Page 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Legi, 28 April 2010/13 Jumadil Awal 1431 H

No: 23132 Tahun Ke-64

Terbit 28 Halaman (A1-8, B1-12, C1-8)

Harga Eceran: Rp 2.500,-

Lulus Cum Laude, Jadi PNS Tukang Pel

PRT Indonesia Rela Mati Demi Anak Majikan

PEKANBARU (Waspada): Untung tak dapat diraih, malang tak dapat ditolak. Pepatah Melayu ini yang dirasakan Jack Lord, PNS di Lembaga Penjamin Mutu Pendidikan (LPMP) Riau. Dia lulus dengan status cum laude di Universitas Riau (Unri), namun kini tugasnya mengepel ruangan. Jack, begitulah panggilan akrab pria bertubuh kecil kelahiran Tanjung Pinang, 30 tahun silam. LPMP Riau tempatnya bekerja, ada di bawah naungan Ditjen Peningkatan Mutu Pendidik dan Tenaga Kependidikan (PMPTK) Kementerian Pendidikan Nasional. Jack adalah PNS golongan III A, yang berkantor di Jl Gajah, Kecamatan Tenyanan Raya, Pekanbaru. Pria lajang ini, tidak gengsi walau selaku sarjana dia diberi tugas sebagai tukang sapu dan pel di tempat kerjanya. LPMP Riau memiliki banyak ruangan diklat untuk pelatihan para guru atau para calon PNS. Kantor LPMP berdiri di atas lahan 3,6 hektar dengan puluhan ruangan. Di sanalah Jack harus bertugas menyapu ruangan dan mengepel.

SINGAPURA (Waspada): Dia demikian sayang pada anak majikannya sehingga dia rela menyerahkan jiwa raganya untuk gadis kecil asuhannya. Pada Sabtu (24/4) malam lalu Puji Astuti — seorang pembantu rumahtangga (PRT) asal Indonesia, menghembuskan nafas terakhirnya untuk membuktikan cintanya dan dia baru saja menyelamatkan anak bosnya yang berusia satu tahun. Puji, 28, sedang menyeberang jalan bersama majikannya, putri termuda Ny. Lam (foto), ketika bus SMRT menabraknya di persimpangan Choa Chu Kang Street 52 dan Choa Chu Kang North 6. Dia menghalangi bayi itu berjalan maju namun dia yang dilindas roda bus, kata laporan The New Paper dan harian berbahasa China Lianhe Zaobao. Dia segera dilarikan ke RS Universitas Nasional Singapura, namun jiwanya tak tertolong, Puji meninggal dunia akibat luka berat yang dideritanya.Putri Lam hanya menderita luka ringan berupa lecet-lecet pada lengan kirinya.

Lanjut ke hal A2 kol. 2

dtc

Lanjut ke hal A2 kol. 1

tst

Ongkos Haji 2010 Naik JAKARTA (Antara): Kementerian Agama mengajukan usulan besaran kenaikan ongkos naik haji atau Biaya Penyelenggaraan Ibadah Haji 2010 menjadi sebesar 3.577 dolar AS, ditambah biaya asuransi Rp100.000. Menteri Agama Suryadharma Ali dalam rapat kerja dengan komisi VIII DPR RI di

gedung DPR, Selasa(27/4), mengatakan, usulan BPIH itu terdiri dari komponen pener-

bangan sama dengan tahun lalu sebesar 1.787 dolar AS, general service fee selama di Arab Saudi sebesar 159,7 dolar AS, biaya operasional di Arab Saudi 1.209,5 dolar AS, “living cost” 405 dolar AS, safeguarding 15,8 dolar AS dan asuransi jemaah haji sebesar Rp100.000. Dibanding tahun 2009, kata Menag, BPIH mengalami

kenaikan 133 dolar AS yang diakibatkan kenaikan komponen akomodasi di Makkah yang disebabkan lokasi pemondokan yang semakin dekat dengan Masjidil Haram, paling jauh 4.000 meter dan adanya penambahan ruang per orang menjadi 4 meter persegi. “BPIH tahun 2009/1430 H

sebesar 3.444 dolar AS dan tahun 2010/1431 diusulkan menjadi sebesar 3.577 dollar AS ditambah biaya asuransi sebesar Rp100.000 per orang,” katanya. Menag menambahkan, kenaikan sewa akomodasi di Mekkah juga diakibatkan masih terjadinya pembongkaran gedung-gedung di sekitar

Masjidil Haram yang berdampak pada tidak seimbangnya supply dan demand. Sementara untuk tarif BPIH Khusus, diusulkan minimal 6.500 dolar AS yang penyelenggaraan sepenuhnya menjadi tanggung jawab Penyelenggara Ibadah Haji Khusus (PIHK). Sebelumnya, Suryadhar-

ma Ali mengatakan bahwa naik turunnya BPIH dipengaruhi banyak komponen seperti harga bahan pesawat, nilai tukar, dan pemondokan. Karena itu, ia mengaku tidak bisa langsung menentukan ONH tahun ini karena masih melakukan penghitungan. “Harga avtur, nilai tukar rupiah itu ikut menentukan,” katanya.

PARIS, Prancis (AP): Mantan diktator Panama Manuel Noriega (foto) menghadapi tuduhan kejahatan pencucian uang di satu pengadilan Prancis Selasa (27/4) setelah dia diekstradisi dari Amerika Serikat. Sidang itu membuka satu perjuangan hukum baru bagi orang kuat Panama itu yang telah menghabiskan waktunya selama dua dasawarsa di belakang jeruji penjara di Florida karena melakukan perdagangan obat bius. Pihak berwenang Prancis menyanet takan Noriega, yang telah digulingkan dalam satu invasi AS tahun 1989, telah melakukan pencucian uang kira-kira AS$7 juta dari keuntungan perdagangan obat bius, dengan membeli sejumlah apartemen mewah dengan istrinya di Paris. Noriega telah didakwa in absentia, namun Prancis setuju untuk menghadapkannya ke satu pengadilan jika dia diekstradisi. Noriega yang berusia 72 tahun itu tiba Selasa (27/4) pagi dengan satu penerbangan langsung dari Miami dan telah diberikan surat perintah penangkapan internasional. Dia kemungkinan menghadapi hukuman 10 tahun penjara lainnya jika didakwa di Prancis. Para pengacara Prancis yang membela Noriega berusaha untuk mendapatkan pembebasannya segera dan mereka

Lanjut ke hal A2 kol. 7

Lanjut ke hal A2 kol. 3

Mantan Diktator Manuel Noriega Diekstradisi Ke Prancis

Medan, Madina Berpeluang Juara Umum

Antara

PETUGAS keamanan menutup sejumlah pintu sel yang berada di lantai dasar Rumah Tahanan khusus Tindak Pidana Korupsi (Tipikor) yang berada di kompleks Lapas Cipinang Klas I, Jakarta Timur, Selasa (27/4).

Patrialis Resmikan Rutan Khusus Tipikor JAKARTA (Antara): Menteri Hukum dan Hak Asasi Manusia (Menkumham) Patrialis Akbar meresmikan rumah tahanan klas I khusus Tindak Pidana Korupsi pertama di Indonesia di Jakarta, Selasa (27/4). Patrialis mengatakan peresmian Rutan Khusus tersangka korupsi itu menjadi sa-

Kelulusan UN Sumut Tinggi Kepala Dinas Pendidikan Sumut Bahrumsyah mengatakan, kualitas pelaksanaan UN tingkat SMA sederajat tahun 2010 lebih baik dari tahun lalu, sehingga masuk peringkat 10 besar tingkat kelulusan UN di Indonesia. B2

Aceh Butuh Kopertis Ketua Majelis Pendidikan Aceh Prof Dr Warul Walidin AK, MA minta pemerintah pusat membentuk Kopertis tersendiri bagi Aceh karena selama ini 105 perguruan swasta di Aceh tunduk kepada Kopertis Wil. I. C3

Penyidik Kejari Stabat resmi menahan Manajer Baitul Maalwattamwil (BMT) Sejahtera Langkat terduga korupsi bantuan dana Kementerian Perumahan Rakyat. C1

lah satu solusi untuk mengatasi kelebihan kapasitas lembaga pemasyarakatan (Lapas) atau rutan di Indonesia. Sementara itu, arsitek Rutan Tindak Pidana Korupsi (Tipikor), Purwo Ardoko menyebutkan rancangan Rutan Khusus itu berdasarkan standar dari Perserikatan Bangsa-

Bangsa (PBB) dengan jumlah kamar sebanyak 64 unit dan berkapasitas 256 orang. Ardoko menuturkan bangunan rumah tahanan (Rutan) Tipikor terbagi dari tiga lantai, lantai satu terdapat 16 kamar yang dihuni satu tahanan untuk satu kamar bagi tahanan yang sakit atau tua.

