara masuk katagori desa tertinggal, kendati potensi alam sangat menjanjikan untuk sektor pertanian dan perkebunan. Demikian disampaikan Kepala Bappeda Aceh Tenggara. Jarwansyah SPd, MPd di ruang kerjanya, Jumat (13/5). Dari 386 desa defenitif, 107 desa katagori tertinggal selebihnya desa maju , sementara semua desa di Kec. Babussalam, tidak satu pun katagori tertinggal. Selain karena minim dan parahnya sarana jalan, jga tak ada fasilitas air bersih dan minimnya penerangan listrik. Banyaknya rumah berlantai tanah, Desa tertinggal di Agara mencapai 30 persen, sedangkan 70 persen lagi katagori desa maju, rinciannya, untuk Kec. Leuser dari 23 desa yang ada seluruhnya katagori desa tertinggal, disusul kecamatan Babul Rahmah

12 desa tertinggal. Lawe Alas 10 desa tertinggal, Kec. Darul Hasanah 9 desa, Deleng Pokisen, Badar dan Kec. Bukit Tusam masing-masing 8 desa, Lawe Sumur 7 desa, Semadam 5 desa, Kec. Lawe Sigalagala dan Bamel masing-masing 3 desa serta Kec. Lawe Bulan 2 desa tertinggal. Desa tertinggal di Agara, di antaranya desa Bintang Alga Musara, Bukit Meriah, Kompas, Kane Mende, LauTawar, Gunung Pakpak, Naga Timbul, Bun-bun Alas, Bun-bun Indah, Akikh Mejile, Permata Musara, Lawe Serakut, Sepakat, Ukhat Peseluk, Bukit Bintang Indah dan beberapa desa lainnya di kecamatan Leuser. Kepala Bappeda Jarwansyah, SPd mengatakan, kendati hampir seluruh kecamatan desa tertinggal, namun dlilihat kondisi jalan dan taraf hidup masyarakatnya, mungkin tak separah di Kec. Leuser. Di Leuser masih banyak rumah berlantai tanah, beratap plastik dan berdinding kulit kayu,” jelas Jarwan.(b27)

Pabrik Sagu Ludes Terbakar PANTONLABU, Aceh Utara (Waspada): Sebuah pabrik pengolah sagu yang baru sekitar sebulan beroperasi di Dusun Matang Bugak, Desa Tanjong Ara, Kecamatan Tanah Jambo Aye, Aceh Utara ludes dilalap si Jago Merah, dan dilaporkan dibakar orang tak dikenal (OTK). Selain memusnahkan bangunan pabrik sederhana yang terbuat dari material kayu, seperangkat alat produksi, termasuk mesin utama, juga gosong dilalap api. Kerugian materil ditaksir mencapai Rp20 juta lebih. Kapolres Aceh Utara AKBP Farid BE melalui Kapolsek Tanah Jambo Aye, Iptu Mardan P, Minggu (15/5) menjelaskan, kebakaran itu terjadi 5 Meihari. Namun karena sempat dicoba selesaikan secara kekeluargaan di tingkat desa, kasus itu baru dilaporkan ke Mapolsek, sekitar sepekan kemudian. “Lambannya masa pelaporan ini membuat kita kesulitan mengungkap identitas pelaku. Sejumlah alat bukti, termasuk sidik jari, sudah tidak mungkin lagi kita deteksi, karena Tempat Kejadian Perkara (TKP) sudah keburu terjamah oleh masyarakat,” kata Kapolsek

Tanah Jambo Aye, Iptu Mardan. Meski demikian, lanjut Kapolsek, proses penyelidikan tidak terhenti. Bahkan hingga Jumat (13/5) lalu sejumlah warga yang tinggal di sekitar pabrik sagu sudah dipanggil ke Mapolsek untuk dimintai keterangan sebagai saksi. Sementara Kepala Desa Tanjoeng Ara, Bustami yang dikonfirmasi secara terpisah, mengatakan, upaya penyelesaian yang dilakukan di tingkat desa, fokus pada masalah keberatan warga terhadap keberadaan pabrik tersebut. Sementara mengenai persoalan pembakaran pabrik, hanya dibahas sekilas mengingat pelaku pembakaran itu sendiri tidak dikenal. “Upaya penyelesaian itu gagal, karena warga tetap menolak keberadaan pabrik sagu tersebut.Warga menilai, pabrik itu cukup berpotensi mencemari lingkungan. Selain menimbulkan bau tidak sedap, limbah yang dibuang ke sungai juga diklaim membuat warna air sungai yang tadinya agak jernih berubah menjadi hitam,”tandas Bustami.(cmus).

Pembentukan Pengurus BPP TAKENGEN (Waspada): Puskesmas Bebesen, Kec. Bebesen, Kabupaten Aceh Tengah menggelar kegiatan penbentukan pengurus Badan Penyantun Puskesmas (BPP). Kegiatan yang difasilitasi Local Government Community In Aceh (LOGICA), diikuti puluhan peserta dari unsur tokoh masyarakat, tokoh agama, LSM, organisasi kemasyarakatan dan dunia usaha yang perduli bidang kesehatan. Dibentuknya BPP akan berperan sebagai mitra Puskesmas dalam menyelenggarakan pembangunan kesehatan masyarakat. Menurut Distrik Manager LOGICA in Aceh, Azroy Melana, Sabtu (14/5), berdasarkan pengalaman membuktikan bahwa dalam menjalankan fungsinya, terutama pemberdayaan msyarakat, Puskemas belum secara optimak mendorong partisifasi masyarakar sehingga komunikasi dengan masyarakat belum lancar. Tersumbatnya komunikasi antara

puskesmas dan masyarakat, menyebabkan kinerja puskesmas belum dapat menjawab kebutuhan masyarakat setempat. “BPP menjadi sarana bagi masyarakat untuk menyampaikan aspirasi dan keluhannya terhadap Puskesmas. Setelah itu, Puskesmas bersama BPP akan melakukan verifikasi dan menindaklanjuti keluhan masyarakar, guna memperbaiki pelayanan Puskesmas. BPP ini, bentuknya hampir sama dengan komite sekolah,” kata Azroy Melana. Kepala Puskesmas Bebesen, dr Chalili Putra menyebutkan, wacana pembentukan BPP sudah sejak lama direncanakan. Dengan adanya program dari LOGICA, sehingga wacana pembentukan BPP baru bisa terlaksana. “Hari ini kita masih melakukan inisiasi pembentukan pengurus BPP, melibatkan unsur masyarakat di Kec. Bebesen ini,” sebut Dr. Chalili.(cb04/b18)

Penutupan Semester Diisi Ajang Kreatifitas Seni Siswa BLANGPIDIE (Waspada): Madrasah Tsanawiyah Negeri (MTsN) Unggul Susoh, Aceh Barat Daya (Abdya), Sabtu (14/5) mendapat perhatian luas berbagai kalangan saat para siswa/i melakukan antraksi seni yang cukup menghibur dan menarik. Kepala MTsN Unggul Susoh, Zamiruddin, S.Pd.I di komplek sekolah tersebut menjelaskan, pelaksanaan ajang kreatifitas seni siswa yang digelar itu wujud kreatifitas para siswa yang diapreasiasikan dalam rangka penutupan semester atau yang sering disebut ‘perpisahan’ antara para siswa kelas III dengan juniornya. “Banyak potensi siswa yang selama ini mungkin belum tergali secara baik, kita harap dapat memicu para siswa mengasah bakat

yang dimilikinya. Selain itu dengan program seperti ini tingkat self confidence (rasa percaya diri) para siswa lebih tinggi sehingga berani melakukan ekpresi yang positif,” jelas Zamiruddin, S.Pd.I, Kepala MTsN Unggul Susoh. Terlihat ratusan siswa beserta masyarakat membaur menyaksikan antraksi seni yang dipertontonkan para siswa yang tergabung di dalam grup seni OSIS MTsN Unggul Susoh. Atraksi menarik lainnya berupa grup band siswa yang terlihat cukup piawai memainkan alat-alat musik modern dengan vokalis yang juga terlihat cukup antraktif. Selain itu drama teatrikal mengedepankan suasana dan pesanpesan religius.(sdp)

Waspada/Ali Amran

RUMAH tak layak huni beratap rumbia usang dan berdinding papan pinggiran, pemandangan yang mudah ditemukan di desa Bun-bun Indah dan beberapa desa lainnya di Kec. Leuser, Aceh Tenggara.

‘Takut’ Dengan Kepala Dinas, Kepsek Tidak Terima Mahasiswa Penelitian BLANGPIDIE (Waspada): Mahasiswa Sekolah Tinggi Keguruan Dan Ilmu Pendidikan (STKIP) Muhammadiyah Aceh Barat Daya (Abdya), kecewa atas sikap salah seorang kepala sekolah yang menolak menerima mereka melaksanakan penelitian psikologi sesuai surat tugas Ketua STKIP Muhammadiyah Abdya, Drs. H. Ridwan Adami, MM. Padahal tugas penelitian psikologi juga dinilai dapat memberi kontribusi bagi sekolah untuk mendapat informasi teraktual, terhadap perkembangan para siswa. “Kita sangat kecewa, kehadiran kita tidak diterima, padahal kita sudah dibekali surat tugas Ketua STKIP. Tujuan kita hanya sebatas melakukan interview untuk melihat kondisi

yang ada di lingkungan sekolah. Jadi tidak ada sangkut paut apa pun dengan persoalan lain, apalagi jika dihubungkan dengan masalah politik. Kami tidak paham hal-hal seperti itu. Jelas lah banyak sekolah di sini tidak berkembang karena birokrasi luar biasa sulit,” keluhYenni, Mahasiswa STKIP Muhammadiyah Abdya yang mengaku tidak diterima di SMP Negeri 3 Susoh, Sabtu (14/5). Tapi Kepala SMP Negeri 3 Susoh, Ahmad Maaz, S.Pd, melalui Waspada membantah dia mempersulit atau menolak para mahasiswa. Dia beralasan, belum dapat ijin langsung dari Kadis Pendidikan terkait rencana penelitian tersebut. Dia juga mengaku tidak dapat mengeluarkan rekomendasi untuk para mahasiswa di sekolah itu

karena ‘takut’ ditegur Kadis. Sebab setiap aktifitas yang dilakukan pihak luar terhadap sekolah, menurutnya harus sepengetahuan Kadis Pendidikan. “Kita tidak menolak mereka, hanya saja kita minta mereka terlebih dulu mendapat ijin dinas. Kita tidak berani kalau mereka belum mendapat ijin dinas, nanti bakal rumit masalahnya,” ujar Ahmad Maaz. Alasan itu mendapat reaksi Ketua STKIP Muhammadiyah Abdya, Drs. H. Ridwan Adami, MM. Kepada Waspada dia menyebutkan, sikap kepala sekolah yang terlalu‘takut’ dengan kepala dinas sangatlah berlebihan, sehingga mengekang kreativitas di sekolah. Itu sikap pengecut yang hanya akan merugikan sekolah itu sendiri. Semestinya pihak sekolah membuka akses

Wagub Aceh: Pagar Kampus Dengan Aqidah DEWANTARA, Aceh Utara (Waspada): Acara silaturahmi Wakil Gubernur Aceh Muhammad Nazar dengan masyarakat di Desa Lancang Barat Kec. Dewantara, Aceh Utara, kemarin. Target utama modus penyebaran aliran sesat adalah kaum terpelajar. Pasalnya kampus atau sekolah umum di Aceh masih minim kurikulum tentang agama, kesempatan ini kekuatan bagi para pemurtadan agama Islam. Keterlibatan mahasiswa merupakan tanggung jawab Perguruan Tinggi itu sendiri. Modus penyebaran aliran sesat memakai nama yang mudah terpancing masyarakat, seperti kasus aliran sesat Millata Abraham yang terjadi di bebe-

rapa daerah baik di Bireuen, Banda Aceh dan daerah lainnya. Begitu juga belasan nama aliran pemurtadan lain yang sudah dinyatakan sesat oleh Majelis Permusyawaratan Ulama (MPU) Aceh ini mesti benar-benar diwaspadai, terutama kalangan mahasiswa. Perguruan Tinggi sebagai roda pendidikan kalangan atas harus menjadi PR yang segera diselesaikan, mengingat kampus utama tiap-tiap daerah seperti Unsyiah Banda Aceh, Unigha Sigli, Unimus Bireuen, UGP Takengon, Unimal dan Politeknik Lhokseumawe, Unsam Langsa dan UTU Meulaboh, hari ini menjadi incaran mereka. “Karena itu saya harapkan Rek-

tor, Dekan sampai Ketua Jurusan untuk mempertimbangkan matakuliah tambahan tentang aqidah bagi mahasiswa,” tuturnya. Di samping beban pemimpin kampus, ini juga tanggungjawab pemimpin keluarga dan pemimpin masyarakat atau lingkungan. “Tingkatkan lagi pengajian bagi kaum muda di meunasah-meunasah, majlis taklim dan juga balai pengajian di tiap-tiap kampung, jangan biarkan gelas kosong di atas meja, pasti akan datang orang lain mengisi air kedalamnya. Artinya seseorang tidak memiliki ilmu agama atau iman akan mudah oranglainmengajarkanilmuyang salah baginya,” pintanya. (b03)

Masyarakat Pertanyakan Ganti Rugi Kerambah Oleh PLTA

Waspada/Muji Burrahman

WAKIL Bupati Nagan Raya M. Kasem Ibrahim B.Sc pada penutupan Jambore tingkat Provinsi di Scout Camp Beutong Kab. Nagan Raya, Sabtu (14/5).(

Jambore 2011 Ditutup Banda Aceh Stand Terbaik NAGAN RAYA (Waspada): Jambore Aceh 2011 ditutup secara simbolis Wakil Bupati Nagan Raya M. Kasem Ibrahim, BSc. Sabtu (14/5). Wakil Bupati menyatakan bangga dengan suksesnya kegiatan ini. Ia mengharapkan jambore yang akan dilaksanakan di Palembang bisa membawa nama harum Aceh. Dia juga mengumumkan, bagi peserta yang menjadi juara, bidang kesenian diraih Kwartir Cabang (Kwarcab) Aceh Utara, pada peringkat pertama, dua diraih Aceh Tengah. Sementara yang mendapat stand terbaik dari Kota Banda Aceh. Dalam kesempatan itu, juga diserahkan

cendaramata kepada pimpinan Pembina kontingen cabang (Pimkobcab). “Kami harap peserta dapat kembali dengan selamat ke tempat tujuan masingmasing. Saya mewakili pemerintah daerah Nagan Raya mengucapkan terima kasih sebesar-besarnya untuk semua kalangan yang terlibat langsung mensukseskan acara jambore ini,” ucap Kasem. Sementara salah seorang anggota pramuka,Yuni, di sela pelepasan mengaku sangat bangga. Dia juga merasa sedih berpisah dari banyak orang yang dikenalnya saat acara diselenggarakan.(Mji)

TAKENGEN (Waspada): Masyarakat pemilik kerambah di sepanjang Daerah Aliran Sungai (DAS) Pesangen, Kabupaten Aceh Tengah mempertanyakan pembebasan atau ganti usah yang dijanjikan pihak Perusahaan Listrik Negara (PLN) dan Pemerintah Daerah Aceh Tengah. Karena kerambah mereka termasuk yang digusur karena masuk wilayah pembangkit listrik tenaga air yang akan segera dikerjakan. Pembebasan yang dimaksud masyarakat pemilik kerambah sesuai dengan janji yang disepakati oleh pihak PLN dan pemerintah daerah. Namun, kesepakatan ganti rugi atau ganti usaha tersebut hingga berita ini diturunkan belum juga terlaksana. “Semua serba tergantung, kami mau menebar benih ikan, khawatir listrik tenaga air mulai dikerjakan. Sementara kerambah kami masih bisa dipergunakan untuk mendapatkan tambahan rejeki, dan coba bayangkan berapa kerugian kami, “ujar Adek, jumat (13/5) pemilik kerambah tancap di Kampung

Asir-asir, Kecamatan Lut Tawar. Begitu juga dengan Adi, Warga Kampung Baru, dia mengatakan pembayaran ganti rugi kerambah hingga saat ini belum jelas, sementara kerambah tersebut tidak mereka rawat dan terbengkalai. Menurut Adi, seharusnya jika keramaah tersebut dimanfaatkan, hingga saat ini mereka sudah bisa beberapa kali panen ikan dan mendapatkan uang. “PLTA dan pemerintah daerah berjanji pembebasan kerambah tersebut akan dilakukan pada Desember 2010 lalu, mundur pada Januari 2011 dan mundur lagi hingga kini tanpa ada kejelasan,” ungkap Adi yang beralih profesi dari peternak ikan kerambah menjadi tukang becak. Sementara itu Bupati Aceh Tengah Ir. H. Nasaruddin, MM mengenai pembebasan kerambah tenacap tersebut, kepada Waspada mengatakan, masyarakat diharapkan jangan khawatir dengan ganti usaha tersebut. ”Perlu kami tegaskan, bahwa pemilik kerambah tersebut akan diganti dengan yang namanya ganti usaha. Bukan pem-

bebasan, ini perlu diluruskan. Tapi, dengan ganti usaha tersebut masyarakat tidak dirugikan. Ini adalah hasil rapat Pemda dengan pihak PLTA,” kata Nasaruddin. Mengenai waktunya, mengapa lambat. Menurut Bupati Aceh Tengah ini pihak PLTA mengurus administrasi dan birokrasinya cukup panjang dan butuh waktu.”Masyarakat jangan khawatir, kompensasi ada untuk ganti usaha dan tidak rugi. Saat ini pihak PLTA lagi meminta legal opinion atau pernyataan resmi dari pihak kejaksaan agar tidak merugikan semua pihak mengenai ganti usaha tersebut,” ungkap Nasaruddin. Sementara itu, kepada Waspada, Bupati Aceh Tengah Ir.H Nasaruddin mengatakan, Presiden Susilo Bambang Yodhoyono (SBY) dipastikan akan meresmikan proses dimulainya pembangunan fisik PLTA Pesangan I dan II. “Namun seremoni peremian proyek itu digelar di Istana Negara dan disiarkan melalui jaringan televise,”sebut Nasaruddin.( cb04/b18)

yang luas kepada publik demi meningkatkan mutu dan perkembangan sekolah, bukan malah menciptakan ‘kekerdilan’ sehingga sekolah tidak bisa diakses publik. “Ini perilaku aneh, di saat daerah dan sekolah ingin memajukan pendidikan dengan membuka ruang akses sebesarbesarnya kepada publik, kok malah dibuat tertutup dan rumit seperti itu. Kondisi seperti ini patut kita pertanyakan, ada masalah apa dengan manajemen pendidikan di daerah ini?

