Issuu on Google+

WASPADA Demi Kebenaran Dan Keadilan

Din Syamsuddin:

Jangan Dibesarbesarkan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

Din Syamsuddin

YOGYAKARTA (Antara): Ketua Umum Pimpinan Pusat Muhammadiyah Din Syamsuddin berharap agar seluruh masyarakat saling menghormati dan menghargai, apabila terjadi perbedaan dalam menentukan awal puasa di antara umat Islam. “Perbedaan awal puasa tersebut tidak perlu dibesar-besarkan. Puasa adalah ibadah yang dilakukan atas dasar keyakinan dari masing-masing umat,” kata Din di Yogyakarta, Minggu (15/7). Muhammadiyah sebagai salah satu organisasi massa Islam telah menetapkan awal puasa pada 20 Juli sesuai perhitungan hisab karena pada Kamis (19/7) ketinggian hilal telah mencapai 1,36 derajat. Din mengatakan, saat ketinggian hilal 0,5 derajat, maka saat itu sudah dihitung sebagai awal bulan baru. Selain menetapkan awal puasa pada Jumat (20/7), Muhammadiyah juga telah menetapkan 1 Syawal atau Lebaran pada 19 Agustus. Muhammadiyah juga berencana tidak mengikuti Sidang Isbath (penetapan) awal Ramadhan yang biasa digelar Kementerian Agama dengan alasan untuk mengurangi ketegangan dan untuk kebaikan bersama. Pemerintah, lanjut Din, sebenarnya tidak perlu menetapkan awal puasa dan 1 Syawal atau Idul Fitri, karena semuanya menyangkut keyakinan dari masingmasing umat. “Pemerintah, hanya perlu melakukan fasilitasi terkait penetapan hari libur bersama saja. Dengan demikian, pemerintah bisa mengayomi seluruh pihak,” katanya.

SENIN, Legi, 16 Juli 2012/26 Sya’ban 1433 H

No: 23927 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: 2.500,-

Pemerintah Jamin Stok Bahan Pokok Hingga Lebaran

repro arabnews

MASJIDIL Haram siap menyambut jutaan jamaah dari seluruh penjuru dunia di bulan Ramadhan 1433 H.

JAKARTA (Waspada): Menteri Koordinator Bidang Perekonomian, Hatta Rajasa mengungkapkan kenaikan harga kebutuhan pokok di pasaran masih dalam batas wajar. Sebab, setiap akan memasuki bulan puasa dan lebaran harga bahan pokok cenderung naik. Pangan yang mulia mengalami kenaikan harga adalah telur, gula dan daging sapi. Pemerintah memang membatasi kuota impor daging sapi. Namun, jika pasokan daging dari peternak dalam negeri tidak mencukupi, maka pemerintah akan membuka opsi impor. “Kalau pasokannya sampai sekarang belum kurang, tapi nanti kalau ada laporan kekurangan, ya kita impor. Jangan sampai terganggu. Tapi kalau peternak kita cukup ya tidak usah,” kata Hatta di Asrama Haji, Pondok Gede, Jakarta, Minggu (15/7). Pembatasan kuota impor dilakukan setelah kasus berhentinya ekspor daging dari Australia beberapa waktu lalu. Pemerintah meningkatkan kemampuan pasokan dalam negeri dengan cara mengurangi pasukan impor perlahan. Kendati demikian, pemerintah tetap memperbolehkan impor daging untuk kualitas tertentu. Terutama daging-daging yang diperlukan oleh restoran dan kalangan tertentu yang tidak dapat dipasok dari dalam negeri. Lanjut ke hal A2 kol. 3

Tanah Suci Siap Sambut Jamaah Ramadhan MADINAH (Waspada) : Jutaan jamaah umroh mulai bersiap memasuki Tanah Suci. Untuk itu, berbagai persiapan dilakukan di Masjidil Haram di Makkah dan Masjid Nabawi di Madinah untuk menyambut jutaan jamaah dan pengunjung selama pelaksanaan bulan puasa Ramadhan tahun ini.

Kepala Kepresidenan Umum dari Dua Masjid Suci Syeikh Abdul Rahman AlSudais mengatakan, “Rencana yang disiapkan untuk Ramadhan bertujuan untuk menjamin suatu suasana tenang dan tertib di Masjidil Haram dan

seluruh kompleksnya dan menyediakan berbagai kebutuhan yang berkualitas bagi para jamaah Umroh dan Haji mendatang.” Lebih dari 5,5 juta visa Umroh telah dikeluarkan untuk musim ini. Jumlah pe-

ngunjung dan jamaah Haji dan Umroh ke dua masjid suci selama Ramadhan diperkirakan akan jauh lebih tinggi dari yang diperkirakan. Meskipun visa tersebut telah dikeluarkan untuk seluruh musim ini, tetapi para

jamaah lebih tertarik untuk melaksanakan Umroh dan berkunjung ke Masjid Nabawi selama bulan Ramadhan. Jutaan jamaah domestik juga menanti Ramadhan untuk menunaikan Umroh dan berjiarah ke Masjid Nabawi.

Syeikh Abdul Rahman AlSudais juga mengatakan, “Pada Ramadhan tahun ini menurut rencana kedua masjid suci itu akan meningkatkan jumlah imamnya yang akan mengeluarkan fatwa bagi para jamaah dan pengunjung,

membagi-bagikan paket iftar (penganan dan makanan berbuka) di dalam masjid dan di halamannya guna mencegah siapa saja membawa makanan dan minuman dari Lanjut ke hal A2 kol. 3

Gatot: Perbanyak Sedekah Di Bulan Suci

Waspada/Amir Syarifuddin

PLT Gubsu H Gatot Pujo Nugroho memberi sambutan pada launching Gerakan Big Smail Indonesia oleh Rumah Zakat Medan di halaman TVRI Medan, Minggu (15/7).

Sumut Dan Provinsi Tetangga

Catatan Gus Irawan

SAAT bertemu dengan beberapa pimpinan media cetak di Medan baru-baru ini iseng saya bertanya. Biasanya saya yang ditanya kali ini giliran saya yang bertanya. Saya tanya, bagaimana pandangan mereka terhadap kondisi Sumatera Utara sekarang. Sebenarnya pertanyaan saya itu jujur untuk mengetahui kondisi sebenarnya. Respon yang saya terima cukup baik. Banyak masalah yang menurut mereka sebenarnya perlu diperhatikan dengan serius. Lanjut ke hal A2 kol. 2

MEDAN (Waspada):- Dalam menyambut bulan suci Ramadhan, Rumah Zakat Medan mengadakan launching gerakan Big Smile Indonesia di halaman Stasiun TVRI Medan, Minggu (15/7) pagi. Gerakan ini diharapkan dapat membangkitkan optimisme bangsa Indonesia menuju masa depan lebih baik. Peluncuran ditandai pemberian pin Big Smile Indonesia kepada Plt. Gubernur Suma-

dan perjuangan mantan Dirut PT Bank Sumut itu menciptakan Provinsi Sumut dan masyarakat yang sejahtera. Sejumlah tokoh Sumut tampak hadir dalam peresmian

tera Utara H Gatot Pujo Nugroho oleh Sadiman, Spd selaku kepala SD Juara Medan yang merupakan binaan Rumah Zakat. Gatot mengatakan, menjelang memasuki bulan penuh berkah, masyarakat seyogyanya melakukan persiapan matang. Sehingga setiap amal ibadah yang akan dilakukan s e l a m a Ra m a d h a n a k a n menghasilkan kemenangan. Tak hanya persiapan, kata Gatot, Ramadhan yang identik sebagai bulan berbagi juga harus diwarnai setiap orang yang beriman dengan memperbanyak sedekah. ”Harus memperbanyak sedekah. Sedekah termurah dan termudah adalah senyum, seperti dalam hal ini yang diluncurkan Rumah Zakat lewat gerakan Big Smile Indonesia,” kata Gatot. Dalam kesempatan itu Gatot juga mengingatkan agar masyarakat meningkatkan iman dan taqwa serta memiliki ilmu

Lanjut ke hal A2 kol. 1

Lanjut ke hal A2 kol. 1

Gus Center Dan Website Diresmikan

Ratusan Tokoh Digandeng Untuk Sumut Sejahtera MEDAN (Waspada): Bakal calon Gubernur Sumatera Utara Gus Irawan Pasaribu, menggandeng ratusan tokoh masyarakat meresmikan Gus Center di Jl. Pattimura No 342 Medan. Gus Center dijadikan salah satu wadah pemikiran

Lakalantas Di Sergai, 3 Tewas 2 Kritis SEIRAMPAH (Waspada): Peristiwa kecelakaan lalu lintas (Lakalantas) di dua lokasi berbeda di jalan lintas Tebingtinggi- Dolok Masihul mengakibatkan dua orang tewas, dua lainnya kritis. Sementara lakalantas di Jalinsum Desa Suka Damai Kec.Sei Bamban merenggut nyawa satu orang tewas di lokasi kejadian. Peristiwa lakalantas perta-

Dua Kelompok OKP Bentrok Di Sekip

Al Bayan

Menahan Marah Oleh Tgk H. Ameer Hamzah Dan orang-orang yang menahan marah dan memaafkan kesalahan orang dan Allah menyukai orang-orang yang berbuat baik. (QS. Ali Imran:134) SEORANG Muslim yang terpimpin jiwanya oleh hidayah Allah senantiasa melatih dirinya untuk mencapai tingkat kesabaran yang tinggi dan menahan amarahnya. Tidak suka menghujat dan mendendam kepada orang Lanjut ke hal A2 kol. 1

Waspada/Surya Efendi

SEJUMLAH warga memanjatkan doa dan membersihkan kuburan sanak keluarganya di pemakaman muslim Jl. Halat Medan, Minggu (15/7). Ziarah merupakan tradisi menyambut datangnya bulan Ramadhan. Warga mulai memadati kuburan sepekan menjelang 1 Ramadhan 1433 H.

Waspada/Surya Efendi

WARGA menyaksikan satu unit sepedamotor yang dibakar dalam bentrokan dua OKP di Jl. Sekip Medan, Minggu (15/7).

MEDAN (Waspada): Dua kelompok Organisasi Kemasyarakatan Pemuda (OKP) terlibat bentrok di Jl.Sekip, Kel Sei Putih Timur, Kec Medan Petisah, Medan, Minggu (15/7) siang. Peristiwa itu, selain membuat suasana mencekam, tiga orang menderita luka-luka dan satu sepeda motor dibakar. Sedangkan, arus lalulintas di kawasan tersebut macat total selama 4 jam. Informasi Waspada peroleh di lokasi kejadian, bentrokan dipicu oleh penyerangan sekelompok pemuda terhadap kelompok pemuda lainnya yang sedang melaksanakan acara pelantikan pengurus ranting dan pengurus anak ranting di Kel Sei Putih Timur, Kec Medan Petisah. Saat itu, enam Lanjut ke hal A2 kol. 6

ma terjadi di jalan lintas Tebing Tinggi- Dolok Masihul tepatnya Blok IX Perkebunan PT.Socfindo Bangun Bandar, Desa Bantan Kec.Dolok Masihul, Kab.Serdang Bedagai, Sabtu (14/7) malam. Informasi Waspada peroleh, saat itu, sepeda motor Yamaha Mio BK 3223 LF dikendarai Chairiwansyah,14, warga Lingk.VI, Kampung Sidorejo,

Ada-ada Saja 20 Tahun Makan Batu Ada-ada saja hobi wanita yang satu ini. Wanita asal Virginia, AS itu mempunyai hobi makan batu. Hobinya tersebut sudah berlangsung selama 20 tahun. Teresa Widener selama ini menganggap batu dan kerikil sebagai makanan yang membuat nyaman. Menurut laporan jaringan ABC, Widener mengidap suatu kelainan yang disebut ‘Pica’, dimana pengidapnya memiliki selera pada Lanjut ke hal A2 kol. 6

Kel.Pekan Dolok Masihul berboncengan dengan Diki,15, warga Lingk.I, Desa Pekan Dolok Masihul, keduanya warga Kec.Dolok Masihul tubrukan dengan sepeda motor Yamaha Jupiter Z dikendarai Sugianto Siahaan,19, berboncengan dengan Frisnando Simanjuntak,17, keduanya warga Desa Kampung Kristen, Kec.Bintang Bayu. Sepedamotor dikendarai Sugianto Siahaan dari arah Tebingtinggi menuju Desa Pekan Dolok Masihul dengan kecepatan tinggi, sesampainya di lokasi kejadian mengambil jalur ke kanan bermaksud mendahului sebuah truk , Lanjut ke hal A7 kol. 6

Serampang - Tidak diperbesar tapi tidak diperkecil - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Legi, 16 Juli 2012/26 Sya’ban 1433 H z zNo: 23927 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Waspada/Surya Efendi

WARGA menyaksikan satu unit sepedamotor matic yang dibakar dalam bentrokan dua OKP di Jl. Sekip Medan, Minggu (15/7).

Dua Kelompok OKP Bentrok Di Sekip MEDAN (Waspada): Dua kelompok Organisasi Kemasyarakatan ,Pemuda (OKP) terlibat bentrok di Jl.Sekip, Kel Sei Putih Timur, Kec Medan Petisah, Medan, Minggu (15/ 7) siang. Peristiwa itu, selain membuat suasana mencekam, tiga orang menderita luka-luka dan satu sepeda motor dibakar. Sedangkan, arus lalulintas di kawasan tersebut macat total selama 4 jam. Informasi Waspada peroleh di lokasi kejadian, bentrokan dipicu oleh penyerangan sekelompok pemuda terhadap kelompok pemuda lainnya yang sedang melaksanakan acara pelantikan pengurus ranting dan pengurus anak ranting di Kel Sei Putih Timur, Kec Medan Petisah. Saat itu, enam orang kader salah satu OKP asal Kec Medan Perjuangan yang mengendarai 3 sepeda motor melintas di Jl. Sekip, tiba-tiba diserang oleh puluhan pemuda berpakaian preman. Kekuatan yang tidak berimbang menyebabkan kelompok yang diserang tunggang langgang melarikan diri dari lokasi kejadian. Sepedamotor yang ditinggalkan, dalam tempo sekejap dibakar oleh penyerang. Penyerangan mendadak itu menyebabkan beberapa anggota kelompok yang diserang menderita luka bacok dan panah. Zulkifli terkena tebasan parang di tubuhnya, Karno, warga Sei Deli menderita luka tusuk anak panah di perut kiri dan mata kirinya. Seorang lagi belum diketahui identitasnya. Lanjut ke hal A2 kol.3

Waspada/Mahadi Pinem

KETUA KIP Dedi Mulyadi Selian ST, (berdiri) bersama komisioneris KIP Agara, usai penandatangan berita acara penetapan pasangan Bupati Agara terpilih priode 2012 – 2017, Minggu (15/7).

H.Hasanuddin B- H. Ali Basrah Kdh Terpilih Priode 2012 – 2017

Waspada/Surya Efendi

POLISI bersenjatan laras panjang berjaga-jaga di Jl. Sekip yang ditutup untuk menghindari bentrok lanjutan dua OKP, Minggu (15/7).

KUTACANE (WAspada) : Rapat pleno terbuka rekapitulasi hasil perhitungan suara Pilkada Bupati/ Wakil Bupati Aceh Tenggara (Agara), yang digelar KIP Agara Minggu (15/7), di gedung Kesenian Agara, menetapkan pasangan calon nomor 2, H.Hasanuddin,B, - H.Ali Basrah, sebagai pasangan Bupati/ wakil Bupati Agara terpilih periode 2012-2017. Perolehan suara keduanya 51.059 atau 47,38 persen. Rapat pleno sempat dihentikan sepekan oleh KIP Agara, sesuai surat KIP nomor 23/2012 tertanggal 5 juli 2012, dan dilanjutkan setelah kasus politik uang diproses di pengadilan Kutacane, sesuai surat Ketua KIP Agara Dedi Mulyadi Selian,ST. Lanjut ke hal A2 kol.6

5,5 Juta Visa Umroh Dikeluarkan Diskriminatif Penanganan Kasus Rumah Guru Terpencil BANDA ACEH (Waspada): Kejaksaan Tingggi Aceh diminta tidak diskriminatif dalam penanganan kasus pembangunan rumah guru terpencil di Aceh. Mestinya kontraktor pelaksana, konsultan pengawas dan Kepala Dinas

Pendidikan Aceh juga dijadikan tersangka. “Dia (Kadisdik Aceh) mestinya juga dijadikan tersangka, selain PPTK (Pejabat Pembuat Teknis Kegiatan dan KPA (Kuasa Pengguna Anggaran),” kata Koordinator Presedium Ge-

Sumut Dan Provinsi Tetangga SAAT bertemu dengan beberapa pimpinan media cetak di Medan barubaru ini iseng saya bertanya. Biasanya saya yang ditanya kali ini giliran saya yang bertanya. Saya tanya, bagaimana pandangan mereka terhadap kondisi Sumatera Utara sekarang. Sebenarnya pertanyaan saya itu jujur untuk mengetahui kondisi seCatatan benarnya. Respon yang saya terima baik. Banyak masalah yang Gus Irawan cukup menurut mereka sebenarnya perlu diperhatikan dengan serius. Kalau diakumulasi ada banyak hal yang perlu pembenahan. Mereka bilang kasus tanah Lanjut ke hal A2 kol.2

RAK Indonesia, Akhiruddin Mahjuddin Minggu (15 7) menyikapi penanganan kasus pembangunan rumah guru terpencil di Aceh. Berdasarkan PP No 58 2005 tentang pengelolaan keuangan daerah dan Permendagri No.13 2006 tentang pedoman pengelolaan daerah, sebut dia, Kepala Dinas Pendidikan Aceh selaku Pejabat Pengguna Anggaran yang paling bertanggung jawab. Sedangkan kontraktor pelaksana dan konsultan pengawas, yang sampai sekarang belum juga ditetapkan sebagai tersangka oleh penyidik Kejaksaaan dinilai ada kejanggalan dalam menangani kasus rumah guru terpencil itu. Sebab, kata Uden, pria ini akrab disapa, berdasarkan data dan fakta yang ada dan keterangan yang menyatakan keduanya melakukan manipulasi dokumen kemajuan pekerjaan, jelas telah melakukan Lanjut ke hal A2 kol.1

MADINAH (Waspada) : Juataan jamaah umroh mulai bersiap memasuki Tanah Suci. Untuk itu, berbagai persiapan dilakukan di Masjidil Haram di Makkah dan Masjid Nabawi di Madinah untuk menyambut jutaan jamaah dan pengunjung selama pelaksanaan bulan puasa Ramadhan tahun ini, yang datang hanya dalam beberapa hari lagi. Kepala Kepresidenan Umum dari Dua Masjid Suci Syeikh Abdul Rahman Al-Sudais mengatakan, “Rencana yang disiapkan untuk Ramadhan bertujuan untuk menjamin suatu suasana tenang dan tertib di

Masjidil Haram dan seluruh kompleksnya dan menyediakan berbagai kebutuhan yang berkualitas bagi para jamaah Umroh dan Haji mendatang.” Lanjut ke hal A2 kol.6

Din Syamsuddin: Jangan Dibesar-besarkan YOGYAKARTA (Antara): Ketua Umum Pimpinan Pusat Muhammadiyah Din Syamsuddin berharap agar seluruh masyarakat saling menghormati dan menghargai, apabila terjadi perbedaan dalam menentukan awal puasa di antara umat Islam. “Perbedaan awal puasa tersebut tidak perlu dibesar-besarkan. Puasa adalah ibadah yang dilakukan atas dasar keyakinan dari masing-masing umat,” kata Din di Yogyakarta, Minggu (15/7). Muhammadiyah sebagai salah satu organisasi massa Islam telah menetapkan awal puasa pada 20 Juli sesuai perhitungan hisab karena pada Kamis (19/7) ketinggian hilal telah mencapai 1,36 derajat. Din mengatakan, saat ketinggian hilal 0,5 derajat, maka saat itu sudah dihitung sebagai awal bulan baru. Lanjut ke hal A2 kol.1

Gatot: Perbanyak Sedekah Selama Ramadhan MEDAN (Waspada): Dalam menyambut bulan suci Ramadhan, Rumah Zakat Medan mengadakan launching gerakan Big Smile Indonesia di halaman Stasiun TVRI Medan, Minggu (15/7) pagi. Gerakan ini diharapkan dapat membangkitkan optimisme bangsa Indonesia menuju

masa depan lebih baik. Peluncuran ditandai pemberian pin Big Smile Indonesia kepada Plt. Gubernur Sumatera Utara H Gatot Pujo Nugroho oleh Sadiman, Spd selaku kepala SD Juara Medan yang merupakan binaan Rumah Zakat. Gatot mengatakan, menjelang memasuki bulan penuh

Waspada/Amir Syarifuddin

PLT GUBSU H Gatot Pujo Nugroho memberi sambutan pada launching Gerakan Big Smail Indonesia oleh Rumah Zakat Medan di halaman TVRI Medan, Minggu (15/7).

Sambut Ramadhan, Warga Aceh Besar Meuramien

Al Bayan

Menahan Marah

BANDA ACEH (Waspada) : Warga Gla Meunasah Baro, Kec. Krueng Barona Jaya, Aceh Besar dalam menyambut Ramadhan menggelar zikir bersama serta ‘meuramien’ di halaman meunasah (surau) setempat, Minggu (15/7). Kepala Desa Gla Mns Baro, Rasyidin menyebutkan, budaya pergi ke pantai atau ke laut menyambut Ramadhan

Oleh: H Ameer Hamzah Dan orang-orangyang menahan marah dan memaafkan kesalahan orang dan Allah menyukai orang-orang yang berbuat baik (QS. Ali Imran:134)

Lanjut ke hal A2 kol.6

SEORANG Muslim yang terpimpin jiwanya oleh hidayah Allah senantiasa melatih dirinya untuk mencapai tingkat kesabaran yang tinggi dan menahan amarahnya. Tidak suka menghujat dan mendendam kepada orang lain. Dia berpedoman kepada kata mutiara yang berasal dari lidah Nabi; orang yang perkasa bukanlah orang yang mempunyai fisik dan otot kuat, tetapi orang yang perkasa adalah ia dapat menahan diri dari amarah. Laisasy Syadid

berkah, masyarakat seyogyanya melakukan persiapan matang. Sehingga setiap amal ibadah yang akan dilakukan s e l a m a Ra m a d h a n a k a n menghasilkan kemenangan. Tak hanya persiapan, kata Gatot, Ramadhan yang identik sebagai bulan berbagi juga harus diwarnai setiap orang yang beriman dengan memperbanyak sedekah. ”Harus memperbanyak sedekah. Sedekah termurah dan termudah adalah senyum, seperti dalam hal ini yang diluncurkan Rumah Zakat lewat gerakan Big Smile Indonesia,” kata Gatot. Dalam kesempatan itu Gatot juga mengingatkan agar masyarakat meningkatkan iman dan taqwa serta memiliki ilmu pengetahuan dan teknologi. Perpaduan iman dan taqwa serta bekal ilmu pengetahuan dan teknologi akan membuat suasana Ramadhan Lanjut ke hal A2 kol.6

Ada-ada Saja

20 Tahun Makan Batu ADA-ada saja hobi wanita yang satu ini. Wanita asal Virginia, AS itu mempunyai hobi makan batu. Hobinya tersebut sudah berlangsung selama 20 tahun. Teresa Widener selama ini menganggap batu dan kerikil sebagai makanan yang membuat nyaman. Menurut laporan jaringan ABC, Widener mengidap suatu kelainan yang disebut ‘Pica’, dimana pengidapnya memiliki selera pada Lanjut ke hal A2 kol.1


Lanjut ke hal A2 kol.6

Waspada/Surya Efendi

ZIARAH JELANG RAMADHAN: Sejumlah warga memanjatkan doa dan membersihkan kuburan sanak keluarganya di pemakaman muslim Jl. Halat Medan, Minggu (15/7). Ziarah merupakan tradisi menyambut datangnya bulan suci Ramadhan.Warga mulai memadati kuburan sepekan menjelang 1 Ramadhan 1433 H.

Waspada/Munawardi Ismail

WARGA Gla Meunasah Baro, Kecamatan Krueng Barona Jaya, Aceh Besar, Minggu (15/7) mengelar acara ‘meuramien’ dan makan bersama di depan meunasah setempat.Sebelumnya mereka berzikir dan berdoa menyambut bulan puasa.

- Tidak diperbesar tapi tidak diperkecil - He.... he....he....

Berita Utama


Demo Hizbut Tahrir Sambut Ramadhan BANDAACEH(Waspada): Seratusan orang massa Hizbut Tahrir Banda Aceh melakukan aksi menyambut bulan suci Ramadhan. Aksi yang berlangsung dua jam di Bundaran Simpang Lima Banda Aceh Minggu(15/7), bertujuan menyambut Ramadhan dengan kebersihan jiwa. Hal itu untuk mencegah dampak moderenisasi yang telah mengubah pola pikir

umat Islam yang cenderung sekuler dan liberal sehingga memisahkan agama dar i kehidupan sehari-hari. “Pemikiran seperti inilah yang telah merasuk umat Islam di mana orang cenderung berbuat semau gue,” kata Pimpinan Dewan Perwakilan Daerah (DPD) II Hizbut Tahrir Indonesia (HTI) Banda Aceh, Thoriq Abu Askar, Minggu (15/7). Selain orasi, massa yang

mengawali aksi dengan berjalan kaki dari Masjid Lamprit membawa poster berisi ajakan menghor mati kehadiran bulan suci umat Islam, diikuti orang dewasa dan anak-anak. Massa meminta pemerintah menjaga stabilitas politik dan menutup tempat-tempat hiburan selama Ramadhan, agar umat Islam dapat merasakan hikmah Ramadhan. (cb06)

Satu Korban Kebakaran Meninggal Dunia SIBOLGA (Waspada) : Setelah 17 Jam mendapatkan perawatan di RSU FL Tobing Sibolga, Nenny br Simamora yang mengalami luka bakar di sekujur tubuh, meninggal dunia, Sabtu (14/7). Nenny br Simamora, salah satu korban yang rumahnya ikut terbakar bersama tiga unit rumah warga lainnya di Jl. Bawal (arah laut), Kel. Pancuran Pinang, Kec. Sibolga Sambas, Jumat (13/7) malam lalu. Saat kejadian, Rahman Nasution suami korban yang mencoba menyelamatkan istrinya juga mengalami luka bakar. Keduanya dirawat di RSU Dr FL

Tobing Sibolga. Direktur RSU FL Tobing drg Tunggul Sitanggang menyampaikan, pihak rumah sakit telah berusaha maksimal menolong korban, dengan menurunkan Dokter Spesialis Anastesi untuk menangani korban. “Kita sudah berupaya maksimal, memberikan pelayanan dan perawatan yang terbaik kepada korban,” ujar Tunggul kepada wartawan, Sabtu (14/ 7) di RSU dr FL Tobing Sibolga. Sebelumnya, Walikota Sibolga HM Syarfi Hutauruk kepada wartawan, Jumat (13/7) malam, di RSU dr FL Tobing Sibolga, saat menjenguk korban

mengatakan, turut prihatin atas musibah kebakaran tersebut. Bantuan Damkar Syarfi mengungkapkan, sejak beberapa waktu lalu, Pemko Sibolga telah mengajukan permohonan ke Pemerintah Pusat terkait pengadaan dan penambahan dua unit armada mobil pemadam kebakaran (Damkar). “Damkar yang kita ajukan, satu unit di darat dan satu unit di laut. Mudah-mudahan dikabulkan dan direalisasikan pada TA 2013,” ujar Syarfi dan menambahkan, Kota Sibolga yang memiliki kepadatan penduduk sangat rawan akan musibah kebakaran. (a24)

Dua Kelompok...

benda-benda yang bukan makanan. Di rumahnya, batu-batu ini bahkan selalu di simpannya di dalam lemari makan. Menurut wanita berusia 45 tahun itu, kebiasaannya tersebut tidak terkendali sebelum ia menikah. Namun setelah menikah dengan pria bernama Jim, Widener berhasil menahan kebiasaan anehnya itu. “Jim membuat saya bahagia, hingga akhirnya saya mengurangi kebiasaan saya. Tetapi kadang saya tetap memakan bebatuan. Hanya batu yang bisa membuat saya senang,” ujar Widener, seperti dikutip Metro, Jumat (13/7). Widener menghancurkan batu yang lebih besar hingga ke ukuran yang lebih bisa dikonsumsinya. (ok/rzl)

Selanjutnya, kelompok yang diserang melaporkan peristiwa tersebut kepada rekan-rekannya yang saat itu sedang berada di acara pelantikan. Mendapat laporan tersebut, ratusan orang dari kelompok yang diserang yang berada di lokasi pelantikan langsung melakukan pengejaran dengan memblokir jalan.Akibatnya, bentrok pecah di Jl. Sekip depan Universitas Prima Indonesia (UNPRI). Batu dan anak panah berterbangan di lokasi, arus lalu

lintas macat .Sejumlah personil kepolisian yang turun ke TKP segera mengamankan lokasi dengan melerai kelompok yang bertikai, termasuk menyemprotkan gas air mata. Kapoldasu Irjen Wisjnu Amat Sastro yang turun ke TKP langsung naik ke atas panggung menenangkan ratusan orang yang sudah tersulut emosi. Didampingi tokoh pemuda seperti Boyke Turangan, Yan Paruhum Lubis, Kapoldasu meminta massa untuk tenang dan membubarkan diri. “ Saya hubungi Econ (Nesron Diapari ) suruh tarik anak

buahmu, saya hubungi Boy (Boyke Turangan) untuk menenangkan anggotanya,” kata Kapolda kepada wartawan. Dalam kaitan ini, Kapoldasu menginstruksikan anggotanya untuk berpatroli di kantungkantung massa untuk mencegah bentrok susulan. “Kedua belah pihak sudah saya suruh mundur, jangan ada penyerangan lagi,” kata Wisjnu. Pantauan Waspada, setelah suasana tenang dan kedua kelompok pemuda menahan diri, arus lalulintas yang sempat diblokir dibuka kembali sekira pukul 17:30. (h04)

guru terpencil itu bukan proyek fiktif sebagaimana yang berkembang dalam opini publik. Sebab, kata Uden, berdasar bukti dan fakta yang ada, pagu proyek senilai Rp. 20,1 M, ada dua kegiatan yg gagal proyek, yakni. Rumah dinas Kepala Dinas Pendidikan Aceh dan rumah guru terpencil di Aceh Tamiang. Hingga nilai kontrak rumah guru terpencil hanya Rp. 18,5 M (itu pun sdh termasuk untuk perencanaan dan pengawasan). Dari 18 Kab/kota, hanya satu kabupaten, yakni Aceh Selatan lima unit pembangunan rumah yang terbengkalai, empat unit selesai, sedangkan di 17 kab/kota selesai 100 persen. Terkait penerbitan SPM (surat Perintah Membayar) yang dipersoalkan oleh penyidik Kejaksaan Tinggi Aceh, prosedurnya terlebih dahulu harus dilakukan, kontraktor Pelaksana harus membuat laporan kemajuan fisik (final), konsultan Pengawas wajib melakukan pemeriksaan fisik atas laporan kemajuan fisik (final) yang telah dibuat oleh kontraktor pelaksana, pelaksana tekhnis kabupaten melakukan persetujuan atas laporan kemajuan fisik (final) setelah terlebih dahulu diperiksa oleh konsultan pengawas dengan adaya bubuhan tandatangan knsultan pengawas dan

Pejabat Pembuat Teknis Kegiatan (PPTK) wajib mengetahui laporan yang dibuat oleh kontraktor pelaksana. Setelah laporan yang diajukan oleh kontraktor pelaksanan diperiksa oleh konsultan pengawas, disetujui oleh pengelola teknis kabupaten dan diketahui oleh PPTK, maka tahapan selanjutnya yaitu PHO yaitu pemeriksaan barang yang dilakukan oleh panitia pemeriksa barang. Selanjutanya Kasubag keuangan dinas pendidikan Aceh melakukan verifikasi keuangan. Setelah proses di atas dilakukan, tahapan selanjutnya adalah pengajuan penerbitan SPM ke pihak KPA melalui PPTK (satu pintu) dimana semua dokumen yang ditandatangani oleh KPA terlebih dahulu diparaf oleh PPTK. Dari sini, katanya, dapat disimpulkan Dinas Pendidikan Aceh telah melakukan pengawasan berlapis dengan menunjuk pengelola teknis kabupaten untuk turut melakukan pengawasan pekerjaan kegiatan pembangunan rumah guru terpencil tahun 2009 di masing-masing kabupaten (hal ini sebenarnya tidak lazim atau tidak wajib); Pihak yang paling bertanggungjawab memastikan realisasi fisik lapangan yang kemudian dibuat dalam laporan kemajuan pekerjaan sebagai dasar

penerbitan SPM adalah 1) Konsultan Pengawas; 2) Pengelola Teknis Kabupaten; 3) Pejabat Pembuat Teknis Kegiatan; 4) Panitia Pemeriksa Barang; 5) Kasubag Keuangan; 6) Kuasa Pengguna Anggaran dan 7) Pejabat Pengguna Anggaran (Kepala Dinas Pendidikan Aceh). Sedangkan dari temuan Inspektorat Aceh terhadap proyek pembangunan rumah guru terpencil APBA tahun 2009, pihak dinas pendidikan Aceh melalui KPA telah menindaklanjuti dengan menegur keras melalui surat kepada masing-masing penyedia barang (kontraktor pelaksana) dan konsultan pengawas untuk segera melakukan penyelesaian kegiatan yang belum diselesaikan sesuai temuan inspektorat Aceh. Diketahui, pihak kontraktor pelaksana hanya merespon surat KPA dengan membuat surat pernyataan sebanyak 3 (tiga) kali; 1) surat pernyataan 5 Agustus 2010 perihal kesediaan kontraktor menyelesaikan pertengahan Agustus 2010 sesuai batas waktu yang ditentukan; 2) surat pernyataan 10 Oktober 2010 perihal bahwa kontraktor akan mengganti kerugian keuangan Negara; 3) surat pernyataan 23 April 2012 perihal pengakuan kontraktor bahwa kontraktor dan konsultan pe-

ngawas telah melakukan manipulasi dokumen kemajuan pekerjaan yang disampaikan ke PPTK. Disebutkan, penyelesaian atas temuan inspektorat Aceh dilaksanakan oleh kontraktor pelaksana dan konsultan pengawas. Yakni, kontraktor pelaksana menyelesaikan temuan inspektorat Aceh (dilengkapi bukti foto, surat rekanan, diketahui oleh konsultan pengawas. Kontraktor pelaksana mengembalikan kerugian keuangan Negara sesuai temuan inspektorat Aceh dibuktikan dengan adanya bukti setoran ke rekening kas daerah dan diselesaikan oleh konsultan pengawas dan PPTK setelah adanya teguran keras berulangkali oleh KPA. Kesimpulan GeRAK Indonesia, menurut Uden, KPA telah melaksanakan tugasnya dengan menindaklanjuti hasil temuan inspektorat Aceh dengan menyurati kontraktor pelaksana dan konsultas pengawas. “Ada sebahagian penyelesaian kegiatan diselesaikan oleh konsultan pengawas mengonfirmasi bahwa konsultan pengawas tidak melaksanakan tugasnya, bahkan dengan sengaja membiarkan terjadinya perbuatan curang yang dilakukan oleh konsultan pengawas,” ungkap GerAK. (Cb01)


obat anti mabuk kendaraan, dan tak terasa sudah sampai di Banda Aceh. Begitulah gambaran infrastruktur di dua daerah tetangga. Beda infrastruktur Banda Aceh, Sumbar dengan Sumut. Padahal kita sama-sama di wilayah yang sama. Ketika bertemu dengan salah satu pemimpin Sumatera Barat di pesawat dia sempat berujar soal buruknya infrastruktur Sumut. Katanya di Sumbar mereka solid untuk membangun. Padahal kalau menurut saya memang ada perbedaan kebijakan antar daerah. Kenapa Sumbar dan Aceh infrastrukturnya bagus padahal kita sama-sama di bawah negara Indonesia. Begitupula dengan kasus tanah. Memang persoalan tanah di Sumut cukup merepotkan. Saya juga dapat masukan ini dari abang-abang saya pengelola media. Mereka sudah mengingatkan betapa beratnya menyelesaikan kasus ini. Apalagi berhubungan pemerintah pusat. Tapi kembali ini harus kita lihat. Kasus tanah misalnya berhubungan dengan BPN (Badan Pertanahan Pusat). BPN yang mewadahi Indonesia itu pasti satu. Tidak mungkin BPN di Kalimantan beda dengan BPN yang mengurus Sumut. Intinya kita ini tetap sama berada di negara Republik Indonesia. Saya mau ambil contoh lainlah. Pengucuran dana KONI Sumut yang terhambat, misalnya. Alasan Pemprovsu lambatnya pengucuran dana ini karena ada Permendagri soal dana bantuan sosial. Tapi setelah kita perbandingkan dengan Riau, Sumbar dan daerah-daerah lain, dana ke KONI yang dikucurkan tidak ada masalah. Padahal di daerah itu pasti juga ada Permendagri tersebut.

Kan tidak mungkin Menteri Dalam Negeri di Riau berbeda dengan Mendagri di Sumut. Samasama Gamawan Fauzi. Jadi saya heran ketika persoalan-persoalan seperti ini mengemuka. Sebab harusnya jika kita berada dalam satu wadah dan negara yang sama pasti Sumut juga bisa berjalan setara dengan wilayah-wilayah itu. Jadi intinya saya yakin apa pun konsepnya, aturan itu pasti tetap sama di semua daerah Indonesia. Harus kita fahami lamalama kondisi Sumut memang bisa semakin terpuruk kalau dibiarkan tanpa perbaikan dan akses yang lebih baik ke pusat. Banyak sekali sebenarnya persoalan yang bisa cepat diselesaikan kalau ada political will dan legitimasi yang kuat. Kalau hanya dengan seremoni saya yakin semua itu tidak akan berguna. Bayangkan kalau saya hanya datang ke masyarakat kemudian tak mendengarkan mereka pasti masukan berharga seperti itu tak akan sampai. Memang pada prinsipnya semua yang berhubungan dengan masyarakat akan mengerucut. Jika diakumulasi itu tidak akan jauh-jauh dari empat atau lima masalah besar. Kesehatan, pendidikan, kemiskinan, infrastruktur serta birokrasi. Saya fikir semua orang yang ingin memimpin Sumut pasti menjadikan ini sebagai isu penting. Mereka yang mengapresiasi sejauh ini cukup banyak. Maka saya sering ungkapkan ke depan Sumut memang harus maju. Tidak boleh lebih rendah dari daerah lain. Kalau Sumbar bisa, kenapa kita tak mampu begitu. Aceh, menurut saya, daerah yang juga berhubungan langsung dengan kita. Namun kita harus lihat history mereka. Ke-

napa misalnya daerah yang sudah lama didera ketidakamanan plus bencana tsunami, bisa lebih bagus dari sisi infrastruktur. Begitupula Sumatera Barat. Kenapa pembangunan mereka lebih cepat. Memang saya sempat berjumpa dengan salah satu kepala daerahnya. Dia seolah mengindikasikan bahwa di Sumut itu terlalu banyak kebocoran anggaran. Namun tidak ingin sayaperpanjangkarenaharusnya itu memang bisa diketahui dari laporan keuangan Pemda. Hanya saja saya kecewa kalau Sumut ini tidak bisa bersaing dengan daerah lain dalam hal pendidikan, kesehatan, kesejahteraan, infrastruktur dan perizinan. Mengupas daya saing kita dengan daerah lain pasti tidak akan habis satu malam. Maka sering saya katakan 2013 adalah tonggak kita menjadikan Sumut yang lebih sejahtera. Bayangkan Tapanuli Tengah dan Sibolga merupakan penghasil ikan dan punya pantai untuk dikelola. Sayang, pengelolaannya masih tertumpu pada pemerintah daerah dan warga setempat. Di Tapanuli Selatan dan Mandailing Natal punya kekayaan alam di pinggir pantai. Sayangnya belum ada upaya untuk menggali dan mengembangkan potensi. Padanglawas Utara dan Padanglawas juga dikenal penghasil sapi terbesar di Sumut. Tapi masih perlu pengembangan. Maukah kita biarkan Sumut terus merosot, dibiarkan, tanpa grand design? Saya berfikir memang Sumut Sejahtera itulah konsep paling pas dan mampu membawa kita kepada pertumbuhan nyata dan lebih baik. Bukan pertumbuhan semu.###

Waspada / Arman Konadi

ANGGOTA komunitas Hizbut Tahrir Banda Aceh menggelar aksi teatrikal cukur rambut sebagai simbol bersih diri dan pikiran di bundaran Simpang Lima Banda Aceh, Minggu (15/7). Ratusan anggota komunitas Hizbut Tahrir menggelar aksi damai menyambut bulan suci Ramadhan 1433 H.

Din Syamsuddin:... Selain menetapkan awal puasa pada Jumat (20/7), Muhammadiyah juga telah menetapkan 1 Syawal atau Lebaran pada 19 Agustus. Muhammadiyah juga berencana tidak mengikuti Sidang Isbath (penetapan) awal Ramadhan yang biasa digelar Kementerian Agama dengan alasan untuk mengurangi ketegangan dan untuk kebaikan bersama. Pemerintah, lanjut Din, sebenarnya tidak perlu menetapkan awal puasa dan 1 Syawal atau Idul Fitri, karena semuanya menyangkut keyakinan dari masing-masing umat. “Pemerintah, hanya perlu melakukan fasilitasi terkait penetapan hari libur bersama saja. Dengan demikian, pemerintah bisa mengayomi seluruh pihak,” katanya.

Ada-ada Saja...

Diskriminasi... pelanggaran hukum. Dalam kaitan itu, Gerakan Rakyat Antikorupsi (GeRAK) Indonesia menyatakan, proses penyelidikan dan penyidikan kasus dugaan korupsi pembangunan rumah guru terpencil sangat diskriminatif dan tidak adil dimana penyidik Kejaksaan Tinggi Aceh hanya menetapkan KPA dan PPTK sebagai tersangka. Padahal dalam kasus ini, dengan bukti dan fakta yang ada yang seharusnya paling bertanggungjawab adalah Kontraktor Pelaksana dan Konsultan Pengawas (dibuktikan dengan adanya pernyataan kontraktor pelaksana CV Devela Industri yang merupakan pelaksana kegiatan di Kabupaten Aceh selatan yang menyatakan dalam surat pernyataan bermaterai bahwa kontraktor pelaksana dan konsultan pengawas telah melakukan manipulasi dokumen kemajuan pekerjaan) Demi keadilan Gerakan Rakyat Antikorupsi (GeRAK) Indonesia mendesak kepada penyidik Kejaksaan Tinggi Aceh untuk melaksanakan penegakan hukum (pemberantasan korupsi) dengan prinsip tidak diskriminasi dan menjadikan fakta-fakta hukum sebagai dasar dalam menangani suatu perkara. Bukan Proyek Fiktif GeRAK Indonesia menegaskan pembangunan rumah

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1.MxGc8+, BxM. 2. BhxBc8+mat. Jawaban TTS: TTS Topik

SERBA “cu”

Jawaban Sudoku:

9 2 7 5 1 6 4 8 3

6 3 4 2 7 8 1 9 5

5 8 1 3 4 9 6 7 2

1 7 2 4 5 3 9 6 8

3 6 9 7 8 2 5 4 1

4 5 8 6 9 1 3 2 7

2 4 3 8 6 5 7 1 9

8 9 6 1 3 7 2 5 4

7 1 5 9 2 4 8 3 6 *241

akan sangat menonjol ke depan. Sebab permasalahan ini sulit diselesaikan. Begitupula dengan kondisi infrastruktur. Informasi dari mereka menunjukkan masih sangat banyak kondisi yang memprihatinkan. Begitupula dengan tema pembangunan secara umum. Sebenarnya bukan dari situ saja saya dapat banyak informasi. Bertukar fikiran, berdialog dan berbaur dengan masyarakat dan mendengar mereka pasti banyak sekali yang mengadu. Semuanya pasti ingin mewujudkan mimpi Sumut Sejahtera. Sebab Sumut Sejahtera itulah konsep saya membangun Sumut. Mulai dari sektor pendidikan, kesehatan, infrastruktur, usaha kecil, perizinan, birokrasi dan kepastian bisnis bisa terakumulasi dalam Sumut Sejahtera. Bahkan dalam berbagai kesempatan pun saya sudah menggiring opini publik untuk lebih dekat dengan Sumut Sejahtera. Apa yang disampaikan media dan masyarakat menurut saya pada dasarnya memang benar soal Sumut. Mereka bilang infrastruktur jelek. Iya, harus kita akui. Saya pernah bawa Bang Anwar Nasution, mantan deputi Gubernur Senior BI dari Padang, Sumatera Barat ke Sipirok. Dari Sumatera Barat, jalan yang kami lalui masih mulus. Tapi sesampainya di Muarasipongi kelihatan kalau kita sudah masuk Sumut. Menurut Bang Anwar, kalau sudah masuk Sumut kita tak akan bisa tidur di mobil. Begitupula ketika saya berangkat dari Medan ke Banda Aceh naik mobil. Saya cukup minum satu

Gatot:... benar-benar berbeda. Khusus untuk sekolah SD Juara yang merupakan binaan Rumah Zakat, Gatot berharap sekolah ini dapat mempersiapkan pribadi- pribadi yang bertaqwa. Selama ini SD Juara menampung putra putri berprestasi dari kalangan kurang mampu, juga yatim piatu. Lewat gagasan SD Juara, Rumah Zakat mencoba berbagi senyuman. Membangkitkan harapan anak-anak di dalam-

Sambut... tidak sesuai dengan adat istiadat Aceh, namun, warga terlanjur menganggap itu sebagai budaya. Menurut dia, acara ‘meuramien’ bagian dari kegiatan minggu terakhir sebelum bulan puasa. “Kebiasaan selama ini, setiap minggu terakhir orang meuramiennya ke pantai, di sini kami ubah, meuremiennya di

H. Hasanuddin... Rapat pleno dipimpin Ketua KIP Dedi Mulyadi,ST, bersama komisinoris, masing-masing, Marzuki Broeh, Mad Budiaman, Fitriana, dan Saidi, dihadiri Bupati Agara Hasanuddin ,B, Kapolres AKBP Trisno R, unsur Muspida, ketua Panwaslu Agara Junianto Siahaan.Dari KIP Aceh tampak hadir lima orang bersama Robi Syahputra juga dihadiri para ketua dan sekretaris PPK 16 kecamatan se-Agara. Pantauan Waspada, dari sejumlah 7 pasangan, saat berlangsung rekapitulasi suara, hanya saksi kandidat nomor 1 dan nomor 2 yang hadir, saksi pasangan calon nomor 1 Raidin-Muslim, masing-masing, Buhari Selian, Kasri dan Bastian, sedangkan saksi calon nomor 2, Hasanuddin B, _Ali Basrah, tampak hadir Beni Novian, Ucok Rangkuti dan Samta. Ketika digelar pembukaan

5,5 Juta... Lebih dari 5,5 juta visa Umrah telah dikeluarkan untuk musim ini. Jumlah pengunjung dan jamaah Haji dan Umrah ke dua masjid suci selama Ramadhan diperkirakan akan jauh lebih tinggi dari yang diperkirakan. Meskipun visa tersebut telah dikeluarkan untuk seluruh musim ini, tetapi para jamaah lebih tertarik untuk melaksanakan Umroh dan berkunjung ke Masjid Nabawi selama bulan Ramadhan. Jutaan jamaah domestik juga menanti Ramadhan untuk menunaikan Umroh dan berjiarah ke Masjid Nabawi. Syeikh Abdul Rahman AlSudais juga mengatakan, “Pada Ramadhan tahun ini menurut rencana kedua masjid suci itu akan meningkatkan jumlah imamnya yang akan mengeluarkan fatwa bagi para jamaah dan pengunjung, membagi-

Al Bayan... bi shur’ah, Innamasy Syadidulladzi yamliku nafsah. Sesungguhnya mampu menahan diri ketika marah merupakan ciri kejantanan seseorang. Sedangkan orang yang cepat tersinggung membuktikan kepribadiannya lemah. Marah itu dari setan, setan diciptakan dari api, api dapat dipadamkan oleh air. Sebaiknya orangorang yang sedang marah segera berwudhu’ supaya marahnya hilang.

WASPADA Senin 16 Juli 2012 nya untuk menyongsong masa depan lebih baik. ”Didik mereka dengan iman dan taqwa serta ilmu pengetahuan dan teknologi. Karena merekalah calon-calon pemimpin masa depan,” tegas Gatot. Sadiman, Spd selaku kepala SD Juara Medan menjelaskan, Big Smile Indonesia adalah sebuah gerakan membangkitkan optimisme bangsa melalui aksi senyum memberdayakan Indonesia yang lebih membahagiakan. Big Smile Indonesia ber-

upaya berkontribusi bagi tujuan pembangunan global di Indonesia, untuk menciptakan banyak senyum di seluruh negeri. Rumah Zakat menghadirkan empat program yakni, Senyum Juara (pendidikan), Senyum Sehat (kesehatan), Senyum Mandiri (ekonomi), dan Senyum Lestari (lingkungan) ”Lewat Big Smile Indonesia yang diluncurkan tahun 2012, kita telah menggelar pengobatan gratis, bakti sosial, serta penyerahan beasiswa untuk 800 anak miskin dan anak yatim seSumut,” kata Sadiman.(m28)

meunasah saja,” katanya. Sebagai gantinya, tambah dia, warga Gla Mns Baro sepakat ‘meuramien’ dan berkumpul di halaman meunasah sambil makan-makan. Kata Rasyidin, pada acara tersebut, warga membawa bungku-san nasi atau ‘bukulah’, sementara kuah beulangong disediakan oleh gampong. Sebelum acara makan, warga melakukan zikir dan doa.

Sementara, Ketua Pemuda Gla Mns Baro, Usman di tempat yang sama menambahkan, selain untuk mengganti kebiasaan meuramien di pantai, kegiatan serupa yang digelar di desa juga dinilai bermanfaat. Untuk kegiatan tersebut, lanjut Us m a n , p i h a k p e m u d a setempat memotong tiga ekor sapi guna menyiapkan kuah beulangong. (b07)

rapat pleno, saksi pasangan nomor 1, Kasri, melakukan instruksi, menyampaikan agenda tahapan pleno ini dinilai tidak sah karena KIP Agara melanggar isi surat KIP Agara bernomor 23/ .2012, tentang penundaan sementara tahapan rekapitulasi. Usai instruksi para saksi pasangan nomor 1 walk out dari ruang pleno. Sekaitan tidak hadirnya saksi pasangan calon lainnya, sekretaris KIP Irwandi Ramud kepada waspada mengatakan , secara tersurat semua saksi telah diberi tahu.Sementara Fitriana komisioner KIP Agara juga mengatakan, selain secara tersurat, KIP Agara juga telah menghubungi via seluler. Ketua KIP Agara Dedi Mulyadi Selian ST, usai dilakukan rekapitulasi penghitungan suara 16 kecamatan di tingkat kabupaten mengatakan, semua yang diselenggarakan sesuai ketentuan.

Hasil rekapitulasi penghitungan suara yakni pasangan, calon nomor 1 Raidin-Muslim memperoleh suara 37.404 atau 34,71persen, pasangan nomor 2 H.Hasanuddin,B – H.Ali Basrah memperoleh suara 51.059 atau 47,38 persen, pasangan nomor 3 Rajidin –Sarim memperoleh 535 suara atau 0,55 persen, pasangan nomor 4 H.Armen Desky-TGk Appan memperoleh suara 10.483 atau 9,73 persen, pasangan nomor 5, Marthin Desky-Kamasiah perolehan suaranya 2039 atau 1,89 persen, pasangan nomor 6 Amriko –Ridwan memperoleh suara 1739 atau 1,61 persen sedangkan pasangan calon nomor 7 Riduan – Erwin Sihombing memperoleh suara 4433 atau 4,11 persen. Suara sah dan tidak sah 109.772.Suara tidak sah dan rusak sejumlah 2018 kertas suara, dan suara sah yang menggunakan hak pilih adalah sejumlah 107.754 suara. (b25)

bagikan paket iftar (penganan dan makanan berbuka) di dalam masjid dan di halamannya guna mencegah siapa saja membawa makjanan dan minuman dari luar ke dalam masjid. Selain ini mereka mengarahkan para jamaah agar mengatur tempat duduknya, tidak di lintasan orang dan meningkatkan operasi pembersihan.” Kepresidenan Umum Dua Masjid Suci juga telah merekrut 900 pekerja ekstra untuk mendukung staf permanen yang ada sekarang ini sebanyak 2.000 untuk memberikan pelayanan yang lebih baik di Masjidil Haram. Mereka akan memberikan pelayanan seperti membimbing pengunjung, memantau dan mengawal gerbang-gerbang ke masjid serta membersihkan bagian dalam masjid dan halaman dalamnya. Mereka juga mengoperasikan semprotan air untuk mengatasi rasa panas bagi para jamaah di

halaman. Pengaturan iftar di dalam masjid dan halamannya juga telah dilakukan. Air Zamzam juga akan dibagikan di semua lokasi di mana disajikan iftar. Masjid Nabawi akan menerima 290 ton air Zamzam setiap harinya selama bulan puasa Ramadhan, guna mengisi sebanyak 13.000 drum yang disediakan. Masjid dan berbagai tempat bagi para jamaah akan dibersihkan secara terus menerus oleh 3.200 pekerja kebersihan. Kepresidenan Umum telah melakukan perhatian khusus untuk menunjuk cukup banyak ulama dan guru untuk mengadakan ceramah harian, kata harian Al-Madinah dalam laporannya Sabtu (14/7). Para ulama akan memandu pengunjung ke masjid selain memberikan jawaban atas pertanyaan yang menyangkut masalah keagamaan yang mungkin timbul dari kalangan jamaah. (an/mujo)

Dalam kehidupan ini kita temukan banyak orang marahmarah. Ada yang marah benaran, ada yang merekayasa kemarahannya. Marah yang direkayasa hanya untuk menampakkan kepada rakyat, dia orang yang benar-benar mencintai rakyat. Merekayasa marah di era “ad-darul harb” ini sebenarnya sangat berbahaya, apalagi seorang orator yang di depannya terdapat ratusan massa. Jika orator tak dapat menahan marah, boleh jadi lidahnya terpeleset untuk mengkomandoi

sesuatu yang bersifat makar. Bila terjadi amuk massa akan mendatangkan malapetaka bagi bangsa. Berhati-hatilah dengan orang marah sebab orang marah itu hatinya sudah dikuasai setan laknatullah! Orang-orang yang sedang marah itu jangan dipercaya ucapannya. Jika kita percaya sama dengan kita percaya kepada setan setan berbicara tanpa dalil, bahkan turut menyelewengkan dalil. Sedangkan orang yang sabar mereka bicara dengan dalil yang kuat dan dengan penuh tanggung jawab.

Berita Utama

A2 Ratusan Tokoh... Gus Center sekaligus peluncuran website www.gusirawan. com dan versi mobile Mereka yang hadir antara lain mantan Kadiv Humas Mabes Polri Irjen Pol (Purn) Sisno Adi Winoto, Kanjeng Gusti Pangeran Haryo (KGPH) Panembahan Agung Tedjowulan dari Kasunanan Karaton Surakarta, Ny Nina Akbar Tanjung, Ketua DPN MPI Meherban Shah, sesepuh AMPI Manahan Lubis, Kwik Sam Ho, Bupati Tapanuli Selatan Syahrul Pasaribu, Wakil Bupati Tapanuli Tengah Syukran Tanjung, Wakil Bupati Labuhanbatu Utara H Minan Pasaribu, Dewan Pembina Yayasan Sultan Makmun Al Rasyid Drs T Achmad Tala’a dan pengurus PWI Sumut yang dipimpin M Syahrir, Ikatan Jurnalis Televisi Indonesia (IJTI) dan organisasi pers lainnya. Selain itu hadir para pelaku bisnis dan undangan lainnya seperti ormas Pendawa Sumut yang dipimpin Ruslan, Relawan Gus Irawan (Religi), Ketua DPP Pujakesuma Hardi Mulyono, pengurus DPW Pemuda Pujakesuma Sumut dan para pelaku UKM di Sumut. “Gus Center ini dibuat untuk siapa saja yang punya visi untuk Sumut Sejahtera. Saya bertekad, tempat ini menjadi

Gatot: Perbanyak... pengetahuan dan teknologi. Perpaduan iman dan taqwa serta bekal ilmu pengetahuan dan teknologi akan membuat suasana Ramadhan benarbenar berbeda. Khusus untuk sekolah SD Juara yang merupakan binaan Rumah Zakat, Gatot berharap sekolah ini dapat mempersiapkan pribadi- pribadi yang bertaqwa. Selama ini SD Juara menampung putra putri berprestasi dari kalangan kurang mampu, juga yatim piatu. Lewat gagasan SD Juara, Rumah Zakat mencoba berbagi senyuman. Membangkitkan harapan anak-anak di dalamnya untuk menyongsong masa depan lebih baik. ”Didik mereka dengan iman dan taqwa serta ilmu pengetahuan dan teknologi. Karena merekalah calon pemimpin

Albayan... lain. Dia berpedoman kepada kata mutiara yang berasal dari lidah Nabi; orang yang perkasa bukanlah orang yang mempunyai fisik dan otot kuat, tetapi orang yang perkasa adalah ia dapat menahan diri dari amarah. Laisasy Syadid bi shur’ah, Innamasy Syadidulladzi yamliku nafsah. Sesungguhnya mampu menahan diri ketika marah merupakan ciri kejantanan seseorang. Sedangkan orang yang cepat tersinggung membuktikan kepribadiannya lemah. Marah itu dari setan, setan diciptakan dari api, api dapat dipadamkan oleh air. Sebaiknya orang-orang yang sedang marah segera berwudhu’ supaya marahnya hilang. Dalam kehidupan ini kita temukan banyak orang marahmarah. Ada yang marah benaran, ada yang merekayasa kemarahannya. Marah yang direkayasa hanya untuk menam-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1.MxGc8+, BxM. 2. BhxBc8+mat. Jawaban TTS: TTS Topik

SERBA “cu”

Jawaban Sudoku:

9 2 7 5 1 6 4 8 3

6 3 4 2 7 8 1 9 5

5 8 1 3 4 9 6 7 2

1 7 2 4 5 3 9 6 8

3 6 9 7 8 2 5 4 1

4 5 8 6 9 1 3 2 7

2 4 3 8 6 5 7 1 9

8 9 6 1 3 7 2 5 4

7 1 5 9 2 4 8 3 6 *241

titik awal kita, bersama seluruh potensi yang ada di Sumut untuk menyejahterakan masyarakat Sumut,” terangnya. Karena itu kata Gus, dengan menggandeng semua stakeholder yang ada , cita-citanya untuk Sumut Sejahtera lebih cepat terwujud. Dia mengatakan, selain sektor UMKM, sejumlah potensi lainnya bisa didorong untuk mempercepat Sumut Sejahtera itu. Sektor pariwisata Sumut yang ada di Danau Toba, kawasan pusat perindustrian Sei Mangkei dan PT Inalum, cukup menjadi modal mensejahterakan Sumut. “Keberadaan tiga potensi tersebut ditambah dukungan Kualanamu akan membuat Sumut menjadi provinsi yang mudah mengejar ketertinggalan dari provinsi lain,” terangnya. Sementara mantan Kadiv Humas Mabes Polri Irjen Pol (Purn) Sisno Adi Winoto dalam sambutan mewakili undangan mengatakan kehadiran Gus Center diharapkan dapat menampung dan menyerap aspirasi masyarakat yang peduli dalam membangun Sumut. “Saya memang orang Jawa, tapi lahir di Sumut. Makanya saya dukung Gus Irawan maju jadi Gubernur Sumut. Sudah cukup lama saya berpindah-pindah menjadi Kamasa depan,” tegas Gatot. Sadiman, Spd selaku kepala SD Juara Medan menjelaskan, Big Smile Indonesia adalah sebuah gerakan membangkitkan optimisme bangsa melalui aksi senyum memberdayakan Indonesia yang lebih membahagiakan. Big Smile Indonesia berupaya berkontribusi bagi tujuan pembangunan global di Indonesia, untuk menciptakan banyak senyum di seluruh negeri. Rumah Zakat menghadirkan empat program yakni, Senyum Juara (pendidikan), Senyum Sehat (kesehatan), Senyum Mandiri (ekonomi), dan Senyum Lestari (ling-kungan) ”Lewat Big Smile Indonesia yang diluncurkan tahun 2012, kita telah menggelar pengobatan gratis, bakti sosial, serta penyerahan beasiswa untuk 800 anak miskin dan anak yatim se-Sumut,” kata Sadiman.(m28) pakkan kepada rakyat, dia orang yang benar-benar mencintai rakyat. Merekayasa marah di era “ad-darul harb” ini sebenarnya sangat berbahaya, apalagi seorang orator yang di depannya terdapat ratusan massa. Jika orator tak dapat menahan marah, boleh jadi lidahnya terpeleset untuk mengkomandoi sesuatu yang bersifat makar. Bila terjadi amuk massa akan mendatangkan malapetaka bagi bangsa. Berhati-hatilah dengan orang marah sebab orang marah itu hatinya sudah dikuasai setan laknatullah! Orang-orang yang sedang marah itu jangan dipercaya ucapannya. Jika kita percaya sama dengan kita percaya kepada setan berbicara tanpa dalil, bahkan turut menyelewengkan dalil. Sedangkan orang yang sabar mereka bicara dengan dalil yang kuat dan dengan penuh tanggung jawab.

polda dan belum sempat berbakti penuh untuk Sumut. Dengan majunya Gus Irawan berarti kita akan wujudkan pengabdian itu dengan keterwakilannya sebagai pimpinan daerah kelak,” kata Sisno yang disambut tepuk tangan. Sisno Adiwinoto yang pernah menjabat sebagai Kapolda Sumatera Selatan dan Sulawesi Selatan meyakini Gus Irawan memiliki kemampuan memimpin Sumatera Utara. Hal ini, menurutnya, terlihat dari pengalaman Gus Irawan yang sukses mengangkat Bank Sumut menjadi bank terkemuka di tingkat nasional. Sisno yang kelahiran Tanjungmorawa Deliserdang me-

ngatakan Sumut membutuhkan pemimpin untuk mengangkat atau memaksimalkan potensi yang dimiliki daerah ini. “Kita yakin, Sumut yang punya potensi besar ini, akan terbangun sebaik-baiknya, jika dipimpin Gus Irawan Pasaribu. Mudah-mudahan, ketertinggalan yang dialami Sumut dari daerah lain, dapat diatasi, bahkan Sumut dapat menjadi yang terdepan dengan adanya peran Gus Irawan,” kata Sisno dan berharap, masyarakat dapat memberikan sumbang saran pemikiran dalam membangun Sumut dan menyampaikannya melalui Gus Center m a u p u n w e b s i t e w w w. dan

Rapat pleno dipimpin Ketua KIP Dedi Mulyadi,ST, bersama komisinoris, masingmasing, Marzuki Broeh, Mad Budiaman, Fitriana, dan Saidi, dihadiri Bupati Agara Hasanuddin ,B, Kapolres AKBP Trisno R, unsur Muspida, ketua Panwaslu Agara Junianto Siahaan.Dari KIP Aceh tampak hadir lima orang bersama Robi Syahputra juga dihadiri para ketua dan sekretaris PPK 16 kecamatan se-Agara. Ketua KIP Agara Dedi Mulyadi Selian ST, usai dilakukan rekapitulasi penghitungan suara 16 kecamatan di tingkat kabupaten mengatakan, semua yang diselenggarakan sesuai ketentuan. Hasil rekapitulasi penghi-

Pemerintah Jamin... Sementara itu, terkait kenaikan harga bahan pokok, Hatta sudah meminta kepada Badan Urusan Logistik (Bulog) dan Menteri Perdagangan, Gita Wirjawan agar segera melakukan operasi pasar. Meskipun kenaikan itu masih dalam

Tanah Suci.... ke dalam masjid. Selain ini mereka mengarahkan para jamaah agar mengatur tempat duduknya, tidak di lintasan orang dan meningkatkan operasi pembersihan.” Kepresidenan Umum Dua Masjid Suci juga telah merekrut 900 pekerja ekstra untuk mendukung staf permanen yang ada sekarang ini sebanyak 2.000 untuk memberikan pelayanan yang lebih baik di Masjidil Haram. Mereka akan memberikan pelayanan seperti membimbing pengunjung, memantau

Sumut Dan Provinsi... Kalau diakumulasi ada banyak hal yang perlu pembenahan. Mereka bilang kasus tanah akan sangat menonjol ke depan. Sebab permasalahan ini sulit diselesaikan. Begitupula dengan kondisi infrastruktur. Informasi dari mereka menunjukkan masih sangat banyak kondisi yang memprihatinkan. Begitupula dengan tema pembangunan secara umum. Sebenarnya bukan dari situ saja saya dapat banyak informasi. Bertukar fikiran, berdialog dan berbaur dengan masyarakat dan mendengar mereka pasti banyak sekali yang mengadu. Semuanya pasti ingin mewujudkan mimpi Sumut Sejahtera. Sebab Sumut Sejahtera itulah konsep saya membangun Sumut. Mulai dari sektor pendidikan, kesehatan, infrastruktur, usaha kecil, perizinan, birokrasi dan kepastian bisnis bisa terakumulasi dalam Sumut Sejahtera. Bahkan dalam berbagai kesempatan pun saya sudah menggiring opini publik untuk lebih dekat dengan Sumut Sejahtera. Apa yang disampaikan media dan masyarakat menurut saya pada dasarnya memang benar soal Sumut. Mereka bilang infrastruktur jelek. Iya, harus kita akui. Saya pernah bawa Bang Anwar Nasution, mantan deputi Gubernur Senior BI dari Padang, Sumatera Barat ke Sipirok. Dari Sumatera Barat, jalan yang kami lalui masih mulus. Tapi sesampainya di Muarasipongi kelihatan kalau kita sudah masuk Sumut. Menurut Bang Anwar, kalau sudah masuk Sumut kita tak akan bisa tidur di mobil. Begitupula ketika saya berangkat dari Medan ke Banda Aceh naik mobil. Saya cukup minum satu obat anti mabuk kendaraan, dan tak terasa sudah sampai di Banda Aceh. Begitulah gambaran infrastruktur di dua daerah tetangga. Beda infrastruktur Banda Aceh, Sumbar dengan Sumut. Padahal kita sama-sama di wilayah yang sama. Ketika bertemu dengan salah satu pemimpin Sumatera Barat di pesawat dia sempat berujar soal buruknya infrastruktur Sumut. Katanya di Sumbar mereka solid untuk membangun. Padahal kalau menurut saya memang ada perbedaan kebijakan antar daerah. Kenapa Sumbar dan Aceh infrastrukturnya bagus padahal kita sama-sama di bawah negara Indonesia. Begitupula dengan kasus tanah. Memang persoalan tanah di Sumut cukup merepotkan. Saya juga dapat masukan ini dari abang-abang saya pengelola media. Mereka sudah mengingatkan betapa beratnya menyelesaikan kasus ini. Apalagi berhubungan pemerintah pusat. Tapi kembali ini harus kita lihat. Kasus tanah misalnya berhubungan dengan BPN (Badan Pertanahan Pusat). BPN yang mewadahi Indonesia itu pasti satu. Tidak mungkin BPN di Kalimantan beda dengan BPN yang mengurus Sumut. Intinya kita ini tetap sama berada di negara Republik Indonesia. Saya mau ambil contoh lainlah. Pengucuran dana KONI Sumut yang terhambat, misalnya. Alasan Pemprovsu lambatnya pengucuran dana ini karena ada Permendagri soal dana bantuan sosial. Tapi setelah kita perbandingkan dengan Riau, Sumbar dan daerah-daerah lain, dana ke KONI yang

tungan suara yakni pasangan, calon nomor 1 Raidin-Muslim memperoleh suara 37.404 atau 34,71persen, pasangan nomor 2 H.Hasanuddin,B – H.Ali Basrah memperoleh suara 51.059 atau 47,38 persen, pasangan nomor 3 Rajidin –Sarim memperoleh 535 suara atau 0,55 persen, pasangan nomor 4 H.Armen Desky-TGk Appan memperoleh suara 10.483 atau 9,73 persen, pasangan nomor 5, Marthin Desky-Kamasiah

Senin 16 Juli 2012 “Namun yang tak kalah penting adalah dukungan dari masyarakat terhadap Gus Irawan Pasaribu. Selamat berjuang dan kita semua mendukung sepenuhnya Gus Irawan Pasaribu,” jelasnya. Gus Irawan Pasaribu menambahkan, selain Gus Center, website www.gusirawan. com ataupun m.gusirawan. com diharapkan sebagai sarana menyerap aspirasi masyarakat. “Masyarakat di manapun berada dapat mengakses website ini, dan memberikan sumbang saran pemikiran, terkait bagaimana kita membangun Sumut ,” jelasnya.(m06)

H. Hasanuddin B-H. Ali Basrah Kdh Terpilih Periode 2012-2017 KUTACANE (WAspada) : Rapat pleno terbuka rekapitulasi hasil perhitungan suara Pilkada Bupati/ Wakil Bupati Aceh Tenggara (Agara), yang digelar KIP Agara Minggu (15/7) di gedung Kesenian Agara, menetapkan pasangan calon nomor 2, H.Hasanuddin,B - H.Ali Basrah, sebagai Bupati/wakil Bupati Agara terpilih periode 2012-2017. Perolehan suara keduanya 51.059 atau 47,38 persen.


perolehan suaranya 2039 atau 1,89 persen, pasangan nomor 6 Amriko –Ridwan memperoleh suara 1739 atau 1,61 persen sedangkan pasangan calon nomor 7 Riduan – Erwin Sihombing memperoleh suara 4433 atau 4,11 persen. Suara sah dan tidak sah 109.772. Suara tidak sah dan rusak sejumlah 2018 kertas suara, dan suara sah yang menggunakan hak pilih adalah sejumlah 107.754 suara. (b25)

Polres L. Batu Tangkap 17 Pencuri Sawit PT SLJ RANTAUPRAPAT (Waspada): Polres Labuhanbatu menangkap 17 orang diduga pencuri sawit di perkebunan PT Sawita Ledong Jaya (SLJ) Desa Air Merah, Kec. Kualuh Ledong, Kab. Labuhanbatu Utara). Kapolres Labuhanbatu AKBP Hirbak Wahyu Setiawan, SIK, SH, yang dikonfirmasi Waspada di Mapolres Labuhanbatu,Minggu (15/7) mengatakan, para pelaku pencuri TBS ( Tandan Buah Sawit) ditangkap Jumat (13/7) siang dan menyita barang bukti

berupa, sepedamotor 16 unit, 3 buah dodos, 3 buah keranjang gandeng dan 200 Kg buah sawit baru siap panen. “Petugas dari Polres yang turun ke TKP menangkap 20 orang laki-laki anggota kelompok tani yang sedang berada di base camp.Setelah diperiksa, 17 di antaranya kita tetapkan menjadi tersangka,” jelas Hirbak dan menambahkan, isinial ke-17 orang itu, yakni DM, LS, IS, YG, AAM, TSG, SS, ST, Sam, HM, Sa, KM, Jumi, IS dan Ru. (a17)

batas normal, Hatta tetap meminta dilakukan operasi pasar untuk menstabilkan harga. “Tapi biasanya memang bulan puasa dan lebaran sedikit meningkat, itulah tempatnya para petani kita, para pedagang kita sedikit menikmati pada musim lebaran, asalkan kenaikan itu tidak

terlalu tinggi,” kata dia. Pemerintah menjamin stok bahan pokok tersedia hingga lebaran. Namun, biasanya kenaikan harga dipengaruhi oleh distribusi yang terganggu dan adanya penimbunan yang dilakukan oleh oknum tidak bertanggungjawab.(vvn)

dan mengawal gerbang-gerbang ke masjid serta membersihkan bagian dalam masjid dan halaman dalamnya. Mereka juga mengoperasikan semprotan air untuk mengatasi rasa panas bagi para jamaah di halaman. Pengaturan iftar di dalam masjid dan halamannya juga telah dilakukan. Air Zamzam juga akan dibagikan di semua lokasi di mana disajikan iftar. Masjid Nabawi akan menerima 290 ton air Zamzam setiap harinya selama bulan puasa Ramadhan, guna mengisi sebanyak 13.000 drum yang disediakan. Masjid dan

berbagai tempat bagi para jamaah akan dibersihkan secara terus menerus oleh 3.200 pekerja kebersihan. Kepresidenan Umum telah melakukan perhatian khusus untuk menunjuk cukup banyak ulama dan guru untuk mengadakan ceramah harian, kata harian Al-Madinah dalam laporannya Sabtu (14/7). Para ulama akan memandu pengunjung ke masjid selain memberikan jawaban atas pertanyaan yang menyangkut masalah keagamaan yang mungkin timbul dari kalangan jamaah. (an/mujo)

dikucurkan tidak ada masalah. Padahal di daerah itu pasti juga ada Permendagri tersebut. Kan tidak mungkin Menteri Dalam Negeri di Riau berbeda dengan Mendagri di Sumut. Sama-sama Gamawan Fauzi. Jadi saya heran ketika persoalan-persoalan seperti ini mengemuka. Sebab harusnya jika kita berada dalam satu wadah dan negara yang sama pasti Sumut juga bisa berjalan setara dengan wilayah-wilayah itu. Jadi intinya saya yakin apa pun konsepnya, aturan itu pasti tetap sama di semua daerah Indonesia. Harus kita fahami lama-lama kondisi Sumut memang bisa semakin terpuruk kalau dibiarkan tanpa perbaikan dan akses yang lebih baik ke pusat. Banyak sekali sebenarnya persoalan yang bisa cepat diselesaikan kalau ada political will dan legitimasi yang kuat. Kalau hanya dengan seremoni saya yakin semua itu tidak akan berguna. Bayangkan kalau saya hanya datang ke masyarakat kemudian tak mendengarkan mereka pasti masukan berharga seperti itu tak akan sampai. Memang pada prinsipnya semua yang berhubungan dengan masyarakat akan mengerucut. Jika diakumulasi itu tidak akan jauh-jauh dari empat atau lima masalah besar. Kesehatan, pendidikan, kemiskinan, infrastruktur serta birokrasi. Saya fikir semua orang yang ingin memimpin Sumut pasti menjadikan ini sebagai isu penting. Mereka yang mengapresiasi sejauh ini cukup banyak. Maka saya sering ungkapkan ke depan Sumut memang harus maju. Tidak boleh lebih rendah dari daerah lain. Kalau Sumbar bisa, kenapa kita tak mampu begitu. Aceh, menurut saya, daerah yang juga berhubungan langsung dengan kita. Namun kita harus lihat history mereka. Kenapa misalnya daerah yang sudah lama didera ketidakamanan plus bencana tsunami, bisa lebih bagus dari sisi infrastruktur. Begitupula Sumatera Barat. Kenapa pembangunan mereka lebih cepat. Memang saya sempat berjumpa dengan salah satu kepala daerahnya. Dia seolah mengindikasikan bahwa di Sumut itu terlalu banyak kebocoran anggaran. Namun tidak ingin saya perpanjang karena harusnya itu memang bisa diketahui dari laporan keuangan Pemda. Hanya saja saya kecewa kalau Sumut ini tidak bisa bersaing dengan daerah lain dalam hal pendidikan, kesehatan, kesejahteraan, infrastruktur dan perizinan. Mengupas daya saing kita dengan daerah lain pasti tidak akan habis satu malam. Maka sering saya katakan 2013 adalah tonggak kita menjadikan Sumut yang lebih sejahtera. Bayangkan Tapanuli Tengah dan Sibolga merupakan penghasil ikan dan punya pantai untuk dikelola. Sayang, pengelolaannya masih tertumpu pada pemerintah daerah dan warga setempat. Di Tapanuli Selatan dan Mandailing Natal punya kekayaan alam di pinggir pantai. Sayangnya belum ada upaya untuk menggali dan mengembangkan potensi. Padanglawas Utara dan Padanglawas juga dikenal penghasil sapi terbesar di Sumut. Tapi masih perlu pengembangan. Maukah kita biarkan Sumut terus merosot, dibiarkan, tanpa grand design? Saya berfikir memang Sumut Sejahtera itulah konsep paling pas dan mampu membawa kita kepada pertumbuhan nyata dan lebih baik. Bukan pertumbuhan semu.###

Waspada/Armin Nasution

GUS Irawan Pasaribu saat meresmikan GUS Center dan melaunching website di Jl. Pattimura Medan No. 342 Medan, Minggu (15/7).