Sedangkan lantai dua dan tiga terdiri dari 12 kamar setiap lantai diperuntukkan bagi tahanan lima orang untuk satu kamar. “Setiap ruangan memiliki luas 7 X 5 meter persegi pada lantai dua dan tiga, sedangkan lantai satu luasnya 3 X 6 meter,” ujar Ardoko. Lanjut ke hal A2 kol. 1

Pejabat Langkat Kumpulkan Berkas Buat KPK

BACA DI HALAMAN DALAM

Dugaan Korupsi, Manajer BMT Sejahtera Langkat Ditahan

Lanjut ke hal A2 kol. 1

MTQ XXXII Sumut

Komplain UN Diharapkan Berhasil RANTAUPRAPAT (Waspada): Terkait kegagalan nilai Ujian Nasional (UN) 99 orang siswa SMA Negeri 2 Kec. Rantau Utara, pihak sekolah tersebut, Selasa (27/4) melakukan komplain ke Dinas Pendidikan Provinsi Sumatera Utara dan diharapkan komplain tersebut berhasil sebagaimana yang diharapkan pihak sekolah dan para siswa peserta UN. Kepala Dinas Pendidikan L.Batu Drs Heriyanto, MM melalui Sekretaris Drs Iskandar menyampaikan hal itu kepada Waspada, Selasa (27/4) melalui selularnya. Menurutnya, Dinas Pendidikan L.Batu bukan dan tidak pernah menolak UN, melainkan pihak SMAN 2 R.Prapat melakukan komplain atau semacam klarifikasi ke Dinas Pendidikan Provsu di Medan dengan difasilitasi oleh Diknas L.Batu. Pihak yang berangkat ke Dinas Pendidikan Provsu adalah kepala sekolah SMA Negeri 2 Rantau Utara M Yusuf Rangkuti S Pd dan salah seorang panitia UN dari Dinas Pendidikan L.Batu Khairulis. Komplain itu sendiri dilakukan guna menampung aspirasi para guru SMA Negeri 2

Ia mengaku pihaknya kini tengah berusaha meningkatkan kualitas pelayanan bagi calon jamaah haji tahun ini. Sebagai contoh, lebih banyak jamaah haji tahun ini yang akan tinggal di pemondokan lebih dekat dengan Masjidil Haram atau Kabah.

Waspada/Abdul Khalik

TEMPAT pengeringan getah PT Darmek Kota Tebingtinggi, runtuh saat hujan lebat. Seorang pekerja terkubur hiduphidup hingga ditemukan tewas pada pukul 18:30.

Dek Getah Runtuh, 1 Pekerja Tewas Terkubur TEBINGTINGGI (Waspada): Bangunan tempat pengeringan getah olahan atau dek, milik PT Darmasindo Inti Karet alias PT Darmek runtuh di tengah suasana hujan lebat, Selasa (27/4).

Lanjut ke hal A2 kol. 3

STABAT ( Waspada): Meski kunjungan Tim KPK ke Langkat telah usai selama dua hari, namun sejumlah pejabat Pemkab Langkat tetap sibuk. Hal itu disebabkan adanya sejumlah berkas-berkas penting lainnya yang harus dikumpulkan mereka. Karena itu baik siang ataupun malam aparatur harus mengumpulkan sejumlah berkas dimaksud. ‘’Jika sewaktu-waktu KPK kembali datang, berkas yang diperlukan sudah ada,’’ kata salah seorang pejabat, Selasa (27/4). Hal itu juga dibenarkan Sekda Surya Djahisa. Dijelaskan, meski kunjungan KPK telah usai, data yang dianggap perlu tetap disiapkan terkait

Lanjut ke hal A2 kol. 1

Waspada/ist

RATUSAN warga Simpang Gambir berdiri di tengah jalan untuk mensweeping setiap kenderaan yang melintas, Selasa (27/4).

PANYABUNGAN (Waspada): Malam ini, Rabu (28/4), Gubernur Sumatera Utara H Syamsul Afirin SE, direncanakan menutup pelaksanaan MTQ XXXII tingkat Provinsi Sumut di lapangan Aek Godang, Kec. Panyabungan, Kab. Mandailing Natal. Berdasarkan data dihimpun Waspada, Selasa (27/4), kafilah Medan dan tuan rumah Madina berpeluang besar untuk meraih juara umum. Peserta dari kedua kafilah ini mendominasi cabang yang difinalkan. Pada Senin (26/4) malam, dewan hakim mengumumkan para peserta yang masuk final.

Lanjut ke hal A2 kol. 6

Presiden No Comment Soal Boediono Dan Mulyani JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono memilih tidak berkomentar terkait pemanggilan terhadap Wakil Presiden Boediono dan Menteri Keuangan Sri Mulyani untuk dimintai keterangan dalam Bank Century oleh Komisi Pemberantasan Korupsi. Juru bicara Kepresidenan Julian Aldrin Pasha di Istana Merdeka, Jakarta, Selasa(27/4), mengatakan, Presiden Yudhoyono sudah mengetahui pemanggilan terhadap Boediono dan Sri Mulyani oleh KPK. Meski demikian, menurut Julian, Presiden memilih tidak merespons pemanggilan tersebut. “Presiden sudah mendengar rencana pemanggilan Bapak Boediono dan Ibu Sri Mulyani ke KPK. Bapak Presiden

Lanjut ke hal A2 kol. 3

Warga Dua Desa Di Madina Saling Sweeping

Seramp ang erampang

PANYABUNGAN (Waspada): Warga Natal, Kec. Natal, dan Simpang Gambir, Kec. Lingga Bayu, Kab. Mandailing Natal, saling sweeping akibat persoalan lahan yang digarap PT Perkebunan Sumatera Utara (PT PSU). Hingga Selasa (27/4), kondisi di dua lokasi masih mencekam. Ratusan warga berkumpul di jalan dan melakukan sweeping terhadap setiap kendaraan yang melintas. Lanjut ke hal A2 kol. 3

- Makin naik makin bejibun yang pergi - He...he...he...


WASPADA Banda Aceh ‘Juara’ Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Legi, 28 April 2010/13 Jumadil Awal 1431 H

No: 23132 Tahun Ke-64

Edisi Aceh

Terbit 28 Halaman (A1-8, B1-12, C1-8)

Harga Eceran: Rp 2.500,- (belum termasuk ongkos kirim)

BANDA ACEH (Waspada): Kota Banda Aceh berada pada ranking pertama (juara) dalam kasus pelanggaran Syariat Islam dari seluruh kabupaten/ kota di Provinsi Aceh sepanjang 2009. Di kota yang baru merayakan 805 hari jadinya itu, tercatat 920 dari 3.701 kasus yang terdaftar. Hal ini terungkap dari rekapitulasi data pelanggaran Qanun Syariat Islam di Provinsi Aceh tahun 2009 yang diterima wartawan dari Kepala Satuan Polisi Pamong Praja dan Wilayatul Hisbah Aceh, Drs.H.Marzuki.A, MM, Selasa (27/4) di Banda Aceh. Pelanggaran terhadap Qanun Syariat Islam, pada 2009

Ratusan Orang Bakar Mobil Dan Rusak Bangunan JAKARTA (Waspada): Aksi amuk massa terjadi di Bogor, Jawa Barat saat sebuah bangunan yang ditenggarai akan dijadikan sekolah oleh sebuah yayasan di Desa Cibeureum, Kecamatan Cisarua, dirusak massa. Massa juga membakar dua buah mobil. Informasi yang dihimpun, sekitar 100 orang berdatangan ke lokasi kejadian sekitar pukul 11.00WIB, Selasa (27/4). Mereka langsung memaksa masuk ke areal wisma tersebut. Selanjutnya, tanpa banyak bicara massa langsung melakukan perusakan. Ratusan orang tersebut membakar sebuah pos pengamanan yang berada di dekat pintu masuk wisma tersebut. Mereka juga merubuhkan pagar wisma yang terletak di tepi jalan akses menuju Taman Safari itu. Tidak hanya itu, massa yang terlihat sangat marah juga membakar dua buah mobil, yakni sebuah mobil Kijang dan sebuah mobil bak terbuka. Saat perusakan berlangsung, tidak ada pihak-pihak yang melakukan pencegahan. Lanjut ke hal A2 kol. 3

mencapai 3.701 kasus. Kasus yang paling mendominasi adalah pelanggar Qanun Nomor 11 Tahun 2002 tentang pelaksanaan Syariat Islam Bidang Aqidah, Ibadah, yaitu 810 kasus, disusul kasus mesum sebanyak 92 kasus. Lanjut ke hal A2 kol. 7

KPK Periksa Wapres Dan Menkeu JAKARTA (Waspada): Komisi Pemberantasan Korupsi (KPK) akan memeriksa Wapres Boediono dan Menteri Keuangan Sri Mulyani Indrawati dalam perkara dana talangan untuk Bank Century, Kamis (29/4), besok. Sekjen Kementerian Keuangan Mulia P Nasution dalam keterangannya di Jakarta Selasa mengatakan, permintaan surat pemeriksaan KPK tersebut bertanggal 23 April 2010 dengan pemberian keterangan dijad-

walkan Kamis 29 April 2010. “Pemeriksaan akan dilakukan Kamis (29/4), yang jelas terkait Bank Century, lebih jelasnya tanyakan pada KPK” ujarnya. Mengenai adanya pemeriksaan tersebut, ia menambahkan, Kemenkeu meminta kepada KPK agar pemeriksaan tersebut dapat dilakukan di Kantor Menteri Keuangan, Gedung Djuanda. Lanjut ke hal A2 kol. 3

Antara

BAKAR BANGUNAN: Seorang warga melempar bangunan BPK Penabur yang telah dibakar dengan batu bata di Cibeureum, Cisarua, Bogor, Jabar, Selasa (27/4). Dua mobil dan tujuh bangunan yang berada dikawasan tersebut dirusak oleh warga karena dianggap untuk pembangunan sarana ibadah.