Kok sedemikian rumitnya sehingga sekolah untuk berkembang saja harus terhambat karena ketakutan yang tidak mendasar,” ungkap Drs. H. Ridwan Adami. Kadis Pendidikan Abdya, Maiyuli RH, S.Pd yang dimintai tanggapannya berhasil dihubungi. Waspada beberapa kali mencoba mengkonfirmasi ke telepon selulernya selalu dalam keadaan tidak aktif. Sedangkan Sekretaris Drs. Jasman yang semula sempat dihubungi namun tibatiba mematikan teleponnya.(sdp)

Nusa Indah Kebobolan, Rp20 Juta Raib PANTONLABU, Aceh Utara (Waspada): Toko pakaian ‘Nusa Indah’ di Jalan Asia Pantonlabu, Kecamatan Tanah Jambo Aye, Aceh Utara, Jumat (13/5) dinihari dibobol maling. Pelaku membawa kabur ratusan potong pakaian jadi, terutama jeans bermerek. Kerugian ditaksir mencapai Rp20 juta. Pemilik toko, M Nur alias Agam, 30, di tokonya, Sabtu (14/ 5) kemarin menjelaskan, saat kejadian toko kosong. Seperti biasa dia dan pekerja menumpang tidur di toko kawan lantaran lantai dua tokonya disewa orang lain. “Saya menduga pencurian terjadi menjelang subuh. Sebab, hingga pukul 04:00 dinihari, tetangga toko saya masih begadang sambil main gitar dan dia tidak mendengar suara mencurigakan,” duga Agam. Dia mengetahui tokonya dibobol maling dari tetangga, sekitar pukul 06:30. “Kami sulit mengambarkan bagaimana mereka masuk. Yang pasti, paginya kami mendapati pintu tuko terbuka dan dua gembok di pintu tidak ada lagi. Bisa jadi gembok itu digergaji lalu dibuang,” jelasnya. Kapolres Aceh Utara AKBP Farid, BE melalui Kapolsek Tanah Jambo Aye, Iptu Mardan P, membenarkan pencurian tersebut. Namun sejauh ini korban belum membuat pengaduan ke Mapolsek Tanah Jambo Aye.(cmus)

LDK Kota Langsa Gelar Aksi Penolakan HUT Israel LANGSA (Waspada): Gelombang penolakan terhadap rencana sekelompok masyarakat di Jakarta yang akan mengelar hari jadi negara Israel saemakin marak terjadi. Kemarin, giliran Lembaga Dakwah Kampus (LDK) se-Kota Langsa yang gelar aksi untuk menolak perayaan HUT negaraYahudi tersebut. Aksi yang mereka sebut gerakan damai untuk kermerdekaan negara Palestina itu, berlangsung di Simpang Tiga Kantor Pos dan Mesjid Raya Darul Falah, Kota Langsa. Aksi damai yang diikuti oleh puluhan aktifis LDK tersebut, diisi dengan pembagian selebaran ke masyarakat dan sebar Spanduk yang mengutuk keberadaan Israel di atas dunia, dan mengajak seluruh masyarakat Langsa khususnya dan Aceh umumnya, untuk menyuarakan kemerdekaan Palestina. Koordinator aksi, Muzakkir adz-zikr,dari LDK al-Furqan STAIN Zawiyah Cot Kala, mengungkapkan bahwa ini merupakan aksi serentak yang dilakukan hampir seluruh masyarakat di belahan dunia yang peduli untuk kemerdekaan Palestina. Dalam pernyataan sikap mereka L,DK se Kota Langsa menuntut seluruh masyarakat Aceh untuk sadar dan peduli terhadap kemerdekaan Palestina, menolak dengan keras perayaan HUT Israel di Jakarta, serta meminta pemerintahan Indonesia untuk bersikap aktif di dunia Internasional untuk kemerdekaan Palestina. (b25)

WHO WANTS TO BE GUBERNUR ACEH? Menurut anda siapakah sosok yang paling tepat sebagai Gubernur Aceh tahun 2011-2016 ........................................................................................ Nama pengirim

: ......................................................


: ......................................................


: ......................................................

Isi dengan huruf balok dengan jelas dan terang



WASPADA Senin 16 Mei 2011

Demi Benahi Kader, Anggota DPD ‘Turun Gunung’

Petani Disandera 5 OTK Bersebo Di Meulaboh MEULABOH (Waspada). M. Dahlan, 32, warga Desa Lapang Kecamatan Johan Pahlawan menjadi korban penyanderaan lima orang tak dikenal (OTK), Jumat (13/ 5) sekira pukul 18.30. Belum diketahui motif penyanderaan terhadap petani itu. Informasi yang dihimpun, penyanderaan terjadi saat korban sedang memancing di sungai sekitar dusun , di belakang Kompi C. Kepada Dahlan, ke lima pelaku menanyakan keberadaan Geuchik (kepala Desa) Lapang Zulhelmi. Diduga ke lima pelaku kesal kepada korban yang tak mau memanggil Geuchik Zulhelmi. Pelaku menyandera M Dahlan di lokasi kebun karet beberapa saat. Namun tak lama pelaku yang membawa 5 karung goni akhirnya melepas Dahlan. Dahlan melaporkan insiden yang dialami kepada Geuchik Lapang Zulhelmi. Merasa keselamatannya terancam, Zulhelmi melaporkan kasus tersebut ke piket Kompi C. Sebelum kembali ke rumahnya, korban sempat dimintai keterangan di Mapolres Aceh Barat. Sementara Kapolres Aceh Barat, AKBP Artanto S.Ik membenarkan insiden tersebut.“Laporannya sudah kita terima dan sudah kami sisir TKP namun kami belum menemukan pelaku,” kata Kapolres sambil menambahkan, korban sudah dibawa ke RSU untuk visum karena katanya sempat dipukul ke lima pelaku. Fikri, 38, warga sekitar lokasi mengatakan, kasus serupa sebelumnya juga pernah terjadi terhadap sepasang suami isteri saat melewati Dusun Cot Kandeh. “Kawasan itu memang rawan perampok,” katanya.(cak)

Polisi Ciduk Penjual Dan Pembeli Togel LHOKSUKON, Aceh Utara (Waspada): Aparat Kepolisian Sektor Lhoksukon, Jumat (13/5) malam menangkap penjual dan tiga pembeli togel, di empat tempat terpisah di Kecamatan Lhoksukon, Kabupaten Aceh Utara. Tersangka penjual AS, 41, warga Kota Lhoksukon. Sedangkan tiga tersangka pembeli yakni MN, 51, asal Desa Dayah Kecamatan Lhoksukon, TH, 26, warga Keude Lhoksukon dan JM, 32, warga Desa Dayah Kecamatan Lhoksukon. Bersama mareka diamankan barang bukti empat unit Hp yang digunakan untuk transaksi togel dan uang tunai hasil penjualan Rp107 ribu. Kapolres Aceh Utara AKBP Farid, BE melalui Kapolsek Lhoksukon Iptu M. Ridwan, S.Sos didampingi Kanit Reskrim Polsek Lhoksukon, Briptu Mas Ariadi, menjelaskan, penangkapan dilakukan nyaris serentak, melibatkan empat tim dari Mapolsek Lhoksukon. “Bandar besar belum terungkap. Tersangka mengaku tidak pernah bertemu langsung dengannya dan segala sesuatu dikomunikasikan via Hp. Kita tidak percaya begitu saja. Kita akan terus dalami kasus ini sampai identitas bandar besar terkuak,” tegas Kapolsek.(cmus)

Mayat Pria Di Krueng Tripa NAGAN RAYA(Waspada).Sesosok mayat diperkirakan berjenis kelamin pria berusia, 30, Sabtu (14/5) pagi sekira pukul 08.00 ditemukan di Desa Neubok Yee Kecamatan Tripa Makmur, Nagan Raya. Korban ditemukan M Jafar, 50, warga yang menuju kebun bersama isterinya Aisyah, 50, di Krueng Tripa dengan kondisi tertimbun ranting kayu. “Saat ditemukan posisi kaki mayat terlihat, di tumpukan ranting kayu tempat mayat ditemukan,” kata Kapolres Nagan Raya, AKBP Heri Heriandi mengutip keterangan kedua warga Seunebok, Sabtu (14/5). Heri Heriandi mengatakan belum mengetahui sebabsebab kematiannya. Juga tidak terdapat identitas korban. Usai ditemukan jelanazahnya dibawa ke rumah sakit umum daerah Nagan Raya untuk dioutopsi. Kasus tersebut dalam penanganan Polres Nagan Raya.(cak)

Berkas Anak Bunuh Ayah Ke Kejari BIREUEN (Waspada): Polsek Samalanga, Bireuen kembali menyerahkan berkas kasus anak membunuh ayah tiri yang terjadi di Desa Cot Trieng, Kec. Simpang Mamplam, Sabtu (12/3), kepada Kajari, Jumat (13/5). “Kita telah menyerahkan kembali tersangka Nas, 25, yang mebunuh ayah tirinya Jailani Nurdin, 45, karena diduga melarikan adik kandungnya. Sebelumnya berkas pernah kita ajukan, namun ada kekurangannya, lalu kita perbaiki lagi,” kata Kapolres Bireuen AKBP HR Dadik Junaedi, SH melalui Kapolsek Samalanga, Iptu Syamsul, SH, Jumat (13/5). Nas, warga Desa Cot Trieng, Simpang Mamplam, Bireuen membunuh ayah tirinya Jailani bin Nurdin,45, karena kesal yang mendunga telah membawa lari adik kandungnya yang sedang mondok di dayah. Saat hendak ke kebun di sebuah lau dia melihat ayahnya berada di warung. Setelah sempat bekelahi Nas mengampak ayah tirinya hingga tewas, dan menyerahkan diri ke Mapolsek Samalanga.(amh)

Tanggul Pemecah Ombak Rusak SABANG (Waspada): Warga Gampong Beurawang, Kec. Sukajaya Sabang minta Pemko Sabang membangun kembali tanggul pemecah ombak yang rusak di sejumlah kawasan pinggir pantai gampong tersebut. Rusak dan pecahnya tanggul-tanggul tersebut terjadi pasca diterjang gelombang tsunami 26 Desember 2004, menimbulkan abrasi pengikisan pada bibir pantai. Abrasi meluas dan tinggal hitungan beberapa meter dari batas jalan lingkar. Warga merasa kwatir, kerusakan akan semakin parah terjadi pada musim-musim tertentu, terutama pada musim angin terjadi hempasan ombak yang kerap terlihat menghantam bibir pantai. Karenanya, warga mengharapkan pemerintah membangun kembali tanggul-tanggul pemecah ombak sebelum terjadi kerusakan semakain parah. “Kalau musim angin, ombak laut tinggi, siapa pun yang melintas di jalan ini bisa melihat hempasan air laut sampai naik ke jalan. Jadi kalau ada pengendara yang lewat tentu akan basah,” ujar Sofyan, 45, salah seorang warga. Kita khawatir bila kerusakan semakin meluas tentu biaya perbaikan akan semakin besar, Pemko Sabang harus berfikir serius dan sesegera mungkin memperbaikinya. (b29)

Waspada / H. Rusli Ismail

MASIH banyak ditemukan Tempat Pembuangan Sampah (TPS) liar di lokasi tertentu di Kabupaten Aceh Besar. Hal ini membuktikan masih kurangnya kesadaran warga dan kurangnya kepedulian perangkat pemerintahan terhadap kebersihan lingkungan sekitar. Seorang tukang becak motor melewati tumpukan sampah yang menggunung di pinggir Jalan Rel Kereta Api melewati depan Kantor Camat Ingin Jaya (Pasar Lambaro) kawasan Meunasah Gampong (Desa-red) Bineh Blang, Pagar Air, Minggu (15/5).