Lakalantas... namun di saat bersamaan dari arah berlawanan muncul kendaraan yang dikendarai Chairiwansyah, putra Ketua PWI Cab.Serdang Bedagai, Chairuddin, sehingga tubrukan tidak dapat dihindarkan. Akibat peristiwa itu, Sugianto Siahaan dan Chairiwansyah tewas di perjalanan menuju rumah sakit, dua korban lainnya kritis. Petugas Poslantas Dolok Masihul dibantu warga sekitar yang turun ke TKP mengevakuasi para korban ke RSU. Kumpulan Pane Kota Tebing-tinggi. Korban Diki dirujuk ke RSU Medistra Lubukpakam, Frismando Simanjuntak dirujuk

Dua Kelompok... orang kader salah satu OKP asal Kec Medan Perjuangan yang mengendarai 3 sepeda motor melintas di Jl. Sekip, tiba-tiba diserang oleh puluhan pemuda berpakaian preman. Kekuatan yang tidak berimbang menyebabkan kelompok yang diserang tunggang langgang melarikan diri dari lokasi kejadian. Sepedamotor yang ditinggalkan, dalam tempo sekejap dibakar oleh penyerang. Penyerangan mendadak itu menyebabkan beberapa anggota kelompok yang diserang menderita luka bacok dan panah. Zulkifli terkena tebasan parang di tubuhnya, Karno, warga Sei Deli menderita luka tusuk anak panah di perut kiri dan mata kirinya. Seorang lagi belum diketahui identitasnya. Selanjutnya, kelompok yang diserang melaporkan

Ada-ada Saja... benda-benda yang bukan makanan. Di rumahnya, batu-batu ini bahkan selalu di simpannya di dalam lemari makan. Menurut wanita berusia 45 tahun itu, kebiasaannya tersebut tidak terkendali sebelum ia menikah. Namun setelah menikah dengan pria bernama Jim, Widener berhasil menahan kebiasaan anehnya itu. “Jim membuat saya bahagia, hingga akhirnya saya mengurangi kebiasaan saya. Tetapi kadang saya tetap memakan bebatuan. Hanya batu yang bisa membuat saya senang,” ujar Widener, seperti dikutip Metro, Jumat (13/7). Widener menghancurkan batu yang lebih besar hingga ke ukuran yang lebih bisa dikonsumsinya. (ok/rzl)

ke RSU.Sri Pamela Tebingtinggi. Korban kritis Frismando Simanjuntak ditemani ibunya Rosmalia,45, ketika ditemui Waspada diruang IX, Tusam kamar IV, RSU.Sri Pamela Tebingtinggi, Minggu (15/7) mengatakan, dia dibonceng teman sedesanya Toga Siahaan dari Desa Pekan Kamis bermaksud pulang, namun sebelum sampai di rumah keduanya mengalami kecelakaan Sementara, kecelakaan kedua terjadi Minggu (15/7) dinihari di Jalinsum KM 68-69 Dusun I, Desa Sukadami, Kec. Sei Bamban, Kab.Serdang Bedagai, antara sepeda motor Kanzen tanpa plat dikendarai Wahyudi,13, warga Dusun II,

Desa Mangga Dua, Kec. Tanjung Beringin dengan mobil pick up L-300 BK 8522 ZE dikendarai Hendy Chaniago,25, warga Desa Sambosar Raya, Kec.Kahaean, Kab. Simalungun. Akibat kecelakaan itu, Wahyudi tewas di lokasi kejadian. Sumber di kepolisian, peristiwa terjadi akibat korban Wahyudi yang dari arah Tebingtinggi menuju Medan melakukan balapan liar dengan kecepatan tinggi, sesampainya dilokasi kejadian mengambil jalur terlalu ke kanan sehingga menabrak depan pick-up. Kasatlantas Polres Sergai, AKP. Hasan Basri ketika dihubungi Waspada, membenarkan kedua kecelakaan. (c03)

peristiwa itu kepada rekanrekannya yang saat itu sedang berada di acara pelantikan. Mendapat laporan itu, ratusan orang dari kelompok yang diserang yang berada di lokasi pelantikan langsung melakukan pengejaran dengan memblokir jalan. Akibatnya, bentrok pecah di Jl. Sekip depan Universitas Prima Indonesia (UNPRI). Batu dan anak panah berterbangan di lokasi, arus lalu lintas macat .Sejumlah personil kepolisian yang turun ke TKP segera mengamankan lokasi dengan melerai kelompok yang bertikai, termasuk menyemprotkan gas air mata. Kapoldasu Irjen. Pol. Wisjnu Amat Sastro yang turun ke TKP langsung naik ke atas panggung menenangkan ratusan orang yang sudah tersulut

emosi. Didampingi tokoh pemuda seperti Boyke Turangan, Yan Paruhum Lubis, Kapoldasu meminta massa untuk tenang dan membubarkan diri. “ Saya hubungi Econ (Nesron Diapari ) suruh tarik anak buahmu, saya hubungi Boy (Boyke Turangan) untuk menenangkan anggotanya,” kata Kapolda kepada wartawan. Dalam kaitan ini, Kapoldasu menginstruksikan anggotanya untuk berpatroli di kantung-kantung massa untuk mencegah bentrok susulan. “Kedua belah pihak sudah saya suruh mundur, jangan ada penyerangan lagi,” kata Wisjnu. Pantauan Waspada, setelah suasana tenang dan kedua kelompok pemuda menahan diri, arus lalulintas yang sempat diblokir dibuka kembali sekira pukul 17:30.(m36/h04)

WASPADA Senin 16 Juli 2012

Medan Metropolitan


Bank Sumut Raih Trophy Platinum Award MEDAN ( Waspada): PT Bank Sumut berhasil mewujudkan impiannya merebut Trophy Platinum Award dari Info Bank, sebuah majalah analisis strategi perbankan dan keuangan ternama di Indonesia. Penghargaan itu diberikan atas reputasi Bank Sumut yang mampu mempertahankan kinerja sangat bagus selama 10 tahun berturut-turut. Bank Sumut meraih predikat “Sangat Bagus” untuk kelompok bank dengan aset di atas Rp10 triliun sampai dengan Rp50 triliun. Trophy bergengsi itu diserahkan oleh Direktur Infobank Benny Handhoni kepada Direktur Pemasaran dan Syariah Bank Sumut Zenilhar, di Pesanggrahan Kesultanan Yogyakarta, Jumat (13/6) malam. Wakil Pemimpin redaksi/ Penanggung Jawab Majalah Infobank Eko B Supriyanto menggatakan, Tim Riset Infobank sebelumnya telah melakukan rating 120 bank dari laporan keuangan tahun 20102011 dengan menggunakan lima kriteria utama yang terbagi dalam tujuh rasio keuangan dan empat rasio pertumbuhan. Indikator dimaksud antara lain rasio permodalan, kualitas Waspada/Mursal AI

WALI KOTA Medan Rahudman Harahap mencoreng harga gula yang seharusnya Rp12.840/kg menjadi Rp11.340/kg pada saat pembukaan Pasar Murah Pemko Medan, di lapangan Bola Jln. Mangaan Medan Deli, Minggu (15/7).

Grosir Jangan Timbun Barang Pasar Murah Pemko Medan Dimulai MEDAN (Waspada): Wali Kota Medan H Rahudman Harahap mengingatkan sejumlah grosir untuk tidak menimbun barang yang nantinya berdampak pada kenaikan harga.

Hal tersebut dikatakan Rahudman saat pembukaan Pasar Murah Pemko Medan, di lapangan bola Jln. Mangaan Medan Deli, Minggu (15/7). “Para grosir jangan coba-coba menimbun barang untuk menaikan harga, karena kita tidak menginginkan ini, dan Pemko

Medan akan melakukan operasi pasar dengan unsur koordinasi pimpinan daerah Kota Medan, bersama DPRD Kota Medan, dan ini memang sudah biasa dilakukan menjelang hari-hari besar keagamaan,” sebutnya. Terkait pelaksanaan pasar murah, Menurut Rahudman, bertujuan untuk membantu masyarakat kurang mampu memenuhi kebutuhan bahan pokok dengan melakukan stabilitas harga pasar, sehingga tidak ada gejolak harga. “Pasar murah ini digelar agar suasana Ramadhan lebih khusuk, untuk itulah

semua masyarakat yang mendapatkan raskin disalurkan dua bulan sekaligus, sampai kebutuhan hari raya,” katanya. Rahudman mengingatkan, tidak ada sistem belanja borongan di pasar murah, namun berbelanja harus sesuai dengan kebutuhan, untuk itulah pasar murah ini perlu pengawasan mulai dari kepala lingkungan, lurah, dan camat. “Saya ingatkan kepada panitia penyelenggara dan pihak terkait, camat, lurah agar melaksanakan, mengawasi dan mensukseskan pasar murah ini,

jangan biarkan Disperindag bekerja sendiri, agar tujuan pasar murah ini tepat sasaran,“ ujarnya. Adapun harga yang tertera di pasar murah, seperti Gula Pasir Rp11.340/kg, Beras Rp6. 250/kg, Tepung Terigu Rp5.960/ kg, Telur Rp 800/btr, Blue Band Rp4.160/saset, Kacang Tanah Rp16.250/kg, Kacang Kupas Rp22.750/kg, Minyak curah Rp8.200/ltr, Migor Sania Rp10.500/ltr, Marqisa Pohon Pinang Rp9.250/btl. Marqisa Sarang Tawon Rp12.000/btl dan Syrup Kurnia Rp11.850/btl. Kepala Dinas Perindustrian

dan Perdagangan H Syahrizal Arif mengatakan, pasar murah tahun 2012 ini merupakan tahun yang kesembilan, yang digelar selama 30 hari dimulai dari 15 Juli sampai 14 Agustus 2012 di 151 titik di 21 kecamatan. “Dengan subsidi harga dari Pemko Medan sebesar Rp5,8 miliar dengan dukungan 27 produsen/ distributor yang memasok kebutuhan seperti, gula pasir, tepung terigu, marqisa, syrup, kacang tanah, blue band, telur, dan pasar murah ini juga didukung para UKMdanhomeindustriyangada di Kota Medan,” jelasnya. (h02)

Gus Irawan Terpilih Jadi Ketua IKA-MM USU MEDAN (Waspada): Ketua baru Ikatan Alumni Magister Manajemen Universitas Sumatera Utara (IKA-MM USU) priode 2012-2014 Gus Irawan Pasaribu terpilih secara aklamasi pada musyawarah anggota III yang digelar di Clubhouse Royal Sumatra, Medan, Jumat (13/7). “Tak diwarnai banyak dialog atau perdebatan, tim formatur

langsung memutuskan calon tunggal Gus Irawan Pasaribu sebagai ketua,” kata Koordinator Humas Kepanitiaan Musyawarah Anggota III IKA-MM-USU Arsyadona Nasution MM, menjawab Waspada, Minggu (15/7). Menurut dia, terpilihnya Gus Irawan Pasaribu karena dedikasinya terhadap perkembangan dunia ekonomi baik

lokal maupun nasional begitu tinggi. Hal ini terbukti saat Gus Irawan memimpin Bank Sumut. Dengan kemampuan beliau Bank Sumut bisa menjadi salah satu bank terbaik di negeri ini. “Kemampuan dan rekam jejak beliau, membuat peserta musyawarah anggota III merasa tepat dan sepakat memilihnya secara aklamasi memimpin

gerbong IKA–MM USU dua tahun kedepan, “ sebutnya. Dia mengatakan, sistem mufakat ini, seluruh agenda acara terlaksana dengan lancar. Mulai dari sidang pleno hingga pemilihan tim formatur seluruhnya berlangsung tertib dan sukses. Sebelum sampai kepada agenda pemilihan tim formatur, acara musyawarah aggota III

Waspada/Surya Efendi

GUS Irawan Pasaribu (no.9 kiri) bersama pengurus IKA MM dalam Musyawarah Anggota III di Royal Sumatra Jln. Djamin Ginting Medan.

diawali pembukaan oleh Arsyadona, lalu pembacaan doa oleh Drs HM Ridwan SAg, MPSi. Kemudian, laporan ketua panitia musyawarah anggota III Drs Panusunan Pasaribu MM, diteruskan sidang paripurna dipimpin Ir Maulana Tamba MM, dan dilanjutkan laporan pertanggungjawaban Ketua Umum IKA MM USU Periode 2004–2006 Drs Ramli MM, diwakili Wakil Ketua Umum Drs Adios Gusri MM. Tidak ketinggalan penyusunan program kerja IKA-MM USU kedepan. Turut memberikan sambutan sekaligus membuka musyawarah anggota III IKA-MM USU, Ketua Jurusan Program Studi Magister Manajemen USU Prof Dr Ir Darwin Sitompul M.Eng yang mengharapkan ikatan ini membawa kontribusi maksimal bagi USU, Provinsi Sumatera Utara, dan Indonesia.”Universitas hebat karena alumninya yang hebat,” katanya. Sedangkan Gus Irawan Pasaribu MM usai terpilih sebagai Ketua Umum IKA-MM USU periode 2012-2014 mengatakan, akan memberikan yang terbaik bagi organisasi alumni ini. “Ini sebagai langkah awal sejarah MM USU kedepannya. Melalui wadah ini kita berikan kontribusi dan meningkatkan level USU, terutama Magister Manajemen pada dunia pendidikan di Indonesia,” ujarnya. Gus berharap, siapapun yang nantinya berada di kepengurusan mohon dengan ikhlas bersama membangun MM USU ke depan. “Terima kasih atas kepercayaan yang diberikan,” katanya. Hadir dalam acara itu, Sekretaris Program Studi MM USU Dr Ir Nazaruddin Matondang MT, Prof Dr Ir Sukaria Sinulingga M.En, Ir Maulana Pohan MM, Drs Arsyad Lubis MM, Drs Akmaluddin Batubara MM, Dra Nar umondang B Siregar MM, Briliant Moktar MM, Drs Sofyan Raz Ak, MM, Parlindungan Purba MM, Johny R Tampubolon MM, dan Mangindar Simbolon MM. Acara dimeriahkan dengan hiburan yang dirancang begitu apik oleh Koordinator Hiburan Musyawarah Anggota III IKAMM USU Erucakra Mahameru MM. (m49)

aset, rentabilitas, likuiditas, efisiensi, pertumbuhan modal, dana, kredit, dan laba. “Sebagian besar bank yang dirating meraih pertumbuhan kredit dan laba yang signifikan, termasuk Bank Sumut yang setiap tahun selalu menunjukkan kinerja sangat baik,” jelasnya. Keberhasilan Bank Sumut meraih Trophy Platinum Award, menurut Eko, merupakan pembuktian reputasi Bank Sumut atas fondasi fundamentalnya yang kuat, baik dari aspek permodalan, aset, manajemen kinerja, dan pertumbuhan volume usaha. Direktur Pemasaran dan Syariah Bank Sumut Zenilhar mengatakan, keberhasilan itu tidak terlepas dari kerja keras, kerja cerdas, dan kebersung-guhan segenap jajaran direksi dan staf karyawan Bank Sumut untuk bekerja secara profesional, yang juga didukung oleh seluruh pemegang saham dan masyarakat Sumatera Utara khususnya nasabah Bank Sumut. “Kepercayaan besar yang

diberikan oleh pemegang saham dan seluruh nasabah Bank Sumut merupakan hutang bagi kami yang harus dibayar dengan kebersungguhan manajemen untuk meningkatkan kinerja dan memberikan pelayanan perbankan secara profesional,” kata Zenilhar. Bank Sumut sampai akhir tahun 2011 telah memiliki aset Rp21,2 triliun atau meningkat 45% dibanding aset tahun 2010 yang mencapai Rp14,6 triliun. Pertumbuhan laba juga terus meningkat setiap tahun. Menutup Tahun Buku 2011, perolehan laba mencapai Rp593 miliar. Sedangkan rasio keuangan tahun 2011 antara lain CAR 14,66%, NPL 2,56%, LDR 78,56% dan ROE 30,68%. Bank Sumut sebelumnya juga meraih predikat BUMD of The Year 2010 sebagai BUMD terbaik dari lebih 2000 BUMD se-Indonesia. Penghargaan itu diterima pada Januari 2011 yang diberikan oleh Badan Kerjasama BUMD seluruh Indonesia bekerjasama dengan Majalah Business Review. (m28)

Gerindra Tidak Perlu Umbar Janji BELAWAN (Waspada): Partai Gerindra dibentuk dan hadir ditengah- tengah masyarakat, sehingga tidak perlu mengumbar janji. Hal itu dikatakan Ketua Dewan Pimpinan Cabang (DPC) Partai Gerindra Kota Medan Yohana Pardede pada acara bhakti sosial sunatan masal dan pelantikan pengurus Pimpinan Anak Cabang (PAC) Partai Gerindra Kec. Medan Marelan, di lapangan sepakbola Pasar V, Marelan, Sabtu (14/7). Dijelaskan Yohana, partai Gerindra dalam kebijakan politiknya tidak perlu mengumbar janji untuk mengambil simpatik masyarakat, karena masyarakat Indonesia yang serba majemuk semakin lama semakin pintar dalam mengkritisi sesuatu. “Yang penting ucapan sesuai dengan kenyataan, jadi jangan sukamengumbarjanji,”tegasnya. Kepada pengurus dan kader partai, dalam menjalankan roda organisasi diminta tetap berpegang teguh pada AD/ART yang sudah digariskan dan bijak menyerap aspirasi masyarakat untuk dijadikan program partai dalam membangun masyarakat. Sementara itu, Ketua PAC Partai Gerindra Kec. Medan Marelan Surianto SH alias Butong didampingi sekretaris Dedek mengaku siap mengemban amanah dan siap menjalankan roda organisasi sesuai AD/ART. “Kita siap bekerjasama dan memenangkan setiap even-even pesta demokrasi di Kota Medan, khususnya Medan Marelan,” sebut Butong. Hadir acara itu Ketua DPD Gerindra Sumut Ramses Simbolon, perwakilan DPP Gerindra Sahala Silalahi, bendahara PAC Gerindra Uci, Camat Medan Marelan Pulungan Harahap, dan Sekcam Ahmad serta Danramil 10-MM dan pengurus PAC Partai Gerindra se-Kota Medan beserta simpatisannya. (h03)


DIREKTUR Pemasaran dan Syariah Bank Sumut Zenilhar menerima Trophy Platihum Award yang diserahkan Direktur Infobank Benny Handhoni di Pesanggrahan KesultananYogyakarta, Jumat (13/6) malam.


Medan Metropolitan

WASPADA Senin 16 Juli 2012

Gatot Resmikan Masjid Ar-Raudhah

PLT GUBSU Gatot Pujo Nugroho menandatangani prasasti peresmian Masjid Kampung Susuk di Jl Abdul Hakim Medan, Jumat (13/7).

Waspada/Amir Syarifuddin

Pemukulan Polantas Tindakan Brutal MEDAN (Waspada): Pemukulan terhadap anggota polisi lalulintas (Polantas) yang dilakukan pengendara sepedamotor dinilai merupakan tindakan brutal. Ketua Komisi A DPRD Sumut Isma Padli Pulungan, minta polisi segera menangkap pelakunya. Isma Padli dihubungi melalui telepon, Minggu (15/7). Dia mengomentari peristiwa pemukulan terhadap Polantas di Jln. Brigjen Katamso – Jln. Ani Idrus,

Bripka Julius Lumban S, babak belur dihajar pengendara sepedamotor yang tidak terima teman wanitanya ditilang, Sabtu (14/7). Menurut Isma Padli, terlepas dariprilakupetugasPolantasyang kurang baik di lapangan, tapi tindakan brutal oleh masyarakat tidak boleh terjadi. Negara ini dibangun berlandaskan hukum. Karenanya, prilaku main hakim sendiri tidak dapat dibenarkan. Isma Padli, mengaku mengetahui peristiwa itu dari berita surat kabar. Tapi informasinya masih sangat kabur. Kesannya, wanita pengendara sepedamo-

AMIK MBP Peringati Israk Mikraj MEDAN (Waspada): Ikatan Mahasiswa Islam (IMI) AMIK MBP memperingati Israk dan Mikraj Nabi Besar Muhammad SAW 1433 H dalam suatu acara yang dirangkai dengan pelantikan pengurus baru IMI periode 2012-2013, dan pemberian santuan kepada anak yatim bertempat di aula kampus Jln. Letjen Jamin Ginting, Medan, baru-baru ini. Turut hadir Ketua Yayasan Mandiri Bina Prestasi (MBP) dr Anna Mari Ulina Bukit, Direktur AMIK MPB yang diwakili Pembantu Direktur III Iswanto Sembiring ST, M.Pd, Direktur Politeknik MBP Drs Tenang Malem Tarigan M.Si, AK, Humas Drs Romanus Sipayung, serta 200 mahasiswa dan dosen. Ketua Yayasan MBP dr Anna Mari Ulina Bukit menyatakan bangga karena mahasiswa yang tergabung dalam IMI mampu menggelar acara keagamaan seperti peringatan Israk Mikraj Nabi Besar Muhammad SAW, padahal pada periode ini baru dibentuk kepengurusan baru. Dia mengharapkan peringatan Israk Mikraj ini jangan sekedar acara seremonial tetapi dapat dijadikan sebagai memotivasi diri untuk bangkit dan giat belajar, sekaligus untuk meningkatkan prestasi akademik sehingga bisa mendapatkan pengetahuan yang benar, bermanfaat bagi diri dan masyarakat. Sementara Ustadz Drs Ahmad Taufik Lubis dalam ceramahnya mengajak para mahasiswa untuk mencontoh jejak perjalanan dan perjuangan Nabi Besar Muhammad SAW yang melakukan hijrah dari tempat yang tidak nyaman ke tempat yang lebih nyaman, walau mesti dilalui dengan proses dan liku-liku yang terkadang penuh dengan tantangan. Lubis mengingatkan, dalam menuntut atau mendapatkan ilmu pengetahuan di sekolah atau perguruan tinggi, para mahasiswa untuk melakukan hijrah dari tadi belum tahu bisa menjadi tahu dengan pendalaman ilmiah dan intelektual. Peringatan Israk Mikraj itu dirangkaikan denganpelantikan pengurus baru IMI AMIK MBP, serta memberi santuan kepada anak yatim Yayasan Pendidikan Islam Padang Bulan. (m22)

Alumni SMAN 6 Gelar Pengajian MEDAN (Waspada) : Tradisi menyambut datangnya bulan suci Ramadhan janganlah sampai disalahniatkan. Karena jika salah niat, nanti akan menjadi sirik, seperti ziarah ke makam, mandi pangir, dan termasuk juga punggahan. “Ziarah ke makam itu bisa kapan saja dilakukan, dan tidak semestinya pada saat menyambut bulan suci Ramadhan,” kata Al Ustadz Drs H Dahron Hasibuan saat memberikan tausiyah pada pengajian akbar dan silaturrahim alumni SMA Negeri 6 Medan, di kediaman Ketua Alumni SMAN 6 Medan angkatan 1981 H Junirwan Kurniawan SH, di Kompleks Taman Setia Budi Medan, Sabtu (14/7). Dahron mengatakan, laksanakanlah sunah Rasul dengan memperbanyak puasa Sya’ban. Selain itu sebelum menyambut datangnya bulan suci, umat Islam dianjurkan untuk meminta maaf kepada orangtua yang masih ada, juga kepada suami ataupun istri dan orang-orang di sekitar kita. Menurutnya, ada beberapa kriteria sikap seseorang ketika bulan puasa tiba, yakni sikap orang yang merasa terusik, sikap apatis atau tidak mau tahu dan sikap yang senang menyambut datangnya bulan yang penuh dirahmati Allah SWT. “Dalam hadist Rasul, barang siapa yang merasa gembira menyambut datangnya bulan Ramadhan, maka Allah haramkan jasadnya itu di api neraka,” sebutnya. Sementara itu, Alumni SMAN 6 Medan angkatan 1981 Enda Mara Lubis, yang juga anggota DPRD Sumut Fraksi Partai Demokrat mengatakan, kegiatan pengajian ini merupakan kegiatan rutin yang dilaksanakan setiap dua bulan sekali secara bergilir, yang bertujuan untuk menambah pemahaman ilmu agama dan memperkuat tali silaturahmi antar sesama alumni, yang digelar sejak tahun 2007. Pengajian akbar itu juga dihadiri Rektor ITM Prof Dr Ir H Ilmi Abdullah MSC, Kepala Biro Pemerintahan Provsu H Naufal Mahyar dan pengusaha RM Garuda Zul Helfi ini juga memberikan santunan kepada 50 orang anak yatim piatu yang ada di Jln. Setia Budi, Jln. Koserna, dan kawasan Medan Area. “Kitaharapkankepadarekan-rekanparaalumniterutamaangkatan 1981, lebih peduli dan bersatu padu dalam suasana persaudaraan serta mengangkat kejayaan SMAN 6 Medan,” ujar Enda didampingi Rahmat Wahid Nasution dan Ustadz Supardi Chan.(h04)

tor itu marah karena ditilang. Setelah beberapa saat dia menelepon, datang dua orang pria berambut cepak dan menganiaya Polantas tersebut. Diduga, pria berambut cepak itu juga alat negara, karena juga memiliki pistol. “Tapi kita belum tahu siapa pria itu dan apa hubungannya dengan wanita yang ditilang itu,” sebutnya. Tapi, terlepas dari keterlibatan dua pria tersebut pada kasus ini, prilakunya menganiaya polisi jelas salah. Menurut Isma, polisi tidak bisa mendiamkan peristiwa ini. Jangan sampai

citra Polri tercoreng oleh prilaku brutal masyarakat. Ubah sikap Menjawab Waspada, Ketua Komisi A DPRD Sumut, yang membidangi masalah hukum dan keamanan ini mengatakan, sepakat kalau petugas kepolisian juga harus merubah sikap. Menurut Isma Padli, sangat banyak aparat kepolisian di lapangan bersikap tidak profesional. Menurut dia, sikap masyarakat Sumut memang beda dengan masyarakat lain di Indonesia. Itu dapat dilihat dari cara mereka berlalulintas yang

sangat tidak tertib. Itu menunjukkan kalau sifat masyarakat kita cenderung emosional. Dalam konteks ini, ujar Isma Padli, aparat kepolisian harusnya lebih arif dalam bertindak. Jangan malah menunjukkan sikap-sikap arogan, dengan langsung mencabut kunci kontak kendaraan, atau langsung menulis buku tilang, tanpa menjelaskan pelanggaran apa yang dilakukan pengendara. “Inilah yang kemudian sering membuat pertengkaran antara pengendara dan polisi,” sebutnya. (m12)

FPD Tuntut Bagi Hasil Sektor Perkebunan MEDAN (Waspada): Fraksi Partai Demokrat (FPD) DPRD Sumut mengajak seluruh pemangku kebijakan di Sumut satu bahasa, menuntut pemerintah pusat merevisi UU tentang perimbangan keuangan antara pemerintah pusat dan daerah. Yakni berupa bagi hasil sektor perkebunan. Ketua FPD DPRD SumutTahan Manahan Panggabean mengatakan itu, Minggu (15/ 7). Dia menyoroti tentang UU No. 25/1999 tentang perimbangan keuangan antara pemerintah pusat dan daerah. Menurutnya, UU tersebut tidak adil, karena tidak ada pasal yang menyebut tentang pembagian devisa dari sektor perkebunan. Berkaitan dengan hal itu, FPD mengajak seluruh elemen, baik DPRD Sumut, Pemprovsu, DPD dan DPRI asal Sumut satu bahasa.Yakni menuntut pemerintah pusat merevisi UU No.25/ 1999 tersebut. Karena, menurut Tahan, satu-satunya cara agar Sumut memperoleh pembagian devisa adalah dari sektor perkebunan.

Kata dia, devisa ekspor hasil perkebunan Sumut setiap tahunnya Rp220 triliun lebih. Sementara pendapatan dari bea keluar (pajak ekspor) komoditi sawit dan karet Sumut Rp28 triliun lebih. “Tapi kita (Sumut) tidak mendapat apa-apa. Karena dalam UU No.25 itu tidak ada pasal menyebut tentang pembagian devisa dari sektor perkebunan,” ujarnya. Sekretaris DPD Partai Demokrat Sumut ini melihat, UU No25/1999 yang dilahirkan pasca reformasi ini sangat diskriminatif bagi Sumut. Buktinya tidak ada satu pasalpun mengatur tentang perimbangan keuangan sektor perkebunan. Sementara untuk sektor kehutanan, pertambangan umum dan perikanan, sangat jelas diatur. Yakni 20 persen untuk pemerintah pusat dan 80 persen untuk daerah. Begitu juga penerimaan negara dari pertambangan minyak dan gas alam yang dihasilkan daerah, lanjut Tahan, sangat jelas diatur. Setelah dikurangi komponen pajak sesuai dengan

ketentuan, dibagi dengan imbangan 85 persen untuk pemerintah pusat dan 15 persen untuk pemerintah daerah. Atau 70 persen untuk pemerintah pusat dan 30 persen untuk daerah. Desakan kepada pemerintah pusat, katanya, harus terus dilakukan. Plt Gubsu Gatot Pujo Nugroho disarankan untuk membentuk konsorsium dengan provinsi lain sesama penghasil produk seperti Riau dan Kalimantan. “Tambahkan saja satu pasal dalam UU itu. Yakni peneri maan negara dari sektor perkebunan dengan imbangan 40 persen untuk daerah dan 60 persen untuk pemerintah pusat,” sebutnya. Kalau tuntutan revisi itu berhasil, Sumut akan sangat maju. APBD Sumut yang saat ini hanya Rp7 triliun akan meningkat tajam ke angka Rp50 triliun. Tentunya dalam sekejap, perekonomaian masyarakat dan pembangunan di berbagai bidang, terutama perbaikan infrastruktur akan berkembang pesat di daerah ini. (m12)

MEDAN ( Waspada): Pelaksana tugas Gubernur Sumatera Utara H Gatot Pujo Nugroho ST, meresmikan Masjid Ar-Raudhah Kampung Susuk, Jumat (13/7). Gatot berharap masjid yang dekat lingkungan kampus USU ini selain jadi tempat ibadah juga menjadi tempat diskusi. Peresmian masjid yang terletak di Jln. Abdul Hakim Medan ini ditandai dengan penandatangan prasasti oleh Plt Gubsu. Dalam shalat Jumat perdana di masjid tersebut, Gatot juga bertindak sebagai imam. Dikatakan Gatot, keberadaan masjid tersebut sangat membantu sekali karena terletak di dekat kampus USU, sehingga dapat digunakan para mahasiswa muslim yang kos untuk beribadah dan berdiskusi. “Rasa syukur yang sedalam-dalamnya tentu adalah seperti yang diingatkan Allah SWT kepada kita.Yakni beramallah, bekerjalah, berprestasilah maka amal kerja dan prestasi itu adalah bagian dari wujud syukur kita kepada Allah SWT. Dengan peresmian masjid ini menjadi bagian perekat persaudaraan antara kita yang ada di Kampung Susuk ini. Jelas bagi kita bahwa yang terbaik di sisi Allah SWT adalah pengabdian dan itu adalah taqwa dan taqwa itu pengabdian yang diimplementasi kepada nilai-nilai iman kehidupan keseharian kita,” ujarnya. Gatot mengatakan, untuk mewujudkan rasa syukur yang mendalam tentunya menjadi tugas semua umat di Kampung Susuk untuk memakmurkan masjid ini. Misalnya, dengan membentuk kepengurusan, menghadirkan wirid-wirid pengajian dan ada program kegiatan

lain yang akan membuat umat rajin mendatangi masjid untuk beribadah dan shalat berjamaah. Gatot berharap, dengan resminya operasional Masjid Ar-Raudhah ini nantinya dapat menjadi markas dakwah serta belajar bagi mahasiswamahasiswa sebagai calon-calon pemimpin masa depan. ”Kalau dulu tahun 1983 saya ngekos di sini dan sekarang menjadi Plt Gubsu sepuluh tahun ke depan tentu dari Kampung Susuk ini juga akan ada yang menjadi gubernur maupun wali kota,” sebutnya sembari mengenang masa lalunya saat tinggal di Kampung Susuk. Ketua Panitia Ismet Sinulingga mengucapkan rasa syukurnya atas peresmian masjid yang telah lama dinantikan tersebut. Seperti diketahui, masjid berdiri atas swadaya masyarakat sekitar dan mulai proses pembangunannya yang panjang yakni selama empat tahun. ”Kami telah lama merindukan masjid ini, alhamdulilah masjid ini akhirnya rampung juga dan yang lebih membanggakannya lagi Pak Gubernur bersedia datang untuk meresmikannya,” katanya. Tokoh masyarakat Kampung Susuk Salomo Perangin-angin mengatakan, hari ini merupakan sejarah bagi Kampung Susuk karena hadirnya Plt Gubsu H Gatot Pujo Nugroho ST, yang meresmikan masjid di kampung mereka. ”Masyarakat Kampung Susuk jumlahnya 350 orang yang kos lebih kurang 1.000 orang, jadi banyak orang pendatang tapi kami semua damai, tak ada gontok-gontokan. Jadi itu yang kita harapkan baik agama Islam maupun agama Kristen satu keluarga yakni keluarga besar Kampung Susuk,” tuturnya.(m28)

MUI Halalkan KB Pria Vasektomi MEDAN (Waspada): Majelis Ulama Indonesia (MUI) mengeluarkan fatwa tentang diperbolehkannya dilaksanakan kontrasepsi mantap (kontap) atau vasektomi bagi pria. Fatwa itu dikeluarkan pada 1 Juli 2012 lalu di Pondok Pesantren Cipasung Tasik Jawa Timur. “Kota Medan daerah pertama tempat sosialisasi fatwa vasektomi ini. Diharapkan kedepan dapat disosialisasikan keseluruh daerah lainnya,” kata Sekjen MUI Pusat DR H Amirsyah Tambunan, di Hotel Dharma Deli, dalam sosialisasi Fatwa Halal Vasektomi bersama Badan Kependudukan dan Keluarga Berencana Nasional (BkkbN) Sumut, Jumat (13/7). Dijelaskan Amirsyah, ada tiga alasan vasektomi diperbolehkan, pertama, dasar akademis dengan berbagai argumentasi kajian. Kedua, dasar atau dalil yang kuat berdasarkan sumber Islam demi kemaslahatan umat. Ketiga, dasar medis dapat menjamin masih terjadinya kehamilan istri bila diinginkan peserta vasektomi. “Tapi syaratnya vasektomi itu tidak digunakan untuk tujuan maksiat. Dari dasar tersebut, MUI menetapkan fatwa vasektomi diperbolehkan, kendati sebelumnya MUI mengharamkan dilakukannya vasektomi pria,” sebutnya. Menurutnya, Situbondo merupakan daerah percontohan vasektomi, dimana terdapat 1.000 lebih pria yang divasektomi. “Dari jumlah tersebut, terdapat sejumlah tokoh agama yang ikut di dalam program BkkbN. Mengubah fatwa vasektomi dari haram menjadi mubal atau boleh bukanlah perkara mudah. MUI memerlukan

waktu sembilan tahun untuk melakukan pembahasan,” jelasnya. Maka dari itu, lanjutnya, setelah adanya pertemuan rutin yang digagas di Jakarta sembilan tahun lalu. MUI saat itu berpendapat bahwa vasektomi haram. Lantas pada pertemuan tiga tahun lalu kemudian di Gontor Ponorogo Vasektomi tetap saja dilabeli haram. Sementara itu, Kepala BkkbN Sumu Drg Widwiono MKes mengatakan, salah satu kendala masyarakat mau mengikuti KB adalah adanya anggapan menggunakan alat kontrasepsi haram hukumnya. Anggapan ini masih sangat kental dimasyarakat, terutama dikalangan konservatif. “Dikeluarkannya fatwa MUI halal KB vasektomi kita sambut baik dan kita akan mengejar target untuk menambah jumlah peserta KB dan pria KB vasektomi,” katanya. Pada dasarnya, kata Widwiono, tujuan KB juga untuk mensejahterakan kehidupan masyarakat. Dengan mengendalikan pertumbuhan penduduk, maka ketersediaan penghidupan dan sumberdaya yang tersedia juga dapat diiseimbangkan. Vasektomi merupakan pemotongan saluran sperma (vasdeferens) sepanjang 1-2 cm disertai pengikatan pada masing-masing ujung potongan yang tertinggal. Sedangkan menurut ahli dan BkkbN, vasektomi merupakan kontrasepsi mantap, tetapi harus memenuhi syarat, yakni anak minimal dua orang usia minimal 30 tahun, tidak ada kontraindikasi dan atas persetujuan istri. (h02)

Distribusi Air PDAM Kawasan Polonia Terganggu MEDAN (Waspada): Dalam rangka meningkatkan pelayanan kepada pelanggan, PDAM Tirtanadi akan melaksanakan pekerjaan relokasi pipa transmisi diameter 375 mm Cast Iron (CI) jalur Sibolangit di Jalan Karang Sari, Polonia, Senin (16/7) malam. Demikian diungkapkan Kepala Divisi Public Relations PDAM Tirtanadi Ir Amrun dalam siaran persnya. Kata dia, pipa transmisi diameter 375 mm yang melintasi kawasan CBD Polonia merupakan pipa lama (peninggalan Belanda) dan diperkirakan sudah mengalami penyempitan diameter dalam pipa, sehingga aliran air menjadi kecil dan tidak lancar. Pipa tersebut akan diganti dengan pipa transmisi diameter 400 mm PVC. “Pemasangan pipa transmisi baru diameter 400 mm PVC sudah selesai, tinggal sekarang pemotongan pipa transmisi lama diameter 375 mm dan kemudian digabungkan dengan pipa transmisi baru diameter 400 mm,” ujarnya. Menurut Amrun, pekerjaan itu akan dilaksanakan, Senin malam pukul 21:00Wib, dan diperki-

rakan baru akan selesai Selasa (17/5) pukul 05:00 Wib dinihari. “Selama pelaksaaan pekerjaan ini dan beberapa hari kemudian, sebagian wilayah pelayanan Cabang Medan Kota, akan mengalami gangguan pendistribusian air karena proses pengisian jalur pipa memerlukan waktu yang agak lama karena pendistribusian sumber air Sibolangit dilakukan secara gravitasi bukan dengan pompa,” katanya. Wilayah yang mengalami gangguan, baik kualitas, kuantitas maupun kontinutas adalah kawasan sekitar Polonia, khususnya Bandara Polonia, Kompleks TNI AU Polonia, Daerah Karang Sari, Perumahan Polonia, Jln. Sudirman sekitaran gubernuran, Jln. Juanda, Jln. Mongonsidi, Jln. Zainul Arifin, Starban. Penditribusian air baru akan normal kembali pada Rabu (18/7). “Kami mohon maaf atas gangguan ini, keluhan dapat disampaikan ke Kantor Cabang Medan Kota Jln. SM. Raja No. 1 Medan atau atau melalui Call Center Tirtanadi ke nomor 555400,” sebut Amrun.(cwan)

Tukang Emas Bantu Korban Kebakaran penyaluran bantuan korban kebakaran Bagan Deli Khaidir Panjaitan didampingi sekretarisnya Johary Ayat SH, menyampaikan ucapan terimakasih atas kepedulian PTMBS. Hingga saat ini bantuan bahan pokok yang telah disalurkan kepada 38 KK korban kebakaran diperkirakan sudah cukup untuk stok bulan Ramadhan. Sekarang warga sangat membutuhkan bantuan bahan bangunan, utamanya kayu, papan atap, dan paku agar mereka bisa mendirikan kembali rumahnya yang telah terbakar. “Kami sangat berharap kedatanganWali Kota Medan Drs Rahudman Harahap yang telah berjanji akan memberikan bahan bangunan dan hingga kini anak-anak kami tidur berselimut angin malam di bawah tenda seadanya,” ujar Khaidir Panjaitan. (h03)

Pujakesuma Pelopor Menuju Sumut Sejahtera

BELAWAN (Waspada): Pengurus dan anggota Persatuan Tukang Emas Belawan Sekitarnya (PTMBS) memberi bantuan sembako kepada 38 kepala keluarga (KK) korban kebakaran di Lingk 3 Lorong Proyek, Kel. Bagan Deli, Kec. Medan Belawan, baru-baru ini. Bantuan senilai Rp11 juta itu terdiri dari beras 38 karung @ 15 kg, minyak goreng 38 kemasan @ 2 liter, gula pasir 38 bungkusan @ 2 kg, mi instan 38 dus, telur ayam 38 papan @ 30 butir, air mineral 15 dus, dan uang untuk pembeli sayur-mayur. Ketua PTMBS Alpenus Angkat SE, didampingi wakilnya Benyamin Pelawi dan Charles Jhonson mengatakan, bantuan itu merupakan wujud kepedulian PTMBS terhadap apa yang dirasakan warga korban kebakaran. “Semoga bantuan itu dapat meringankan beban mereka,” katanya. Sementara itu, koordinator penerima dan

MEDAN (Waspada): Dalam usianya yang kini mencapai 32 tahun, organisasi Putra Jawa Kelahiran Sumatera (Pujakesuma) makin strategis. Tak heran, jika Hari Ulang Tahun ke 32 menjadi momen untuk mengukuhkan identitas dan jati diri dan pertanda warga Jawa di Sumatera Utara benar -benar bersatu serta berperan dalam pembangunan bangsa. Demikian dikatakan Pelaksana Tugas Gubernur Sumatera Utara (Plt Gubsu) H Gatot Pujo Nugroho ST, dalam perayaan HUT Pujakesuma di Kompleks Bisnis Jln. Ringroad Gagak Hitam Medan, Sabtu (14/7). Selaku Dewan Pembina Pujakesuma, Gatot mengakui, penguatan kelembagaan masyarakat termasuk Pujakesuma merupakan salah satu strategi penting dalam menyatukan aksi dan visi yang sama bagi warga Jawa Sumut. Kesatuan aksi dan visi ini penting untuk menja-

KETUA PTMBS Alpenus Angkat memberikan bantuan kepada seorang ibu perwakilan korban kebakaran di Kel. Bagan Deli, Kec. Medan Belawan.

lankan amanah budaya leluhur, berfikir, berbuat dan bertindak kerakyatan dan menjunjung persatuan nasional. Dia mengatakan, keberadaan masyarakat Jawa di Sumut, sangat memiliki peran dan andil besar membina harmonisasi dan kerukunan antar etnis. Termasuk tentunya dukungan dalam pergerakan ekonomi masyarakat. Harmonisasi dan keberhasilan menjalankan budaya leluhur, termasuk yang digagas Pujakesuma diakui sangat berperan penting menangkis dampak negatif globalisasi. Sehingga ketimpangan ekonomi maupun politik dalam interaksi global dapat dicegah dan diatasi. “Ketahanan budaya merupakan benteng kuat agar identitas Indonesia tidak tercabut dari akarnya akibat infiltrasi budaya asing yang masuk tanpa tersaring dari berbagai penjuru dunia,” tegas Gatot.

Untuk itu dalam momentum ulang tahun ke-32 Pujakesuma harus meningkatkan pengetahuannya sehingga eksistensi mereka dapat ikut membangun serta memajukan Sumatera Utara sesuai dengan kemampuan yang dimiliki di masa datang. ”Di samping itu saya berharap Pujakesuma menjadi pelopor dan mempererat persatuan kesatuan menuju Sumut yang maju sejahtera,” harapnya. Acara ulang tahun Pujakesuma yang ke 32 ditandai dengan pemotongan tumpeng oleh H Gatot Pujo Nugroho, ST. Dia memberikan potongan tumpeng satu persatu kepada sesepuh Pujakesuma yang hadir. Selain memperingati ulangtahunnya, kegiatan ini dirangkai dengan peringatan Israk Mikraj Nabi Muhammad SAW dan menyambut datangnya bulan suci Ramadhan 1433 H. (m28)

Waspada/ Rustam Effendi

Medan Metropolitan Prihatin Medan Sebagai Kota Metropolitan


WASPADA Senin 16 Juli 2012

MEDAN (Waspada): Pemerhati dan pengamat transportasi dan tata ruang Ir Filiyanti TA Bangun, Grad.Dipl.PM, M.Eng sangat prihatin Medan sebagai kota metropolitan tetapi masih banyak pemandangan yang sangat ironis di sejumlah ruas jalan. “Masih banyak pemandangan yang sangat memprihatinkan dan sangat ironis apalagi

dengan gegap gempitanya kampanye Wali Kota Medan untuk menjadikan Medan menjadi Kota Metropolitan,” kata Filiyanti (foto) di Medan, Sabtu (14/7). Kata dia, Jalan Bulan dengan panjang lebih kurang 12,6 m, lebar 8 m yakni dari simpang Jln. Veteran-Jln. Bulan sampai dengan Jln. MT Haryono terlihat tidak berfungsi sebagai jalan

16 Siswa Lulus Seleksi Paskibra Audiensi Ke Balai Kota MEDAN (Waspada): 16 siswa SMA kota Medan yang lulus seleksi Paskibra tingkat provinsi dan nasional beraudiensi ke Balai Kota Medan, Jumat (13/7). Para siswa tersebut diterima olehWakilWali Kota Medan Dzulmi Eldin didampingi Kepala Dinas Pendidikan M Rajab Lubis, Kepala Dinas Pemuda dan Olahraga Hanas Hasibuan dan sejumlah kepala sekolah SMA. Dzulmi Eldin mengatakan, Pemko Medan bangga dengan para siswanya yang mengukir prestasi. Untuk itu, dia berharap, agar siswa-siswa itu tidak saja berprestasi dibidang seleksi Paskibra, tetapi semua bidang para siswa Kota Medan harus dapat melahirkan prestasi. “Kepada para siswa yang berhasil mengukir prestasi di bidang Paskibra dan terpilih kiranya dapat bergabung dengan rekan lainnya dari kabupaten/kota untuk dilakukan pembinaan dan pelatihan selanjutnya. Jagalah nama baik kota Medan dan untuk seleksi nasional menjaga nama Sumatera Utara, manfaatkan kesempatan ini untuk menambah wawasan dan pengalaman dan jangan lupa menjaga kesehatan,” katanya. Sementara itu, Kepala Dinas Pemuda dan Olahraga Kota Medan Drs Hanas Hasibuan mengatakan, dari 66 siswa yang terpilih pada seleksi Paskibra tingkat Sumatera Utara, 16 orang di antaranya dari Kota Medan, dan satu orang lulus seleksi tingkat nasional di Jakarta yakni Puspita Ladiba dari SMA Swasta Eria Medan.“Seleksi tingkat provinsi ini telah digelar pada 31 Mei sampai 2 Juni 2012 di Asrama Haji,” sebutnya. (h02)

Sugianto Ketua KSPSI Sumut Hasil Rekonsiliasi Menjelang Musda MEDAN (Waspada): Ketua DPD FSPTI Sumut Rizaldi Mavi yang definitive menjelaskan Sugianto Situmeang, SH sebagai ketua KSPSI Sumut hasil rekonsiliasi untuk menjelang Musda DPD FSPTIKSPSI. “Jadi yang bersangkutan diangkat sebagai ketua sampai menjelang Musda FSPTI-KSPSI Sumut yang akan dilaksanakan secepatnya,” kata Rizaldi Mavi di sekretariat FSPTI Sumut Jalan Denai No.184 C Medan, Selasa (10/7). Pengangkatan itu didasari hasil rekonsiliasi DPD FSPTI-KSPSI Sumut yang telah ditetapkan DPP KSPSI tertuang dalam surat keputusan No. Kep.61/SK/DPP KSPSI/V/2012 tanggal 21 Mei 2012 ditandatangani Yorrys Raweyai dan Rudy Rayitno. Dalam SK tersebut menetapkan kepengurusan rekonsiliasi PD FSPTI-KSPSI Sumut periode masa bakti sampai pelaksanaan Musda PD FSPTI-KSPSI. Rizaldi Mavi mengharapkan seluruh kader sampai ke tingkat basis bisa memakluminya. Pengurus rekonsiliasi PD FSPTI-KSPSI Sumut tidak mengeluarkan SK baru maupun pembekuan DPC FSPTI-KSPSI yang dapat menimbulkan dualisme organisasi, terkecuali bagi PC-PC yang ganda wajib dikeluarkan SK pengurus rekonsiliasi PC FSPTI-KSPSI, mekanismenya sama dengan kepengurusan rekonsiliasi PD FSPTI-KSPSI yang dikeluarkan DPP KSPSI. Kepengurusan rekonsiliasi PD FSPTI-KSPSI, Ketua Sugianto Situmeang SH,Wakil Ketua H Rizaldi Mavi MBA, Parlindungan Hutabarat, Janes Simanjuntak, Haryo Pramisto, Aldiansyah ST, J Simanjuntak, P Maratua Hutagalung SH, Mhd Yusuf SE, Andhy P Nainggolan ST, Eka Suryaamen SH, Keswari, Husen Syukri. Sekretaris Surya Kalvin dibantu wakil, bendahara Ir Polman Sianturi dibantu wakil. Sugianto Situmeang yang dikonfirmasi Waspada mengatakan, sebagai ketua DPD, mengimbau kepada semua pengurus harus ada izin ketua kalau mau membuat klarifikasi atau keterangan kepada wartawan, karena wakil ketua tidak mewakil DPD. “Kalau tidak terima dengan SK tersebut silahkan keluar dari kepengurusan. Wakil ketua kalau mau bicara harus izin ketua,” katanya. (m39)

namun sebagai pasar tradisional. “Jalan Bulan terlihat kumuh dengan kerusakan perkerasan jalan seperti kubangan pada saat hujan. Padahal bila ditata dan ditertibkan maka akan mengurangi kepadatan arus lalulintas dari Jalan HM Yamin mulai dari Tembung ke arah Barat, Jalan HM Said, Jalan Seram, Jalan Veteran dan Jalan MT. Haryono,” jelasnya. Menurut Filiyanti yang juga Peneliti Bidang Sistem Transportasi di Departemen Teknik Sipil, Fakultas Teknik USU Medan, pada areal Jalan Bulan ter-

sebut tumbuh terminal-terminal liar, tanpa izin dari Pemko Medan, namun menjadi tempat ngetem angkot. Hal ini merupakan hubungan sebab-akibat antara kebijakan penyelenggaraan oleh regulator yang tidak konsisten (bersifat musiman) vs prilaku (kultur) masyarakat Sumut yang dimanfaatkan peluang lemahnya kebijakan dengan dalih untuk mencari nafkah atau dalih masyarakat ekonomi lemah. Di Medan, terminal tidak berfungsi dengan semestinya, maka muncul terminal-terminal liar di berbagai lokasi di Kota Medan. Pemandangan ini sangat memprihatinkan dan sangat ironis apalagi dengan gegap gempitanya kampanye untuk menjadikan Medan menjadi Kota Metropolitan!? Infrastruktur Masalah infrastruktur jalan di Kota Medan, merupakan masalah yang kompleks dan berkepanjangan yang menyangkut berbagai aspek. Misalnya masalah tiga bulan jalan diaspal rusak, berarti ada yang tidak match. Pemko Medan dan Pem-

prov Sumut tidak mengerti dan konsultan serta kontraktor jalan memiliki paradigma yang salah. Sering sekali mereka beranggapan bahwa makin tebal lapisan-lapisan perkerasan tersebut maka makin kuatlah perkerasannya. Selain itu, mestinya mulai dari tahapan perumusan perencanaan program, tahapan implementasi serta pengawasan implementasi programprogram Pemko Medan dan Pemprov Sumut tersebut di lapangan mestinya terintegrasi dan saling berkolaborasi. Disinilahdibutuhkanketegasanperan dan political will dari Wali Kota Medan dan Gubernur Sumut. Namun mengapa kubangan-kubangan di wilayah inti kota ini serta masalah overlay jalan masih tetap dibiarkan hingga saat ini? Apakah ini menunjukkan hak gertak DPRD Medan dan DPRD Sumut tidak lagi memiliki wibawa hukum? “Ataukah masalah kubangan-kubangan di inti kota dan masalah overlay ini tidak termasuk dalam agenda para wakil rakyat tersebut,” sebut Filiyanti. (m39)

Pelatihan Pembentukan Karakter Mahasiswa Dan Pemuda MEDAN (Waspada): Sedikitnya 100 peserta dari kalangan mahasiswa dan pemuda Kota Medan, ikuti pelatihan Character Building (pembentukan karakter), di Semarak Internasional Hotel Jln. SM Raja, Kamis (12/7), dengan menghadirkan empat nara sumber. Wali Kota Medan diwakili Drs Darussalam yang membuka acara itu mengatakan, pelatihan pembangunan karakter memang cukup tepat dilakukan karena saat ini banyak pemuda kita yang sudah kehilangan atau sama sekali tidak memiliki karakter dan malah ada juga mulai tidak mengerti siapa dirinya, bagaimana, dan untuk siapa dia berdiri. Pemko Medan menyambut baik pelatihan pembentukan karakter yang diselenggarakan Perguruan Tinggi AMIKOM.

Wali Kota meminta para pemuda benar-benar memiliki pengetahuan dan karakter yang bagus, karena secara sadar tongkat estafet pemerintahan nantinya juga akan jatuh kepada generasi muda sebagai generasi penerus bangsa. Sementara itu, KetuaYayasan AMIKOM Drs Tenang Malem Tarigan M.Si, Ak mengingatkan kalangan pemuda dan mahasiswa untuk mencapai sesuatu itu tidakdilakukan secarainstantetapi akan lebih paham dan menguasai sesuatu bila melalui proses. Namun, kenyataan saat ini tidak jarang kalangan pemuda atau mahasiswa menempuh jalan pintas yang sangat merugikan diri sendiri. Salah satu contoh tidak jarang terjadi saat seseorang ingin mendapatkan ijazah perguruan tinggi, tanpa kuliah dengan hanya memba-

yar sekian juta kepada orangorang tertentu bisa menerima ijazah dengan gelar kesarjanaan. Tenang Malem mengingatkan karakter seseorang pemuda hanya bisa terbangun melalui pendidikan, terutama pendidikan tinggi. Dia menyarankan agar selalu jujur kepada diri sendiri, kepada teman atau orang lain, apalagi kepada TuhanYang Maha pencipta alam semesta. Turut memberi sambutan pada acara pelatihan yang diketuai Armansyah Harahap M.Pd, yang jugaWakil Ketua KNPI Medan, antara lain Direktur AMIKOM Medan Wanra Tarigan ST, M.Kom, Ketua KNPI Medan. SedangkannarasumberDrsHMargono MM, dari KopertisWil.I Sumut-Aceh, Kadis Pemu-da OlahragaMedanDrsHanasHasibuan, DR H Arifinsyah MA, dosen pascasarjana IAIN Sumut. (m22)

FPU Sumut Gelar Pengobatan Tradisional Gratis MEDAN (Waspada): Forum Peduli Umat (FPU) Sumut bersama Ahli Pengobatan Tradisional asal Banten Jumanta dan CV Tunas Jaya Sentosa menggelar pengobatan tradisional gratis di Lapangan Bola Kaki Barasokai Jln. Rahmadsyah, Kel. Kota Matsum, Kec. Medan Area, Jumat (13/7). Selain itu, warga yang mengikuti pengobatan gratis tersebut mendapat tausiyah dari Ketua Umum FPU Sumut Ahmad Yani Bin Abdullah tentang arti hakikat kehidupan. “Gunakan waktumu untuk agama, jika tidak waktupun akan habis tapi bukan perkara agama. Gunakan hartamu untuk agama, jika tidak hartapun akan habis tapi bukan untuk agama. Matilah engkau dalam agama, jika tidak engkaupun akan mati tapi bukan dalam perkara agama,” ujar Ahmad Yani. Dia menjelaskan, tujuan pengobatan tradisional ini membentuk kepedulian dan tujuan awal dari pengobatan tersebut memberikan pemahaman tauhit pada seluruh umat. “Pada dasarnya banyak umat Islam percaya dengan Allah tapi tidak yakin bahwa Allah itu benar-benar ada,” katanya. Sementara itu, Direktur CV Tunas Jaya Sentosa Edi Suriono mengatakan, acara tersebut bertujuan demi kemasalahatan umat terutama dengan kesehatan. “Seperti teh mengkudu ini, dengan buah mengkudu ciptaan Allah dan dengan keyakinan insyaallah buah mengkudu dapat membuat masyarakat sehat, dan selagi ada yang murah dan manjur kenapa cari yang mahal,” tuturnya. Kegiatan itu didukung pihak kelurahan dan kecamatan setempat. (h02)


SALAH seorang warga mendapatkan pengobatan tradisional secara gratis di Lapangan Bola Kaki Barasokai Jln. Rahmadsyah, Medan.


WALI KOTA Medan diwakili Drs Darussalam foto bersama Ketua Panitia Armansyah Harahap, Ketua Yayasan AMIKOM Medan Tenang Malem Tarigan, dan Direktur AMIKOM Wanra Tarigan.

Waspada/Ismanto Ismail

KAPOLSEK Medan Helvetia AKP Tris Lesmana Zeviansyah SH, SIK, MH, menginterogasi tersangka EG disaksikan korban Ratna Br Simanjuntak.