Demo Tuntut Usut Indikasi Korupsi Dana Politeknik TAPAKTUAN (Waspada): Sekira 50 warga dari berbagai elemen masyarakat yang tergabung dalam Gerakan Masyarakat Aceh Selatan (Gemas),Selasa (27/4) kemarin menggelar aksi demo ke gedung DPRK Jalan Syech Abdurrauf, Tapatuan. Mereka menuntut Kapolres dan Kajari Tapaktuan mengusut tuntas indikasi korupsi dana politeknik yang dikelola pantia dengan jumlah total sebesar Rp2,6 miliar lebih. Penarikan dana tersebt, terlihat adanya kejanggalan dan

banyaknya kegiatan yang tidak rasional, seperti biaya makan selama enam bulan sebesar Rp40 juta lebih. Sedangkan dalam proposal pengajuan selama tujuh bulan sebesar Rp 29 juta lebih, sehingga terjadi penggelumbungan. Dalam pernyataan sikap yang dibacakan Koordinator Aksi, Ali Zamzami, juga mensinyalir membengkaknya dana listrik satu paket sebesar Rp 45 juta, biaya perjalanan dan konsultasi tim Rp 359 juta lebih, biaya sosialisasi sebesar Rp 83 juta dan

hingga kini sosialisasinya masih nihil. Demikian pula, kata Ali Zamzami, persiapan dan renovasi kampus sementara di ruko reklamasi pantai sebesar Rp 450 juta, padahal ruko tersebut masih dalam masalah dengan aparat hukum dan belum diserahterimakan. Biaya magang dosen di Bandung dan Belitung, jumlahnya sama dan hanya di copy paste, kontribusi out bond Rp 112 juta Lanjut ke hal A2 kol. 1

PKL Duduki Kantor Walikota Waspada/Zamzamy Surya

Baca Halaman Dalam Kampung Nelayan Terancam Karam Sedikitnya dua desa pesisir di Kecamatan Kembang Tanjong, Kab. Pidie terancam karam. Pasalnya, jarak bibir pantai tempat jatuhnya deburan obak terpaut enam meter lagi dari perumahan penduduk. Bahkan warga setempat kini mulai cemas dengan fenomena alam itu. Hal C4

BERORASI: Sejumlah aktivis Gamas sedang berorasi di gedung DPRK Aceh Sealatan dalam aksi demo yang mereka lancarkan Selasa (27/4). Mereka menutut Kapolres dan Kajari Tapaktuan mengusut tuntas indikasi korupsi dana yang dikelola panitia politeknik sebesar Rp 3,6 miliar lebih.

KOTA LHOKSEUMAWE (Waspada): Ekses dari penertiban kota, puluhan pedagang kaki lima (PKL) kehilangan lapak. Setelah empat bulan lalu, Walikota Lhokseumawe berjanji akan menyediakan lapak baru bagi mereka. Namun hingga kini, janji tersebut belum direalisasi. Karenanya, puluhan PKL, Selasa (27/4) menduduki Kantor Walikota Lhokseumawe, guna menuntut janji tersebut. Diakui, Pemkot Lhokseumawe telah berhasil membangun lapak baru di lokasi pasar buah. Namun, dari 128 pintu

kios yang dibangun itu tidak satu pun diberikan kepada mereka. Bahkan kios-kios tersebut disewakan kepada orang yang bukan pedagang. Dengan kondisi ini, terkesan Walikota Lhokseumawe seperti sengaja menelantarkan mereka tanpa sumber mata pencaharian. “Dari 128 pintu yang disediakan semuanya sudah penuh sesak disewakan kepada pihak lain, yang kebanyakan bukan pedagang buah. Malahan, ada yang sudah berantai dari satu pihak, kepihak lainnya disewakan lapaknya dengan harga bervariasi,” kata Zakaria, 32, didam-

pingi PKL lain, Jailani, 54, Iskandar, 40, Sayuti, 27, Dedi Saputra, 26, yang berhasil dijumpai Waspada kemarin. Saat penertiban kota dilakukan, Camat, Banda Sakti, dengan penuh yakin mengatakan, akan menyediakan lapak baru bagi PKL yang selama ini beroperasi di Kota Lhokseumawe. Namun ungkapan itu sepertinya hanya untuk memudahkan pekerjaan mereka saja dan hanya untuk menyenagi para PKL yang bernasib susah. “Kami sama sekali tidak dipedulikan Lanjut ke hal A2 kol. 7

Ekses Tak Lulus UN, SMAN 1 Dilempari Raden Ajeng Kartini Oleh H. Ameer Hamzah Raden Ajeng Kartini bercita-cita memajukan perempuan Indonesia dalam berbagai aspek kehidupan sesuai dengan hak-hak yang telah diberikan ajaran Islam. Kartini melepaskan diri dari emansipasi dan jender yang ditafsirkan secara keliru oleh tokoh-tokoh perempuan yang tak beriman. “Habis Gelap Terbitlah Terang”. Itulah judul kumpulan surat-surat Raden Ajeng Kartini kepada sahabatnya di negeri Belanda. Dalam surat-suratnya itu Kartini mengeluh kepada temannya, bahwa perempuan Indonesia (Jawa) banyak yang berpendidikan rendah, tunduk kepada kemauan lakiLanjut ke hal A2 kol. 1

NGKERAN, AcehTenggara (Waspada): Diduga karena kecewataklulusUjianNasional (UN), setelah melihat pengumumanyangdipampangkan pihak sekolah, gedung SMAN 1LaweAlas,Selasa(27/4)siang akhirnya jadi sasaran kemarahan siswa. Akibatnya, tempat parkir kenderaan roda dua roboh dan pot bunga berserakan. Atap gedung dewan Guru SMAN 1 Lawe Alas juga jadi sasaran dan dilempari batu olehsebagiansiswayangdiduga tak lulus ujian nasional. Beberapa sumber yang ditemui Waspada di tempat kejadian,Selasa(27/4)mengatakan, mengamuknya siswa sampai terjadinya lemparan batu ke atap gedung dewan guru serta terbaliknya beberapa unit kenderaan roda dua yang sedang di parkir itu, sempat membuat dewan guru di Lanjut ke hal A2 kol. 3

Waspada/Ali Amran

ROBOH: Tempat parkir kenderaan roda dua di SMAN 1 Lawe Alas ,Selasa (27/4) roboh paska mengamuknya siswa yang tak lulus ujian nasional, selain itu atap gedung juga tak luput dari sasaran lemparan batu oleh siswa.

Antara

RUMAH TAHANAN TIPIKOR: Menteri Hukum dan HAM Patrialis Akbar (tengah) saat meninjau Rumah Tahanan khusus Tindak Pidana Korupsi (Tipikor) yang berada di kompleks Lapas Cipinang Klas I, Jakarta Timur, Selasa (27/4).

Rutan Tipikor LP Cipinang Siap Tampung Koruptor JAKARTA (Waspada): Menkum HAM Patrialis Akbar Rabu hari ini meresmikan rutan kelas I khusus tahanan dan narapidana Tipikor yang pertama di Indonesia. Rutan ini diklaim berstandar Perserikatan Bangsabangsa (PBB) dan arsiteknya telah melakukan studi banding ke beberapa negara.

“Untuk mendesain rutan yang berstandar PBB kita telah melakukan studi banding ke beberapa negara yakni China, Australia, Malaysia, Singapura, Hongkong dan Thailand,” ujar arsitek Rutan Tipikor Purwo Ardoko. Lanjut ke hal A2 kol. 1

ONH Mungkin Tidak Naik JAKARTA (Waspada): Ongkos Naik Haji (ONH) tahun 2010 kemungkinan besar tidak akan naik. Pemerintah bersama DPR sedang membahas upaya efisiensi anggaran untuk menekan ONH tahun ini. “Kalau sekarang kan kurs dolar turun, jadi kemungkinan besar tidak naik. Kalau bisa malah turun,” kata Ketua Komisi VIII DPR Abdul Kadir Karding kepadawartawandiGedungDPR, Senayan, Jakarta, Selasa (27/4). Menurut Kadir, saat ini Komisi VIII sedang mengamati proposal yang diajukan pemerintah. Sekalipun ada bagian biaya dinaikan, masih ada beberapa pembiayaan yang bisa di efisienkan. “Kita sedang melihat mana yang bisa ditekan. Sedang kita bahas bersama pemerintah melalui Komisi VIII. Pokoknya kita janjikan tidak akan naik,” terang Karding. Menteri Agama Suryadharma Ali mengaku sedang menimang biaya ONH. Surya juga

menyampaikan perihal upaya kementeriannya yang sedang menyusun rincian anggaran Haji tahun ini. “Kita belum mendapat informasi menyeluruh tentang komponen biaya ibadah Haji terutama soal pesawat. Kalau diasumsikan biaya penerbangan tetap, maka ada kenaikan sedikit AS$ 133,” terang Suryadharma. Namun demikian, dengan optimalisasi di sektor yang lain, diharapkan kenaikan dapat ditekan dengan menurunkan biaya sektor lain. (dtc)

Serampang - Hadiahnya Apa Ya? - He... he... he...