Jalur Independen Keputusan Final Wagub: ‘Jangan Ada Lagi Pikiran Aneh-aneh Di Aceh’ LHOKSEUMAWE, (Waspada): Wakil Gubernur (Wagub) Aceh, H Muhammad Nazar, S.Ag menegaskan, jalur independen sudah menjadi keputusan final. Karena itu suara-suara sumbang terhadap jalur independen itu tidak ada gunanya. Sudah jadi keputusan Mahkamah Konstitusi (MK), para calon kepala daerah di Aceh, dibolehkan maju lewat jalur independen,disampinglewatjalurpartaipolitik. “Kalau sudah jadi keputusan MK, Presiden saja tidak mampu membatalkan, apalagi gubernur dan pihak-pihak lainnya. Maka, jangan ada lagi pikiran aneh-aneh di Aceh,” tandas Muhammad Nazar dalam pengarahannya pada pelantikan komisariat daerah Korp Alumni IAIN Ar-Raniry (Korda-Koniry) Provinsi Aceh, Korda Lhokseumawe dan Aceh Utara, di Aula Setdako Lhokseumawe, kemarin. Pada bagian lain dari pengarahannya Wagub Aceh mengingatkan para bakal calon (balon) atau calon kepala daerah, baik gubernur, bupati/walikota yang akan maju dalam Pemilukada di Aceh, jangan mengumbar janji yang tidak mampu dilaksanakan, misalnya akan dibangun jalan emas jembatan perak. “Rakyat Aceh sekarang ini sudah cukup cerdas untuk melihat sosok pemimpin yang patut dipercayakan ke depan. Tak mempan lagi dirayu dengan janjijanji politik dan hal-hal lain tipu daya

politik yang tak masuk akal,” katanya. “Pembangunan di Aceh, terutama pembangunan aqidah, pembangunan agama dan ilmu pengetahuan. Tanpa ketiganya Aceh tidak mungkin berubah, Aceh tidak mungkin lebih bagus dari kemarin dan hari ini. Lalu ke tiganya (aqidah, agama dan ilmu pengetahuan) tadi perlu dioperasikan, agar dia berproses dalam kehidupan sehari-hari,” ujarnya. Betapa banyak, kata dia, tiap tahun perguruan tinggi menghasilkan sarjana dan dayah/pasantren menghasilkan ulama. Tapi, kalau ilmu pengetahuan itu tidak dioperasikan, dia akan statis, artinya tidak pernah membawa perubahan di kalangan kehidupan umat manusia. Demikian pula aqidah dan agama, jika tidak dioperasikan, dia tidak akan berproses. Contoh, menurut Muhammad Nazar (Wagub Aceh). Tiang pancang pagar di Aceh sudah lapuk, sedang berbagai jenis hama masuk ke Aceh, sehingga kalau sekarang ada informasi 4000 warga Aceh sudah menukar agama, belum terhitung warga Aceh lainnya yang terpengaruh dengan berbagai ajaran sesat. Karena itu pembangunan aqidah, agama dan ilmu pengetahuan menjadi urutan terpenting ke depan. Ada yang mengatakan, pentingnya pembangunan ekonomi dan sering pula diumbar para balon kepala daerah yang akan maju dalam Pemilukada Aceh. “Me-

Kandang Ayam Dilalap Api 500 Ekor Mati Terpanggang PANTONLABU, Aceh Utara (Waspada): Sebuah kandang ayam potong berkapasitas 3.000 ekor di DusunV Desa Meunasah Panton, Kecamatan Tanah Jambo Aye, Kabupaten Aceh Utara, Minggu (15/5) dinihari ludes dilalap api. Tidak ada korban jiwa dalam peristiwa itu. Namun, selain menghanguskan semua peralatan kandang termasuk mesin pengatur suhu, 500 ekor ayam usia 5 hari dengan berat rata-rata sekitar 1,8 ons, juga mati terpanggang. Kerugian ditaksir Rp70 juta, sementara penyebab kebakaran belum jelas. Muhammad Isya, 53, pemilik kandang, yang tinggal sekitar 10 meter dari

lokasi kebakaran menjelaskan, pihaknya mengetahui kebakaran itu setelah istrinya terbangun dari tidur karena mendengar suara mencurigakan berupa letusan-letusan kecil, sekitar pukul 04:00 Wib dinihari. “Saya sempat berpikir suara itu suara truk pemasok umpan. Setelah saya intai dari lobang jendela, ternyata kandang sedang terbakar. Saya pun panik dan buruburu membangunkan bapaknya anakanak sembari berteriak kebakaran,” kata Aisyah Abbas, 50, istri Muhammad Isya, saat ditemui Waspada di lokasi kebakaran, kemarin. Selanjutnya, sela Muhammad Isya, dia segera menuju ke kandang untuk menge-

SEORANG ibu rumah tangga Nurhayati Reubi, 34 warga Desa Kareueng, Kecamatan Batee, Kabupaten Pidie, dikabarkan hilang sejak, 9 Mei. Saat ditemukan, Minggu (15/5) sudah menjadi mayat dengan kondisi membusuk di dalam semak-semak. Jasatdjanda beranak satu ini,ditemukan warga di kawasan perbukitan Desa Karueng, Batee yang di bawahnya di kelilingi areal persawahan. Saat ditemukan kondisi mayat korban sudah membusuk, dan sebagian daging pada bagian paha hilang. M.Ali, 23 warga setempat, kepada Waspada, Minggu (15/5) mengungkapkan, awalnya mayat Nurhayati Reubi

dilihat oleh tiga wanita setempat, yang memang sedang melakukan pencaharian terhadap korban. Mayat Nurhayati Reubi awalnya dilihat oleh Ny. Madani bersama dua rekannya sekira pukul 10.00. “Setelah ditemukan, lalu ketiga perempuan ini melaporkan kepada warga lain. Selanjutnya dilaporan diteruskan pada polisi,” kata M. Ali. Ny. Madani, 43 kepada Waspada, mengisahkan saat itu ia bersama dua perempuan desa sekampungnya sedang melakukan pencaharian terhadap Nurhayati Reubi yang dikabarkan sudah tujuh hari menghilang. Dalam perjalanannya mereka sempat bercerita tentang korban, dan berfirasat bahwa mereka akan me-

Berangkat (flight, tujuan, waktu)

GA 146 Jakarta/Medan


GA 147 Medan/Jakarta


Y6 537 Medan


Y6 538 Medan


JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


AK 305 Kuala Lumpur *


AK 306 Kuala Lumpur*


FY 3401 Penang **


FY3400 Penang **


Batavia Air Lion Air

Sriwijaya Air Air Asia Fire Fly

* Setiap Senin, Rabu , Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

vakuasi ayam yang masih selamat ke kan-dang sebelah. “Alhamdulillah, dari total 2.500 ekor, 2.000 diantaranya berhasil saya pindahkan. Selebihnya mati ter-panggang,” kata Muhammad Isya didampingi rekan kongsinya Syukri,50. Disinggung soal penyebab kebakaran, Muhammad Isya curiga kandangnya sengaja dibakar. Namun ia mengaku tidak punya cukup bukti dan saksi guna menguatkan kecurigaan itu.”Kalau dikatakan akibat konslet listrik, tidak mungkin. Sebab, ketika sebagian kandang mulai terbakar, lampu masih menyala. Di sisi lain, di kandang juga tidak ada sumber api lain selain listrik,”imbuhnya. (cmus)

Tujuh Hari Menghilang, Ditemukan Sudah Menjadi Mayat

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

nurut saya itu penting, tapi pada urutan ke empat setelah pembangunan aqidah, agama dan ilmu pengetahuan. Dulu, masa ayah dan nenek moyang kita ekonomi Aceh kurang bagus dan Aceh ketinggalan dalam berbagai bidang pembangunan, namun ketika itu tak pernah kedengaran orang Aceh menukar agama, serta tidak pernah kedengaran ajaran sesat masuk Aceh,” tegas Muhammad Nazar. Wagub juga mengupas secara rinci fenomena Aceh sekarang, dengan membaca data narapidana (Napi). 65 Persen napi di Aceh, terlibat kasus narkoba dan 25 persen dari akumulasi napi di luar Aceh, merupakan warga Aceh yang terlibat kasus narkoba. Ketika ekonomi Aceh sekarang baik, warga Aceh yang sudah sejahtera, kawin beberapa orang di Aceh, lalu menambah lagi di Medan. “Entah berapa orang sudah isterinya,” lanjut Muhammad Nazar yang disambut tawa hadirin. “Koniry bukan organisasi politik, tapi semacam wadah silaturrahmi para alumni IAIN Ar-Raniry Banda Aceh yang kebetulan saya ketua umumnya. Saya pesankan, kalau ada balon kepala daerah gubernur, bupati/walikota di Aceh, jangan manfaatkan Koniry. Sarana berpolitik menghadapi Pemilukada di Aceh, cukup dengan independen dan partai politik,” tegas Wagub Aceh, menjawab Waspada usai acara.(b10)

Waspada/Muhammad Riza

BEBERAPA warga Desa Kareueng,Kec.Batee,Pidie terlihat mengevakuasi jasad Nurhayati Reubi yang ditemukan warga di dalam semak-semak kawasan perbukitan desa setempat.

nemukan jasad Nurhayati Reubi. “Ternyata benar, sesampai di lokasi ini kami awalnya mencium bau tidak sedap. Lalu mencoba mendekati dan ternyata melihat sesosok mayat tergelatak ditanah dengan kondisi sudah membusuk. Lalu kami laporkan ke warga lainnya untuk diteruskan ke polisi” katanya. Menurut Ny. Madani, yang juga dibenarkan oleh beberapa warga lainnya, sebagian warga desa yang sama, pada saat itu juga sedang melakukan pencaharian ke dalam hutan dipimpin kepala desa setempat. Dan rombongan tersebut, katanya belum mengetahui kalau mayat Nurhayati Reubi sudah ditemukan di dalam semak-semak kawasan perbukitan desa. Dikisahkanya, Nurhayati Reubi semasa hidupnya dalam kondisi ganguan mental, dan almarhumah sering keluar masuk hutan pinggir desa tersebut untuk mencari pinang.Selain itu beberapa warga juga menyampaikan saat korban bepergian sempat mengeluhkan sakit perut. Kapolres Pidie melalui Kasat Reskrim AKP. Supriadi, SH kepada Waspada, Minggu (15/5) membenarkan warga sudah menemukan mayat Nurhayati Reubi yang dikabarkan sudah menghilang selama tujuh hari. Mayat korban ditemukan warga di dalam semak-semak kawasan perbukitan Desa Kareung, Kecamatan Batee. Jasad korban setelah diperiksa polisi, lalu dievakuasi oleh warga setempat ke ruma rumahnya di Desa Kareung dan telah dikebukan. “ Pihak keluarga tidak mengizinkan mayat Nurhayati divisum. Keluarga sudah ikhlas dan mengaku akan segera mengebumikan secara layak,” tandas Supriadi. Muhammad Riza

TAKENGEN (Waspada): Ir. Mursyid, anggota Dewan Perwakilan Daerah (DPD) dari Aceh akan turun “gunung”. Dia akan ikut Pemilukada calon bupati Aceh Tengah. Dengan alasan untuk membenahi kaderisasi masyarakat gayo diranah politik dan birokrasi. Dikatakan Mursyid, dia bertekad maju Pemilukada nanti untuk calon bupati Aceh Tengah, karena menurutnya kaderisasi orang Gayo baik di tingkat provinsi maupun nasional telah redup, khususnya di bidang politik dan birokrasi. “Dengan izin Allah, jika saya terpilih, pada lima tahun ke depan, saya akan berusaha membenahi kaderisasi dan regenerasi di semua lini. Ada yang di departemen, badan, komisi, angkatan darat/laut/ udara, kepolisian, sampai Anggota DPRA, MPR/DPR/DPD RI, dan lain-lain,” kata anggota DPD-RI kelahiran Takengon itu, kepada Waspada, Minggu (15/5). “Fokus saya tetap di perbaikan Sumber Daya Manusia (SDM) melalui program S-1, S-2, dan S-3 serta pendidikan secara umum,” jelas Mursyid, dan menambahkan ia akan membenahi masalah dekadensi moral yang kian parah di Takengen, ibukota Kabupaten Aceh Tengah “Dengan kenalan yang saya miliki sekarang, terutama di DPD, MPR, DPR RI dan departemen, dan pengalaman serta pembelajaran dari daerah lain di Indonesia yang pernah saya lihat, Insya Allah akan semakin mudah membenahi Aceh Tengah,” ungkapnya. (cb04/b18)

Eksekutif Diminta Evaluasi Realisasi PAD Setiap Triwulan BIREUEN (Waspada): Wakil Ketua Dewan Perwakilan Rakyat Kabupaten (DPRK) Bireuen, Syafruddin meminta pihak Eksekutif (pemerintah) untuk melakukan evaluasi terhadap realisasi Pendapatan Asli Daerah (PAD) minimal setiap triwulan. Demikian antara lain disampaikannya kepada Waspada, Minggu (15/5) via telepon selularnya. Lanjut Syafruddin, evaluasi tersebut dapat dilaksanakan antara lain dengan cara meminta dinas-dinas pengelola PAD agar membuat laporan realisasi pendapatan, serta kendala yang dihadapi dinas dalam rangka meningkatkan penerimaannya. Menurutnya, hal ini perlu dilaksanakan Eksekutif sebagai salah satu upaya meningkatkan pendapatan daerah dalam rangka menekan defisit. Dia menyebutkan, sebelumnya dewan juga telah menyampaikan hal tersebut kepada eksekutif, namun hal tersebut tidak ditindaklanjut kendati kini triwulan ke dua sudah berjalan satu bulan lebih. Berdasarkan hasil evaluasi terhadap realisasi PAD pada masingmasing dinas terkait sehingga pemerintah dapat melakukan terobosanterobosan jika realisasi pendapatan tersebut belum maksimal. “Bila perlu diberi warning kepada kepala dinas,” tegasnya. “Karenanya, untuk melakukan pengawasan terhadap realisasi PAD dan keberadaan asset daerah, dewan akan segera membentuk Panitia Khusus (Pansus). Di mana, hasil kerja Pansus tersebut akan disampaikan kepada bupati untuk ditindaklanjut,” kata Syafruddin. (cb03)

Waspada/H.AR Djuli

CAMAT Kota Juang Dahlan,SE menyerahkan piala bergilir diterima Ketua Panitia MTQ Ir Nasrullah Muhammad, MSi, MT di Mesjid Agung Sabtu (14/5) malam.

Pembukaan MTQ Bireuen Minim Pengunjung BIREUEN (Waspada) \: Karena diguyur hujan, acara pembukaan MTQ ke-30 Kabupaten Bireuen minim pengunjung. Sedianya MTQ dibuka Bupati di pentas arena MTQ, namun terpaksa dialihkan di dalam mesjid Agung Sabtu (14/5) malam. Pembukaan MTQ turut dihadiri unsur Muspida, Alim Ulama para Kadis, Badan, Kantor, Kakan Kemenag Bireuen, para Camat 17 Kecamatan serta sejumlah undangan lainnya ditandai dengan penyerahan piala bergilir dari Camat Kota Juang Dahlan,SE yang sudah dua kali berturut-turut juara umum kepada Ketua panitia MTQ Ir Nasrullah Muhammad MSi, MT. Bupati Bireuen Nurdin Abdul Rahman juga melantik para Dewan Hakim dari tujuh Cabang MTQ yang diperlombakan. Dalam sambutannya antara lain Bupati mengatakan, mengikuti MTQ bukan hanya untuk meraih juara yang lebih penting adalah mengamalkan isi kandungan AL Qur’an sebagai pedoman hidup bagi umat manusia di dunia dan akhirat kelak. Ketua panitia MTQ Kabupten Bireuen Ir Nasrullah Muhammad M Si menyampaikan penghargaan dan terima kasih kepada semua pihak yang telah memberikan partisipasi bantuan moril dan material sehingga penyelengaraan MTQ ke-30 Kabupaten Bireuen sudah terlaksana sesuai harapan. Teristimewa kepada masyarakat Kecamatan Kota Juang yang berkenan menampung pemodokan 401 peserta kafilah dari 17 kecamatan selama mengikuti MTQ 14-21 Mei di Kecamatan Kota Juang yang mendapat kepercayaan sebagai tuan rumah. Cabang MTQ yang diperlombakan diikuti putera-puteri golongan kanak, remaja dan dewasa, yaitu Cabang Tilawah, Hifzil Qur/an, Fahmil Qur’an, Syarhil Qur’an, Khattil Qur’an, Tafsir Qur’an dan Mushabaqah menulis kandungan Al Qur’an (M2KQ). (b16/amh)

Gajah Putih Tertantang Bantu Open Source Software TAKENGEN (Waspada):Pihak rektorat Universitas Gajah Putih (UGP) Aceh Tengah tertantang membantu mengembangkan teknologi informasi berbasis Open Source Software (OSS) di daerah atau kabupaten manapun yang membutuhkannya. Hal tersebu dikatakan Ir. Syukur Kobath, Rektor Universitas Gajah Putih, Minggu (15/5) kepada Waspada. Dia mengatakan siap membantu apabila dibutuhkan untuk mengimplementasikan Open Source Software di seluruh wilayah Indonesia bahkan negara-negara Asean yang membutuhkannya. “Kesiapan ini berdasarkan fakta bahwa UGP khususnya Fakultas Teknik Informatika (FTI) bersama dengan yayasan Air Putih telah melakukanImplementasiOpenSourceSoftware diKab.AcehTengahuntukseluruh kantor pemerintahan mulai tingkat kabupaten sampai tingkat desa. Dijelaskannya, sejak tahun tahun 2010, FTI-UGP telah melakukan implementasi open source di berbagai sekolah di Kabupaten Aceh Tengah, seperti Madrasyah Tsanawiyah 1 dan 2 Takengen. Dan implementasi yang dilakukan bukan hanya menggunakan open source di laboratorium komputer saja tapi sampai pelatihan para dewan guru. Dirincikannya juga, pada tahun 2011 FTI-UGP bekerja sama dengan Yayasan AirPutih melakukan implementasi di Lingkungan Pemkab Aceh Tengah dengan melatih sekitar 250 staf di seluruh SKPD termasuk 14 kantor camat. “Selain pegawai Kecamatan, tim migrasi open source FTi-UGP juga melatih sejumlah sekdes di 14 kecamatan, terutama kampung-kampung yang memiliki komputer. Disamping melatih aparatur pemerintahan dari tingkat kabupaten sampai kampung, FTi-UGP juga melatih sejumlah anggota masyarakat dari berbagai tingkatan umur. “ Pendidikan yang dianut oleh FTI-UGP yang telah menerapkan Open Source Software sejak tahun 2008. Saat ini fakultas itu memiliki sekitar 1300 orang mahasiswa dan semua mata kuliah praktikum menggunakan OSS,”pungkas Syukur Kobath. (cb04/b18)