Sepedamotor Perampok Tabrakan MEDAN (Waspada): Tim Khusus Reskrim Polsek Medan Helvetia menangkap seorang perampok yang berulangkali melakukan aksinya di Medan, setelah sepedamotornya menabrak pengendara sepedamotor lainnya di Jln. Gaperta, Minggu (15/7) dinihari. Tersangka EG, 21, penduduk Jln. Seribu Janji, Simalungun, merampok tas milik Ratna Br Simanjuntak, 38. Ketika berusaha kabur usai beraksi, tersangka menabrak sepedamotor Yamaha Mio BK 6868 QAC, sehingga dua pengendaranya menderita luka-luka. Saksi mata kepada Waspada di Tempat Kejadian Perkara (TKP) mengatakan, korban Ratna Br Simanjuntak mengendarai sepedamotor Vario dari tempat kerjanya di Jln. Sisingamangaraja hendak pulang ke

rumahnya di Jln. Budi Luhur, Kel. Dwikora, Kec. Medan Helvetia. Mendekati kawasan Jln. Gaperta, tiba-tiba tas sandangnya dirampok tersangka EG yang mengendarai sepedamotor Suzuki Kawasaki Ninja warna orange nomor polisi B 474 X (palsu). Tersangka yang kabur dengan kecepatan tinggi menabrak sepedamotor Yamaha Mio BK 6868 QAC yang ditumpangi Tomi Hidayat bersama pamannya yang hendak pulang ke rumahnya di kawasan Helvetia. Akibatnya, tersangka EG dan Tomi Hidayat terjatuh ke aspal. Kanit Reskrim Polsek Medan Helvetia Iptu Syarifurrahman SH, bersama personelnya yang sedang melakukan patroli mengantisipasi aksi kejahatan

jalanan melihat kejadian itu langsung menangkap tersangka yang mencoba melarikan diri. Kapolsek Medan Helvetia AKP Tris Lesmana Zeviansyah SH, SIK, MH mengatakan, tersangka masih menjalani pemeriksaan. Menurut dia, EG diduga sudah berulangkali melakukan aksinya di Medan. Buktinya, saja plat BK sepedamotor yang dikendarainya palsu. Sementara itu, Kapolresta Medan Kombes Pol Monang Situmorang SH, MSi yang saat itu sedang berada di lokasi mengatakan, mengantisipasi aksi kejahatan jalanan, pihaknya tidak bosan-bosan menginstruksikan jajaran Polsek dan Polresta Medan agar meningkatkan patroli dan hunting, agar suasana menyambut bulan suci Ramadhan di Medan tetap kondusif. (m36)

Advokat Jangan Takut Menyuarakan Kebenaran MEDAN (Waspada): Advokat harus dapat memberikan contoh yang baik kepada masyarakat dan sesama rekan, tegas, dan tidak perlu takut dalam melaksanakan tugas untuk menyuarakan kebenaran. “Kebenaran itu yang paling penting, inilah tugas seorang advokat untuk menegakkan kebenaran tersebut. Tidak perlu takut dalam menghadapi oknum penegak hukum (polisi, jaksa, dan hakim) yang dinilai melenceng dan tidak sesuai dengan kebenaran dalam menegakkan hokum,” kata Presiden Kongres Advokat Indonesia (KAI) Indra Sahnun Lubis dalam sambutannya melantik 73 advokat KAI Sumatera Utara, di Hotel Santika Dyandra Jln. Kapten Maulana Lubis, Medan, Jumat (13/7). Indra Sahnun yang didampingi Ketua DPD KAI Sumut Borkat Harahap SH, dan Ketua Panitia Pelantikan Khairil Anwar SH menegaskan, tugas seorang advokat untuk mengkritisi dan meluruskan bila ada melihat yang dianggap salah dan tidak benar di muka bumi ini.

“Seorang advokat harus dapat mengatakan yang benar itu adalah benar. Dan yang salah itu adalah salah, ini adalah panggilan hati nurani,” ujarnya. Menurut dia, anggota advokat KAI harus benar-benar memiliki tanggung jawab yang tinggi untuk membela kepentingan rakyat yang sedang menghadapi masalah hukum. “Baik itu permasalahan di pengadilan, kejaksaan, maupun kepolisian, karena hal ini adalah tugas yang sangat mulia yang diemban oleh seorang advokat yang berada di bawah naungan KAI. Ini harus tetap dilaksanakan,” sebutnya. Kata Indra, untuk menjadi seorang advokat yang baik dan dihargai masyarakat, harus dapat melaksanakan tugas sesuai dengan ketentuan hukum yang berlaku dan menjaga etika di tengah masyarakat. Tanpa memiliki etika dan perilaku yang baik dan terpuji, sulit rasanya seorang advokat yang melaksanakan tugas dalam penegakan hukum bisa berhasil menjalankan misi yang diembannya. “Sekali saja se-

orang advokat berbuat kesalahan dan dianggap tidak mencerminkan penegak hukum yang baik, masyarakat yang meminta pertolongan bantuan hukum itu tidak akan percaya lagi untuk selamanya,” tuturnya. Disebutkannya, dalam melaksanakan tugas seorang advokat juga dituntut harus jujur, berwibawa, dan berpenampilan menarik, serta rapi dalam berpakaian, sehingga masyarakat yang meminta bantuan hukum tersebut juga merasa senang. Sementara itu, Ketua Panitia Pelantikan Advokat KAI Sumut Khairil Anwar SH menuturkan, ke 73 advokat yang dilantik itu telah lulus ujian dan juga telah mengikuti Diklat Pendidikan Khusus Advokat (DKPA) Khairil mengatakan, para advokat yang dilantik merupakan hasil ujian angkatan IV gelombang I dan II. Sedangkan calon advokat gelombang II yang telah lulus ujian sebanyak 53 peserta dari 63 peserta, akan mengikuti DKPA yang diselenggarakan dalam waktu dekat ini. (cwan)

IKWI Sumut Jadi Percontohan Nasional MEDAN (Waspada): Ketua Umum Persatuan Wartawan Indonesia (PWI) Pusat H Margiono selaku Pembina Ikatan Keluarga Wartawan Indonesia (IKWI) mengatakan, komposisi kepengurusan, target keanggotaan serta program kerja yang diusung IKWI Cabang Sumatera Utara (Sumut) akan dijadikan percontohan nasional. Hal itu dikemukakan Margiono pada pelantikan pengurus IKWI Cabang Sumatera Utara masa bakti 2012-2015 di Medan Club Jalan RA Kartini Medan, Jumat (13/7) malam. Menurut Margiono, komposisi kepengurusan IKWI Sumut yang besar hingga mencapai 75 orang, kemudian target keanggotaan yang mencapai 1.000 orang, serta berbagai program kerja yang luas dan menyentuh di segala bidang, sangat progresif dan membesarkan hati. “Dengan segala keunggulan ini, saya nyatakan IKWI Cabang Sumut layak menjadi percontohan nasional,” kata Margiono seraya menjanjikan apabila program kerja yang diusung berjalan dengan baik akan diberikan penghargaan pada peringatan Hari Pers Nasional (HPN). Sebelumnya Ketua IKWI Sumut Hj. Dewi Budiati TJ Said dalam pengantar kerjanya mengatakan, dalam waktu dekat pihaknya akan melakukan kunjungan dan memberi pelatihan kepada warga Lembaga Pemasyarakatan (LP) Wanita dan panti asuhan, agar bisa belajar mengerjakan produk daur ulang sampah yang menghasilkan sebuah cenderamata. Sementara untuk program jangka panjang selama tiga tahun, sebut Dewi, pihaknya akan membuat program berhias yang artinya bersih, hijau asri dan sehat yang bertujuan untuk program perbaikan lingkungan. Disebutkan,programmendaurulangsampahdiharapkanmampu menjadi sarana produktif mengurangi timbunan sampah.“Program pelatihan pemanfaatan sampah juga akan dilakukan dengan cara membuat kompos dan membuat bank sampah,” katanya. Sejalan dengan itu, lanjutnya, program yang akan dikerjakan IKWI Sumut juga melakukan penghijauan dengan melakukan penanaman pohon, menanam tanaman sayuran di pekarangan

berkonsep urban farming (bertani di perkotaan), serta hemat energi dan air. Sederetan program lainnya juga mencakup pemberian beasiswa kepada anak-anak yatim wartawan, menyelenggarakan pengajian, pelatihan menghafal Alquran, kegiatan olahraga, kegiatan kesenian, merangkai bunga, pendirian kantin IKWI, pembuatan makanan kering dan manisan, penyewaan peralatan pesta, dan sebagainya. Pelantikan ditandai penyerahan pataka oleh Ketua Umum IKWI Pusat Hj Umi Rahayu Margiono kepada Ketua IKWI Sumut Hj Dewi Budiati TJ Said. Dirangkai penandatanganan memorandum of understanding (MoU) antara IKWI Sumut dengan Perguruan Eria, dan penyerahan cinderamata produk daur ulang sampah kepada para mitra kerja IKWI Sumut. Hadir dalam rangkaian pelantikan itu, Plt Gubsu diwakili Kepada Dinas Kominfo Sumut Dr H Asren Nasution MA, Ketua TP-PKK Sumut Hj Sutias Handayani Gatot Pujo Nugoroho, anggota DPD-RI Parlindungan Purba, anggota DPRD Sumut Nurhasanah S.Sos, Wakil Wali Kota Medan Drs HT Dzulmi Eldin MSi, Wakil Bupati Deli Serdang H Zainuddin Mars, Ketua KONI Sumut Gus Irawan Pasaribu, Ketua PWI Sumut Drs Muhammad Syahrir, Ketua Serikat Perusahaan Pers (SPS) Sumut H Teruna Jasa Said, Ketua Yayasan Perguruan Eria H Prabudi Said, dan Ketua BKOW Sumut Ny Hj Kemalawati AE, SH. Selain itu juga hadir Kadis Kehutan Provsu JB Siringoringo, Kepala Badan Penanaman Modal dan Promosi Provsu Purnama Dewi, Dewan Kota Medan H Afifuddin Lubis, tokoh pendidikan dan lingkungan dr Robert Valentino Tarigan dan Jaya Arjuna, Direktur Eksekutif SPS Sumut M Zaki Abdullah, serta para Pemimpin Umum dan Pemimpin Redaksi media massa cetak dan elektronik di antaranya H Baharuddin, HA Ronny Simon, Farinda Putra Sinik, Drs Hendra DS, Drs Simon Pramono, Tiorida Simanjuntak, dan Zultaufik Nasution. Suasana acara pelantikan dimeriahkan dengan hiburan serta pameran kerajinan cendramata dari hasil daur ulang sampah

mulai dari vas bunga, tas, aneka aksesoris, sampai replika patung. Beberapa replika yang patung yang dipajang antara lain replika Dato’ Seri H Syamsul Arifin, HT Rizal Nurdin, Raja Inal Siregar dan keluarga Presiden Amerika Serikat Barack Obama. Di sela acara, Ketua IKWI Dewi Budiati Teruna J Said yang akrab disapa ibu Dewi, menjelaskan, terbentuknya pengurus IKWI di Sumut berkat dorongan Cerpenis terkenal asal Sumut, Ibundu Nurleli Qelana, istri wartawan Antara Sumut Qelana Putra. Dijelaskan, IKWI Sumut awalnya didirikan tahun 1959 dan sempat terhenti karena ada gejolak pada saat itu dan kembali dibentuk tahun 1962. Setelah itu kata Dewi, kini disusun lagi kembali kepengurusan IKWI cabang Sumut dan anggota didalamnya meliputi seluruh wanita yang kerja di media massa, baik itu wartawati, karyawati pers, istri wartawan dan janda wartawan (warakawuri). Komposisi kepengurusan IKWI Sumut masa bakti 2012-2015 yang dilantik, Ketua Hj Dewi Budiati Teruna J Said, Wakil Ketua Bidang Organisasi, Humas dan Umum Ny Tuti Haryati Syahrir, Wakil Ketua Bidang Pendidikan Fadia Achri Yulan Farianda, Wakil Ketua Bidang Sosial, Kesehatan dan Warakawuri Ny Rukiah Cahiruddin Wahid, Wakil Ketua Bidang Ekonomi dan Koperasi Ny Halimatussa’diah Hermansjah. Sekretaris Julia Nuraini Tarigan dengan wakil Risda Sari Hendri. Bendahara Lora Taurisia Hendra DS dengan Wakil Eli Marlina. Kompisisi dilengkapi dengan seksi-seksi, terdiri dari Seksi Organisasi, Seksi Humas dan Umum, Seksi Pendidikan dan Sumberdaya Manusia, Seksi Sosial dan Warakawuri, Seksi Kesehatan dan Lingkungan Hidup, Seksi Ekonomi, Kewirausahaan dan Koperasi, Seksi Hukum dan Hak Azasi Manusia, serta Seksi Olahrga. Penasehat terdiri dari Ny Hj Supiah Ronny Simon, Ny Hj Yusra Zakaria S Piliang, Ny Hj Zulfina Zaki Abdullah, Ny HjYusnita Prabudi Said, Ny Supandi Kusuma, Ny Immanuel Panggabean, Ny Rudolf M Pardede, Ny Hj Yusmaniar Ibrahim Sinik, Ny Dr Hj Linda M Fauzi Lubis, Ny Hj Soekarni Baharuddin, Ny Hj Simon Pramono, Ny Hj Sari Banun, Ny Hj Mahmulsyah, dan Ny Siti Anggur Sulben Siagian. (m27)

Politik & Hukum


WASPADA Senin 16 Juli 2012

BKM Tapteng Minta RE Nainggolan Maju TARUTUNG (Waspada): Dukungan dari para tokoh dan elemen masyarakat terus mengalir untuk DR RE Nainggolan, MM agar maju mencalonkan diri pada Pemilihan Gubernur Sumatera Utara (Pilgubsu) tahun depan karena figurnya merakyat dan sudah sangat berpengalaman di pemerintahan. Waspada/Ist

DR Kartini Sjahrir dan Yenny Abdurrahman Wahid menyatakan kebulatan tekatnya usai mendeklarasikan peleburan Partai PIB dan Partai Kemakmuran Bangsa Nusantara (PKBN) menjadi Partai Kedaulatan Bangsa Indonesia Baru (PKBIB) di Jakarta Kamis lalu.

Deklarasi Partai Kedaulatan Bangsa Indonesia Baru

RE Nainggolan selama menjabat di pemerintahan, sangat dekat dengan rakyat. Dalam menjalankan tugasnya sebagai pamong, tidak pernah membeda-bedakan suku, agama maupun golongan. Semuanya sama diperlakukan. Kiprahnya pun di pemerintahan sudah dikenal masyarakat luas di daerah ini. Hingga terakhir sebagai Sekdaprovsu. ‘’Kami sebagai pengurus di salah satu kenaziran masjid di Kabupaten Tapanuli Tengah (Tapteng) meminta RE Nainggolan untuk maju pada Pilgubsu tahun depan. Beliau sangat layak memimpin

Sumut kearah yang lebih cemerlang,” kata Ketua BKM (Badan Kenaziran Masjid) Al-Rahmat Tapteng Marasuddin Pasaribu, didampingi Zamaluddin ButarButar kepada wartawan di Pandan – Tapteng, Minggu (15/7). Dia mengatakan, figur RE Nainggolan tidak diragukan lagi kredibilitasnya dalam memimpin Sumatera Utara. Dia sudah mapan. Meniti karier dari bawah sebagai staf di Kantor Camat Pahae Jae – Tapanuli Utara, hingga menjadi Sekda Kabupaten Dairi, Bupati Taput (1999 – 2004), Kepala Badan Infokom Sumut, Kepala Bappeda Sumut, Sekdaprovsu. Karier PNS-nya sangat bagus. Selain itu, beliau banyak dipercaya sebagai penasihat di berbagai organisasi kemasyarakatan di Sumut. “Kami yakini RE Nainggolan sangat layak menjadi Gubsu,” ujar Pasaribu yang mengakui pihaknya di Tapteng terus mengikuti perkembangan setiap figur Cagubsu yang bermunculan. Menurutnya, untuk menjadi pemimpin Sumut ke depan

harus mampu berkomunikasi dengan semua pihak atau elemen masyarakat. Mampu turun ke semua lapisan, mendengar keluhan masyarakat akan pembangunan di berbagai daerah. Dari catatan kami, RE Nainggolan sewaktu Bupati Taput, selalu turun ke desa-desa terpencil untuk menyahuti keinginan rakyatnya. Barangkali ini merupakan suatu kriteria yang perlu dimiliki seorang pemimpin. Tidak hanya mengumbar janji dan menghadiri acara-acara seremonial. Untuk itu, selaku pengurus salah satu kenaziran masjid maupun sebagai warga Tapteng, sangat mendukung dan meminta RE Nainggolan untuk terus maju pada Pilgubsu mendatang. “Rakyat sudah pintar untuk memilih siapa yang bersih dan paling mampu untuk memimpin Sumatera Utara ke arah yang lebih cemerlang. Kami melihat figurnya, bukan karena yang lain-lain. Saya juga mengajak teman-teman untuk bersatu mendukung RE Nainggolan,”

ujar Pasaribu. Sementara Zamaluddin mengungkapkan, RE Nainggolan merupakan salah satu tokoh yang bersikap netral di semua lini. Sangat ramah. Itu kami lihat sewaktu beliau sebagai Sekdaprovsu. Selain ke berbagai elemen masyarakat, juga dekat dengan insan pers maupun LSM (Lembaga Swadaya Masyarakat). Tetapi yang paling terpenting, gebrakannya sudah banyak dalam membangun masyarakat,” terang Zamaluddin yang juga sebagai salah satu Ketua LSM Kabupaten Tapteng. Zamaliuddin maupun Ketua BKM Al-Rahmat menyatakan, dalam waktu dekat pihaknya akan membuat suatu pertemuan untuk menyatukan kebulatan tekad mendukung RE Nainggolan menjadi Gubsu. “RE Nainggolan sudah dikenal luas di berbagai etnis, golongan maupun agama.Yang jelas figurnya benar-benar mau membangun Sumut ke jenjang yang lebih baik lagi. Bukan hanya retorika belaka,” tandasnya.(a21)

MEDAN (Waspada): Partai Perjuangan Indonesia Baru ( PPIB ) dan Partai Kemakmuran Bangsa Nusantara ( PKBN ) Kamis (12/ 7) melebur menjadi satu partai baru bernama Partai Kedaulatan Bangsa Indonesia Baru (PKBIB). Pendeklasiannya dilakukan pada Kongres Partai PPIB di Jakarta. Demikian penjelasan Ketua DPD PPIB Sumut Sonny Firdaus, SH yang diterima Waspada Sabtu (14/7) dari Jakarta. Menurutnya, Ketua Umum Partai PIB DR Kartini Sjahrir memaparkan dalam laporan pertanggungjawabannya, penggabungan kedua parpol itu diharapkan mampu menjadi satu kekuatan politik membawa angin segar bagi peta perpolitikan di Indonesia ke depan. Di hadapan seluruh kader partai yang hadir dalam kongres itu, kata Sonny Firdaus, Kartini Sjahrir menjelaskan penggabungan kedua parpol itu ibarat suatu pernikahan yang tidak terbayang sebelumnya. Namun sebenarnya sejak 2009 pihaknya telah memikirkan tentang perjalanan partai nomor urut 10 pada masa mendatang. “Berbagai ujian dan halangan dalam perpolitikan di Indonesia, secara tidak langsung juga membuat segenap pengurus partai ini berpikir keras untuk tetap dapat berjuang dengan ideologi politik akal sehat dan semangat kebangsaan yang kokoh,” katanya seperti diutarakan Ketua DPD PPIB Sumut Sonny Firdaus. Namun tanpa disangka dan diduga pertemuan dalam suatu acara makan siang bersama Yenny Abdurrahman Wahid, putri almarhum Gus Dur di Jakarta 2 bulan lalu, akhirnya melahir suatu kesepakatan meleburkan kedua partai yang mereka pimpin itu dalam satu nama baru. Kesamaan garis perjuangan, berpolitik dengan akal sehat, mengelola perbedaan dan kemajemukan menjadi suatu kekayaan, menurut Sonny, merupakan ciri khas dari partai yang didirikan oleh Alm. DR Sjahrir, suami Kartini yang juga sering menjadi pokok seruan Alm. Gus Dur kepada para pengikut dan simpatisannya. Alasan itu pula Kartini Sjahrir mau menerima pinangan dari Yenny Abdurrahman Wahid dengan syarat Yenny harus bersedia menjadi ketua umumnya. Dalam kongres tersebut, setelah bermusyawarah untuk mufakat, seluruh kader PPIB termasuk DPD PPIB Sumut bersama Sekretaris Henry Siagian menyetujui penggantian nama partainya menjadi Partai Kedaulatan Bangsa Indonesia Baru ( PKBIB ) dan memilih Yenny Abdurrahman Wahid secara aklamasi sebagai ketua umum menggantikan DR Kartini Sjahrir. Acara deklarasi itu dihadiri mantan Ibu Negara Sinta Nuriyah Abdurrahman Wahid dan beberapa tokoh nasional serta ribuan kader PKB Gusdur dan PPIB. Yenny Wahid menyatakan, kendati kongres telah memilih dirinya sebagai ketua umum secara aklamasi, namun secara merendah ia menyatakan hanya sebagai penerus dari tugas DR Kartini Sjahrir yang kini menjadi Dubes RI untuk Argentina. (m22)

PR GUBSU: Persoalan Papan (rumah tempat tinggal) merupakan salah satu pekerjaan rumah (PR) bagi Gubernur Sumatera Utara terpilih tahun 2013. Masih banyak rumah yang tidak layak huni di daerah ini termasuk lingkungan yang menyebabkan rendahnya derajat kesehatan masyarakat. Salah satu contoh rumah tidak layak huni tersebut masih ditemui di kawasan pesisir Kabupaten Batubara walaupun daerah itu eskipun sudah lima tahun menjalani pemekeran dan tiga tahun kepala daerah difinitf. Kondisi rumah tersebut sangat-sangat memperihatinkan, lantai tanah, dinding tepas, papan usang dan atap rumbia atau daun nipah.

Tiga Pemakai Narkoba Dan Penulis Togel Ditangkap

Polisi Razia Lima Tempat Hiburan Malam

MEDAN (Waspada): Tiga pemakai narkoba jenis sabu-sabu dan seorang penulis judi toto gelap ditangkap polisi dari lokasi berbeda, Sabtu (14/7). Petugas Polsek Medan Barat dalam penggerebekan di salah satu rumah di Jalan Mabar Gang Pribadi, Kec. Medan Deli, meringkus tiga pemakai narkoba berinisial RL, 32, S, 28, dan N, 23, ketiganya tinggal di Rumah Potong Hewan (RTP) Jalan Mabar Pasar 1 Gang Pribadi. Dari ketiganya disita barang bukti 4 bungkus kecil sabu senilai Rp200 ribu, 1 botol kaca, 1 pecahan pipet kaca, 1 mancis, 2 pipet plastik hijau, 2 buah pipet plastik putih, 2 karet dot, dan 1 unit hape Nokia tipe 1280. Kepada petugas tersangka RL mengaku baru empat bulan memakai sabu-sabu. “Saya baru makai sabu empat bulan belakangan ini,” katanya. Kapolsekta Medan Barat Kompol Nasrun Pasaribu SIk, melalui Kanit Reskrim AKP Antoni Simamora membenarkan adanya penangkapan tersebut. “Masih kita periksa dulu ketiga tersangka untuk dilakukan pengembangan,” sebutnya. Togel Sementara itu, petugas Reskrim Polsek Medan Timur menangkap seorang penulis togel beromset Rp300 ribu per hari dalam penyergapan tidak jauh dari kediaman tersangka di Jalan Gaharu Gang Sekolah. Dari tersangka AA, 41, disita barang bukti handphone berisi nomor tebakan togel dan uang Rp300 ribu. Kapolsek Medan Timur Kompol Patar Silalahi melalui Kanit Reskrim AKP Ridwan kepada wartawan mengatakan, tersangka ditangkap saat menulis nomor tebakan togel di handphone nya. “Tersangka menyetor hasil penjualan togel kepada Edi Kambing, warga setempat. Kita masih memburonnya,” ujarnya. (m39)

Pemilihan Gubernur Sumut akan berlangsung 7 Maret 2013. Sejalan dengan itu bermunculanlah para peminat jabatan tersebut. Mereka al. Gatot Pujo Nugroho, Gus Irawan, Chairuman Harahap, AY Nasution, Amri Tambunan, Cornel Simbolon, RE Nainggolan, Benny Pasaribu, Wildan Tanjung, T. Milwan,Soetan Bhatoegana,Rosiana Sianipar,Anuar Shah, Kamaluddin Harahap, Bintatar Hutabarat, Erry Nuradi, Fadly Nurzal, Syah Afandin dan Kastorius Sinaga. Dari sekian banyak nama-nama tsb di atas, Anda tentu mempunyai pilihan. Tuliskan satu nama calon gubernur Sumut pilihan Anda di bawah ini. Nama Gubsu Pilihan Anda: ————————————————————— Nama pengirim : Alamat




� Kirim ke Harian Waspada Jl. Brigjen Katamso No. 1 Medan � Harian Waspada akan mengumumkan setiap hari hasil pilihan pembaca mulai tanggal 10 Juli 2012. � Hasil pilihan pembaca ditutup 15 Agustus 2012 dan pada

16 Agustus 2012 pengumuman bagi 10 pemenang yang berpartisipasi.

� 10 Pemenang masing-masing akan mendapat 1 (satu) buah BlackBerry Gemini. �

Keputusan panitia tidak dapat diganggu gugat. (tim)

Hasil Pilihan Pembaca Waspada 14 Juli 2012 Sampai Pkl 16:30 WIB

Waspada/Erwan Efendi

10 Pengunjung, Belasan Butir Diduga Ekstasi Diamankan MEDAN (Waspada): Satuan Reserse Narkoba Polresta Medan merazia lima tempat hiburan malam, Minggu (15/7) dinihari. Dalam razia itu, polisi mengamankan 10 pengunjung tempat hiburan malam, tiga di antaranya wanita. Selain itu disita barang bukti dua bungkus plastik berisi belasan butir diduga ekstasi, enam butir pil ekstasi dan lainnya. Pantauan Waspada di lapangan, razia dilakukan pukul 01:00 dinihari, dipimpin Kabag Ops Polresta Medan Kompol SF Napitu SH, SIK, bersama Kasat Reserse Narkoba Polresta Medan Kompol Dony Alexander SH, SIK, M.Hum, menurunkan personel Sabhara, Paminal, Provost Polresta Medan, dan Denpom. Petugas dengan mengen-

darai truk, mobil, dan sepedamotor secara beriringan menuju ke tempat hiburan malam untuk melakukan razia. Pertama kali yang dituju tempat hiburan malam Tobasa yang berada di Hotel Danau Toba Int Jln. Imam Bonjol Medan. Dari lokasi tersebut, polisi menemukansatubungkusplastik kecil berisi butiran diduga ekstasi dandarikamarmandiditemukan tiga butir diduga pil ekstasi. Selain itu, tiga pasang pengunjung Tobasa digiring naik ke truk Sabhara Polresta Medan. Selanjutnya, petugas menuju ke Diskotek M3 di Thamrin Plaza Jln. Thamrin Medan. Ketika hendak menaiki lift, petugas menemukan dua butir diduga pil ekstasi di depan pitu lift. Sedangkan seorang pria yang

hendak menaik lift langsung diamankan. Dari Diskotek M3 tidak ditemukan barang bukti. Kemudian petugas menuju ke tempat hiburan Hawerl Hall dan Tuak House (TH) di Jln. Pegadaian Medan. Dalam pemeriksaan para pengunjung baik di lokasi bilyar dan karaoke, tak ditemukan barang bukti. Setelah itu, petugas menuju ke Dikotek X3 Young Lime di kawasan Jln. Thamrin Medan. Polisi menemukan satu butir diduga pil ekstasi di lantai tempat hiburan tersebut. Seorang pengunjung pria diamankan untuk diambil keterangannya. Selesai melancarkan razia, Kabag Ops Polresta Medan Kompol SF Napitu mengatakan, razia itu dilakukan agar suasana

menyambut bulan suci Ramadhan tetap kondusif. “Razia dilakukan secara rutin untuk mengantisipasi peredaran narkoba,” ujarnya. Sementara Kasat Reserse Narkoba Polresta Medan Kompol Dony Alexander mengatakan, pria dan wanita yang diamankan akan dimintai keterangan. “Mereka diperiksa selama 3x24 jam dan apabila tidak terbukti, mereka dipulangkan dan sebelumnya membuat surat pernyataan tertulis,” katanya. Dony menjelaskan, semua barang bukti ditemukan dari lantai, tidak ada dari badan pengunjung. Pil yang ditemukan itu akan diperiksa di Labfor Polri Cabang Medan, untuk memastikan apakah itu ekstasi atau bukan. (m36/h04)

Siswi SD Diperkosa Tetangganya MEDAN (Waspada): Siswi kelas 5 SD berinisial NA, 11, warga Jl. Rakyat Ujung Gg. Merpati Pasar III, Medan, menjadi korban pemerkosaan oleh tetangganya yang bekerja sebagai sopir angkot, bermarga S, 50, Minggu (15/7). Akibat pemerkosaan itu, korban mendapat perawatan intensif karena mengalami trauma dan kemaluannya mengeluarkan darah. Peristiwa berawal saat korban hendak membeli jajan di warung yang berjarak tiga rumah dari tempat tinggalnya. “Awalnya si anak ini mau membeli jajanan di warung milik istri tersangka, tapi karena istri dan anaknya sedang pergi ke gereja, tersangka inilah yang jaga warung itu. Mungkin korban dirayu atau dipaksanya,” kata warga yang ikut mengantar korban ke RS Pirngadi. Usai memperkosa korban, tersangka lalu mengancam korban agar tidak memberitahukan kepada siapapun tentang apa yang telah diperbuatnya. “Setelah itu tersangka pergi dari rumahnya, sedangkan korban usai dicabuli terdiam di rumahnya,” ujarnya. Ibu korban Boru Hombing, 40, sempat melihat anak perempuannya duduk dan terdiam serta melihat celana yang dikenakan korban penuh dengan darah. Dia kemudian bertanya kepada anaknya, tapi korban hanya diam saja dan tidak memberitahukan apa yang telah dialaminya. Namun, setelah dipaksa ibunya korban mengaku diperkosa tersangka. Warga yang mendengar kejadian tersebut segera mengepung dan menangkap tersangka lalu menyerahkannya ke Polresta Medan. Sementara itu, salah seorang perawat ruangan IGD mengatakan, kemaluan korban mengalami pendarahan akibat luka robek hingga harus menjalani operasi dan rawat inap. (h02)

Geng Kereta Serang Tiga Remaja MEDAN (Waspada): Sekelompok geng kereta mencoba menyerang tiga remaja di Jln. Masjid Taufiq, Minggu (15/7) dinihari. Namun aksi tersebut berhasil dihalau massa sehingga ketiganya berhasil diselamatkan. Peristiwa terjadi sekira pukul 04:00. Dinihari itu ketiga remaja Roger Sigalingging, 18, warga Perwira I Krakatau, Ranto Situmeang, 19, warga Jln. Gereja Gang Sukaria, dan Adi Lesmana, 18, warga Jln. Gereja, Medan Tembung, baru saja selesai makan nasi goreng di kawasan Jln. Rakyat bermaksud pulang ke rumah. Setibanya di Jln. Masjid Taufiq, ketiga remaja yang mengendarai sepedamotor itu dihadang segerombolan pemuda menaiki sepedamotor yang diduga kelompok geng kereta. Kemudian ketiga remaja itu berusaha menyelamatkan diri. Begitu juga seorang remaja lainnya, Rizal Harahap, 18, warga Jln. Rakyat, Medan Perjuangan, yang melintas dilokasi nyaris menjadi sasaran geng kereta tapi berhasil menyelamatkan diri dan bergabung dengan warga sekitar. Warga yang melihat aksi itu langsung menyerang kelompok geng kereta. Mendapat serangan warga, kelompok geng kereta itu melarikan diri. KapolsekMedanTimurKompolPatarSilalahimelaluiKanitReskrim AKP Ridwan membenarkan peristiwa itu. “Korbannya masih kita periksa.Belumtahuapakahkelompokyangmengendaraisepedamotor ini geng kereta atau tidak,” katanya. (m39)

Dua Penjambret Diringkus MEDAN (Waspada): Dua penjambret yang melakukan aksinya di Jln. Prof HM Yamin Medan simpang Jln. GB Josua ditangkap Reskrim Polsek Medan Timur dalam penyergapan terpisah, Minggu (15/7) dinihari. Tersangka DIO, 22, anak oknum Polri warga Jln. Perumahan Ekawarni I Kav 10, Medan Johor, dan MI, 25, anak kepling warga Jln. Prof HM Yamin Gang Bidan, Medan Perjuangan, dijebloskan dalam sel tahanan. Kapolsek Medan Timur Kompol Patar Silalahi didampingi Kanit Reskrim AKP Ridwan kepada wartawan mengatakan, kedua tersangka merupakan target operasi (TO) polisi. Keduanya terakhir melakukan aksinya pada Kamis, 5 April 2012 pukul 21:00 di jalan Prof HMYamin simpang Jalan GB Josua, Medan Perjuangan, terhadap korban Nurul Aini Haris Nasution, 21, warga jalan Bubu, Tembung. Malam itu korban yang menaiki sepedamotor sendirian bermaksud pulang ke rumahnya. Setibanya di lokasi kejadian, datang kedua tersangka menaiki sepedamotor mendekati korban. Tersangka yang ada diboncengan langsung merampok tas sandang warna hijau milik korban berisikan uang, KTP, SIM, dan ATM. Korban kemudian membuat pengaduan ke Polsek Medan Timur sesuai LP No.413/IV/12/Sektor Medan Timur. Polisi kemudian melakukan pemeriksaan terhadap korban dan menanyakan ciri-ciri pelaku. Berdasarkan keterangan korban, polisi mendapat informasi kalau pelakunya MI, warga Jln. Prof HM Yamin. Namun saat dilakukan pencarian yang bersangkutan tidak diketahui keberadaannya. ”Polisi kemudian menjadi MI sebagai TO dan terus melakukan pencarian keberadaan tersangka,” sebut Ridwan. Setelah diburon selama dua bulan, anggota ReskrimPolsekMedan Timur melihat keberadaan tersangka MI di Jln. Prof HM Yamin dan menangkapnya. Hasil pengembangan diketahui teman MI adalah DIO. Polisi terus mengejar keberadaan DIO dan menangkapnya saat berada di rumah temannya di Jln. M Yakub Medan. ”Hasil pemeriksaan kedua tersangka mengakui melakukan aksinya terhadap korban di Jln. HM Yamin simpang Jln. GB Josua. Hasil kejahatan dibagi dua, DIO mendapat Rp1,5 juta sedangkan MI mendapat Rp1,8 juta. Sisanya untuk foya-foya. Sedangkan surat-surat pentingnya lainnya di buang di parit busuk,” ujarnya. Tersangka DIO, merupakan residivis karena pernah dihukum tahun 2011 kasus jambret. Dia yang berperan sebagai pengemudi sepedamotor mengaku uang hasil rampokannya dihabiskan untuk bersenang-senang. Sedangkan MI mengaku, uang hasil rampokan telah dipulangkan kepada korban. Alasannya, karena korban masih ada hubungan saudara. (m39)

Gubernur Sumut Pilihan Pembaca Waspada

BKM Muslimin Peringati Israk Mikraj

Waspada/Ismanto Ismail

KASAT Reserse Narkoba Polresta Medan Kompol Dony Alexander, SH, SIK, M.Hum meminta pengunjung tempat hiburan malam membuka tas untuk diperiksa.

MEDAN (Waspada): Badan Kenaziran Masjid (BKM) Muslimin melaksanakan peringatan Israk dan Mikraj Nabi Muhammad SAW 1433 H di Masjid Muslim Jln. Perbatasan, Kel. Suka Maju, Medan Johor, Jumat (13/7) malam. Acara diawali pembacaan ayat suci Alquran oleh Qori Azroi Hasibuan, dihadari sejumlah tokoh masyarakat, di antaranya H Budi Harjo, H Edwar, H Juanda, Ketua Perwiritan Yasin Muslimin Saidil Amri, Ketua DPC PAN Medan Johor Iwan Suherman, para kepling dan jamaah masjid. Ketua BKM Muslimin H Syahroni Husen menyampaikan terima kasih kepada warga dan jamaah masjid yang berpartisipasi, sehingga syiar agama Islam ini terlaksana sesuai harapan. Dia mengatakan bahwa peringatan Israk Mikraj memiliki makna berupa pesan membangun moralitas kaum muslimin, khususnya generasi muda Islam. Penceramah Drs H Abdul Rahman Syamsuddin dalam tausiyahnya menyampaikan inti dari peringatan Israk Mikraj adalah peningkatan amal ibadah shalat. “Satu-satunya hasil Israk Mikraj adalah Asshalah (perintah shalat). Shalat adalah amal ibadah pertama kali yang ditanyakan Allah setelah seseorang menghadap sang pencipta,” ujarnya mengatakan, bila shalatnya diterima, maka seluruh ibadahnya akan diterima .(m27)

Ekonomi & Bisnis

WASPADA Senin 16 Juli 2012

Tinjauan Ekonomi

Jhon Tafbu Ritonga Pengamat Ekonomi

Catatan Tanah Untuk Balgubsu (1) Permasalahan tanah mrupakan isu strategis yang akan dihadapi Gubsu 20132018. Sebagaimana terjadi secara nasional, di Sumut pun, masalah tanah sudah kusut dan luas. Bukan hanya menghambat investasi atau daya saing ekonomi, tapi sudah mengancam keselamatan NKRI. Menyadari itu kolom ini sekelumit catatan dari “Seminar Nasional Fungsi Tanah Dalam Perspektif Agama, Hukum, Dan Ekonomi” di Fakultas Ekonomi USU (10/7). Tiga pemakalah: Prof Dr Hasballah Thaib (Agama), Prof Dr M. Yamin Lubis(Hukum) dan saya sendiri (Ekonomi) dimoderatori Wahyu Pratomo. Perserta 100-an orang: mahasiswa, dosen, pejabat pemda, DPRD dan Pengurus FRBSU. Kegitan yg dirangkai dgn dies natalis USU ke-60 itu dimaksudkan memberi pemikiran kepada pemerintah pusat, pemda dan rakyat penderita konflik pertanahan. Oleh karena itu prosiding akan diterbitkan dalam bentuk buku dengan rencana tajuk “Mencegah Revolusi Agraria Dengan Land Reform”. Tajuk buku diinspirasi curhat Forum Rakyat Bersatu Sumut yang tampak capek tapi masih semangat demo. Jika land reform belum juga terealisasi, katanya akan ada revolusi agraria. Semua pembicara, sesuai agama, UUD 1945 dan UU Pokok Agraria, sependapat bahwa rakyat sebagai bangsa lebih berhak memanfaatkan tanah untuk kehidupan daripada korporasi dan orang perorang. Sementara pemerintah wajib melindungi segenap bangsa dan memajukan kesejahteraan umum. Tapi, caranya harus baik dan benar, dengan nilai-nilai dan hukum Indonesia, bukan dengan kemarahan sosial yang disebut revolusi. Semua setuju bahwa lebih baik lagi terus memperbanyak doa dan berusaha meyakinkan pemerintah agar segera melakukan land reform, dari pada revolusi yang mengambil korban baru. Solusinya mestilah dalam bingkai agama, UUD 1945, UU Agraria dan prinsip ekonomi. Pilihan terbaik ialah reformasi atau land reform. Bukan revolusi yg dapat “memangsa pejuangnya sendiri”. Masalah pertanahan tercermin pada kegiatan Panja Konflik dan Sengketa Pertanahan, Komisi II DPR-RI. Pada Februari 2012 Panja mengadakan rapat dengar pendapat dengan banyak pemangku kepentingan pertanahan. Banyak kasus yang dibahas dengan areal puluhan ribu hektar, seperti kasus Mesuji dari Lampung, dari Jawa Timur, Jawa Barat, Sulawesi Tenggara, Jambi, Bali, dan Riau. Tiga dari banyak kasus yang dibahas Panja ialah kasus Sumatera Utara: Konflik areal perkebunan antara masyarakat dengan PTPN3 Kebun Rambutan Deliserdang, Kasus HGU PTPN2 seluas 5.000 ha lebih juga di Kabupaten Deliserdang, Konflik tanah antara masyarakat dengan TNI-AU Polonia di Medan. Selain yang dibahas Panja DPR RI, masih panjang daftar sengketa tanah yang sedang dan akan menyebabkan konflik di Sumut. Seperti di Madina, Tapsel, Paluta, Labuhanbatu, Asahan dst. Pekan menjelang seminar rakyat demo menunggu Reformasi Agraria oleh Pemerintah Pusat, Provinsi dan Kabupaten, di Deliserdang, Langkat dan Medan. Keputusan Presiden RI Susilo Bambang Yudhoyono (SBY) mengganti Kepala Badan Pertanahan Nasional (BPN) JoyoWinoto dengan Hendarman Supandji memberi harapan baru akan ada perbaikan dan peningkatan penyelesaian masalah pertanahan di Indonesia. Itu karena masalah pertanahan biasanya kental dengan keterlibatan orang penting baik di pusat maupun daerah. Maka Hendarman yang mantan Jaksa Agung itu diharapkan memiliki integritas dan kapasitas menyelesaikan kasus tanah yang melibatkan aparat hukum, pejabat, pengusaha dan petinggi BUMN. Sebenarnya konflik pertanahan sudah ada sebelum merdeka. Penjajah dan VOC datang mengkavling dan mengatur (dgn devide et impera) penggunaan tanah kita demi kegiatan ekonomi mereka. Ada cultuurstelstel (sistem tanam paksa) sejak 1836 dengan tujuan mem-produksi komoditas yang sedang laris di pasaran dunia.

Leluhur kita ialah bangsa-bangsa yang dijajah Hindia Belanda pada masa itu mereka paksa membudidayakan tanaman keras seperti kopi, lada, gula, tembakau, teh, kina, karet, dan kelapa sawit. VOC dan Belanda yg monopoli ekspor mendapat keuntungan lipat ganda. Artinya kasus konflik pertanahan ialah sejarah yang panjang hingga era SBY. Oleh kerana masalah pertanahan berakar pada keterbatasan sumber daya ekonomi, maka harus diselesaikan dengan pendekatan sesuai sistem ekonomi yang membumi di Indonesia. Negara kepulauan dengan sejarah bangsabangsa yang sudah eksis sejak tempo doeloe. Sudah mempunyai tatanan kehidupan sosial dan budaya dengan kebhinekaan jauh sebelum dipersatukan dengan Soempah Pemoeda 1928 dan Proklamasi 17 Agustus 1945. Masalah pertanahan yang kian banyak dan meluas ialah karena Pemda dan Pusat memberi privilese kepada korporasi mengusai tanah. Bahkan pemda dan pusat sering tak berdaya. Tidak bisa lagi mudah membebaskan lahan utk membangun jalan raya karena tanah dikuasai privat. Seperti akses ke Bandara Kualanamu lambat karena masalah tanah. Sebelumnya ada pengalaman Pemprovsu harus membayar ganti rugi tanah kepada pemegang HGU (PTPN) untuk perkantoran Pemda yang juga susah urusannya. Itu contoh pelanggaran atas pasal 33 UUD 1945. Data Sensus Pertanian 1993 mencatat Rumah Tangga Pertanian pengguna lahan adalah 20.518.000. Sensus 2003 naik menjadi 24.176.000 atau tumbuh rata-rata 1,8 persen per tahun. Maka RT Tani yang lahannya kurang 0,5 ha atau petani gurem bertambah dari 10.804.000 (53 persen) menjadi 13.663.000 (57 persen). Diperkirakan hasil sensus 2013 mendatang akan mencatat indikator yang semakin buruk. Kekhawtiran akan kian memburuk karena luas daratan Indonesia tidak bertambah, yakni 1.910.931,32 km2. Kecuali penjajahan dibenarkan di muka bumi yang membolehkan Indonesia (meniru Israel mecaplok Palestina) menduduki Benua Australia. Pertambahan penduduk alamiah menyebabkan kepadatan penduduk meningkat. Sebagaimana telah dialami pada tahun 1950 dengan jumlah penduduk 77,2 juta kepadatan adalah 40 jiwa/km2. Tahun 2010 jumlah penduduk tercatat 237,6 juta berarti kepadatan menjadi 124 jiwa/km2. Mudahnya ingat saja teori deret ukur pertambahan penduduk Malthus dengan kondisi tanah yang konstan. Andaikan tahun 1950 daratan Indonesia dibagi rata, setiap orang bisa mendapat seluas 24.751 m2. Tahun 2010 menjadi cuma 8.041 m2 per orang atau berkurang 16.710 m2 (67,5 persen) per orang. Dengan pertumbuhan penduduk 1,0 persen per tahun, 60 tahun mendatang dengan total penduduk 333 juta kepadatan mencapai 174 jiwa/km2. Setiap orang hanya kebagian 6 m2. Kelak bangsa Indonesia akan saling “memangsa” sesamanya ditambah bangsa lain yang juga membutuhkan tanah. Diprediksi 60 tahun mendatang manusia harus mampu hidup di udara ataupun lautan lepas. Pertambahan petani gurem (penyempitan penguasaan lahan oleh petani) terutama karena pada kebijakan penguasaan lahan berpihak pada korporasi. Pemerintah memberi hak penguasaan lahan yang sangat luas kepada korporasi (boleh ribuan atau puluhan ribu ha dalam 30 tahun hingga seabad). Keputusan dibuat terpusat dengan basa-basi di daerah. Pada gilirannya pemerintah gagal karena informasi yang asimetrik dan ketidakmampuan aparat melaksanakan fungsinya. Sementara di daerah, kepemilikan tanah dijadikan sebagai sumber penerimaan PBB. Diperburuk oleh proses pengurusan sertifikat kepemilikan tanah untuk rumah tangga yang bisa lebih mahal dan sulit dibanding dengan korporasi mengurus HGU (hak guna usaha). Demikian sekelumit catatan dari “seminar nasional tanah dalam perspektif agama, hukum dan ekonomi” yang perlu menjadi bagian penting dalam penyusunan visi misi Balgubsu yang sedang mencitrakan diri pantas dipilih menjadi Cagubsu.

Proyek Spektakuler Menteri BUMN Dahlan Iskan

Pelindo I, II, III, IV Gabung Jadi No 4 Dunia No 1 Asean � Tribuana Said Dan Rayati Syafrin Peroleh SPS Award 2012 MEDAN (Waspada): Menteri BUMN Dahlan Iskan ternyata punya ambisi menggabung empat pelabuhan laut utama (Pelindo I, II, III, dan IV) menjadi satu, khususnya pelabuhan peti kemas internasional. Tujuannya agar pelabuhan Indonesia meningkat kelasnya menjadi No 4 di dunia dan bisa No 1 di Asia Tenggara, terutama di bidang ekspor CPO (minyak kelapa sawit). ‘’Kalau merger sudah jadi nanti, pelabuhan kita bisa nomor empat di dunia,’’ ujar Dahlan Iskan ketika membuka Konferensi CEO Media, Rakernas, dan penyerahan SPS Award 2012 kepada tokoh-tokoh pers nasional yang sudah mengabdikan dedikasi dirinya, komitmen, dan profesionalitasnya untuk membangun dan membesarkan dunia pers Indonesia selama 30 tahun atau lebih di Hotel Pangeran, Pekanbaru. Event tersebut berlangsung dua hari dan ditutup secara resmi Sabtu (14/7) malam. Se l a m a i n i , k a t a n y a , pelabuhan di Indonesia, seperti Belawan (Medan), Dumai, Batam, Jakarta, Makasar, dan Surabaya belum mampu meningkatkan kinerjanya. Kalau pelabuhan kita hanya mampu dirapati kapal yang ukuran 800 kontainer, seperti Belawan, maka wajar saja antrean kapal sampai delapan hari lebih. Pemilik kapal rugi. Nantinya Belawan dan pelabuhan laut lainnya seperti di Batam, Makassar, Jakarta, Surabaya, bahkan sampai Sorong/Papua (akan dibangun) bisa disatukan menjadi satu karidor highway laut, maka kemampuannya luar biasa. Proyek spektakuler menjadikan pelabuhan laut dari Belawan hingga Sorong –Barat ke Timur—ini nantinya bisa dirapati kapal-kapal besar raksasa memuat sampai 3000 kontainer yang saat ini masih dalam proses dan tidak menggunakan keuangan negara (APBN). Jika nanti terwujud, Indonesia bisa menjadi pelabuhan laut terbesar No. 4 dunia. Antrean kapal bisa dipersingkat menjadi 4 hari atau kurang. Biaya logistiknya sama saja, bisa lebih murah 50 persen dan 10 persen keuntungannya bisa digunakan

untuk pembangunan sektor lain, seperti jalan tol. ‘’Selama ini biaya ongkos laut kita masih mahal. Misalnya Jakarta sampai Belawan sekitar Rp 12 juta per kontainer. Nantinya ongkos angkut hanya sekitar Rp 6 juta,’’ ujarnya. Dahlan Iskan prihatin melihat infrastruktur pelabuhan di Indonesia dibanding Singapura yang tidak punya perkebunan sawit malah menjadi pengekspor sawit terbesar no. 1 di Asean. Indonesia di bawah Singapura, Malaysia, dan Thailand. Hal itu bisa terjadi karena pelabuhan Singapura sudah sangat modern dan bisa dirapati kapalkapal bermuatan hingga 3000 kontainer. Program melakukan penggabungan (merger) pelabuhan laut di Indonesia dari Belawan hingga Sorong dalam satu highway akan menjadikan Indonesia sebagai negara pengekspor sawit no 1 di Asean mengalahkan Singapura. Syaratnya infrastruktur pelabuhan, seperti panjang dermaga dan kedalamannya, peralatannya harus modern sehingga bisa dimasuki kapal bertonase raksasa, bisa memuat sampai 3000 kontainer. Khusus pelabuhan Belawan, pihaknya sudah merancang satu pelabuhan baru khususnya untuk ekspor CPO di Kuala Tanjung. Pelabuhan tersebut sama besarnya seperti juga pelabuhan besar lainnya agar ekspor kelapa sawit di Indonesia tidak kalah dengan Singapura, Malaysia, Thailand. ‘’Jadi kita harus buat pelabuhan besar yang mampu menampung semua kelapa sawit dari seluruh Sumatera,’’ demikian Dahlan. Serahkan SPS Award Dahlan Iskan yang juga Ketua Umum SPS Pusat setelah membuka Konferensi CEO Media dan Rakernas berkenan memberikan SPS Award 2012 kepada tokoh media yang sudah mengabdikan dirinya selama 30 tahun lebih di media. Tokoh yang menerima SPS Award itu antara lain Komisaris Harian Waspada H. Tribuana Said, MDS, Pemimpin Umum Waspada Dr Hj Rayati Syafrin, MBA, MM. Tokoh pers lainnya: Dahlan Iskan, Jakob Oetama, Surya Paloh, Budi Santoso, Gunawan Mu h a m m a d , A g u n g A d i Prasetyo, Mirta Karto Hadi, Fikri Jufri, Mirta Kartohadiprojo, H. Alwi Hamu, Bram Tuapattinaya, Harjoko Trisnadi, Syafik Umar, H. Basrhil Djabar, Gusti Rusdi Effendi, H. Tahar, dr Sulastomo, Lukman Setiawan.(m03)

Harga Cabai Meroket Lagi MEDAN (Waspada : Jelang Ramadhan, harga cabai yang dijual di sejumlah pasar tradisional Kota Medan kembali naik dalam beberapa hari terakhir. Kenaikan harga ini dipengaruhi minimnya pasokan dari sentra penghasil cabai di Berastagi, Tanah Karo. Pantauan Waspada, Jumat (13/7), sejumlah pedagang mengaku, saat ini pasokan berkurang hingga lebih dari 30 persen dalam beberapa hari terakhir. “Meski sebelumnya harga cabai sempat turun, namun kini harga cabai pedas lagi. Cabai merah yang biasanya seharga Rp24.000 naik menjadi Rp30.000 per kg, cabai hijau dari harga Rp22.000 naik menjadi Rp24.000 per kg, sama juga halnya dengan harga cabai rawit juga naik dari harga normal Rp24.000 Rp30.000 per kg,” ujar Marbun, pedagang di Pusat Pasar Medan. Menurutnya, kenaikan ini terjadi karena cuaca buruk,

hingga banyak petani cabai di Kabupaten Tanah Karo yang menjadi pemasok cabai di Medan, gagal panen hingga berkurangnya produksi. Marbun mengatakan, naiknya harga cabai tersebut juga memengaruhi permintaan konsumen. “Dalam beberapa hari terakhir, penurunan permintaan mulai terlihat. Dalam sehari rata-rata permintaan konsumen turun sebesar 10 persen. Penurunan permintaan ini diperkirakan akan terus terjadi hingga pasokan dan harga kembali normal,” ujarnya. Hal senada juga dikatakan Ginting, pedagang di Pasar Petisah Medan. Menurutnya, dalam beberapa hari terakhir pasokan mulai tersendat karena hasil panen petani sangat minim. Itupun, cabai-cabai yang masuk kali ini juga kualitasnya kurang baik. Sejauh ini, lanjut Ginting, khusus harga cabai saja yang mengalami kenaikan cukup

signifikan. Untuk harga hasil pertanian lainnya seperti tomat dan sayur mayur relatif stabil. Kenaikan harga ini pun terus dikeluhkan konsumen. Eli misalnya, seorang ibu rumah tangga yang tinggal di Jalan Brigjen Katamso, mengaku kewalahan dengan kenaikan harga tersebut. Menurutnya, jelang Ramadhan harga kebutuhan pokok mulai merangkak naik, padahal Ramadhan masih lama lagi waktunya. “Jika harga pada naik, tentunya hal ini akan membuat rakyat semakin sulit. Pemerintah harus bisa mengantisipasi dan menstabilkan kenaikan harga jelang Ramadhan, “ ujarnya. Sementara itu, pantauan Waspada untuk harga bahan pokok seperti gula pasir , minyak goreng, dan beras, sampai saat ini juga relatif stabil. Untuk harga beras jenis IR 64 dijual Rp8.500 per kg, minyak goreng Rp11.000 per kg, dan gula pasir Rp13.500 per kg. (cdu)

Di Pasar Lambaro, Harga Bahan Pokok Naik KOTAJANTHO (Waspada): Harga sembilan bahan pokok di Peukan Lambaro, Aceh Besar menjelang Ramadhan bergerak naik. Kenaikan harga bahan pokok yang paling dirasakan konsumen, selain beras dan minyak goreng, juga telur, gula pasir dan bawang serta cabai merah. Pantauan di Pasar Lambaro, Jumat (12/7), harga bahan pokok di tingkat pedagang eceran seperti beras Tangse 10 kg dibandrol Rp90.000 per zak dan 15 kg Rp135.000 per zak. Minyak goreng Malinda Rp11.000 per

kilogram sebelumnya Rp10.000. Minyak Bimoly kemasan 1 liter Rp14.000, sedangkan harga di pedagang grosir Rp13.400. Telur ayam buras satu papan Rp27.000 sebelumnya Rp26.000. Gula pasir Rp13.000 sebelumnya Rp12.000 per kilogram. Cabai Merah Rp37.000 yang sebelumnya Rp34.000 per kilogram. Kenaikan harga juga terjadi pada ayam kampung Rp35.000 per ekor yang sebelumnya Rp28.000 dan ayam potong Rp30.000 sebelumnya Rp27.000 per ekor. “Un t u k s e k a r a n g i n i ,

kenaikan harga belum terasa karena ada juga harga barang belum naik. Tidak tau bagaimana kalau puasa nanti, mudah-mudahan stabil,” kata Intan, warga Lubok Batee. Ka d i s Per i n d u s t r i a n , Perdagangan dan Koperasi Aceh Besar Rizal Junaidi mengatakan, stok kebutuhan pangan di Aceh Besar sejauh ini tidak ada masalah. “Semuanya cukup dan terkendali di semua pasar. Menyangkut harga memang sedikit mengalami kenaikan, dan ini disebabkan faktor psikologis saja,” kata Rizal. (b05)



Deputy Regional Manager Jacob J Maitimu foto bersama dengan Dirut PD Pasar Kota Medan Benny Sihotang, MBDC Manager Bank Mandiri Kanwil I Medan M Alwi, Kabag Perekonomian Pemko Medan, Lurah Pusat Pasar Muda Harahap.

Mandiri Salurkan Bina Lingkungan Ke Pusat Pasar MEDAN (Waspada) : PT Bank Mandiri Kantor Wilayah (Kanwil) I Medan menyalurkan bantuan bina lingkungan senilai Rp 50,6 juta untuk melengkapi fasilitas di Pusat Pasar Medan serta meningkatkan kenyamanan dari ribuan pengguna Pusat Pasar. Penyerahan bantuan ini dilakukan Deputy Regional Manager Jacob J Maitimu dan diterima Dirut PD Pasar Kota Medan Benny Sihotang, di Pusat Pasar, kemarin. Kegiatan tersebut juga dihadiri MBDC Manager Bank Mandiri Kanwil I Medan M Alwi, Kabag Perekonomian Pemko Medan, Lurah Pusat Pasar Muda Harahap dan para undangan. Jacob J Maitimu mengatakan, pasar memiliki peran sangat besar dalam menunjang perputaran roda perekonomian masyarakat. Sehingga, bantuan tersebut diharapkan dapat memberikan nilai tambah bagi pasar itu sendiri. “Dengan kondisi pasar yang lebih nyaman, masyarakat tentu akan menjadikan Pusat Pasar ini sebagai pilihan utama dalam memenuhi kebutuhan sehari-hari dibandingkan pasar modern,” jelasnya. Jacob Mengatakan, dari total bantuan senilai Rp50,6 juta tersebut, sebesar Rp48,8 juta digunakan untuk membiayai penggantian 2 set pegangan tangga dan Rp1,85 juta dialokasikan untuk pengadaan payung parkir. “Program ini menjadi salah bentuk kepedulian sosial perusahaan dalam mendorong pertumbuhan perekonomian daerah di seluruh Indonesia. Ini merupakan komitmen Bank Mandiri untuk tumbuh bersama, membangun negeri,” tegasnya. Jacob juga mengatakan, Bank Mandiri memiliki komitmen yang kuat untuk membantu nasabah mikro membutuhkan pinjaman dengan nilai hingga Rp100 juta. Sementara Dirut PD Pasar Benny Sihotang mengatakan, PD Pasar akan segera melakukan pembenahan terhadap lantai 3 Pusat Pasar yang sudah lama tidak digunakan. Lantai tersebut menurut rencana akan diisi sebanyak 604 kios dan dipasang AC, dua unit lift dan escalator. “Di samping itu juga perlu kami informasikan, Bank Mandiri dengan PD Pasar Kota Medan telah menjalin MoU penyaluran kredit bagi pedagang dengan agunan surat kios atau surat stan dari pedagang,” jelasnya. (m38)

Wakil Penanggung Jawab Waspada H. Sofyan Harahap (kanan) mewakili H. Tribuana Said, MDS dan Dr Hj Rayati Syafrin, MBA, MM, menerima SPS Award 2012 dalam satu upacara di Hotel Pangeran, Pekanbaru.

BI Peringatkan 100 Eksportir Sumut MEDAN (Waspada): Bank Indonesia (BI) Kordinator IX Wilayah Sumut dan Aceh di Medan menyurati 100 eksportir di Sumatera Utara (Sumut) terkait implementasi ketentuan penerimaan Devisa Hasil Ekspor (DHE) yang berlaku sejak Januari 2012, dimana perusahaan ekspor diberi tenggang melaksanakannya mulai Juli ini. Deputi Direktur Ekonomi dan Moneter Wilayah IX Sumut dan Aceh Mikael Budisatrio mengatakan, tujuan menyurati eksportir untuk mengingatkan mereka agar segera melaporkan DHE-nya ke bank nasional. “Sudah pernah dipanggil satu setengah bulan lalu dan juga sudah diimbau. Di Medan sudah lima kali sosialisasi yang dilakukan di Belawan, Bea Cukai, Disperindag, dan BNI,” ujar Mikael kemarin. Di Sumut, katanya, ada 90 sampai 100 perusahaan ekspor, tapi laporannya tidak ada di BI Sumut dan Aceh, demikian pula dengan nilai nominal DHE di

Sumut juga tidak diketahui secara detail. “Data DHE yang ada di pusat, sekarang sudah 7 miliar Dolar AS dari sekitar 14 miliar Dolar AS dan hasil devisa yang ditempatkan di bank nasional sekitar 51 persen,” ujarnya. Khusus Sumut, sebut Mikael, pengusaha crude palm oil (CPO) masih banyak yang tidak menempatkan devisanya di bank nasional. Seyogianya, bulan pelaporan Juli sudah melaporkan hasil devisa di bank nasional. Kalau tidak maka mereka bisa dikenakan sanksi denda maksimal Rp100 juta. Sanksi selanjutnya, fasilitas kepabeanan sebagai eksportir akan dicabut oleh Bea Cukai karena valas harus masuk perbankan nasional. “Jadi BI akan menyurati, kalau ada perusahaan sesuai monitor BI yang tetap mengekspor tapi hasil devisanya belum dilaporkan,” katanya. Hal ini dilakukan agar pasar valas di pasar keuangan Indo-

nesia jadi lebih kuat, mengingat mata uang domestik sedang tertekan terus baik pada pasarpasar keuangan di ASEAN atau pertumbuhan Eropa yang masih bermasalah. Selain itu, BI juga memberikan kesempatan valasnya dalam deposito sehingga dapat bunga dan BI punya cadangan devisa. Menurutnya, tujuan dari peraturan ini agar DHE dan devisa utang luar negeri masuk ke dalam negeri, memenuhi pasar valas domestik secara struktural, kestabilan nilai rupiah dengan adanya hot money. Ketua Kamar Dagang Indonesia (Kadin) Sumut, Irfan Mutyara mengatakan, peraturan tersebut sangat sulit untuk diterapkan. Alasannya, perusahaan tidak memiliki data administrasi lengkap kecuali untuk internal. “Tidak mungkin perusahaan menyusun administrasi yang diinginkan karena akan merumitkan perusahaan,” katanya. (m41)

Permasalahan Tanah Masih Problema Perusahaan Perkebunan M E D A N ( Wa s p a d a ) : Problema paling utama yang dihadapi pihak perkebunan di Sumatera Utara saat ini adalah masalah pertanahan, baik diperkotaan maupun di kabupaten dimana timbul fenomena penggarapan yang dilakukan oleh sekelompok orang mengklaim pemilik tanah, sehingga dikhawatirkan mengganggu kelangsungan kinerja perusahaan perkebunan. Hal itu diungkapkan Kepala Devisi Perekonomian dan Keuangan Komunitas Peduli Perkebunan Negara (KP2N) Kamsir Aritonang, SE, Ak di Medan, Sabtu (15/7). Seraya mendesak Plt Gubernur Sumatera Utara Gatot Pujo Nugroho tidak hanya memperjuangkan bagi hasil perkebunan, tetapi harus juga memperjuangkan nasib para pekerja perkebunan dan memberinya perlindungan hukum dari para penggarap lahan maupun oknum yang menguasai lahan perkebunan secara ilegal. “Rasa tidak nyaman kini menggeluti perasaan pekerja disektor perkebunan. Padahal berkat kerja keras mereka devisa ekspor perkebunan telah berhasil menjadi penyangga pembangunan nasional, kata Kamsir. Menurut Kamsir Aritonang, KP2N mengapresiasi langkah Gotot tersebut memperjuang-

kan tentang bagi hasil perkebunan diantaranya pajak ekspor CPO, namun diharapkan juga langkah tegas dapat ditampilkannya dalam membela karyawan perkebunan baik itu perkebunan Badan Usaha Milik Negara maupun perkebunan Swasta asing dan nasional. “Tercatat di Direktorat Jendral Perkebunan, lanjut Kamsir, pendapatan devisa pajak ekspor dari sektor perkebunan yang diperoleh Pemerintah Pusat pada tahun 2011, mencapai Rp25 miliar Dolar Amerika atau Rp220 triliun. Diantaranya kontribusi terbesar kelapa sawit yaitu 15 miliar Dolar Amerika dan karet tujuh miliar Dolar Amerika, komoditi tersebut sebagian besar berasal dari Sumatra Utara. Pencapaian itu tentu erat hubungannya dengan kerja keras yang dilakukan karyawan perkebunan. Untuk itu diharapkan keinginan dan janji Plt Gubsu memperjuangkan bagi hasil devisa CPO, juga dapat diperlihatkannya membela maupun melindungi usaha Managemen dan karyawan perkebunan, ujarnya. Bendahara KP2N HA Sulaiman Lubis menambahkan, berbagai peristiwa penggarapan dihadapi perusahaan perkebunan seperti dialami PTPN II, PTPN III, PTPN IV, dan pihak swasta asing maupun perke-

bunan swasta nasional. “Namun hal ini terkesan pembiaran oleh Pemvropsu sehingga penomena penguasaan lahan secara ilegal bergerak kencang ke daerah seperti Kabupaten Langkat, Binjai, Sergei, Asahan, Labuhan batu dan beberapa daerah lainnya. Berlarut-larutnya penyelesaian lahan PTPN II diseputar Medan membuat sekelompok masyarakat didaerah mencontoh perilaku penggarapan lahan perusahaan perkebunan.” Kondisi itu, tutur Sulaiman Lubis, diharap menjadi perhatian serius dari Gatot untuk mencari solusi dalam penyelesaian setiap peristiwa penggarapan. Dengan mengedepankan peraturan dan hukum sehingga masyarakat perkebunan merasa dilindungi, tidak seperti selama ini setiap timbul persengketaan lahan, karyawan kebun merasa dimarjinalkan, padahal mereka juga bagian dari rakyat Sumatera Utara. Sementara sekitar 16 ribu orang pensiunan karyawan PTPN II berharap memperoleh bagian dari lahan eks PTPN II yang telah dibebaskan seluas 5863 hektare, namun hingga kini tidak jelas kemana arahnya. Bahkan diluar lahan tersebut yang masih dalam HGU juga sudah banyak digarap, tapi kurang mendapat perlindungan hukum dari Pemprovsu. (m38)

Luar Negeri

A8 Menteri Afghanistan Luput Dari Usaha Pembunuhan

WASPADA Senin 16 Juli 2012

Seputar ASEAN

Filipina Takkan Protes Soal Kapal China

Dalam Serangan Bunuhdiri Ketiga Terhadap Para Pejabat Tinggi

KUNDUZ (Antara/AFP): Menteri pendidikan tingkat tinggi Afghanistan lolos dari pemboman oleh gerilyawan, Minggu (15/7), serangan ketiga kalinya terhadap para pejabat tinggi yang terjadi dalam waktu tiga hari, kata gubernur provinsi. Saat insiden terjadi, Menteri Obaidullah Obaid sedang berada dalam perjalanan antara provinsi Baghlan dan Kunduz di bagian utara ketika iring-iringan kendaraannya menghantam sebuah bom di tepi jalan —bom yang sama yang digunakan oleh para gerilyawan Taliban. Sang menteri lolos tanpa mengalamiluka-lukanamundua polisiyangmengawaliring-iringan tersebutluka-luka, kata Gubernur Baghlan Munshi Abdul Majeed. MunshimenunjukTalibansebagai pelaku pemboman tepi jalan itu. Dalamseranganterpisahhari Minggu,duabommeledakhingga melukai 14 orang di provinsi LogardiselatanKabul.Ledakanbom kedua mengenai pasukan keamanan ketika mereka sedang berkumpul untuk menyelidiki ledakan pertama, kata polisi. Para korban pengeboman itu sebagian besar adalah polisi, tentara, penyelidik intelijen, kata polisi. Sehari sebelumnya, seorang pengebom bunuhdiri menewaskan seorang pejabat penting antiTaliban dan 22 tamu lainnya pada satu pesta pernikahan di bagian utara Provinsi Samangan, Afghanistan, kata para pejabat. Pengebomtersebutmeledakkandirinya

ketika dia memeluk anggota parlemen Ahmad Khan Samangani, yang merayakan pesta pernikahan putrinya, kata polisi. Ledakan itu juga menewaskan Kepala Intel Provinsi dan Panglima Polisi Senior. Samangani — seorang etnis UzbekdanpemimpingerilyaantiUni Soviet terkenal pada tahun 1980an, yang kemudian menjadi seorang anggota parlemen — sedang sibuk menyambut tamu yang menghadiri pesta perkawinan putrinya ketika terjadi ledakan di Aybak, ibukota provinsi Samangan. Dia juga diketahui akrab denganpemimpinsukuUzbekistan Abdul Rashid Dostum, yang memimpin ribuan orang di kawasan itu. Suku Uzbekistan merupakan bagian dari koalisi suku minoritas yang berperang melawan Taliban di kawasan itu. Serangan itu, termasuk paling mematikan dalam beberapa bulan terakhir, meningkatkan resiko situasitidakamandiprovinsiyang relatif aman itu, kata para analis. Sedikitnya23orangtewasdan 60 lainnya cidera, begitu satu pernyataan dari kantor Presiden Hamid Karzai yang mengecam seranganitu.“MusuhAfghanistan sekalilagimengincartokoh-tokoh

Banjir Paksa 250.000 Warga Jepang Untuk Mengungsi

mujahidin yang memperjuangkan persatuan nasional,” kata Karzai. Para korban cedera dalam kondisi kritis dan jumlah korban tewas kemungkinan bertambah, kata jubir Kepolisian Regional Lal Mohammad Ahmadzai. Samangani meminta penjaga pesta untuktidakmemeriksaparatamu, kata Kepala polisi provinsi Khalil Andarabi. Taliban, yang selama ini berada di belakang sejumlah serangan bunuh diri tahun ini, membantahbertanggungjawab.“Kami

tidak terlibat dalam hal ini,” kata jubirZabihullahMujahid.“Ahmad Khan (Samangani) merupakan mantan panglima mujahidin, dia seorang terkenal dan banyak orang mengalami masalah dengannya.” Presiden Hamid Karzai mengatakan 23 orang tewas dana kira-kira 60 lainnya, termasuk sejumlah pejabat pemerintah, cedera dalam serangan tersebut, yang dikutuknya. Karzai mengatakanledakanbomdilakukan‘oleh musuhAfghanistan.’Diamemerintahkan satu tim dari Kabul untuk

terbang ke provinsi utara itu guna menyelidiki pengeboman. Kepala divisi kriminal kepolisian setempat, Ghulam Mohammad Khan, menyatakan seorangkomandanmiliterAfghanistan turut menjadi korban bom yang diledakkan di muka pintu masuk balairung. Selain korban tewas, 40 tamu lain dilaporkan mengalami lukaluka, termasuk Jend. Sayed AhmadSameh,seorangkepalapolisi Afghanistan. Taliban menolak bertanggung jawab atas serangan itu. Pada Jumat, direktur urusan

perempuan provinsi Laghman, Hanifa Safi, tewas ketika sebuah bom yang ditempelkan ke kendaraannya meledak. Suami Hanifa danputerimereka,yangjugaterkena seranganitu,mengalamilukaberat. Pemboman bunuh diri dan pembomantepijalanmerupakan senjata yang kerap dipakai oleh kelompok Islam Taliban, yang melakukan pemberontakan terhadap pemerintahan dukungan Barat di bawah kepempimpinan Presiden Hamid Karzai sejak rejim mereka terguling pada tahun 2001.(m23/m10)

Brunei Rayakan HUT Ke-66 Sultan Hassanal Bolkiah The Associated Press

TOKYO (AP): Sekurang-kurangnya 250.000 warga Jepang diminta agar meninggalkan rumah mereka di kawasan Jepang Baratdaya akibat hujan deras yang makin parah dikhawatirkan akan menyebabkan terjadi banjir dan tanah longsor. Berbagai laporan menyebutkan lebih dari 20 orang tewas atau hilang setelah hujan deras selama tiga hari di Pulau Kyushu. Badan Meteorologi Jepang mengatakan curah hujan di pulau tersebut mencapai 11 cm/jam Sabtu (14/7). Tanggul di sejumlah sungai jebol dan warga memilih tinggal di tempat-tempat penampungan untuk menghindari genangan air yang makin tinggi di sejumlah permukiman. Tayangan televisi menunjukkan air berlumpur yang bercampur dengan aneka puingpuing menerjang perumahan. Di sekitar Sungai Yamakuni di Prefektur Oita, ketinggian banjir sempat mencapai atap rumah, namun kemudian air surut. Seorang pejabat mengatakan di Prefektur Fukuoka saja telah terjadi 181 tanah longsor. Jurubicaraprefektur ini,HiroakiAoki, mengatakan820rumah rusaksementaratigajembatanterbawaarus.“Sayatidakpernahmelihat banjir dengan skala seperti ini di prefektur kami,” kata Aoki.(m10)

Roket Soyuz Rusia Diluncurkan Ke Stasiun Angkasa Internasional ALMATY, Rusia (Antara/Reuters): Satu pesawat ruang angkasa Soyuz yang membawa astronot Rusia, Jepang, dan Amerika Serikat diluncurkan di Stasiun Antariksa Internasional (ISS) Kazakhstan pada Minggu (15/7). Astronot Jepang Akihiko Hoshide, kosmonot veteran Rusia Yuri Malenchenko dan astronot NASA SunitaWilliams diluncurkan dalam roket Soyuz TMA-05M dari kosmodrom Baikonur, Kazakhstan, pada pukul 02.40 GMT (22.40 WIB Sabtu). Trio astronot itu dijadwalkan untuk berlabuh pada Selasa pagi, bergabung dengan Insinyur Penerbangan NASA Joseph Acaba dan dua kosmonot Rusia, Gennady Padalka dan Sergei Revin, di dalam pesawat ISS, satu kompleks penelitian senilai 100 miliar dolar AS yang mengorbit sekitar 240 mil (385 kilometer) di atas Bumi.