Berita Utama

A2 Rutan Tipikor LP ... Purwo mengatakan itu sebelum peresmian rutan Tipikor oleh Menkum HAM Patrialis Akbar dalam rangka Hari Bhakti ke-64 LP seluruh Indonesia, di LP Cipinang Jl Raya Bekasi Timur, Cipinang, Jakarta Timur, Selasa (27/4). Menurut Purwo, rutan ini berdiri tiga lantai dan memiliki 64 kamar dengan kapasitas 256 tahanan. Lantai 1 terdapat 16 kamar yang akan dihuni masing-masing 1 kamar untuk satu tahanan. Namun ruang tersebut diperuntukkan bagi tahanan yang sudah tua dan sakit. Sedangkan di lantai 2 dan 3 terdapat 12 ruang untuk tahanan. Kapasitas setiap ruangan 5 tahanan dengan luas 7x5 meter persegi per ruangan serta ada juga yang ukurannya 3x6 meter persegi. Untuk yang ukuran 3x6 meter persegi ditambahkan ruangan sebesar 25 persen untuk ruangan salat dan membaca. “Ruangan itu sesuai standar internasional karena kalau sudah malam mereka tidak bisa salat di luar kamar,” kata Purwo. Di lantai 1 juga ada ruangan semacam aula yang bisa digunakan untuk aktivitas napi seperti acara bebas. “Nanti ruangan bisa dipergunakan untuk tenis meja,” jelas Purwo. Dari semua lantai, setiap napi akan diberi 1 kasur. Para sipir keliling yang berjaga juga harus mengetok teralis biar tahu kalau ada teralis yang rusak atau tidak. Setiap kamar juga akan ada satu pos jaga setiap 10 meter. Rutan ini sementara khusus untuk napi laki-laki. Rutan ini temboknya memiliki ketebalan 20 cm. Cat yang digunakan anti bahan kimia, dan teralisnya memiliki ketebalan 22 mm. Jadi kalau dipotong gergaji besi paling tidak butuh waktu 1 jam. Napi boleh bawa kipas angin? “Fasilitas lain akan diatur nanti, tapi setahu saya tidak ada aturan yang melarang setiap napi boleh membawa barang. Yang tidak boleh itu merubah struktur bangunan misalnya lantai diganti marmer,” tandas Purwo. (dtc)

Demo Tuntut ... lebih, serta biaya monitoring dua orang. Dari dasar persoalan di atas, pernyataan yang ditandatangani Ir. Subiyono, dari Yayasan Mata Air (Yama), Muhammad Nasir,SH dari Kajian dan Advokasi Hukum (KAUM), May Fendri, SE, dari Lembaga Independen Bersih Aceh Selatan (LIBAS) dan T. Hermasyah, SH dari Forum Pemantau, Kajian Kebijakan, Kinerja DPRK Aceh Selatan (Formak). Selain menuntut Kapolres dan Kajari Tapaktuan mengusut indikasi penyeleweangan tersebut, mereka juga mendesak Pemkab mengevaluasi kinjerja Panitia Politeknik serta membatalkan semua calon dosen dan tenaga administrasi yang direkrut sebelumnya secara terselubung. Pihak DPRK juga diminta melakukan pengawasan ketat terhadap kinerja tim dan harus mengembalikan dana magang serta mempertanggungjawabkan penggunaannya. Tim juga harus mempertanggungjawakan administrasi dan keuangan kepada masyarakat dihadapan DPRK menyangkut tahapan pendirian politeknik. “Jika tuntutan ini tidak dipenuhi atau diindahkan dalam waktu seminggu ke depan, kami akan melakukan aksi demo dalam party besar serta menyegel kantor sekretariat panitia,”sebut Ali Zamzami. Sementara Ketua Panitia Politehnik H. Irfanullah Kasim, SH, MM dalam tanggapannya pada pertemuan tim dengan perwakilan pendemo, difasilitasi dan dipandu Ketua DPRK Safiron dalam ruang rapat musyawarah dewan, menyebutkan keberadaannya sebagai ketua tim yang dituding bisa menghambat proses pemeriksaan keuangan, merupakan kepercayaan pimpinan. “Saya tak pernah minta jabatan ketua tim,tetapi karena ini sebuah kepercayaan, maka saya selaku bawahan tak mungkin menolak,”sebut Kepala Inspektorat Aceh Selatan itu. Tetapi Sekretarisnya Drs.Jasmiadi Jalkfar, MSi dalam pertemuan itu justru berpendapat lain dengan Irfanullah. “Rekrutmen dosen dianggap mendesak karena melengkapi persyaratan profosal”kata Jasmiadi yang disambut kecaman keras dari perwakilan pendemo. Irfan juga mengakui dana yang sudah ditarik sebesar Rp3,6 miliar lebih itu, kini masih tersimpan dalam rekening biro di bank. Jadi tak ada penyelewengan, karena dana itu pada saatnya nanti juga akan dipertanggungjawakan. (b19)

Raden Ajeng Kartini ... laki, bersedia dijadikan isteri yang kedua, tiga, dan empat. Hak-hak mereka belum didapat sepenuhnya, sebab perempuan Jawa berpendidikan rendah. Sebagai perempuan yang beragama Islam, Raden Ajeng Kartini tahu persis bahwa hak-hak yang diberikan Islam kepada perempuan sangat luas, namun perempuan Jawa terkungkung dengan tradisi. Dalam tradisi Jawa perempuan memang sulit setara dengan kaum pria, apalagi dalam lingkungan priyai, bangsawan yang kadang-kadang memiliki gadis simpanan. Raden Ajeng Kartini sangat ingin kaumnya (perempuan) dapat meraih kembali hak-hak yang telah diberikan oleh agama Islam kepada perempuan. Moyangnya Ratu Kaliangat pernah penjadi pemimpin di Jepara, dan Datuknya Tgk Syeikh Ibrahim dari Pasee patut diteladani. Syeikh Tgk Ibrahim dapat menerima kepemimpinan seorang perempuan menjadi “raja” di Jepara. Jaman Ratu Kaliangat status perempuan sudah sangat baik, sama dengan kondisi di Pasee, Ratu Nahrisyah menjadi kepala Negara Kerajaan Islam Pasee. Cita-cita suci Raden Ajeng Kartini tidak terwujud, ia sendiri tidak punya kesem-patan untuk bersekolah yang lebih tinggi, orang tuanya memaksanya supaya segera Jawaban Problem Catur, berumah tangga dengan TTS Dan Sudoku lelaki yang berpoligami, Dari Halaman Sport. Kartini menjadi isteri kedua dari suamnya, dan Kartini meninggal dunia ketika Jawaban Problem Catur: bersalin anak pertama. Ia mati muda, 25 tahun. 1. Kg5+, Rg8. Seandainya Kartini ma2. Me6+, Mf7. sih hidup atau Allah membolehkan Kartini hidup se3. MxM+mat. jenak saja, pasti Kartini sangat marah kepada peremJawaban TTS: puan Indonesia yang mengTTS Topik Kesehatan kultusnya, memperingati T E H H I J A U K A F E I N hari lahirnya, menjadikan N A A A T tanggal tersebut sebagai S D E N T A L T M tanggal bersejarah. Kartini A I O S R pasti tidak rela, sebab dia tiP B A Y A M I M A D U dak pernah bercita-cita menK E J U A U E jadikan perempuan IndoL N V I T A M I N S P C T I nesia seperti ala sekarang. K O P I B L U E B E R R Y Perempuan Indonesia sekaS R A S E rang sudah kebablasan dari D R G O W A B A H cita-cita mulia Kartini. F R U K T O S A K E Habis gelap (dzulumat) L O B N yang dimaksudkan Kartini A L K O H O L A G A R A M adalah berakhirnya masa I I T D penjajahan,masakebodohan Jawaban Sudoku: akibat penjajahan, di mana para perempuan kota meni4 6 2 8 5 3 1 7 9 ru-nirucaraorangEropahber1 7 8 9 6 2 3 4 5 pakaian. Sedangkan terbitlah 3 5 9 7 4 1 8 2 6 terang (An-Nur) artinya, telah terbit cahaya kemerdekaan, 5 3 7 1 2 4 9 6 8 di mana para perempuan In9 8 6 3 7 5 2 1 4 donesia sudah waktunya me2 4 1 6 8 9 7 5 3 ninggalkan cara-cara kafir dalam berpakaian. Saatnya 7 9 4 5 1 8 6 3 2 perempuan Indonesia berpa6 2 3 4 9 7 5 8 1 kaian yang sopan sesuai de8 1 5 2 3 6 4 9 7 ngan tradisi timur dan Islam.

SBY: Bahas RUU Pencabutan Perppu JPSK JAKARTA (Waspada): Presiden Susilo Bambang Yudhoyono (foto) mengembalikan surat DPR mengenai penolakan atas RUU Pencabutan Perppu Jaring Pengaman Sistem Keuangan (JPSK). Pembahasan RUU ini memanas akhir 2008 lalu karena isinya memberikan perlindungan dan kebal hukum bagi pejabat yang memiliki kewenangan kebijakan keuangan. Namun, RUU ini sudah ditolak pada 18 Desember 2008 lalu. Kemudian, DPR mengirim surat kepada Presiden untuk mengoreksi suratnya yang

menyatakan paripurna penolakan baru dilakukan 30 September 2009. Dalam surat Presiden tertanggal 7 April 2010, DPR diminta untuk membahas kembali mengenai RUU pencabutan Perppu JPSK. Wakil Ketua DPR Priyo Budi Santoso mengatakan, implikasi dari surat Presiden ini cukup serius. Jika dibahas kembali, putusan penolakan pada 18 September 2008 dianggap tak ada. Implikasi lebih jauh, ada kekebalan hukum bagi pejabat pemegang otoritas keuangan di saat krisis, yaitu Sri Mulyani dan Boediono. “Kalau disetujui pencabutan itu sekarang, berarti berlakunya sampai hari ini, dan

semua kebal hukum. Kami Pimpinan DPR sangat terbebani karena derajat politiknya tinggi di saat kita ingin menyelesaikan Century,” ujar Priyo dalam jumpa pers di Gedung DPR, Jakarta, Selasa (27/4). Dalam surat tersebut, ungkap Priyo, tidak ada yang berubah sama sekali. Padahal, sebelumnya DPR sudah mengoreksi tanggal keputusan paripurna DPR yang menyatakan menolak RUU Pencabutan Perppu JPSK. “Implikasinya, aparat yang berwenang di sektor keuangan akan kebal hukum,” tegas Priyo. Karena implikasi serius, Pimpinan DPR memutuskan akan melakukan rapat konsul-

tasi dengan pimpinan fraksi mengenai solusi untuk menanggapi surat tersebut. Rapat konsultasi dengan pimpinan fraksi dijadwalkan akan dilakukan pada Kamis (29/4/2010) mendatang. (kps)