WASPADA Senin 16 Mei 2011

B9 RRI Takengen Masuk Peringkat Pemberitaan Nasional

Pemerintah Aceh Sertifikasi Aparatur Pelayanan Publik

TEKENGEN (Waspada):Radio Republik Indonesia (RRI) Takengen, Aceh Tengah masuk dalam peringkat empat dalam rangka pengiriman berita Nasional dari 16 studio produksi yang ada di Indonesia. Hal tersebut dikatakan Kepala Cabang RRI Takengon Riswandi, ST, Rabu (11/5). “Pengiriman berita nasionalApril 2011, dari 16 studio produksi yang ada di Indonesia, RRI Takengen berada di peringkat empat, di bawah Batam, Sampang Madura, dan RRI studio produksi Nunukan Kalimantan,” sebut Kepala Cabang RRI ini dalam kata sambutannya pada acara memperingati ulang tahun pertama RRI Takengen, Aceh Tengah. Ditambahkannya, untuk komunitas RRI Aceh Tengah telah terbentuk di beberapa kecamatan kabupaten ini, yakni Ikatan Pendengar RRI. “Selain itu program unggulan radio republik ini adalah siaran kebudayaan sebagai perekat sosial dalam keragaman budaya guna memajukan kebudayaan nasional dan menumbuh kembangan budaya lokal d itengah arus budaya global,”katanya. Di akhir kata sambutannya, dikatakan, masih banyak kekurangan dan kelemahan yang harus dibenahi, mulai jangkauan siaran yang masih terbatas dengan kekuatan pemancar 150 watt belum mampu menjangkau semua daerah Aceh Tengah.”Pemkab Aceh Tengah telah memberikan bantuan, dalam waktu dekat 2.500 watt akan segera ber operasi dan saat ini masih dalam tahap pembangunan ruang pemancar, tower dan jaringan listrik,” ungkapnya. Sementara itu, Bupati Aceh Tengah Ir. H. Nasaruddin mengatakan, saat ini pemerintah daerah sedang bekerjasama dengan pihak operator seluler untuk membangun sarana komunikasi agar daerah yang belum terjangkau arus komunikasi, segera dapat terjangkau.(cb04/b18)

BANDA ACEH (Waspada): Pemerintah Aceh bersama Balai Besar Pengkajian dan Pengembangan Informatika Medan, menggelar bimbingan teknis (bimtek) budaya dokumentasi dan sertifikasi bagi aparatur pemerintah daerah Aceh. Gubernur Aceh IrwandiYusuf dalam sambutan pada pembukaan kegiatan itu mengatakan dengan bimtek diharapkan aparatur pemerintah mendapat bimbingan mengelola dokumentasi, mulai pengumpulan, pengolahan, penyajian hingga pelayanan. “Bimtek ini akan menghasilkan standar kompetensi bagi pejabat pengelola informasi dan dokumentasi pada Pemerintah Aceh,” ujar Irwandi dalam sambutan yang dibacakan Asisten I Setda Aceh, Marwan, SP, SH, Kamis (12/5) sore di Sultan Hotel, Banda Aceh. Bimtek yang dilaksanakan sejak 12-15 Mai 2011 ini, diikuti aparatur humas dari 23 kabupaten/kota serta aparatur PNS lingkup Pemerintah Aceh. Diakhir kegiatan akan dilaksanakan ujian sertifikasi pejabat pengelola informasi dan dokumentasi. “Kegiatan ini untuk menyiapkan aparatur yang bertanggungjawab dibidang pelayanan publik, yakni Pejabat Pengelola Informasi dan Dokumentasi (PPID) dan Chief Information Officer (CIO),” cetus gubernur. Pada bagian lain, Gubernur Irwandi Yusuf mengatakan dengan pengesahan UU Nomor 14 Tahun 2008 tentang Keterbukaan Publik yang masa berlakunya dimulai Mai 2010, Aceh sedang mempersiapkan pembentukan Komisi Informasi Daerah (KID) Aceh.(b04)

Aliran Sesat Subur Karena Ulama Dinomorduakan LANGKAHAN, Aceh Utara (Waspada): Aliran sesat tumbuh subur di kalangan masyarakat lantaran sebagian besar umat, termasuk kalangan pemimpin, semakin jauh dari ulama. Mareka menomorduakan ulama yang sejatinya dijadikan lentera menuju kebahagiaan dunia akhirat. Hal ini disampaikan Bupati Aceh Utara Tgk Ilyas A. Hamid saatmemberiarahansingkatdihadapanribuanundanganmaulid akbar Kec. Langkahan, di aula kantor camat, Rabu (11/5). “Orang sesat itu kan karena tidak tahu jalan dan enggan bertanya. Demikian pula dalam perkara aliran sesat. Jika umat senantiasa mendekatkan diri dengan ulama, selalu minta petunjuk ulama, tentu masalah aliran sesat tidak akan terlalu parah seperti sekarang,” katanya. Ilyas menambahkan, tidak dapat dipungkiri, ilmu agama satu-satunya media paling ampuh dalam membentengi diri dari aliran sesat. Seseorang yang membekali diri dengan ilmu agama memadai akan memiliki iman teguh, tidak mudah terpengaruh ajaran-ajaran asing yang bertentangan dengan iktikad Ahlussunnah-waljamaah. “Karena itu, mari kita introspeksi diri. Jika ada hal tentang agama yang kurang kita pahami, konsultasikan dengan ulama. Jangan malu bertanya. Di samping itu, kami juga mengimbau jajaran camat supaya menghidupkan pengajian rutin di kecamatan dan desa supaya syiar agama tetap lestari di masyarakat,” tandasnya.(cmus)

Bireuen 2014 Jadi Satu DSD BIREUEN (Waspada): Kadis Pertanian, Kehutanan dan Perternakan Bireuen, Ir. Azmi Abdullah mengungkapkan, Kab. Bireuen 2014 akan menjadi salah satu Daerah Swasembada Daging (DSD). Sebab itu upaya pencapaian dan pengembangan uasaha industri pertenakan berdaya saing meningkatkan populasi, produksi dan produktivitas ternak secara optimal. “Program swasembada daging sapi (PSDS) pertama dilakukan 2008, tapi saat ini namanya berubah menjadi swasembada daging sapi atau kerbau bersumber dana dari APBN. Dan Bireuen ditetapkan sebagai salah satu kabupaten prioritas tentang hal itu,” katanya pada pertemuan kordinasi pelaksanaan Program Swasembada Daging Sapi dan Kerbau (PSDS/ K) 2014 di dinas setempat, Rabu (11/5) dihadiri tim Provinsi, kabupaten serta tim dari 17 kecamatan di Kab. Bireuen. DikatakanAzmi,untukmendukungupayaswsembadadaging 2014, yang sangat penting itu adalah pengendalian penyakit pada sapi dan kerbau. Maka tugas utama bekerjasama dengan petugas di tingkat kebupaten dan kecamatan, sehingga dapat meningkatkan populasi dan pengendalian penyakit stategis.(amh)

Industrialisasi Produk Pertanian Antisipasi Ledakan Pengangguran LHOKSEUMAWE(Waspada):Masalahketenagakerjaanmenjadi salah satu masalah sosial ekonomi yang krusial di Aceh, termasuk di Kab. Aceh Utara. Hasil survei Badan Pusat Statistik (BPS) Aceh,padaFebruari2011jumlahpenganggurandiAcehmencapai 171.000 orang atau naik 9.000 orang diban-ding Agustus 2010. Angka pertumbuhan jumlah penduduk yang rata-rata di atas 2,3 persen per tahun atau lebih tinggi dibanding ratarata nasional sebesar 1,5 persen, dan ke depan kemungkinan terus meningkatnya jumlah pengangguran di Aceh sangat tinggi, kata Direktur Eksekutif LSM Bina Rakyat Sejahtera (Bytra), Saifuddin Irhas kepada Waspada, Selasa (10/5). Di sisi lain, sektor pertanian masih menjadi sektor andalan penyerapan tenaga kerja di Aceh, dari sekitar 1,9 juta tenaga kerja yang berkerja di Aceh, 60 persen bekerja di sektor perta-nian. Ini secara segmentasi tak cocok dengan lulusan peguruan tinggi. Menghadapi ledakan pengangguran tersebut, katanya, pemerintah perlu mempertimbangkan untuk pengembangan kawasan industri yang berbasis pada penambahan nilai produk pertanian seperti pabrik pengalengan durian, pabrik tepung coklat, pengolahan tepung pinang dan industri lainnya yang bahan baku bersumber dari produk pertanian yang telah tersedia di Aceh Utara. Beberapa tahun yang lalu, Saifuddin menyatakan, pemerintah Aceh Utara telah mencanangkan pembangunan Kawasan Industri Pasai di Kawasan Rancong. Namun, hingga saat ini belum menunjukkan tanda-tanda pengembangan yang serius. Untuk penanganan ledakan pengangguran yang terjadi saat ini kiranya dapat ditempuh dengan melanjutkan proses pembangunan Kawasan Industri Pasai (KIP), dengan pendekatan pabrikasi hasil pertanian yang memiliki basis produksi masal di Aceh Utara, tandasnya.(b12)

Pemprov Plin-plan Soal Rumah Korban Tanah Amblas Bidari LANGKAHAN, Aceh Utara (Waspada): Pemprov Aceh khususnya Dinas Bina Marga dan Cipta Karya (BMCK) dinilai plin-plan soal realisasi pembangunan 33 rumah untuk 33 KK korban tanah amblas di desa non status Bidari, Kec. Langkahan, Kab. Aceh Utara, Desember 2008. “April 2011 Muspika Langkahan mengirim utusan ke kantor BMCK Banda Aceh, menanyakan masalah rumah tersebut. Ketika itu BMCK berjanji membangun secara bertahap. Tapi dalam pertemuan kali dua, baru-baru ini, BMCK malah memberi jawaban mengambang,” kata Abdullah Husein, Koordinator Keuchik Kec. Langkahan, Rabu (11/5). Ditemui di sela kenduri maulid akbar kecamatan, di komplek kantor Camat Langkahan, kemarin, Abdullah Husein menambahkan, kondisi itu cukup mengiris hati masyarakat Langkahan, terutama korban tanah amblas. Apalagi musibah itu sudah tiga tahun berlalu dan mereka sudah tiga tahun bertahan hidup di barak sementara. “Kami heran, mengapa realisasi bantuan jalan di tempat. Padahal bantuan rumah itu dijanjikan langsung oleh Gubernur Irwandi Yusuf, ketika meninjau lokasi musibah beberapa hari pasca kejadian. Kalau begini caranya, dinas terkait bisa saja dituding menyepelekan titah gubernur,” kata Abdullah Husein. Di tempat sama, Camat Langkahan Drs. Amir Hamzah ketika dikonfirmasi membenarkan realisasi bantuan rumah di desa non status Bidari, mengambang. Camat mengaku kecewa sekaligus menyesalkan sikap BMCK Provinsi yang tidak tegas dalam memberi informasi ke masyarakat.(cmus)

Waspada/Muhammad H. Ishak

LINTASAN Medan - Banda Aceh kawasan Lueng Putu, Kab. Pidie Jaya (Pijay) Provinsi Aceh, terancam. Tidak kurang dari 50 meter bronjong (tembok penahan—red) yang dibangun beberapa tahun silam kini mulai ambruk ke sungai. Menurut warga, dalam sebulan tidak kurang dari 5 kali kendaraan roda dua/roda empat terperosok, sebab ambruknya bronjong hanya menyisakan sekira satu meter dari badan jalan negara. Foto diambil, belum lama ini.

Ditangkap Saat Pesta Ganja Dan SS TAPAKTUAN (Waspada): Aparat kepolisian Resort Aceh Selatan, menangkap lima warga sedang asyik pesta ganja dan sabu-sabu di sebuah rumah, di kawasan Desa Simpang Empat, Kecamatan Kluet Utara. Penangkapan berlangsung Jumat (13/5) malam sekira pukul 23.30 Wib. Kelima warga

berikut barang buktinya, malam itu juga diamankan di Mapolres Aceh Selatan diTapaktuan, guna pengusutan lebih lanjut. Kelima warga tersebut adalah Irwan,28, warga setempat, Izwar, 29, warga Desa Lampu’uk, Kec. Lhoknga, Aceh Besar, Muzairil,25, warga Desa Lampanah Dayah, Kec. Indra-

puri, Aceh Besar, Fajri,23, warga Desa Kueh, Kec. Lhoknga, Aceh Besar dan Nasrullah,33,warga Desa Lampaseh, Kec. Mraxa, Banda Aceh. Kapolres Aceh Selatan AKBP Bambang Safriyanto, melalui Kasat Narkoba, Ipda Indra Asrianto kepada wartawan Minggu, mengakui penangka-

pan lima warga tersebut di sebuah rumah di kawasan Desa Simpang Empat, Kec. Kluet Utara. Penangkapan tersebut, katanya, berkat pengembangan informasi masyarakat, dan beberapa aparat kemudian memergoki mereka sedang mengisap ganja dan. (b19)

Rencana Studi Banding Keucik Abdya Menuai Kecaman BLANGPIDIE (Waspada) : Rencana studi banding seluruh Keucik di Kabupaten Aceh Barat Daya (Abdya) ke Surabaya pada Juni mendatang mendapat kecaman keras dari LSM Gerakan Anti Korupsi (GeRAK) Aceh. Tencana tersebut dinilai sebagai bentuk pemborosan anggaran di saat keuangan daerah sedang mengalami defisit serta kesulitan melakukan pembiayaan pembangunan. Rencana tersebut juga dituding sebagai bentuk sensasi murahan dari Bupati Abdya saat ini menjelang suksesi Pemilukada ke depan dalam rangka mencari

simpati dengan tujuan politik. “Rencana tersebut tidak lebih sebagai bentuk mencari simpati dari penguasa saat ini menjelang suksesi Pemilukada mendatang. Kita patut menolak rencana tersebut, apalagi target kegiatannya juga tidak jelas”. “Jika misalnya ke sana hanya sekedar untuk mencari tau bagaimana pembuatan tempe atau kegiatan lainnya yang ada di sana (Surabaya, red), untuk apa harus melakukan pemborosan anggaran sedemikian rupa. Jauh lebih efesien jika kita mengundang pakar yang ahli dalam bidang tersebut ke dae-

rah, tentu anggaran akan lebih hemat, jadi rencana tersebut jelas sudah tidak logis dan hanya sekedar sensasi murahan Bupati Akmal Ibrahim,” ungkap Askhalani, Koordinator LSM GeRAK Aceh kepada Waspada Jum’at (13/5). Sementara itu, ketua Komisi-A DPRK Abdya, Reza Mulyadi terkait rencana tersebut juga menyampaikan kecamannya dengan menyebutkan bahwa rencana studi banding para keucik se-Abdya ke Surabaya sebagai bentuk pencitraan dengan tujuan politik. Apalagi dana yang dipakai untuk ren-

Waspada /Sudarmansyah

KETUA Komisi-A DPRK Abdya Reza Mulyadi (kanan) bersama ketua DPW PA Abdya Tgk.Nazier (tengah) serta pengurus DPW PA Abdya Tgk. Jakfar (kiri) dalam pernyataan sikap mereka yang berlangsung di kantor DPW PA Abdya menolak rencana studi banding seluruh keucik Abdya ke Surabaya.

cana tersebut dinilai sangat besar bahkan dengan mengorbankan dana pembangunan insfrastruktur di pedesaan yang semestinya harus lebih di prioritaskan. Dirinya meminta semua pihak harus menolak rencana tersebut karena hanya menimbulkan persoalan baru di masyarakat. Padahal menurutnya, dana Rp10 juta / desa yang akan digunakan oleh para keucik untuk rencana studi banding ke Surabaya tersebut akan jauh bermanfaat jika dapat digunakan untuk pembangunan infrastruktur di pedesaan yang saat ini memang banyak mengalami kerusakan. Kepala KPMPPKS Abdya, Sudirman,SH, yang dihubungi Waspada membantah keras terhadap tudingan adanya kepentingan politik terkait rencana studi banding para Keucik ke Surabaya tersebut. Bahkan, dirinya juga menolak jika rencana tersebut dianggap sebagai sebuah sensasi murahan yang dilakukan oleh Bupati Akmal Ibrahim dalam rangka suksesi pemilukada Abdya mendatang. Alasannya rencana studi banding ke Surabaya tersebut bukan ide Bupati Akmal Ibrahim, melainkan aspirasi para Keucik saat Musrenbang di gedung pertemuan Kec. Susoh yang dihadiri Bupati serta seluruh Camat dan Keucik se Abdya. (sdp)