MANILA (Antara/AFP): Filipina Minggu (15/7) mengatakan pihaknya tidak akan mengajukan protes diplomatik kepada China setelah Beijing melepaskan kapal fregat angkatan lautnya dari sebuah dangkalan di Laut China Selatan yang disengketakan. Kapal perang kecil milik China itu pekan lalu terjebak di dangkalan Half Moon —yang disebut Manila sebagai Hasa Hasa— selama empat hari. Menteri Luar Negeri Filipina Albert del Rosario menganggap kejadian itu tak lebih dari sekedar insiden. “Kita tidak melihat ada niat buruk menyangkut keberadaan kapal itu di zona ekonomi eksklusif kami,” kata del Rosario.“Mengenai protes diplomatik, kami tidak akan melakukannya,” ujar del Rosario. Kapal fregat China itu dilaporkan sedang melakukan ‘patroli rutin’ketikaRabuterjebakdidangkalanyanglokasinyaberadahanya 96,5 km dari pulau Filipina di bagian barat, Palawan, yaitu berada dizonaekonomieksklusif(ZEE)Filipina.Menuruthukuminternasional, ZEE sebuah negara jaraknya adalah 321,9 km dari pantai. Kedutaanbesar China di Manila mengatakan bahwa kapal fregatnya itu ‘telah mengapung kembali dengan sukses’ sebelum fajar, Minggu, dan del Rosario mengatakan dia telah diberitahu bahwa kapal tersebut sudah berlayar kembali menuju China. “Semoga pelayaran ke China berjalan dengan aman,” katanya. Dangkalan tersebut merupakan bagian dari Kepulauan Spratly — yang disebut China sebagai Nansha, yaitu serentetan karang dan pulau-pulau yang berada di jalur pelayaran penting di Laut China Selatan dan diyakini kaya akan sumber daya mineral. Selain Filipina dan China, Kepulauan Spratlys juga diklaim secara keseluruhan atau sebagian oleh Taiwan serta tiga negara di Asia Tenggara, yaitu Brunei, Malaysia dan Vietnam. Bertumpuknya klaim terhadap Laut China Selatan kerap menimbulkan ketegangan di antara negara-negara pengklaim. Filipina dan Vietnam baru-baru ini menuduh China kian agresif menancapkan klaimnya. Masalah di Laut China Selatan baru-baru ini merusak pertemuan tahunan para menteri luar negeri ASEAN (perhimpunan negaranegara Asia Tenggara) yang berlangsung pekan lalu di Kamboja, di mana Manila menuduh China ‘bermuka dua’ dan melakukan intimidasi. Sengketa wilayah itu memecah belah posisi ASEAN, dengan Kamboja membela China dan menggagalkan perhimpunan tersebut mengeluarkan pernyataan bersama —yang biasanya berupa kesimpulan tentang berbagai pencapaian dan keprihatinan.

MEMPROTES FELDA. Ribuan demonstran berpawai ke Istana Nasional untuk menyerahkan satu memorandum sebagai protes terhadap kebijakan Felda Global Malaysia di Kuala Lumpur, Malaysia, Sabtu (14/7). Perusahaan minyak sawit Felda Global dari Malaysia meningkat perdagangan debutnya sebanyak 20 persen pada 28 Juni lalu. Rencana pendaftaran Felda yang awalnya menghadapi penentangan dari para petani yang dimiliki sebagian dari perusahaan dan dikhawatirkan hilangnya kendali.

Peran AS Dalam Pasca Mubarak Di Mesir Masih Belum Jelas KAIRO (AP): Menghadapi desakan dari presiden baruMesir, Menteri Luar Negeri AS Hillary Rodham Clinton Minggu (16/7) berusahauntukmemobilisasipengaruhWashingtonapakahmasih ada pada pemimpin militer yang memainkan peran pentingnya di negara itu pasca-Hosni Mubarak. Pengaruh pemimpin militer tersebut selama ini telah memecah belah Mesir antara mereka yang melihat militer sebagai ancaman bagi demokrasi dan mereka yang berharap militer sebagai penjamin stabilisasi. Tuntutan Clinton kepada militer sederhana: Bekerjasama denganparapemimpinbaruyang Islamis mengenai satu transisi penuh kepada pemerintahan sipil. Namun AS yang telah menyetujui pengiriman besar-besaran bantuanmiliter,makabelumjelas apa tujuan pemerintahan Presi-

den Barack Obama, apakah berusaha menciptakan stabilitas Mesiratauinginmembangunsatu hubungan baru dengan antara Washington yang sekali waktu pernah menjadi sekutu kerasnya dengan Mesir. Pertemuan Clinton dengan Marsekal Hussein Tantawi di Kairo dilakukan bersamaan dengan transformasi yang dilakukan Mesir dari kekuasaan diktator ke alamdemokrasi.ClintondanTantawi bertemu selama lebih dari satu jam. Clinton menegaskan ‘dukungan kuat’Washington bagi transisi demokratis Mesir, setelah berunding dengan Presiden Mohamed Moursi. “Saya datang ke Kairo untuk menegaskan dukungan kuat AS kepada rakyat Mesir dan transisi demokratis mereka,” kata Hillary dalam jumpa pers bersama dengan Menlu Mesir Mohammd Amr setelah perte-

muan itu. “Kami menginginkan satu mitra yang baik dan kami ingin mendukung demokorasi yang telah diperoleh dengan keberanian dan pengorbanan rakyat Mesir,” katanya. DalamlawatanduaharidiMesir, diplomat penting AS itu juga bertemudenganTantawi-penguasa sementara negara itu setelah HosniMubarakdigulingkandalam satupemberontakanrakyattahun lalu—sertaparaaktiviswanitadan para pemimpin Coptic. Hillary datang saat terjadi konflik politik pergolakan kekuasaan antara presiden yang berasal dari kelompok Islam itu dan Dewan Tertinggi Angkatan Bersenjata(SCAF)yangmemerintahMesir setelah Mubarak digulingkan. “Demokrasi memang sulit,” katanya. “Demokrasi memerlukan dialog dan kompromi dan politik riil. Kami akan mendorong

dan kami menginginkan itu bermanfaat.Tetapi kami tahu itu bukan untuk AS tetapi rakyat Mesirlah yang akan memutuskannya.” Pertemuan Hillary dengan Moursi yang lama menjadi anggota Ichwanul Muslimin terjadi setelah pemilihan presiden yang bebas pertama negara itu setelah penggulingan Mubarak sekutu AS puluhan tahun itu. “Kami sangat, sangat ingin bertemu anda dan gembira anda ada di sini,” kata Moursi kepada Hillary ketika mereka siap berembuk di istana kepresidenan di daerah pinggiran Hekiopolis Kairo. Pekan lalu Moursi memerintahkan parlemen bersidang, mengabaikan keputusan militer yang membubarkan parlemen setelahpengadilanpentingnegara itu memutuskan dewan perwakilan rakyat itu tidak sah.(m10)

BANDAR SERI BAGAWAN (Antara/Xinhua-OANA): Brunei Darussalam Minggu (15/7) merayakan dengan megah dan meriah ulangtahun ke-66 rajanya, Sultan Hassanal Bolkiah, yang memerintah selama 45 tahun dari dinasti Muslim 607 tahun tak terputus. Sultan Hassanal Bolkiah Mu’izzaddinWaddaulah, mengenakan seragammiliterhitamdansabukemas,tibadenganpermaisuriSaleha Mohamed Alam dalam iring-iringan mobil dan anak-anak sekolah melambaikanbendera,bersamawisatawandanroyalisyangberkumpul disekitarLapanganSultanOmarAliSaifuddindiBandarSeriBegawan, di mana prosesi perayaan utama diadakan. Banyak warga di sana menyampaikan penghargaan mereka kepada raja untuk jasanya. “Saya ingin melihat raja dan saya melakukan bagian saya untuk berada di sini sebagai cara untuk berterima kasih kepada raja atas kontribusinya dalam memberikan antara lain pendidikan gratis, kesehatan gratis kepada rakyat,” kata dosen, Aishah Din, kepada Xinhua. Selama masa pemerintahan Sultan Hassanal Bolkiah terjadi kemajuan teknologi yang menjadikan Brunei Shell Petroleum Company Sdn Bhd (BSP) menemukan ladang minyak lepas pantai di tahun 1960, meningkatkan produksi minyak menjadi 250.000 barel per hari dari 15.000 barel per hari yang diproduksi pascaPerang Dunia II . BSP dimiliki oleh pemerintah Brunei dan satu perusahaan patungan dengan Shell dan perusahaan minyak Belanda Royal Dutch. Saat ini Brunei berada di peringkat kelima terkaya di dunia dengan PDB per kapita 48.333 dollar AS. Upacara dimulai dengan raja, yang juga selaku komandan pertahanan tertinggi, memeriksa barisan kehormatan ketika 21 dentuman meriam ditembakkan. Dia menyampaikan pidato di hadapan para tamu undangan antara lain termasuk Menteri Energi Thailand, Menteri Pendidikan Indonesia, Menteri negara Malaysia dan beberapa anggota parlemen Jepang. Perayaan itu diakhiri dengan satu pesta malam dan kembang api di belakang istana Nurul Iman.

Taiwan Berniat Perpanjang Landasan Pacu Di Spratly


PELUNCURANPESAWAT ANGKASA LUAR SOYUZ.Pesawat angkasa luar Soyuz TMA-05M yang membawa awak untuk Stasiun Angkasa Luar Internasional (ISS) dari Rusia kosmonot Yuri Malenchenko, astronot Jepang Akihiko Hoshide dan astronot Amerika Sunita Williams melesat ke angkasa dari pelataran peluncurannya di Kosmodrom Baikonur Minggu (15/7)

TAIPEH (Antara/AFP): Taiwan mempertimbangkan akan memperpanjang landasan pacu di pulau sengketa Spratly, langkah yangdikhawatirkanakanmemicu ketegangan baru di Laut China Selatan —wilayah maritim yang diperebutkan oleh beberapa negara, kata laporan media Minggu (15/7). Jika disetujui, proyek tersebut akan membuat landas pacu bandara di Pulau Taiping lebih panjang 500 meter. PulauTaiping terbesar di perairan yang disengketakan dan terletak sekitar 1,4 km dari Taiwan, kata laporan Liberty Times. “Pihak-pihak berwenang keamanan nasional belakangan ini menyelenggarakansebuahpertemuan untuk mengevaluasi proposal proyek kendati situasi di Laut China Selatan makin rumit,” kata media tersebut dengan mengutip sumber di kantor keamanan nasional. Ketegangan di Laut China Selatan baru-baru ini meningkat saat China dan Filipina terkunci dalam perselisihan maritim menyangkutDangkalanScarborough di perairan Filipina. Landas pacu, yang saat ini memiliki panjang 1.150 meter itu, dibangun pada 2006 walaupun diprotes oleh negara-negara pengklaim Laut China Selatan, termasukVietnam,Brunei,China, Malaysia dan Filipina. Seruan bagi peningkatan kemampuan pertahanan Taiwan

di wilayah yang disengketakan itu meningkat sementara negaranegara pengklaim lainnya telah mengerahkanlebihbanyakpasukan serta menambah fasilitasfasilitasmiliterdiwilayahtersebut. Mei lalu para penjaga pantai Taiwanmengatakanbahwakapalkapal penyusup Vietnam tahun

lalu berdatangan hingga jumlahnya mencapai 106 kapal, yang tadinya hanya berjumlah 42 pada tahun sebelumnya. Pada bulan yang sama, Taiwanmembentuksebuahunitterbang khusus yang memiliki kemampuan berkitar menguasai Laut China Selatan hanya dalam

waktu beberapa jam, menyusul kunjungan yang dilakukan oleh tiga anggota parlemen sereta sejumlah pejabat tinggi militer dalam sebuah kunjungan. Kunjungan itu sendiri dimaksudkan untuk memperbaharui klaimmerekakendatiketegangan di wilayah tersebut memuncak.

Pria Bersenjata Serang Kantor Polisi Arab Saudi, Seorang Tewas RIYADH, Arab Saudi (Antara/AFP): Seorang pria bersenjata tewas dalam serangan ke satu kantor polisi sementara empat

polisi Arab Saudi cedera dalam serangan terpisah terhadap patroli mereka di daerah timur negara itu, kata media pemerintah.

Kebakaran Dermaga New York Berhasil Dipadamkan NEW YORK (Antara/Reuters): Api berkobar di satu dermaga yang terkenal di kalangan wisatawan dan orang yang berbelanja di NewYork dipadamkan. Kobaran api membuat asap tebal membubung ke udara wilayah Manhattan sebelum petugas pemadam bisa memadamkan si jago merah, kata seorang petugas pemadam. Penyebab kebakaran di Dermaga 17 di South Street Seaport, yangmenjaditempatpertunjukanmusikSabtu(14/7),sedangdiselidiki, kata jurubicara Dinas Pemadam New York City. Apimelahapsatudaerahbangunandanpapankayuyangmenutup wilayah seluas 100 kaki kali 100 kaki, dan dipadamkan hanya dalam waktu satu-setengah jam tanpa memusnahkan toko lain, kata jurubicaraitu.Sebanyak140petugaspemadammenanggapipemberitahuan mengenai bencana tersebut. Howard Hughes Co, yang mengoperasikan pelabuhan tersebut, menyatakan akan bekerjasama dengan pihak berwenang dalam penyelidikan mereka. Ditambahkannya, banyak petugas pemadam danpolisitelahsiagakarenaacaraitu,yangdiberiizinuntukdilanjutkan.

“Empat pria bersenjata mengenakan topeng dan mengendarai sepeda-sepeda motor memasukisatukomplekskantorpolisi Al-Awamiyadimanasalahseorang dari mereka melemparkan bom bensin sementara tiga lainnya menembaki kantor itu,” kata juru bicara kementerian dalam negeri Mansural-Turki,yangdikutipkantor berita SPA, Sabtu (14/7). Serangan di kota Syiah AlAwamiya itu terjadi Jumat petang, kurang dari seminggu setelah dua pemrotestewasdalambentrokan denganpolisididistrikQatifsetelah penahanan seorang ulama terkemuka Syiah. Dalambentrokan-bentrokan itu, Minggu malam, para aktivis mengatakan puluhan pemrotes cedera ketika polisi menembaki satu unjuk rasa menentang penahanan Sheik Nimr al-Nimr yang pihak berwajib tuduh sebagai “penghasut.”


SULTAN Brunei Hassanal Bolkiah (ketiga dari kanan) berjalan untuk melakukan pemeriksaan barisan kehormatan dalam acara perayaan ulangtahun ke-66 sultan di ibukota Bandar Seri Begawan, Brunei, Minggu (15/7).

Jepang Panggil Dubes Dari Beijing TOKYO (Antara/AFP): Jepang memanggil pulang duta besarnya di China untuk konsultasi pada Ahad di tengah peningkatan sengketa di antara kedua negara Asia itu menyangkut wilayah di Laut China Selatan, kata laporan. Uchiro Niwa pulang ke Tokyo untuk berembuk dengan Menteri LuarNegeriKoichiroGembamengenaiperkembanganterkinisengketa itu,katamereka.“Sayaakanmelapordanmelakukankonsultasidengan Gemba, kata Niwa kepada wartawan ketika tiba di kementerian luar negeri di Tokyo, kata kantor berita Jiji Press. Niwa mengatakan belum diputuskan kapan ia akan kembali ke Beijing. “Tetapi saya kira saya harus pulang setelah perundingan selesai,” katanya yang dikuti kantor berita Kyodo.Gembamembantah pemerintah memanggil pulang Niwa untuk memprotes China, dan menekankan kepulangannya untuk melakukan konsultasikonsultasi, kata media Jepang. Jepang pekan lalu mengajukan dua protes terpisah kepada Beijing setelah kapal-kapal China memasuki perairan yang kaya sumber alam yang diklaim Tokyo dan Beijing dekat satu kelompok pulau yang oleh Jepang disebut Senkaku sedangkan China menamakannya Diaoyu. Jepang memanggil dubes China setelah insiden pertama itu. Sementara itu China menyatakan penentangan kerasnya terhadap satu rencana Jepang untuk membeli pulau-pulau dari keluarga yang Tokyo akui sebagai pemilik sah. Kendatipun kedua negara berkepentingan dalam hubungan dagang, hubungan antara Jepang dan China sering tegang, terutama menyangkut sengketa wilayah dan agresi Jepang semasa perang di Asia.


WASPADA Senin 16 Juli 2012


Garcia Sandingkan Sabuk WBC-WBA LAS VEGAS, AS (Waspada): Danny Garcia secara mengejutkan menang Technical Knock Out (TKO) atas Amir Khan dalam pertarungan unifikasi gelar kelas welter ringan di Las Vegas, Amerika Serikat, Minggu (15/7) pagi WIB. Sukses menjatuhkan lawannya pada ronde keempat tersebut, membuat Garcia merebut gelar World Boxing Association (WBA) untuk disandingkan dengan sabuk juaranya di World Boxing Council (WBC). Khan sempat tampil agresif di ronde pertama. Duel makin memanas di ronde ketiga, ketika Garcia sempat memukul jatuh Khan lewat pukulan tangan kiri. Garcia kembali membuat Khan tersungkur lewat pukulan ke arah dagu ronde keempat, sehinggawasitKennyBaylesssegera menghentikan pertandingan. “Tangan saya berada sedikit ke bawah saat itu dan saya harus


WASIT Kenny Bayless berusaha menghentikan pembantaian Danny Garcia terhadap Amir Khan (kiri) di Las Vegas, AS, Minggu (15/7) pagi WIB. membayarnya. Danny Garcia menunjukkan kinerja yang hebat,” kata Khan. “Itulah tinju, satu pukulan bisa mengubah segalanya. Pikiran saya tetap jernih, saya terkejut wasit menghentikan pertarungan. Seharusnya saya lebih banyak mengambil pukulan keras,” dalih petinju Inggris itu.

Problem Catur

Haye Berjaya Di Stadion Upton Park, London, Sabtu (MingguWIB), David Haye berjaya memenangkan partai bergengsi antara petinju Inggris. The Hayemaker menghentikan perlawanan Dereck Chisora dalam lima ronde lewat TKO. Setelah lima sabuk juaranya


Putih melangkah, mematikan lawannya dua langkah.

Jawaban di halaman A2 8







dilucutiWladimir Klitchko tahun lalu, Haye merebut sabuk juara IntercontinentalWBA dan juara kelas berat versi WBO yang sebelumnya kosong. Pertarungan keduanya sempat memanas saat Haye dan Chisora sama-sama sempat melemparkan pukulan saat bel sudah berbunyi, gestur saling serang pun terjadi namun tidak ada insiden besar. Petinju berusia 31 tahun itu beberapa kali memasukan jab keras ke wajahChisora,yanglebih banyak bertahan, sebelum menuntaskan perlawanan Chi-sora di stadion yang menjadi markas West Ham United tersebut. “Semua berjalan lancar karena latihan saya sangat bagus. Dereck petinju yang handal, dia memberikan saya perlawanan yang hebat,” ucap Haye. “Saya tidak menghargai dia sebelumnya, tapi sekarang telah berubah. Suatu saat nanti dia pasti akan jadi juara,” katanya menambahkan. (m15/vvn/mirror/rtr)



1. Tertarik hatinya; Jatuh cinta. 3. Daun muda; Ujung yang runcing; Yang tertinggi. 7. Tanaman untuk bahan ramuan obat; Kecur; Belum banyak pengalaman; Belum dewasa. 8. Kata seru untuk menyatakan bahwa sesuatu sudah dipilih (dimiliki); Cop; Gelas plastik atau kertas (Inggris). 9. Sudah memadai; Tidak kurang. 12. Larikan orang dengan maksud tertentu. 14. Jentik-jentik; Anak nyamuk di dalam air. 15. Cotok; Patuk (Jawa); Duri (Sunda). 17. Pajak atau bea. 19. Distrik. 20. Tidak masuk kerja beberapa hari secara resmi untuk berliburan. 22. Alat untuk melecut. 25. Benda atau ruang yang beralas bundar dan merunjung sampai ke satu titik (besarnya ialah luas alas kali sepertiga tinggi). 29. Bingung; Kacau. 30. Ambil barang orang lain dengan tidak sah. 31. Takut; Gentar. 32. Bungsu.


1 A








1. ____Sei Tuan, kota di Sumatra Utara.

2. 3. 4. 5.

6. 8.

10. 11.

13. 16. 18. 19. 21. 23. 24. 26. 27. 28.

Akar gambir yang dikeringkan. Cangkul. Tiruan bunyi air memancur, dsb. Takaran beras (1/4 gantang); Kepala pengudut (tempat candu dibakar); Struktur berbentuk gelembung. Tukang cukur; Alat untuk mencukur. _____Sudarijanto, pernah jadi menteri muda, ketua Badan Penyehatan Perbankan Nasional, Dirut Telkom dan Bank Mega. Celana dalam. Wadah dari daun pisang yang dilipat dan disemat dengan lidi sehingga membentuk lekukan; Rujak buah; Pikat. Masam (seperti rasa cuka); Merasa ngeri; Gentar. Cotok; Pagut; Tabung buluh untuk tempat air dsb. Timpang; Bengkok. Lubang pada lesung; Lubang tempat memasang tiang. Singkatan Intensive Care Unit. Jual diri; Buruk laku; Celaka; Sial. Garpu (dipakai bersama sendok). Campur aduk; Tidak teratur; Kacau (tentang berpikir, bahasa). Terjal dan dalam. Anak dari anak.

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan dalam waktu lima menit. Jawabannya di halaman A2 kolom 1.

9 6 5 2 8 7 4 1 1 4 1 6 8 7 3 5 2

3 4 7 6 5 8 9 3 2 1


2 8 7 4 1 3 6 5 2 7 2 8 1 3 9 4 6 *241



Waspada/Arianda Tanjung

WASPADA Senin 16 Juli 2012

PEMIMPIN Umum PT Harian Waspada Hj Rayati Syafrin didampingi EO dari PT Citra Mekar Sari Billy Hartanto, dan Sekretaris Panpel Erwinsyah SE membaca kupon pemenang satu unit sepeda motor Honda Mega Pro pada pengundian Kuis Tebak Juara Euro 2012 di pelataran parkir Kantor Harian Waspada, Jl Letjen Suprapto No 1 Medan, Sabtu (14/7).

Warga Medan Raih Tiga Honda Kuis Tebak Juara/Top Skor Euro 2012 MEDAN (Waspada): Tiga sepeda motor Honda yang menjadi hadiah utama Kuis Tebak Juara Euro 2012, akhirnya diraih warga Kota Medan. Kepastian itu setelah dilakukan pengundian di pelataran parkir Harian Waspada, Jl Letjen Suprapto No 1 Medan, Sabtu (14/7). Ketiga sepeda motor Honda itu terdiri atas Honda Mega Pro, Honda Supra X 125, dan Honda Beat. Honda Mega Pro diraih Morgan, penduduk Jl M Idris Medan. Morgan meraih hadiah utama setelah kuponnya diundi Pemimpin Umum Harian Waspada, Hj Rayati Syafrin. Turut mengundi Billy Hartanto dari PT Citra Mekar Sakti,

juga perwakilan sponsor di antaranya Charles (PT Sinde Budi Sentosa), Gunarko Hartoyo (CV Indako Trading Co) serta puluhan warga yang menyaksikan pengundian. Untuk sepeda motor Honda Supra X 125 dimenangkan Hery Saputra, warga Jl Belanga No 12 Ayahanda Medan. Sedangkan sepeda motor Honda

Waspada/Arianda Tanjung

PERWAKILAN dari PT Sinde Budi Sentosa, Charles, mengundi pemenang satu unit sepeda motor Supra X 125 cc.

Beat direbut Habibah, penduduk Jl Masjid Gg Ikhlas Medan. Selain tiga pemenang sepeda motor Honda tersebut di atas, juga terdapat satu pemenang komputer tab, dua pemenang televisi 21 inci, tiga pemenang laptop, empat pemenang lemari es, lima pemenang handphone, dan 20 hadiah hiburan (lihat daftar pemenang). Pengundian Kuis Tebak Juara juga dirangkai dengan pengundian Kuis Top Skor Euro 2012 yang menyediakan berbagai hadiah menarik, di antaranya satu unit komputer tab, dua unit televisi, dua unit laptop, dua unit lemari es, lima handphone, dan lainnya. Sesuai keputusan panitia, peserta kuis yang memilih satu di antaranya enam pemain yang masuk daftar top skor, yakni Fernando Torres, Mario Gomez, Alan Dzagoev, Mario Mandzukic, Mario Balotelli, dan Cristiano Ronaldo yang samasama mengemas tiga gol, maka pilihannya dianggap benar. Sekretaris Panpel, Erwinsyah SE, mengatakan khusus untuk Kuis Tebak Juara Euro 2012, pihaknya menerima kupon masuk sekira 250 ribu lembar dan sekira 300 ribu lembar untuk kupon kuis Top Skor. “Bagi para pemenang dapat

Daftar Pemenang Kuis Tebak Juara Euro 2012 1 Pemenang Honda Mega Pro -Morgan, Jl M Idris Medan

1 Pemenang Honda Supra X 125

-Hery Saputra, Jl Belanga No 12 Ayahanda Medan

1 Pemenang Honda Beat

-Habibah, Jl Mesjid Gg Ikhlas Medan

1 Pemenang Komputer Tab

-Musliadi, Jl Rakyat/Rajawali No 70 Sidodame

2 Pemenang TV 21 Inci

-Irma Jayanti, Jl Pelopor Gg Sepakat No 3 -Vitalia HMS, Jl Sembada XV No 10

3 Pemenang Laptop Waspada/Arianda Tanjung

segera mengambil hadiah di Kantor Harian Waspada mulai Rabu (18/7). Pemenang harus menyerahkan fotokopi identitas diri sesuai yang tertera di kupon pemenang,” ujar Eriwinsyah. Erwin pun mengucapkan terima kasih kepada pihak sponsor, yakni PT Sinde Budi Sentosa dengan produknya Tea Angin Cap Badag, PT Yagi Utama dengan Produknya Minyak Angin Cap Kapak, dan CV Indako Trading Co, yang telah mendukung penuh acara. (m42)

SEJUMLAH pengunjung menyaksikan pengundian Kuis Tebak Juara Euro 2012. Tampak tumpukan sekira 250 ribu kupon yang siap diundi.

Waspada/Arianda Tanjung

MANAJER Promosi CV Indako Trading Co, Gunarko Hartoyo, mengundi hadiah utama Kuis Tebak Top Skor Euro 2012.

SEORANG pengunjung mengundi kupon Kuis Tebak Top Skor.

4 Pemenang Lemari Es

-Ahmad Syahril, Jl Halat Gg Cemara -M Jaka Aditya, Jl Sei Musi Medan -Rai Yoshi Aki, Jl Gajah Mada Gg Rukun Medan -Suhendri, Jl Kuswari Gg Pribadi Medan

5 Pemenang Handphone

-M Ali Iswan Nst, Jl Nanio Salak D. Lama P Batu Deli -Bima Siahaan, Jl SM Raja Gg Aman Medan -Ihwan Anadi SE, Jl Budi Luhur Medan -Irmaini, Jl Pelabuhan Ujung Sei Bilah Brandan -Sofian M, Ling XV Beringin

20 Pemenang Hadiah Hiburan

Waspada/Arianda Tanjung

Waspada/Arianda Tanjung

SALAH satu pengunjung diberi kesempatan untuk turut mengundi.

-Wawan Kurniawan, Jl Pelita P Brayan -Tjie Man Koen, Jl Keris No 70 A Medan -Husaini Ismail, Jl Megawati Gg Damai Ujung

-Darwin Effendi, Jl Amaliun Gg Umanat -Donna Monalisa, Jl Denai/Rawa Medan -Herwin Chan, Jl B Katamso Medan -Yudhi Arifin, Jl Kapas Medan -Ade Wardah Lubis, Jl B Zein Hamid -Pangurunan Nasution, Panyabungan, Madina -Syaiful Bahri Tambunan, Gg Tabib Medan -Rinaldy, Jl MA Selatan Gg Teratak -Ade Marlina, Jl Bilal Gg Keluarga -Hartoyo, Ling III Kelurahan Tualang Perbaungan -Darwin M Amin, Gg Keluarga Dusun IV -Syarah, Jl Bhayangkara 351 Medan -Nila Handayani, Jl Pengilar Medan -Loly Febrinda Sari, Jl Sempurna -Sri Yenni Wulandari, Jl Sehat Sunggal -Ikhramsyah Putra, Jl Karya Utam -Agung Laksono, Jl Tj Sari Pasar I -Ramadhani, Dusan Gunung Pane Sipispis Sergai -Sumihar Situmeang, Sri Gunting Blok 1 B -Oei Jian Min, Jl Sriwijaya No 65

Daftar Pemenang Kuis Top Skor 1 Pemenang Komputer Tab

-Wiji Santoso, Jl Sakti Lubis Medan

2 Pemenang TV 21 Inci

-Henny Surianto N, Jl DTM Abdullah Tanjungbalai -Mahyaruddin Salim, Jl Denai Tegal Sari Medan

2 Pemenang Laptop

-Sadiman Saka, Jl Binjai Km 10,3 Gg Jadi -Slamet Riyanto, Jl B Zein Hamid Gg Saudara

2 Pemenang Lemari Es

-Faisal, Jl Ismaliyah Medan -Ardjun Lubis, Jl Garu II A Medan

5 Pemenang Handphone

-Muhammad Thohir, Jl MJ Sutoyo T Tinggi -Jeffrey DIP Simamora, Jl Flamboyan Medan -Ilham Ramadhan Hsb, Desa Baru Dusun IV Bt Kuis -Zubaidah Hsb, Jl Bhayangkara 524 Tembung -Rihandi, Jl Sei Serayu Gg Buntu Medan

15 Pemenang Hadiah Hiburan

-Ngat Mawardi, Jl Amal Luhur Gg Kueni Medan -Sudarman Panggabean, Jl Sei Serayu Gg Buntu Medan -DuspanerySawata,JlPelaksanaanDusunIVBandarSetia -M Irsan, Jl Ibrahim Umar Medan -The Gek Kaw, Jl Banteng I Gg Sederhana Mandala -Fajar Novi Rianto, Jl Sawah Kasar Medan -Mangaradja Siregar, Kompleks Tasbih -H Suriono, Jl Garu IV Medan -Panusunan Siregar, Dusun V Perum TA Permai -Roy Naldo Gurning, Jl Karya Setuju Gg Bilal 19 -Ir Gion Sinarta, Jl Gaperta Ujung Tanjung Gusta -Saifullah, Jl PB II Gg Pendidikan I -Tomi H Hutabarat, Jl Karya Jasa Gg Karya April 29 -Haganta Karo Karo, Jl Pajar Berastagi -Rumintang Simorangkir, Jl Danau Laut Tawar Medan

100 Pemenang T-Shirt Cap Kapak

-Cucu Yulia, Jl Tj Permai I Dsn IV Tj Gusta -The Gek Kaw, Jl P Banting I Gg Sederhana Medan -Law Tjong Hian, Jl B Katamso Medan -Eko Chandra K, Jl Sawi Binjai Barat -Warninda, Jl Kartika Eka Paksi Binjai Kota -Rajib Muhammad Nur, Jl Sumpah Prajurit Medan -Iwan, Jl Taman Permai 2 Tj Gusta

-Hj Saidah A Simanjuntak, Jl Suka Adil Medan -Mayaruddin Aghus , Jl Alumunium Gg Mangga Tj Mulia -Drs H Imran Lubis, Jl Suka Adil Medan Johor -Aisyah Khairani Lbs, Jl Suka Adil Medan Johor -Bambang Trisno, Jl Warni Medan -Armansya, Jl Bilal Ujung Gg Arimbi P Brayan -Hanggodo Sutrio, Kompleks Taman Jasmine Mas -Subarianto, Jl Amal Luhur Gg Kuini Medan -Ipan Jl Cempaka Medan -Taufan Pradipta, Jl Utama Gg Cendana Medan Area -Lukmanul Hakim, Yayasan Al Fityam Medan -Rahmah Jl Pukat Harimau Gg Sepakat Tembung -Khairul Doso, Jl Tanjung Permai I, Tj Gusta -M Mas’ah, Lembaga Bahasa Arab dan Studi Islam -Mahyudi, Jl Sei Mencirim Dsn II Paya Geli Sunggal -Sumarno, Jl Madiosantoso Gg Saudara P Brayan -Mawardi Lubis, Lk II PJKA, Medan Johor -Nasiawati, Jl Kampung Aur Lembah Medan -Ahmad, Dusun II Sei Rampah -Ana Erfiana H, Jl Lembu Medan -M Idham Surya, Jl Bersama Gg Jaya Baru Medan -M Ridwan, Link Utama Tangkahan Durian P Brandan -Sriyadi, Jl Eka Rasmi Gg Eka Dewi Medan -Sumasdi, Jl Intan Medan -Ade Suryani, Jl Intan Medan -Ferry Fadly Lbs, Jl Dame Medan Ampals -Putri Ismah Sari, Jl Setia Luhur Gg Melati I -Sukamdi, Jl Danau Singkarak Lk II Binjai -Surya Irawan, Jl G Krakatau Gg Berkat II-5 Medan -Sri Rahayu Ek, Jl Garu II B Medan Amplas -Hj Salha M Aljabri, Jl Lembu Medan -M Furqon M Hrp, Jl Denai Gg Satu Medan Area -Muhajirin Srg, Jl Bajak III Medan Amplas -Fauzi Thalib Aljabri, Jl Lembu Medan -Ilham Pusanto, Jl Gambir Dusun X Bandar Klipa -Donna Molisa, Jl Denai/Rawa Medan Denai -Hotdame S, Desa Satahi Nauli, Kab.Tapteng -Roni Muharis, Jl Puri Medan Area -Irwanda A Lbs, Jl Suka Adil Medan -Hendra Lubis, Jl B Katamso Medan -Hamdan Srg, Jl Alumunium I Gg Mangga Tj Mulia -IrfanWahyudi R, Jl Pijer Podi Gg Tarigan Medan Selayang -Tommy Darsilen, Jl Puri Gg Amaliah Medan Area -Resiadi, Jl Karya Gg Perdamaian Medan Barat -Yudianto, Jl Sei Bingai No13 Lk IV Binjai Selatan -Yoga Fernando, Batang Anai, Pariaman -Rinaldo, Jl Jamin Ginting Lk III Binjai Selatan

-M Lhuswandi, Jl Sidorukun Gg Sidoeleng Medan -Deni Ramdhani, Jl Kampung Aur Medan -Dahrifuddin Hrp, Jl Selamat Medan -Parulian P, Jl T A Hamzah Binjai Tumur -Lia Rosanti, Jl Air Bersih Gg Rezeki Medan -Juwarno, Jl Coklat I No 16 Medan Tuntungan -Siswanto, Dusun XV Gg Pendidikan Tembung -Andrian, Jl Puskesmas Lk IV Medan Sunggal -Sri Mardiah, Jl Pratu M Nuh Dusun I Percut Sei Tuan -Dedy Adlin Syahputra, Gunung Bayu -Suhartono, Dsn II Kutomulyo Deliserdang -Wiwit M, Dusun I Patumbak Deliserdang -Effendy, Jl Amal Gg Sehat Medan Sunggal -Saidarmaningsih, Jl Sei Kera Gg Indraloka Medan -Agus Salim, Jl Paduan Tenaga Kota Maksum -Hapsah R, Jl Bromo Ujung Medan Denai -Gunawean, Jl Jermal VII Murni I Medan Denai -MRidho,JlMentengIIGgPembangunan MedanDenai -Darwisman, Jl Selamat No 88 Medan -Nilawati, Jl Selamat No 88 Medan -Juniar Pakpahan, Jl Gn Singgamata Medan -Imanuel Marpaung, Jl Gn Singgamata Medan -M Zulfi Azmi, Jl Dahlian Medan -M Silalahi, Jl Karikatur Medan -Topan, Jl Kiwi No 72 C Medan -Maris, Jl Teratai Pasiran No 11 Medan -Mayang, Jl Benteng Dusun V Delitua -Elisa, Jl Ekarasmi Medan Johor -M Yusfan, Jl Kenari VIII Deliserdang -Rudi Tampubolon, Jl Serdang No 317 Medan -Wiwik Puspa Ayu, Jl Sembada XVI Medan -Vika Handayani, Jl Kampung Aur Medan -Andti Syafritai, Jl Gaperta Medan -Tiffany Metty, Jl Binjai Perumahan Padang Hijau -Chandra Dermawan, Jl B Katamso Gg Jarak Medan -Saddam Saiful, Jl STM Ujung Medan -Teguh Hermawan, Jl B Zein Hamid Medan -Mardianis Piliang, Jl STM Medan -Nazwir Erwin, Jl Kampung Baru Medan -Zinial, Jl Sosro Medan -Hendro, Jl Makmur Medan -Dody, Pasar VII Tembung -Yeni Dayanti, Paya Redas Langkat -Ramadhan, Perbaungan Sergai -Imam, Jl Eka Bakti -Hj Jasma, Kompleks Rispa Medan

Waspada/Arianda Tanjung

ANGGOTA panitia kuis Waspada memasukkan kupon ke karung setelah selesai diundi.

WASPADA Senin 16 Juli 2012


A11 Bintang Jaya Juara Grup 8 Besar Kompetisi Divisi II PSSI

BEK muda asal Brazil, Thiago Silva (kanan), resmi berbaju PSG musim depan.

Milan Rugi, PSG Untung MILAN, Italia (Waspada): Kepindahan Thiago Silva ke Paris Saint-Germain (PSG) ditanggapi kecewa sejumlah pemain AC Milan. Menurut Luca Antonini, Milan dipastikan rugi besar setelah Silva resmi merapat ke Paris dengan nilai transfer 42 juta euro (Rp487 miliar), Sabtu (14/7). Silva mendapat kontrak lima musim di PSG dan bakal menerima gaji sebesar 7,5 juta euro per-tahun (Rp86 miliar). Kepindahan itu disebut Antonini sebagai sebuah kerugian besar bagi Milan. Namun, Antonini yakin bahwa CEO Adriano Galliani bakal memboyong pemain yang sebanding untuk menggantikannya. “Thiago adalah bek terkuat dunia. AC Milan tentunya mengalami kerugian besar. Saya sangat menyesal dia pergi. Dia

adalah teman terbaik saya. Kami telah bersama selama empat tahun,” ujarnya, Minggu (15/7). “Klub telah mengambil keputusan dan kami harus melangkah maju. Kami tak khawatir karena Galliani biasanya melakukan pembelian besar menjelang ditutupnya bursa transfer,” sambungnya terkait Silva yang bergabung ke Milan di musim 2009 setelah diboyong dari klub Brazil, Fluminense. Selain Antonini, Alessandro

Nesta dan Paolo Maldini juga mengomentari keputusan timnya melepas Silva ke PSG. Kedua mantan bintang Milan itu menilai manajemen klub telah bertindak gegagah setelah sempat menegaskan Silva tidak akan dijual ke klub manapun. “Tentu saya mengikuti berita-berita Milan setiap hari melaui internet. Saya masih merasa dekat dengan tim itu (AC Milan). Menjual Silva itu kerugian besar dan tidak seharusnya dilepas di bursa transfer,” ulas Nesta. Lain halnya dengan Maldini, mantan kapten Milan itu akan maklum jika melepas Zlatan Ibrahimovic, namun tidak demikian untuk Silva. Di mata Maldini, Silva masih memiliki potensi untuk berkembang. “Saya bisa mengerti pada suatu titik penjualan Ibrahimovic

karena usianya hampir 31 dan gajinya mahal. Tapi, saya tidak mengerti penjualan Thiago Silva yang berpotensi sebagai kapten masa depan Milan,” sebut Maldini. Sebaliknya, pelatih Carlo Ancelotti menjadi sosok paling gembira dengan kehadiran Silva di Parc Des Princes. Ancelotti pun optimistis mahkota juara Ligue 1 2013 akan jadi milik PSG. Apalagi, Les Parisiens juga berpeluang merekrut rekan seklub Silva, Zlatan Ibrahimovic. “Ia adalah salah satu bek terbaik di planet ini. Pesepakbola fantastis dan seluruh dunia tahu akan talentanya. Bersamanya, kami memiliki pertahanan yang solid. Aku tahu Thiago karena pernah melatihnya selama enam bulan di Milan,” tandas Carletto, sapaan Ancelotti. (m33/ini/goal)

KISARAN (Waspada): PS Bintang Jaya Asahan tampil sebagai juara grup dalam lanjutan pertandingan babak 8 Besar Kompetisi Divisi II PSSI. Turun dengan target mencari hasil seri melaju ke babak empat besar, Bintang Jaya menang 1-0 atas PS Sorong Papua di Stadion WR Soepratman, Purworejo, Minggu (15/7). Setelah kalah 1-0 dari Perseden Denpasar, Sabtu (14/7), Bintang Jaya yang hanya membutuhkan hasil imbang melawan PS Sorong. Bintang Jaya Asahan tampil menyerang di hadapan Ketua Umum Bintang Jaya H.Erwis Edi Pauja Lubis yang langsung melecut semangat juang anak-anak besutan duet pelatih Legimin dan Jamaluddin Hutahuruk. Asisten Manajer, Azwar Mahmud, menyatakan gol semata wayang Bintang Jaya dihasilkan Alrizan memanfaatkan kemelut di depan gawang PS Sorong. Ketua Umum Bintang Jaya, Erwis EPL, menyambut gembira kemenangan pemain yang menjadi satu-satunya tim asal pulau Sumatera yang lolos ke babak empat Kompetisi Divisi II PSSI tahun ini. (a31)

Potensi Bridge Sumut Besar MEDAN (Waspada): Ketua Umum Pengprov Gabungan Olahraga Bridge Seluruh Indonesia (Gabsi) Sumut, Dr M Arifin Siregar MSc, menyambut positif dukungan KONI dan Pemko Medan menggelar turnamen untuk mendorong perkembangan bridge di daerah. “Potensi mengembangkan dan meningkatkan prestasi bridge di Sumatera Utara cukup besar, dengan semakin banyak event kita yakin potensi ini semakin cepat berkembang,” ungkap Arifin di sela-sela pembukaan Turnamen Bridge Piala Wali Kota Medan di Aula Brimobdasu, Medan, Sabtu (14/7). Dengan adanya dukungan KONI Medan, maka frekuensi kompetisi bridge di Sumut bertambah sampai dua-tiga kali setahun. Belum lagi aktivitas Gabsi Medan yang diketuai Ir Khairuddin AM, juga bertambah seperti agenda sosialisasi dan pelatihan. Selain Medan, Gabsi Langkat juga giat melahirkan prestasi. Di bawah asuhan Ir Perwira Sakti Lubis, telah lahir generasi baru bridge Sumut yang merupakan anak-anak usia dini dari tingkatan SD hingga SLTA. Bahkan dua atlet bridge dari Langkat terpilih memperkuat Indonesia ke kejuaraan dunia bridge junior di China, yakni Vila Rosa dan Yessi Gracella. Ketua Umum Gabsi Medan, Ir Khairuddin AM, menambahkan event ini dilaksanakan sebagai salah satu rangkaian memperingati HUT Kota Medan ke-422. Dari sekira 45 peserta yang terbagi dalam sembilan tim, terdapat tim undangan dari Langkat yang merupakan pemain bridge junior yang berprestasi nasional. Selain itu, ada beberapa atlet binaan dari kalangan mahasiswa. (m47)

Mourinho Cuma Butuh 22 Pemain MADRID (Waspada): Sedikit tapi berkualitas dan berkomitmen. Itulah yang diinginkan Jose Mourinho dari skuad Real Madrid yang akan mengarungi musim depan. Sejauh ini, Madrid memang belum melakukan belanja besar-besaran seperti beberapa musim sebelumnya. Mourinho ingin agar skuad Madrid hanya tersusun atas 22 pemain yang terdiri atas tiga kiper dan 19 pemain di lapangan. Meski semua klub La Liga memiliki jatah 25 pemain untuk tim utama, The Special One ingin mengambil langkah yang lebih drastis dalam memaksimalkan potensi pemain pilihannya. Musim lalu, Mou memiliki 23 pemain di tim utama. Kini, keinginan Mou merampingkan skuad akan membuat para direktur Madrid harus bekerja keras membuang beberapa nama. Kedatangan Fernando Gago dan dipromosikannya dua pemain Castilla ke tim utama membuat Madrid kini punya 25 pemain. Alhasil, maka Madrid setidaknya harus menyisihkan empat pemain dari tim utama dengan catatan Los Blancos berhasil mendatangkan Luka Modric dari Tottenham Hotspur. Yang paling terancam tentu saja adalah Gago, Ricardo Carvalho,

Waspada/Armansyah Abdi

DUA atlet Labuhanbatu berprestasi, Suzen R Simangunsong dan Stevany Nasution, foto bersama Bendahara KONI dan Kadisporabudpar Labuhanbatu, Minggu (15/7).

Atlet Labuhanbatu Terima Tali Asih


GELANDANG asal Kroasia, Luka Modric (tengah), sudah ditunggu Jose Mourinho dan pemain Real Madrid lainnya. Nuri Sahin, dan Ricardo Kaka. Sudah bukan rahasia lagi bahwa Gago dan Carvalho tak lagi dibutuhkan Mourinho dan kepergian mereka sepertinya tinggal menunggu waktu. Sementara itu, situasi Kaka dan Sahin lebih rumit. Kaka tidak akan dijual murah, sedangkan Sahin dianggap masih memiliki prospek cerah. Jelang persiapan tim di Valdebebas, Senin (16/7) ini, punggawa Madrid menyambut baik keinginan

klub memboyong Modric. Pepe dan Alvaro Arbeloa termasuk salah satunya. “Saya senang jika dia (Modric) jadi bergabung. Tapi kami punya banyak gelandang bagus, jadi, mereka harus bersaing untuk bisa mendapatkan tem-pat,” ucap Arbeloa, Minggu (15/7). “Saya juga tahu Modric adalah pemain yang bagus. Hal ini terlihat dengan dirinya menjadi nyawa permainan Tottenham dan timnas Kroasia di Euro

2012,” puji Pepe. Dikutip dari Mirror, sumber dekat Modric menyebutkan pemain berusia 26 tahun itu sudah menjalin kesepakatan pribadi dengan Los Merengues selama empat tahun. Kabarnya, Madrid mengajukan tawaran sebesar 28 juta pounds (Rp407 miliar). Akan tetapi, Spurs baru akan melepas Modric dengan nilai 35 juta pounds (Rp509 miliar). (m33/dm/ini)

Garuda Muda Jaga Gengsi


PEKANBARU (Waspada): Indonesia memupus harapan Singapura melaju ke putaran final Piala Asia U-22. Di laga terakhir penyisihan Grup E, tim Garuda Muda menyikat Singapura 2-0 di Stadion Utama Riau, Minggu (15/7).

Hasil ini terasa pahit bagi Singapura yang membutuhkan kemenangan untuk menggeser Australia dari runner-up grup. Sebelumnya, Australia kalah telak 0-5 dari Jepang dan nasibnya tergantung hasil laga Indonesia kontra Singapura.

Indonesia, sudah tidak punya kans lolos, tampil mendominasi kendati tampil tanpa Andik Vermansyah. Kedua gol Garuda Muda tercipta di babak kedua yang diborong oleh striker Agung Supriyanto (foto). Ironisnya, kepahlawanan Agung ternoda di masa injury time akibat terkena kartu merah. Gol pertama Agung tercipta di menit 64 melalui eksekusi penalti yang sempat diulang. Tak seperti eksekusi pertama yang mengenai mistar gawang, kali ini Agung menebus kesalahannya. Menit 69, Agung memastikan kemenangan tuan rumah lewat aksi solo run yang fantastis.

Sayangnya, kemenangan ini tidak membantu Timnas U-22 mendampingi Jepang sebagai wakil grup. Jepang sendiri menjadi tim ke-13 yang lolos ke putaran final Piala Asia U-22 berkat kemenangan telak atas Negeri Kangguru. Australia pun patut berterima kasih kepada Indonesia karena mendampingi Jepang. Tim Negeri Matahari Terbit menjadi juara grup dengan 15 angka dan Australia di posisi kedua mengantongi 10 poin. Posisi ketiga ditempati Indonesia dengan sembilan angka disusul Singapura (7), Timor Leste, dan Macau. (m33/ant)

PBI Sumut Dukung Penuh JAKARTA (Waspada): Kabar gembira bagi dua peboling remaja Sumut, Aldila Indryati dan Imam Wiguna, yang baru saja tampil bersama timnas boling junior Indonesia di ajang bergengsi Asian School Championship 2012. Hal tersebut terkait keinginan keduanya untuk terus eksis di dunia boling nasional maupun internasional, termasuk dengan ikut skuad Garuda tampil di Asian Games 2014 mendatang di Doha. “Ibarat kata, saat ini keduanya sudah berada di dalam kereta, jangan sampai ketinggalan kereta. Keduanya harus terus berjuang agar tidak terlempar dari skuad timnas,” tutur Ketua Pengprov PBI Sumut, Singgih Goenawan, kepada Waspada di sela-sela Asian School Championship 2012 di Bowling Center Ancol Jakarta, Sabtu (14/7) lalu.

Singgih menambahkan pihaknya bakal mendukung penuh semua upaya yang dilakukan Indri dan Imam, serta peboling Sumut lainnya, dalam rangka meningkatkan prestasi. “Tidak hanya Indri dan Imam, semua peboling Sumut yang ingin meraih prestasi sudah pasti kami dukung. Kami memang berharap tidak hanya dua peboling Sumut yang masuk skuad timnas, tetapi ada lagi yang menyusul,” ujar Singgih. Senada itu, Ketua Umum PBI, Oki Harwanto, berharap agar Sumut dalam waktu dekat bisa mengirim wakilnya untuk timnas, baik itu junior maupun senior. Dikatakan, peluang Sumut mencetak atlet boling berprestasi cukup terbuka lebar. Hal tersebut karena Sumut merupakan salah satu dari tiga sentra pembinaan atlet boling nasional.

RANTAUPRAPAT (Waspada): Pengurus KONI dan pihak Dinas Pemuda Olahraga Kebudayaan dan Pariwisata (Disporabudpar) Kabupaten Labuhanbatu menyerahkan tali asih kepada dua atlet berprestasi nasional daerah itu. Penyerahan tali asih dilakukan oleh Bendahara KONI Ir Bina Ginting dan Kadisporabudpar Drs Sarimpunan Ritonga MPd di sekretariat sementara KONI Labuhanbatu di Kompleks Perumahan Sakura Indah, Jl Cut Nyak Dien Rantauprapat, Minggu (15/7). Kedua atlet yang menerima tali asih adalah Suzen Ramsi Simangunsong (tinju) dan Stevany Nasution (tenis meja). Suzen merupakan pelajar SMAN 1 Kecamatan Rantau Utara yang sukses peraih medali emas dan petinju terbaik Kejurnas Youth 2012 di Jakarta baru-baru ini. Dia menerima tali asih dalam bentuk uang tunai senilai Rp3 juta. Stevany Nasution, pelajar kelas V SD Panglima Polim Rantauprapat, sukses meraih medali perak Olimpiade Olahraga Siswa Nasional (O2SN) di Palembang dan menerima tali asih senilai Rp2 juta. Pelatih Suzen juga ayah kandungnya, Johny Ramsi Simangunsong, dan pelatih Stevany, Safar, juga ayah kandungnya tak luput menerima tali asih dari KONI dan Disporabudpar Labuhanbatu. Bina Ginting mengatakan Suzen dalam waktu dekat akan mengikuti kejuaraan tinju dunia di Bangkok dan Stevany berlaga di kejuaraan tenis meja Asean juga di Bangkok. “Untuk meningkatkan pembinaan tinju di Labuhanbatu, KONI siap memfasilitasi Pengcab Pertina Labuhanbatu untuk mendirikan sasana tinju,” ucap Ginting. (a18)

Gelar Sempurna Sriwijaya FC PALEMBANG (Waspada): Sriwijaya FC menyempurnakan gelar juara Indonesian Super League (ISL) 2012, setelah menang penalti atas ISL All Star 5-4 dalam laga Perang Bintang di Stadion Gelora Jakabaring, Palembang, Minggu (15/7). Kedua kubu terpaksa harus beradu dari titik 12 pas setelah bermain imbang 1-1 di waktu normal. Dari lima eksekutor SFC, hanya Siswanto yang gagal menjalankan tugasnya. Sebaliknya, Mario Costas dan Riccardo Salampessy tidak mampu menembus gawang I Made Wirawan. Dalam duel prestisius itu, ISL All-Star membuka keunggulan di menit 10 melalui gol Alberto Beto Goncalves. Namun, SFC memenuhi harapan pendukungnya dengan gol balasan yang dicetak Hilton Moreira enam menit berselang. Di babak kedua, SFC sempat diuntungkan dengan keluarnya Aldo Barreto yang mendapat kartu kuning kedua. Sayang, kondisi tersebut tak kuasa menghasilkan apa-apa bagi skuad besutan Kas Hartadi. Laga bintang pun ditutup dengan upacara seremonial penyerahan trofi juara kepada SFC sebagai kampiun ISL musim 2011-2012 oleh Ketua Umum PSSI hasil KLB Ancol, La Nyalla Mahmud Mattalitti. Sebagai kampiun, Laskar Wong Kito berhak atas uang tunai senilai Rp2,5 miliar. (m33)

Regu Dayung Desa Perlis Kampiun Trofi Bupati Langkat

Waspada/Yuslan Kisra

KETUA Pengprov PBI Sumut, Singgih Goenawan, pose bersama dua peboling muda Sumut, Aldila Indryati dan Imam Wiguna, di Bowling Center Ancol Jakarta, Sabtu (14/7) lalu. “Sumut adalah sentra pembinaan untuk wilayah Indonesia bagian barat. Sangat kita harapkan segera lahir atlet boling dari daerah tersebut,” kata Oki. “Peboling muda ini akan kita

bina dengan baik dan benar, sehingga mereka menjadi support bagi skuad timnas. Dalam waktu tertentu, mereka tentunya sudah bisa masuk timnas,” tutup Oki. (yuslan)

P.BRANDAN (Waspada): Regu dayung dari Desa Perlis, Kecamatan Brandan Barat, menjuarai lomba dayung sampan diadakan Pemuda Pancasila Kecamatan Brandan Barat di Perairan Babalan, Minggu (15/7). Sebelumnya, peserta dilepas langsung oleh Bupati Langkat, H Ngogesa Sitepu SH. Bupati beserta unsur Muspida Kabupaten Langkat juga menyempatkan diri untuk menyerahkan hadiah kepada para jauara. Seperti diketahui, posisi kedua diduduki Pemuda Pancasila Desa Teluk Meku, Kecamatan Babalan, peringkat ketiga diraih Desa Klantan, Kecamatan Brandan Barat, dan tempat keempat diraih regu dari Sri Langkat, Kelurahan Sei Bilah, Kecamatan Sei Lepan. “Kepada regu dayung yang sudah meraih prestasi, hendaknya terus berlatih untuk bisa mengukir prestasi di event-event nasional. Kepada yang belum berprestasi jangan berkecil hati karena masih ada kesempatan untuk meraihnya,” ujar Ngogesa yang langsung bertatap muka dengan peserta lomba. (a02/c01)



Lagi-lagi Lorenzo MUGELLO, Italia (Waspada): Rider Yamaha asal Spanyol, Jorge Lorenzo (foto), berjaya di ajang MotoGP Italia setelah menjadi juara seri tersebut di Sirkuit Mugello, Minggu (15/7) malam. Start dari posisi kedua, Lorenzo menyelesaikan 23 putaran balapan dengan waktu 41 menit 37,477 detik tanpa perlawanan berarti dari pesaingpesaingnya dan memperlebar jarak di klasemen kejuaraan dunia dengan keunggulan 19 poin. Peraih pole position yang juga jagoan Repsol Honda, Dani Pedrosa, finish di urutan kedua terpaut 5,223 detik diikuti rider tim satelit Yamaha, Andrea Dovizioso, dengan waktu selisih 10,665 detik. Balapan hanya ketat di lima lap awal, di mana Pedrosa dan Dovizioso masih mampu menempel Lorenzo. Selepas putaran keenam, Lorenzo mampu memperlebar jarak dan semakin lama menjauh untuk melenggang tak terkejar merebut kemenangan kelimanya musim ini. Pebalap muda asal Jerman, Stefan Bradl, menempati urutan keempat setelah dilewati Dovizioso di putaran terakhir. Peringkat lima diisi andalan Ducati, Valentino Rossi, sebagai hasil terbaiknya di lintasan kering musim ini. Rossi bertarung ketat dengan Cal Crutchlow (Yamaha) di akhir-akhir lomba, sehingga keduanya mampu melewati rekan setim Rossi di Ducati asal

AS, Nicky Hayden. Sementara itu, juara dunia Casey Stoner kembali menuai hasil buruk. Stoner, di Jerman pekan lalu terjatuh di putaran akhir, kali ini keluar lintasan yang membuat posisinya melorot ke urutan 10. Pada hasil akhir, Stoner finish kesembilan dengan waktu terpaut 30 detik dari Lorenzo dan makin tertinggal dalam klasemen. Sebaliknya, Lorenzo semakin kokoh di puncak klasemen kejuaraan dunia dengan total 185 poin disusul Pedrosa (166) dan Stoner (148). (m47/ap)

Hasil MotoGP Italia Jorge Lorenzo Dani Pedrosa Andrea Dovizioso Stefan Bradl Valentino Rossi Cal Crutchlow Nicky Hayden Casey Stoner Hector Barbera Alvaro Bautista Ben Spies Randy De Puniet Aleix Espargaro James Ellison Mattia Pasini Ivan Silva

(Spanyol/Yamaha Factory) (Spanyol/Repsol Honda) (Italia/Yamaha Tech 3) (Jerman/LCR Honda) (Italia/Ducati) (Inggris/Yamaha Tech 3) (AS/Ducati Team) (Australia/Repsol Honda) (Spanyol/Pramac Ducati) (Spanyol/Honda Gresini) (AS/Yamaha Factory) (Prancis/ART CRT) (Spanyol/ART CRT) (Inggris/ART CRT) (Italia/ART CRT) (Spanyol/FTR-Kawasaki CRT)

41:37.477 41:42.700 41:48.142 41:48.188 41:49.172 41:49.537 41:49.712 42:L8.094 42:9.205 42:12.066 42:35.339 42:37.440 42:48.677 42:48.935 42:49.305 1 lap


WASPADA Senin 16 Juli 2012

Sumatera Utara

WASPADA Senin 16 Juli 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:33 12:46 12:33 12:41 12:40 12:37 12:33 12:29 12:36 12:35

‘Ashar 15:58 16:12 15:59 16:06 16:06 16:02 15:59 15:55 16:01 16:01

Magrib 18:43 18:59 18:44 18:53 18:52 18:43 18:43 18:38 18:46 18:47



Shubuh Syuruq


19:57 20:14 19:58 20:08 20:06 19:57 19:57 19:52 20:00 20:01

04:50 05:00 04:51 04:55 04:55 04:58 04:52 04:48 04:53 04:51

05:00 05:10 05:01 05:05 05:05 05:08 05:02 04:58 05:03 05:01

L.Seumawe 12:39 L. Pakam 12:32 Sei Rampah12:31 Meulaboh 12:43 P.Sidimpuan12:30 P. Siantar 12:31 Balige 12:31 R. Prapat 12:28 Sabang 12:46 Pandan 12:32

06:21 06:31 06:21 06:26 06:26 06:29 06:22 06:18 06:24 06:22

Zhuhur ‘Ashar 16:04 15:58 15:57 16:08 15:56 15:57 15:57 15:53 16:11 15:58




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:52 18:42 18:41 18:54 18:37 18:40 18:39 18:36 19:00 18:39

20:06 19:56 19:55 20:08 19:51 19:54 19:53 19:49 20:14 19:53

04:53 04:49 04:48 04:59 04:52 04:50 04:51 04:48 04:59 04:53

05:03 04:59 04:58 05:09 05:02 05:00 05:01 04:58 05:09 05:03

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:32 12:34 12:43 12:36 12:33 12:40 12:28 12:39 12:32 12:31

18:39 18:42 18:56 18:44 18:44 18:52 18:37 18:48 18:39 18:41

19:53 19:56 20:11 19:58 19:58 20:06 19:51 20:02 19:53 19:54

04:53 04:53 04:58 04:56 04:50 04:56 04:47 04:57 04:52 04:49

05:03 05:03 05:08 05:06 05:00 05:06 04:57 05:07 05:02 04:59

Panyabungan 12:29 Teluk Dalam12:36 Salak 12:34 Limapuluh 12:30 Parapat 12:32 GunungTua 12:29 Sibuhuan 12:28 Lhoksukon 12:38 D.Sanggul 12:32 Kotapinang 12:27 AekKanopan 12:29

06:24 06:20 06:19 06:30 06:22 06:20 06:21 06:18 06:30 06:23

15:58 15:59 16:09 16:02 15:59 16:06 15:54 16:04 15:57 15:56

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Hanya Dua SKPD Binjai Capai Target PAD BINJAI (Waspada): Perolehan pajak dan retribusi daerah kota Binjai sampai triwulan II, terealisasi hanya Rp14,5 miliar dari target ditetapkan Rp26,6 miliar. Berarti pajak dan retribusi tercapai, 54,70 persen. “SKPD pemungut pajak dan retribusi diharapkan proaktif mengejar target PAD yang ditetapkan,” ujar Wali Kota Binjai HM Idaham melalui Sekdako Iqbal Pulungan, pada repat kordinasi evaluasi pendapatan asli daerah (PAD), di aula Pemko Binjai, kemarin. Rapat dihadiri pimpinan kantor pelayanan pajak pratama dan bank Sumut cabang Binjai. Wali Kota mengatakan, hanya dua dari 12 SKPD yang mampu merealisasi target PAD, yakni Dinas Kependudukan dan Capil dengan hasil 225,5 persen dan Dinas Pariwisata, Pemuda dan Olahraga terealisir 102 persen. Malahan Dinas Pendapatan Kota Binjai baru mencapai 59, 44 persen, Dinas Pertanian dan Perikanan 53,25 persen, Kantor Pelayanan Perizinan Terpadu 68,54 persen. Sedangkan lima SKPD masih di bawah 50 persen dan satu SKPD bahkan nol persen.Wali Kota Binjai HM Idaham berharap, pencapaian target hendaknya disesuaikan. “Jika ada masalah atau kendala, cepat laporkan,” tegasnya.(a04)

Satlantas Polres Langkat Tilang 2012 Kenderaan LANGKAT (Waspada): Dari awal minggu pertama Operasi Patuh Toba 2012, Satlantas Polres Langkat menilang 2012 lebih pengendara, baik sepedamotor maupun mobil yang tidak memiliki kelengkapan administrasi. KasatLantasPolresLangkat,AKPM.Sitorus,dikonfirmasiWaspada, kemarin menjelaskan, dari 2012 yang ditilang diamankan barang bukti 557 SIM, 988 STNK dan 141 pengendara mendapat teguran. AngkakecelakaanlalulintassepanjangOperasiPatuhTobanberjalan, kata Sitorus, terdapat lima kasus dengan rincian satu tewas, enam luka berat dan tiga luka ringan. Total kerugian mencapai Rp13,7 juta. Kasat Lantas berharap operasi ini menumbuhkan kesadaran masyarakat untuk lebih disiplin dan tertib berlalulintas. Sebagai daerah yang mendapat penghargaan piala Wahana Tatanugraha, dia bertekad terus berupaya menciptakan budaya disiplin.(a02)

228 Gram Ganja Kembali Ditemukan Di LP TEBINGTINGGI (Waspada): Sedikitnya 228,9 gram ganja kering siap edar kembali ditemukan di dalam Lembaga Pemasyarakatan (LP) Jalan Pusara Pejuang, Tebingtinggi, depan kamar sel No. 8. Blok 8, Jumat (13/7) pagi sekira pukul 08.30. Barang haram tersebut diperkirakan masuk dengan cara dilempar dari luar LP, setelah adanya pembicaraan antara seorang yang memesan dari dalam LP dengan sesorang di luar LP. Guna proses penyelidikan, 2 paket ganja ukuran besar dan kecil tersebut selanjutnya dibawa ke ruang Sat Narkoba PolresTebingtinggi. Temuan ganja tak bertuan di dalam LP ini sudah sering terjadi. Diduga pemiliknya adalah penguhuni LP, namun saat kejadian belum sempat mengambil barang tersebut, hingga akhirnya ditemukan petugas Lapas bersama seorang napi ketika sedang membersihkan lokasi. “Kasus ini sedang diselidiki. Sejumlah saksi tengah dimintai keterangan untuk mengetahui siapa pemilik barang tersebut,” ucap Kapolres Tebingtinggi, AKBP Drs. Andi Rian Djajadi, S.Ik melalui Kasubag Humas AKP Ngemat Surbakti. Sampai saat ini sudah empat kali ditemukan bungkusan ganja tak bertuan di dalam LP, satu kasus sudah tertangkap pemiliknya. KepadapetugasLP,HumasPolresmengimbauagarlebihjelimemantau peredaran barang haram itu, agar tidak mudah masuk LP. “Karena LP bukan wilayah kerja Polres Tebingtinggi, kita tidak bisa langsung membasminya, tapi melalui kerjasama dengan KPLP, atau Kalapas,” ucap Humas.(a11)

Dua Rumah Terbakar Di Gebang STABAT (Waspada): Dua rumah di Dusun I Desa Paluh Manis Kec. Gebang, Kab. Langkat musnah terbakar, Kamis (12/7). Tidak ada korban jiwa namun kerugian diperkirakan ratusan juta rupiah karena seluruh harta benda di dua rumah tersebut menjadi puing. Informasi dihimpun dari warga, api diduga berasal dari obat anti nyamuk salah satu rumah yang menjadi korban. Meski demikian aparat Polsek Gebang masih menyelidiki penyebab pastinya. Tiga mobil pemadam Pemkab Langkat berusaha memadamkan api, namun api terus berkobar dan baru dapat dipadamkan satu jam kemudian. Hingga kini kedua korban,Tua Nainggolan dan Rafles Simanjuntak bersama keluarganya masih mengungsi di rumah tetangga, seraya menunggu bantuan Pemkab Langkat.(a03)

Waspada/Abdul Hakim

DUA rumah terbakar di Kec. Gebang Kab. Langkat. Petugas berusaha memadamkan api.