Siswa MUQ Lulus 100 Persen LANGSA (Waspada): Pengumuman Ujian Nasional (UN) tahun 2010 yang dikeluarkan kemarin (Senin—red), Madrasah Ulumul Qur’an (MUQ) Yayasan Dayah Bustanul Ulum, Kota Langsa, kembali mengukir prestasi gemilang, dimana siswa Aliyah (SMA) MUQ lulus 100 persen. Ketua Madrasah Aliyah (MA) MUQ Langsa, Drs. Muhammad Nasir didampingi sekretaris MUQ, Tajul Munir Hsb, kepada Waspada, Selasa (27/4) mengatakan, bahwa kelulusan 100 persen santri tingkat MA tersebut merupakan salah satu kesuksesan sistim pendidikan

dan pengajaran yang diterapkan di MUQ selama ini. “Kita bangga dengan prestasi yang diraih oleh anak-anak kita tahun ini, berkat ketekunan dan keyakinan mereka belajar selama ini sebagaimana metode yang diterapkan, alhamdulillah MA MUQ berhasil meraih prestasi kelulusan 100 persen dan ini adalam prestasi yang kesekian kalinya diraih oleh MUQ Langsa,” ungkap M.Nasir. Lanjutnya, atas kelulusan 100 persen itu MA MUQ Langsa menduduki prestasi pertama sekolah tingkat SMA/MA seKota Langsa. Sebagaimana tahun sebelumnya juga berhasil

meraih tingkat pertama kelulusan MA se-Aceh. “Tentunya prestasi ini juga berkat adanya dukungan dari wali siswa, masyarakat serta yang paling utama adalah para siswa itu sendiri yang serius dan tekun dala, belajar,” sebut Nasir lagi. Adapun upaya yang membuat MUQ berhasil meraih prestasi kelulusan 100 persen antara lain dengan peningkatan kualitas guru yang dilakukan lewat pelatihan kopetensi guru, peningkatan profesionalisme guru sesuai dengan mata pelajara dan pelaksanaan MGMP tiap mata pelajaran. “Untuk siswa, MUQ mela-

kukan bimbingan belajar secara itensif dengan guru mata pelajaran, bimbingan belajar dengan penyedia jasa bimbingan khusus UN, remedial teaching secara regular untuk mata pelajaran UN serta membentuk kelompok belajar siswa di asrama,” terang Nasir lagi. Adapun siswa MA MUQ Langsa yang mengikuti UN tahun ini berjumlah 198 siswa dengan rincian 71 laki-laki dan 127 perempuan. Berdasarkan jurusan, MAK 36 orang, IPA 101 orang dan IPS 61 orang, semuanya dinyatakan lulus 100 persen dengan bobot nilai tertinggi rata-rata 8,80 – 9.00. (cmad)

KPK Periksa ...

kata Juru Bicara KPK, Johan Budi di Jakarta, Selasa (27/4). Johan menjelaskan, KPK belum mendapatkan konfirmasi tentang waktu dan tempat pemeriksaan dari pihak Boediono. Namun, menurut Johan, KPK sejak awal berencana meminta keterangan Boediono di tempat kerja Boediono. “Kita menghormati pak Boediono sebagai wakil presiden,” kata Johan memberi alasan tentang pemilihan tempat pemeriksaan itu. Menurut dia, pemeriksaan di tempat kerja seorang penyelenggara negara sudah biasa dilakukan oleh KPK. “Jadi memang pemeriksaan tidak harus dilakukan di Gedung KPK,” kata Johan menambahkan. Dalam kasus Bank Century, KPK juga telah memeriksa beberapa pejabat BI, antara lain Deputi Gubernur BI Budi Mulya, Muliaman D. Hadad, dan Budi Rochadi. Kemudian, Direktur Pengawasan Bank I Bank Indonesia (BI) Budi Armanto, Deputi Direktur pada Direktorat Pengawasan Bank I BI Heru Kristiana, Direktur pada Direktorat Penelitian dan Pengaturan Bank Indonesia (BI) Halim Alamsyah.

Kemudian, pegawai pada Direktorat Pengawasan BI Pahala Santosa, dan pegawai BI yang juga anggota Satgas Pengawasan Bank Century Ahmad Fuad. Selain itu, Direktur Klaim dan Resolusi Bank Lembaga PenjaminSimpanan(LPS)NoorCahyo, Kepala Divisi Penjaminan LPS Poltak L. Tobing, dan Ketua Badan Pengawas Pasar Modal dan Lembaga Keuangan (BapepamLK)AhmadFuad Rahmany juga telah diperiksa. Kasus Bank Century mencuat setelah publik mengetahui pengucuran dana Bank Indonesia (BI) dalam bentuk Fasilitas Pendanaan Jangka Pendek (FPJP) kepada Bank Century. Pengucuran FPJP berawal ketika Bank Century mengajukan permohonan repo aset kepada BI pada Oktober 2008 sebesar Rp1 triliun karena mengalami kesulitan likuiditas. Namun, menurut audit Badan Pemerisa Keuangan (BPK), BI memproses permohonan itu sebagai permohonan Fasilitas Pendanaan Jangka Pendek (FPJP). Pada saat permohonan itu diajukan, rasio kecukupan modal (CAR) Bank Century adalah 2,35 persen. Padahal,

peraturan BI nomor 10/26/PBI/ 2008 menyatakan sebuah bank harus memiliki CAR minimal delapan persen untuk mengajukan permohonan pendanaan. Pada 14 November 2008, BI mengubah PBI tersebut sehingga bank yang memiliki CAR positif bisa mengajukan permohonan. Padahal menurut BPK, saat itu hanya Bank Century yang rasio keucukupan modalnya di bawah delapan persen. Namun demikian, BI tetap mencairkan FPJP kepada Bank Century secara bertahap sejak 14-18 November 2008 hingga mencapai Rp689 miliar. Pada bulan yang sama, Bank Century juga menerima kucuran dana Lembaga Penjamin Simpanan (LPS) hingga mencapai Rp6,7 triliun. Pengucuran dana LPS itu bermulapada20November2008, ketika BI melalui Rapat Dewan Gubernur menetapkan Bank Century sebagai bank gagal berdampak sistemik. Keputusan itu kemudian disampaikan kepada Menteri Keuangan selaku Ketua Komite Stabilitas Sistem Keuangan (KSSK) melalui surat rahasia nomor 10/ 232/GBI/Rahasia tanggal 20 November 2008. (ant)

kara, membenarkan sekolah yang hanya berjarak ratusan meter dari ibukota kecamatan Lawe Alas tersebut dilempari siswa yang tak lulus UN. Beberapa jam sebelum kejadian, ujar Ali Basrah dan Abdus Samad, situasi tetap tenang dan tak ada tanda-tanda, jika siswa yang tak lulus ujian nasional akan mengamuk dan tak bisa mengontrol emosi mereka. Masalahnya, mereka telah bertemu dengan kepala sekolah dan dewan guru untuk mendaftar ulang agar bisa mengikuti ujian ulangan yang digelar awal Mei ini. Namun beberapa saat setelah mendengar arahan dan penjelasan dari pihak sekolah, tiba-tiba terdengar suara lemparan batu ke atap sekolah, menyusul robohnya tempat parkir sekolah serta vas bunga maupun beberapa unit kenderaan roda dua yang berada dalam komplek SMAN 1 Lawe Alas. Berdasarkan data di Dinas Dikpora, ujar Ali Basrah, meskipun di tingkat propinsi, persentase kelulusan siswa tingkat

SMA sederajat menempati urutan lima besar di Aceh. Namun, persentase kelulusan siswa di SMAN 1 Lawe Alas terbilang rendah, karena dari 208 peserta yang ikut UN, yang lulus hanya 32 persen, sedangkan sisanya sebanyak 125 orang tidak lulus dan terpaksa mengikuti ujian ulangan. “Mungkin itu yang jadi penyebab terjadinya pelemparan terhadap sekolah itu,”ujar Ali singkat. Senada dengan Kadis Dikpora, Kapolres Agara AKBP,Drs. Arsyad kepada Waspada mengatakan, meskipun persentase ketidak lulusan siswa di SMAN 1 Lawe Alas terbilang tinggi dibandingkan dengan sekolah lainnya di Agara, namun sejak pengumuman kelulusan ditempelkan, tak ada tanda-tanda akan terjadi pelemparan terhadap sekolah. Bahkan, dari laporan petugas yang ditempatkan di SMAN 1 Lawe Alas, tak ada gelagat akan timbul gejolak akibat rasa kecewa maupun rasa tidak puas dari siswa tak lulus un untuk

membuat onar. Namun, setelah siswa selesai menerima pengerahan dari pihak sekolah, beberapa menit kemudian akhirnya timbul gejolak. “Untuk mengantisipasi agar kejadian yang membuat dewan guru dan Kasek serta warga lainnya resah dan was-was, pihak kepolisian akan terus dikerahkan dan berjaga-jaga di kompleks SMAN 1 Lawe Alas, sambil terus memantau dan melihat perkembangan di lapangan,” pungkas Kapolres.(b27)