Pelaku Khalwat Diperas Dan Masuk Penjara SAF, 20, benar-benar ketiban sial. Gara-gara berkhalwat, jejaka ting-ting asal Desa Matang Keutapang, Kec. Langkahan ini dirampok Orang Tak Dikenal, lalu dibogem massa dan terakhir masuk penjara. Sialnya lagi, pasangan kekasih yang tadinya mengaku janda kembang, ternyata istri orang yang sudah beranak satu. Asmara terlarang ini bermula ketika Saf yang suka iseng mengacak nomor handphone tersambung dengan nomor Hp Nur, 28, ibu satu anak warga Desa Alue Ie Mirah, Kec. Tanah Jambo Aye, Aceh Utara. Nur merupakan istri kedua CA, 65, seorang pria gaek yang sempat berstatus duda lantaran ditinggal mati istri pertama. Setelah sekitar dua bulan cuap-cuap di udara, Saf dan Nur pada Kamis (12/5) malam sepakat bertemu. Saf menjemput Nur di Desa Alue Ie Mirah, lalu mareka jalan-jalan malam dengan sepeda motor hingga ke Paya Cicem,sebuah kawasan hutan gambut sepi penduduk di Kec. Baktiya—Alue Ie Puteh, Aceh Utara. Setiba di Paya Cicem, Saf berhenti. Agar tidak mengundang curiga para pelintas, dia merebahkan sepedamotornya dekat bahu jalan lalu ditutup semak. Namun baru sebatas pemanasan, tiba-tiba tiga pria tak dikenal yang mengendarai satu sepeda motor berhenti dan turun dekat sepedamotor Saf. Sembari memperlihatkan sebilah golok, ketiga OTK tadi merampas dua Hp plus uang tunai Rp190 ribu milik Saf dan Nur. Setelah pelaku pergi, Saf serta Nur juga buru-buru pulang. “Warga memang sudah lama mengintai gerak-gerik Nur, yang memang terlihat tidak taat suami. Begitu mareka sampai di Desa Alue Ie Mirah, sekitar pukul 23:00, keduanya ditangkap lalu dimandikan air comberan. Karena emosi massa tak terkendali, bahkan sudah mulai membogem Saf dan Nur, kami kemudian mengamankan keduanya ke Mapolsek Tanah Jambo Aye,” kata Keuchik Alue Ie Mirah, Zulkifli Ali, di Mapolsek Tanah Jambo Aye, kemarin.

Sementara Saf yang ditanyai terpisah di tempat sama, mengaku siap mempertanggungjawabkan perbuatannya yang telah merusak rumah tangga orang dengan menikahi Nur. Saf tidak keberatan meski usia mereka selisih delapan tahun. “Apa mau dikata bang. Sudah terlanjur. Jika memang harus mengawini Nur, saya siap menikahi dia,” kata pemuda tanggung itu pasrah. Pengakuan senada juga disampaikan Nur. Bahkan Nur yang dikabarkan sempat berpoliandri sekitar dua bulan di Medan, pada tahun lalu, terlihat sumringah mendengar pengakuan Saf yang mau menikahinya. “Kami sebenarnya hanya gitu-gitu aja. Tidak sampai buat macam-macam. Dia (Saf-red) hanya mencumbu dan mencium saya. Itu pun baru sekali ini. Tapi kalau memang harus dinikahkan, saya siap,” imbuhnya, malu-malu. Ditanya mengapa tega mengkhianati suami, Nur secara gamblang mengaku sudah hampir enam bulan tidak harmonis dengan suami. “Saya seperti tidak dianggap. Sudah enam bulan, kami pisah ranjang, tanpa nafkah batin. Saya diperlakukan seolah hanya sebagai pembantu. Padahal, dulu saya sangat mencintai dia,” kilah Nur. Kapolres Aceh Utara AKBP Farid BE melalui Kapolsek Tanah Jambo Aye, Iptu Mardan P, mengatakan, begitu diantar warga, Saf dan Nur langsung diamankan di Mapolsek. Saf sendiri sempat dijebloskan dalam terali besi. Namun karena wewenang penyelesaian kasus itu berada ditangan Wilayatul Hisbah (WH) atau Polisi Syariat, kedua tersangka, Jumat (13/5) siang diserahkan ke WH Pos Pantonlabu. “Kita hanya sebatas mengamankan tersangka dari amuk massa. Untuk tindak lanjutnya ditangani WH. Dan sesuai informasi dari Danpos WH Pantonlabu, Tgk Amiruddin, kemungkinan besar kasus itu akan diselesaikan secara kekeluargaan,” kata Kapolsek diiyakan Danpos WH Pantonlabu, Tgk Amiruddin, disela serah terima tersangka, kemarin. -Musyawir-M Jakfar Achmad

Masyarakat Protes Pelayanan PNS DEWANTARA, Aceh Utara (Waspada): Sekitar seratus warga berkumpul di halaman kantor camat Dewantara, Aceh Utara untuk menyampaikan aspirasi kepada DPRK, Kamis (12/5). Mereka memprotes pelayanan para PNS yang tidak maksimal, padahal dana daerah yang dihabiskan untuk belanja pegawai sampai 54 persen dari Rp1,087 trilyun APBK TA-2011. Tokoh Warga Paloh Lada, Baharuddin di hadapan Sekretaris Komisi-A DPRK Aceh Utara, melaporkan minimnya pelayanan pegawai di Puskesmas Dewantara. “Pelayanan hanya mulai pukul 09.00 sampai pukul 12.00,” jelasnnya. Sehingga ketika masyarakat butuh pelayanan setelah pukul 12.00 jadi kecewa. Di sisi lain, tambah dia, dana APBK sebagian besar terserap untuk belanja pegawai. “Seharusnya dengan dana yang besar, pelayana kepada masyarakat juga harus ditingkatkan,” tambahnya kepada wakil rakyat yang ikut didampingi Muspika Dewantara, termasuk Kepala Puskesmas setempat. Kunjungan para anggota legislatif ke Wilayah Barat Aceh Utara tersebut untuk menampung aspirasi warga melalui kegiatan reses. Keluhan lainnya juga disampaikan Tgk.Ilyasmatsyah. Pimpinan balai pengajian ini, mengatakan penyaluran honor para perangkat desa sangat lamban. Bahkan honor para imam desa yang seharusnya disalurkan per triwulan, namun memasuki bulan ke lima juga belum direalisasikan. Kondisi itu diakui oleh Anwar Sanusi dari Komisi-B, sebagai akibat SDM para pegawai di sekretariat daerah setempat masih rendah. Sehingga pelayanan kepada masyarakat tidak maksimal. (b17)

Pemerintah Diminta Serius Tangani Paya Geurugoh BIREUEN (Waspada): Petani di Kemukiman Buket Rata dan Buket Antara padalaman Gandapura, Bireuen minta pemerintah supaya serius menangani Paya Geurugoh, rawa atau payau yang dapat menampung air untuk mengaliri sawah. Pasalnya, rawa seluas 200 hektar itu sampai sekarang terlantar. Menurut petani, Paya Geurugoh dapat menampung air untuk mengairi ratusan hektar sawah, di antaranya sawah di Desa Tanjoeng Raya, Cot Rambat, Tanjong Mesjid, Paya Seupat, Moen Jeureujak, Blang Kubu, Pante Sikumbong dan sejumlah hektar sawah lainnya. “Supaya potensi Paya Geureugoh bermanfaat bagi warga, pemerintah harus memikirkan membangun saluran air masuk dan saluran pembuang untuk mengairi ratusan hektar sawah yang selama ini hanya berharap pada air hujan,” kata Nasruddin, warga kepada Waspada, Selasa (10/5). Menurutnya, seandainya Paya Geureugoh ditangani dengan baik hampir bisa dikatakan, di Kec. Gandapura bisa mencapai surplus beras dalam upaya meningkatkan ketahanan pangan. Namun, sampai sekarang Paya Geurugoh belum dimanfaatkan. (amh)

Pemkab Bireuen Minta Investor Pacu Pembangunan PKS BIREUEN (Waspada): Pemerintah Kab. Bireuen melalui Badan Perencanaan Pembangunan Daerah (Bappeda) minta investor yang membangun Pabrik Kelapa Sawit (PKS) di Gandapura, memacu pekerjaannya agar segera rampung sebagaimana direncanakan, Agustus mendatang. “Kalau PKS itu cepat rampung ekonomi masyarakat juga akan berkembang,” kata Kepala Bappeda Bireuen, Razuardi Ibrahim kepada wartawan disela-sela meninjau pembangunan PKS Gandapura, Selasa (10/5). Menurut Razuardi, dengan dibangunnya PKS itu diharap dapat menghasilkan penambahan Pendapatan Asli Daerah (PAD) Bireuen dan pendapatan masyarakat khususnya di Kec. Gandapura dan sekitarnya. Selain itu, hasil pantauan dan laporan yang diterima Razuardi dari investor yang membangun pabrik termegah tersebut, PKS yang dibangun di atas lahan seluas lebih kurang 30 hektar itu saat ini telah menampung ratusan pekerja lokal, kecuali tehnisi yang didatangkan dari luar daerah. “Berdasarkan pantauan kami di lokasi, para pekerja cukup bersemangat, seperti pembangunan tanki-tanki minyak kepala sawit, instalasi dan lainnya cukup meyakinkan kita kalau PKS itu dapat beroperasi tahun ini. Selain itu rumah karyawan di komplek itu juga mulai rampung dikerjakan. Kita harap investor lebih memacu pekerjaannya lagi,” harapnya. (amh)

Tunggakan PLN Idi Rp5 M IDI, Aceh Timur (Waspada): Meski terus dilakukan berbagai gebrakan dalam menurunkan angka tunggakan beberapa tahun terakhir, tetapi tunggakan listrik pelanggan di PLN Ranting Idi masih mencapai Rp5 miliar. Angka Rp5 miliar dinilai sudah turun dari angka Rp9 miliar lebih di tahun 2009. “Tiap tahun angka tunggakan terus menurun, dan dalam dua tahun terakhir dari angka Rp9 miliar tersisa Rp5 miliar lagi,” sebut Manager PLN Ranting Idi, Ridwan Salam, Kamis (12/5) di Idi. Menurut dia, pelanggan PLN dalam wilayah Ranting Idi, selama dalam pantauannya semakin hari makin sadar melunasi tunggakan, sehingga angka tunggakan turun setiap bulan, baik itu rekening pelanggan biasa atau pun rekning perkantoran baik kantor pemerintah atau swasta. “Intinya, semakin hari tunggakan rekening di Ranting Idi mulai membaik,” kata Ridwan Salam. Dia merinci, persentase penurunan tunggakan diperkirakan berkisarhingga50persendibandingtahun-tahunsebelumnya.Ridwan Salam menyebutkan, pada 2011 rata-rata pelanggan PLN punya 2 lembar rekening tunggakan, sedangkan tahun–tahun sebelumnya setiap pelanggan punya tunggakan hingga 5 lembar rekening.(cmad)


Setia Budi Vista Blok M.8 Medan. Harga Rp 7.5 jt/th (nego). 2 KT, 1 KM, 1 RT,. Fasilitas: Kolam Renang, Lap. Basket dan Play Ground. Hub. 081361455015.


Hub: 0651-22385 0645-42109

B10 1 CM 2 CM

Rp. 12.000 Rp. 24.000

WASPADA 3 CM Rp. 36.000 4 CM Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000


TOYOTA Avanza 2011 - 100% Baru

Informasi Pembaca

TOYOTA Corolla 77 BK Medan, Original, CDI Tape, AC, BR, warna hijau. Hub. 0812 632 6962


Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower

PS : Power Stearing PW : Power Window RT : Radio Tape VR : Velg Racing EW : Electric Window

BMW 318i Mewah, Hitam met Thn. 96. Velg 18 inc mulus luar dalam, sound sistem full pake TV. Hrg. 73 Jt. Nego, Hub. 0821 6811 9355

DAIHATSU Espass Thn. 1997. Real Van 1600 AC, Tape, Ban Radial. Warna biru, Harga Nego. HP. 0813 7526 9930 DAIHATSU BARU KREDIT & CASH DP 7 Jt-an..........................Pick Up DP 11 Jt-an........................Xenia DP 15 Jt-an........................Terios Hub. Chico 0813 7694 1988 / 77722561


Ready: Xenia, Terios, Gran Max MB & Pick Up. Bunga Ringan. Proses Cepat !!. Data dijemput! Hub. Edy 061-77723699 / 0819 851688 XENIA Vvti...DP mulai 12 Jt-an angsuran 3 Jtan NEW TERIOS...DP Mulai 15 Jt-an angsuran 4 Jt-an Luxio, Sirion, Pick Up & Minibus Dp Hanya 10 % Syarat mudah, Proses Cepat, Kredit s/d 5 tahun Hubungi: ROZAK * 0812 6310 9000 - 77049000


Xenia Li Angs. 2.866Jt. TS Extra Angs. 3,779Jt. Luxio Cash Bac 12 Jt, Sirion Cash Back 15 Jt. Hub. DIKA 0852 7074 7744 - (061) 7744 3877


TOYOTA Kijang Commando Long 6 Speed Th. 92. BR, VR, AC Dingin, RTP, mesin sehat, Hrg. 49 Jt Ng. Wrn. Hitam Met, Hub. 0812 6477 7088 TOYOTA Kijang Commando Long Thn. 90 Akhir 99% mulus. Luar dalam Velg Racing, jok kulit, AC, Tape, BK Panjang. Kondisi siap pakai. W. Merah metalik. HP. 0852 7562 7458 TP. HB Nego.

Gran Max Pick Up DP 9 Jt-an Angs. 3 Jt-an Xenia 10 Deluxe DP 12 Jt-an Angs. 3 Jt-an Terios TS Xtra DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 6 Jt’an Angs. 3 Jt-an Sirion Type D DP 8 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 63154132 - 061.77402067

TIMOR DOHC Injection Silver met Thn. 98. Mulus luar dalam, asli medan, Hrg. 46Jt Nego. Hub. 0821 6811 9388

DAIHATSU baru paket hemat. Xenia DP 15 Jt-an / Terios DP 24 Jt-an. Luxio DP 8 Jt-an/Pick Up DP 8 Jt-an Info Hub. 0852 9775 6889


DAIHATSU Xenia/Li tahun 2004 D i j u a l . Wa rn a s i l v e r ( P o w e r Window/Miror) BK. Harga 95Jt. Nego. HP. 0852 6294 6310 # DAIHATSU MURAH 100% BARU # Xenia.......DP 12 Jt-an.....Angs. 3 Jt-an Terios........DP 16 Jt-an.....Angs. 4 Jt-an Pick Up.....DP 8 Jt-an......Angs. 2 Jt-an Luxio.........DP 8 Jt-an.......Angs. 3 Jt-an Hub. Capella Medan. 0812 6311 0820 (Josia) # PAKET MEI MURAH #

Grand Max Pick Up DP 8 Jt-an Xenia DP 18 Jt-an Terios DP 20 Jt-an Luxio DP 6 Jt-an Ready Stock, Full Cash Back n bonus Hub: NITHA ASTRA. 0812 60 1111 98 / 061 7757 7722

ISUZU Panther Grand Royal 2.3 Th. 95. Sgt mulus, luar dalam, VR, BR, PS, PW, CL RMT, AC Dingin. Hrg. 60Jt. Nego. Hub. 061-69679753


PICANTO City Car - HEMAT DP 13.5Jt Mobil COKI - KIA HP. 0812 6378 6388 * MITSUBISHI BARU PROMO * T120PU DP 12 Jt-an Angs. 2,4 L300 PU FP DP 29Jt-an Angs. 3,7Jt. Colt Diesel DP 40 Jt-an Ans. 5,8 Data Dijemput. Hub. 0813 9799 0818


Carry PU 1.5 FD Rp. 9 Jt-an ..Angs. 2.587.000,APV Rp. 12Jt-an ...........Angs. 3.705.000,New Karimun Rp. 9 Jt-an..Angs. 3.302.000,Splash GL RP. 13 Jt-an ...Angs. 3.744.000,Swift ST DP 16 Jt-an ...Angs. 4.354.000,SX4 DP 19 Jt-an ........Angs. 5.357.000,Hub. 0812 654 0809 / 77722121