DPD PAN Binjai Kunjungi PA Al Jamiyatul Washliyah

06:23 06:23 06:29 06:26 06:21 06:26 06:17 06:27 06:22 06:19

Zhuhur ‘Ashar 15:54 16:01 16:00 15:55 15:57 15:54 15:54 16:04 15:58 15:52 15:54




Shubuh Syuruq

18:35 18:41 18:42 18:39 18:40 18:36 18:35 18:51 18:40 18:34 18:37

19:48 19:55 19:56 19:53 19:54 19:49 19:48 20:05 19:54 19:48 19:51

04:51 04:59 04:53 04:48 04:51 04:50 04:50 04:53 04:52 04:47 04:48

05:01 05:09 05:03 04:58 05:01 05:00 05:00 05:03 05:02 04:57 04:58

06:22 06:29 06:24 06:18 06:21 06:20 06:21 06:24 06:23 06:18 06:18

Kawanan Pencuri Kabel Dibekuk P. BRANDAN (Waspada): Polsek P. Brandan menangkap empat tersangka sindikat pencurian kabel milik PT Telkom, termasuk seorang pengusaha penadah hasil kejahatan. Sementara dua dari kawanan spesialis pencurian kabel, masih dikejar polisi. Ke empat tersangka, Ma, 30, warga Kel. Sei. Bilah, Su, 31, warga Jalan Stasiun Kereta Api, Kel. Sei. Bilah, Kec. Sei Lepan, Ir, 16, dan MY, 16, warga yang sama. Penadah barang hasil kejahatan yang turut diamankan MJ, 40, warga Jalan Imam Bonjol. P. Brandan. Kapolsek P. Brandan, AKP ZainuddinLubisdidampingiKanit Reskrim, Iptu Iswanto, dikonfirmasi Waspada, Minggu (15/ 7) mengatakan, penangkapan

komplotan maling spesialis kabel dantiangteleponmilikPTTelkom ini berawal dari penangkapan terhadap Ma. Menurut Lubis, Ma ditangkap dari tempat persembunyiannyadikawasanTandembeberapa hari lalu. “Hasil pengembangan, kitakembalimenangkaptigalainnyatermasukpenadah,”terangnya. Para pelaku, lanjut Lubis, menjalankan aksi di kawasan Gang Armenia, Kel. Sei. Bilah,

terminal angkot di Jalan Sutomo, dan di Jalan Stasiun Kreta Api depan Rutan kelas II P.Brandan. Tersangka tidak hanya memutus jaringan kabel telepon, tapi juga membongkar tiang besi. Sebelummaterialdijual,pelaku membakar kabel untuk diambil tembaganya.Sementarauntuktiang besi,pelakumemotongnyadengan gergajibesi.Kabeldantiangtersebut, kataLubis,dijualkepadapenadah Rp200 per kg. Akibat aksi para tersangka, PT Telkom mengalami kerugian ratusan juta rupiah. Tidak hanya itu,aksipelakumembuatjaringan atauhubunganteleponkerumah pelanggan kerab mengalami gangguan, sehingga masyarakat turut dirugikan.(a02)

Swakelola Mampu Atasi Masalah Pembangunan LUBUKPAKAM (Waspada): Pekerjaan swakelola disebut sangat efektif dalam percepatan pembangunaninfrastrukturjalan dan jembatan di Deliserdang, sebab mampu mengatasi masalah pembangunan. “Permasalahan pembangunan yang sering muncul, adalah tidak meratanya pembangunan ataupun lambatnya respon pemerintah terhadap usulan pembangunan. Sehingga tidak berlebihan jika swakelola satusatunya solusi efektif untuk mengatasi,”ujarKetuaHimpunan Kerukunan Tani Indonesia (HKTI) Kab. Deliserdang, Sabam SagalakepadaWaspada,kemarin. Menurutnya, pembangunan infrastruktur utamanya jalan dan jembatan di Deliserdang, kini cukup merata. Itu tidak terlepas dari kejelian Ir. Faisal dalam melaksanakan pekerjaan swakelola.

“Kini para petani di Deliserdang utamanya di Kec. Lubukpakam, tidak lagi kesulitan pergi ke ladang. Sebab infrastruktur yang dibutuhkan petani sudah memadai,” tandasnya. Bahkan, lanjutnya, tidak hanya infrastruktur jalan dan jembatan, perbaikan irigasi pertanian yang diusulkan juga cepat direspon melalui swakelola. “Selain Bupati Amri Tambunan, sangat pantas jika kita mengedepankan Kadis PU Ir. Faisal melalui swakelolanya sebagai salah satu figur paling menonjol dalam kemajuan pembangunan di Deliserdang.” Ketua Majelis Ulama Indonesia (MUI) Kec. Lubukpakam, H. Doroni, juga mengatakan hal sama. Dia bahkan mengatakan, melalui swakelola masyarakat turut termotivasi dalam ikut berpartisipasi mensukseskan pem-

bangunan. “Pola pikir itu dapat dilihat dengan berlombanya masyarakat menjaga dan memelihara infrastruktur yang telah dibangun. Itu tidak terlepas dari terpupuknya jiwa membangun masyarakat, yang diawali dengan adanya swakelola,” sebutnya. SementaratokohetnisTionghoa Lubukpakam, Muin mengungkapkan, warga masih terus menanti akhir dari proses hukum yang sedang dijalani Kadis PU Ir. Faisal.Warga bahkan sangat berharap Faisal divonis bebas murni, agar segera dapat melanjutkan pembangunanyangsudahdirencanakan. “Kita terus menanti dan mendoakan agar proses hukum Ir. Faisal segera berakhir, dengan vonisbebasmurnisehinggadapat melanjutkan tugas-tugasnya dalam melanjutkan pembangunan seperti direncanakan,” ungkapnya.(c02)

PT. KWPC Santuni Anak Yatim PANTAICERMIN (Waspada): Sebagai bentuk rasa syukur, PT. Kawasan Wisata Pantai Cermin (PT KWPC) yang mengelola obyek wisata bahari Themepark dan Resort Hotel, menjelang bulan suci Ramadhan 1433 H menyantuni anak yatim, baru-baru ini. Ritual yang dilakukan setiap tahun dipimpin Pawang Desa, Ezharudin, Rahmad dan Ipan warga Pantai Cermin, di lokasi obyek wisata Themepark, diawali

doa bersama, tepung tawar dan penyembelihan dua ekor kambing. Assisten Direktur Oprasional Sales Marketing Themepark, T. Feria Aznita didampingi Ops Manager, Lee Beng Teik usai memberi santunan berupa uang dan perlengkapan sekolah terhadap 100 anak yatim, mengatakan ini sebagai wujud kepedulian dan mempererat hubungan silaturahmi dengan

masyarakat sekitar obyek wisata bahari Pantai Cermin. Karena, kata T. Feria, keberhasilan memajukan Themepark tak terlepas dari dukungan moral maupun moril seluruh warga Pantai Cermin. Riski, 7, dan Inur, 11, siswa kelas II dan VI SD, warga Desa Pantai Cermin Kiri dan Kanan berterimakasih kepada pengelola Pantai Cermin yang menyantuni mereka.(c03)

Kadisdik Sergai Lantik 7 KCD SEI RAMPAH (Waspada): Bupati Serdang Bedagai Ir. HT. Erry Nuradi, M.Si diwakili Kadisdik Drs. H. Rifai Bakri Tanjung, MAP melantik tujuh Kepala Cabang Dinas (KCD) di Lingkungan Disdik Kab. Serdang Bedagai, di Kec.Tebing Syahbandar, baru-baru ini. Ke tujuh KCD yang dilantik masing masing Drs. Jon Lukman, MM menjadi KCD Kec. Sipispis, Sunaruddin menjadi KCD Kec. Dolok Masihul, Bahtiar Ritonga menjadi KCD Kec. Bintang Bayu, Julu Sirait KCD Kec. Bandar Khalifah, Dame Napitupulu menjadi KCD Kec. Sei Bamban, Nasruddin KCD Kec. Teluk Mengkudu dan Norman Saragih

KCD Kec. Kotarih. Dari tujuh KCD yang dilantik tiga di antaranya wajah baru, yakni Bahtiar Ritonga Julu Sirait dan Norman Saragih. Kadisdik Kab. Serdang Bedagai Drs. H. Rifai Bakri Tanjung, MAPberterimakasihkepadaKCD yang telah lama mengabdi dan mendapat tugas baru, dan mengucapkan selamat bertugas kepada KCD yang baru dilantik. Kadisdik juga menyarankan KCD yang baru dilantik rajin bertanya kepada KCD senior bila ada halhal kurang dimengerti. Kadisdik akan menilai kinerja KCD baru tiga bulan ke depan. Bila prestasinya tidak baik pihaknya akan melakukan evaluasi kembali. Pada kesempatan itu Kadis-

dik juga menyebutkan, akan ada pelantikan kepala sekolah SD dan SMPusailebaran.Sebabmenurut laporan ada kepala SD dan SMP kurang baik melaksanakan tugas. “Saya sangat mengharapkan para kepala sekolah sebagai pimpinan bisa melaksanakan tiga hal, yaitu disiplin, loyalitas dan berprestasi. Bila ketiga hal itu tidak bisa dilaksanakan akan saya evaluasi kembali,” tegasnya. Selain itu, Kadisdik menjanjikanmerehabseluruhsekolahbila masihadayangkurangbagus,sebab harus meningkatkan prestasi dan mutu pendidikan. “Bupati sangat pedulimembangunsemuasektor yangdibutuhkanmasyarakatKab. Serdang Bedagai,” katanya.(a08)

BINJAI (Waspada): Dewan Pimpinan Daerah (DPD) Partai Amanat Nasional (PAN) Kota Binjai, Rabu (11/7) sore berkunjung ke Panti Asuhan Al Jamiyatul Washliyah, Jalan Bukit Tinggi, Kel. Rambung Timur. Anjangsana ke panti asuhan merupakan rangkaian menyambut Hari Ulang Tahun (HUT) PAN ke 14 dan penyambutan bulan suci ramadhan. Ketua DPD PAN Binjai Rudi Alfahry Rangkuti, SH, MH dan pengurus lainnya disambut pengurus panti asuhan Al Jamiyatul Washliyah, Amirudin dan 70 anak panti asuhan. Pengurus PAN Binjai berbaur dengan anak-anak panti asuhan, sebagai mempererat silaturahmi. Ketua PAN Binjai Rudi Al Fari Rangkuty juga mengundang warga panti asuhan pada peringatan HUT PAN ke 14, pada 23 Agustus 2012.“Silahturrahmi ini juga bagian dari PAN peduli dengan rakyat,” ujar Rudi Alfahry.(a04)

Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu, SH meninjau Jembatan Sei Makam Dusun III Desa Sei Ular Kec. Secanggang, usai diresmikan.

Bupati Langkat Puji Swakelola Masyarakat STABAT (Waspada): Bupati Langkat H. Ngogesa Sitepu, SH menyahuti dan memuji perbaikan jalan sepanjang 500 meter yang dikerjakan secara swakelola oleh masyarakat, melalui Program Pembangunan Infrastruktur Pedesaan (PPIP) APBN 2011. Sedangkan untuk pembenahan jalan berupa hotmix 2 km jurusan dermaga Tanjungibus, dan perbaikan jalan sepanjang 800 meter di Dusun III Desa Sei Ular Kec. Secanggang, ditampung dalam APBD tahun ini dan segera dikerjakan. “Kebersamaan antara pemerintah dan masyarakat dalam pemeliharaan bangunan maupun sarana infrastruktur lainnya, sangat dibutuhkan,” kata Bupati H. Ngogesa usai meresmikan jembatan Sei Makam Dusun III Desa Sei Ular Kec. Secanggang, baru-baru ini.

Pemkab Langkat, katanya, tetap berkomitmen membenahiinfrastrukturjalanmaupunjembatan, yang tentu dilakukan bertahap karena anggaran terbatassertapemerataanpembangunandi23kecamatanseKab.Langkat.Bupatijugamelakukanpengguntingan pita petanda peresmian jembatan Sei MakamjurusanDesaIIISeiUlar–DusunIVSeiMakam. Selain peresmian jembatan, diselenggarakan peringatanIsrakMikrajdenganpenceramahUstadz Misnan, yang mengingatkan umat Islam untuk mempersiapkan diri menjadi penghuni surga dengan menjaga shalat dan memanfaatkan kehadiran Ramadhan yang diambang pintu. Sementara Bupati H. Ngogesa secara spontan memberikan hadiah untuk menunaikan ibadah hajikepadaMansur,tokohmasyarakatdanpetugas P3N setempat.(a01)

Dekranasda Dan KPRI Kemenag DS Raih Penghargaan Menkop Dan UKM LUBUKPAKAM (Waspada): Ketua Dewan Kerajinan Nasional Daerah (Dekranasda) Kab. Deliserdang, Ny. Ir. Hj. Anita Amri Tambunan dinilaiberhasilmelaksanakanperanmeningkatkan berbagai usaha produk kerajinan rakyat, dalam menopang meningkatnya kesejahteraan serta perekonomian masyarakat. Selain itu, Dekranasda juga berhasil memberdayakan Usaha Kecil Menengah (UKM) dengan menciptakan tenun Deliserdang serta berbagai hasil produk kerajinan masyarakat sekaligus mempromosikannya ke berbagai daerah di Indonesia hingga jadi terkenal. Atas keberhasilan itu, Ny Hj Anita Amri Tambunan yang juga Ketua TP PKK Kab. Deliserdang ditetapkan sebagai salah seorang penerima penghargaan Bhakti Koperasi dari Menteri Negara Koperasi dan UKM, DR Syarifuddin Hasan pada puncak peringatan Hari Koperasi Nasional Ke65 Tahun 2012 dipusatkan di lapangan Temanggung Tilung Palangkaraya, Kalimantan Tengah (Kalteng), Kamis (12/7). Selainpenghargaanitu,Menterijugamenyerahkan penghargaan kepada Ketua Koperasi Pegawai

RI (KPRI) Kantor Kementerian Agama (Kemenag) Kab. Deliserdang, H. Syawal Harahap, S.Ag yang ditetapkan sebagai KPRI Berprestasi tingkat Nasional 2012. Kepala Dinas Koperasi dan UKM Kabupaten Deliserdang Ir. Hj. Syarifah Alawiyah, MMA yang hadirpadapuncakperingatanHariKoperasi tingkat nasional saat dihubungi melalui selulernya, Kamis (12/7), membenarkan dua prestasi tingkat nasional itu berhasil diraih Kab. Deliserdang. Hj. Syarifah menjelaskan, keberhasilan Dekranasda Deliserdang tidak terlepas dari peran aktif dan kreativitas ketua bersama unsur pengurus, dalam mempromosikan hasil-hasil produk kerajinanmasyarakatyangmenjadibinaanmelaluiUKM. Sedangkan KPRI kantor Kemenag Deliserdang karenakeberhasilannyamengelolajasa,khususnya bidang simpan pinjam. Sementara Ketua KPRI kantor Kemenag Deliserdang, H. Syawal Harahap, S.Ag yang dikonfirmasi menjelaskan, yang menjadi penilaian keberhasilan adalah terlaksananya Rapat Anggota Tahunan (RAT) sesuai jadwal serta meningkatnya Sisa Hasil Usaha (SHU) setiap tahun.(a06)

Aniaya Pemborong, Tiga Pria Diamankan Polisi BATANGKUS (Waspada):Tiga pria baru-baru ini diamankan petugas Polsek Batangkuis dengan tuduhan menganiaya seorang pemborong. Kapolsek Batangkuis AKP Ilham Aceh didampingi Kanit Reskrim Iptu Martualesi Sitepu, SH, MH kepada Waspada, Kamis (12/7) menjelaskan, kejadian berawal saat korban Adi Yanto, 48, warga PasarVI Desa Kolam Kec. Percut Seituan didatangi salah seorang pemuda yang kemudian diketahui berinisial Dar alias M, yang minta pekerjaan sebagai penjaga malam di lokasi. Kedatangan tersangka disambut korban sambil menjelaskan pekerjaan yang dimaksud pelaku telah ada orangnya. Begitu pun pelaku disarankan berkoordinasi dengan penjaga malam yang sudah ada tersebut. Setelah mendapat penjelasandarikorban,pelakumeninggalkanlokasi. Namun beberapa saat kemudian pelaku

kembali bersama 10 temannya langsung menganiaya korban. Bahkan di antara pelaku ada yang merampas kalung emas seberat 20 gram milik korban. Petugas Polsek Batangkuis yang menerima pengaduan korban, dipimpin Kanit Reskrim Iptu Martualesi Sitepu, SH, MH bersama anggotanya langsung menyisir lokasi, sekaligus mengamankan tiga di antara tersangka. Dari para tersangka disita perhiasan milik korban berupa 20 gram emas. Akibat perbuatannya, para tersangka Dar alias M, SW dan ER dijerat pasal 151 KUH Pidana dengan ancaman hukuman di atas 5 tahun penjara. “Khusus untuk tersangka ER kita jerat dengan UU Darurat tahun 1951, karena tersangka ini membawa senjata tajam berupa sangkur untuk mengancamkorban,”tambahKanitReskrim.(crul)

Masyarakat Minang Harus Berkontribusi Untuk T. Tinggi

Tewas Tergantung Di Rumah STABAT (Waspada): Riski, 18, warga Jalan Merdeka Kel. Pekan Tanjungpura Kab. Langkat ditemukan tewas tergantung di dalam rumahnya, Kamis (12/7) waktu maghrib. Informasi dihimpun, jenazah korban pertamakali ditemukan ayahnya Ataruddin yang masuk ke rumah setelah pulang kerja. Saksi curiga melihat pintu rumah dan jendela dalam keadaan terkunci. Taklamakemudiansangayahmelihatanakpertamadariduabersaudara itu tewas tergantung di ruang makan, menggunakan tali. Menurut keterangan keluarga korban, Rizki diduga stres hingga mengakhiri hidupnya karena sebelumnya dikeluarkan dari SMU Sri Langkat Tanjungpura disebabkan berbagai hal. Aparat Polsek Tanjungpura masih menyelidiki penyebab tewasnya korban.(a03)


Waspada/Eddi Gultom

KADISDIK Drs. H. Rifai Bakri Tanjung, MAP menyaksikan Nasruddin, KCD Teluk Mengkudu menandatangani naskah berita acara pelantikan di Kec. Tebing Syahbandar.

TEBINGTINGGI (Waspada): Masyarakat Minang yang ada di kotaTebingtinggi harus memberi kontribusi bagi kemajuan kota. Kontribusi bisa diberikan jika warga Minang bersatu dan bekerjasama dengan semua elemen masyarakat, tanpa harus kehilangan identitas sebagai ‘urang awak’ di perantauan. “Di mana bumi dipijak di situ langit dijunjung, merupakan petatah petitih yang harus dipegang baik,” kata Ketua Badan Musyawarah Masyarakat Minang (BM3) kota Tebingtinggi, dr. H. Vive Kananda, Sp.THT, kemarin di gedung Hj. Sawiyah Nasution, dalam rangka silaturahmi BM3 dan perkenalan kepengurusan. Hadir sejumlah tokoh warga Minang Kota Tebingtinggi, yakni anggota DPRD M. Erwin Panyalai, Zulfikar, Samsul Bahri Jambak, pejabat Pemko Tebingtinggi Djayardi Rinal, BE, Camat T.Tinggi Kota Sri Imbang Jaya, AP, MSP Pamen

Polres AKP Marlina, serta aktivis sosial/politik dan ratusan warga Minang dari berbagai puak dan suku. Diungkapkan,selamainibanyakwargaMinang di kota Tebingtinggi terkesan enggan memperkenalkan diri sebagai‘urang awak’ sehingga tak jarang terjadi pergesekan antar sesama. “Ke depan, dengan terbentuknya BM3 diharapkan terjalin hubunganakrabantarwargaMinangdalamrangka ikut membangun kota Tebingtinggi,” ujar Vive Kananda yang juga Kadis Kesehatan. Susunan kepengurusan sementara, Ketua Umum dr. H.Vive Kananda, Sp.THT, Ketua Harian DjajardiRinal,BEditambahsejumlahketuabidang. Sekretaris Drs. Syafrial Firdaus, MBA dan Bendahara Sri Imbang Jaya, AP, MSP. Di acara itu juga dibentuk panitia pelantikan, yakni Ketua Khaidir Amri, SE, Sekretaris Sri imbang Jaya, AP, MSP dan Bendahara Hj. Nina Zahara MZ, SH, MAP.(a09)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa,. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

SEIKANAN (Waspada): Pertemuan pembahasan rencana Musyawarah Unit Kerja (Musnik) K-SPSI/SPTI PKS PT. Sumber Tani Agung (STA), Desa Sabungan, Kec. Seikanan, Kab. Labusel, Sabtu (14/7) sore berlangsung ricuh. Puluhan emak-emak dan buruh bongkar muat pabrik menghentikan paksa pertemuan yang difasilitasi DPC K-SPSI/SPTI Labusel dan dihadiri Muspika setempat itu. Pengamatan Waspada, kericuhan berawal saat Wakil Ketua DPC K-SPSI/SPTI Labusel H. Zul Endar Sikumbang didampingi Camat Seikanan Arsan Nasution,KapolsekSeikananAKP. Amir Husin Siregar, dan perwakilan Danramil Seikanan Serda MSiregarhendakmemulaipertemuan yang digelar di depan PKS PT. STA itu. Tiba-tiba, puluhan perempuan bersama buruh bongkar muat perusahaan membawa tojok (besi yang diruncingkan) dengan marah dan menghentikan pertemuan. Merekaprotesdanmenuding pertemuan itu menyalahi AD/ ART organisasi dan melanggar kesepakatan pada musyawarah yang sudah dilakukan sebelumnya. Mereka mendesak agar segera digelar Musnik (Musyawarah Unit Kerja), bukan pengukuhan pengurus. Sambil berteriakteriak minta agar digelar Musnik, massa juga menggoyang-goyang teratak tempat pertemuan. Bahkan massa yang emosi juga menghujani Muspika serta

pengurus DPC dengan hujatan. “Menurut AD/ART organisasi, jika ditempat itu sudah ada pengurusnya maka harus digelar Musnik untuk menentukan pengurus baru, bukan main tunjuk. Jangan hisap darah buruh. Kami di sini ingin bekerja nyaman jangan jadikanburuhsebagaiadu domba politik,” kata Sekretaris PUK K-SPSI/SPTI PT. STA, Erlin. Kepada Waspada Erlin menyebutkan, kericuhan itu dipicu adanya undangan pertemuan yang diberikan DPC K-SPSI/SPTI Labusel kepada mereka sebagai pengurus PUK K-KSPSI/SPTI PT. STA yang diketuai Lahmuddin sehari sebelum pertemuan itu digelar. Dalam undangan itu disebutkan, pertemuan itu bermaksud untuk menegaskan disiplin organisasi dan pengukuhan pengurus. Sementara, musyawarah yang dilakukan pengurus PUK bersama Muspika maupun antara pengurus DPC dengan Muspika beberapa hari lalu disepakati untuk segera dilakukan Musnik.

“Harusnya yang dilakukan Musnikbukanpengukuhan,”katanya. Sementara itu Camat Seikanan, Arsan Nasution dalam penjelasannya mengatakan, pertemuan itu bukan untuk melantik pengurus PUK melainkan pertemuan untuk merencanakan kapan dilakukannya Musnik. Sebab kata dia, baik pengurus DPC K-SPSI/SPTI Labusel maupunpengurusPUKPT.STAsamasama berkeinginan agar segera dilakukannya Musnik. Arsan juga menjelaskan, pada undangan memang disebutkan pengukuhan, tapi bukan bermaksud untuk perombakan pengurus melainkan pengukuhan pengurus sementara yang diketuai Maimun untuk segera dilakukan Musnik. “Ini hanya salah paham. Belum apa-apa mamak-mamak sudah disuruh datang. Bagaimana kita mau musyawarah,” katanya. Khawatir perselisihan meruncing, Muspika bersama pengurus DPC K-SPSI/SPTI Kab. Labusel dan pengurus PUK menggelar musyawarah di ruang pertemuan PT. STA. Pada pertemuan itu Muspika mengusulkan agar pelaksanaan Musnik harus dilakukan selambatnya satu minggu setelah pertemuan tersebut. Sementara pelaksana Musnik ditentukan oleh DPC KSPSI/SPTI. Namun usulan tersebut tidak disepakati dan akhirnya pertemuan itu tidak membuahkan hasil. (c18)

DPC Hanura Santuni Ratusan Anak Yatim TANJUNGBALAI (Waspada): Dewan Pimpinan Cabang Partai HatiNuraniRakyat(DPCHanura) menyantuni ratusan anak yatim keluarga miskin, Minggu (15/7). Penyerahan santunan berlangsung di kantor sekretariat di Jl. H. Maksum Pane, No. 6, Kel. Selatlancang, Kec. Datukbandar Timur. Kegiatan itu merupakan baktisosialpertamadalamrangka menyambut bulan suci Ramadhan 1433 Hijriah. Ketua DPC Hanura Kota Tanjungbalai Ir. Rusnaldi Dharma Siahaan, MM, didampingiWakil Ketua Rudi Rinaldi, A.Md dalam

sambutannya mengatakan, sebagai partai yang mengedepankan hati nurani, Partai Hanura selayaknya mengedepankan kegiatan sosial dari pada yang sifatnya hanya seremonial belaka. Dia berharap, seluruh kader Partai Hanura harus mampu berbuat yang terbaik bagi masyarakat Kota Tanjungbalai, sehingga Hanura dicintai rakyat. Ratusan anak yatim miskin tersebut berasal dari enam kecamatan se KotaTanjungbalaidenganrincian 50 orang per kecamatan. Masingmasinganakmenerimabingkisan berupa alat-alat sekolah dan uang

saku untuk membantu menghadapi tahun pelajaran baru sekaligus menyambut bulan puasa. Sementara Al Ustadz Drs. Syahrialdalamtausyiahsingkatnya mengajakseluruhanakyatimuntuk tidak minder atau pesimis mengarungi hidup kehidupan. Sebab, masih banyak saudara sesama muslim mau berbagi dan membantusepertiyangdilakukan kader-kader Partai Hanura. Ust Syahrial berharap bingkisan itu dapat menambah semangat belajar sekaligus perangsang anak yatim untuk lebih giat lagi dalam menuntut ilmu. (a32)

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002

KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Rotasi Kasek Pemicu Aksi Wali Murid LIMAPULUH (Waspada): Rotasi penyegaran terhadap sejumlah kepala sekolah (Kasek) yang dilakukan Pemkab Batubara melalui Dinas Pendidikan setempat, menimbulkan pro kontra di kalangan masyarakat yang menilai petinggi dinas pendidikan Batubara tidak becus. Hal itu terbukti, Kamis (12/7), puluhan orangtua wali murid Desa Titi Putih Kec. Limapuluh mendatangi Sekolah Dasar Negeri 014727 menolak keberadaan kasek baru memimpin sekolah tersebut. Kemarahan warga dipicu saat mengetahui bahwa kasek yang lama (Rusli, Spd red) ditukar dengan kepala sekolah yang baru (Hj. Manaria), yang dinilai arogan dan banyak menimbulkan masalah selama oknum tersebut bertugas di beberapa sekolah. Menurut warga, keberadaan Rusli sebagai kasek ditempat itu sudah cukup membangkitkan semangat orangtua, wali murid untuk menyekolahkananakmerekadisekolahitu.Halituterlihatdariantusias orangtua siswa dari luar desa memasukan anak mereka ke sekolah itu. Bukan itu saja, Rusli juga kata warga sudah banyak memajukan sekolah yang dulunya kumuh dan kini tertata dengan rapi. “Jadi, apa bila dinas pendidikan tetap ngotot untuk memindahkan pak Rusli dari sekolah ini, dan menggantinya dengan yang baru, maka kami orangtua wali murid akan mencabut anak kami dari sekolah itu. Dan apa bila tuntutan kami tidak direspon dengan positif, kami akan mengusung semua murid tersebut ke dinas UPT Kec. Limapuluh serta ke DPRD untuk menyampaikan aspirasi penolakan atas penempatak kasek yang baru,” tegas mereka. KetuaKomiteSDNegeri014727,Drs.Helmisaatdikonfirmasiwartawan membenarkan telah terjadi aksi protes yang dilakukan warga setempat tentang penukaran pimpinan sekolah yang baru. Dikatakan Helmi, masyarakat di desanya tidak percaya terhadap kasek yang baru itu, sebab perilakunya ditempat yang terdahulu terlalu banyak membuat masalah dan meresahkan masyarakat. (c05)

Senin 16 Juli 2012

Pertemuan SPSI PT. STA Dihentikan Paksa

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi:


Waspada/Rasudin Sihotang

PETUGAS pemadam berusaha menguasai api dengan menyiramkan air ke arah bangunan terbakar.

Rumah Dua Pintu Terbakar TANJUNGBALAI (Waspada) : Sebuah rumah dihuni dua kepala rumah tangga (dua pintu) terbakar di jalan Bakti, Lingk. IV,Kel.Keramatkubah, Kec. Seitualang Raso, Kota Tanjungbalai, Jumat (13/4) malam sekira pukul 22.00. Tidak ada korban jiwa, namun kerugian diperkirakan mencapai puluhan juta rupiah. Sementara penyebab masih dalam penyelidikan namun dugaan awal kebakaran akibat arus pendek listrik. Informasi dihimpun Waspada, malam itu pemilik rumah Asiah, 78, dan M Saini, 50, bersama keluarga mereka bepergian. Tiba-tiba, dari bagian dapur salah satu rumah muncul kobaran dan dengan cepat merembet ke sisi bangunan yang seluruhnya terbuat dari kayu itu. “Aku terkejut begitu melihat asap hitam dan api warna merah di rumah buk Asiah. Seketika saya dan beberapa warga lainnya berupaya memadamkan api dengan peralatan seadanya,” tutur seorang saksi mata. Namun, akibat tak mampu memadamkan api yang kian membesar, masyarakat lalu meminta bantuan dari petugas pemadam kebakaran. Tak berapa lama, enam truk pembawa air warna merah milik Badan Penanggulanan Bencana Daerah (BPBD) Kota Tanjungbalai tiba di tempat

kejadian. Tetapi, petugas tampak kesulitan memasuki lokasi kebakaran karena gang yang sempit dan padatpemukiman.Apalagi,banyaknyamasyarakat diperkirakan ribuan orang memadati tempat kejadian sehingga menghalangi tugas pasukan penakluk api itu. Setelah berhasil memasuki lokasi, pemadam kemudianmulaimenembakkanairkearahkobaran api. Setelah bekerja kurang dari 10 menit, si jago merah dapat dikuasai sehingga tidak sempat merembet ke rumah lain. Kepala BPBD Kota Tanjungbalai Mahdin Siregar didampingi Koordinator Lapangan Sofyan ST mengatakan, banyaknya warga yang berada dilokasidanmenghalangijalanmerupakankendala utama. Disamping lambatnya informasi yang diterima pemadam kebakaran. “Kita mengimbau masyarakat agar tidak memasuki lokasi kebakaran karena akan menghambat kerja petugas,” Sofyan berharap. Kapolres Tanjungbalai melalui Kapolsek Seitualang Raso AKP Ruslan Lubis didampingi KasubbagHumasmengatakanpenyebabkejadian masih dalam penyelidikan, namun dugaan awal akibat korsleting listrik. (a32)

Bupati L. Batu Lampaui Target Perekaman e-KTP RANTAUPRAPAT(Waspada):Atas keberhasilan Kab. Labuhanbatu melampaui target dalam perekaman elektronik Kartu Tanda Penduduk (e-KTP), Bupati dr H Tigor Panusunan Siregar SpPD menerima Piagam Penghargaan dari Menteri Dalam Negeri (Mendagri) H Gamawan Fauzi SH MH yang berlangsung di Hotel Grand Aston City Hall Medan, Senin (9/7). Hal itu dikatakan Kabag Humas Pemkab Labuhanbatu Abdurrahman Hasibuan ketika ditemui di ruang kerjanya, Jumat (13/7). Penghargaan ini diterima Bupati, karena perekaman yang dilakukan di Kabupaten Labuhanbatu telah melampaui target perekaman yang ditetapkan sebanyak 211.300 wajib KTP, telah teralisasikan 211.327 KTP atau 100,01 %. Rahman menambahkan, bahwa saat ini telah diterima Dinas Kependudukan dan Catatan Sipil sebanyak72.451buahe-KTPyangtelahdidistribusikan kepada sembilan kecamatan se-Kabupaten Labuhanbatu. “Jadi, masyarakat tinggal menunggu sajakapanakanmenerimae-KTPtersebut”,katanya. Terkait e-KTP yang belum diterima sebanyak 138.876 buah lagi, Rahman menjelaskan, bahwa saat ini sedang dilakukan verifikasi dan proses pencetakan di Kementerian Dalam Negeri. “Mudah-mudahan dalam waktu dekat akan segera datang,” ujarnya.

Menurutnya, piagam penghargaan itu sangat wajar diterima oleh Kab. Labuhanbatu, karena untuk mencapai target perekaman e-KTP tidak mudah,petugasharusbekerjasampailarutmalam, dan tidak mengenal hari libur. “Hal itu tentunya demi menyukseskan program e-KTP yang dicanangkan secara nasional”, ungkapnya. Pencapaian target ini, tambahnya, juga tidak terlepas dari keseriusan Bupati danWakil Bupati (Tigor-Suhari) yang telah memprogramkan pendataan/pencatatan kependudukan dan catatan sipil secara gratis yang dikenal dengan KTP, KK dan Akta Kelahiran Gratis. Bupati danWakil Bupati, katanya, pada setiap kunjungan ke daerah dan melakukan dialog denganmasyarakatsenantiasamengajakmerekauntuk melakukan pengawalan terhadap proses pelaksanaan KTP Gratis itu agar tidak terjadi penyimpangan. “Tindakan tegas juga telah dilakukan Bupati terhadap mereka yang melakukan penyimpangan”, katanya. Selain Labuhanbatu, ada 13 kabupaten/kota lainnya yang mendapatkan piagam penghargaan serupa Mendagri. Ke-14 Kab/Kota tersebut yakni, Tapanuli Selatan, Langkat, Deliserdang, Simalungun, Asahan, Medan, Pematang siantar,Tanjungbalai, Binjai, Mandailing Natal, Serdang Bedagai, Batubara dan Labuhanbatu Selatan. (c07)

Pemuda Diajak Tingkatkan Amal Ibadah Di Bulan Ramadhan Waspada/Rasudin Sihotang

WAKIL Ketua DPC Partai Hanura Kota Tanjungbalai Rudi Rinaldi, A.Md memberikan bingkisan dan santunan kepada anak yatim miskin.

Chairuman: Pembangunan Sumut Butuh Konsep KISARAN (Waspada): Pembangunan Provinsi Sumut membuntukankonsepyangjelasdalam mengembangkan sumber daya masyarakat, karena 67 tahun Indonesia merdeka, Jalinsum masih buatan Belanda Pernyataan itu disampaikan anggota Komisi VI, DPR RI Dr.H.Chairuman Harahap, SH, MH, saat silaturahmi dengan masyarakat Asahan dan Kota Tanjungbalai, di aula Hotel Bumi Asahan, Kisaran, Jumat (13/7). Dia menuturkan, bahwa infrastrukturmerupakanuratnadi dalam pengembangan potensi masyarakat. Sehingga, pembangunan itu harus membutuhkan konsep yang jelas, sehingga bisa sesuai dengan kebutuhan.

“Secara geografis, Sumut terletak di tempat yang strategis, baik itu lintas darat dan lintas laut. Tapi kenyataannya potensi ini belum sepenuhnya dimanfaatkan,sehinggapembangunanbelum bisamengangkatmasyarakatdari kesulitan,” ujar Chairuman. Chairuman menjelaskan, bahwaSumutitukedepanterletak pada SDM masyarakat, sehingga di masa yang mendatang Sumut bisa lebih maju dalam segala bidang.Mengingatpenduduknya heterogen (bermacam suku bangsa).Chairumanjugamengatakan bahwa anggota DPR RI perwakilanSumutcukupbanyak, namun sayangnya, belum ada konsep Pemerintah Sumut untuk menyatukan mereka agar ber-

juang untuk kemajuan Sumut. “Akibatnya, pembangunan hanya jalan di tempat, dan masyarakat Sumut belum ada perubahan,terutamamasyarakat pesisir, karena jalan lintas pesisir belum ada, dan hanya memanfaatkan Jalinsum buatan Belanda untukmengangkuthasilkekayaan alamnya,” ujar Chairuman. Silaturahmi itu dihadiri sedikitnya sekitar hampir 200 orang yang berasal dari etnis dan agama yang ada di Asahan dan Kota Tanjungbalai. Ketua Panitia Drs. Parenta Siregar, menjelaskan bahwa kegiatan ini adalah salah satu sarana komunikasi dalam pengembanganpotensimasyarakatuntuk perjalanan pembangunan. (a15)

RANTAUPRAPAT (Waspada): Para Pemuda yang tergabung diberbagai Organisasi Kemasyarakatan Pemuda (OKP) di Kab. Labuhanbatu diajakuntukmeningkatkanamalibadahnyadengan cara memperbanyak infak dan sedekah serta memakmurkan masjid-masjid di lingkungan tempat tinggal masing-masing. Imbauan itu disampaikan Ketua DPD KNPI L.Batu Muhammad Rispan SH kepada wartawan, Minggu (15/7) di Rantauprapat. “Mari memperbanyak infak dan sedekah kepada umat khususnya kepadayangkurangmampudandilengkapidengan memakmurkan masjid dengan memperbanyak ibadah solat tarawih, witir dan tadarus,” ujarnya.

Sedangkan kepada para pemuda yang tidak melaksanakan ibadah puasa diharapkan agar senantiasa menjaga dan menghormati orang yang sedang berpuasa. “Kalau kita tidak menghormati orang lain, tidak mungkin orang lain akan menghormati kita. Untuk itu marilah kita jaga hubungan silaturahmi ini dengan baik,” kata Rispan. Selain itu, Ketua KNPI L.Batu ini juga mengimbau para pemilik dan pengusaha tempat hiburan agar menghentikan aktivitasnya selama bulan suci Ramadhan untuk menghormati orang yangsedangmelaksanakanibadah,sekaligusdapat menjaga situasi kantibmas agar lebih baik dan tetap kondusif. (a18)

IKM Dan UKM Prioritas Pembangunan Labura AEKKANOPAN (Waspada): Salah satu prioritas program pembangunan di Labuhanbatu Utara (Labura) adalah pengembangan Industri Kecil Menengah (IKM) dan Usaha Kecil Menengah (UKM). Di samping itu, pengembangan usaha ini juga dapat mengurangi tingkat pengangguran. Hal itu disampaikan Kadis Perindag Labura H. Ismael Hasibuan, MM saat pembukaan kegiatan pembinaan dan pengembangan bantuan peralatan industri tenun songket di Desa Pulo Dogom, Kec. Kualuhhulu baru baru ini. “Kegiatan ini diharapkandapatmengurangipengangguran,”jelasnya. Dikatakan, kegiatan itu juga diharapkan dapat menumbuhkembangkan minat masyarakat memakai hasil produksi lokal dan menumbuhkan

iklim usaha sehat, kondusif dan legal melalui kepastian berusaha dan memperoleh fasilitas permodalan yang memadai. “Kepada instansi terkait, lakukan pembinaan terhadap pengelola IKM dan UKM agar lebih meningkatkan dan mengembangkan mutu hasil produksi dalam bentuk pengelolaan produk unggulan daerah (tenun songket) sehingga dapat bersaing dengan hasil produk daerah lain,” kata Ismael Hasibuan. BupatiLaburaH.Kharuddinsyah,SEmenekan kan agar Kab. Labura memiliki tenunan songket denganmotiftersendirisehinggamenjadicirikhas.” Saya harapkan Labura sudah mempunyai tenun songket dengan motif tersendiri,” ujar bupati. (c08)

Israk Mikraj Momentum Akbar Nabi Muhammad SAW


ANGGOTA KomisiVI DPR RI Chairuman Harahap, sedang menjelaskan perjalanan pembangunan Provinsi Sumut yang membutuhkan konsep yang jelas di Hotel Bumi Asahan.

TG TIRAM (Waspada): Israk Mikraj merupakan momentum akbar dan mukjizatnya Nabi Muhammad SAW dalam upaya menjemput ibadah Shalat perintah Allah SWT dari bumi ke langit yang dilakukan dalam satu malam. ‘’Peristiwa ini bukan makanan akal bagi umat manusia,namunmerupakanmakananiman.Nah, di sini bisakah manusia Mikraj,’’ tukas Al-Ustadz H Sorkam Butar-Butar dalam ceramah singkatnya pada Peringatan Israk Mikraj Nabi Muhammad SAWTahun 1433 H dilaksanakan Panitia Hari Besar Islam (PHBI) Desa Lalang, Kec. Tanjungtiram, Kab. Batubara di Masjid Al-Huda desa setempat,

Jumat (12/7). Mikrajmelakukanshalat,katanya,sebagaimana hadist ‘Asshollah Mi’rojul Mukmin’ artinya shalat itu, merupakan Mikraj atau naiknya seorang mukmin (ketika mengangkat takbir, red). Ketua dan Sekretaris Panitia, Elfan Taupika danSuheimibesertabendaharaMYusnarHarahap menyatakan terima kasih kepada Bupati H OK Arya yang telah mendukung terselanggaranya kegiatan Israk Mikraj yang dirangkaikan dengan bakti sosial pemberian bantuan kepada anak yatim, bilal mayit, penjaga masjid dan penggali kubur. (a13)

Sumatera Utara

WASPADA Senin 16 Juli 2012


Pemkab Didesak Perbaiki Dek Penahan Aek Singengu PANYABUNGAN (Waspada) : Pemkab Mandailing Natal (Madina ) di desak untuk memperbaiki dek penahan yang ada di sekitar bantaran Sungai (Aek) Singengu, tepatnya di bawah Jembatan Singengu pasar Kotanopan. Pasalnya, dek penahan tersebut sudah hampir setahun ambruk akibat banjir besar di sungai tersebut namun tidak pernah diperbaiki. Akibat tidak diperbaikinya dek penahan ini, warga yang tinggal di sekitar daerah aliran sungai tersebut merasa was-was akan munculnya banjir besar. Sebab, kalau hal itu terjadi, otomatis dek penahan yangada tidak akan mampu lagi menahan arus sungai yang menyebabkan ma-

suknyaairke rumah-rumahwarga seperti yang terjadi setahun lalu. Hal itu dikatakan salah seorang warga RT 01 Kelurahan PasarKotanopanYusrenLubiskepada Waspada, Sabtu (14/7) di Kotanopan.“KitamendesakPemkab Madina agar membangun dek penahan ini, karena kalau banjir

Ahli Perdata Dan Pidana USU Bersaksi Di PN Sidimpuan P. SIDIMPUAN (Waspada): Dua orang ahli perdata dan pidana dari Universitas Sumatera Utara (USU) Medan, Prof. Dr. Tan Kamello, SH, MHum (Perdata) dan Prof. DR. Alvi Syahrin SH.MS (Pidana), memberi keaksian ahli pada persidangan perkara dugaan pemalsuan surat dokumen kayu IPK PT. Panai Likas Sejahtera (PLS) yang digelar Pengadian Negeri Padangsidimpuan. Pada sidang perkara No.201/Pid.B/2012/PN.Psp atas nama terdakwa HJ (pengusaha kayu) itu, Selasa kemarin, keduanya menyatakanbahwaterdakwaberhakataskepemilikandanpengurusan dokumen angkut kayu stok opnam IPK PT. PLS di Kec. Angkola Selatan, Kab. Tapanuli Selatan “Prof. Dr. Tan Kamello, SH, MHum pada intinya menegaskan bahwa Surat Perjanjian No. 361 yang dibuat pada Maret 2008 antara Direktur PT. PLS saat itu, Budianto dengan HJ adalah sah dan mengikat berdasarkan hukum. Sehingga tidak dibenarkan dibatalkan sepihak oleh Budianto,” kata kuasa hukum HJ, Marwan Ranguti, SH. Karena perjanjian itu sah secara hukum, maka seluruh hasil produksi kayu-kayu yang diproduksi berdasarkan IPK PT. PLS sebagai landasan perjanjian itu, adalah hak dan milik terdakwa HJ. Jikapun ada pembatalan oleh Prianto selaku Direktur PT. PLS yang baru, maka secara hukum pembatalan itu tidak sah. Sementara ahli pidana, Prof. DR. Alvi Syahrin, SH, MS pada intinya menjelaskan bahwa yang menjadi substansi penting untuk dibuktikan dalam perkara dugaan pemalsuan surat ini adalah siapa yang membuat keterangan palsu dalam data atentik itu dan siapa siapa pemilik kayu tersebut. Jika nantinya terbukti bahwa HJ adalah pemilik kayu itu, maka HJ tidak bisa dikatakan membuat surat palsu atau menyuruh menempatkan keterangan palsu pada akta autentik sebagaimana maksud Pasal 263 jo Pasal 266 KUH Pidana. (a27)

Satlantas Polres Tapteng Bagi Helm Gratis SIBOLGA (Waspada): Satuan Polisi Lalu Lintas (Satlantas) Polres TapanuliTengah (Tapteng) membagikan helm gratis kepada wartawan dan pengurus LSM di Sibolga/Tapteng. Helm gratis itu diberikan langsung Kasat Lantas AKP Eddy Sudrajad bersama para satuannya di lapangan kantor Satlantas, Kamis (12/7). Eddy Sudrajad atas nama Kapolres Tapteng, AKBP Dicky Patrianegara mengatakan, pembagian helm tersebut sebagai bentuk jalinan kemitraan antara Satlantas dan insan pers di Sibolga dan Tapteng. Selain itu, untuk kepentingan tertib berlalulintas dalam rangka mengurangi risiko kecelakaan di jalan raya. “Sebelumnya kita juga sudah menyosialisasikan UU Nomor 22/ 2009 tentang Lalu Lintas dan Angkutan Jalan (LLAJ) kepada masyarakat yang tujuannya untuk meningkatkan disiplin berlalulintas,” kata Eddy. Dikesempatanitu,Eddymembeberkan,beberapajenispelanggaran lalulintasyangbisaditilangantaralain,parkirdanngetemdisembarang tempat, surat kendaraan tidak lengkap, tidak memakai helm SNI, tidak menghidupkan lampu utama pada siang hari (light on), tidak memakai kaca spion, gunakan handphone saat berkendara, dan lainnya. KamaruddinSaragih,mewakiliwartawanyangbertugasdiSibolga/ Tapteng menyampaikan apresiasi positif atas pemberian helm gratis tersebut kepada insan pers di Sibolga/Tapteng. Dia berharap, jalinan kemitraan antara pers dan Satlantas tersebut dapat terpelihara dan selalu dapat bergandengan tangan dalam tujuan yang positif. (a24)

MOS Di Ponpes Subulussalam Berakhir PANYABUNGAN (Waspada): Masa oreantasi siswa (MOS) terhadap siswa baru di Pondok Pesantren Subulussalam Sayurmaincat Kotanopan Kab. Mandailing Natal (Madina), Sabtu (14/7) berakhir dengan di tandai penutupun oleh Kepala Aliyah Ponpes Subulussalam Esmin Pulungan S.Ag. Masa oreantasi yang berlangsung mulai 19 Juli tersebut di ikuti oleh puluhan santri baru. Umumnya materi yang diberikan saat MOS ini adalah pengenalan sekolah, peraturan, motivasi, disiplin, ceramah, permainan, wawasan kebangsaan dan metode belajar yang baik dan benar. Selain di bimbing para kakak senior santri di Pesantren tersebut, juga di bimbing ustadz dan ustadzah serta perceramah dari luar. Kepala Aliyah Ponpes Subulussalam, Esmin Pulungan usai acara penutupan mengatakan, tujuan MOS ini adalah positif, selain untuk memperkenalkan sekolah atau pesantren ini kepada santri baru, juga mereka di sini akan diberikan motivasi bagaimana cara belajar yang baik dan benar. Begitu juga dengan peraturan dan tata tertib, organisasi di sekolah, kegiatan ekstra serta wawasan keagamaan dan kebangsaan. (c15)

BKM Bambu Kuning Santuni Anak Yatim SIBOLGA (Waspada): Badan Keswadayaan Masyarakat Bambu Kuning Kelurahan Pancuran Bambu Kecamatan Sibolga Sambas Kota Sibolga menyantuni 100 orang anak yatim yang masih duduk di bangku SD, Rabu (11/7). Camat Sibolga Sambas Faisal Fahmi Lubis dalam sambutannya menyambut baik program kerja BKM Bambu Kuning, salah satunya kegiatan sosial memberikan santunan kepada anak yatim. Faisal mengharapkan bantuan yang diberikan agar dapat dimanfaatkan menjadi motivasi bagi siswa khususnya anak-anak yatim untuk terus giat belajar dalam menambah ilmu pengetahuan dan teruslah mengejar cita-cita. “Bagi anak-anakku sekalian, walaupun kalian sudah yatim namun janganlah berkecil hati dan teruslah belajar dengan sungguh-sungguh agar cita-cita yang diinginkan dapat tercapai dimasa yang akan datang”, jelas Faisal. Sementara mewakili BKM Bambu Kuning Pancuran Bambu Muswardi dalam laporannya mengatakan, bantuan berupa alatalat tulis yang bersumber dari APBD Kota Sibolga disalurkan melalui PNPM yakni santunan penerima manfaat untuk anak-anak yatim yang masih duduk dibangku SD sebanyak 100 orang se-kelurahan Pancuaran Bambu. Selain itu, kata Muswardi, berbagai pogram kerja PNPM melalui BKM Bambu Kuning sudah dilaksanakan melalui rapat musyawarah di Kelurahan Pancuran Bambu, dan hal ini merupakan peran serta masyarakat yang selalu bekerjasama dengan pemerintah dalam mewujudkan pembangunan di segala lini. Turut hadir, Lurah Pancuran Bambu Ardiansyah Lubis, Paskes Sosial Lukman Hakim, tokoh masyarakat dan orang tua dari anakanak yatim. Sementara beberapa orangtua dari anak-anak yatim mengaku sangat berterimakasih atas adanya bantuan alat-alat tulis tersebut, dimana dalam memasuki tahun ajaran baru ini masih banyak kebutuhan lain yang harus dipersiapkan. (a24)

datangdekpenahaninitidakakan mampu menahan arus air yang datang. Kita tidak ingin kejadian seperti tahun lalu terulang di mana air masuk ke rumah mencapai 2 meter,” ujarnya. Dikatakannya, sebenarnya permohonan perbaikan dek penahan ini telah kita sampaikan kepada Pemkab Madina, namun entah apa masalahnya sampai sekarang belum ada realisasinya. Padahal perbaikan dek penahan

ini sangat urgen, warga yang tinggal di sini sudah merasa tidak nyaman, mereka khawatir banjir besar tiba-tiba muncul. Jadi kepada pihak terkait, tolonglah dekpenahaninidiperbaiki,”harap Yusren. Menurutpantauandilapangan, sebenarnya bukan dek penahan ini saja yang perlu diperbaiki. Hampir sepanjang bantaran sungai Aek Singengu di RT 01 Kelurahan Pasar Kotanopan perlu di

bangun dek penahan. Sebab di seberangdekpenahanini,kondisi bantaran sungai juga sudah terkikis habis yang sangat mengancamkesalamatanjiwawargasekitar. Hal senada juga di katakan Arif Lubis, 35, salah seorang warga yang rumah bagian belakangnya terancam hanyut kalau bajir datang. “Kita berharap Pemerintahmembangunbronjongatau dek penahan di sepanjang bantaran sungai ini,” harapnya. (c15)

Kementerian Pendidikan Terkesan Separuh Hati

Waspada/Alpin Lubis

PEMKAB Madina didesak untuk memperbaiki dek penahan yang ada di sekitar bantaran Sungai (Aek) Singengu, tepatnya di bawah Jembatan Singengu pasar Kotanopan.

Laksanakan Program UT PADANGSIDIMPUAN (Waspada): Kementerian Pendidikan Indonesia terkesan separuh hati melaksanakan program Universitas Terbuka (UT). Sehingga, banyak kendala yang dialami mahasiswauntukmeraihsarjana, seperti tutorial yang kurang lengkap, yang membuat ada di antara mereka sudah menjalani 15 semester, namun belum mampu menyelesaikan berbagai mata kulyah. Demikian keluhan sejumlah mahasiswa yang disampaikan kepada Waspada Kamis (12/7). Salah seorang mahasiswa, Nur mengatakan, dia sebagai mahasiwa UT program PAUD Kota Padangsidimpuan tahun 2011. Saat sosialisasi pelaksana Universitas Terbuka dari Medan antara lain menjelaskan, program mendapat subsidi dari

pemerintah, termasuk menyiapkan tutorial,sehingga seluruh mahasiswa tidak dibebani SPP, tanpa menjelaskan dari pemerintahan mana. Mendapat penjelasan yang begitu bagus, apalagi serba gratis, banyak calon mahasiswa yang tertarik mendaftar. Untuk Kota Padangsidimpuanadasekitar260 orang, dibagi dalam dua grop pengelola, namun dalam menjalanikuliahawalmahasiswasudah mulai ragu. Setelah berjalan beberapa lamaapayangmerekadugamulai terasa, sebab ada beberapa mata kuliah yang tidak ditutorialkan, karena kondisi demikian banyak mahasiswa yang memperoleh nilai E, ternyata untuk semester berikutnya jugademikian,sehingga rata rata mahasiswa terpaksa mengulangbeberapamatakuliah.

Pelaksana UT Program PAUDPadangsidimpuan, Saudani Hasibuan ,S.Ag yang dikonfirmasi Kamis (12/7) membenarkan jika beberapa mata kuliah tidak ada tutorial, seperti dasardasar Pendidikan TK dan teori belajar dan pembelajaran. KasubbagUTSumut,Hanum Lubis yang dikonfirmasi via telepon oleh orangtua mahasiswa, Kamis (12/7), membenarkan jika tahun lalu pemerintah provinsi berikan subsidi sehingga mahasiswa tidakbayarSPP.Demikian jugatutorialhanyasebagian mata pelajaran yang disiapkan pemerintah. “Jika mahasiswa ingin seluruh mata pelajaran ada tutorial, mereka harus siap membiayai. Atau Dinas Pendidikan Kota Padangsidimpuan mengadakan lobby keWali Kota Padangsidimpuanuntukberikansubsidi. (a26)

Pelatikan Eselon III Dan IV Palas SIBUHUAN (Waspada): Plt Bupati Padanglawas (Palas) H.Ali Sutan Harap (TSO) mengatakan, tuntutan masyarakat terhadap aparatur pemerintah untuk mampu memberikan layanan publik yang lebih profesional efektif dan transparan harus segera direspon dengan nyata dalam praktek pelaksanaan tugas. “Penataan dan perbaikan dalam berbagai aspek dengan tetap berlandaskan visi pemerintah yang ingin mewujudkan masyarakat yang beriman, cerdas, beradat dan berbudaya harus terus dilaksakan,” ujar Bupati dalam pengarahannya pada pelantikan pejabat eselon III dan IV di aula kantor bupati Sibuhuan, Jumat (13/7). Dikatakan, proses penetapan pejabat yang dilantik yakni 21 pejabat eselon III dan 13 eselon IV tetap mempertimbangkan berbagai aspek secara logis dan objektif. Dan dalam kesempatan itu juga akan diberikan surat perintah pelaksana tugas (SPT) kepada 13 orang pejabat eselon II dengan harapan supaya penyelenggaraan pemerintah dapat berjalan dengan semestinya.

MEDAN (Waspada): Terkait penyaluran anggaran dana bantuan sosial pada tahun 2010 senilai Rp424.388.575.000 terealisasi Rp348.105.050.000, Kejaksaan Tinggi Sumatera Utara (Kejatisu) periksa Sekretaris Dewan Pembina Yayasan Museum Barus Raya Masbar R Marbun. “Benar, untuk menetapkan tersangka dan kerugiannegaradidalampenyalurandanabantuan sosial (bansos), Kejatisu melakukan pemeriksaanterhadapsejumlahpenerimadanatermasuk SekretarisDewanPembinaYayasanMuseumBarus Raya,” ujar Marcos Simaremare Jumat, (13/7). Sekretaris Dewan PembinaYayasan Museum Barus Raya Masbar R Marbun mengakui telah diperiksa oleh tim pidsus Kejaksaan Tinggi Sumatera Utara (Kejatisu) tentang penerimaan dana bantuansosial(bansos)pada2010.“Sayadiperiksa hampir sekitar tujuh jam di Kejatisu sebagai saksi dalam perkara dana bansos,” ujarnya. Dalam pemeriksaan tersebut, lanjutnya, bahwa yayasan telah menerima bantuan hibah sebesar Rp250 juta yang tertuang di dalam surat Sekretaris Daerah Provsu yang ditandatangani Kepala Bina Kemasyarakatan, Hasbullah Lubis. “Hal ini berdasarkan permohonan yang ditandatangani Ketua Umum yang sebelumnya Syukran Tandjung pada 2007 dan dana hibah tersebut cair pada 26 Agustus 2010 masuk ke rekening yayasan. Namun alamat tabungan yang sudah berubah tanpa diketahui dewan Pembina dan sejumlah pengurus yayasan,” ujar Masbar R Marbun. Seharusnya masuk ke rekening yayasan yang beralamat Jl. Raya Kelapa Dua, Kebun Jeruk yang selama ini dibuat oleh pengurus yayasan. Namun

ternyata, dana tersebut masuk ke rekening yang sudahberubahdimanarekeningYayasanMuseum Barus Raya Jl. Bukit Barisan Dalam. “Hal ini telah kita tunjukkan bukti-bukti yang telah kita simpan kepada pihak Kejatisu untuk mengusut tuntas aliran dana tersebut dan bagaimana penggelapannya,” ujarnya. Bahkan, lanjutnya, surat pengakuan yang dilakukan oleh Ketua Umum Yayasan Museum BarusRaya,SyukranTandjungjugakitaperlihatkan bahwadalamhaltersebutdirinyamengakuibahwa dana tersebut diambil dan akan dikembalikan pada 8 Oktober 2010. “Akan tetapi dana tersebut tidak juga dikembangkan sehingga bangunan Museum Barus Raya terbengkalaiyangseyogianyaakandibangunmulai pada2005,akantetapihingga2012tidakjugakelar,” ujarnya. Sekretaris Dewan PembinaYayasan Museum Barus Raya Masbar R Marbun menyatakan, selain mendalami kasus bansos tersebut, pihak Kejatisu juga harus melakukan pemeriksaan terhadap penyalahgunaan dana bansos. “Setelah diketahui dana tersebut diambil dan tidak diperuntukkan pada halnya, kita juga meminta Kejatisu untuk mengusut penggunaan dana bansos tersebut. Karena jelas Ketua Umum sebelumnya Syukran Tandjung telah mengundurkan diri pada 2008, namun tetap mengambil dana bansos yang cair pada 2010,” lanjutnya. Sebelumnya ratusan mahasiswa yang tergabung didalam Aliansi Oposisi Mahasiswa (AOM)TapanuliTengah mendesak Kejatisu untuk menangkap Syukran Jamilan Tandjung atas penggelapan anggaran pembangunan museum Barus Raya. (m38)

Persatuan Halak Mandailing Malaysia Kunjungi Tanah Leluhur Waspada/Syarif Ali Usman

PLT Bupati Palas H.Ali Sutan Harahap (TSO) saat menyerahkan secara simbolis kepada tiga pejabat yang dilantik di Aula Kantor Bupati. Kepada yang dilantik, TSO mengatakan dia percaya bahwa pejabat yang dilantik tersebut akan dapat memenuhi harapan dari berbagai pihak yang memiliki keinginan yang sama untuk menjadikan daerah dan masyarakat Palas yang maju dan berkembang.

“Saya akan memantau dan mengepaluasi proses kerja dan kinerja sudara dalam menjalankan tugas di jabatan masingmasing dan hal ini akan menjadi catatan tersendiri bagi saya untuk bahan pertimbangan karir saudara selanjutnya,” tegas TSO. (a34)

Partai Demokrat Diyakini Makin Signifikan Di Madina PANYABUNGAN(Waspada): Partai Demokrat (PD) sebagai partai besar telah terbukti akomodatif dan responsif terhadap kondisi rakyat. Baik itu menyangkutkehidupanmasyarakatberupa pendidikan, dan kesehatan yang ditunjang dengan kamapanan ekonomi. “Saya yakin keberadaan Partai Demokrat di wilayah Madina inikedepanakandapatlebihsignifikandalamperjunganmewujudkan cita-cita partai apabila kita dapat merapatkan barisan untuk berpikir, berencana, dan bertindak selalu menekankan pada prinsip demokratis sejati, yakni dari rakyat, oleh rakyat dan untuk rakyat,”. DemikiandisampaikanKetua DPC PD Madina, HM Hidayat

Kejatisu Periksa Sekretaris Dewan Pembina YMBR

Batubara didampingi Sekretaris DPC PD Madina, Safaruddin Ansyari alias Todonk saat membuka Musancab PD. Selasa (10/ 7) di Hotel Internasional Paya Loting- Panyabungan. Musyawarah Anak Cabang (Musancab) Partai Demokrat seDaerah Pemilihan I, II, III dan IV yang meliputi 19 kecamatan di Kabupaten Mandailing Natal (Madina) merupakan rencana peningkatanpembangunanyang disesuaikan dengan kebutuhan masyarakat yang pro terhadap masyarakat miskin. Ketua DPC Partai Demokrat ini mengatakan, sangat merasakan ruh demokrat yang cukup kuat mengitari kegiatan partai, yang terlihat dari kehadiran dengan semangat juang para kader

dengan konsisten terhadap keberadaan Partai Demokrat. Menurutnya,setiap partai besar tentu tidak terlepas dari dukungan dan kepercayaan masyarakat terhadap keberadaa partai. Karena itu kepercayaan tersebut tidak terlepas dari kapasitas dan kapabilitas pola pikir dan pengabdian dari orang-orang yang menjadi pengurus terhadap masyarakat. “Untuk itu kita harus yakin bahwa kita mampu untuk membirukan Madina. Oleh karena itu musyawarah kali ini kita mengedepankantemaoptimis,kerjakeras. Karena itu rekan juang harus mengedepankan semua sumber dayayangadadalamkoridorpolitik praktisyangdilandasietika,” ucap Hidayat Batubara. (c14)


PENGURUS DPC PD Madina saat foto bersama 19 Ketua DPAC PD Madina terpilih, usai Musancab di Hotel Paya Loting Internasional, Panyabungan.