masih berjaga-jaga di sekitar areal pembangunan sebuah wisma yang dirusak massa di Cisarua, Bogor, Jawa Barat. Polisi juga telah meminta keterangan 6 orang pelaksana proyek pembangunan wisma tersebut. “Sebanyak 6 orang pekerja sudah kita mintai keterangan,” kata Kapolres Bogor, AKBP Tomex Kurniawan, di lokasi kejadian, Tomex menambahkan, berdasarkan informasi sementara, di tempat tersebut hanya akan dibangun wisma oleh sebuah yayasan. Dia menegaskan, kabar akan dibangunnya rumah ibadah dan sekolah sama sekali tidak benar. Hal senada diungkapkan Camat Cisarua, Bambang. Menurut Bambang, kejadian ini merupakan bentuk kesalahpahaman warga. “Berdasarkan kesepakatan, di tempat ini hanya akan dibangun wisma,” tegas Bambang. Bambang menambahkan, kasus ini berawal dari kecurigaan warga saat peletakan batu pertama pembangunan wisma tersebut. Kegiatan ter-

sebut dilakukan dengan upacara tertentu. “Jadi warga curiga akan dibangun tempat ibadah. Dan hari ini warga berniat ke kantor bupati untuk dimediasi. Namun Pak Bupati sedang tidak berada di tempat. Warga yang tidak sabar akhirnya melakukan penyerangan,” ungkap Bambang. Saat ini di sekitar lokasi kejadian, puluhan personel polisi terlihat masih berjagajaga. Mereka khawatir aksi penyerangan akan kembali terjadi. Sejumlah kendaraan aparat yang terparkir, membuat arus lalu lintas di sedikit tersendat. Menurut versi warga, aksi ini dipicu sikap yayasan tersebut yang melanggar kesepakatan. Sebelumnya telah disepakati pihak yayasan hanya akan membangun bangunan yang akan difungsikan sebagai wisma di lahan seluas 2,5 hektar. Namun kenyataannya, yayasan tersebut juga berencana mendirikan sebuah kompleks pendidikan.(dtc)

“Surat pemeriksaan telah diajukan kepada pihak KPK, dan permintaan dari kami agar pemberian keterangan dapat dilakukan di Kantor Menkeu, disebabkan karena kesibukan ibu menteri” ujar Mulia. Menurut dia, dalam pemeriksaan nanti Menkeu akan didampingi oleh Biro Bantuan Hukum dan beberapa pejabat terkait. “Ibu Menteri pastinya akan mempersiapkan diri, apalagi kejadiannya telah berlangsung lama dan kemungkinan tidak jauh dari hal-hal yang telah ditanyakan pada pemeriksaan di panitia angket DPR,” ujarnya. Menkeu saat ini masih berada di Amerika Serikat hingga Rabu Pagi (28/4) untuk menghadiri sidang G20 dan Bank Dunia. Sementara, tim penyelidik Komisi Pemberantasan Korupsi berencana memeriksa Boediono, mantan Gubernur Bank Indonesia yang saat ini menjabat Wakil Presiden, pada Kamis (29/4) terkait proses penyelidikan dugaan korupsi dalam kasus Bank Century. “Rencananya dimintai keterangan tanggal 29, hari Kamis,”

Ekses Tak Lulus ... SMAN 1 Lawe Alas panik. Sebenarnya, sejak awal pengumuman ditempelkan di komplek sekolah yang berlokasi di desa Ngkeran Pasir Bangun itu, ada petugas kepolisian berjaga-jaga untuk mengantisipasi kejadian yang tak diinginkan, akibat tingginya persentase ketidak lulusan siswa pada sekolah di kecamatan Lawe Alas tersebut. Namun, emosi siswa yang tak lulus tak bisa diredam, bahkan tanpa diduga beberapa menit setelah keluar dari sekolah dan usai menerima pengarahan dari dewan guru serta kepala sekolah, atap ruangan gedung dewan guru terdengar bak gemuruh akibat dilempari batu dari luar kompleks sekolah. Kapolres Agara, AKBP Drs. Arsyad didampingi Kabag Ops AKP Fakhri dan Kadis Dikpora,H.Ali Basrah.S.Pd.MM dan Kasek SMAN 1 Lawe Alas Abdus Samad.S.Pd kepada Waspada, di tempat kejadian per-

Ratusan Orang ... Imam, salah seorang warga yang melakukan perusakan mengatakan, aksi anarkis ini dilakukan karena mereka kesal terhadap pihak yayasan pemilik wisma itu. Pihak yayasan tersebut dinilai telah melanggar kesepakatan yang pernah dibuat bersama warga. “Mereka janjinya hanya akan membangun wisma, tapi ternyata juga akan membangun sekolahan. Ini melanggar kesepakatan,” ujar Imam. Menurut Imam, warga sudah mencoba meminta pihak kecamatan melakukan mediasi. Namun mereka tidak menemukan petugas kecamatan yang mau melakukan mediasi. Akhirnya, warga pun mendatangi wisma tersebut dan melakukan perusakan. Pantauan di lokasi kejadian saat ini sudah ada puluhan aparat polisi dari Polres Kabupaten Bogor. Kapolwil Bogor Kombes Pol Unggung Cahyono juga sudah tiba di lokasi kejadian. 6 Orang Saksi Puluhan personel polisi

WASPADA Rabu 28 April 2010

Ramlah Tewas Disambar Petir BIREUEN ( Waspada): Ramlah binti Abdurrahman, 47, seorang petani asal Desa Ulee Alue, Kecamatan Samalanga, Bireuen, Selasa (27/4) sekira pukul 12.40 Wib tewas disambar petir di sawah desanya pada saat memanen padi bersama tiga petani lainnya. Namun, ketiga petani lainnya itu selamat dari tragedi naas itu, hanya saja mereka mengalami depresi atau shock berat pasca musibah dan harus dirawat di Puskesmas setempat. Kapolsek Samalanga, Ipda Samsul kepada Waspada kemarin (27/4) membenarkan, Ramlah seorang petani yang tercatat warga Ulee Alu, meninggal disambar petir saat

memanen padi bersama tiga petani lainnya di sawah desanya. Namun, ketiga temannya itu selama dari musibah yang merenggut nyawa Ramlah meski harus dirawat di puskesmas setempat setelah kejadian akibat shock. Ketiga teman korban yang mengalami shok berat itu adalah, Nuhasanah binti Hafiah,50, Saudah binti Ibrahim, 45, dan Abdiah binti Andit, 40, ketiganya warga desa yang sama. “Korban dipulangkan ke rumah duka, sedangkan ketiga teman korban mengalami shok berat atas kejadian tersebut, kondisinya tidak apaapa, namun harus dirawat di Puskesmas setempat,” katanya. (amh)

Banda Aceh ‘Juara’ ... Dia menguraikan, setelah Banda Aceh, posisi kedua ditempati Kabupaten Aceh Timur dengan jumlah kasus pelanggaran Syariat Islam sebanyak 542 kasus, disusul Kabupaten Aceh Selatan 457 kasus, dan Kota Lhokseumawe 405 kasus. Sementara itu Kab. Simeulue, 153 kasus, Kab.Gayo Lues 152 kasus, Kab.Aceh Besar 105 kasus, Kota Langsa 86 Kasus. Provinsi 76 kasus, Kota Sabang 75 kasus, Kab.Nagan Raya 51 kasus, Kab. Bireun 34 kasus, Kab. Pidie 25 kasus, Kota Subulussalam 20 kasus dan yang paling rendah data pelanggarannya yaitu Kab.Abdya hanya 11 kasus. Untuk tahun 2009 saja, urainya, pelanggaran Qanun nomor 11 Tahun 2002 tentang pelaksanaan Syariat Islam Bidang Aqidah, Ibadah dan syi’ar Islam sebanyak 2.689, pelanggar Qanun nomor 12 tahun 2003 tentang minuman keras, 74 kasus. Pelanggaran Qanun nomor 13 tahun 2003 tentang maisir (perjudian) 102 kasus, selanjutnya pelaku mesum atau pelanggar Qanun nomor 14 tahun 2003 mencapai 836 kasus. Namun, dari keseluruhan Kabupaten/Kota di Aceh, masih terdapat enam kabupaten yang belum menyerahkan data pelanggaran Qanun Syariat Islam tahun 2009 yaitu Kab.Aceh utara, Kab.Aceh Barat, Kab.Aceh Singkil, Kab.Aceh Tenggara, Kab.Aceh Tengah, dan Kab.Bener Meriah. Ketika ditanya mengenai jumlah data pelanggaran ditahun 2010 ini, Marzuki mengaku belum mendapat data valid, apalagi pihaknya sedang melakukan pendataan. “Januari hingga Februari 2010 baru terjadi 60 kasus yang terjadi di seluruh Aceh, dan mudah-mudahan ini pada tahun ini akan munurun dari tahun-tahun sebelumnya,” sebut Marzuki. Kemudian, tambah dia, pada Mei 2010 ini, sebut Marzuki, WH akan melakukan eksekusi hukum cambuk kepada dua warga Aceh Jaya, keduanya terlibat kasus perjudian. (b05)

PKL Duduki Kantor ... Pemkot Lhokseuamwe. Mereka selalu berjanji, tapi satu pun tidak ditepati,” ucap mereka. Agar mata penacaharian mereka tidak hilang, Pemkot Lhokseumawe diminta segara mencari solusi terbaik yakni dengan cara menyediakan lapak baru bagi para pedagang. “Kalau tak diatasi, maka jangan salahkan kami seandainya nanti paksakan diri berjualan dipinggiran jalan raya,” sebut salah seorang pedagang lainnya. Sofyan, Kabag Humas Pemkot Lhokseumawe yang diwawancarai wartawan mengatakan, pihak Kecamatan akan melakukan pengecekan kembali kebenaran informasi dimaksud. Selanjutnya, akan dicarikan solusi terbaik. “Kita akan melakukan pengecekan, apakah benar apa yang disampaikan mereka. Kemudian, baru kita carikan solusinya,” sebut Kabag Humas, seraya mengatakan, aksi para PKL selesai sekitar pukul 14.00 siang. (cmun)

Gamba Tanyo Anda membawa-bawa handphone dengan kamera minimal 3,2 mega piksel dan menyaksikan peristiwa menarik atau unik yang ingin anda sampaikan juga kepada para pembaca Waspada? Abadikan dengan kamera handphone Anda dari jarak ideal untuk mendapatkan gambar yang jelas, dan kirim melalui layanan MMS dengan handphone yang sama ke redaksi Gamba Tanyo nomor 08192 11 01 47. Kirim juga keterangan fotonya, yang meliputi nama dan alamat Anda, judul foto, kapan dan di mana foto diabadikan, serta keterangan tentang peristiwa yang diabadikan. Kini foto yang dimuat akan mendapat imbalan pulsa Rp 20.000. Kami tunggu foto Anda untuk dimuat di Gamba Tanyo Waspada!