New Avanza G 2011 DP 17 Jt. ang. 4,4Jt Tersedia Juga Innova, Rush, Yaris, Fortune, dll. Full diskon, Hadiah menarik. Hub. 0813 9767 3580

TOYOTA Kijang LX Th. 2003 dijual W. Hitam. AC DB, Tape, P. Steering, VR BR, BK Mdn (1 nama), sehat, tinggal pakai. Hrg. 112Jt/Nego. Hub. 0813 7618 8118


DP 10%...Avanza, Innova, dll. Hub. Purba 0813 9736 0333 / (061) 77151516

BUTUH DANA Proses Cepat 1 Jam Cair Anggunan BPKB Mobil Thn. 95 Up Hub. 0812 6357 6669 - 0852 9634 7333 - 061.77631725

DANA EXPRESS SHM, SK Camat 1 Hari Clear 0813 6229 0001 0812 6095 5531 (Henrik) BUTUH DANA CEPAT

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633


Rp. 91.000 Rp. 104.000


Cicilan 2,4 Jt-an Timbul Silalahi / 0813 7057 0061

Avanza, Innova, TOYOTA Ready: Fortuner, Yaris, Rush, Vios, Altis Cepat. Cash / Credit BARU Proses Hub. BUDI 0821 6060 4998/ 2011 061-69699882 DICARI MOBIL OVER KREDIT Fortuner/Innova/Honda Jazz. Kontan pun OK! H. Saiful. 0812 6038 5555 / Telp/SMS

7 CM 8 CM




Isi Freon - Cuci - Perbaikan Bkr Pasang dan Spare Parts AC - KULKAS - MESIN CUCI Hub.061-7797 2065 0813 6149 7921


Service: AC, Kulkas, M. Cuci, TV, CCTV, Bngkr, Pasang. Bergaransi. Hub.061-77913537 - 0813 7553 3375 REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757- 0812 1671 84742 Siap Ketempat



WASIR/ AMBEIEN Garansi 10 Hari Sembuh Tanpa Operasi Hubungi Spesialist Wasir


9 CM Rp. 126.000 10 CM Rp. 140.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di

061-4576602. Terimakasih



Jl. Brigjend. Katamso No. 683C Medan ( ± 50m dari Simpang Pelangi) HP. 0852.9751.4253 - 0812.6050.0881





11 CM Rp. 165.000 12 CM Rp. 180.000



Jadikan Pria Jadi Idaman Para Wanita

Ciri2 Ambeyen: Disekeliling Dubur Ada Benjolan Seperti Daging Tumbuh/Jerawat, Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur Seperti Luka, Solusinya Datang dan Berobatlah ke




CALL CENTER: (021) 9862000 0878 8200 0020



Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!




Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663


Langsung Berangkat ! Tidak Perlu Ngantri ! Umroh Promo Ramadhan Full Ramadhan: 22 Juta 11 Hari : 18 Juta

Umroh Promo Reguler Mei Dan Juni 2011 11 Hari : 15 Juta 14 Hari : 17 Juta





Grand Shafa

Al - Anshor Starap

US.8.000 US.7.500 US.7.300


JL. BINJEI - KUALA KM. 13 PSR. 2 PADANG CERMIN/ SIMP. PEMANCAR - SELESAI - LANGKAT TELP. (061) 457.6116 - 0813.7630.8291 - 0813.6137.2321


1. 2. 3. 4. 5. 6. 7. 8.

Program 1 bln Aprt jarak ±1 Km Rp. 20.000.000 Program 1 bln Aprt jarak ±250m Rp. 27.000.000 Program 1 bln Hotel jarak ±250m Rp. 35.000.000 09 Hr awal Aprt jarak ±250m Rp. 16.500.000 09 Hr awal Hotel jarak ±250m Rp. 17.500.000 09 Hr Pertengahan Aprt jarak ±250m Rp. 18.500.000 09 Hr Pertengahan Hotel jarak ±250m Rp. 22.000.000 2 minggu akhir Aprt jarak ±250m Rp. 24.000.000 DAFTAR SEKARANG…!!! Hubungi: MULTAZAM TRAVEL

Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing-D Medan Telp. (061) 457.6116 – (061) 451.2319 HP. 0813.6137.2321 – 0812.6495.8456 – 0813.7017.1508



Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput



Jl. Prof. H.M. Yamin S.H No. 251 A Simpang Pahlawan Tel.(061) 4563067 Cabang I

Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar web: ffaridar aridar aridara


Cucu Asli Mak Erot Bersama

Jl. Bunga Harum (Benteng) No. 26 Suka Jadi Telp. 0761-45368 -HP. 0812 6568 700 Pekan Baru Telp. (0761) 45368 HP. 0812.656.8700 Cabang II: Komp. Perhub. Laut Jl. Baruna II/II Telp. 0765 36906 HP. 0852 6201 0594, 0812 60311 695 Dumai

Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan sampai tuntas, Insya Allah




Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll

Senin, 16 Mei 2011

BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333








Penerbangan Via Singapore Khusus bagi jema’ah dari luar kota nginap di Hotel Madani Gratis

UMROH HEMAT Rp. 14.600.000

Offic: Gedung Gelora Plaza Lt. 1 Jl. SM. Raja No. 4/18 Medan Telp. (061) 7326981, 081375031889 - 085262133488




Kami memberi bukti bukan janji, alat vital besar dan panjangditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama. Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin menceng-kram, wangi. Buktikan disini (Bergaransi) HP. 0812.8481.8889 Alamat praktek: Jl. SM. RAJA SAMPING UISU MASUK JL. SEMPURNA 300M NO. 49 MEDAN

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda


DP.18Jt - an Mulai

atau Angsuran 2 Jt-an

DP.25Jt - an Mulai

atau Angsuran 4 Jt-an

Ekonomi & Bisnis Prosedur Barang Impor Ditinjau Ulang


WASPADA Senin, 16 Mei 2011

DENPASAR (Antara): Menteri Perindustrian Mohamad S Hidayat mengatakan akan segera meninjau kembali semua prosedur barang-barang impor ke Indonesia. “Kami akan tinjau ulang prosedur itu, sebagai wujud keberpihakan pemerintah dalam upaya meningkatkan daya saing produk industri nasional,” kata Menteri Hidayat di Denpasar, Bali, Sabtu (14/5). Usai peresmian konsentrasi manajemen kewirausahaan Fakultas Ekonomi Universitas Udayana, ia menyebutkan, jika ditemukan prosedur masuk tidak sepantasnya dilakukan atau bahkan ilegal, petugas akan segera mengambil tindakan. “Pelaku yang berani cobacoba memasukkan barang tidak

sesuai dengan ketentuan, akan langsung ditindak,” ucapnya, menandaskan. Ia mengemukakan, bila ditemukan adanya barangbarang impor masuk lewat pelabuhan dan tidak memenuhi standar nasional, barang tersebut akan segera dicabut dari peredaran. Kementerian Perindustrian juga akan lebih gencar melakukan razia terhadap produkproduk impor yang legalitasnya diragukan dan bermutu rendah. “Persaingan yang `fair` harus dijalankan. Indonesia jangan hanya jadi tujuan tempat pemasaran produk-produk asing, tetapi harus pula diarahkan sebagai tempat produksi yang kompetitif,” ucapnya. Selama ini, kata dia, produkproduk industri Indonesia, baik dari segi kualitas maupun harga, selalu kalah bersaing dengan yang datang dari luar. “Produk kita selalu kalah saing. Ini antara lain karena masih terjadinya `high cost` atau

biaya tinggi pada industri dalam negeri. Selain biaya transportasi dan suku bunga yang masih tinggi, juga ditambah masih banyaknya pungutan liar,” paparnya. Dicontohkannya, untuk biaya transportasi dari wilayah barat ke Kawasan Timur Indonesia (KTI), justru lebih besar dibandingkan dengan biaya ekspor. “Di lain pihak, suku bunga kredit bank di Indonesia masih dua digit, yakni pada kisaran 1415 persen,” ujarnya. Dikatakan, berbeda dengan pesaing-pesaing Indonesia seperti China, suku bunga kredit dibebankan kepada UMKM di negeri itu pada kisaran tiga persen. Semua itu, lanjut menteri, telah menciptakan biaya tinggi pada dunia perindustrian di dalam negeri. “Agar produk Indonesia bisa bersaing, haruslah dibuat lebih murah dan efisien. Minggu depan kami berencana bertemu

dengan pimpinan Bank Indonesia, untuk mempertanyakan apakah UMKM bisa dibantu, yakni suku bunganya bisa dibuat lebih rendah,” tuturnya, menjelaskan. Menurut dia, bila suku bunga bisa diturunkan, setidaknya akan banyak dapat membantu kalangan UMKM dalam mengembangkan industri di Tanah Air. Demikian juga untuk meningkatkan daya saing industri nasional, kata Hidayat, pemerintah telah memfokuskan pada enam bidang industri, yakni industri padat karya, kecil menengah, industri barang modal, industri berbasis sumber daya alam, industri pertumbuhan tinggi, dan industri prioritas khusus. “Pemerintah tahun ini juga mengalokasikan dana Rp200 miliar untuk membantu penyediaan mesin-mesin industri bagi UMKM guna menggantikan mesin-mesin yang sudah tua,” ucapnya, menambahkan.

XL Resmikan BTS Ke-5000 M E D A N ( Wa s p a d a ) : Presiden Direktur XL-Hasnul Suhaimi mengatakan, industri selular telah berkembang demikian pesat ke pelosok tanah air, membuka pintu komunikasi dan informasi daerah terisolasi. Menurutnya, XL fokus pada layanan data melalui Mobile Data Services, Internet via perangkat selular, value added services dan lain sebagainya, ujarnya Jumat (13/5) saat meresmikan BTS XL ke-5000 di Jakabaring-Palembang juga



menandai mendukung SEA games ke 26. Disebutkannya,XL juga berkomitmen untuk mengembangkan komunitas, memberikan layanan selular yang dapat dinikmati seluruh lapisan masyarakat. Untuk mendorong tumbuhnya layanan Mobile Data Services, XL membangun infrastruktur jeringan terlengkap agar semua aplikasi dapat berjalan dengan lancar dan masyarakat dapat nyaman menggunakannya. Tarif selular saat ini sudah


Wanita (Gadis/ Janda), Mjd Prw anak, Prwt org tua, Gaji 800 Rb - 1,2 Jt/bln + Uang cuti 50 Rb/ bln Hub. “BPK RIDHO” 0852.7552.3457 (061) 7641.8383 Bebas ikatan kontrak/ terima gaji tiap bulan Jl. Periuk 73C Ayahanda - Medan




DIBUTUHKAN SEGERA BAKER (Ahli masak Roti), Satu orang laki-laki, Umur max. 40 tahun Hub. 0813.6125.5363


DIBUTUHKAN: Gadis/ Janda untuk menjaga anak di Medan, Gaji 700 Rb s/d 1,5 Jt/ bln Hub. Bapak Andi 0812.6553.5559 Medan



Dibutuhkan segera P/W min. SLTA untuk “POSISI KANTOR” (100% bukan Sales/ terbuka bagi Mahasiswa, Penghasilan Rp. 1.500.000 – Rp. 2.500.000 + Harian Hub. IBU MERY SIMBOLON/ HP. 0812.6550.4283 – IBU RAMADANI HP. 0852.9667.2733 Alamat: Jl. Brigjen. Hamid No. 8B arah Delitua (Ruko pertama lewat Jembatan Kanal), pukul 09.30-15.30 WIB NB: Bagi yang baru tamat ijazah dapat menyusul

LOWONGAN KERJA SMK Telkom Sandy Putra Medan, membutuhkan Tenaga Pengajar Guru untuk Bid. Studi sbb: 1. 2. 3. 4.


Persyaratan: a. Tamatan S1, IP min. 3,00 pada bidangnya b. D a p a t m e n g o p e r a s i k a n computer, exel, word, dll c. Pengalaman mengajar min. 2 tahun d. Memahami Server Windows dan Linux (No. 2) e. D i u t a m a k a n w a n i t a d a n menguasai beberapa tarian daerah dan alat musik (No. 4) Lamaran dapat diantar langsung atau via pos ke: SMK Telkom Sandhy Putra Jl. Letjend. Jamin Ginting Km. 11,1 No. 9C, paling lambat tgl. 20 Mei 2011

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu


Dicari cepat 2 (dua) orang GURU MENJAHIT Busana wanita, Yang berpengalaman/ Ijazah Diknas utk tugas di: “JULIANA JAYA” Glugur Kota Hub. SMS 0878.8509.5600





Bawa lamaran lengkap ke: PLAZA MEDAN FAIR LT. 4, ETC TOKO MILLIONAIRE CELLULAR (Berlaku 2 minggu)

Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

DIJUAL Perum. Umar Baki 2 Jl. Umar Baki - Binjai. Type 45/ 7x15, SHM, Rp. 135 Jt Hub. Irwan Arci 0852.6078.7555

Hub. 0812.6060.4122 Bpk. Iwan




Cpt Guru TK/ Playgroup, SMU/ D3/ S1 syarat: Kreatif, datang langsung Jl. Karyawisata No. 23A Johor Tp. 786.1690 Medan

Dicari Tk. Bubut Jl. T. Bongkar IX No. 67 Mandala, Bengkel Bubut AR-Ridho


bukan lagi menjadi isu bagi masyarakat. Semua lapisan masyarakat sudah dapat menikmati sambungan selular sesuai dengan isi kantongnya. Tarif telepon sudah sangat murah bahkan sudah Rp0 di waktu tertentu. Dukungan dari masyarakat, pemerintah daerah tentu akan sangat membantu komitmen XL pada masyarakat. XL memiliki komitmen kuat untuk mengembangkan jaringan dan kapasitas telekomunikasi, untuk memberikan layanan

1.SATPAM (SERTIFIKAT POLDA) 2.SUPIR (SIM B1, B II) U. penempatan kerja daerah Tj. Morawa, Kirim ke PT. SIL Jl. Mangaan VIII No. 20 Bantenan Ujung Mabar Telp. (061) 6871.780 e-mail:


Beberapa orang Karyawati ahli di Bidang Marketing Persyaratan: - Umur 25 - 35 thn - Surat lamaran kerja - Foto copy KTP - Foto Kopi Ijazah terakhir - Foto terbaru 3x4: 3 lembar Hubungi:

PT. HAPPY DREAM MEDAN Jl. Merdeka Lk. 20 No. 1A Pulo Brayan Hub Telp: (061) 662.2736 HP. 0812.1217.834

PT. HAPPY DREAM HELVETIA Jl. Kapten Muslim No. 18F (dpn Mesjid Al Islam) Telp. (061) 847.2755 HP. 0821.1277.2255

Pasang Iklan Mini

“WASPADA” Telp: 061 - 4576602

Sisa ± 6 Bulan lagi, 2 Tingkat Lokasi strategis, didaerah Kedai Durian Hanya 8 Jt/ nego

HP. (061) 6647.7734 / 0813.9779.1077, Maaf TP


Jl. Bilal Ujung Gg. Karya No. 4 Kav. 13, L. ±200, LB. 17x10, Surat lengkap, Rumah siap huni, Harga damai HP. 0878.8704.1423 – 0821.6133.4602


Jl. Suasa Tengah Lingk. V Gg. AlIstiqomah No. 10 Mabar Hilir Medan Deli, LT. 14x16m, LB. 6x11½, SHM, PLN (1300), 3 KT, 1 KM, 1 Gong (Gudang), Garasi 7x8m (Btk L), Hrg Rp. 300 Jt/nego TP Hub. 0811.6024.149 / 0813.6135.7495


JL. BRIGJEN. A. MANAF LUBIS (GAPERTA) JL. MESJID AR-RAHMAN LT. 7,5x15,30 – LB. 7,5x11m, Permanent, PLN, PDAM, Star Roof, Gypsum, 3 KT, 2 KM, Full keramik, SHM, 250 Jt/nego (±50m dari SMU NU) Hub. 0812.632.6962 0813.6177.9580


Jl. Jermal 3 No. 8 Ujung, Lk. VII Kel. Denai, Kec. Medan Denai, LT. 300m², LB. 150m², Harga Rp. 400 Jt/ Nego, Sertifikat Hak Milik PLN + Air PAM + Telp HP. 0821.6752.0606


Terletak di Complex Citra Wisata, LT. 490m, LB. ±500, Full furnish, SHM, 5 KT, 1 KP, 5 Kmr Mandi, Lokasi Premier, Harga 2,6 M Hub. 0852.7500.2388 Maaf tanpa perantara