PANYABUNGAN (Waspada): Persatuan Halak MandailingMalaysia(PHMM) dipimpinPresidenEncikRamli Bin Abdul Karim Hasibuan melakukan kunjungan silaturahmi ke tanah leluhur orang Mandailing di Sumut. Kunjunganitumerupakan inisiatif dan sokongan dari Dato’ SeriUtama Dr RaisYatim sebagai Menteri Penerangan, Komunikasi dan Kebudayaan negera tersebut. Tanah leluhur orangMandailing dikunjungi meliputi Medan,Padangsidimpuan,Tapanuli Selatan (Tapsel), MandailingNatal(Madina),PadangWaspada/Munir Lubis lawas(Palas)danPadanglawas PRESIDEN PHMM Encik Ramli (tengah) diabadikan bersama Utara (Paluta). Bupati Madina H. Hidayat B atubara dan Wali Kota Di Kab. Madina, Selasa Padangsidimpuan H. Zulkarnein Nasution usai pertemuan (10/7),EncikRamlididampingi silaturahmi di bagas godang rumah dinas bupati Madina di Prof. Dr. Ahmad Atory Bin Parbangunan, Kec. Panyabungan. Hussain Nasution (anggota meningkatkan hubungan baik, kemesraan dan panel pemikir), Cik Diana Binti Semaon Harahap salingmengenaliantarapimpinanPHMMdengan (Setiausaha), Encik Yusof Bin Amin Noordin daerah tingkat I dan tingkat II Di Sumut. Juga Nasution (anggota majelis pimpinan). Juga memperkokoh hubungan silaturahmi dan didampingi Tuan Haji Ahmad Ikram Bin Abdul ukhuwahIslamiyahsertamendekatkanhubungan Karim Nasution dan Encik Sulaiman Bin Taibon persaudaraan sesama masyarakat Mandailing (mantan anggota majelis pimpinan), yang di Malaysia melalui Mandailing Malaysia. disambut dan dijamu di atas amak lampisan Seterusnya untuk mengenal pasti bidang(tikar berlapis) sebagai salah satu adat istiadat bidangataulapanganyangbolehdijalinhubungan Mandailing di bagas godang rumah dinas bupati kerjasama dengan pemerintah di Sumatera Utara Madina di Parbangunan, Kec. Panyabungan. sekaligus membentuk persefahaman untuk Selain diterima Bupati Madina Hidayat memulakan langkah pertama ke arah mencapai Batubara, rombongan PHMM itu disambutWali tujuan-tujuan/ objektif ditetapkan. Kota Padangsidimpuan H. Zulkarnein Nasution, “Kunjungan kami juga bertujuan untuk memtokoh-tokoh adat Kab. Madina tergabung dalam beri ruang untuk memperjelaskan isu-isu berbendera Badan Pemangku Adat (BPA) serta bangkit bagi memastikan tiada salah paham, sebaundangan terkait lainnya. liknya senantiasa mengelak daripada berlakunya Encik Ramli Hasibuan mengatakan, tujuan masalah komunikasi,” ujarnya. (a28) kunjungan mereka ke tanah lelulur adalah guna

Pelatihan Advokasi Hukum Dan Pengembangan Media GUNUNGTUA (Waspada) : Ratusan pelaku Program Nasional Pemberdayaan Masyarakat Mandiri Perdesaan dari 9 kecamatan se-Kab. Padanglawas Utara (Paluta) mengikuti pelatihan lanjutan Pokja RBM (Ruang Belajar Masyarakat) PNPM Mandiri Perdesaan Kab.Paluta tahun anggaran 2011. PelatihanyangdikutiBKAD(BadanKerjasama Antar Desa), Unit Pelaksana Kegiatan (UPK), Badan Pengawas UPK (BP-UPK) dan fasilitator ini di gelar di Aula Hotel Mitra Gunungtua, Rabu (11/7)hinggaKamis(12/7)denganmenghadirkan narasumber, Kabag Hukum Setdakab Paluta, Burhan Harahap SH, Ketua Perhimpuan Advokad (Peradi) Tapanuli Selatan Ridwan Rangkuti SH MH, Anggota DPRD Paluta HjYayah Sukiyah, Tohong Pangondian Harahap dan Sori Parlah Harahap dari kalangan media. Acara dibuka Kepala Badan Pemberdayaan Masyarakat dan Pemerintahan Desa dan Ke-

lurahan Paluta, Drs Mahlil Rambe diwakili Satuan Kerja (Satker) PNPM Paluta, Riswan Harahap, S.Sos dihadiri fasilitator PNPM- Mandiri serta Pelaku PNPM Mandiri Pedesaan dan undangan lainnya. Kepala Badan Pemberdayaan Masyarakat dan Pemerintahan Desa dan Kelurahan Paluta, Drs Mahlil Rambe dalam sambutannya yang dibacakan Satuan Kerja (Satker) PNPM Paluta, Riswan Harahap, S.Sos saat membuka pelatihan tersebut mengharapkan agar BKAD dan BP UPK dan unsur lainnya dapat meningkatkan pemahaman tentang latar belakang, tujuan, kebijakan, prinsip-prinsip, prosedur dan ketentuan PNPM mandiri perdesaan khususnya pemahaman bagaimana mengelola dan meningkatkan pengetahuan di bidang hukum, media/jurnalis, kesetaraan gender dan pengawasan berbasis masyarakat dalam paradigma pembangunan dengan basis perdesaan. (a35)

Sumatera Utara


WASPADA Senin 16 Juli 2012

Lakalantas, 2 Tewas 1 Luka Berat PEMATANGSIANTAR (Waspada): Kecelakaan lalulintas di wilayah hukum Polres Pematangsiantar dan Simalungun mengakibatkan dua korban tewas, di mana satu di antaranya calon mahasiswa USU yang baru lulus testing, satu korban luka berat dan satu luka ringan. Berbagai keterangan dihimpun,calonmahasiswaUSU,Martin Panggabean, 19, warga Jalan Rakutta Sembiring, Kel. Pondok Sayur, Kec. Siantar Martoba, Kota Pematangsiantar, tewas sesudah sepedamotor Yamaha Mio BK 4363 TAL dikemudikannya terjatuh dan ditabrak serta diseret angkutan kota (angkot) Koperasi Beringin BK 1755 LU, dikemudikan Pangihutan Sibarani, 29, warga Perumnas Batu Enam, Kec. Siantar, Kab. Simalungun, di depan kampus FKIP UHN/ SMAKampus,JalanSangnawaluh Pematangsiantar, Sabtu (14/7) pukul 07:30.

Korban dengan membonceng tetangganya, Tomi, 20, sebelum kejadian hendak mengambil ijazah dari SMA Kampus guna melengkapi persyaratan sesudah diterima di USU. Ketika sampai di depan kampus FKIP UHN/SMA Kampus, korban berusahamendahuluikendaraan di depan. Namun sepedamotornya selip hingga terjatuh. Angkot Koperasi Beringin yang meluncur dari arah berlawanan langsung menabrak korban yang terjepit di sepedamotor dan sempat terseretsejauh30meter.SedangTomi selamatkarenaterjatuhketempat lain dan mengalami luka ringan.

Bupati Samosir Buka Workshop Geopark Guru SAMOSIR (Waspada): Pemkab Samosir bekerjasama dengan Badan Geologi Bandung menggelar workshop terhadap guru-guru mengenai pemahamaman dan pengembangan Geopark di Kab. Samosir, bertempat di aula Hotel Dainang Pangururan, kemarin. Kepala Badan Geologi Bandung Ir. S.R. Sinun Baskoro, MM mengatakan, kegiatan ini upaya dan terobosan serta kebutuhan dalam pengembangan geopark. Di samping itu, untuk memberi persamaan persepsi akan geopark sehingga lebih memahami dan rencana pengembangannya di Samosir. Bupati Samosir Ir. Mangindar Simbolon, menyambut baik workshop geopark, mengingat pentingnya untuk memberin pemahaman ke berbagai pihak terutama masyarakat, guna mempersiapkan diri dalam pembangunan. Karena itu, ini sengaja kami tujukan kepada guru mengingat guru dapat mentransformasi kepada siswa-siswi yang akan menerangkan kepada masyarakat, sehingga masyarakat mengetahui maksud geopark.(c11)

Ketua PDIP Sumut Bantu Anak Mantan Wartawan Hr Waspada SIDIKALANG (Waspada): Ketua DPD PDI Perjuangan Sumut, Panda Nababan dalam kunjungan kerjanya ke Dairi, Sabtu (14/ 7) menyerahkan bantuan uang tunai kepada Lee Klein Sinaga, kelas II SMAN 1 Sidikalang, anak mantan wartawan Hr. Waspada Leston Sinaga (alm), warga Jalan A. Yani Sidikalang. Panda Nababan mengatakan sangat terharu mendapat informasi dari Ketua DPC PDIP Dairi, Ir. Benpa Nababan ada siswa SMA Negeri 1 Sidikalang yang menjadi yatim piatu setelah ayah dan ibunya meninggal empat tahun lalu. Dengan haru, Panda memberi semangat terhadap Lee dan mengingatkan agar rajin belajar. Benpa Nababan kepada Waspada mengatakan, Leston Sinaga semasa hidupnya tergolong wartawan senior dan bernyali tinggi. Saya dulu sangat kompak dengan almarhum. Orangnya pintar dan periang. Leston meninggal tahun 2008 akibat sesuatu penyakit. Istrinya guru PNS di SMP Negeri 1 Sidikalang meninggal 2009, karena sakit. Almarhum meninggalkan tiga anak, dua putra dan satu putri. Anak pertama masih kuliah di UI dan anak kedua kuliah di USU.(a20)

Ribuan Umat Islam Peringati Israk Mikraj SIDIKALANG (Waspada): Panitia hari besar Islam (PHBI) Kab. Dairi memperingati Israk dan Mikraj Nabi Muhammad SAW 1433 H sekaligus menyambut bulan suci Ramadhan di Gedung Olahraga (GOR) Jl. Rumah Sakit Umum Sidikalang Kamis, (12/7). Peringatan Istak Mikraj ini diikuti ribuan pelajar SD, SMP, Tsanawiyah, Aliyah, SMU, SMK, TNI, Polri, PNS, Muspida, MUI dan jemaah lainya, sehingga tempat duduk lantai dua gedung olah raga Sidikalang tampak penuh. Drs. H. Ahmad Musa Hasibuan, MH dalam ceramahnya mengungkapkan, Islam adalah penyebar kedamaian, Islam adalah pemersatu di bumi ini. Ketua PHBI Kabupaten Dairi, H.R.Ardin Ujung,SPdI. menyebutkan, perayaan Israk Mikraj ini bukan saja untuk menambah iman, akan tetapi kita dapat mempererat tali silaturahmi di antara kita. Ketua Panitia, Teuku Umar didampingi Sekretaris Anto Buang Menalu mengungkapkan rasa bangga atas kepercayaan Pengurus PHBI Kabupaten Dairi memberi kepercayaan kepada mereka sebagai pantia. (ckm)

Korcap PP: Pakpak Bharat Berkembang Pesat PAKPAK BHARAT (Waspada): Kabupaten Pakpak Bharat mengalami kemajuan yang sangat cepat dibandingkan dengan beberapa tahun yang lalu. “Pakpak Bharat mengalami perkembangan sangat pesat. Beberapa tahun lalu saya kemari masih sangat lengang. Ini, di manamana sudah terdapat perkembangan,” ujar Koordinator Cabang MPWPemudaPancasilaMbelgahTarigan,diHotelWarisusaimelakukan Rapat Koordinasi dengan jajaran MPC Pemuda Pancasila Pakpak Bharat, baru-baru ini. Hal senada disampaikan Ketua MPC Pemuda Pancasila Kabupaten Pakpak Bharat Antoni Efendi Berutu, SE. “Pertumbuhan ini semua tentunya bukan hanya atas upaya pemerintah kita saja, namun seluruh elemen masyarakat Pakpak Bharat memiliki peran,” ujar Toni. Ditambahkanya, pertumbuhan signifikan lebih terlihat pada sekitar tiga atau empat tahun yang lalu, namun secara khusus dua tahun terakhir sangat banyak perubahan yang terlihat. “Saat ini pemkab terlihat sangat serius membangun infrastruktur jalan besar mengelilingiKotaSalaksetelahsebelumnyamenuntaskanpembukaan jalan hingga pelosok Pagindar,” ujarnya. Harapanya,kondisisinergitasyangsudahdijalinbaikpihakPemkab, masyarakat dan legislatif termasuk insan pers/LSM dan Muspida Plus dapat terus dipelihara, sehingga peningkatan itu terus berlanjut bahkan semakin signifikan. (csb)

Gelar Renang Dasar Militer PEMATANGSIANTAR (Waspada): Minggu militer merupakan salahsatuprogramkebijakanTNIADdalammembentukdanmembina setiap prajurit, dengan tujuan agar tetap memiliki kemampuan dasar militer hingga terampil dalam gerakan militer dasar. Untuk menunjang itu, Danrem 022/PT Kolonel Inf Restu Widiyantoro, M.DA menyelenggarakan latihan renang dasar militer bagi seluruh perwira di kolam renang Detis Sari Indah, Kota Pematangsiantar, Rabu (11/7). Informasi ini disampaikan Kapenrem 022/PT Mayor Caj Drs. Prinaldi, Kamis (12/7). MenurutKapenrem,kegiatanrenangdasarmiliteritudilaksanakan guna mengetahui dan menguji kemampuan serta ketangkasan renang dasar militer dan sebagai evaluasi secara individu bagi prajurit Korem 022/PT. “Seorang prajurit harus memiliki empat dasar kemiliteran, dimana salah satunya, seorang prajurit harus bisa berenang hingga tidak tenggelam di air. Ketangkasan renang dasar militer harus dikuasai setiap prajurit, karena merupakan tuntutan dalam melaksanakan tugas, sekaligus menjaga kondisi fisik dan kebugaran tubuh. Renang dasar militer turut merupakan salah satu persyaratan yang harus dipenuhi bagi prajurit dalam Usul Kenaikan Pangkat (UKP),” terang Kapenrem. Turut serta dalam latihan renang dasar militer antara lain, Kasrem 022/PT Letkol Arm Anton Irianto Popang, SH, para Kasatdisjan jajaran Korem 022/PT, para Kasi Korem 022/PT dan para perwira Makorem 022/PT serta perwira Satdisjan jajaran Korem 022/PT.(a30)

Warga membawa korban ke rumahsakit,namundiperjalanan, korban meninggal dunia. Sat Lantas Polres Pematangsiantar dipimpin Kanit Laka Iptu Sugeng W, SH mengamankan sepedamotorkorbanbersamaangkotKoperasiBeringindanpengemudinya. Kapolres Pematangsiantar AKP Alberd TB Sianipar, S.Ik, MH saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu, Kasat Lantas AKP Hendrik Situmorang, MM dan Kanit Laka Iptu Sugeng W, SH, Minggu (15/7), menyebutkan kasusnya dalam penyelidikan. Sementara korban Maralus Silalahi, 43, petani, warga Dusun Hobun Girsang II, Kel. Girsang, Kec. Girsang Sipanganbolon,

Kab. Simalungun tewas sesudah sepedamotor Suzuki Smash BK 5550TA ditumpanginya ditabrak lari mobil barang Mitsubishi Colt Diesel, di jalan umum km 41-42 jurusan Parapat-Balige, Girsang II, Kel. Girsang, Kec. Girsang Sipanganbolon, Sabtu (14/7). Mitsubishi Colt Diesel datang dari arah Balige menuju Parapat dengan kecepatan tinggi. Tiba di tempat kejadian yang jalannya menurun dan menikung ke kiri, pengemudi diduga kurang hatihati dan mengambil jalan terlalu ke kanan. Akibatnya, mobil barang menabrak sepedamotor Suzuki Smash dikemudikan Maradim Samosir, 43, petani, warga sama dengan Maralus Silalahi yangdatangdariarahberlawanan.

MaralusSilalahidanMaradim Samosir bersama sepedamotor terlempar ke badan jalan hingga mengalami luka berat. Namun Maralus Silalahi tewas sesudah sampaidirumahsakit,sedangkan Maradim Samosir masih mendapat perawatan. SatLantasPolresSimalungun Pos Lantas Parapat mengamankansepedamotorkorban,sedang mobil barang melarikan diri. KapolresSimalungunAKBPM.Agus FajarH,S.Ik saatdikonfirmasimelalui Kasubbag Humas AKP H. Panggabean, Kasat Lantas AKP Hendrawan, S.Ik dan Kanit Laka Iptu Alsem Sinaga, Minggu (15/ 7), juga menyebutkan kasusnya dalam penyelidikan, dan mobil barang dalam pencarian.(a30)

Masyarakat Siantar Produksi 511 Ton Sampah PEMATANGSIANTAR (Waspada): Sampah yang diproduksi masyarakatkotaPematangsiantar 511 ton setiap hari, sementara petugas Dinas Kebersihan hanya mampu mengangkut 345 ton ke pembuangan akhir (TPA) setiap hari, sehingga tersisa 175 ton sampah. Menurut Kepala Dinas Kebersihan Pematangsiantar, Ir. Khadimin, tidak dapat terangkatnyaseluruhsampahkarenaalasan kondisi alat angkut. Jumlah alat angkut yang beroprasi setiap har 32 truk dan 1 pick up dalam kondisi tidak sehat karena termakan usia. Dari 32 truk yang di gunakan masih ada buatan tahun 1987. Jumlah petugas kebersihan 292 orang, terdiri dari penyapu jalan, penggali parit, petugas

potong rumput dan 33 sopir serta 73 kenek truk sampah. Petugas kebersihan tidak

pernah libur demi menciptakan kota Pematangsiantar yang bersih.(c16)

Waspada/Mulia Siregar

TIGA petugas Dinas Kebersihan Pematangsiantar menaikkan sampah ke dalam truk.

Simpang Tiga Kabanjahe Rawan Lakalantas KABANJAHE(Waspada): Jalan negara, tepat di depan Masjid Agung simpang tiga Kabanjahe, kondisinya memperihatinkan, berlubang-lubang. Sudah banyakkorbanberjatuhandijalan berlobang ini. Pantauan Waspada di lokasi, Jumat 13/7), terlihat kondisi jalan negara Kabanjahe-Sidikalang ini, memangtampakmengkhawatirkan. Menurut warga sekitar, di sini sering terjadi kecelakaan lalulintas (lakalantas) karena kondisi jalan berlubang-lubang. Pengguna jalan diingatkan selalu waspada. “Disinimemangseringterjadi lakalantas. Bahkan, beberapa kali kami saat hendak menyeberangi jalan,hampirdisenggolkendaraan yang melintas karena kendaraan ituberusahamengelakkanlobang didepanMasjidRaya,”ujarLenny Br Saragih, warga yang tinggal tepat di pinggir jalan tersebut. Dijelaskannya, di persimpanag jalan utama antara Kabanjahe-Sidikalangtepantyadidepan Masjid Agung memiliki empat persimpangan yang letaknya sangat berdekatan.

“Hendaklah segera diperhatikandanpasangkantrafficlight yangsangatdibutuhkanolehpara pengguna jalan dan masyarakat yangadaseputaransimpangtiga,” katanya. Di jalan tersebut terlihat beberapalubangyangmenganga

bahkan kedalamnya mencapai 25 cm dan lebarnya mencapai satu meter lebih yang ada di persimpangan bahkan di sepanjang jalan Kabanjahe-Sidikalang. Pemkab Karo diminta memperhatikandansegeramelakukan perbaikan. (c10)

Waspada/Micki Maliki

LUBANG rnenganga di jalan simpang tiga, tepatnya di depan Masjid Agung Kabanjahe rawan lakalantas.

Warga Protes PTPN IV Kebun Marjandi SIMALUNGUN (Waspada): Seratusan massa berasal dari Kel. PaneiTongah,Nagori(Desa)Janggir Leto, Nagori Simpang Raya dan Nagori Bah Bolon Tongah, Kec. Panei, Kab. Simalungun memprotes keras PTP Nusantara IV Kebun Marjandi. Prores mereka lakukan dengan melakukan aksi unjukrasa di halaman DPRD Simalungun di Pematang Raya, kemarin, karena PTPN IV Kebun Marjandi dituding menutup parit isolasi yang ada di sekitar kebun, yang mengakibatkan pemukiman warga sering kebanjiran belakangan ini. Massa datang dengan mengendarai sepedamotor dan mobil angkutan umum sembari membawa spanduk yang intinya meminta Bupati Simalungun, JR Saragih, segera turun tangan mengatasi masalah dihadapi warga, serta meminta pihak managemen kebun Marjandi menutup parit isolasi serta mengganti tanamankelapasawitkepadatanaman teh sebagaimana sebelumnya.

Aksi dikomandoi John MarudutTuahSaragihbesertasejumlah tokoh masyarakat Panei Tongah berlangsungtertibdanaman.Para pengunjukrasasecarabergantian menyampaikan orasi di hadapan ketua dan anggota Komisi II DPRD Simalungun yang menerima pengunjukrasa. Dikatakan,kedatanganmassa ke gedung dewan untuk menyampaikan keluhan warga terkait dengan terjadinyabanjiryang melandakelurahanPaneiTongah serta beberapa nagori lainnya di Kec. Panei. Banjir yang melanda daerah ini dituding warga bersumber dari parit isolasi yang dibangun pihak kebun Marjandi Selain meminta agar parit isolasi segera ditutup, massa dalam pernyataan sikapnya juga menuntut agar pihak kebun Marjandi memberikan perhatian kepada warga yang terkena dampak banjir, dengan cara memperbaiki fasilitas masyarakat seperti rusaknya titi (jembatan) rumah warga, paret yang hancur sepan-

jang jalan protokol, persawahan yang terancam gagal panen, fasilitas SMP Negeri 1 serta membayar ganti rugi yang terkena banjir. Ketua Komisi II DPRD Simalungun, Ir. Makmur Damanik beserta anggota Komisi II lainnya seperti Mansur Purba, Suriawan, Luhut Sitinjak dan Pantas Sitanggang, dalam dialog dengan warga menyatakan siap mendukung warga, jika penutupan parit isolasi merupakan solusi utama. Dalam dialog yang juga dihadiri unsur eksekutif seperti Asisten I Pemkab Simalungun, Marolop Silalahi, Kaban Lingkungan Hidup, Radja Sianipar, Camat Panei, Baktiar Sinaga, Kabag Humas Mixnon A Simamora serta staf lainnya, sepakat pada saat itu juga turunkelokasibencanabersamasama dengan warga. Sebelumnya, massa juga telahmendatangikantormanagemen PTPN IV kebun Marjandi. Namun warga hanya dijanjikan pihak manajemen, bahwa parit isolasi akan ditutup. (a29)

Waspada/Hasuna Damanik

SERATUSAN massa menamakan diri Forum Masyarakat Peduli Panei Tongah menyampaikan orasi di halaman kantor DPRD Simalungun di Pamatang Raya.


KAPOLRES Tapanuli Utara AKBPWijatmika didampingi Kasubbag Humas AipdaW Baringbing, Kapolsek Parmonangan bersama perwira di jajaran Polres Taput, memberikan pemahaman kepada para orangtua/keluarga para pelaku penganiayaan oleh isu begu ganjang.

Kasus Begu Ganjang, Massa Datangi Mapolres TARUTUNG (Waspada): Seratusan massa warga Desa Aek Raja, Kec. Parmonangan, Kab. Tapanuli Utara (Taput) mendatangi Mapolres Taput di Jalan Soeprapto, Tarutung, kemarin. Massa mendatangi Mapolres karena Kamis pagi 16 warga tersebut diamankan pihak Polres, terkait perusakan dan penganiayaan terhadap warga lainnya yang diduga memiliki begu ganjang. Kedatangan massa diterima Kapolres AKBP Witjamika, Kasubbag Humas Aipda W Baringbing bersama para perwira di jajaran Polres Taput di halaman Mapolres. Perwakilan massa, Lindung Manalu (mantan Kades), menyampaikan, kedatangan mereka untuk meminta kepada pihak Polres agar warga mereka diperlakukan manusiawi selama proses hukum. “Saya yang mewakili warga dan keinginan ini adalah keinginan seluruh massa yang ikut serta ke Mapolres ini. Kami inginkan perlakuan yang manusiawi kepada warga kami yang diamankan Polres selama proses hukum. Mereka telah terlanjur berbuat salah dan apapun nantinya hukuman yang dijatuhkan kepada mereka, harus diterima dengan lapang dada,” ujar Lindung Manalu.

Kepala Desa Aek Raja Marojahan Manalu, 52, kepada Waspada Jumat (13/7) pagi menerangkan, belasan warganya melakukan penganiayaan dan pengerusakan rumah warga lainnya yaitu rumah Gopar Manalu, 54, dan rumah Mikael Manalu,43. Akibatnya, penghuni rumah Delima Simanjuntak, 53 dan anaknya Fernando Manalu, 35, beserta Mikael Manalu harus mendapat perawatan intensif di rumah sakit swadana Tarutung, karena menderita luka cukup serius. Kapolres Taput didampingi Kasat Reserse AKP J Tampubolon membenarkan terjadinya kasus penganiayaan dan perusakan rumah korban, Rabu (11/7) sekitar Pukul 23:00. Kamis (12/7), 16 pelaku diamankan ke Mapolres dan satu orang masih dalam pengejaran. “Ke-16 pelaku yang telah diamankan di Mapolres masing-masing, HS, B, HM, AP, JM, BM, PM, MA, AS, JS, JM, WP, MS, TS, OM, SM dan MS yang masih dalam pengejaran, sudah kita tetapkan sebagai tersangka. Atas perbuatan para pelaku, mereka dijerat pasal 406 dan pasal 351 subsider 170 dengan ancaman pidana 12 tahun,” katanya. (a21)

Usut Proyek Rehab Kemenag Dan KUA KABANJAHE (Waspada): Muncul desakan agar dilakukan pengusutan terhadap proyek rehab (perbaikan)kantorKementerianAgama(Kemenag) dan Kantor Urusan Agama (KUA) Kab. Karo berbiaya ratusan juta rupiah. Proyek yang sudah dimulai sejak April lalu itu, diminta agar diusut tuntas, apalagi di lapangan terlihat proyek ini seperti misterius. Bahkan, tidak ada plank dipampangkan di sekitar proyek. “BiayaperbaikankantorKemenagsekiraRp150 juta,danKUARp50juta.Pekerjaanmulaidilakukan April, dan akan selesai pada Juli ini. Tidak benar terjadi Pungli dan penyimpangan dalam perehabankantorini,”ujarKepalaKantor(Kakan)Kemenag Kab. Karo Drs Mardinal Tarigan kepada Waspada, Kamis (12/7) Dijelaskannya,perbaikankantortersebutmulai dari atap kantor (seng) serta lantai yang dikeramik. Pekerjaannya tersebut ditenderkan. Pantauan Waspada di lokasi, tampak dua pekerja sedang melakukan perbaikan, dan atap

kantor Kemenag sudah diganti dengan seng gelombang warna hijau. Sementara lantai kantor yangmempunyaisekiradelapanruangan,tampak digantidengankeramikwarnaputih.Untukkantor KUA yang persisi di samping Kemenag, tidak adatanpakperbaikansepertiyangdikatakanKakan Kemenag. “Kami baru tiga hari mulai memperbaikin kantor Kemenag, dan kami akan menyelesaikan pekerjaan lebih kurang satu bulan. Untuk perbaikan tersebut, hanya kantor Kemenag saja, tidak ikut kantor KUA. Jika dananya saya tidak tau persis, yang pasti diperkirakan lebih dari Rp200 juta, dan bisa mencapai Rp500 juta. Namun, begitu juga kami tetap berdua menye-lesaiakan pekerjanan ini,” terang salah satu tukang di kantor Kemenag. Warga setempat mengatakan, seng bekas dari kantor Kemenag diduga telah raib, entah kemana. “Padahal semalam sore masih ada seng itu,” terang J. Tarigan di luar kantor Kemenag. (c19)

Kejatisu Diminta Usut Pembangunan Dermaga Sipinggan Dan Simanindo SAMOSIR (Waspada): Kejatisu diminta mengusut pembangunan fasilitas darat dermaga dan pelataran parkir ferry yang berada di Kec. Simanindo dan Desa Sipinggan, Kec Nainggolan. Informasi dihimpun Waspada, Jumat (13/ 7), sesuai nomor adendum kontrak 028/2.337.a/ Hubkominfo/IX/2011 pekerjaan penataan pelataran parkir pelabuhan Ferry Simanindo dengan pagu Rp695.366.000 dan No Addendum kontrak No ADD-I/028/2.558/Hubkominfo/2011 pekerjaan pembangunan fasilitas darat pelabuhan ferry Sipinggan Kec. Nainggolan dengan pagu Rp509.972.000. Di lapangan berkembang informasi, diduga ada anggaran di-mark up untuk harga satuan di beberapa pekerjaan seperti bongkar paving block 1 meter kubik senilai Rp273.542 padahal sesuai harga gaji buruh satu orang/hari sebesar Rp60.000. Selanjutnya biaya angkut tiang besi dermaga yang lama dari Simanindo ke Pangururan dan biaya bongkar Rp 34 juta lebih dan harga pompa air merek Shimizu Rp7 juta padahal harga standar Rp3 juta. Kemudian pekerjaan tanah uruk timbun Rp1.621,92 m3 tidak dilaksanakan namun yang ada pasir yang diuruk dari sepanjang bibir pantai Danau Toba dengan menggunakan alat excavator, sementara di dalam kontrak tidak ada

mobilisasi alat berat tersebut. Kemudian, itu sudah menyalahi izin pertambangan (galian C) sesuai Perda No 10 Kab Samosir. Berbagai informasi ini disampaikan aktivis sosial H Sinurat kepada Waspada, di ruang tunggu Kejatisu Medan, Jumat (13/7). Dia menyebutkan, alasan Kadis Perhubungan Samosir Subandrio Parhusipmengatakanaddendummencapai100% dilakukan karena lahan tidak diberikan oleh masyarakat, padahal addendum 100 % harus mendapat izin dari DPRD Samosir dan lahan pelataran perparkiran tersebut tidak ada masalah bagi masyarakat, ujar Sinurat. Kejatisu diminta menindak lanjuti dugaan tindak pidana korupsi yang diduga semakin merajaleladilingkunganPemkabSamosirdipimpin Bupati Samosir Ir. Mangindar Simbolon terkait temuan di Dinas Perhubungan tersebut, ujarnya. “KetikakunkerWakilBupatiSamosirMangadap Sinaga ke Kec Nainggolan saat pelantikan Kades hasil pemekaran baru desa Sipinggan akhir 2011, Mangadapmengatakan,pembangunanpelataran perparkirandiSipinggansudahmenyalahikontrak,” ujar tokoh masyarakat Robet Siringo. Kerugian keuangan negara yang patut diusut, di antaranya kawat beton bronjong diduga tidak sesuaidenganukuran,kemudianukuranbatuterlalu kecil tidak sesuai standar sehingga pemasangan bronjong terlihat berkelok, tambahnya. (c11)

DPRD Taput Setujui LKPJ Bupati TARUTUNG(Waspada):DPRDTapanuliUtara melalui rapat paripurna dewan melalui pendapat akhir fraksi menerima dan menyetujui LKPJ (Laporan Keterangan Pertanggung Jawaban) Bupati 2011 untuk dijadikan Ranperda tentang pertanggungjawaban pelaksanaan APBD tahun anggaran 2011, Rabu (11/7), di Gedung DPRD Taput di Tarutung. Penerimaan LKPJ Bupati tahun 2011 itu juga disahkan melalui penandatanganan bersama keputusan DPRD nomor: 05 tahun 2012 tentang LKPJ BupatiTaput tahun 2012 dan penandatangan berita acara persetujuan bersama bernomor : 08/SKB/TU/2012 Ranperda tentang pertanggungjawaban pelaksanaan APBD Taput tahun anggaran 2011. Fraksi di DPRD Taput yang menerima dan menyetujui LKPJ Bupati Tahun 2011 , yakni Fraksi PDI Perjuangan, Fraksi Hanura, Fraksi Patriot Peduli Rakyat/Buruh, Fraksi Demokrat, Fraksi Gerhana, Fraksi Golkar dan Fraksi PKB. Bupati Taput Torang Lumbantobing dalam sambutannya mengungkapkan, pihaknya akan

mencatat butir-butir pendapat akhir fraksi sebagai mutiara yang indah yang akan dijadikan menjadi masukan yang sangat berharga dalam mengkaji dan merumuskan kebijakan serta pengambilan keputusan pada masa mendatang. “Ini akan menjadi catatan khusus bagi kami yangperluditindaklanjutiuntukmasamendatang, sebagai kemitrasejajaran yang dilandasi kebersamaan serta persaudaran untuk bersama-sama mengantar Bonapasogit yang kita cintai ini dalam mengagapai hari esok yang lebih baik,” katanya. Sementara FL Fernando Simanjuntak, SH MH selaku pimpinan rapat pada sidang paripurna tersebut berharap, agar apa yang telah disepakati bersama menjadi satu kebulatan tekad untuk bahu-membahu antara eksekutif dan legislatif dalam memajukan daerah ini. Hadir dalam rapat paripurna DPRD tersebut, Bupati Taput Torang Lumbantobing, Kapolres Taput, mewakili Dandim 0210/TU, Plt Sekdakab Taput HP Marpaung, pimpinan BUMN/BUMD, pimpinan SKPD, asisten, staf ahli serta Kabag. (a21)








M R m B NG C m G M m U N

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

A C : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window



OVER KREDIT Xenia Family 1000cc. Thn. 2008. Warna Aqua Blue. Blk DP 45Jt. Angsuran 29x lg. Hub. 0853 7388 3777 DAIHATSU Xenia XI 1.3 Dijual. Wrn hitam, BK Medan, Thn. 2007. Hrg. 116Jt. Hub. 0813 6101 8855 DAIHATSU Zebra Tahun 94, Minibus Wrn biru, BK Medan. 5 Speed. Pintu belakang. Harga Damai. Hub. 0813 7015 4503. Alamat Km. 13,5 Jl. Binjai Medan


Gran Max Pick Up DP 7 Jt-an Angs. 2 Jt-an Gran Max Minibus DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 16 Jt-an Angs. 5 Jt-an Xenia M. Deluxe DP 21 Jt-an Angs. 4 Jt-an Terios TS Xtra DP 21 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061 77402067


Xenia....DP 30 Jt-an...Angs. 3 Jt-an Terios.....DP 35Jt-an...Angs. 3 Jt-an Pick Up..DP 11 Jt-an...Angs 2 Jt-an Luxio......DP 20 Jt-an...Angs. 3Jt-an Hub. Capella Medan (Josua) 0812 6311 0820


24 Jt-an Terios 140rb/hr 21 Jt-an Xenia 9 Jt-an GMax 87rb/hr Serius Hub. 0852 7085 9366 / 77387369 PROMO DAIHATSU JULI

Xenia DP 17 Jt-an angs. 4 Jt-an Pick Up DP 7 Jt-an angs. 2 Jt-an Terios DP 17 Jt-an angs. 4 Jt-an Sirion DP 12 Jt-an angs. 4 Jt-an Luxio DP Nego. Full Discount, Ready Stock, Proses Cepat. Hubungi: IRNANDA 0813 7580 2895 / 0821 6761 2659

ALL NEW XENIA (BARU) 1300cc, AC DB, Sensor Parking, CD, MP3, USB, Alarm, Central Lock, Angs. 2.333.100. Pick Up Angs. 2.409.000. Terios Angs. 2.747.000. Hub. Adek - Astra. 0812 6340055. PIN 274CA61C


- Pick Up Granmax DP 12 Jt-an....Angs. 2,4 - Xenia DP 30 Jt-an......................Angs. 3 Jt - Terios DP 3 Jt-an...................Angs. 4 Jt-an Hub.TEDDY CAPELL 0812 6325 656 / 77884663


Xenia, Terios DP 24 & 27 Jt-an /Angs. 2 Jt-an Luxio..DP 13 Jt-an/Angs. 2 Jt-an Gran Max, MB DP 17 Jt-an/angs. 2 Jt-an Pick Up DP 11 Jt-an/Angs. 2 Jt-an “Proses Cepat & Dapatkan Penawaran Khusus” Hub. R I A N A S T R A 0 8 1 2 6 3 8 3 6 9 1


Xenia 1.300cc Angs. 2,4Jt-an/bln. Gran Max Pick Up Angs. 2,3Jt-an/bln. Hub. DIKA 0852 7074 7744 (Terima Tukar Tambah)

JAZZ DP 38Jt-an Ready Stok Jazz RS Notic FREED DP 24 Jt-an CR-V 3 Tahun Tanpa Bunga CR-V DP 56 Jt-an 081.370.999.998 / 77.388.133


5 CM 6 CM

Rp. 65.000 Rp. 78.000


L300 PU, Outlander, Pajero, Colt Diesel

Hub: VANBY : 0813 7030 8989

MERCY C 180 Kompressor A/T Thn. 2003. Silver BK. Hub. 0853 6246 2132 DIJUAL 1 Unit T120 Pick Up. Wrn Hitam, BK Medan, Thn. 2005. Hrg. 47Jt. Hub. 0813 6101 8855 DEALER RESMI SUZUKI

Carry PU DP 15Jt-an Angs. 3,2Jt 3 Thn. APV DP 20 Jt-an Angs. 5 Jt 2 Thn. Splash DP 42Jt-an Angs. 4,7Jt-an 3 Thn. Ertiga DP 42Jt-an Angs. 4,6Jt 3 Thn. Hub. RIDWAN SIREGAR 0813 6143 7654

SUZUKI Escudo 2.0 Thn. 2001. Silver BK Mdn Rp. 98Jt. Hub. 0812 6594 2789 SUZUKI Katana 95 4x4 Hijau. Mulus, 55Jt. 0813 9656 4299, 061.68788599

7 CM 8 CM

Rp. 91.000 Rp. 104.000


Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500

BUTUH MODAL / KPR DITOLAK BANK Grop Investor Siap Bantu Kucurkan Dana dan Mudah Disetujui. Jaminan Properti Hub. 0823 6732 1000 - 061.8222 774

PINJAMAN SUPER CEPAT Jaminan: SHM, SK Camat, SK Lurah, BPKB Spd. Mtr, mobil, Pick Up. Bantu Pelunasan BPKB Pinjaman 1 Juta - 1 Milyar. Proses 3 Jam Cair. Tanpa Usaha. Pinjaman 5 M - 500 Milyar. Jaminan SPBU, Pabrik, Tambang Batu Bara. Rumah Sakit, Hotel. Hub. Family Finc: HP. 081362290001, 0813 70446633


ALL NEW PICANTO DP 30 Jt-an/Angs. 2 Jt-an Proses Cepat, Data Dijemput Ready, Rio, Sportage, Pregio Hub. 0812 6990 1990 ASEN

KIA ALL NEW PICANTO & ALL NEW RIO, ANGS 2 JT-AN SPORTAGE BUNGA 0%. MOBIL TERBAIK DESAIN EROPA. MOBIL DAPATKAN HADIAH SPESIAL & JALAN2 KE KOREA. BARU BELI SEKARANG HUB: ADE KIA 0852.9608.6218 ISUZU PANTHER LDX DIJUAL Thn. 1992 Warna abu-abu. Mulus Pajak full 1 tahun. Harga 45Juta Nego. Hub. HP. 0852 6296 1668 PEUGEOT, 405, BK, 730, FA, 95 Satu tangan dari baru Kondisi Luar Biasa Mulus (Original) Hub. 0821 6399 3022

ISUZU Panther LDR 92. Merah metalik. P. Steering, P. Window, jok, CD, Velg Ready, body mulus, siap pakai. Harga 45Jt/Nego. Hub. 0812 6568818 / 77305875

MITSUBISHI L300 Pick Up Thn. 99. BK Medan Lengkap. Bebas Denpul. H. Nego. HP. 0813 9741 5555

Pelanggan Yang Terhormat


Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602



Oven roti, mixer roti, mexin pres, adukan, srikaya, Hub.0812.6393.636 0819.646.878

Ready Stock Avanza, Veloz, Innova, Rush, Bunga 6%. Hub. DEDY SIMATUPANG. 0813 6165 1801 - 0853 6207 2000

TOYOTA Kijang Krista Diesel Thn. 2003. Hitam met, BK Rp. 149Jt. Hub. 0853 7089 9893



TOYOTA Corolla All New 1.6cc Thn. 1996. Warna hijau metalik, Plat Asli Medan, mobil pribadi, harga nego, Hubungi: 0812 6328374 - 0821 6668 4786




1. Pemasangan Depot Air Minum Sistem Multi Filtrasi & RO Rp. 14 Jt s/d 38 Jt 2. Pemasangan AMDK dan Pengurusan SNI & BPOM 3. Air Pegunungan 7000 Liter 4. Menyediakan Segala jenis Spare Part Depot Air Minum 5. Menyediakan Mesin Penjernih Air Rumah Tangga, R.S, Pabrik dll

TOYOTA Kijang LGX Bensin 1.8cc Thn. 2004, warna Silver campange, plat Medan, pribadi, CD Player. Harga Nego. Hubungi: 0812 6328 374 - 0821666 84786

TOYOTA Innova 2.0G Bensin Thn. 2004 akhir. Warna hitam metalic lengkap. sgt mulus. Hrg. Rp. 144/Nego. Hub. 0852 705 44544




BERAS “ORGANIK” SELARAS ALAM PANDAN WANGI/ SIHERANG 5 KG -> Rp. 64.000 JADI Rp. 61.000 10 KG -> Rp. 125.000 JADI Rp. 120.000 JUGA TERSEDIA BERAS MERAH 5 KG = Rp. 75.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000


JL. SETIA BUDI 144 PSR 2 TJ. SARI (061) 821.6612 - 0821.6386.3340



-Menerimapengurusan/perpanjangPASPORT - Tiket ferry T. balai - Poklang (Malaysia) - Travel Medan - Tanjung Balai (Pelabuhan) Hubungi: (061) 6647.7734/ 0852.9616.6601 (Roy)


Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.







0853 7083 9300




Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

10 (SEPULUH) ORANG TENAGA KERJA Hub: (061) 7779.1210 (061) 7795.0757


12 JULI - 26 AGUSTUS 2012





Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0852 6168 0200 - 0812 600 5410


- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput




SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000


TOYOTA LIMO 2005 Wrn putih, ex Taxi, BBN Plat hitam a/n. pembeli. Kondisi langsung cek 0813 9676 8123


11 CM Rp. 165.000 12 CM Rp. 180.000


HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab


SUZUKI Karimun Th. 2000. Warna coklat muda met. Cat mulus, orisinil. BK Medan Komplit. H. 63Jt Nego. Hub. 0812 6599 2655

Warna Hitam Metalic, Type 1.5 Idsi, Harga 131 Jt. TP Hub. 0812.6335.7942 ISUZU Panther Touring Th. 2007. BK Medan asli Hitam, Bodi mulus, Nego. Hub. 0823 6839 5315

9 CM Rp. 126.000 10 CM Rp. 140.000

Senin, 16 Juli 2012





T.A. 2012/2013




(izin resmi dari BPPSDM Kes.No:


HP. 0813 7035 7291 Ada Garansi


845.8996 0812.631.6631

HK.00.07/III/I/00847/2012) PERSYARATAN: - Foto copy Ijazah D1 Kebidanan - Pasphoto 3x4: 2 lembar

Bergaransi/ Jl.Kpt. Muslim

Pendaftaran sampai dengan: 31 JULI 2012


Perkuliahan dimulai: AGUSTUS 2012

0812 631 6631 Ada Garansi

Kontak Resmi: IBU KRISTIN HP. 0813.7019.6876 - 0811.638.960 0812.6318.9828




JL. LETJEND. JAMIN GINTING NO. 2 MEDAN TELP. (061) 822.3939 CP. 0878.6721.1681 - 0811.634.594




Dibutuhkan min. lulusan: SMU untuk ditempatkan jadi Guru TK/PAUD, Persyaratan datang langsung ke:Tadika Puri Jl. Karya Wisata No. 23A Telp. (061) 786.2156 Medan Johor, Bp. E. Saragih, SH

Ada THR, Gaji bonus, Jam kerja 9.00-17.00 WIB, Jl. Serdang No. 2-D Belakang Showroom Honda, Mdn 0853.5823.5393 0813.6209.3407 - 0819.3340.3749


(061) 7765.0020 0819.1111.8252/ Asin



Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu


Uk. Tanah 9x14m (SHM), 3 KT, 2 KM, Teras depan/belakang, Garasi, KEramik, Pagar, Over kredit, Rp. 100 Jt, Sisa angsuran 6 tahun 9 bulan lagi, Rp. 418.000/bulan, Lokasi Perum. Kuis Indah Permai Batangkuis Serius hub. 0813.9712.3498 (TP)


Grand Monaco Jl. Eka Surya Johor, Type 36, Blok T No. 20, Sertifikat Hub. 0821.7859.7597/ TP




Rmh kost, Warnet 3 tingkat Jl. Gedung Arca Gg. Sehat No. 1 (061) 6872.1968/ 0812.6021.0202





Pusat Pelatihan Usaha membuka lowongan, dengan syarat: - Mahir dlm menjahit tas, dompet - Dibutuhkan ±10 orang Bagi yg berminat hubungi:


Surat Tanah SK Camat No. 593.83/385/2001 A/n. Ramlah Lubis di Tg. Morawa - L. Pakam. Yang menemukan Hub. Pak Amir 0852 6252 7745


Surat Tanah atas nama: Alm. Terubus, yang terletak Jl. T.A. Hamzah Lk. 1 Kelurahan Jati Makmur Kecamatan Binjai Utara, dgn luas ±2331m²

TELAH TERCECER Satu Surat Akta Pelepasan hak dan penyerahan dengan ganti rugi dengan nomor 163/3/HPH-GR/M/ 1989. A/n. SHELLY KHAIRUNNISA yang beralamat Jl. Puri Gg. Zainar No. 409 C Medan.



Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama



Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR


Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333





(Untuk Ambeien)

Wasiri berani menjamin kesembuhan tuntas ambeien/wasir anda. Sangat berkhasiat dan cepat menghilangkan ambeien. Wasir yang menonjol maupun yang tumbuh di dalam. Redakan rasa sakit, perih dan menghentikan pendarahan waktu buang air besar, mencegah infeksi dan panas dalam serta melancarkan buang air besar. Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222


Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat


Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari


WASPADA Senin 15 Juli 2012

07.00 Sinema Pagi 09.00 Dahsyat 11:00InfotainmentINTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14.30 Kabar Kabari 15.00 Silet 15.45 Target Operasi 16.30 Body Bowling 17.00 Seputar Indonesia 17.30 Mega Sinetron : Hanya Kamu 18.30YangMasihDiBawah Umur 19.00 Mega Sinetron : Tukang Bubur Naik Haji 21.00 Air Mata Ummi 22.00 Box Office Movie 00.00 Seputar Indonesia Malam


07.00 Inbox 09.00 Halo Selebriti 10.00 SCTV FTV Pagi 11:00SLLiputan6Terkini 12:00 Liputan 6 Siang 12.30 SCTV FTV 14:00 Liputan 6 Terkini 14:30 Status Selebriti 15.00 Cinta Dan Uya Sama Sama Kuya 17.00 Liputan 6 Petang 17.30 SCTV FTV Istimewa 19.30 SCTV Sinetron : Putih Abu Abu 20.30 Badil Dan Blangkon Ajaib 21.30 Biang Kerok 22.30 Liputan 6 Terkini

07:00 Disney Club : Handy Manny 08:00 Serial Pilihan 10:00 Kisah Unggulan 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Diantara Kita 15:30 Lintas Petang 16:00 Animasi Spesial 16:50 Filler Didi Tikus 17:00 Animasi Spesial : Shaun The Sheep 18:00 Animasi Spesial : Chaplin And Co 18:30 Aladdin 19:30 Dewi Bintari 20:30RadenKianSantang 21:28 Filler Mnctv Pahlawan Indonesia 21:30 Putri Nabila 23:00 Intermezzo

07:30 Fresh & Fun 08:00 Friends 09:00 Fenomania 09:30 Seleb @ Seleb 10:00 Bread, Love And Dreams 11:30 Topik Siang 12:00 Klik ! 13:00 Tom & Jerry 14:00 Duckula 14:30 Woody Wood Pecker 15:00 ISL 17:30 Topik Petang 18:00 Pesbukers 19:30 Catatan Si Olga 20:30 Style 21:30 Pilih Pilih Mantu 22:30 Black In News 23:00 Four Wheel Drive 23:30 Dokumenter

07:00 KISS Pagi 08:00 Sinema TV Pagi 10:00 Sinema Tv Spesial 12:00 Patroli 12:30 Drama Asia (Korea): The Moon That Embraces The Sun 13:30 Drama Asia (Korea): Protect The Boss 15:00 KISS 16:00 Fokus 16:30 Buaya Show 18:00 Drama Asia 19:00 Sinetron Unggulan 20:00 Tutur Tinular 22:00 Pandawa Kurawa 23:30 Mega Asia

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Metro Xin Wen 11.05 e Lifestyle 13.05 Zero to Hero 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Prime Interview 21.05 Top Nine News 22.05 Economic Challenges 23.05 Metro Realitas 23.00 Metro Sports


07:30 Sinema Spesial Liburan 09:30CintaCenatCenut 10:30 Insert 11:30 Jelang Siang 12:00 Reportase Siang 12:30 Jika Aku Menjadi 13:15 Jail 14:00 Magic Comedy 14:30 Digital Clip 15:00 Sketsa 16:00 Show Imah 17:00 Reportase Sore 17:30 Insert Investigasi 18:15 Comedy Project 19:15 Tahan Tawa 20:00 Canda Bule 21:00 Bioskop TransTV 23:00 Kakek-Kakek Narsis 00:00 Bioskop TransTV

06.30 Apa Kabar Indonesia 09.30 Kabar Pasar Pagi 10.00 Coffee Break 11.30 Kisah Sukses UMKM 12.00 Live News Kabar Siang 13.30 Satu Jam lebih Dekat 14:30 Live News Kabar Pasar 15.00 Best Match La Liga 17.00 Live News KAbar Petang 19.30 Apa Kabar Indonesia Malam 21.00 Live News Kabar Malam 22.00 Live News KAbar Arena 23.30 The Legend

08:00 Oggy and The Cockroaches 08:30 Cerita Pagi 09:00 Doo Bee Doo 10:00 Dapoer Cobek 10:30 Obsesi 11:30 Hot Spot 12:00 Global Siang 12:30 Awas Ada Sule 13:30 Petualangan Panji 14:00 Masih Main Kata 15:00 100% Ampuh 16.00 Fokus Selebriti 16:30 Spongebob Squarepants 18:30 Big Movies 21:00 Big Movies 23:00 Big Movies

07:30 Selebrita Pagi 08:00 Gak Nyangka 08:30 Ups Salah 09:00 Mendadak Jutawan 09:30 Spotlite 10:30 Warna 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-Citaku 14:00 Dunia Binatang 14:30 Koki Cilik 15:00 Brownies 16:00 Jejak Petualang 16:30 Redaksi Sore 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Jam Malam 00:00 Mata Lelaki 00:30 Sport7 Malam **m31/G

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Musisi Keluhkan Maraknya Ameesha Patel Berperan Sebagai Pembajakan Karya Musik Wanita Penggoda Sejumlah musisi mengeluhkan masih maraknya aksi pembajakan karya musik sehingga membuat mereka seakan tidak diakui dengan karyanya.

Gabby bersama Om Ben

Gabby Munthe Rekaman SKOM Gabriella Putri Dear Munthe menjuarai ragam perlombaan plus ajakan rekaman — setelah lolos audisi Semua Karena Om Ben (SKOM) ditayangkan ANTv diproduseri Nagaswara. Padahal, ketika dinyatakan lolos dan berhak mewakili Medan ke Jakarta, sang ibu, Sanita Nainggolan, sedang menanti persalinan hingga siswi Kls 6 SD Bethany Jl Kapitan Purba 1 itu harus didampingi papanya, Aipda Effendy Iswanto Munthe berdinas di Ditlantas Poldasu. Agustus 2012, Gabby memasuki hari-hari sibuk karena harus kembali ke Jakarta untuk rekaman plus mengisi festival di Jakarta. Sebelumnya, Gabby mendulang prestasi mulai dari model, puisi, pidato bahasa Inggris hingga kesenian lain, tapi karena memiliki talenta lebih diarahkan Amri di Kensington Studio Medan dalam asuhan Kensington Creative Management — anak sulung dari 4 bersaudara itu fokus ke olah vokal. Prestasi terakhir Gabby adalah menjadi remaja cilik, satusatunya siswa sekolah dasar di SKOM. “Disebabkan tawaran dari Jakarta dan efektivitas waktu, Gabby sedang dipikirkan hijrah ke Jakarta,” ujar ibunya di kediaman Perumahan Milala Jl Jamin Ginting Medan, Kamis, (12/7). “Usai rekaman SKOM di ANTv, Gabby fokus di sekolahnya. Selama ini, sejak bersekolah terus menjadi juara umum,” tambah Sanita Nainggolan. Dari prestasi diganjar hadiah — di antaranya juara umum April Ceria Bethany, juara model BNI dan Toyota — Gabby pernah sampai ke Istana Wakil Presiden lewat jawara di Jagoan Cerdas Indonesia 2011 di Jakarta. Saat tampil dan berlaga dengan para jawara seluruh Indonesia, Gabby disemangati Menteri Peranan Wanita dan Perlindungan Anak Linda Agum Gumelar, berhasil menunjukkan prestasinya dalam bidang fashion show menampilkan busana etnik Batak Toba Modern.(rel/m19)


PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188


Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

KURSIPANGKASMURAHDIJUAL Kursi 5 buah + Kaca cermin Uk. kaca 7x3m, Hrg 12 Jt/nego Hub. 0813.6084.5333

Anda Butuh Perabot Jepara Asli?


Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243



“Aksi pembajakan masih sangat marak di Indonesia. Lagu dari musisi, dibajak yang angkanya bisa sampai 97 persen, sementara sisanya yang asli beredar,” kata vokalis grup musik Seventeen Riefian Fajarsyah ditemui dalam acara temu wartawan di sebuah hotel Kota Kediri, Jawa Timur, Jumat. Sebagai musisi, pihaknya mengaku sangat resah dengan maraknya aksi pembajakan karya musik. Para personel di grup musik seakan tidak dihargai karyanya. Bukan hanya menderita kerugian berupa materi tetapi juga mental. Ia mengatakan, saat ini grup musik cukup terbantu dengan adanya nada sambung pribadi

(NSP/RBT). Hasil karya para musisi lebih banyak dihargai dan mereka benar-benar mendapatkan haknya. Namun, dia juga mengaku agak resah dengan adanya regu-lasi baru. Pemerintah melalui Badan Regulasi Telekomunikasi Indonesia (BRTI) pada 18 Okto-ber 2011 memang menghenti-kan penawaran konten melalui pesan singkat/pop screen/ voice broadcast dan “deaktiviasi” semua layanan premium seperti SMS, MMS, nada dering, gemas dan wallpaper. Semua bisnis penyedia layanan tersebut saat ini seakan tiarap. Alasan pemerintah memang masuk akal. Selama ini beberapa penyedia konten melakukan penyedotan pulsa pada pelanggan, terlebih lagi mereka harus kehilangan pulsa yang nominalnya cukup besar, per bulan bisa mencapai Rp20 ribu. Walaupun sampai saat ini kasus tersebut belum jelas, Riefian mengaku masih

terbantu. Ia dengan temantemannya masih mendapatkan kesempatan untuk bisa tampil dan menyanyi dengan “off air”. “Kami masih beruntung, masih bisa tampil, walaupun off air. Saat ini, kami juga sedang fokus untuk menggarap album baru,” kata pria yang akrab disapa Ifan ini. Tentang album baru, dia enggan untuk mengungkapkan detailnya. Ia hanya mengatakan isialbumituadalahsejumlahsingle lama.Untukyangbarudiantaranya ada lagu tentang religi, salah satu temanya adalah tentang pengorbanan seorang ayah. Seventeen merupakan sebuah grup musik pop asal Indonesia kini berdomisili di Jakarta. Grup musik ini dibentuk pada 1999 beranggota band Bani (bass), Yudhi (gitar), Herman (gitar), Andi (drum) dan Ifan (vokal). Hingga saat ini, mereka telah merilis empat album, yaitu Bintang Terpilih (1999), Sweet Seventeen (2005), Lelaki Hebat (2008) dan Dunia Yang Indah (2011). (ant)


Ice Age: Continental Drift Paling Top Di Dunia FilmIceAge:ContinentalDrift diputar di 9.505 bioskop di Amerika Serikat dan Kanada termasuk di 4.200 bioskop dilengkapi fasilitas tiga dimensi meraup keuntungan 78 juta dolar AS untuk meraih ratarata 8.206 dolar persitus. Peringkat kedua ditempati film blockbuster seri keempat The Amazing Spider-Man menjadi film box-office di seluruh dunia dengan mengumpulkan keuntungan 2,5 juta dolar. Film Sony ini diputar pada 6.068 situs hanya di 13 tempat pemasaran meraih penghasilan 50,2 juta dolar pada akhir minggu dengan pendapatan rata-rata perlokasi 8.273 dolar. Continental Drift merupakan film paling top di dunia dan judul keempat film animasi komputer meraup pendapatan 1,918 miliar dolar di seluruh dunia lebih dari 10 tahun belakangan ini. Continental Drift menempati rangking satu pada awalawal pemutarannya ditambah lagi posisi terhormat diraihnya ketika dipasarkan di Inggris. Continental Drift di Amerika Latin dan Selatan begitu mengesankan. Film ini laris manis di Meksiko, Brazil, Argentina, Kolumbia, Peru, Amerika Tengah dan Chile. Pemutaran Continental Drift di Meksiko mencomot 13, 8 juta dolar dari 2.516 bioskop di negeri itu. Brazil meraih pendapatan 6,9 juta dolar diputar di 1.010 bioskop. Di Prancis sekuel animasi ini mencatat pendapatan terbesar tahun ini yaitu mencapai 11,8 juta dolar dipasarkan di 1.072 bioskop. Sementara di Australia me-

nyumbangkan 6,4 juta dolar diputar di 580 bioskop. Figur pembukaan Continental Drift mengindikasikan judul untuk total pendapatan secara global sebesar 500 juta dolar. Sementara film Ice Age: Dawn of the Dinosaurs terbit tahun 2009 mendapat 887,1 juta dolar. Produksi orijinal Ice Age diluncurkan tahun 2002 mendapatkan total keuntungan 381,1 juta dolar secara global yang sebahagian pendapatannya diraih dari pemutarannya di luar negeri yaitu sebesar 207 juta dolar. Film Ice Age 2: The Meltdown meningkat menjadi 649,5 juta dolar dengan pendapatan 457 juta dolar didapat dari pemutarannya di bioskop seluruh dunia. Continental Drift dibuka minggu lalu di 14 titik pemasaran termasuk Jerman dan Holland. The Amazing Spider-Man terkonsentrasi di kawasan Asia diputar di Korea Selatan menghasilkan 13,4 juta dolar diputar di 1.213 situs, Jepang mencomot 11,4 juta dolar dari 1.092 titik pemasaran dan India meraup 6 juta dolar diputar di 1.236 bioskop. Sedangkan peluncuran di Jerman mengumpulkan pendapatan 4,2 juta dolar diputar di 755 lokasi. Sementara sekuel SpiderMan memiliki pendapatan yang hampir sama baik secara domestik maupun global yaitu 417,9 juta dolar di seluruh dunia versus 403,7 dolar di AS dan Kanada. Spider-Man 2 dirilis tahun 2004 pendapatan globalnya meningkat menjadi 412,7 juta dolar, sedangkan pendapatan domestiknya 373,4

juta dolar. Penghasilan SpiderMan 3 diluncurkan tahun 2007 di seluruh dunia sebesar 555,3 juta dolar , sementara secara domestik mencomot 336,5 juta dolar. Sementara rilisan Universal Ted dibuka pada posisi nomor satu di AS dan Kanada akhir minggu lalu mendapatkan posisi nomor dua di Australia. Dalam tiga hari pemasarannya film komedi fantasi garapan sutradara SethMacFarlane dibintangiMark Wahlberg di-perkirakan meraup keuntungan 4,5 juta dolar hasil pemutaran di 199 bioskop. Film animasi DreamWorks Madgascar3: Europe’s Most Wanted sudah beredar empat pekan di seluruh dunia mendapatkan penghasilan 244,2 juta dolar pemutarannya secara global di 7.011 bioskop pada 44 lokasi pemasaran. Film Snow White and the Huntsman produksi Universal menempati posisi nomor 4 film-film box office akhir minggu lalu mencomot 15,5 juta dolar dari pemutarannya di 6000 bioskop di 60 titik pemasaran. Film aksi fantasi arahan sutradara Rupert Sanders dibintangi Kristen Stewart, Chris Hemsworth dan Charlize Theron mendapatkan penghasilan 189 juta dolar secara global. Film Brave dipasarkan melalui Disney mengkoleksi 6,7 juta dolar dan mendapatkan keuntungan total di seluruh dunia sebesar 26,8 juta dolar. Produksi Sony Men In Black III dimainkan di 4.355 bioskop di 80 titik pemasaran mengha-silkan 6,4 juta dolar keuntungan akhir pekan lalu. Nur/thr

Aktris Ameesha Patel sudah dua bulan belajar menjadi perokok profesional, namun sampai sekarang belum behasil. Karena itu ia terus berlatih menjadi perokok profesional. Kendati sudah lama berlatih merokok, ia tidak berubah menjadi pecandu rokok. Semuanya dilakukannya demi tuntutan peran sebagai seorang wanita penggoda dalam film barunya Paradise Street. “Saya telah mencoba menyalakan rokok selama dua bulan ini tapi gagal. Dalam film baru saya berperan sebagai wanita penggoda yang candu rokok. Agar terlihat terbiasa merokok di film saya berlatih dengan mulai menghisap sebatang rokok. Untuk menghayati peran, saya menonton film-film tahun enampuluhan khususnya mengenai karakter wanita penggoda memiliki kebiasaan merokok ” ujar Patel. Dalam film Bollywood Paradise Street, Patel berperan sebagai wanita jalanan. Meski menjadi wanita penggoda, karakter Patel dalam film itu sangat percaya diri dan ia sebenarnya menyesal dengan perbuatannya. Patel digambarkan sebagai seorang wanita muda yang polos dan baik. Dalam Paradise Street , ia tidak memakai make up,

Ameesha Patel/ tapi sering mengenakan kacamata hitam. “Saya memiliki 125 koleksi kacamata hitam mempunyai kebiasaan

membeli satu kacamata dalam setiap tiga hari. Saya senang memilih berbagai disain kacamata,” ujar Patel. Nur/





Pidanakan Pedagang Seenaknya Timbun & Naikkan Harga Sembako


enjelang tibanya bulan puasa, 1 Ramadhan 1433 H, harga kebutuhan pokok warga masyarakat bergerak naik. Tidak ada sembako yang tidak naik, mulai dari beras, minyak makan, gula, tepung terigu, ikan, daging dll. Walikota Medan Rahudman Harahap, bersama Tim Pengendali Inflasi Daerah (TPID) melakukan inspeksi mendadak (sidak) ke Pusat Pasar Medan kemarin, dan kita harapkan setelah sidak ada tindak lanjut dari Pemko Medan untuk melakukan operasi pasar di setiap kelurahan. Kalaupun dalam pemberitaan media disebutkan harga gula turun dari Rp14.000 per kg menjadi Rp12.500 per kg hal itu bisa terjadi karena sebelumnya sudah beberapa kali naik. Bisa juga penurunan itu karena pedagang tahu sedang dilakukan sidak, sehingga setelah sidak berlalu harga gula dan lain-lain kembali melambung. Hukum ekonomi memang berlaku. Permintaan bertambah banyak otomatis harga naik dan semakin naik, sehingga yang diperlukan adalah menambah banyak jumlah barang (sembako) dan menjualnya langsung ke kawasan yang membutuhkan, misalnya di kelurahan atau lapangan terbuka. Jika terlambat, dipastikan harga sembako semakin melambung di bulan Ramadhan nenti dan menjelang lebaran Idul Fitri pada minggu ketiga Agustus mendatang. Untuk diketahui bahwa masa mendekatnya bulan puasa dan lembaran merupakan momentum mengaut keuntungan sebanyaknya, atau diistilahkan panen besar buat para pedagang dan grosir. Sebab, di masa itulah jumlah dan kebutuhan konsumen meningkat sehingga pedagang bisa seenaknya menaikkan harga untuk mengejar keuntungan sebanyak-banyaknya. Setelah momentum itu berlalu, biasanya masih ada panen besar lainnya yaitu menjelang Tahun Baru. Buat sebagian pedagang ketiga momentum—puasa, Idul Fitri, dan Tahun Baru— merupakan ajang mengumpulkan keuntungan sebanyaknya, dan bagi pedagang yang masih belum punya kios hasil keuntungannya itu bisa membeli kios baru. Bagi pedagang yang belum mampu membeli kios keuntungan setahun tiga kali itu bisa dipergunakan untuk memperpanjang sewa kios/toko dan memenuhi kebutuhan keluarga, seperti membayar biaya pendidikan dll. Kalau menurut Walikota, sidak ini dilakukan untuk dapat mengetahui harga kebutuhan pokok di pasar saat ini, sebenarnya hal Intisari itu tidak diperlukan sekali. Jangan sampai pasar murah yang digelar Pemko Medan harganya hanya beda tipis dengan pasar modern Pemko Medan harus dan tradisional. Pemko Medan dan juga Pemko Pemkab se-Sumut harusnya bisa memmerealisasikan rencana dan bantu warga masyarakatnya dengan mengmembuka 151 titik pasar gelar pasar murah dan harganya benar-benar Kalau di pasaran harga gula Rp12.500 murah sebelum harga murah. per kg, di pasar murah yang digelar harganya sembako menggila harus di bawah Rp10.000. Begitu juga dengan jenis-jenis kebutuhan pokok lainnya. Intinya, jangan sampai masyarakat resah menghadapi bulan puasa dengan kenaikan harga sembako yang tidak terkendalikan atau gilagilaan. Pemerintah pusat dan daerah bisa menindak pedagang yang seenaknya menimbun barang agar terjadi kenaikan harga, begitu juga pedagang yang seenaknya menaikkan harga dan mengurangi takaran serta melakukan kecurangan-kecurangan lainnya. Mereka bisa dipidanakan. Termasuk menjual barang-barang yang sudah kadaluarsa sehingga membahayakan kesehatan masyarakat. Untuk itulah pihak terkait perlu melakukan pemantauan terkait kualitas barang yang dijual termasuk harganya. Dan bagi konsumen yang menemukan produk rusak dan dirugikan oleh pedagang bisa melapor kepada lembaga konsumen atau pihak berwajib agar kasusnya diproses sesuai hukum yang berlaku. Jika aparat terkait tegas menjalankan tugasnya diyakini harga sembako tidak akan naik secara gila-gilaan. Kalau kenaikannya hanya di bawah 5 persen pastilah masyarakat tidak akan resah. Hal itu termasuk normal karena memang kondisinya harus naik di masa puasa, Idul Fitri, dan Tahun Baru. Pemko Medan diminta segera merealisasikan rencana membuka 151 titik pasar murah di Kota Medan. Setelah berjalan nanti perlu dipantau, apakah mereka benarbenar menjual sembako dengan harga murah. Selama ini ada klaim masyarakat, takaran sembakonya sengaja dikurangi. Harga beras atau gula normalnya Rp12.0000 per kg di pasar tradisional di pasar murah bisa di bawah Rp10.000 per kg namun takarannya tak sampai 1 kg (hanya 8 ons saja). Akal-akalan seperti itu harus dicegah! Satu hal yang sangat penting diperhatikan adalah jumlah barang harus tersedia. Jangan sampai stok sembakonya kurang. Bagi sebagian konsumen berapa pun harganya tidak masalah asalkan barangnya tersedia, mudah diperoleh, namun bagi mayoritas konsumen lainnya, dari kalangan bawah, jenis-jenis barangnya mudah didapat dan harganya jangan sampai melonjak. Pemerintah maupun Depag dan MUI juga bisa mengimbau masyarakat, khususnya umat Islam untuk tidak resah dan mengubah pola hidupnya. Puasa dijalankan dengan penuh khidmat, menahan diri dari hawa nafsu, memperbanyak amalan, bukan dengan menambah biaya pengeluaran keluarga. Harusnya konsumsi di bulan puasa tidak lebih tinggi dari hari biasa karena di siang hari umat Islam berpuasa. Menghadapi lebaran pun tidak perlu dengan ‘’jor-joran’’ sehingga semuanya harus diganti baru. Lakukan pola hidup sederhana sesuai dengan ajaran Rasulullah SAW dan syariat Islam (Al-Quran).+

Oleh Prof Dr Ir Widyo Nugroho Sulasdi & Prof Safwan Hadi, Ph.D Pemerintah dalam melaksanakan akreditasi nasional hingga saat ini hanya mengakui BadanAkreditasi Nasional PerguruanTinggi (BAN-PT) sebagai satu-satunya badan akreditasi.


alam Pembukaan UUD 1945 pada alinea ke-3 secara sangat gamblang dinyatakan bahwa Pemerintah Negara Indonesia mempunyai kewajiban yang harus mampu diwujudkan antara lain melindungi segenap bangsa Indonesia dan seluruh tumpah darah Indonesia dan untuk memajukan kesejahteraan umum, mencerdaskan kehidupan bangsa, dan ikut melaksanakan ketertiban dunia. Dalam upaya mewujudkan kecerdasan bangsa yang dilakukan melalui pendidikan, telah diundangkan UU No.20 Tahun 2003 tentang Sistem Pendidikan Nasional yang mempunyai sebanyak 22 bab dan sebanyak 77 pasal. Berikut ini dikutipkan isi dari beberapa pasal yang terkait erat dengan judul tulisan di atas: (1) Setiap warga negara mempunyai hak yang sama untuk memperoleh pendidikan yang bermutu. (2) Standar nasional pendidikan terdiri atas standar isi, proses, kompetensi lulusan, tenaga kependidikan, sarana dan prasarana, pengelolaan, pembiayaan, dan penilaian pendidikan yang harus ditingkatkan secara berencana dan berkala. (3) Pemerintah menentukan kebijakan nasional dan standar nasional pendidikan untuk menjamin mutu pendidikan nasional. (4) Peran serta masyarakat dalam pendidikan meliputi peran serta perseorangan, kelompok, keluarga, organisasi profesi, pengusaha, dan organisasi kemasyarakatan dalam penyelenggaraan dan pengendalian mutu pelayanan pendidikan.Berkaitan dengan butir (4), masyarakat dapat mendirikan Yayasan yang selanjutnya dapat mendirikan Perguruan Tinggi, yang lazim disebut Perguruan Tinggi Swasta (PTS). Sekarang ini di Indonesia terdapat sekitar 3600 PTS. Kebalikan dari PTS, pemerintah mendirikan Perguruan Tinggi Negeri (PTN). Di Indonesia terdapat sekitar 93 PTN. Berkaitan dengan PTN dan PTS ini realitasnya terdapat perbedaan yang tampak nyata dalam konteks pengelolaan dan penyelenggaraannya. Perguruan Tinggi yang dikelola pemerintah, sudah barang tentu halhal yang berkaitan dengan pengelolaan dan penyelenggaraan pendidikan terkontrol dengan baik. Dana penyelenggaraan pendidikannya berasal dari pemerintah, demikian juga para penyelenggara satuan pendidikannya merupakan PNS (Pegawai Negeri Sipil), yang relatif lebih mudah dilakukan pengawasan terhadapnya. PTS di Indonesia dimiliki yayasan. Di dalam yayasan ini mempunyai struktur organisasi yang terdiri atas

Faks 061 4510025

Facebook Smswaspada

+6285276926560 Maju terus pak Gatot visi dan misi bapak dah ter bukti rakyat tidak bodoh rumh sekolah sudah bapak bangun rakyat tidak sakit .rumh sakit dah di buka puskemas 24 buka rakyat tidak miskin dah terbukti org dah pake kerta brompit tiap rmh ada 4 hanya 1 saja yg tinggal rakyat tidak lapar dari atok lb ktoromg di pondok nan langang tmbg. +62811632744 Yth. Redaksi Waspada InsyaAllah Kami termasuk dalam kelompok batas porsi aman CALHAJ 2012, Sudilah kiranya pada setiap terbitan hari jum’at memuat “seluk beluk kebutuhan haji/tip/dll” trimakasih. +6287891595934 Mengapa Sebagian Orang Yg Di Pilih Rakyat Sebagai Pemimpinnya, Menjadikan Orangorang Yg Memilihnya Itu Sebagai Budak Untk Menghasilkan Keuntngan Bagi Pemimpin Itu,bukan Menjadi Mensejahtrakan Masyarakat Tersebut. Be The Best Of Leader. +6285297057749 Kalau kita lihat berita-berita Aceh di hr Waspada ini, banyak sekali pembangunan yang tidak beres, seperti jalan dan jembatan serta bangunan sekolah, memang kalau jalan propinsi okelah, tertipu kita melihatnya, hebat sekali Aceh ini, tapi coba anda masuk kepedalaman anda akan tercengang. tertipu dia. yang mewah itu mobil dinasnya dan rumah pejabatnya. +6281265738670 Pak walikota tolong kami orang miskin PBB jangan naik 100 persen kalau bisa bantu lah kami pak nggak bayar. +6282162990203 Semua berebut uang, harta dan jabatan, calon pemimpin di angkat dan di pilih dari golongan yg kaya, tanpa meneliti kelayakan utama sbg seorang pemimpin yaitu, adil, jujur dan dermawan, tanpa 3 kriteria ini , jgn berharap, negeri ini mencapai cita2 nya selain menuju kehancuran. +6281990379228 Sbd Rsul: Bila nyawa telah berpisah dari jasad, maka dipanggil dari langit dengan 3 panggiln: Hai anak Adam, apakah engkau telah meninggalkan dunia, atau dunia telah meniggalkan engkau?. Apakah engkau yang telah mengumpulkan dunia, atau dunia yang telah mengumpulkan engkau ?. Apakah engkau telah membunuh dunia, atau dunia yang telah membunuh engkau. Bila mayat telah diletakkan ditempat pemandian, maka datang panggilan dari langit dengan 3 panggilan: Hai anak Adam, dimana tubuhmu yang kuat, apa yang membuatmu lemah ?. Dimana lidahmu yang fasih, apa yang mendiamkanmu? Dimana telingamu yang dapat mendengar, apa yang menulikanmu ?. Dimana teman2mu yang setia, mengapa ia melepaskanmu ?. Apa bila mayat telah diletakkan dalam kafan, maka datang panggilan dari langit dengan 3 panggilan: Hai anak Adam, bahagia engkau, bila ridha Allah menyertaimu, dan celaka engkau, bila murkaNYA menyertaimu. Hai anak Adam, bahagialah engkau.(.....) +6282165293457 JANGANLAH MEMBUAT KERUSAKAN DI MUKA BUMI,.Allah telah memberikan rezeki kepada kita melimpah ruah dari segala tempat,tetapi mereka memungkiri nikmat Allah(tidak bersyukur).maka Allah menimpakan kepada mereka bahaya kelaparan, dan ketakutan.di sebabkan apa yg selalu mereka perbuat.