Kesempatan Menjadi Wartawan Waspada masih membuka kesempatan bagi yang memiliki kemampuan jurnalistik untuk bergabung menjadi wartawan di: Kota Jantho,Beureuneun, Meureudu, Lhoksukon, Kualasimpang, Calang, Meulaboh, Jeuram, dan Blangpidie. Pelamar harus berdomisili di kota tersebut di atas. Kirim melalui e-mail lamaran, pasfoto, fotokopi tanda pengenal dan CV ke redaksi@waspadamedan.com dalam waktu tujuh hari.


WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

z Edisi Tapanuli RABU, Legi, 28 April 2010/13 Jumadil Awal 1431 H z No: 23132 Tahun Ke-64z

Terbit 28 Halaman (A1-8, B1-12, C1-8) z zHarga Eceran: Rp 2.500,-

Inilah Rutan Koruptor z Berkapasitas 256 Orang, Satu Ruangan 5 Tahanan z Sejumlah Pejabat Segera Tempati Ruangan JAKARTA (Waspada): Menteri Hukum dan Hak Asasi Manusia (Menkumham) Patrialis Akbar meresmikan rumah tahanan klas I khusus Tindak Pidana Korupsi pertama di Indonesia di Jakarta, Selasa. Antara

Menteri Hukum dan HAM Patrialis Akbar (tengah) menemui salah satu tahanan (3 kanan) saat meninjau Rumah Tahanan khusus Tindak Pidana Korupsi (Tipikor) yang berada di kompleks Lapas Cipinang Klas I, Jakarta Timur, Selasa (27/4).

Patrialis mengatakan peresmian Rutan Khusus tersangka korupsi itu menjadi salah satu solusi untuk mengatasi kelebihan kapasitas lembaga pemasyarakatan (Lapas) atau rutan di Indonesia. Sementara itu, arsitek Rutan Tindak Pidana Korupsi (Tipikor), Purwo Ardoko menyebutkan rancangan Rutan Khu-

sus itu berdasarkan standar dari Perserikatan BangsaBangsa (PBB) dengan jumlah kamar sebanyak 64 unit dan berkapasitas 256 orang. Ardoko menuturkan bangunan rumah tahanan (Rutan) Tipikor terbagi dari tiga lantai, lantai satu terdapat 16 kamar yang dihuni satu tahanan untuk satu kamar

bagi tahanan yang sakit atau tua. Sedangkan lantai dua dan tiga terdiri dari 12 kamar setiap lantai diperuntukkan bagi tahanan lima orang untuk satu kamar. “Setiap ruangan memiliki luas 7 X 5 meter persegi pada Lanjut ke hal A2 kol 3

Warga 2 Desa Di Madina Saling Sweeping PANYABUNGAN (Waspada): Warga Natal, Kec. Natal, dan Simpang Gambir, Kec. Lingga Bayu, Kab. Mandailing Natal, saling sweeping akibat persoalan lahan yang digarap PT Perkebunan Sumatera Utara (PT PSU). Hingga Selasa (27/4), kondisi di dua lokasi masih mencekam. Ratusan warga berkumpul di jalan dan melakukan sweeping terhadap setiap

kendaraan yang melintas. Di Natal, aksi sweeping dilakukan di daerah Simpang Gugung (Kampung Sawah). Sebelum melakukan aksinya, para pemuda yang ada di daerah itu berkumpul di lapangan Merdeka Natal. Selanjutnya menuju Simpang Gugung untuk menyetop semua kendaraan yang lewat, dan meminta identitas setiap penumpang. Di Simpang Gambir, ratu-

san warga berkumpul di depan jembatan yang mengarah ke Sumatera Barat. Mereka melakukan aksi penyetopan terhadap setiap kendaraan yang melintas. Mereka memintai kartu tanda penduduk (KTP) penumpang dan pengemudi kendaraan. Umumnya, kedua warga yang ada di daerah tersebut terlihat memegang senjata tajam, seperti parang dan

bambu runcing. Mereka juga melarang wartawan untuk mengambil foto. Akibatnya, dua orang wartawan group MNC menjadi saasaran pukulan dan lemparan batu. Menurut Muhammad Ali Hanafiah, 26, warga Natal, aksi itu dipicu PT PSU yang bergerak di bidang perkebunan kelapa sawit menggarap Lanjut ke hal A2 kol 7

Presiden Tidak Komentari Pemanggilan Boediono

Sri Mulyani Diperiksa Kamis JAKARTA (Antara): Menteri Keuangan Sri Mulyani Indrawati segera menjalani pemeriksaaan oleh Komisi Pemberantasan Korupsi (KPK) terkait kasus dana talangan Bank Century, pada Kamis (29/4). Sekjen Kementerian Keuangan Mulia P Nasution dalam keterangannya di Jakarta, Selasa (27/4).mengatakan permintaan surat pemeriksaan KPK tersebut Lanjut ke hal A2 kol 2

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono memilih tidak berkomentar terkait pemanggilan terhadap Wakil Presiden Boediono dan Menteri Keuangan Sri Mulyani untuk dimintai keterangan dalam Bank Century oleh Komisi Pemberantasan Korupsi. Juru bicara Kepresidenan Julian Aldrin Pasha di Istana Merdeka, Jakarta, Selasa (27/4), mengatakan, Presiden Yudhoyono sudah mengetahui pemanggilan terhadap Boediono dan Sri Mulyani oleh KPK. Meski demikian, menurut Julian, Presiden memilih tidak merespons pemanggilan tersebut. “Presiden sudah mendengar rencana pemanggilan Bapak Boediono dan Ibu Sri Mulyani ke KPK. Bapak Presiden menyampaikan bahwa tidak memberikan respons apa pun tentang hal tersebut,”

tuturnya. Presiden, lanjut Julian, memilih tidak berkomentar terhadap pemanggilan terhadap dua pembantunya di pemerintahan tersebut. Boediono akan dimintai keterangan oleh KPK sebagai mantan Gubernur Bank Indonesia, sedangkan Sri Mulyani selaku mantan Ketua Stabilitas Sistem Keuangan (KSSK). Terima Surat Panggilan KPK Wakil Presiden Boediono telah menerima surat panggilan dari Komisi Pemberantasan Korupsi untuk dimintai keterangannya seputar kasus Bank Century. “Surat diterima pada Senin (26/4) sore,” kata Juru Bicara Wapres, Yopie Hidayat di Istana Wapres, Jakarta, Selasa. Ia mengatakan, surat pemanggilan KPK terhadap Boediono bukan untuk Lanjut ke hal A2 kol 3

Waspada/Abdul Khalik

Tempat pengeringan getah PT Darmek Kota Tebingtinggi, runtuh saat hujan lebat. Seorang pekerja terkubur hidup-hidup hingga ditemukan tewas pada pukul 18:30. Namun evakuasi lambat hingga diperkirakan tak terselmatkan. Terlihat upaya evakuasi secara manual dilakukan perusahaan dengan cara mengangkat blanket mencapai puluhan ton. Foto direkam, Selasa (27/4).

Medan Dan Madina Berpeluang Raih Juara Umum

Lanjut ke hal A2 kol 3

BACA DI HALAMAN DALAM B12 Pemkab Paluta Diminta Tegas Tentang Pengalihan Alih Fungsi Lahan B12 Di Paluta, Siswa Gagal UN Kalah Di Bahasa Indonesia-Matematika B12

TEBINGTINGGI (Waspada): Bangunan tempat pengeringan getah olahan atau dek, milik PT Darmasindo Inti Karet alias PT Darmek runtuh di tengah suasana hujan lebat, Selasa (27/4). Akibatnya, seorang pekerja bernama Nasib, 35, warga Perumahan BTN Kel. Lalang, Kec. Rambutan, Kota Tebingtinggi terkubur hidup-hidup hingga diketahui tewas pada pukul 18:30. Puluhan ton blanket getah menimpa korban. Pasca runtuh, terlihat perusahaan tidak serius memberikan pertolongan kepada korban yang terkubur, karena hanya membongkar runtuhan getah seadanya. Dari keterangan yang berhasil dihimpun, bangunan dek getah itu runtuh pada kamar 2, 3 dan 4 di lantai empat, saat hujan lebat sekira pukul 13:30.