Jl. Bajak V Komp. Villa Mutiara Blok B-20 LT. 96m², P. 16, L. 6 Harga 150/nego, SHM Hub. 0852.9700.1251

telekomunikasi murah. Untuk menunjang kenyamanan layanan kepada seluruh pelanggan XL di Seluruh Indonesia, XL telah membangun infrastruktur Fiber Optik yang terbentang di sepanjang Pulau Sumatera, Jawa, Bali, Lombok, Kalimantan dan Sulawesi. Disamping itu XL juga menempatkan XL Center dan DACOMM (Data Communication) tempat pelanggan bisa ’belajar’, mengakses informasi, komunikasi di lokasi strategis di kotakota besar di Sumatera .(m19)


DIJUAL CEPAT Hub. (061) 9113.0366 0821.6160.8000


1 unit Rumah Perum. Taman Setia Luhur di Jl. Budi Luhur Kav. 7, LT. 8x13m, Rmh Tipe 70, KT 3, KM 2, Dpr, RT, R. Kg, PLN, PAM, SHM, Rumah baru siap huni Peminat langsung hub. 0813.7016.0474

HP. 0821.6124.9975

DIJUAL CEPAT Rumah dan Tanah Uk. 10x25m, SK Camat, Lokasi Jl. Jala IX Lingk. IV P. Pasir Marelan Harga 250 Jt/nego Peminat hub langsung Ateng Kariadi HP. 0813.6132.1683 - 0813.6141.4569

JUAL RUMAH JL. PIMPINAN UK. 20 X 24,15M SURAT SHM, 6 KT, 2 KM HUB. 0821.6810.9757

PANYABUNGAN ( Waspada) : Setelah sempat melambung tinggi, kini harga cabai merah di sejumlah pasar tradisional di Kabupaten Mandailing Natal anjlok atau turun drastis. Ini terjadi akibat jumlah pasokan di pasaran melimpah. “Harga cabai merah mengalami penurunan drastis karena pasokan barang tidak hanya dari sentra produksi dari di daerah melainkan juga dari beberapa daerah sentra produksi daerah luar Madina, seperti Tanah Karo bahkan Sumbar,” kata Isnawati boru Nasution pedagang cabai di Pasar Kotanopan, Sabtu ( 4/5). Menurutnya, harga cabai merah longsor lebih cepat dari perkiraaan. “Kalau pada Februari-Maret 2011 lalu,harga cabai merah diberbagai pusat pasar tradisonal di Madina sempat melam-

bung tinggi mencapai Rp55.000 – Rp 60.000 per kg,tapi dalam dua pekan terakhir harga terus anjlok dan tercatat menjadi Rp8.000-Rp12.000 per kg,” ungkapnya. Turunnya harga cabai merah, kata Isnawati, juga diikuti cabai rawit kini seharga Rp13.000 – Rp14.000 per kg dari sebelumnya di atas Rp20.000 per kg. Kata dia, kini para pedagang hanya bisa pasrah, sebab penurunan harga cabai merah juga diikuti beberapa jenis komoditas pertanian lainnya seperti tomat, terong dan jenis sayur-sayuran juga mengalami penurunan yang signifikan. Ia berkenyakinan,harga cabai merah tersebut kemungkinan dalam dua bulan ke depan akan kembali mengalami kenaikan,khususnya dalam menjelang bulan puasa Ramadhan.




TRANSMISI MOBIL METIK Bermasalah: 1. Perawatan 2. Ganti Oil (System Plashing) 3. Recondisi (Overhaul) Telp. 061-77288681 HP. 0813 9770 3303 0813 9631 4465


- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954





Luas ± 7000m² Tembok keliling Jl. Garu III Alfalah Medan Amplas Hub. 0812.6358.4056 TP Harga nego



Setia Budi


ELEKTRONIK P HARGA PROMOSI !!! A Paket 4 CH + Rekam: K - 4 Bh Camera Infrared + DVR Best Seller E T 4 Chanel + HDD 500 Gb

Paket 8 CH + Rekam: - 8 Bh Camera Infrared + DVR 8 Chanel + HDD 1000 Gb NB: Tersedia Paket 4 Ch, 8 Ch Internet. Informasi Harga, Tlp. dibawah ini: M C C T V


Toko H.W

Jalan Asia No. 1C Telp. 061.7346093 - 75330002 061.7793 9314 JUAL - BELI

TV LED, LCD, Kulkas, M. Cuci, Handycam DSLR, Laptop, LCD, Projector, PS 1, 2, & 3 H. Theater, Sound System, dll. Hub. CV. MARKET. Tel. 7632 4682 - 0812 6539 3000, S. Budi Tj. Sari No. 424 B, Psr IV dkt BNI






Jl. Setia Budi

845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F Jl. Brayan Medan

8442246 WC 08126427 1725

Tumpat Sedot



Ada Garansi




Tv Lcd=975rb (CCTV=199rb) Camera Pulpen rec video=595rb LATOP 1.9Jt -Rokok electric is good for Health=275rb TvLcd 32" Tosiba@2xJt (Tv29" LG1Jt) * Mini Hom-Thr: LG=788rb Komputr P4+Lcd15"LG +Spker aktif=1,2Jt * P4 + Mon 15"=800rb Camera Dgtl baru + Bat=550rb (Jual-beli TT). 0812636-1967 Jl.rantang 20s.

acer 4738Z-P6200/1Gb/500 Rp.3.5Jt/Baru (grs nasional) Hub. 0852 7512 9878.

acer 4741 Corei-3/320Gb/1Gb/Wifi/Web cam /DVD-RW/Kotak/ Grs Bln juli 2011 Rp. 3.7 Jt* acer 4732 Dual core/1Gb/160 Rp. 2.750Kt Toshiba Portege T110-U4100/250Gb/ddr3-2gb/Wifi/Web Cam/ 11.6 incBlack Glosy/dus-Manual Rp. 3.9Jt.


Sistem RO, Rasa Alami dan Segar, Kaya Oksigen Harga Rp. 11.500/ Kotak Isi 48 Cup Siap antar di tempat Hub. SABILUNA JAYA - INI JALAN KITA TELP. 061-8455.634 / 0852.6166.9810


1.Surat Pelepasan dan Penyerahan Hak Dengan Ganti Rugi Nomor: 592.2-168/BB/X/2002 Tgl.8-10-2002 dari Camat Binjai Barat. 2. Surat Pelepasan Hak atas Tanah dengan Ganti Rugi Nomor: 2 Tgl. 26 Desember 2007. Dari Notaris Nurliana, SH. Mkn. Hilang di Jl. Brigjend Katamso Gg. Rela pada bulan Juni - Juli 2010 Yang kehilangan: ZULVIYAN, Drs. Ak. Jl. Brigjend Katamso Gg. Rela No. 9 Medan Maimon.


BPKB Mobil Daihatsu Thn. 1989. BK 1353 LF. a/n. Syarip Muda Siregar. Alamat Jl. SM. Raja WEK V Kec. PSP Selatan. No. Rangka: 953389 - No. Mesin: 929537


TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188






Jln. Sutomo No. 139C (Simp. Gandhi) Tel. 061-7343415 - 7360741 - 77982281


ADHIKA COMP COMP.. (4150371) Jl. M. IDRIS 23 (77426432)

“Keadaan seperti ini hampIr terjadi setiap tahun,bagi pedagang masalah tersebut sudah merupakan hal biasa, artinya tidak perlu dikhawatirkan,” jelasnya. Sementara pedagang sayurmayur lainnya Nurulhuda Matondang mengatakan, menurunnya harga tersebut, belum diikuti daya beli konsumen yang cenderung normal. Investasi meningkat Pertumbuhan bidang investasi di Madina terus mengalami peni-ngkatan setiap tahunnya. Pening-katan itu meliputi sektor perta-nian, perkebunan,perikanan dan pertambangan, ungkap Kabag Humas dan Protokol Pemkab Madina M Taufik Lubis, Minggu (15/5). “Pertumbuhan investasi itu terus bergerak sebagai hasil upaya promosi dan pencip-taan suasana kondusif sebagai-mana



WC 0812 60444275 WC 0813 6147 0812 AC WC 0813 7035 7291 WC JL. SETIA BUDI





BARU GARANSI FULL 1 TAHUN Speek: PIV INTEL 3.0 GHZ M. MEDIA Rp. 2.458.000 PIV INTEL DUO CORE 1.8 GHZ M. M Rp. 2.518.000 Case USB, 512MB, HD80GB PIV INTEL DUO CORE 2.2 GHZ M.M Rp. 2.558.000 DVD, RW (Black) PIV INTEL DUO CORE 2.6 GHZ M.M Rp. 2.618.000 Mont ‘17 SAMSUNG PIV INTEL DUO CORE 2.7 GHZ M.M Rp. 2.678.000 Key, Mouse, Speaker PLUS BONUS PIV INTEL CORE 2 DUO 2.9 GHZM. M Rp. 3.128.000 SEKEN GARANSI 1 BULAN PIII - 800 256 MB/10GB/CDROOM/M.M Rp. 958.000 MON 15” DIG CASE USB, PIV - 1,7 256MB/10GB/CDROOM/M.M Rp. 1.058.000 KEYBOARD, PIV - 1,8 256MB/40GB/CDROOM/M.M Rp. 1.188.000 MOUSE, PIV - 2,0 256MB/40GB/CDROOM/M.M Rp. 1.228.000 SPEAKER PIV - 2,4 256MB/40GB/CDROOM/M.M Rp. 1.288.000 BARU PIV - 2,6 256MB/40GB/CDROOM/M.M Rp. 1.328.000 PIV - 2,8 256MB/40GB/CDROOM/M.M Rp. 1.328.000 MONT 15” 17” FLAT PUTIH/HITAM MULUS (DELL, LG, SAMSUNG) MURAH....


TANAH Dijual L. (14,9m) x P (54m), di Psr. VII Tembung, SK Camat, Jl. Bengkel (±100m dari sekolah Budi Rahayu), Khusus Muslim, TP Hub. 732.2763

Pinggir jalan lintas Sumatera, Luas ±2,1 Ha, Tembok keliling perdus, Serdang Bedagai Hub. 0812.6358.4056, TP Harga nego


Dua orang nelayan membawa daun nipah usai mengambil di sekitar sungai di Kel. Paya Pasir Kec. Medan Marelan, Sumut, Sabtu (14/5). Di daerah pesisir, nelayan memanfaatkan daun pinang sebagai bahan obatobatan tradisional dan bahan pembuat atap rumah.

Harga Cabai Merah Di Madina Anjlok

1 (satu) unit Rumah 2 Tingkat, Surat Rumah Hak Milik Di Jl. Bajak Lima Perumahan Villa Mutiara Blok F7


Per manen, Uk. 14x15m, LT. keramik, Kmr 3, Rp. 250 Jt/nego alamat Jl. Ampera Gg. Melati No. 37B Mandala By Pass Medan


SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Anda Butuh Perabot Jepara Asli?




MENJUAL PECI TEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan




PHOTO COPY Foto Copy Sharp Sp. 8300. Harga 3 Jt. HP. 0813 7526 9930




MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243



Jl. Karya No.68 Sei Agul Medan Telp. 061-663 9308, 7700 9000 HP. 0813 70900 400, 0852 6144 8000 0816 301 761



diinginkan kalangan investor serta penyediaan berbagai fasilitas pendukung lainnya,” katanya. Taufik mencontohkan, investasi di bidang perkebunan, telah beroperasi sejumlah perusahaan besar bergerak di sektor perkebunan kelapa sawit, seperti PTPN 4, PT Sago Nauli, PT Gruti Lestari Pratama, PT Rizki Mandiri Pratama, PT Anugrah Langkat Makmur, PT. MAL, PT.DAL, PTPSU, RMM, Palmaris Raya, PT Rendi Pratama dan PT Teluk Nauli. “Dengan kehadiran perusahaan perkebunan tersebut, tentunya sangat membantu perekonomian warga karena lapangan kerja terbuka. Kita masih ingat,saat Madina dipisahkan dari kabupaten induk Tapsel,belum ada satupun pabrik kelapa sawit (PKS), namun saat ini sudah ada berdirti 4 PKS,” ujarnya. (a28)



Ekonomi & Bisnis


Inspirasi Bisnis

Pengamat & Praktisi Manajemen

Cahyo Pramono

Penjualan VS Penagihan ATAS nama efisiensi, acapkali tugas penagihan dirangkap oleh salesman yang menerima order dan bernegosiasi dengan klien. Memang efisien, tak perlu dua orang untuk urusan itu, tetapi jelas pekerjaan rangkap itu penuh dengan potensi penyelewengan. Bukan sedikit kasus kerugian besar dialami pengusaha ketika dana pembayaran pelanggan dilarikan salesman. Ada yang lari tak pernah kembali, ada yang berdamai dan banyak yang berakhir di kantor polisi. Modus penggelapan yang dilakukan penuh variasi, dari upaya tidak menyetorkan pembayaran, mengutak-atik bukti pembayaran, mengolah kertas order hingga membuat pembayaran palsu. Bahkan ada yang sangat berbahaya ketika salesman bekerjasama dengan pihak pelanggan dalam melakukan tindak kejahatannya. Menjerumuskan Pada dasarnya, memberikan tugas ganda yang seharusnya dipisah adalah tindakan nekat yang sangat berbahaya. Atas nama kepercayaan dan segala bentuk penghematan, akhirnya salesman juga bertugas sebagai juru tagih. Jika benar-benar diperhatikan, jikalah terjadi penyelewengan, sebenarnya tidak 100 persen merupakan kesalahan salesman. Karena, pada dasarnya hal ini seharusnya sudah disadari oleh pihak pimpinan atau si pengusaha itu sendiri. Memberikan tugas penagihan kepada salesman sebenarnya seperti memberikan pisau kepada anak kecil. Pemberian pisau tersebut memang dipesankan untuk digunakan sebagai alat untuk kebaikan, tetapi pada saat yang sama, pisau tersebut juga bisa menjadi alat yang berbahaya dan mematikan. Artinya, memberikan tugas penagihan kepada salesman sebenarnya adalah sebuah langkah yang cenderung saya katakan sebagai penjerumusan. Karena pada dasarnya tidak ada manusia yang bisa selalu sadar dan termotivasi. Kadang-kadang sangat manusiawi jika manusia bertindak lalai, iseng atau memang berniat jahat. Semua kejahatan adalah bertemunya kesempatan dan niat. Kemudian, memberikan tugas penagihan kepada salesman adalah sebuah opsi yang saya bilang sebagai memberi kesempatan. Kesempatan ini hanya diawasi karakter dan sikap baik si salesman. Bayangkan jika iman dan karakternya mudah tergoyah, lalu dia mendadak membutuhkan sejumlah dana yang sangat mendesak. Tentu selanjutnya niatnya akan tergoda dan setan adalah kawan yang sangat senang dengan kondisi tersebut. Sebutlah mendadak ayah kandung atau anak kandung si salesmen dirawat di unit gawat darurat di sebuah rumah sakit, tapi si salesman tidak memiliki uang. Tentu saja uang ditangan yang merupakan pembayaran dari pelanggan bisa saja beralih fungsi. Si salesman berusaha untuk menenangkan diri bahwa ini hanya sementara dan akan diganti, tetapi jika nasib berkata lain, tentu ini adalah awal mula terjadinya bencana. Celah Saya melihat ada beberapa potensi penggelapan terjadi karena ada masa antara pembayaran oleh pelanggan hingga diterima oleh kasir perusahaan. Selain itu, fungsi pengawasan yang lemah serta lambat dan tidak ada konsep yang jelas dan tegas untuk mengantisipasi terjadinya celah tersebut. Apalagi jika salesman diberikan wewenang untuk menentukan nilai jual sesuai negosiasi dengan pelanggan. Salesman itu diberikan rentang harga jual yang berpotensi terjadinya