Pembina, Pengurus, dan Pengawas. Pada dasarnya Yayasan ini pemiliknya terbagi atas dua macam, yakni dimiliki oleh keluarga atau komunitas (seperti paguyuban kebudayaan, paguyuban keagamaan). Dalam perjalanan PTS ini, sering kali dihadapkan kepada konflik internal, yang jenis konfliknya antara lain : (a) konflik antara Pengurus dan Rektorat, (b) konflik antara antar pemilik Yayasan. Konflik antara pengurus dan rektorat senantiasa bersifat klasik yang berkaitan dengan pengelola keuangan dan intervensi Pengurus yang masuk ke dalam ranah pengelolaan dan penyelenggaraan pendidikan. Dapat dikatakan masih jarang pengurus memperhatikan mutu pendidikan. Pemilik yayasan ini banyak yang berorientasi pada bisnis (manajemen proyek) dan tidak paham arti perguruan tinggi yang di dalamnya terdapat budaya akademik dan manajemen pendidikan yang sangat berbeda sifatnya dibandingkan terhadap manajemen proyek yang sangat kuat berorientasi keuntungan. Pengurus berkeinginan mendapatkan keuntungan dari aspek finansial dari berbagai pendapatan perguruan tinggi yang dipunyainya. Kewenangan yang mestinya berada di tangan rektor dalam pengelolaan dan penyelenggaraan pendidikan diintervensi pengurus. Penetapan pembantu rektor, dekan, pembantu dekan bahkan ketua prodipun diintervensi pengurus. Seringkali yang berkaitan dengan hal tersebut, muncul pandangan bahwa pengurus hanya mendasarkan dirinya pada pertimbangan sempit, yaitu terjebak pada aspek kekerabatan dibandingkan terhadap pertimbangan aspek kualitas sumber daya insani. Aspek kekerabatan ini bertujuan memperkuat posisi, namun sangat jauh dari keinginan membangun sistem pengelolaan dan penyelenggaraan pendidikan berbasis peningkatan mutu yang berkelanjutan. Di lingkungan PTS masih terdapat jenis konflik yang lain, yakni konflik antara pemilik Yayasan yang tergolong sangat jauh menyimpang dari visi dan misi didirikan Perguruan Tinggi pemiliknya. Sangat tidak mungkin satu perguruan tinggi dikelola oleh dua Yayasan. Logika yang sederhana sekalipun akan mengatakan bahwa yayasan yang sah hanya satu. Adapun kata sah ini mempunyai arti menurut hukum (undang-undang, peraturan) yang berlaku. Bila dalam konflik ini, salah satu yayasan sudah dinyatakan tidak sah menurut hukum, mestinya harus ada tanggung jawab yang sangat besar untuk dikembalikan seperti keadaan semula. Tidak berdiri di atas kesengsa-

raan para mahasiswa yang akan dialaminya sesuai dengan perjalanan waktu. BAN-PT Pemerintah dalam melaksanakan akreditasi nasional hingga saat ini hanya mengakui Badan Akreditasi Nasional Perguruan Tinggi (BAN-PT) sebagai satu-satunya badan akreditasi. Tugas utama BAN-PT ini adalah meningkatkan mutu pendidikan tinggi, memperkenalkan serta menyebarluaskan “Paradigma Baru dalam Pengelolaan Pendidikan Tinggi“, dan meningkatkan relevansi, atmosfer akademik, pengelolaan institusi, efisiensi dan keberlanjutan pendidikan tinggi. BAN yang menilai mutu perguruan tinggi baik perguruan tinggi negeri, kedinasan, keagamaan, dan swasta. Berkaitan akreditasi nasional bagi PTS harus dicermati, yakni PTS seperti apa yang akan diakreditasi oleh BAN-PT. Untuk memahami hal ini sebagai titik tolak jawabannya adalah mengacu kepada UU No.28 Tahun 2004. Dalam undang-undang ini disebutkan “Yayasan memperoleh status badan hukum setelah akta pendirian Yayasan sebagaimana dimaksud dalam pasal 9 ayat (2) memperoleh pengesahan dari Menteri “. PTS adalah perguruan tinggi yang didirikan yayasan. Dalam hal ini tentu saja yayasan tersebut adalah yayasan sah sesuai perundang-undangan yang berlaku. Berkaitan dengan fenomena tersebut dapat ditempatkan dalam konteks persoalan UISU yang sah dan yang tidak sah. Pada tanggal 2 April 2012, Koordinator Koordinasi Perguruan Tinggi Swasta Wilayah-I, yaitu Prof.Ir. Mochammed Nawawiy Loebis, M.Phil, Ph.D menulis surat kepada BAN-PT bernomor : 202/K1.2.1/PS/2012. Isinya rekomendasi bagi UISU sebanyak 21 Program Studi untuk direakreditasi seandainya tidak bertentangan dengan ketentuan yang berlaku. Surat Koordinator Kopertis tersebut jika dicermati menggunakan ilmu logika jelas membuka peluang untuk masuk ke dalam ranah penafisiran pada kalimat, yaitu “seandainya tidak bertentangan dengan ketentuan yang berlaku“. Sesungguhnya jika menggunakan pendekatan logika genetis diyakini bahwa Koordinator mustahil tidak mengetahui keberadaan: (a) Putusan Mahkamah Agung RI Nomor 150/K/ TUN/2008 tanggal 16 Pebruari 2009; (b) Surat Direktur Jenderal Administrasi Hukum Umum, Departemen Hukum dan Hak Asasi Manusia Nomor C.HT.01-14 tanggal 3 April 2007 perihal Penegasan Yayasan UISU yang sah; (c) Surat Direktur Jenderal Administrasi Hukum Umum, Departemen Hukum dan Hak Asasi Manusia Nomor AHUAH.01.08-418 tanggal 16 Juli 2009 perihal Yayasan UISU. Jika mengacu pada tugas pokok dan fungsi Kopertis yang sejak tahun 1975 peran dan fungsinya sangat tampak berkembang sejalan dengan terbitnya SK Mendikbud No.062/0/1982,

No.0135/0/1999 dan SK.Mendiknas No.184/U/2001, yang menggambarkan Kopertis perpanjangan tangan Ditjen Dikti di wilayah untuk melaksanakan pengawasan, pengendalian dan pembinaan, yang mengacu pada paradigma sebagai berikut: kualitas yang berkelanjutan, otonomi perguruan tinggi, akuntabilitas, akreditasi, evaluasi diri. Selain hal tersebut PTS diminta untuk melaksanakan tiga strategi dasar dalam melaksanakan peran lembaga pendidikan tinggi, yakni daya saing bangsa, otonomi perguruan tinggi dan organisasi yang sehat, maka Koordinator Kopertis mestinya telah mengetahui secara hukum yang mana UISU yang sah dan UISU yang tidak sah. Lepas dari itu semua, surat implisit dari Koordinator Kopertis ini justru menjadi pembuka pintu kejelasan. Sikap BAN-PT Sangat penting untuk diapresiasi yang tinggi kepada BAN-PT yang sangat cerdas ketika membaca surat dari Koordinator Kopertis. Langkah yang dilakukan BAN-PT adalah melalui surat tanggal 20 April 2012 ditujukan kepada Dirjen Dikti Kemdikbud meminta klarifikasi yang mana yang sah menurut hukum antara UISU Kampus VI, Jl.Karya Bakti No.34 Pangkalan Masyhur-Medan dengan pimpinan Dr.Ir. Mhd.Asaad, M.Si dan UISU Jl.SM Raja Medan dengan pimpinan Prof Zulkarnain Lubis. Berkenaan permohonan klarifikasi BAN-PT kepada Dirjen Dikti, melalui surat bernomor: 326/E2.2/2012, Direktur Kelembagaan dan Kerja Sama Dirjen Dikti menyatakan bahwa Yayasan UISU dengan Ketua Umum, Prof.Dr. Usman Pelly, MA adalah Yayasan yang sah. Setelah mendapatkan klarifikasi dari Ditjen Dikti, BAN-PT melalui surat bernomor : 929/BAN-PT/LL/2012 telah memberitahu kepada Ketua Yayasan UISU yang berkedudukan di Kampus VI Jl.Karya Bakti No.34, Kel. P.Masyhur Kec.Medan Johor, MedanIndonesia 20143 dan Kampus UISU, Jl.SM. Raja Medan 20217 bahwa UISU yang akan diproses akreditasinya adalah UISU yang diselenggarakan oleh Yayasan UISU dengan Ketua Prof.DR. Usman Pelly, MA. Penutup Penyelesain konflik Yayasan UISU sesungguhnya akan terselesaikan dengan baik sepanjang mampu memahami secara mendalam hakekat dari Visi UISU yang berbunyi “UISU menjadi Perguruan Tinggi yang Islami, andal, teruji dan bermartabat mulia dicintai oleh masyarakat dan diridhoi Allah SWT. Sungguh sangat tidak mudah untuk menjadi Islami dalam praktik keseharian”. Penulis: Widyo Nugroho Sulasdi adalah Guru Besar ITB , Tim Pengembang Pendidikan Karakter Ditjen Dikti; Safwan Hadi adalah Guru Besar ITB Staf Ahli Rektor UISU.

Memanusiakan Anak Anda


WASPADA Senin 16 Juli 2012

Oleh Nana Raihana A Tak urung juga diskusi dan advokasi tentang hak anak selesai digagas ahli, pakar, dan penggiat dunia anak. Terhitung dari psikolog ternama seperti Kak Seto,penggiat Komnas Perlindungan Anak, sampai dengan pejabat eselon I Kemendikbud bersoal tentang pendidikan anak usia dini (PAUD) dan kontraproduktifnya materi Calistung (Baca Tulis Hitung).


epuluh tahun terakhir Calistung menjadi materi primadona para pemain lembaga pendidikan anak yakni pada tingkat Kelompok Bermain dan Taman Kanak-Kanak, hal ini menjadi pemicu berbondong-bondongnya para orang tua menyeleksi TK dan PAUD yang menawarkan paket Calistung tersebut. Alih-alih pada proses penerimaanmuridditingkatSekolahDasar (SD), uji atau tes Calistung menjadi prasyarat mutlak untuk penerimaan, implikasinya penerimaan murid baru tidak ditinjaulagidarikelayakanusiaanakseperti tertera di dalam PP 17Tahun 2010 tentang Pengelolaan dan Penyelenggaraan Pendidikan. Lambat laun ini telah menciptakan bom waktu yang siap meledak kapanpun. Perilakumenyimpangdarianakpadamasa kanak-kanak, pra remaja, remaja, bahkan pra matured (jelang dewasa) kerap terjadi, dicemasi,dandiperbincangi.Semuaakhirnya sepakat pada materi Calistung dan seabrek beban pendidikan dan keterampilanmenyebabkananakmenjaditertekan dan berkembang bukan sebagai manusia sesungguhnya. Anak adalah robot yang siap disetir oleh orang tua yang haus akan pujiandanrasabangga,anakdipaksauntuk melupakanpetakumpet,larijongkok,jolok jambu, congklang, ataupun permainan lainnya. Kesemuanya harus beralih ke les matematika,matapelajaran,piano,renang dan basket. Ditambah lagi dengan bebanbeban yang diterapkan oleh sekolah berlabel ”favorit/unggulan” yang mewajibkan muridnya meraih capaian nilai diatas 75 untuk semua mata pelajaran. Para orang tua galau kalau anaknya yang berumur enam tahun belum juga bisa membaca dan menulis, tapi mereka

tidak galau ketika anaknya berbicara seenaknyakepadaorangtuanyaatauorang yang lebih tua. Orang tua biasanya merasa rendah diri jika anaknya tadi tidak bisa menghitung dengan baik. Namun mereka merasa baik-baik saja ketika anaknya tersebut mulai mencoba berbohong. Parahnya lagi, orang tua akan bangga jika anak mereka bisa cas cis cus berbahasa asing sebut saja Inggris, namun mereka tidak peduli jika anak tidak mengerti bertutursantun dengan bahasa bangsanya ataupun merasa malu untuk memperkenalkan bahasa ibu atau bahasa daerah. Alhasil anak tersebut akan tumbuh ibarat sebatang pohon mangga yang berdaun durian, namun berbuah kelapa, satupun tidak ada yang utuh dan penuh, tumbuh tanpa karakter dan identitas yang solid. Teori pengajaran dan pembelajaran bahasa secara jelas menguraikan proses pemerolehan bahasa adalah awal dari segala hal informasi yang akan didapat seorang anak kelak, jika lolos pada tahap pemerolehan bahasa (language acquistion) maka selamatlah anak tersebut. Dari ujaran anak mengenal sebutan mama, papa, mi-

num, dll, serta mengenal sinyal emosi dari orang sekitarnya yang bermuara pada etika, nilai dan moral. Sebagai ilustrasi, ketika seorang bayi manusia lahir, yang pertama didengar oleh orang sekitarnya adalah bunyi atau suara tangisan, seolah tangisan itu memberi tahu orang-orang bahwa ”aku telah hadir, aku kedinginan, dan sayangi aku”, kemudian respons pertama yang pertama keluar dari orangorang sekitarnya adalah ”cup..cup sayang... bayi yang sehat atau cantik!”. Fase selanjutnya, orang tua dan orangorang sekitarnya akan semakin sering mengajak bayi tersebut berbicara, maka tersenyum, tertawa, bahkan menangislah dia, atau sesekali dia merespon dengan suara-suara yang dianggap orang dewasa tanpa makna namun ternyata itulah ujarannya. Dari ilustrasi tersebut nyatalah bahwa manusia memperoleh stimulus dari lingkungan sekitarnya dari mendengar atau menyimak, dan bersuaraatau berbicara bukan dari membaca apalagi menghitung. Semakin tinggi intensitas orang dewasa mengajak bayi manusia ”mengobrol” maka makincepatlahdia memahami, dan berkembanglahselsel pemicu kecerdasannya. Membiarkan seoranganakmanusia berkembang sesuai usia dan fase yang layak untuknya adalah sebuah langkah bijak dan arif bagi orang tua. Jika anak harus merangkak pada usia 9 bulan dan bukan 7 bulan, kemudian bisa berdiri pada usia 11 bulan dan bukan 10 bulan, biarkanlah itu terjadi. Sebab, anak akan menemukan kesiapan dan keterampilan dari dalam dirinya tanpa harus didikte orang lain termasuk orang tua. Ini adalah bentuk penghargaan orang tua terhadap anak, sangat mungkin dia akan menghargai orang dewasa yang telah dengan tulus memanusiakannya kelak.

Jika kupu-kupu dewasa bersabar dan bersahabat menanti calon kupu-kupu menjalanifasepanjangmetamorfosisyakni dari telur, ulat kecil, ulat dewasa, kepompong dan menjadi kupu-kupu sejati, sebab tidak pernah ada kupu-kupu dewasa berusahamerobekcangkangkepompongagar si ulat dewasa segera menjadi kupu-kupu. Maka manusia dewasapun harus demikian.Orangtua,pendidik,danpelakubisnis pendidikansertapemerintahberkewajiban untuktugasmuliainiyaknimemanusiakan anak kita semua. Penulis adalah Peneliti Di Balai Bahasa Medan Dan Seorang Ibu

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Cagubsu harus berani lakukan inovasi - Paling tidak jalan Tol bertambah * Aturan dua putaran Pilkada DKI digugat - Bagaimana dengan Sumut? * Bupati Langkat: Jangan lelah layani masyarakat - Walaupun tak dapat parcel,he...he...he


D Wak


WASPADA Senin 16 Juli 2012

Masa Depan Indonesia

Lalulintas Kota Medan Saya adalah salah seorang warga Kota Medan yang kesehariannya sering menggunakan jalan,melalui surat pembaca ini saya ingin menyampaikan bahwa akibat dari seringnya terjebak kemacetan sehingga membuat kebutuhan saya terhadap BBM menjadi meningkat, belum lagi waktu saya yang banyak terbuang dijalanan membuat produktifitas saya menjadi menurun. Saya ingin menyampaikan bahwa lalulintas di Kota Medan ini banyak terjadi macet karena beberapa hal,yaitu antara lain adalah banyaknya Traffic Light yang tidak berfungsi,penanganan parkir yang kurang baik dan pengaturan arus di beberapa ruas jalan yang belum pas, serta pengguna jalan yang belum menyadari berlalulintas dengan baik sehingga terjadilah banyak kemacetan disana-sini. Karena hal tersebut saya ingin menyarankan kepada PakWali agar memerintahkan dinas terkait untuk memfungsikan kembali traffic light di beberapa persimpangan seperti di Jalan gaharu,simpangamplas,JalanSutomosimpangBambudanbeberapasimpanglainnya.Penataan parkirdiJalanCirebon,JalanPerniagaandanbeberapajalurjalanyanglainuntukdapatditertibkan termasuk Jalan Suprapto. Demikian permohonan saya sampaikan semoga Kota Medan semakin lebih tertata baik dihari-hari kedepan. Riyanto Medan

Kompetensi Siswa Konon dilelang tengkorak manusia dari seluruh dunia. Ternyata tengkorak orang Indonesia terjual dengan harga tertinggi. Para hadirin heran, kenapa bukan tengkorak orang Eropa yang mahal.Apa sih kehebatan tengkorak orang Indonesia.Seorang wartawan bertanya kepada pialang yang membeli tengkorak tersebut.Jawabannya masuk akal.Katanya,karena tengkorak orang Indoonesia masih orisinil, jarang dipakai. Anekdot di atas memberikan pesan bahwa orang Indonenesia semasa hidupnya jarang menggunakan otaknya. Tak mau capek mikir. Laksanakan saja berdasarkan contoh. Berbeda dengan tengkorak orang Eropa yang sudah kosong karena terlalu sering dipakai di masa hidupnya. Selalu mencipta,merancang,menemukan dll.Sang pialang tentu membeli barang yang masih orisinil dibanding barang yang sudah dipakai lama, aus dan rusak. Orang Indonesia jarang mencipta. Hal ini dapat kita lihat melalui pendidikan. Ternyata pembelajarandisekolahSMPdanSMAdominanteoridaripadaperaktek.Jaranggurumengadakan penelitian. Karena tak ada reward yang didapat. Dari 40 orang guru satu sekolah paling hanya dua tiga orang yang melakukan penelitian atau peraktek dalam mengajar. Minus prakteik di sekolah disebabkan guru malas capek tanpa imbalan yang sepadan. Karena mengajar peraktek memerlukan energi lima kali dibanding mengajar teori. Hal ini diperburuk minimnya alat peraktek. Ratusan sekolah SMP dan SMA ternyata laboratorium perakteknya nyaris tak memiliki alat peraktek. Yang tersisa sudah tua, usang dan berkarat. Bagaimana dengan sekolah SMK. Memang di SMK lebih selalu peraktik dibanding SMA. Namun itu hanya SMK pavorit saja. Namun yang sebagian besar SMK belum memiliki alat peraktik yang sesuai dengan bidang studi. Bahkan satu komputer untuk sepuluh siswa. Satu siswa yang pegang alat audio visual, sedangkan yang lain hanya lihat doang. Kalaupun ada berita anak SMK buat mobil,itu hanya sepuluh dari seribu SMK yang terdapat diPulauJawa.JikaSMKMedanmampubuatkomputer,ituhanyaduadariseribuSMKdiSumatera Utara. Ternyata komputer anak Medan belum ada di pasaran. Ternyata mobil tak lulus uji emisi tak layak jalan. Anak SMK buat mobil dan komputer bagaikan ayam bertelur satu ribut sekampung. Menindaklanjuti hal tersebut maka kementerian Pendidikan harus aktif meningkatkan kompetensi siswa SMK. Tingkatkan perlengkapan praktik siswa di seluruh SMK. Dana BLSM yang rencana digulirkan alihkan ke SMK tersebut. Agar anak SMK mampu membuat juatan hanphon, laptop, kamera, televisi dan semua barang elektronik. Kita malu menjadi bangsa yang konsumtif, menjadi jajahan ekonomi bangsa lain.Semua harus beli. Sampai kapan kita menjadi konsumen terus. Berapa banyak belanja anak bangsa hanya untuk barang elektonik.Berapa keuntungan bangsa asing dalam penjualan sepedamotor dan mobil. Jika anak SMK mampu membuat handphone,laptop,barang elektronik dll.Mungkin harga jual dapat lebih murah karena kecilnya biaya transportasi. Karya anak SMK ini harus segera nangkring di toko, berseleweran di pasar Indonesia, dicintai anak bangsa. Pemerintah dapat mempercepat tumbuh kembang karya anak SMK dengan bantuan Permen,Perda atau Undangundang. Ayo..SMK bisa..! Nada Sukri Pane Guru SMA Negeri 16 Medan


Dedi Sahputra

Wilayah Kebetulan Dia muncul lagi. Seperti tahun lalu, menjelang puasa tahun ini muncul perdebatan awal Ramadhan. Ada di majlis-majlis, ba’da shalat, ada di ruang rapat, ada di warung-warung, ada pula di dunia maya. Semuanya seru-seru. Saya merasa semuanya terlibat dalam perdebatan. Ada yang nyaring ketika berbicara. Saya tidak tahu apakah memang bawaan lahirnya bersuara nyaring atau dia juga bergembira menyambut kehadiran bulan suci itu—atau malah sekedar menikmati berdebat. Kalau tanggal awal Ramadhan yang benar cuma satu, maka sudah pasti yang lain salah. Nah untuk mencari siapa yang salah inilah yang membuat perdebatan itu jadi panjang dan mengasyikkan. Maka kemudian ada yang memvonis, awal Ramadhan harus sama, seragam, kalau tidak, “awas”. Karena kebenaran itu esa seperti halnyaTuhan. Maka pokoknya harus seragam. Padaha soal seragam ini kita punya pengalaman. Negeri ini pernah serba seragam dan senada, seperti suara koor dipandu sang komponis.Semuanyatenang, damai dalam keseragaman itu—dan tiba-tiba negeri ini nyaris kolaps. Segala sesuatunya kemudian serba hubarhabir. Tapi ada juga yang mengajakmenerimaperbedaan. Sudah-lah.Lhawongcaranya sudah beda, ya hasilnya pun beda-lah.Biarinaja,yangpentingsalingmenghargai,begitu kira-kira ajakannya. Karena kalau cara menentukan awal Ramadhan itu domain-nya fiqh maka keragaman itu tak akan terhindarkan. Karena domain ini dekat dengan disiplin ilmunon-eksak yang mensyaratkan invalidasi dalam setiap hasilnya. Jadi kalau Anda menghitung-hitung dengan metode hisab maka ia akan menawarkan “kepastian” invalidasi di sana. Sama halnya ketika engkau men-rukyah dengan melihat wujud bulan dan menghitung derajat ketinggiannya, ini juga menyimpan invalidasi itu. Ini seperti membagi 10 ke dalam 3, maka hasilnya tak akan habis 3,33333333..................... Karena itulah hukumnya, ketetapan itu tak pernah berada di level 0,0000000... tetapi akan selalu ada ketidaktepatan di ujung sana. Akan selalu ada angka 1, 2, 3 dan sebagainya di ujung ekorangkanolitu—yangmenjadipenandamunculnya penyimpangan. Apa boleh buat, ini memang sudah levelnya manusia. Tapi memang tak mudah mengajak orang untuk sepakat, sama tak mudahnya mengajak orang untuk sekedar menerima perbedaan. *** Eksotisme shubuh itu selalu membuat saya terkagum-kagum. Suasana yang sejuk, satu-satu

orang yang lalu-lalang jadi lebih akrab ketimbang ketikahariberanjaksiang.Memperhatikanorang mulai membuka pintu, mengawali aktivitas, juga kesenangan yang misteri. Semua keindahan ini akan lebih nikmat jika disertai keluarga, pikirku.Tapi memang tak mudahmengajakoranglainmenikmatikesenangan eksklusif ini. Selalu saja ada alasan anak-ku untuk tidakmengikutiajakankusecarasukarela.“Ngantuk yah..,” katanya. Ketika kukisahkan ulang saat-saat indah jalan-jalan pagi shubuh—sambil mengenang apaapa yang kami temui—cuma aku sendiri yang terharu biru. Anak-anak itu bahkan menunjukkan respons polos yang menyakitkan: “Gak enak..,” kata mereka. Maka aku sungguh merasa tidak nyaman dengan situasi ini. Tapi bukan cuma aku yang begitu, karena mereka juga merasakan yang sama. Si kecil itu paling suka berselubung selimut di ranjang, “pesta bulan” katanya. “Ayah sini.., kita pesta bulan,” ajaknya. Di dalamselimutitusensasinya melayang-layang.Diaberteriak-teriak, sesekali berbisikbisik mengajak saya terus berinteraksi dengannya. Andatahu,inisekedarketerpaksaan saya mengikuti ajakannya.Celakanyadiaitu. “Ayah bangun..,” katanya sambil mendekatkan matanya ke mata saya— ketika saya ketiduran. Anda tentu bisa membayangkan kerepotannya. Ini baru si kecil, belum lagi kakak dan abangnya, juga ibunya, yang punya hobi beragam pula. Ini baru keluarga kecil kami, bayangkan betapa luasnya keragaman dalam hidup dalam payung sebuah negara itu. *** Kalau engkau melintas di tengah hujan, tibatiba petir yang menyambar sebatang pohon itu menimpakendaraanmu—dengancepatengkau akan mengatakan ini kebetulan. Lantas siapa yang mengatur kebetulan itu? AtauketikaPesawatMandalakebetulanjatuh di Padang Bulan, menimpa orang yang sedang santai di peraduannya. Kenapa bukan jatuh di Sipiongot atau di laut misalnya. Makna kata kebetulan ini sejatinya wujud yang menandakan kelemahan manusia merancang segala sesuatu, istilah Prancisnya Force Majeure (keadaan yang memaksa/kekuatan yang lebih besar). Kekuatan besar itulah kekuatanTuhan yang “memaksa” segala sesuatu tunduk patuh padaNya. Maka keragaman dalam tataran fiqh yang non eksak itu adalah sebuah desain yang sudah jadi. Maka kalaupun engkau benar dalam metodemu ketika menebak sesuatu, wilayahmu tetap pada “kebetulan”.(Vol.329, 13/7/2012)

Kolom foliopini dapat juga diakses melalui


Oleh M Ridwan Lubis Tesis kedua BJ Habibie yang menarik dicermati khususnya untuk kasus Indonesia adalah kondisi masyarakat yang pluralistik yang diimbangi sikap toleransi seluruh masyarakatnya akan melahirkan keunggulan dan produktivitas.


enarik untuk disimak seri tulisan Prof Dr BJ Habibibe dengan judul QuoVadis Indonesia di surat kabar Republika secara berturut-turut sejak 22 sampai dengan 24 Desember 2011. Beliau menulisartikeltersebuttepatdipenghujung tahun 2011 seakan mengingatkan bangsa kita bahwa kondisi kekuatan dan kelemahan telah terbentang nyata di hadapan kita. Sekarang persoalannya adalah tergantung kepada bangsa ini untuk menyadarkan dirinya tentang berbagai potensi kelebihan maupun kekurangannya. Berikutnya, beliau mengingatkan berbagai langkah yang harus dilakukan guna mengejar keunggulan yang dimiliki berbagai bangsa yang sudah lebih dahulu maju. Prof BJ Habibie mengemukakan dua tesis dalam tulisan beliau. Tesis pertama, sejarah membuktikan bahwa hanya sumber daya manusia yang merdeka, bebas berpikir dan bebas berkarya saja yang dapat meningkatkan produktivitas dan keunggulan. Tesis kedus, sejarah juga telah membuktikan bahwa semakin pluralistik sebuah masyarakat dan semakin toleran perilakunya akan semakin tinggi daya saing dan kreativitasnya. Lalu apa yang harus dilakukan oleh bangsa Indonesia. Menurut beliau, prasyarat untuk pengembangan produktivitas dan keunggulan sumber daya manusia telah terpenuhi. Tinggal persoalannya adalah penyiapan prasarana dan konsep teruji (1) pembudayaan, prasarana (2) pendidikan dan penelitian dan prasarana dan (3) penyediaan lapangan kerja. Menelaah tesis pertama, agaknya semua sepakat bahwa proklamasi 17 Agustus 1945 dengan bahasanya yang singkat, tegas dan padat telah menjadikan bangsa Indonesia sebagai bangsa yang merdeka. Demikian juga konstitusi telah menjamin bahwa setiap warga negara memiliki kebebasan berpikir dan mengekspresikan pendapatnya sepanjang hal itu tidak bertentangan dengan prinsip ketertiban dan ketenteraman sosial. Setiap warga negara Indonesia memiliki kebebasan berkarya yang mendapat jaminan dari nilai-nilai agama dan budaya. Tetapi persoalannya kemudian adalah apakah nilai-nilai normatif tersebut telah teraktualisasi dalam kehidupan berbangsa. Kita dengan prihatin membaca penilaian orang luar terhadap kondisi bangsa Indonesia terutama yang berkenaan dengan Indeks Pembangunan Manusia yang memiliki jarak yang sangat jauh dari sesama negara-negara di seputar ASEAN. Syarat untuk meraih keunggulan ditentukan oleh tiga hal yaitu manusia yang

merdeka, kebebasan berpikir dan berkarya. Munculnya kemerdekaan bagi manusia adalah berakar dari kesadaran yang mendalam terhadap hakikat dirinya sebagai manusia ciptaan Allah. Adanya perbedaan antara sesama penduduk hanya sekedar identitas yang menjadi tanda pengenal untuk membedakan satu dengan lainnya. Dasar kepribadian yang merdeka berangkat dari kesadaran iman yang menentukan seseorang layak diberi penghargaan manakala telah memiliki prestasi yang muncul dari kreativitasnya sendiri. Selanjutnya kemerdekaan mendorong setiap orang untuk bebas berpikir apa saja yang menjadi perhatiannya. Namun tentunya kebebasan berpikir tidak sekedar pada term kebebasan akan tetapi kebebasan itu memiliki batas-batas sebagaimana yang dinyatakan dalam Hadis Rasul: berpikirlah tentang ciptaan Allah dan jangan pikirkan ZatNya. Kebebasan yang sesungguhnya adalah melahirkanketertibanalur pikir yaitu yang bisa dipikirkan adalah hal-hal yangmenjadiwilayah pemikiran.Sebaliknya yang tidak bisa dipikirkan k a re n a m e mang berada di luarkawasanuntuk dipikirkan hendaklah didekati secara nurani maka di sanalah letaknya keyakinan yang disebut iman. Dengan demikian, berpikir adalah bertujuan untuk membuka cakrawala yang lebih luas sementara nurani adalah untuk menangkap sesuatu yang absolut yang harus didekati dengan kesadaran nurani. Pada tataran itu, manusia mengalami mobilitas kepribadian yaitu berangkat dari kegelapan (zulmani) menuju kepada yang terang benderang (ruhani). Dalam pandangan agama, kemerdekaan dan kebebasan berpikir itu memiliki misi yang lebih universal yaitu berusaha untuk selalu menampilkan kebaikan dan kebajikan bagi alam semesta. Rasul dalam sebuah sabdanya menyatakan bahwa manusia yang baik itu adalah yang paling memberi manfaat bagi manusia lainnya (khairun al nâs anfa’uhum li al nâs). Terminologi manfaat adalah kata kunci yang menjadi misi dan orientasi hidup setiap manusia. Setiap komunitas sosial yang anggotanya selalu berupaya membawa rahmat bagi diri dan lingkungannya. Kata rahmat mengandung makna yang amatdalamterhadapsifatkasihsayangyang

harus digali manusia dari dalam dirinya dan disumbangkan kepada seluruh alam semesta. Karya-karya besar dengan kreativitas yang tinggi telah dilahirkan karena pertemuan agama dengan budaya dan puncak dari keunggulan peradaban itu terjadi ketika perkembangan kesejarahan Islam yang terjadi antara abad pertama sampai abad ketujuh hijriyah. Ulama sebagaicendekiawanagamatidakberhenti pada pencarian terhadap kepuasan emosional semata akan tetapi menularkan kebaikan kepada seluruh penjuru alam semestakarenakebaikanitubersifatuniversal lintas agama, etnis maupun budaya. Tumbuhnyaberbagaikreativitasdalam sejarah peradaban Islam karena berangkat dari ajaran ibadah. Kondisi kehidupan manusia mengalami suasana pencerahan baru ketika mereka mulai berkenalan dengan pesan-pesan yang bersumber dari agama-agama mondial khususnya Islam. Ritual dalam Islam yang disebut ibadah memiliki perbedaan substansi dengan ritual dalam kepercayaan masyarakat yang bersahaja itu. Dalam ibadah, manusia berada pada posisi sintesis antara cemas (khawf) dan harap (thama’) yang dilandasi perasaan cinta kepada Allah sehingga berusaha sekuat tenaga mengabdikan seluruh wawasan pemikiran, sikap dan perilaku serta keterampilannya sebagai jalan melakukan pendekatan diri kepadaNya. Kriteria penilaian terhadap keberadaan manusia tidak ditentukan oleh ikatan primordial akan tetapi didasarkan kepada kedekatan dirinya kepada Allah. Dalam kaitan itulah dalam pandangan Islam, manusia memiliki dua fungsi dalam kehidupannya yaitu fungsi ibadah dan khilafah. Ibadah adalah pendekatan diri kepada Allah yang dilandasi oleh perasaancintayanghakikiyangkemudianberimbas kepada munculnya kesadaran terhadap panggilan nurani untuk mengelola alam semesta sebagai karuniaNya untuk dipergunakan bagi sebesar-besarnya bagi kehidupan umat manusia. Selanjutnya, kesadaran mengelola alam semesta yang didasarkan dengan berbekal ilmu pengetahuan akan memantulkan kembali sinar terang yang mengantarkan manusia agar terhubung kepada Zat Allah Yang Maha Kuasa. Demikianlah, arus bolak-balik antara ibadah dan khilafah mendorong berbagai kreativitas manusia untuk menciptakan berbagai kebaikan (solah) dan menghindarkan dari kerusakan (fasad). Karena itu, tidak mengherankan apabila kreativitas yang melahirkan peradaban pada era kejayaan Islam tidak hanya dinikmati hasilnya oleh umat Islam akan tetapi juga oleh seluruh umat manusia. Tesis kedua BJ Habibie yang menarik juga dicermati khususnya untuk kasus Indonesia adalah kondisi masyarakat yang pluralistik yang diimbangi dengan sikap toleransi dari seluruh masyarakat-

nya akan melahirkan keunggulan dan produktivitas. Keunggulan dilihat dari substansinya adalah keinginan yang kuat untuk menggali lebih dalam lagi berbagai manfaat dari berbagai sumber daya alam yang dianugerahkan Tuhan. Munculnya keunggulan itu tentunya adalah berangkat dari sikap yang tidak sekedar memadakan produk yang sudah ada tetapi terus menggali produk lain guna memperoleh berbagai produk baru. Dasar dari motivasi untuk meraih keunggulan berkembang pada masyarakat yang memiliki setting sosial yang majemuk antara satu dengan yang lain atau satu kelompok dengan kelompok. Adanya kelompok yang lain tidak dilihat sebagai musuh yang harus diperangi akan tetapi adalah rekan sesama umat manusia makhluk Tuhan yang sedang dalam perjalanan (fellow travel) menuju cita-cita. Atas dasar itu, maka terjadilah kompetisi yang sehat dan masing-masing bergerak ke depan dengan menawarkan dua opsi yaitu memperkuat tradisi karena dipandang masih relevan dengan perkembangan masa atau juga menggali sesuatu yang lebih baru yang dipandang lebih baik. Hal inilah cara berpikir yang telah menjadi tradisi di kalangan orang-orang arif pada masa lalu yang disebut ulama, kiai, tuan syekh, ajengan dan lain sebagainya yang mereka wariskan kepada generasi kemudian. Kemajemukan sosial bagi kelompok masyarakat yang bercita-cita menghasilkan produk keunggulan, tidak mereka pandang sebagai ancaman tetapi justru menjadi potensi yang mendorong lahirnya dinamika, kreativitas dan inovasi. Mereka bersedia dan mampu bekerjasama dengan berbagai orang yang memiliki latar belakang dan asal usul yang bermacam-macam karena ia lebih berorientasi kepada tujuan yang lebih strategis bukan pada hal yang tidak prinsip. Hal itu dapat terwujud manakala manusia memiliki sikap toleransi antar sesama warga bangsa yaitu memberikan pengakuan, penghormatan, penghargaan kepada orang lain dan sekaligus juga setiap orang memiliki kebebasan untuk mengekspresikan sesuatu menurut keyakinannya. Pada ketika itulah, hukum tidak terlalu banyak aktif mengingat manusia telah memiliki kesadaran komitmen terhadap nilai-nilai etik, moral dan spiritual yang menyadari batas kebebasan individu dan implementasi tanggung jawab sosial. Setiap manusia sebagai warga kelompok hendaklah selalu sadar untuk berupaya menuju jalan tengah untuk memperoleh ketenteraman, ketertiban dan kesimbangan sosial. Bangsa Indonesia yang dari asal usulnya sudah ditakdirkan sebagai bangsa yang pluralistik selayaknya menempatkan kemajemukan berlandaskan sikap toleransi yang tinggi agar potensi keunggulan dan produktivitas yang mereka miliki tidak hilang percuma ditelan oleh konflik dan perseteruan. Allâhu a’lam bish shawâb. Penulis adalah Dosen UIN Syarif Hidayatullah Jakarta.

Jokowi – Ahok Yang Fenomenal Oleh H.Irham Taufik Umri, SH, MAP Meskipun berhadapan dengan lawan tangguh, Jokowi – Ahok mempunyai self confidence yang tinggi.


ilkada DKI Jakarta Rabu 11 Juli 2012 lalu berlangsung tertib, aman dan damai. Hasil penghitungan cepat (quickcount)enamlembagasurveidiJakarta telah mengumumkan pasangan JokoWidodo – Basuki Tjahya Purnama (Jokowi –Ahok) unggul dari lima pasangan calon lainnya. Enam lembaga survey tersebut, masing-masing Lingkaran Survei Indonesia (LSI),Indobarometer,SaifulMujaniResearch and Consulting, Jaringan Suara Indonesia (JSI), PRISMA, STEKPI. Survei mereka menyatakan Jokowi – Ahok memperoleh ratarata 42 % suara, disusul pasangan Fauzi Bowo–NachrowiRamli34%suara.Kemudian pasangan Hidayat Nurwahid – Didik Rachbini 11 %, Faisal Basri – Bim Benyamin 5%. Sedangkan dua pasangan lainnya masingmasing Alex Noerdin - Nono Sampono dan Hendarji Supandji - A Riza Patria memperoleh suara dibawah 5 %. Walaupun hasil resmi harus ditetapkan KPUsebagaiotoritasPilkada,tapihasilpenghitungancepat ini cukup mengejutkan atau di luar dugaan. Selama ini atau sebelum hari pemungutan suara seluruh lembaga survei mengemukakan tingginya popularitas Foke – Nara dibandingkan dengan lima pasangan calon lainnya. Bahkan Foke Nara diestimasikan menang mutlak dalam satu kali putaran. Namun prakiraan survei tersebut meleset. Hal itu disebabkan warga Jakartayangbelummenentukanpilihannya (undecided voters) pada survei sebelum pemungutan suara telah merubah hasil survei tersebut. Berdasarkan Undang-undang Nomor: 29 tahun 2007 tentang pemerintahan DKI Jakarta, mengisyaratkan calon gubernur terpilih adalah mereka yang memperoleh lebih dari 50% suara. Jika syarat tersebut tak dipenuhi harus dilakukan putaraan kedua yang diikuti pemenang pertama dan kedua. Sedangkan untuk daerah lain di luar DKI Jakarta persyaratan kemenangan kepala daerah adalah 30 %. Merujuk hasil cuick count tersebut, menempatkan pasangan Jokowi – Ahok serta pasangan Fauzi Bowo – Nachrowi Ramli akan kembali bertarung pada putaran kedua yang digelar September mendatang. Anak bawang MunculnyaJokowi–Ahokyangdiusung PDIP dan Gerindra memenangkan pertarunganputaranpertamacukupfenomenal.

Betapa tidak! JokoWidodo yang diketahui selama ini sebagaiWalikota Solo dan Ahok sebagai anggota DPR bisa dikatakan“anak bawang” bila dibandingkan dengan lawanlawannya yang sudah punya nama dan popularitas—bukan hanya di DKI Jakarta tapi sudah menasional. Hidayat Nur Wahid, misalnya adalah mantan Ketua MPR, jabatan prestisius di negeri ini. Sebelumnya ia Presiden Partai Keadilan Sejahtera, Partai Dakwah yang menduduki empat besar pada Pemilu legislatif 2009. Lawan tangguh lainnya adalah sang incumbent Fauzi Bowo. Sebagai Gubernur DKI Jakarta tentu saja dikenal luas warganya. Apalagi “pak kumis” ini putra Betawi yang sudah malang melintang di birokrasi serta memegang jabatan-jabatan strategis di pemerintahan DKI. Menggunakan sampan Partai Demokrat, ia didukung para ulama, mantan Gubernur DKI sebelumnya Sutiyoso, serta pendampingnya cukup kuat—karena menakhodai Ketua Partai Demokrat DKI yaitu Nachrowi Ramli yang nota bene putra Betawi. Selain Foke - Nara lawan Jokowi lainnya yang cukup diperhitungkan adalah sang intelektual Faisal Basri, pakar/pengamat ekonomi yang dikenal bersih. Ia juga pernah berkecimpung di partai politik pasca bergulirnya reformasi di negeri ini. Bersama Amin Rais lokomotif reformasi, Faisal Basri turut membidani lahirnya Partai Amanat Nasional sekaligus menjadi sekretaris jenderal (Sekjen)terpilih.Adalagicalonyangtakkalah populernya yaitu Alex Noerdin Gubernur Sumatera Selatan. Alex Noerdin yang diusung partai Golkar dikenal sukses menggelar SEA Games di wilayahnya. Dicintai Media Meskipun berhadapan dengan lawan tangguh, Jokowi – Ahok mempunyai self confidence yang tinggi. Khusus Jokowi, ia turun dari kota kecil menuju arena ke kota metropolitandenganmodalpopularitasnya selama ia berkiprah di wilayah yang dikenal dengan kota budaya tersebut. Dengan performance sederhana, bicara lugas (ceplas ceplos) dan merakyat. Gebrakannya untuk memberikan pelayanan (fasilitasi) kepada publik kota Solo mendapat respons positif dan dukungan warganya. Kiprahnya membangun kota dan masyarakat Solo membuahkan berbagai penghargaan bukan hanya dalam skala nasional, bahkan interna-

sional. Bahkan ia mendapat predikat sebagai salah satu walikota terbaik di belahan bumi ini. Tidak dapat dipungkiri popularitas Jokowi berkat peran dominan dari media massa terutama media cetak surat kabar dan media elektronik televisi, facebook, twitter dan sebagainya. Apapun yang dilakukannyadiSolomaupunsewaktumencalonkan diri sebagai calon gubernur DKI terutama masa kampanye, semuanya diliput dan diberitakan secara luas oleh media massa nasional, sehingga Jokowi muncul sebagai figur pemimpin publik di tingkat nasional. Popularitasnya yang menasional itu menunjukkan Jokowi “dicintai media”. Tidak mengherankan pemberitaan negatif tidak ada yang melekat pada dirinya. Demikianpuladiinternetfacebookdan twitter. Media yang digandrungi kalangan muda ini juga berpihak pada Jokowi. Fenomena itu mengingatkan kita akan sosok Dr H.Susilo Bambang Yudhoyono (SBY) ketika muncul sebagai calon Presiden Republik Indonesia ke-6. Ketika itu media sangatmengidolakanSBY.Hampirsetiaphari publik dapat menyaksikan di televisi, surat kabar,majalah,tabloid,bukudandiinternet mengenai sosok SBY yang juga memiliki performance santun bahkan ganteng. Ketika itu nyaris tidak ada sentimen negatif dari media terhadap SBY. Melalui peran media SBY berhasil memenangkan Pemilu Presiden (Pilpres) 2004 dengan mengalahkan incumbent Megawati Soekarno putri, lokomotif reformasi Amin Rais bahkan seniornya di TNI Wiranto. Berkat pencitraan positif yang dimilikinya, lima tahun kemudian SBY kembali terpilih sebagai Presiden periode kedua padatahun2009.PengalamanSBYtersebut tersebut kini dapat diraih Jokowi. Sedangkan Ahok yang mendampingi Jokowi sebelumnya tidak dikenal publik Jakarta. Politisi Golkar yang duduk sebagai anggota DPR ini populer setelah ia muncul sebagai pasangan Jokowi. Elektabilitas Ahok kemungkinan besar berasal dari etnik China yang kebanyakan pengusaha besar (konglomerat)bermukimdiibukota.Elektabilitas AhokmiripsepertidrSofyanTanyangnyaris memenangkan Pilkada di kota Medan. Negatif Sebaliknya Fauzi Bowo lawan politik Jokowi, popularitasnya tidak setinggi rating Jokowi. Sekalipun ia masih memegang tampuk pemerintahan sebagai Gubernur DKIJakartadanpunyafasilitasmemanfaatkan media massa, tetapi citra negatif selalu menerpa dirinya. Berita-berita miring mengenai kredibilitasnya menyelesaikan ma-

salah kota Jakarta kerap diberitakan secara massif. Misalnyatahunlalumasalahkemacatan lalu lintas, hampir semua surat kabar dan televisi menyerang kebijakannya selamamenjabatsebagaigubernur—tidakada terobasan baru untuk menyelesaikan arus kemacatan ibu kota. Seperti perluasan bus way, pembangunan monorel yang lama terbengkalai, penataan parkir dan mengerem laju pertumbukan kenderaaan roda dua maupun roda empat. Demikianpulabanjiryangsetiaptahun menjadilanggaanrutinyangdialamiwarga ibu kota. Masalah penanggulangan kemiskinan, pengangguran dan urbanisasi menjadi isu sentral yang mendera pemerintahan Fauzi Bowo. Selain masalah krusial yang dialami warga Jakarta, pemberitaan berkaitan situasi perpolitikan nasional turut pula menurunkan citra dan pamor Fauzi Bowo. Misalnya isu suksesi Presiden pada Pilpres 2014 mendatang, yang akhir-akhir ini hangat diperbincangkan para politisi, akademisi dan praktisi menanggapi hasil survei yang menyiratkan popularitas Capres dari kalangan tua masih tetap mendominasi percaturan perpolitikan nasional— meskipun tingkat elektabilitas Capres tua tersebut rendah. Opini publik yang berkembang tidak menginginkan Capres kalangan tua muncul dalam pertarungan Pilres 2014. Kalangantuahendaknyamemberikankesempatan kepada kaum muda sebagai Capres alternatif. Sehingga munculnya istilah yang ditujukan kepada Capres kalangan tua dengan akronim 4 L (lu lagi.., lu lagi...). Karena opini ini menggelinding pada saat kampanye Pilgub DKI Jakrta, tentu saja merugikan popularitas Fauzi Bowo yang berusia tua. Strategi Kendatipunpadaputaranpertamapasangan Jokowi – Ahok meraih 42 % suara jauh meninggalkan rivalnya Fauzi Bowo – Nachrowi Ramli yang hanya meraih 34% suara bukan berarti Jokowi Ahok mulus akanmemenangkanpertarunganmemperebutkan Jakarta 1 dan 2.Tetapi perjuangan masih berat, melelahkan dan sarat dengan tantangan. Masih ada waktu dua bulan mengonsolidasikan pendukung masingmasing secara all out untuk mencapai hasil optimal. Segala kemungkinan bisa saja terjadi, tergantung kedua pasangan beserta tim sukses menyusun strategi jitu. Apakah Foke-Narabisamembalikkanhasilputaran pertama atau malah Jokowi-Ahok akan mendulang sukkses? Wait and see! Penulis adalah Dosen Sekolah Tinggi Ilmu Tarbiah Al Hikmah Kota Tebingtinggi.


B10 Forsi Asokaya Salurkan Bantuan BIREUEN (Waspada): Komunitas Forum Silaturrahmi (Forsi) Asokaya, Bireuen, menyalurkan bantuan kepada puluhan anak yatim yang berdomisili di beberapa desa di sekitar Kota Bireuen, di Sekretariatnya, Lantai II Warkop Atra Juang, Kota Bireuen, Minggu (15/7) sore. Selain itu, mereka kegiatan bakti sosial menata rumah ibadah juga yang ada di sekitar kota tersebut. “Bakti sosial, makan bersama dan pemberian santunan kepada anak yatim, merupakan agenda komunitas Forsi Asokaya yang telah dipersiapkan menyambut Ramadhan 1433 H,” kata Ketua Dewan Pembina, Kaspul Topan kepada Waspada di selasela acara. Menurut Kaspul, Forsi Asokaya merupakan satu wadah silaturrahmi warga Bireuen yang sudah go internasional dan anggotanya sudah di beberapa daerah di Indonesia dan di beberapa negara di dunia. “Cakupannya sangat luas, jadi siapa pun dan di mana pun mereka yang mengaku masyarakat Bireuen, adalah bagian dari forum silaturahmi ini. Di sini kita berkumpul dan saling memberi kontribusi untuk membangun daerah kita,” jelasnya. Anggota dewan pembina Forsi Asokaya Drs Murdani, dalam arahannya mengatakan, Forsi Asokaya patut diperhatikan pemerintah karena perannya adalah untuk pembangunan Bireuen ke depan. “Terus terang secara pribadi saya sangat mendukung Forsi Asokaya ini, semoga dengan adanya dapat menyatukan banyak perbedaan dalam rangka memberi kontribusi bagi pembangunan Bireuen yang lebih baik ke depan dan menurut saya Asokaya ini satu wadah untuk menyatukan masyarakat Bireuen dengan pemerintah,” ujar Murdani yang juga Asisten I Setdakab Bireuen sekarang ini. (cb02)

Satpol PP Minta Kejelasan Pengelolaan Perizinan LHOKSEUMAWE (Waspada) : Satuan Polisi Pamong Praja dan Wilayatul Hisbah (Satpol PP-WH) Kota Lhokseumawe meminta instansi pengelolaan perizinan memperjelas koordinasi. Pasalnya, pemberian izin selama ini terkesan menghargai satu pihak. Hal itu dikatakan Ketua Satpol PP-WH Azwar di ruang kerjanya, Kamis (12/7). Azwar menuturkan, pihaknya selama ini kurang dilibatkan pihak kantor Pelayanan Perizinan Terpadu Satu Atap (KKP2TP) saat mengeluarkan perizinan di Lhokseumawe. “Harapan kami kepada KKP2TP melakukan koordinasi saat mengeluarkan izin,” papar Azwar. Kata Azwar, melakukan koordinasi tersebut agar mudah mempelajari di saat izin yang telah dikeluarkan itu berakhir. Karena saat menertibkan itu adalah tugas Satpol PP, jadi kurang etis bila Satpol PP dilibatkan hanya saat eksekusi, tapi waktu mengeluarkan izin tidak pernah berkoordinasi. Kepala Kantor Pelayanan Perizinan Terpadu Satu Atap (KP2TP) Lhokseumawe Baktiar, Jumat (13/7) menuturkan, pihaknya bukan tidak melakukan koordinasi dengan Satpol PP, karena mereka tdak termasuk dalam tim teknis. Tim teknis di sini hanya dinas KP2TP dan dinas terkait. Tambah Baktiar, pihaknya akan mengusullkan Satpol PP agar masuk ke dalam tim teknis pada 2013 nanti. Dan, Baktiar mengaku tidak berniat hanya menggunakan tenaga Satpol PP sebagai eksekutor semata, tapi selama pernah melakukan koordinasi dengan mereka. (cmk)

Kecamatan Kota Juang Mulai Salurkan e-KTP BIREUEN (Waspada) : Kecamatan Kota Juang Bireuen sudah mulai menyalurkan e-KTP kepada warga 23 desa, Jumat (13/7). Camat Kota Juang Darmansyah, Jumat (13/7) menjelaskan, warga 23 desa di Kota Juang yang sudah wajib KTP sebanyak 34.797 orang, sudah selesai direkam sebanyak 24.054 orang dan yang belum membuat e-KTP sebanyak 10.743 orang. Camat Kota Juang Darmansyah mengimbau kepada warga yang belum membuat e-KTP agar dapat segera membuat eKTP saat ini masih gratis, jIka tidak dibuat segera nantinya akan dikenakan biaya sesuai Qanun. Dikatakan, saat ini sebagian e-KTP warga Kecamatan Kota Juang sebanyak 17.977 buah sudah selesai dicetak di Jakarta dan sudah mulai disalurkan kepada wraga yang sudah membuat e-KTP. Sedangkan sebanyak 6.077 buah e-KTP yang masih dicetak di Jakarta akan menyusul dikirim untuk disalurkan kepada warga. (b12)

Waspada/H AR Djuli

PETUGAS Kecamatan Kota Juang sedang menyalurkan e-KTP kepada warga Desa Cot Jrat, Kecamatan Kota Juang, Jumat (13/ 7).

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


Senin 16 Juli 2012

Takut Terjaring Razia, Puluhan Kendaraan Berhenti Di Pinggir Jalan BIREUEN (Waspada): Puluhan pemilik kendaraan roda dua dan empat terlihat berhenti dipinggir jalan nasional sebelah barat dan timur Mapolres Bireuen, Sabtu (14/7) sore. Pasalnya, saat itu di depan Mapolres setempat sedang dilakukan razia rutin kendaraan. Pantauan Waspada, Sabtu (14/7), puluhan sepedamotor dan mobil berhenti di pinggir jalan nasional kawasan sebelah barat dan timur Mapolres Bireuen, sebagian di antara sudah diparkirkan pemiliknya, namun ada juga sebagian pemiliknya berada di atas kendaraannya. “Ada razia bang di depan Mapolres, makanya kami berhenti di sini dulu,” kata seorang pengendara sepedamotor yang berhenti sebelah barat Mapolres menjawab Waspada. Informasi yang diperoleh, para pemilk kendaraan tersebut tidak melanjutkan perjalanannya karena takut akan terjaring razia polsi, karena di antaranya, mereka tidak memaki helm muka belakang, ada kendaraannya yang kurang lengkap, bahkan ada yang tidak membawa surat kendaraannya. “Saya pergi sebentar tadi, karena buru-burulupabawaSTNK,daripadanantiditangkap lebih saya berhenti sebentar disini, setelah razia saya langsung pulang,” kata seorang gadis.

Sementara itu, di depan Mapolres Bireuen saat itu, Satuan Polisi Lalulintas (Satlantas) menggelar razia operasi patuh 2012 menjaring puluhan unit sepedamotor yang tidak memiliki surat lengkap kendaraannya dan yang tidak memakai helm muka belakang mereka yang membocengi Selain itu, anggota Satlantas yang berseragam lengkap saat itu menghentikan setiap pengendara sepedamotor yang tidak memakai helm dan mobil yang memakai plat polisi bukan BL. Petugas juga menertibkan mobil angkutan umum yang menutup plat polisi dengan stiker gelap. “Kita sekarang mulai menggelar Operasi Patuh 2012 ini hingga minggu pertama Ramadhan atau sekitar 14 hari ke depan,” kata Kapolres Bireuen, AKBP Yuri Karsono SIK, melalui Kasat Lantas, AKP H Suharmadi kepada Waspada usai menggelar razia. Operasi patuh 2012 itu digelar, sambung Kasatlantas, dalam rangka menertibkan suratsurat kendaraan bermotor dan surat izin mengemudi, serta berupaya mencegah terjadinya kriminalitas dalam wilayah Kabupaten Bireuen. (cb02)

Apa Nu, Keuchik Dayah Panjoe

PPMJ Aceh Di Subulussalam SUBULUSSALAM (Waspada): Pusat Paguyuban Masyarakat Jawa (PPMJ) Aceh mulai eksis di Kota Subulussalam, Aceh. Dedi Armansyah BM/Asep Sumantri, Sekretaris/Ketua PPMJ Aceh bersama sejumlah pengurus kepada Waspada, Jumat (13/7) di Sekretariat PPMJ Aceh Subulussalam mengatakan, SK No. 006/SKPPMJ/I/2012 tentang Pengangkatan Dewan Pengurus Perwakilan PPMJ Aceh Distrik Subulussalam Periode 2012-2014 ditetapkan di Banda Aceh, 12 Januari 2012 oleh Ketua, M Samin ZZ dan Sekretaris Prayitno. Kepengurusan PPMJ Aceh dengan Bendahara Nisful Laili ini dilengkapi Divisi Humas/Koord. Lapangan, Bidang Sarana dan Prasarana serta Koord. Bidang Etnis Agama dan Kebudayaan, dengan penasehat DPW PA Subulussalam dan sejumlah unsur. (b28)


Waspada / Zainuddin Abdullah

EKSPLORASI GALIAN C : Sejumlah pemuda menggunakan satu unit kendaraan truk angkutan sedang memuat bahan bangunan jenis batu hasil eksplorasi di sungai tepat di bawah jembatan rangka baja Kecamatan Sawang Kabupaten Aceh Utara, Minggu (15/7). Akibat dari kegiatan ilegal itu juga menyebabkan terjadinya pengikisan hebat yang telah menghancurkan bangunan bronjong dan merusak bagian opvrit Jembatan rangka baja.

Empat Wanita Bawa Kabur Barang Asesoris BIREUEN (Waspada): Aksi penipuan dengan berbagai dalih atau kedok sepertinya tak pernah sepi. Bahkan selalu ada korbannya. Seperti, yang dialami pemilik toko asesoris Gebrina, Bireuen, Jumat (13/ 7) menjelang maghrib barangnya diperkirakan senilai Rp7 juta dibawa kabur empat wanita setengah baya dengan mobil Avanza yang berkedok sebagai pembeli. Informasi yang diperoleh Waspada Jumat (13/7) malam, empat wanita setengah datang ke Toko Gebrina di jalan T Hamzah Bendahara Bireuen, milik Azhari dengan mobil Avanza hitam yang disopiri seorang pria. Lalu keempatnya melihat

dan bertanya harga beberapa jenis bunga yang dijual warga Komplek BTN Buket Indah. Tanpa ragu Azhari bersama istrinya Juliana, 35, melayani mereka dengan baik. Saat itulah mereka memilih bunga hias yang dijualnya satu persatu, sehingga jumlahnya mencapai sekitar Rp7 juta. Setelah semua pilihannya dibungkus, lalu Azhari menulis bon dan mengangkat barang ke mobil Avanza hitam yang diduga nomor polsinya, BK 1522 JN yang diparkir tidak jauh dari depan tokonya. Anehnya setelah itu, keempat wanita langsung naik mobil dan belum membayarnya. Namun, Azhari baru sadar setelah mobil hilang. Menurut keterangan Azhari, dia tidak menyangka empat wanita yang sempat memeperkenalkan namanya pada saat masuk ke tokonya diantaranya mengaku namanya, Suryani, Sur Anum, Aida, dan Sur mela-

kukan hal itu kepadanya. Namun, Azhari mengaku pada saat itu dirinya seperti kurang sadar bahwa pembeli belum menyerahkan uang kepadanya. “Saya dan istri baru sadar setelah keempat mereka meninggalkan toko kami dengan mobil,” katanya yang dibenarkan isterinya. Merasa belum diberikan uang, lalu Azhari tidak buang waktu lagi langsung mencarinya. Namun, usahanya tidak membuahkan hasil. Lalu melaporkan kepada polisi kasus yang baru dialaminya. “Sudah saya laporkan kepada polisi,” katanya. Kapolres Bireuen, AKBPYuri Karsono melalui Kapolsek Kota Juang, Iptu Syamsul SH, yang dikonfirmasi Waspada Minggu (15/7), mengaku belum ada laporan kepadanya. “Mungkin sudah dilaporkan, namun laporannya belum masuk kepada saya saja,” katanya singkat. (cb02)

Taman Rekreasi Krueng Simpo Juli Dipadati Pengunjung BANDAR JULI (Waspada): Menjelang libur puasa lokasi Taman Rekreasi Krueng Simpo Km-19 jalan Bireuen – Takengen, Minggu (15/7) dipadati pengunjung. Pengamatan Waspada di lokasi rekreasi Krueng Simpo minggu kemarin, taman rekrerasi Krueng Simpo dipadati siwa-siswi dan keluarga besar SMAN-1, SMAN-2 dan sekolahsekolah lainnya yang akan memasuki masa libur sekolah 18 Juli – 28 Juli 2012. Selain para siswa dan dewan guru juga turut dipadati warga masyarakat Kota Bireuen, PNS bersama keluarganya berekreasi minggu terakhir menjelang kedatangan bulan suci Ramadhan. Kendati lokasi rekreasi Krueng Simpo masih alami cukup padat dikunjungi masyarakat dari Kota Bireuen dan sekitarnya lantaran lokasi rekreasi pantai Kuala Raja selama ini masih ditutup warga setempat sebagai lokasi rekreasi. Menjelang kedatangan

Waspada/H.AR Djuli

PARA siswa dan keluarga besar SMAN-1 dan SMAN-2 Bireuen menjelang memasuki masa libur puasa sedang berekreasi bersama keluarga di Taman Rekreasi Krueng Simpo Jalan Bireuen – Takengen, Kecamatan Juli. bulan suci Ramadhan hanya dua lokasi reakreasi di Kabupaten Bireuen dipadati pengunjung, masing-masing Krueng Simpo Kecamatan Juli, lokasi rekreasi Batee Iliek, Kecamatan

Samlalanga berlokasi dilintasan Jalinsum Banda Aceh- Medan perbatasan Kabupaten Bireuen – Pidie Jaya, dipadati pengunjung berasal dari Kabupaten Bireuen dan Pidie Jaya. (b12)

BIREUEN (Waspada): M Nur yang akrab Apa Nu terpilih sebegai Keuchiek Gampong Dayah Panjoe, Kecamatan Kutablang, Bireuen priode 2012-2018. Setelah dalam Pemilihan kepala Desa (Pilkades) yang dilaksanakan di meunasah desa setempat dua hari lalu memperoleh 170 suara. Apa Nu terpilih dalam pilkades yang ikut dihadiri Muspika setempat, selain mengungguli Bakri yang mendapat 71 suara juga mengantikan Anwar Ismail yang telah habis masa jabatannya. Bakri calon kades yang belum terpilih, kepada Waspada, Minggu (15/7), mengatakan, pesta demokrasi tingkat desa yang telah dilaksanakan itu, diketuai Mukhtaruddin, berlangsung aman dan lancar serta tertib dari acara pencebolasan hingga penghitungan suara atau hingga Apa Nu terpilih. “Saya pribadi menerima dengan lapang dada dan saya juga siap mendukung kepemimpinan Apa Nu yang terpilih baru-baru ini bersama masyarakat. Semoga desa kami ke depan bertambah baik,” katanya singkat.