pengolahan diskon untuk dirinya sendiri. Lebih berbahaya lagi jika salesman diberi wewenang untuk menandatangani bukti pembayaran dan transaksi. Para penganut filosofi Machiavelli semakin yakin bahwa sebenarnya manusia pada dasarnya memiliki jiwa serakah, tak tahu diri, tak tahu berterimakasih, tak bisa dipercaya, culas dan selalu berusaha menguntungkan diri sendiri diatas penderitaan orang lain. Saya tidak tahu, apakah anda termasuk salah satunya, karena pernah mengalami penghianatan-penghianatan oleh salesman yang anda percaya. Pada sisi lainnya, salesman memiliki karakter yang pada dasarnya sangat berbeda dengan karakter penagih. Salesman selayaknya dinamis dan fleksibel sementara juru tagih selayaknya kosisten, kaku sesuai aturan dan tidak tawar menawar. Jelas sebuah posisi yang berbeda jauh. Bayangkan kalau salesman yang harusnya mengambil hati pembeli dan bergaya fleksible diharuskan untuk menagih. Antisipasi Yang pertama saya sarankan adalah pisahkan fungsi penjualan dan penagihan.Yang kedua, pastikan ada sistem akuntansi yang memastikan tanda terima dikerjakan oleh orang lain dan ada fungsi-fungsi pengawasan transaksi termasuk piutangnya. Yang ketiga, upayakan semaksimal mungkin si penagih tidak menerima uang secara tunai. Kembangkan konsep transaksi non tunai seperti transwer bank, kartu kredit dan lain sebagainya. Yang keempat, jika terjadi pembayaran via salesman yang berbentuk kertas giro atau check, pastikan tertulis didalamnya nama perusahaan penerima yang sesuai dengan rekening perusahaan di bank, sehingga kertas giro/check tersebut tidak bisa digunakan selain oleh pemilik rekening yang dituju dan tertulis di kertas tersebut. Yang kelima, bisa saja karena alasan jarak, salesman yang menerima pembayaran menerima uang cash dan bermalam dikota yang jauh, pastikan mereka dibekali kesempatan untuk segera menyetorkan berapapun uang yang diterimanya melalui bank yang ada di kota tempat ia berada. Yang menarik adalah bahwa makin hari jumlah bank semakin banyak dan merata. Untuk wilayah yang tidak tersedia bank, kini bisa menggunakan jasa seperti yang dilakukan kantor POS. Mereka sudah seperti bank dengan penyebaran yang rata di semua pelosok tanah air. Menjaga kepercayaan Ada seni yang harus diterapkan untuk menjaga seseorang tetap bisa dipercaya dan selalu terjaga loyalitasnya. Intinya adalah seni memperlakukan manusia dengan manusiawi sesuai keadaan dan kondisi orang yang dituju. Tentu, langkah pertama yang benar adalah memastikan orang yang dituju mendapatkan hak hidupnya yang layak. Harus ada pola penggajian yang adil dan nyaman dihati pengusaha dan si pekerja. Yang pasti komunkasi untuk menjaga motivasi tersebut jangan pernah terputus. Diperlukan motivasi yang sering, berkelanjutan dan mengutamakan kualitas hubungan antara pengusaha dengan pegawai adalah salah satu pagar yang memastikan pekerja selalu teringat akan peran dan tanggungjawabnya masing-masing. Pastikan semua orang tahu dan faham bahwa setiap tindakan baik akan mendapat ganjaran yang baik dan yang berbuat salah mendapat hukumannya. Sesekali perlu dimunculkan hukuman yang diberikan kepada mereka yang melenceng. Jadikan contoh! Konsultasi & Pelatihan;

LPS Sepakati Suku Bunga 7,25 Persen


DIRUT PT Sidomuncul Irwan Hidayat (tengah) saat menandatangani draft MoU antara perusahaan tersebut dengan pemerintah daerah setempat.

Sidomuncul MoU Dengan Pemda J A K A RTA ( Wa s p a d a ) : Pengembangan tanaman obat klaster biofarmaka PT SidoMuncul dipimpin Dirut PT SidoMuncul Irwan Hidayat bekerjasama dengan Pemda Kabupaten Semarang, bertujuan untuk membangun komitmen guna memanfaatkan potensi yang ada di Kabupaten Semarang. Penandatanganan kesepakatan kerjasama (MoU) dilaksanakan di Bank Indonesia Semarang akhir pekan lalu untuk pengembangan ekonomi Jawa Tengan antara Gubernur Jawa Tengah dan Deputi Gubernur Bank Indonesia dan melibatkan beberapa pihak terkait. Diantaranya Dinas Perindustrian dan Perdagangan Provinsi Jawa Tengah, Kantor Wilayah Badan Pertanahan Nasional Propinsi Jawa Tengah, Kabupaten Semarang Jawa Tengah, PT SidoMuncul, Bank Rakyat Indonesia dan Bank Pembangunan Daerah Jawa Tengah. Salah satu implementasi dari MoU tersebut adalah penandatanganan kerjasama pengembangan klaster tanaman obat di Kabupaten Semarang. Direktur Utama PT SidoMuncul Irwan Hidayat menjelaskan kerjasama klaster biofarmaka yang difasilitasi Bank Indonesia untuk menggerakkan sektor riil merupakan kerjasama melibat-

kan beberapa pihak untuk saling mendukung agar terwujud satu tujuan. “Yaitu memajukan perekonomian dalam pengembangan Usaha Mikro, Kecil dan Menengah (UMKM) di Jawa Tengah.” Nota kesepakatan berdurasi tiga tahun yaitu 2011 sd 2013, untuk selanjutnya diharapkan klaster biofarmaka ini bisa mandiri dan bisa melakukan kerjasama dengan PT SidoMuncul selamanya. Direktur Utama PT. SidoMuncul menambahkan bagi mereka pengembangan kerjasama klaster ini penting dilakukan karena untuk menjamin kualitas, kuantitas dan kontinuitas pasokan tanaman obat ke PT SidoMuncul. Disisi lain untuk meningkatkan produktifitas, kualitas, daya saing komoditas biofarmaka di Semarang dan untuk memenuhi kebutuhan industri jamu secara nasional maupun internasional. Pada pendeklarasian kerjasama klaster biofarmaka di Kabupaten Semarang ini akan dicoba pada dua sentral kawasan yaitu kawasan Kecamatan Tengaran dan kawasan Kecamatan Sumowono. Adapun komoditas tanaman obat yang dikembangkan adalah kunyit, jahe dan kayu manis.(rel)

JAKARTA (Waspada): Lembaga Penjamin Simpanan (LPS) menyepakati tingkat suku bunga penjaminan simpanan nasabah di bank umum di pertahankan pada posisi 7,25 persen untuk periode 15 Mei-14 September 2011. Pertimbangan Dewan LPS mempertahankan posisi simpanan ini, mengikuti kondisi BI Rate bertahan di 6,75 persen dan kondisi makro relatif stabil. “Posisi tersebut sama dengan bulan lalu. Hal ini didasari pertimbangan antara lain kondisi perekonomian dalam negeri relatif kuat,” kata Sekretaris LPS M. Iman Pinuji di Jakarta, akhir pekan lalu. Terlebih kondisi cadangan devisa RI yang semakin meningkat, begitu juga nilai tukar Rupiah terhadap dolar AS yang menguat, dan dipertahankannya BI Rate pada tingkat 6,75 persen. “Sedangkan untuk suku bunga penjaminan simpanan valas di bank umum tetap 2,75 persen dan suku bunga penjaminan simpanan di BPR juga bertahan di 10,25 persen,” tutur Iman. (j03)

WASPADA Senin 16 Mei 2011

Kejahatan Perbankan Gunakan Modus Pencucian Uang JAKARTA (Antara): Pakar tindak pidana pencucian uang, Yenti Garnasih, berpendapat kasus-kasus kejahatan perbankan belakangan ini sudah termasuk dalam

Yenti Garnasih

kategori kejahatan pencucian uang karena modusnya dengan menyebarkan dana yang berhasil digelapkan kepada beberapa pihak atau perusahaan lain. “Begitu uang nasabah atau uang bank keluar lalu dimanfaatkan atau dipakai pelaku atau disebar lagi ke beberapa perusahaan lain, itu sudah jelas masuk kategori praktik pencucian uang,” kata Yenti di Jakarta, Sabtu (15/5). Ia mencontohkan kasus pembobolan dana nasabah oleh Melinda Dee saat bekerja di Citibank yang dananya dibelikan mobil mewah atau apartemen, selain melanggar Undang-Undang (UU) Perbankan juga melanggar UU Tindak Pidana Pencucian uang nomor 8/2010. Contoh lain, menurut dia, adalah kasus penggelapan dana PT Elnusa dan Pemkab Batu bara, Sumatera Utara di Bank Mega, juga masuk ranah kejahatan pencucian uang karena uang hasil pembobolan dimasukkan dalam perusahaan lain. “Ketika kejahatan di perbankan dilakukan itu masuk

pidana perbankan, tetapi ketika hasil kejahatannya disalurkan itu masuk pencucian uang,” kata doktor pertama di Indonesia mengenai kejahatan pencucian uang ini. Untuk itu, Yenti menyarankan agar pihak berwajib juga menggunakan UU Pencucian Uang untuk menyelesaikan berbagai kasus perbankan belakangan ini sehingga bisa melacak larinya dana digelapkan dari perbankan. “Hasilnya akan sangat signifikan kalau yang berwajib menggunakan UU anti pencucian uang, karena penegak hukum bisa lebih cepat bergerak serta bisa mencari di mana uang yang dicuri itu berada,” katanya. Namun, Yenti menyayangkan sikap penegak hukum yang sepertinya enggan menggunakan UU anti pencucian dalam kasus-kasus perbankan sehingga menimbulkan kesan justru sengaja melindungi beberapa

pelaku dan membiarkan uang hasil kejahatan tidak ditemukan. “Sepertinya ada kesengajaan untuk tidak mau memakai UU pencucian uang karena uang tidak bisa dilacak dan pelaku tidak bisa dipidana. Dan memang inilah tujuan para penjahat menggunakan modus ini,” katanya. Dengan tidak menggunakan UU anti pencucian uang, lanjut Yenti kasus kejahatan di perbankan hanya akan diselidiki menggunakan UU pidana perbankan atau UU korupsi jika pelaku adalah pejabat negara atau pimpinan perusahaan negara, namun para penerima dana sulit diungkap atau dipidanakan. Sebelumnya, Deputi Gubernur Bank Indonesia Halim Alamsyah meminta perbankan dan lembaga keuangan lainnya mewaspadai maraknya jaringan sindikat pembobol dana yang beroperasi dengan canggih termasuk menggunakan modus pencucian uang. “Dari berbagai kasus belakangan ini, terlihat bahwa mereka adalah jaringan sindikat yang bergerak dengan sangat terencana dan dengan modus yang canggih,” kata Halim. Menurut Halim, sindikat tersebut seperti yang beraksi di Bank Mega sengaja menggunakan dana perusahaan Badan Usaha Milik Negara (BUMN) dan Pemerintah Daerah, sehingga kasus itu dapat diungkap dari sisi tindak pidana korupsi dan tindak pidana perbankan.

Padahal kasus perbankan seperti itu justru bisa diungkap dengan tuntas jika menggunakan UU anti pencucian uang yang juga bisa melacak larinya dana yang digelapkan. Dalam kasus pembobolan dana PT Elnusa Rp111 miliar di Bank Mega, dugaan praktik pencucian uang terlihat saat Kantor Cabang Bank Mega mengubah perintah penempatan dana ke deposito berjangka menjadi deposito “on call”. Dugaan pencucian uang tersebut akan semakin terlihat ketika dana itu kemudian dikirim ke dua perusahaan investasi keuangan yaitu Harvestindo dan Giro Discovery Indonesia. “Memang ada indikasi penggelapan dana kemudian disebar untuk menghilangkan jejak. Hal serupa dialami dana Pemkab Batubara,” kata Halim. Dengan meningkatnya kasus pembobolan dana oleh sindikat ini, Halim mengingatkan perbankan untuk memperketat penerapan aturan “Know Your Customer” (KYC) yang bisa mendeteksi dugaan adanya transaksi mencurigakan dilakukan oleh beberapa pihak. Halim juga meminta bank untuk melaksanakan dengan ketat. Peraturan Bank Indonesia (PBI) No.11/28/PBI/2009 tanggal 1 Juli 2009 tentang Penerapan Program Anti Pencucian Uang dan Pencegahan Pendanaan Terorisme Bagi Bank Umum yang dikeluarkan untuk memerangi praktek pencucian uang.

Menperin: Kenaikan TDL Dilematis J A K A RTA ( Wa s p a d a ) : Menteri Perindustrian, MS Hidayat mengatakan rencana pemerintah menaikkan Tarif Dasar Listrik (TDL) sebesar 15 persen tahun depan sangat dilematis. “Seharusnya tak perlu naik. Tetapi saya mengerti alasan dasar kenaikan tersebut,” kata MS Hidayat, di Denpasar, Bali, Sabtu (14/5). Terkait rencana kenaikan TDL itu, kata dia,

pemerintah meminta PLN untuk menekan biaya produksinya. “Pemerintah mengumumkan rencana kenaikan TDL sebesar 15 persen. Atas hal itu, pemerintah minta PLN menurunkan biaya produksinya,” tambahnya. Menurut dia, saat ini pemerintah berupaya mengurangi beban subsidi yang mencapat di atas Rp40 triliun.

“Kalau dilakukan penurunan subsidi, maka harus diikuti dengan penurunan atau efisiensi biaya-biaya yang tidak perlu seperti pungutan liar, pungutan tidak resmi di pelabuhan-pelabuhan dan lain sebagainya,” tam-bahnya. Sebelumnya, pemerintah beralasan kenaikan TDL ini dipicu subsidi listrik yang dinilai besar dan belum tepat sasaran. Menurut Menteri Keuangan

Agus Martowardojo, jika 2012 tidak ada program-program lain dilakukan, maka diperlukan penyesuaian TDL sebesar 10 hingga 15 persen. Hal ini sejalan d e n g a n re n c a n a j a n g k a menengah pemerintah. “Kita harus tahu subsidi listrik itu besar dan belum tepat sasaran,” kata Agus di Kementerian Keuangan, Jumat 13 Mei 2011.(vvn)

Bank Belum Serius Gandeng UKM JAKARTA (Waspada): Usaha kecil dan menengah (UKM) sebenarnya bisa jadi potensi pasar cukup besar bagi industri perbankan. Namun, berdasarkan data Perhimpunan Bank Perkreditan Rakyat Indonesia (Perbarindo), jumlah UKM sudah dibiayai bank umum baru mencapai 47,17 persen atau sekitar 24,88 juta UKM. Sementara itu, sisanya, 52,83 persen atau sekitar 27 juta lebih UKM belum tersentuh perbankan. “Kami melihat UKM itu lebih berorientasi pada lingkungan setempat atau lokal, antara lain pasar lokal dan sumber keuangan lokal,” kata Ketua Umum Perbarindo, Joko

Suyanto, ketika ditemui di Jakarta Convention Centre (JCC), Jakarta. Menurut Joko, pengusaha mikro belum tersentuh bank umum tersebut adalah peluang sangat besar. Apalagi, berdasarkan pengalaman ketika dampak krisis ekonomi melanda Indonesia dan dunia beberapa waktu lalu, UKM lebih mampu bertahan. Peluang besar di pasar UKM itu kemudian membuat Bank Perkreditan Rakyat (BPR) terus meningkatkan performanya dengan melakukan ekspansi dan pendekatan secara personal. “Perbarindo melihat adanya potensi untuk meningkatkan

aktivitas pengusaha mikro dalam hal pembiayaan guna pengembangan usaha melalui modal kerja,” tuturnya. “Selain itu, upaya tersebut untuk meningkatkan lapangan kerja di perdesaan.” Kondisi itu membuat kepercayaan masyarakat terhadap BPR meningkat, sehingga bank semakin optimistis dana terhimpun tumbuh cukup signifikan. “Peningkatan dana yang terhimpun itu juga mengindikasikan kepercayaan masyarakat semakin kuat terhadap BPR,” tutur Joko. Me s k i p u n B P R t i d a k terlepas dari sumber dana bank lain, ketergantungan tersebut cukup rendah, yakni hanya

14,06 persen dari seluruh sumber dana yang ada di BPR. Joko menambahkan, BPR yakin dapat merebut pasar UKM yang belum tergarap tersebut melalui keuntungan komparatif. Pendekatan dan pembiayaan secara personal untuk mengetahui karakter debitor serta pemantauan terhadap penggunaan dana diyakini BPR dapat merebut pasar UKM dibandingkan bank umum. Penyediaan produk yang sesuai dengan kultur masyarakat setempat, serta proses cepat dan sederhana juga menjadi keuntungan bagi BPR dalam merebut pasar UKM itu. (vvn)

Waspada, Senin 16 Mei 2011  

waspada daily

Waspada, Senin 16 Mei 2011  

waspada daily