Dua Muzakkir Sebelumnya, Muzakkir Daud, 41, terpilih sebagai keuchik Desa Paya Seupat, Kec. Gandapura, kabupaten yang sama, setelah penghitungan suara pilkades yang dilaksnakan di meunasah desa setempat Kamis (12/7), memperoleh 143 suara. Sedangkan M Husen Nurdin seorang rivalnya hanya mendapatkan 45 suara. Muzakkir terpilih menggantikan Abdul Gani yang telah habis masa jabatannya. Sehari sebelumnya, Muzakkir Hamid, 46, terpilih kembali sebagai Keuchiek Desa Mon Keulayu, kecamatan yang sama setelah mengumpulkan 331 suara dalam pilkades yang dilaksanakan di desanya, sedangkan seorang saingannya Tgk Darni hanya memperoleh 146 suara. Ketua Pelaksana Pilkades Kecamatan Gandapura, Ridwan Sulaiman, kepada Waspada, Minggu (15/7), mengatakan, Gandapura, hingga sekarang telah melaksanakan pilkades 99 persen. “Setiap yang melaksanakan Pilkades selalu dihadiri tim Muspika,” katanya. (cb02b17)

TPQ Kulah Batee Bireuen Gelar Aneka Lomba BIREUEN (Waspada) : Ketua Umum Ipqah Kabupaten Bireuen H Jufliwan M Ali, SH.MM membuka Mushabaqah Tilawatil Quran santriwan-santriwati Taman Pendidikan Alquran Darul Jadid Kulah Batee Bireuen di Meunasah setempat, Jumat (13/7) malam. Ketua pantitia MTQ dan Dakwah Islamiyah Meunasah Kulah Batee Tgk H Mustafa kepada Waspada menjelaskan, MTQ santriwan-santriawati dan dakwah islamiyah dengan mengundang mubaligh Tgk Mulyadi dari Kandang Lhokseumawe dalam rangkaian menyambut kedatangan bulan suci Ramadhan 1433 hijriah. MTQ yang digelar sejak Jumat malam (1317/7) diikuti 169 peserta santriwan-santriawati Taman Pendidiikan Islam Darul Jadid Kulah Batee tingkat TK, SD, SMP dan SMA. Cabang MTQ yang dilombakan antar san-

triwan -santriawati TPQ Darul Jadid, untuk tingkat SMP dan SMA, cabang lomba Azan 10 peserta, lomba praktik shalat fardhu 9 peserta dan lomba praktik shalat jenazah 13 peserta. Tingkart SD dari kelas IV –VI lomba azan 23 peserta, lomba praktik shalat fardhu 14 peserta, lomba praktik shalat jenazah 7 peserta dan lomba hafalan surat pendek 10 peserta. Lomba tingkat Taman Kanak hingga kelas III SD lomba azan 10 peserta, lomba pratik shalat fardhu 30 peserta, hafalan doa sehari-hari 15 peserta, lomba hafalan surat-surat pendek 15 peserta dan basa Alquran 4 peserta. Sementara dakwah Islamiyah menyambut Ramadhan dengan mengundang mubaligh Tgk Muliadi dari Kandang Lhokseumawe akan berlangsung di tempat yang sama Minggu (15/ 7) malam ini, ujar Tgk H Mustafa. (b12)

HMI Peusijuk Pasangan Wali Kota Langsa Terpilih LANGSA (Waspada) Sagai bentuk rasa syukur dan dukungan atas hasil Pemilukada Putaran Kedua Kota Langsa, Himpunan Mahasiswa Islam (HMI) Cabang Langsa melakukan prosesi peusijuk terhadap pasangan Wali Kota Langsa terpilih Usman Abdullah, SE – Drs. Marzuki Hamid, MM (UMARA) di sekretariat organisasi mahasiswa tersebut, Minggu (15/7). Ketua Umum HMI Cabang Langsa, Rahmadhani, S.Sos.I dalam sambutannya mengatakan, tepung tawar yang dilakukan pihaknya tersebut merupakan sebagai bentuk komitmen HMI Cabang Langsa dalam mendukung dan ikut mengawal kepemimpinan Wali Kota Langsa terpilih. “Apalagi Wakil Wali Kota Langsa terpilih dalam putaran kedua ini adalah keluarga besar HMI yang tergabung dalam Koprs Alumni HMI (KAHMI) Langsa, maka sudah menjadi kewajiban kami selaku kader dan juniornya Wakil Wali Kota untuk terus mengawasi dan mengawal masa kepemimpinan beliau demi mewujudkan Kota Langsa yang lebih baik,” sebut Rahmadhani. Hal senada juga disampaikan Ketua Umum KAHMI Kota Langsa, M Khairurradhi Ibrahim, SPd atau yang lebih dikenal Jenderal

Kancil. Menurutnya, sudah menjadi kewajiban bagi HMI untuk terus mengawasi kinerja yang dilakukan oleh seniornya dipemerintahan. “Hal itu perlu, agar dalam menjalankan amanah rakyat yang dipercayakan sebagai pemimpin daerah, senior tidak salah langkah. Namun demikian dalampengawasannya HMI tidak hanya melakukan kritikan, tapi juga harus memberikan solusi terbaik agar apa yang diharapkan dapat terwujud, karena baik buruknya alumni yang telah dipercayakan oleh rakyat juga berdampak pada HMI atau KAHMI itu sendiri,” ungkap Khairurradhi. Sementara itu Pj Wali Kota Langsa, Drs H Bustami Usman, MSi yang ikut hadir dalam proses peusijukWali Kota Langsa terpilih, dalam arahannya mengatakan, tepung tawar yang dilakukan oleh HMI tersebut merupakan adat budaya Aceh yang telah turun temurun dengan tujuan untuk memberikan dukungan dan penghargaan kepada sosok yang dianggap penting dan sakral. Semoga kepemimpinan Wali Kota Langsa terpilih tersebut dapat memberiakn yang terbaik bagi Kota Langsa sebagaimana harapan HMI, KAHMI dan rakyat Kota Langsa secara keseluruhan,” demikian harap Pj.Walikota Langsa. (b20)

Nurman DS: Jabatan Bukan Warisan

Penyidik Menunggu Hasil Uji Tekenan PPK Kasus Beasiswa Unimal Lhokseumawe

HARI ini, Senin (16/7) Gubernur dr Zainal Abdullah atas nama Presiden Republik Indonesia melantik H Riswan NS dan Hasrul Edyar, MAP sebagai Bupati-Wakil Bupati Simelue terpilih. Dengan demikian usai pula masa tugas Nurman DS di kepulauan itu. Sabtu malam Minggu kemarin, Waspada bertandang ke Pendopo Nurman. Pria berkacamata kelahiran Sawang, Aceh Selatan ini terlihat sendiri menatap TV LCD di ruang tamu pendopo sembari menekan nomor pada keypad selularnya. Senyum ramah, kelakar kelakar kecil yang seakan menjadi ciri khas sang Nurman, menghidupkan suasana pertemuan. Tak sedikitpun Rona wajah mengisyaratkan sebentar lagi ia tak jadi seorang pejabat nomor wahid di sebuah kabupaten.

LHOKSEUMAWE (Waspada): Penyidik Tindak Pidana Korupsi dari Polres Lhokseumawe masih menunggu hasil uji Labfor untuk mengetahui keaslian tekenan PPK kasus beasiswa Universitas Malikussaleh (Unimal) Lhokseumawe. Dua mantan pejabat Unimal terancam terjerat dalam kasus beasiswa senilai Rp2 miliar tersebut. Kepala Satuan Reserse Kriminal Polres Lhokseumawe AKP Supriadi kepada wartawan, Jumat (13/2) mengatakan, penyidik sedang menunggu hasil uji Laboratorium Forensik (Labfor) Polri Cabang Medan tentang keaslian tandatangan mantan Penjabat Pembuat Komitmen (PPK) anggaran rutin Unimal. Sebelumnya mantan PPK, Muammar Khadafi dan pejabat yang meneken surat perintah membayar (SPM), Aiyub mengaku tidak pernah mengeluarkan tekenan dalam mencairkan beasiswa bermasalah tersebut. Menurut Supriadi, Khadafi dan Aiyub meragukan keaslian tekenan mereka yang ada dalam dokumen pencairan dana beasiswa Unimal bersumber dari APBN 2010. “Mereka merasa tidak pernah teken. Atas dasar itu kita kirim dokumen yang telah kita sita sebagai barang

“Semua seperti biasanya,” jawabnya atas pertanyaan Waspada akan perasaannya menjelang detik detik terakhir masa tugasnya. Lebih lanjut Nurman bertutur, saya jalani semua dengan ikhlas. Makanya saya bekerja tanpa beban. Katanya, bagi saya jabatan adalah amanah bukanlah warisan keluarga. Sebab itu saat berakhir bagi saya semua biasa saja. Saya kemari menjalankan tugas dan dalam bekerja saya ingin menjadi contoh panutan. Dengan berakhirnya masa tugas, bagi sebagian orang rasanya memang berat meninggalkan fasilitas yang dipinjamkan selama ini oleh negara. Bagi dia, kata Nurman, yang belakangan ini digadang-gadangkan akan masuk bursa kandidat kepala daerah pada Pilkada Aceh Selatan 2013/2018

itu, berhubung berakhir besok jangankan pakai mobil dinas plat merah, disuruh diami pendopo menunggu pulang saja ke Aceh Selatan saya sudah nyatakan kepada Sekda, menolaknya. Ini menurut dia bukan karena sedih hati atau tersinggung. Melainkan semata mata ingin mengajari bawahannya jabatan bukanlah selamanya, datang dan pasti akan pergi. Dengan kesadaran begitu maka sisi positifnya akan memudahkan menertibkan aset daerah. Dan tidak muncul keinginan pribadi menguasai suatu fasilitasyangdipinjamkannegara. Saya kata Nurman pernah menangis beberapa hari lalu saat pertemuan dengan staf staf sekdakab, tapi itu bukan karena saya sedih hilang jabatan. Tapi berat rasanya pisah dengan teman-teman.(cb04)

bukti ke Labfor, di mana dalam dokumen itu ada tandatangan keduanya, untuk diuji apakah asli atau palsu,” jelas Supriadi. Bukti tandatangan Khadafi dan Aiyub, dikirim ke Labfor Polri Cabang Medan sekitar sebulan lalu. “Kita sudah koordinasikan kembali dengan pihak Labfor, tapi sejauh ini proses uji tekenan itu belum selesai,” kata Supriadi didampingi Kepala Unit Tipikor AipdaYunus Damanik. Penyidik juga telah menyita satu unit komputer di Bagian Keuangan Unimal sekitar dua pekan lalu. “Melalui komputer itu, tersangka Jafar (mantan bendahara Unimal) menscan tandatangan Rektor Unimal untuk delapan SK (surat keputusan) Rektor tentang penerimaan beasiswa. Penomoran SK itu juga tidak terdaftar dalam registrasi SK Rektor,” katanya. Kasus dugaan korupsi dana beasiswa senilai Rp2 miliar bersumber dari APBN 2010. Kasus itu menjerat dua petinggi Unimal sebagai tersangka. Mereka adalah Muammar Khadafi (mantan PPK dana rutin Unimal) dan Jafar (mantan Bendahara Unimal). Kasus tersebut ditingkatkan ke tahap penyidikan sejak 9 Desember 2011. (b15)


WASPADA Senin 16 Juli 2012

Anggota DPR RI Gelar Khitanan Massal Di Aceh Besar

Wartawan Harus Tingkatkan Kemampuan SINGKIL (Waspada) : Wartawan harus terus tingkatkan kemampuan dan keterampilan agar lebih profesional dalam menjalankan pekerjaan jurnalistiknya. Penjabat Bupati Aceh Singkil Razali AR menyampaikan apresiasinya kepada kalangan wartawan di daerah itu saat membuka Musyawarah Besar (Mubes) II Persatuan Wartawan Aceh Singkil (Perwasi), Jumat (12/7) di Balai Wartawan, Pulo Sarok, Singkil. Terkait Perwasi sebagai organisasi profesi tunggal di kabupaten setempat, Razali menyebutkan, organisasi harus bisa membuat anggotanya betah dan memayunginya. Razali juga minta Perwasi untuk terus membenahi diri agar lebih profesional, seperti melakukan pendidikan dan pelatihan (Diklat) sebagai upaya peningkatan kompetensi. (b27)

KOTA JANTHO (Waspada): Anggota DPR RI T Riefky Harsya dari Partai Demokrat bekerjasama dengan Komunitas Kesehatan Aceh menggelar khitanan massal di Puskesmas Ingin Jaya, Aceh Besar, Minggu (15/7). Kegiatan Sunnah Rasul diikuti 130 anak yatim dan duafa di Kecamatan Ingin Jaya dan sekitarnya. Kegiatan yang turut disaksikan Bupati Aceh Besar Mukhlis Basyah, Ketua MPU Kecamatan Ingin Jaya Tgk Bustami, anggota DPRK, Muspika Ingin Jaya dan tokoh masyarakat setempat dalam rangka menyambut Bulan Suci Ramadhan 1433 H. Bupati Aceh Besar Mukhlis Basyah mengatakan, Pemerintah Aceh Besar berterima kasih atas kepedulian anggota DPR RI yang telah ikut ambil bagian dalam melaksanakan Sunnah Rasul, terutama terhadap anak yatim, duafa dan anak-anak kurang mampu yang menjadi

Komunitas Anak Muda Bersihkan Sampah Pantai BANDA ACEH (Waspada) : Sejumlah komunitas peduli lingkungan di Banda Aceh menggelar pembersihan pantai Lampuuk, Lhok Nga, Aceh Besar, Minggu (15/7). Kegiatan dari pagi sampai siang itu berhasil mengutip sampah sebanyak 65 Kg. Aksi pembersihan pantai itu dilakukan komunitas anak muda seperti AcehYouth Forum,Youth Leadership Camp 2012 dan Komite Mahasiswa dan Pemuda Kota (Kompak) Banda Aceh. Selain mereka, acara ini juga diikuti oleh Putri Pariwisata Aceh 2012 Cut Rita Kemala dan Putri Bahari Aceh 2012 Rizka Khairina. Pembersihan sampai dilakukan sepanjang garis pantai. Sampai yang terkumpul dikumpul dalam belasan kantong plastik besar. digalakkan oleh masyarakat Aceh. “Tapi yang paling pentin (b07)

Alumni Deakin Latih Guru Bahasa Inggris BANDAACEH (Waspada) : Kurangnya metode dan bahan ajar bahasa Inggris serta lemahnya kompetensi sebagian besar guru bahasa Inggris di sekolah-sekolah dasar di Aceh menjadi keprihatinan alumni Universitas Deakin Australia di Aceh. Selama 10 hari, mereka menggelar pelatihan bahasa Inggris yang menarik dan menyenangkan kepada 35 guru SD dari Banda Aceh dan Aceh Besar. Pelatihan diselenggarakan di Pusat Peningkatan Mutu Guru (PPMG) di Banda Aceh, dari 28 Juni sampai 11 Juli 2012 atas kerjasama Dinas Pendidikan Aceh dan Universitas Deakin. “Selama ini model pengajaran bahasa Inggris di sekolahseko-lah dasar kita lebih banyak menggunakan pendekatan untuk orang dewasa, bukan bahasa Inggris untuk pembelajar pemula,” kata Muhammad Aulia, Project Manager Aceh Deakin Alumni Group, di Banda Aceh, kemarin. Selama pelatihan berlangsung, tambah Aulia, pihaknya berusaha mengenalkan para peserta dengan sejumlah metode, di antaranya peningkatan keterampilan produktif dan reseptif. “Keterampilan produktif mencakup kemampuan berbicara, menulis dan menciptakan teks/sastra, sedangkan keterampilan reseptif mencakup mendengar, membaca dan mengamati ekspresi/stimulan,” katanya. (cb01)

Musabaqah Dalail Khairat Jadi Even Tahunan BANDA ACEH(Waspada):WakilWalikota Banda Aceh Hj. Illiza Sa’aduddin Djamal berharap Musabaqah Dalail Khairat akan jadi even tahunan yang setiap tahun bisa di gelar di Kota Banda Aceh. Kata dia, ajang perlombaan Dalail Khairat yang di prakarsai oleh Majelis Adat Aceh yang bekerjasama dengan Pemko Banda Aceh, itu dapat dijadikan sebagai sarana untuk mempelajari nilai-nilai yang terkandung di dalamnya. “Meskipun bertajuk perlombaan, dalail khairat yang akan disenandungkan ini bisa memberikan bekas dalam sikap dan perbuatan kita sehari-hari,” ujar Illiza saat membuka Musabaqah Dalail Khairat tingkat Kota Banda Aceh, di Mesjid Nurul Huda Gampong Peunjeurat Kecamatan Banda Raya, Banda Aceh, Kamis (12/7), malam. Ketua Majelis Adat Aceh (MAA) Kota Banda Aceh, Sanusi Husein dalam mengatakan, Musabaqah Dalail Khairat ini berlangsung (12-14/7), diikuti oleh Sembilan Grup Dalail dari Sembilan Kecamatan di Banda Aceh. Kepada pemenang, kata dia, panitia akan memberikan trophy dan dana pembinaan, masing-masing juara 1 Rp. 5.000.000, juara II Rp Rp 4.000.000, dan juara III Rp 3.000.000. (b02)

AJI Bekali Karang Taruna Ilmu Jurnalistik BANDA ACEH (Waspada): Aliansi Jurnalis Independen (AJI) Banda Aceh bekerjasama dengan American Friendship Service Committee dan Dinas Sosial Aceh, menggelar pelatihan jurnalistik dasar untuk 25 karang taruna dan anggota Forum Komunikasi Pekerja Sosial Masyarakat (FKPSM). Para peserta berasal dari Kabupaten Pidie, Aceh Besar, dan Kota Banda Aceh, ini akan dibahani mengenai dasar-dasar ilmu jurnalistik, media online, dan jejaring sosial. Mereka mengikuti pelatihan jurnalistik dasar selama tiga hari, sejak Selasa hingga Kamis (10-12/7) di Aula Balai Latihan Kerja Aceh. Tampil sebagai pembicara dalam pelatihan itu yakni Maimun Saleh (Ketua AJI Banda Aceh) dan Fakhruradzie Gade (Pemimpin Redaksi Kedua pemateri itu tampil secara terpisah dan mengisi materi tentang jurnalistik, praktik menulis, pengenalan media sosial, dan media online, serta jurnalisme warga. Koordinator Program Training Jurnalistik Dasar AJI, Misdarul Ihsan, mengatakan, kegiatan pelatihan jurnalistik ini dilakukan untuk mengembangkan potensi menulis para relawan binaan Dinas Sosial, sehingga mampu membangun komunikasi dengan pekerja pers dan media. (b04)

Di Sabang, 10 Koperasi Akan Dibubarkan SABANG (Waspada) : Di Kota Sabang, sekitar 10 koperasi akan dibubarkan dalam tahun ini karena sudah lama tidak berjalan. “Kalaukoperasi sampai 10 tahun tidak melakukan Rapat Anggota Tahunan (RAT) sebaiknya kita bubarkan saja,” ujar Kepala Disperindagkop Sabang Nasdi Adiansyah pada acara pembukaan pelatihan manajemen kewirausahawan bagi pengurus koperasi yang berlangsung di aula Disperindagkop Sabang, Kamis (12/7). Kata dia, pada zaman orde baru, koperasi benar-benar diberdayakan dengan berbagai program bantuan karena koperasi dijadikan sebagai kekuatan ekonomi yang strategis di tingkat pedesaan. Bukan hanya program bantuan dana bergulir, tapi sampai ke tahap penyaluran pupuk, kebutuhan pokok seperti gula disalurkan lewat koperasi.(b31)

Ratusan PNS Di Sabang Bersihkan Pasar Pagi SABANG (Waspada): Dalam rangka mengisi program Jum’at bersih yang dicanangkan Pj.Walikota Sabang, Drs. Zulkifli HS,MM, ratusan Pegawai Negeri Sipil (PNS) dari berbagai instansi di lingkungan Pemko Sabang mengadakan kegiatan gotong royong membersihkan pasar pagi, Jumat (13/7) sore. Pj. Walikota Sabang, Zulkifli HS dalam setiap kesempatan selalu mekampanyekan kegiatan Jum’at bersih tujuannya adalah untuk menjaga kawasan wisata ini menjadi indah dan bersih. Kalau kota yang mungil ini bersih akan tampak indah dan tamutamu yang datang menikmati masa libur dan berkunjung ke sabang akan menjadi nyaman selama berasa di kota wisata ini. Program Jum’at bersih sebenarnya sudah pernah dicanangkan sejakWalikota Sabang dijabat oleh Drs. Sofyan Haroen, setiap hari Jum’at selalu melaksanakan kegiatan gotong royong dan sangat positif sekali. (b31)



BUPATI Aceh Besar Mukhlis Basyah (baju bartik) didampingi T. Riefky Harsya saat meninjau pelaksanaan khitanan massal di Puskesmas Ingin Jaya, Aceh Besar, Minggu (15/7).

Agama Obat Paling Ampuh BANDA ACEH (Waspada): Meski obat-obatan terlarang begitu gencar masuk ke Aceh, namun para remaja Aceh jangan takut. Karena, kalau pemakainya tidak ada, tentu barang haram tersebut takkan laku, sehingga pemasoknya rugi dan tidak akan memasukkannya lagi. Demikian disampaikan Dosen FK Unsyiah, dr H Mohd. Andalas, SpOG, di depan peserta seminar sehari tentang Nafza, Seksualitas dan HIV/AIDS yang digelar Kelompok Diskusi Kespro SMAN 3 Banda Aceh di aula Balaikota Banda Aceh, Sabtu (14/7). Kata dia, tidak bisa dipungkiri, bila narkotika dan zat aditif lain disalahgunakan, akan membawa kehancuran, teruta-

ma di kalangan remaja. Dimana mereka kadang terjatuh pada pergaulan seks bebas yang mengancam jiwa mereka dari penyebaran penyakit menular seksual, seperti HIV/AIDS, yang kini telah meningkat begitu drastis di Indonesia, termasuk di Aceh yang dulu-dulunya hampir tidak pernah terdengar adanya kasus HIV/AIDS. “Terhadap HIV/AIDS, walau kasusnya terus meningkat, kalian jangan takut tertular kalau tidak melakukan seks bebas dan menggunakan narkoba. Jadi, katakan no for drug and free sex,” kata Andalas yang disambut gemuruh tepukan peserta. Menurut dia, penyebab terjadinya penyalahgunaan narkotika dan zat aditif lain (NAFZA) dan seks bebas ini terkait erat dengan lemahnya pengawasan keluarga dan pendidikan agama si anak. “Karena itu, pendidikan

keagamaan dan pengawasan keluarga menjadi benteng awal dalam menangkis serangan narkoba dan seks bebas yang begitu dahsyat akhir akhir ini. Jadi, apapun ceritanya, obat yang paling ampuh melawan semua itu adalah agama,” sebut Andalas. Acara seminar sehari yang diikuti kelompok pelajar se-Kota Banda Aceh ini banyak memancing pertanyaan yang terkait narkoba, kesehatan reproduksi dan HIV/AIDS, sebab mereka takut terhadap bahaya seks bebas, narkotika dan infeksi HIV/ AIDS. Apalagi setiap tahunnya jutaan orang di dunia meninggal karena kasus AIDS. Selain dr H Mohd. Andalas, SpOG, semainar sehari tersebut juga menampilkan pemateri lain, seperti Kahar, SH dari Kejaksaan Tinggi (Kejati) Aceh dan perwakilan dari KPA AIDS Aceh. (b04)

Walhi Serahkan Draft Raqan Kehutanan BANDAACEH (Waspada) : Wahana Lingkungan Hidup Indonesia (Walhi) Aceh menyerahkan dokumen tentang draf rancangan qanun kehutanan Aceh melalui kepala Biro Hukum dan Humas Pemerintah Aceh. Draft rancangan qanun diterima Kepala Biro Hukum dan Humas Pemerintah Aceh Makmur. Draft rancangan qanun kehutanan Aceh beserta naskah akademiknya tersebut diserahkan Direktur Eksekutif Walhi Aceh Teuku Muhammad Zulfikar didampingi beberapa staf

Walhi Aceh, di antaranya Kepala Divisi Riset dan Kajian Kebijakan Teuku Mursalin dan staf Divisi Advokasi dan Kampanye, Yusriadi, Kamis (12/7). Draf raqan kehutanan Aceh telah dimulai pembahasannya pada Juli tahun 2011, baik melalui diskusi terbatas, seperti fokus group diskusi, maupun meminta masukan baik lisan maupun tertulis dari berbagai pihak terkait, termasuk dari akademisi, pegiat LSM, masyarakat, pemerintah, serta berbagai kalangan dan institusi terkait lainnya. Termasuk beberapa kali workshop

juga sudah dilakukan untuk menyaring berbagai masukanmasukan demi penyempurnaan draf rancangan qanun tersebut. Direktur Eksekutif Walhi Aceh TM Zulfikar dalam penyerahan ini menyampaikan mengapa Walhi Aceh menginisiasi penyusunan draf rancangan qanun kehutanan Aceh, karena banyak permasalahan yang terjadi dalam pengelolaan hutan di Aceh, mulai dari tata kelola hingga tumpang tindih regulasi dan kebijakan yang dikeluarkan pemerintah. (cb01)

Pembangunan Jembatan Tak Kunjung Usai, Warga Mengeluh KABUPATEN Nagan Raya adalah kabupaten di Provinsi Aceh, Indonesia. Ibukotanya Suka Makmue, yang berjarak sekitar 287 km atau 8 jam perjalanan dari Banda Aceh. Kabupaten ini berdiri berdasarkan UU Nomor 4 Tahun 2002 tanggal 2 Juli 2002 sebagai hasil pemekaran Kabupaten Aceh Barat. Kata Nagan merupakan kependekan dari Seunagan yang menunjukkan lima kecamatan hasil pemekaran, sedang Raya berarti besar. Kabupaten Nagan Raya sendiri berada di pantai barat Sumatera yang subur dan sangat cocok bagi pertanian, khususnya padi yang terpusat di Kecamatan Seunagan, Seunagan Timur, dan Beutong karena ditunjang Sungai Krueng Beutong dan Sungai Krueng Nagan yang mengalir di wilayah tersebut. Potensi lainnya adalah usaha peternakan dan perkebunan terutama kelapa sawit. Karena sumber daya pertaniannya yang melimpah, maka Nagan Raya yang merupakan tempat tragedi Beutong Ateuh ini dikenal sebagai salah satu lumbung beras utama di Aceh. Sebelum ada Gerakan Aceh Merdeka, Nagan Raya menjadi pusat bagi transmigran yang menghidupkan sektor pertanian di kawasan ini. Namun setelah 2001 banyak transmigran yang meninggalkan unitunit permukimannya karena gangguan dan ancaman dari kaum separatis. Jarak Bandara Cut Nyak Dien ke ibu kota Nagan Raya kurang lebih 25 km, sedangkan ke Meulaboh 45 km. Transportasi ke kedua tempat tersebut terse-

Waspada/Didit Arjuna

PENGERJAAN jembatan di Simpang Peut, Kecamatan Kula, Kabupaten Nagan Raya yang terhenti. Karena itu, hingga saat ini jembatan tersebut belum selesai. Sehingga masyarakat dengan kendaraan bermotor yang ingin melintas masih menggunakan rakit. dia sepanjang waktu dengan kualitas jalan yang sangat baik. Di Nagan Raya saat ini telah berdiri Rumah Sakit Umum Daerah Tipe C (Dokter Spesialis, Dokter Umum dan Dokter Gigi) dan 10 Puskesmas yang kesemuanya terletak di pinggir jalan raya sehingga mudah diakses. Namun, hingga saat ini perawatan sejumlah fasilitas umum di Nagan Raya masih minim. Selain itu, tidak sedikit pula sejumlah bangunan yang terbengkalai dan mubazir. Seperti keluhan warga Gampong Blang Teungku, Kecamatan Seunagan Timur, Kabupaten Nagan Raya yang mengeluhkan pembangunan jembatan yang tidak kunjung selesai di gampong mereka. Jembatan tersebut merupakan penghu-

bung Gampong Blang Teungku, dan Kandeh dengan akses ke luar Seunagan Timur. Azhar, warga Gampong Blang Teungku mengatakan, pembangunan jembatan penghubung di gampong mereka sudah dimulai sejak 2010 lalu. Namun hingga sekarang, pembangunan jembatan tersebut belum juga selesai. “Ada tiga gampong yang berdekatan sampai sekarang masih kesulitan untuk menyeberang sungai,” kata azhar. Saat ini, warga dari tiga gampong itu harus menggunakan rakit untuk bisa menyeberangi sungai. Azhar berharap kondisi jembatan segera diperbaiki agar memudahkan akses transportasi warga. Didit Arjuna

tugas dan tanggung jawab bersama. Sementara T Riefky Harsya dalam sambutannya mengatakan, kegiatan yang dilaksanakannya itu tidak semata-mata berkaitan dengan politik, tetapi lebih kepada sosial dan ibadah, terutama menjelang Bulan Ramadhan. Menurutnya, kegiatan khitanan massal itu akan dilaksanakan di 23 kecamatan di Kabupaten Aceh Besar dengan jumlah anak yang akan dikhitan 1.208 dari 604 gampong. “Satu gampong diambil dua anak dan pelaksanaannya dipusatkan di masing-masing kecamatan,” ungkapnya. Ketua Panitia Pelaksana Maimunsyah Banta menyebutkan, khitanan massal yang anggota DPR RI T Riefky Harsya bekerjasama dengan Komunitas Kesehatan Aceh dan Puskesmas Ingin Jaya itu berlangsung satu hari penuh. (b05)

Ormas Islam Pawai Anti Maksiat SUBULUSSALAM (Waspada): Jelang Ramadhan 1433 H (beberapa hari ke depan), sejumlah ormas Islam, santri pondok pesantren, mahasiswa, perwiritan ibu-ibu dan lainnya lakukan Pawai Anti Maksiat se-Kota Subulussalam, Sabtu (14/7). Pawai dikoordinir Forum Bersama Umat Islam (Forbumi) Subulussalam mengambil titik kumpul di Lapangan Beringin Subulussalam. Rombongan, 35 unit mobil roda empat dari berbagai merek yang mendapat pengawalan Polisi setempat bergerak menuju Desa Lae Ikan Kec. Penanggalan, perbatasan langsung dengan Kab. Pakpak Bharat, Sumatera Utara. Sejumlah lokasi yang disinyalir tempat merebaknya penyakit masyarakat (pekat), seperti Kolam Pancing Desa Kuta Tengah dan sejumlah titik di Desa Lae Mbrsih Kec. Pe-

nanggalan disinggahi, sembari memasang spanduk imbauan berantas maksiat. Pawai dilanjutkan ke Kec. Sultan Daulat, Longkib dan Rundeng, menyusul istirahat makan siang di Lapangan Beringin, Subulussalam dan shalat zuhur. Koordinator pawai, Abdul Rozak Naufal dari Forbumi didampingi Kapolsek Simpang Kiri, AKP R Manurung minta kepada peserta pawai tertib dan tidak membuat tindakan tidak simpati warga. R. Manurung dalam arahannya menyatakan dukungan untuk pemberantasan pekat di sana. “Indikasi penyakit masyarakat, seperti miras hingga sabu masih ada,” tandas Manurung pastikan, tanpa bantuan dan keterlibatan semua unsur masyarakat pihaknya tidak bisa memberantas pekat. (b28)

Kapolres : Tolong Bantu Pahami Proses Dan Prosedur Hukum BLANGPIDIE (Waspada) : Beragam persoalan hukum yang saat ini terjadi di Aceh Barat Daya terkadang sering dipahami secara keliru oleh sejumlah pihak dan kalangan di masyarakat. Bahkan tak sering sejumlah kasus tertentu juga dikait-kaitkan dengan persoalan lain di luar koridor hukum, tak pelak kondisi itu diakui cukup ‘memusingkan’ bagi AKBP Eko Budi Susilo,S.IK selaku kepala kepolisian di kabupaten Abdya. “Harus kami sadari tidak gampang untuk dapat memberikan pemahaman secara menyeluruh kepada masyarakat tentang sebuah proses dan prosedur hukum, umumnya masyarakat ingin proses atau prosedur hukum itu menurut kemauan atau pemikiran mereka, padahal tidaklah seperti itu, penyamaan dan pemahaman persepsi inilah yang tentu dibutuhkan dukungan semua pihak, khususnya dari rekan-rekan wartawan, tolong bantu warga pahami proses dan prosedur hukum,” ungkap Kapolres Abdya AKBP Eko Budi Susilo saat bersilaturahmi dengan para wartawan dan beranjangsana ke Balai PWI Abdya di Jalan Persada Blangpidie, Sabtu (14/7). Kapolres yang ikutserta didampingi Kasat

Reskrim Iptu Marzuki,SH menyatakan harapannya agar setiap persoalan hukum yang saat ini sedang ditangani pihak kepolisian agar terus dipantau dan tidak disangkut-pautkan dengan persoalan lain di luar koridor hukum. Kapolres juga menyampaikan apresiasinya atas dukungan serta peran serta masyarakat Abdya yang dinilai ‘luarbiasa’ dalam upaya menjaga ketertiban dan keamanan di lingkungan masing-masing, sehingga diakuinya, pelaksanaan pilkada putaran kedua yang telah usai kemarin dapat terlaksana dengan baik dan sukses. Sementara itu para wartawan yang hadir dalam pertemuan itu yang terdiri dari pengurus Balai PWI Abdya seperti Nasrun Yunan (Harian Realitas), Sudarmansyah (Harian Waspada), Azhari (Serambi Indonesia) dan Syahrizal (Pikiran Merdeka) mengungkapkan harapannya agar kemitraan yang telah terjalin secara baik antara para wartawan dengan pihak kepolisian selama ini akan terus terjalin kuat demi mewujudkan harapan masyarakat agar setiap penegakan hukum yang selama ini berjalan dapat terus terpublikasi demi terciptanya akuntabilitas publik. (cb05)

Syeikh Ali Saleh Jaber Ingin Sabang Dijadikan Sebagai Ahlul Quran SABANG(Waspada): PjWalikota Sabang Drs Zulkifli HS MM mengatakan, kehadiran ustadz Syeikh Ali Jaber di Sabang telah memberikan suatu manfaat yang sangat besar bagi masyarakat Sabang. Manfaat tersebut bukan saja dari tausiayah yang disampaikan kepada masyarakat Sabang, tapi keinginanya untuk menjadikan Sabang sebagai tempat Ahlul Qur’an (Hafal Al Qur’an). Keinginan itu sendiri didasari dari sejarah Aceh umumnya dan Sabang khususnya sebagai daerah serambi Mekkah dan pernah dijadikan sebagai tempat kumpul dan berangkatnya jamaah haji menggunakan transportasi kapal laut pada masa lalu. “Ini suatu penghargaan besar yang patut kita syukuri bersama, keinginan Ustadz Syeikh Ali Jaber sebagai imam besar masjid Madinah Arab Saudi ingin menjadikan Sabang sebagai Ahlul Qur’an merupakan cita-cita yang sangat mulia,” kata PjWalikota Sabang Zulkifli HS kepada wartawan kemarin. Dirinya mengaku sangat mendukung, terlebih lagi jika rencana tersebut terealisasi akan ada bonus yang diberikan bagi masyarakat, bukan saja bermanfaat untuk akhirat tapi bonus berangkat umroh atau naik haji.

Sebagai tindak lanjut dari rencana itu akan dibicarakan lebih lanjut bila Walikota dan Wakil Walikota terpilih sudah dilantik, sebagaimana dikatakanUstadzSyeikhAliJaberyangkeraptampil memberikan tausiyah di sejumlah televisi swasta. Bahkan, Ustadz Syeikh Ali Jaber sendiri sangat mengharapkan saat pelantikanWalikotaWakil Walikota Sabang nanti dirinya minta diundang menghadiri pelantikan kedua pemimpin pilihan masyakat Sabang. “Jangan lupa undang saya saat pelantikan nanti, saya akan langsung bacakan do’a untuk kedua pemimpin Sabang ini, kita minta berkah dan ridha Allah untuk pak Zulkifli dan pak Nazaruddin,” kata Pj walikota Sabang Zulkifli HS menirukan ucapan Ustadz Syeikh Ali Jaber. Menurutnya, meskipun baru pertama datang ke Sabang Ustadz Syeikh Ali Jaber bersama adik kandungnya Ustadz Syeikh Husain Jaber mengaku senang dan kagum dengan keindahan pariwista Sabang. Bahkan, dengan rasa bangga Ustadz Syeikh Ali Jaber berjanji akan membawa datang orang tua dan saudara kandungnya ke Sabang sekaligus akan memperkenalkan Sabang kepada kerabat serta sanak saudaranya saat nanti kembali ke Arab Saudi.(b31)

Buku Nurcholis Madjid Dibedah MEULABOH (Waspada) : Sekolah Tinggi Agama Islam (STAI) Teungku Dirundeng Meulaboh menggelar bedah buku “Integrasi Agama dan Negara, Paradigma Politik Nurcholish Madjid Era Orde Baru Tahun 1966-1998” yang menjabarkan pemikiran cendikiawan muslim Indonesia, Nurcholish Madjid atau yang lebih dikenal dengan Cak Nur. Buku karya Dr Syamsuar, MAg yang juga sebagai Ketua STAI Teungku Dirundeng tersebut turut dibedah dua akademisi IAIN Ar-Raniry Banda Aceh, Dr T Safir Iskandar, MA dan Dr.Muhammad AR, M.Ed serta difasilitasi Muhammad Riza, MA sebagai moderator. Acara yang berlangsung pada Jumat lalu itu turut dihadiri sejumlah perwakilan instansi pemerintahan Kabupaten Aceh Barat, kepala sekolah, pimpinan pesantren, ormas serta perwakilan mahasiswa dari sejumlah perguruan tinggi di Aceh Barat. Ketua Panitia, Danial Jamal, MA, menyebut-

kan buku karya Dr Syamsuar, MAg ini merupakan bentuk semakin berkembangnya analisis para intelektual Aceh pada perkembangan ilmu pengetahuan, terutama dalam menulis buku mengenai pemikiran dari tokoh Islam. “Kita harapkan dengan peluncuran buku seperti ini nantinya akan mendorong putraputra Aceh untuk menulis dan menerbitkan buku terkait dengan perkembangan Islam di nusantara maupun dunia,” kata Danial. Sementara itu, Dr Syamsuar, M.Ag mengatakan, dirinya merasa sangat senang dengan sejumlah masukan terhadap bukunya yang baru diluncurkan dan berharap ke depan bisa menerbitkan buku-buku selanjutnya. “Semoga ke depan semakin banyak dosen kita yang membukukan karya penelitian mereka untuk dibaca masyarakat, terutama penelitian di bawah Lembaga Penelitian, Pengembangan, dan Pengabdian Masyarakat (LP3M) STAI Teungku Dirundeng” katanya. (b07)



Warga Sembilan Desa Di Samudra Terancam SAMUDRA(Waspada): Jalan Madan yang menghubungi sembilan desa ke ibu kota kecamatan Samudra, Aceh Utara ini sengaja tidak selesai dikerjakan di beberapa bagian, sehingga menuai bencana bagi penggunanya. Selama tiga tahun lebih saat pengaspalan, di bagian tikungan sungai Krueng Pase di wilayah Gampong Boreoe, Sepanjang 350 meter badan jalan di wilayah situ seperti sengaja dibiarkan tidak diaspal dan hanya ratakan saja, sebagaimana jalan yang dasar dengan batu dan kerikil alami. Pada saat turun hujan, jalan di atas tanggul sungai itu membentuk banyak lubang dan genangan air. “Setiap hari dapat disaksikan orang-orang dari sembilan desa yang melintasi jalan itu dengan kereta motor tersuruk jatuh ke lubang-lubang secara beruntun,” ungkap Kechik Gampong Baroe, Hamdani SPd, Minggu (15/7). Penduduk sembilan desa, meliputi Keude Gedong, Tanjong Kleng, Gampong Baroe, Tanjong Baroh, Madan, Tanjong Hagu, Tanjong Reungkam, Tanjong Awe, dan Meunasah Masjid amat kesulitan bila hendak membawa hasil pertanian ataupun berpelanja ke pasar Geudong, Samudra. Saban hari terdengar keluhan dari mereka, tetapi tidak ada yang peduli. Tidak diaspalnya badan jalan itu menimbulkan semacam kebingungan penduduk, karena di bagian jalan lainnya tetap dikerjakan. Hal serupa ini juga terjadi di Gampong Meunasah Mesjid. Jalan sepanjang 200 meter sengaja disisakan, tidak diaspal. Menurut Hamdani, masalah itu bukan terletak pada penduduk, melainkan pihak pemerintah Aceh Utara sendiri yang mengatur masalah proyek jalan dan tanggul sungai. “Apa pun masalah mereka, yang jelas penduduk kampung ini sudah jadi korban. Kami cuma ingin pemerintah menyambung sisa jalan yang belum diaspal ini,” tegasnya. (b14)

Pelantikan Bupati-Wakil Bupati Bireuen Menunggu SK Mendagri BIREUEN (Waspada) : Berkas usulan penetapan Bupati/ Wakil Bupati Bireuen H Ruslan H M Daud – Ir Mukhtar Abda M Si sudah diterima Menteri Dalam Negeri Jumat (13/7) sedang diproses penetapannya untuk pelantikan. Ketua DPRK Bireuen Ridwan Muhammad, SE menjelaskan hal itu menjawab pertanyaan Waspada, Jumat (13/7) petang. Dikatakan, berkasnya sudah lengkap semua pihak di Kabupaten Bireuen berharap agar Menteri Dalam Negeri dapat segera menerbitkan SK penetapan agar pelantikannya diharapkan tepat waktu sesuai dengan tahapan yang sudah dijadwalkan. Tahapan pelantikan Bupati/Wakil Bupati Bireuen yang sudah dijadwalkan 25 Juli 2012, soal jadwal pasti tergantung Gubernur Aceh sambil menunggu turunnya SK penetapan Menteri Dalam Negeri, ujarnya. (b12)

Nanti Malam, Dakwah Akbar Digelar IDI CUT (Waspada): Nanti malam Senin (16/7) sekira pukul 20:00 Wib, pengurus Badan Komunikasi Pemuda Remaja Masjid Indonesia (BKPRMI) Idi Cut Kecamatan Darul Aman Kab. Aceh Timur menggelar dakwah akbar di halaman Masjid Besar Baitul Muttaqin Idi Cut. “Besok malam—nanti malam—dakwah dalam rangka menyambut Ramadhan 1433 hijriah akan kita gelar di mesjid besar kecamatan. Peceramahnya ada Tgk Abdul Wahid dari Aceh Tamiang,” papar Sektaris Panpel Tgk Ismuhadi di sela-sela gotong royong di Masjid Besar Baitul Muttaqin Idi Cut, Minggu (15/ 7) siang. Dikatakan, persiapan demi persiapan telah dilakukan oleh Badan Komunikasi Pemuda Remaja Masjid Indonesia (BKPRMI) Idi Cut selaku penggerak kegiatan Peringatan Hari-hari Besar Islam (PHBI) di Idi Cut. “Untuk dana kita panitia masih mencari dan mengumpulkan dari para dermawan dan pihak-pihak yang tidak terikat,” kata Ismuhadi. Ketua BKPRMi Idi Cut, Tgk Aswadi secara bersamaan menambahkan, kegiatan dakwah yang digelar pihaknya berdasarkan kepada agenda tahunan untuk memeriahkan PHBI. “Dukungan dari Muspika, MPU dan tokoh adat dan tokoh masyarakat akan menjadi sudut suksesnya kegiatan dakwah akbar nanti,” tandasnya. (b24)

70 Persen Siswa Bimbingan Lulus SNMPTN KUALASIMPANG ( Waspada): Sebanyak 22 Siswa dari 32 siswa Bimbingan Belajar yang mengikuti program super intensif SNMPTN 2012 berhasil lulus di berbagai Perguruan Tinggi Negeri (PTN), Pendiri Bima Aceh Tamiang, Taufik Ramadhan, S.Sos didampingi Pimpinan BT/BS BIMA Aceh Tamiang TM Sahudra, MPd dan Manajer Umum M Yasir SPd di Gedung BIMA-Aceh Tamiang Karang Baru kepada Waspada, Minggu (15/7) memaparkan Jumlah siswa yang mengikuti super intensif SNMPTN di BT/BS BIMA Aceh Tamiang ini 32 orang dan 22 orang atau 70 persen di antaranya berhasil lulus di PTN yang di dominasi oleh Universitas Syiah Kuala (Banda Aceh) dan Universitas Sumatera Utara (Medan) .Untuk Unsyiah ada 13 Orang yang lulus, USU 6 orang, Universitas Malikul Saleh 2 Orang dan Universitas Negeri Medan Unimed) hanya ada 1 orang yang lulus SNMPTN Tahun 2012 yang telah diumumkan secara serentak pada 7 Juli 2012. “ Kita berharap kedepannya semakin banyak persentase kelululusan SNMPTN yang berasal dari Bimbingan belajar di BIMA Aceh Tamiang ,” ujar Sahudra.(b23)

Senin 16 Juli 2012

Kembali Ke Syariah Secara Kaffah

‘Haram’ Suara Petasan Saat Tarawih IDI (Waspada): Tokoh pemuda dan masyarakat di Aceh Timur meminta jajaran kepolisian baik Polres ataupun Polsek untuk mencegah suara mercon selama berlangsungnya ibadah shalat tarawih umat Islam dalam bulan Ramadhan tahun ini. Hal itu dinilai penting demi khusuknya ibadah baik yang dilaksanakan di mesjid-masjid ataupun di rumah ibadah sejenisnya di Aceh Timur. “Kita minta pedagang mercon untuk menghormati ibadah puasa Ramadhan umat Islam,” kata Rahmad Hidayat, tokoh masyarakat Idi kepada Waspada Minggu (15/7). Menurut dia, sudah seharusnya pedagang mercon sadar dengan segala peribadatan umat Islam di dalam bulan suci Ramadhan. Begitu juga dengan pembeli mercon agar tidak membakar atau membunyikan mercon pada saat malam hari. Jikapun sudah menjadi tradisi para anak-anak diharap untuk tidak membunyikan mercon selama pelaksanaan shalat tarawih. “Untuk mengantisipasi munculnya suara mercon ataupun petasan selama berlangsungnya shalat tarawih diharapkan polisi bisa siaga di titik-titik yang biasa muncul seperti diseputaran Masjid Agung Darussalihin Idi,” kata Rahmad Hidayat. Hal yang sama juga dikatakan Ketua Badan Komunikasi Pemuda Remaja Masjid Indonesia (BKPRMI) Aceh Timur, Tgk Ilyas, SPd. Dia bahkan meminta kepolisian untuk menggulung habis pedagang petasan yang tidak mengantongi izin. “Jika tidak mengantongi izin, lebih baik gulung saja dan amankan seluruh petasannya,” katanya. Jikapun mengantongi izin dagang petasan, lanjut Ilyas, dia menyarankan para pedagang untuk menghormati bulan ramadhan agar tidak berdagang selama pelaksaan ibadah shalat tarawih. “Mari kita hormati ramadhan sebagai bulan yang penuh mahgfirah, rahmad dan ampunan dariNya,” tandas Ilyas. (b24)


Massa HTI Langsa Pawai Simpatik Sambut Ramadhan


MASSA HTI ketika menggelar pawai simpati di alun-alun Lapangan Medeka dalam menyambut bulan suci Ramadhan 1433 H, Sabtu (14/7).

Aceh Timur Siap Lepas PNS Dan Pejabat Yang Bermasalah LANGSA (Waspada): Sekretaris Daerah (Sekda) Kabupaten Aceh Timur Syaifannur, SH.MM menegaskan pihak Pemkab Aceh Timur siap melepas pejabat ataupun pegawai negeri sipil (PNS) daerah ini yang ingin pindah ke daerah lain atau luar Kabupaten Aceh Timur. Namun kran itu hanya terbuka bagi pejabat dan PNS yang malas, bandel dan sering melalaikan tugasnya. Namun untuk pejabat/PNS yang memiliki kompetensi baik, bertanggungjawab, loyal dan berkualitas

serta disiplin, kran kepindahan tertutup rapat . Hal itu ditegaskan Syaifannur saat memberikan materi jam pimpinan pada peserta Diklat Kepemimpinan Tingkat IV Angkatan V Provinsi Aceh Kabupaten Aceh Timur, pekan lalu di Aula BKPP atau SKB Aceh Timur di Langsa. Pernyataan Sekda ini, cukup beralasan, mengingat masih banyak PNS dan pejabat daerah ini yang memohon mutasi pindah ke luar Aceh Timur. Namun ,karena sebagian di antaranya masih sangat berpotensi dan berkualitas, terpaksa permohonan kepindahan mereka kita tolak, seperti ada yang minta pindah ke Banda Aceh dan Langsa serta daerah lainnya. Namun untuk

alasan yang jelas seperti tugas negara dan lainnya, tentu kita pertimbangkan, sebut Sekda.” Untuk yang malas malas, bandel dan sering lalai dalam tugas, mungkin kami sebagai pembina kepegawaian siap melepas sesegera mungkin, namun bagi yang berkualitas dan bertanggungjawab, kran tersebut tertup rapat,tandas Sekda. Saat ini lanjutnya, Aceh Timur butuh PNS yang mampu bertindak sebagai peren-cana, pelaksana dan pengawas serta berjiwa jujur, ikhlas dan siap mengabdi demi kemajuan daerah, nusa dan bangsa.”Mudah mudahan, anda peserta Diklatpim IV ini cakap untukkriteria tersebut,” tutupnya. (b20)

Pejabat Yang Tidak Loyal Segera Dipindahkan LHOKSEUMAWE ( Waspada): Semua pejabat di lingkungan Kabupaten Aceh Utara saat ini sedang kebingungan dan kasak-kusuk mencari informasi apakah mereka akan dipindahkan atau tidak oleh Bupati dan Wakil Bupati Aceh Utara periode 2012-2017. Karena ketidakpastian itu juga, membuat kinerja Kadis, kepala kantor, kepala badan lesu darah. Karena itu, Waspada mencoba mengkonfirmasi Muhammad Thaib, Bupati Aceh Utara dan Drs Muhammad Jamil, M.Kes,Wakil Bupati Aceh Utara, Minggu (15/7), tentang kemungkinan akan dilakukannya mutasi secara besar-besaran pada masa kepemimpinnya itu. Kata Muhammad Thaib, mutasi pejabat memang akan dilakukan, namun waktunya belum dapat ditentukan dan bahkan rencana tersebut belum juga dibicarakan dengan Baperjakat. Meskipun mutasi akan dilakukan, para pejabat untuk tidak lesu darah dalam memberikan pelayanan kepada ma-

syarakat. Pasalnya, para pejabat yang akan dimutasi hanya para pejabat yang tidak loyal kepada masyarakat Aceh Utara. “Kalau pejabat itu loyal kenapa kita pindahkan, karena dia sudah berpengalaman, tapi kalau dia tidak loyal untuk apa dipertahankan, yang ada rusak aja. Begitupun, sampai saat ini kami belum membahas persoalan itu,” kata Muhammad Thaib diamini Drs M Jamil, M.Kes. Ditanya apakah mutasi hanya akan dilakukan pada dinasdinas tertentu saja, bupati mengatakan, percaya atau tidak dan dengan tidak mengagungagungkan seseorang, namun ada pertanyaan, adakah sekarang yang lahir lebih daripada dia, yang mampu dalam bekerja. “Aceh Utara membutuhkan orang seperti dia. Karena itu jangan takut pada mutasi, karena mutasi hanya dilakukan pada orang-orang yang tidak bekerja. Sekarang mari mengukur diri, apakah termasuk sebagai orang

yang profesional dalam bekerja atau bukan,” ulang M. Thaib. Jimbron, Direktur Eksekutif Lembaga Swadaya Masyarakat Reuncong Aceh kepada Waspada, Minggu (15/7) mengaku setuju dengan keputusan yang diambil oleh Bupati dan Wakil Bupati Aceh Utara tentang rencana mutasi akan dilakukan pada orang-orang yang tidak profesional dalam bekerja. Kalau orang-orang yang tidak profesional terus dipertahankan, maka akan sia-sia, bak kata pepatah arang habis besi binasa. Namun, kalau mutasi dilakukan oleh kepala daerah hanya karena orientasi uang sangat memalukan dan akan menjadi ancaman kegagalan dalam melaksanakan pembangunan lima tahun ke depan. “Karena itu, bupati harus cerdik dalam memilih siapa saja yang layak dipertahankan dan siapa yang tidak layak. Yang paling penting, mutasi dilakukan bukan atas dasar finansial,” kata Jimbron kemarin. (b18)

LANGSA (Waspada): Seratusan masa DPD II Hizbut Tahrir Indonesia (HTI) Kota Langsa mengelar pawai simpatik Tarhib Ramadhan 1433 H bertajuk Ramadhan Kokohkan Iman, Tegakkan Syariah dan Khilafah di alun-alun Lapangan Merdeka Kota Langsa, Sabtu (14/ 7). Massa yang mulai berkumpul di Masjid Raya Darul Falah Kota Langsa, bergerak menuju Jalan Ahmad Yani dan ke alun-alun Lapangan Medeka untuk melakukan orasi, lalu bergerak kembali menuju masjid raya. Koordinator aksi Musri dalam orasinya mengatakan, pawai simpatik ini mengajak masyarakat untuk lebih bersemangat memperjuangkan syariat Islam secara kaffah. “Bulan Ramadhan adalah bulan ketaatan, bulan murâqabah. Ramadhan juga adalah bulan pengorbanan di jalan Allah SWT. Di dalamnya setiap muslim dituntut untuk berkorban dengan menahan rasa lapar dan dahaga demi meraih derajat taqwa,” sebutnya. Taqwa adalah puncak hikmah dari ibadah shaum pada bulan Ramadhan. Perwujudan taqwa secara individu tidak lain adalah dengan melaksanakan semua perintah Allah SWT dan menjauhi semua larangan-Nya. Sedang perwujudan taqwa secara kolektif adalah dengan menerapkan syariah secara kaffah dalam seluruh aspek kehidupan bermasyarakat dan ber-

negara di bawah naungan khilafah. “Semua kebaikan yang didapat sepanjang bulan Ramadhan tentu menjadi kurang bermakna jika tidak ditindaklanjuti oleh pelaksanaan syariah secara kaffah, karena justru itulah sesungguhnya wujud ketaqwaan yang hakiki,” kata Musri. Berkenaan dengan kedatangan bulan suci Ramadhan 1433 H Hizbut Tahrir Indonesia menyerukan kepada seluruh umat Islam Indonesia agar dapat melaksanakan shaum Ramadhan dengan sebaik-baiknya, dengan penuh khusyu’ dan ikhlas, serta dengan penghayatan sehingga seluruh hikmah puasa dapat ditangkap dengan baik. “Suasana bulan Ramadhan yang juga disebut syahrul jihad (bulan jihad) hendaknya mampu menambah kekokohan iman, semangat untuk berpegang teguh kepada Islam, serta lebih giat lagi melakukan amar ma’ruf nahi mungkar dan berjuang demi terwujudnya kehidupan Islam melalui tegaknya kembali syariah dan khilafah di muka bumi,” sebutnya. Dijelaskan Musri kembali, massa yang turun pada hari ini berkisar 200an terdiri dari kalangan pelajar, ibu-ibu pengajian , pengurus HTI dan tokoh-tokoh masyarakat serta warga Kota Langsa. Selain menggelar aksi simpati, kami juga membagi-bagikan jadwal dan selebaran Imsakiah Ramadhan 1433 H. (m43)

Ratusan Santri MUQ Bustanul Ulum Unjukrasa

Tuntut Dikembalikan Guru Yang Dipecat LANGSA (Waspada): Ratusan santri dari berbagai jenjang pendidikan di Madrasah Ulumul Quran (MUQ) Yayasan Bustanul Ulum Langsa, Minggu (15/7), menggelar aksi demo di halaman madrasah. Mereka meminta pihak yayasan segera mengembalikan guru mereka yang telah dipecat secara sepihak beberapa waktu lalu. Aksi damai itu berlangsung sekitar satu jam, dan selanjutnya para siswa membubarkan diri dengan tertib. Pantauan Waspada, ratusan siswa MUQ Bustanul Ulum Langsa sudah berkumpul di halaman sekolah sekitar pukul 11:00 sambil mengusung berbagai spanduk yang berisikan kecaman terhadap pihak yayasan. Meski tidak melakukan orasi dan hanya berkumpul sebagai ungkapan rasa simpatik terhadap guru yang telah dipecat, namun isi spanduk yang mereka usung dapat mewakili orasi mereka. Isi spanduk yang mereka usung, terlihat para santri menginginkan guru dayah mereka yang telah dipecat beberapa waktu lalu agar segera dikembalikan. Bahkan mereka menilai sejak Yayasan Bustanul Ulum Langsa dipegang Aidil Fan, system pendidikan dayah telah berubah jauh dari apa yang dicita-citakan oleh pendiri madrasah itu. Yang mengherankan, posisi guru yang telah dipecat, kini digantikan oleh orang lain yang diduga merupakan kader salah satu partai politik. Pada bagian lain, puluhan wali murid MUQ Yayasan Bustanul Ulum Langsa pada kesempatan yang sama, menggelar pertemuan dengan salah seorang pimpinan Yayasan yaitu Ustadz Nurdin Ibrahim. Pada kesempatan itu, salah seorang Wali murid mengungkapkan sistem pendidikan pada MUQYayasan Bustanul Ulum selama ini sudah berbeda dan terlihat mulai memprihatinkan. Hal ini karena Ketua Yayasan Aidil Fan

merombak semua system pendidikan termasuk menggantik akte notaris pendirian yayasan. “Tentunya dengan berubahnya sistem pendidikan maka berpengaruh pula pada kualitas santri yang sedang menempuh pendidikan di sini,” ujar wali murid. Karena itu, hampir semua wali murid yang hadir pada pertemuan itu, meminta agai Aidil Fan segera dicopot dari jabatannya sebagai Ketua Yayasan Bustanul Ulum Langsa. Sementara sejumlah wali santri yang akan menjemput anaknya pulang pada hari terakhir sekolahnya itu menggelar pertemuan dengan pihak YDBU. Sesuai janji pihak yayasan sebelumnya akan memberikan penjelasan resmi terkait perubahan sistem belajar dan manajemen di MUQ Langsa. Seperti saat ini siswa di MUQ Langsa apabila shalat shubuh tapi tak lagi diharuskan kepada santri untuk membaca doa qunut dan shalat tahajjud juga boleh dilakukan berjamah dan termasuk biaya-biaya santri MUQ yang terjadi pembengkakan pada tahun ajaran 2012 ini. Namun, hingga pukul 12:00 pihak Yayasan Dayah Bustanul Ulum tidak juga berani menjumpai pada wali santi. Menurut informasi, pada hari itu tidak satupun pihak yayasan berada di tempat, hingga akhirnya aksi unjuk rasa ratusan santri MUQ Langsa membubarkan diri pada pukul 12:00, karena masing-masing santri banyak yang dijemput para orangtua disebabkan pada Minggu (15/7) merupakan hari terakhir santri belajar. Sekretaris yayasan, Tajul, saat dikonfirmasi Waspada mengatakan semua yang ditudukan itu tidak benar dan fitnah. Yayasan hanya ingin menegakkan disipilin tapi karena ada pihak yang tidak senang maka anak diprovokasi. (m43/a20)

Bupati Aceh Timur: Jiwai Alquran BUPATI Aceh Timur Hasballah bin Thaib yang akrap disapa Rocky berpesan ajang Mushabaqah Tilawatil Quran (MTQ) tidak hanya sebatas perlombaan untuk meraih yang terbaik di antara yang baik, tetapi umat Islam pada umumnya dan masyarakat Aceh Timur pada khususnya harus menjiwai Alquran. Menurut Hasballah, Alquran tak hanya sebatas sebagai kitab suci, tapi Alquran harus benar-benar dijadikan sebagai undang-undang dan pedoman hidup umat Islam agar mendapatkan kesenangan di dunia dan bahagia di akhirat. “Berlombalah secara Islami, berlombalah sebagaimana dianjurkan Rasulullah sehinga apapun kegiatan yang kita lakukan menjadi ibadah dan mendapat pahala disisi-Nya,” kata Hasballah dalam sambutan pada Pembukaan MTQ XXXII Aceh Timur, Kamis (11/7). Kegiatan MTQ kali ini dipusatkan di halaman Masjid Manzilul Minan Gampong Beusa, Kecamatan Peureulak Barat. Bupati Aceh Timur mengharapkan, pelaksanaan MTQ merupakan sebuah wahana dalam rangka memacu pengembangan tilawah, hafalan dan pendalaman isi kandungan Alquran, karenanya semua umat Islam tidak boleh berhenti menjiwai Alquran, sebab sebuah ke-

giatan yang bersifat kolosal dan sarat dengan syiar Islam akan sia-sia. “Percuma saja apabila tidak meninggalkan motivasi dan pengaruh positif di masyarakat,” kata Hasballah M. Thaib seraya menambahkan, untuk itu diperlukan perhatian, keterlibatan dan tanggungjawab seluruh komponen umat dan jajaran pemerintah agar penyelenggaraan kegiatan MTQ dapat memberi motivasi dan pengaruh positif yang tampak serta dapat dirasakan secara nyata dalam

perkembangan kehidupan bangsa dan agama. Ketua Panpel MTQ XXXII Aceh Timur, T Reza Rizki melaporkan kegiatan itu berlangsung 12 hingga 15 Juli 2012 dengan jumlah peserta 373 orang qariqariah dan 72 official/pelatih dari 24 kecamatan. “Diantara cabang yang diperlombakan Tartilul Quran, Tilawah AnakAnak, Tilawah Remaja, Tilawah Dewasa, Hifdhil Quran, 1,5 dan 10 juz, Fahmil Quran, Syarhil Quran,” katanya. Muhammad H Ishak

Waspada/Muhammad H Ishak

BUPATI Aceh Timur Hasballah bin M Thaib saat menekan sirine tanda dibukanya MTQ XXXII Aceh Timur di halaman Masjid Manzilul Minan, Kec. Gampong Beusa, Kamis (12/7).


RATUSAN santri Madrasah Ulumul Quran (MUQ) Yayasan Dayah Bustanul Ulum (YDBU) Langsa, Minggu (15/7) berunjuk rasa akibat dipecatnya tujuh guru pengajar mereka oleh pihak yayasan.

Pedagang Pakaian Minta Perlindungan Tempat Jualan Selama Bulan Ramadhan LANGSA (Waspada): Para pedagang pakaian di Kota Langsa meminta pemerintah melindungi aktifitas mereka berjualan selama bulan Ramadhan tanpa diganggu dengan kedatangan para pedagang luar yang menggelar dagangannya secara bebas di tempat-tempat sarana umum. Karena jika pedagang luar bebas menggelar dagangannya di tempat-tempat umum seperti di lapangan merdeka dan di pinggir-pinggir jalan, para pembeli lebih mudah menjangkau tempat mereka dan akan enggan pergi ke tokotoko, sehingga omset jualan pedagang resmi otomatis akan terganggu. Demikian sejumlah pedagang pakaian kepada Waspada di Langsa, Minggu (15/7), dengan harapan Pemrintah Kota Langsa dan DPRK setempat mendengarkan aspirasinya. Adapun bentuk perlindungan yang diharapkan, supaya pemerintah tidak memberi izin sarana umum digunakan untuk kegiatan berjualan. Apalagi dengan menggunakan sarana umum untuk berjualan juga merupakan suatu kezaliman terhadap orang lain, demikian kata

Jufri, salah seorang pedagang kain yang juga dibenarkan dua temannya Khaidir dan Kamal. Menurut mereka, kezaliman yang terjadi jika sarana umum dipergunakan untuk tempat berjualan yang pertama kali merasakan akibatnya adalah pedagang resmi yang membayar pajak dan menyewa toko. “Kami sebagai pedagang resmi sangat merasakan kezaliman itu, karena jualan kami akan terganggu justru saat-saat kami berharap bisa mendapat masa panen setahun sekali,” ujar Khaidir. Sementara kezalimannya lainnya juga dirasakan masyarakat secara umum, badan jalan menjadi sempit sehingga akan mengganggu lalulintas. Demikian juga jika lapangan digunakan untuk tempat berjualan yang terzalimi adalah orang-orang yang mau melakukan kegiatan olahraga, terpaksa mereka tidak bisa berolahraga. “Padahal kegiatan olah raga juga sangat penting untuk menjaga kesehatan masyarakat selama bulan Ramadhan,” demikian Khaidir beralasan.(b20)

Waspada, Senin 16 Juli 2012