Penutupan MTQ XXXII Sumut

gedung DPR, Selasa (27/4) mengatakan, usulan BPIH itu terdiri dari komponen penerbangan sama dengan tahun lalu sebesar 1.787 dolar AS, “general service fee” selama di Arab Saudi sebesar 159,7 dolar AS, biaya operasional di Arab Saudi 1.209,5 dolar AS, “living

Penjudi Di Padangsidimpuan Didenda Rp25 Juta

Antara

Terpidana kasus korupsi Abdul Hadi Djamal berada di pintu masuk Rumah Tahanan khusus Tindak Pidana Korupsi (Tipikor) yang berada di kompleks Lapas Cipinang Klas I, Jakarta Timur, Selasa (27/4).

Dek Getah PT Darmek T.Tinggi Runtuh, 1 Pekerja Tewas Terkubur

Kementerian Agama Usulkan ONH 2010 Naik JAKARTA (Antara): Kementerian Agama mengajukan usulan besaran kenaikan ongkos naik haji atau Biaya Penyelenggaraan Ibadah Haji 2010 menjadi sebesar 3.577 dolar AS ditambah biaya asuransi Rp100.000. Menteri Agama Suryadharma Ali dalam rapat kerja dengan komisi VIII DPR RI di

Antara

Petugas keamanan menutup sejumlah pintu sel yang berada di lantai dasar Rumah Tahanan khusus Tindak Pidana Korupsi (Tipikor) yang berada di kompleks Lapas Cipinang Klas I, Jakarta Timur, Selasa (27/4). Menteri Hukum dan HAM Patrialis Akbar meresmikan Rutan Tipikor yang berdiri tiga lantai dan memiliki 64 kamar dengan kapasitas 256 tahanan itu bertepatan dengan Hari Bhakti Pemasyarakatan ke-46 hari ini.

Waspada/Munir Lubis

Ratusan massa dari Forum Pejuang Revisi Peta TNBG, Hutan Lindung dan Hutan Produksi yang didukung penuh Rahmad Centre menyampaikan orasi di gedung DPRD Madina di kompelks perkantoran Payaloting Panyabungan, Selasa (27/4).

Soal Tapal Batas TNBG

Ratusan Warga Demo Balai TNBG, Kantor Dishutbun Dan DPRD Madina PANYABUNGAN (Waspada) : Ratusan warga dari Forum Pejuang Revisi Peta Taman Nasional Batang Gadis (TNBG), Hutan Lindung dan Hutan Produksi yang didukung penuh Rahmad Centre melakukan aksi demo ke kantor Balai TNBG, Dinas Kehutanan dan Perkebunan serta DPRD Kabupaten Mandailing Natal, Selasa (27/4). Usai melakukan orasi di depan Kantor

Balai TNBG di Aek Galoga Panyabungan, massa yang datang dengan menaiki kendaraan roda dua dan empat terus melakukan aksinya ke kantor Dinas Hutbun di perkantoran Payaloting, kemudian dengan berjalan kaki melanjutkan aksi ke gedung DPRD Madina.

Lanjut ke hal A2 kol 1

PANYABUNGAN (Waspada): Malam ini, Rabu (28/4), Gubernur Sumatera Utara H Syamsul Arifin SE, direncanakan menutup pelaksanaan MTQ XXXII tingkat Provinsi Sumut di lapangan Aek Godang, Kec. Panyabungan, Kab. Mandailing Natal. Berdasarkan data dihimpun Waspada, Selasa (27/4), kafilah Medan dan tuan rumah Madina berpeluang besar untuk meraih juara umum. Peserta dari kedua kafilah ini mendominasi cabang yang difinalkan. Pada Senin (26/4) malam, dewan hakim telah mengumumkan para peserta yang masuk final. Masing-masing cabang yang diperlombakan di final diikuti tiga peserta yang lolos babak seleksi. Panitia pelaksana maupun dewan hakim tidak berani memberikan nama dan daerah asal para kafilah yang lolos ke final. Alasannya demi kerahasiaan dan objetifnya penilaian. Namun demikian, Waspada masih bisa memperoleh sejumlah nama dan kafilah yang lolos tersebut. Cabang tilawah remaja putra, NPP 176 atas nama Azrai Hasibuan dari kafilah Medan, NPP 134 Rido Riski dari Sidikalang, NPP 182 Syaiful FaI dari Madina. Tilawah remaja putri, NPP 167 Yulia Hermawati dari Medan, NPP 187 Mardhotillah Ulfa dari PTPN Wilayah I, NPP 179 Arsil Zahuri dari Sergai. Tilawah dewasa putra, NPP 248 Jaffar Hasibuan dari Medan, NPP 234 Muhammad Rahim dari Sergai, NPP 210 Madhasad dari Madina. Tilawah dewasa putri, NPP 217 Nurlaila SPdI dari Medan, NPP 247 Hj Misrawati dari Sergai, NPP 249 Nurmisbah Surya dari Asahan. Lanjut ke hal A2 kol 1

Saat kejadian sejumlah pekerja melakukan tugasnya di lantai 1 di antaranya Nasib yang tengah merehab beton penahan bangunan bersama dua temannya. Ketika bangunan lantai empat, tiga dan dua, runtuh secara beruntun, Nasib masih sempat mengingatkan rekan-rekannya dan berhamburan menyelamatkan diri. Namun naas, Nasib sendiri terjebak hingga terkubur hidup-hidup. Diperkirakan, runtuhnya bangunan itu, karena berat beban blanket basah yang melebihi kapasitas, selain daya dukung bangunan yang sudah tidak maksimal, karena termakan usia. Diungkapkan, untuk satu palet blanket yang dikeringkan bisa mencapai berat 500 kg. Untuk satu kamar dek, Lanjut ke hal A2 kol 1

DPD KNPI Tobasa Dilantik BALIGE( Waspada): Pengurus DPD KNPI Kabupaten Toba Samosir (Kab.Tobasa) 2009-0012 resmi dilantik Sekretaris DPD KNPI Provinsi Sumatera Utara Aji Syari,SAg di Gedung Serbaguna HKBP Balige, Minggu (25/4). Acara pelantikan dengan thema “Tingkatkan Daya Saing Pemuda, Perkokoh Persatuan Bangsa Menuju Negara Kesatuan Republik Indonesia (NKRI) yang berdaulat dan bermartabat” turut dihadiri Muspida dan Ketua DPRD Tobasa, Pengurus DPD KNPI Kabupaten Taput dan Humbahas,Ormas, OKP dan tokoh masyarakat, berjalan dengan lancar dan penuh hidmat. Sekretaris DPD KNPI Sumut Aji Syari dalam sambutanya mengatakan sesuai Lanjut ke hal A2 kol 1

Serampang - Kapan ya ONH bisa turun .... - He.... he....he....


Berita Utama

A2 Ratusan Warga ....

pala Badan Pertanahan Pusat, Menteri Kehutanan, Komnas HAM meninjau dan memastikan kepemilikan tanah masyarakat dan tapal batas yang mengikuti UUD 1945, UUPA 1960, petunjuk tekhnis 1997 UURI Nomor 39 tahun 1999 tentang HAM yang menjamin hak-hak rakyat. Menurut Kepala Balai T N B G Ku s w a y a k e p a d a sejumlah wartawan, dalam keputusan Menhut No:SK. 126/Menhut-II/2004 tertanggal 29 April 2004 ditetapkan keputusan Menhut tentang perubahan fungsi dan penunjukan hutan lindung, hutan produksi terbatas dan hutan produksi tetap di Madina Provinsi Sumatera Utara seluas 108.000 hektar menjadi tanaman nasional dengan nama Taman Nasional Batang Gadis (TNBG). (a24)

Dek Getah ....

kan, korban menanggung dua anak masih kecil dan seorang istri. Terkait itu, pengawas pekerja PT Darmek Salman Pane, mengatakan kejadian itu merupakan musibah alam. Dia mengatakan, bangunan dek itu terkena angin puting beliung dan melihat langsung kejadiannya. Pengawas itu, juga mengatakan selama 25 tahun bekerja di perusahaan, itulah pertama kali terjadinya musibah. Namun, salah seorang pekerja menyebutkan keterangan itu bohong, karena kejadian runtuh pukul 13:30, sedangkan pengawas itu datang pada 14:30. “Dia bohong itu,” ujar singkat, pekerja yang minta namanya tidak dimuat. Korban berhasil dikeluarkan pada pukul 18:30 dalam keadaan sudah tidak bernyawa. Saat ditemukan kondisi tubuh korban terlihat memarmemar pada beberapa bagian tubuh. Bagian tubuhnya terlihat gepeng dan diduga akibat ditimpa blanket (slendang getah). (a08)

Dalam orasinya, massa mendesak pe-merintah meninjau ulang penetapan tapal batas kawasan TNBG. Mereka juga mendesak segera merevisi SK Menhut Nomor 44 tahun 2004, kemudian memperhatikan SK Menhut Nomor P:192004 tentang penentuan tapal batas taman nasional dengan musyawarah dan mufakat. Melaksanakan kolaborasi pengelolaan ekosistem TNBG satu-satunya di Indonesia TNBG yang melibatkan dan mengikutsertakan masyarakat sebagai pengelola. Memberikan kesejahtraan kepada masyarakat yang bersinggungan dengan TNBG sesuai dengan SK tersebut di atas. Warga berasal dari berbagai desa itu juga mendesak DPRD Madina, DPR-RI, Ke-

menampung sekira 60 palet blanket. Jika yang runtuh ada tiga kamar dikalikan tiga lantai, maka beban blanket yang runtuh mencapai puluhan ton, hitung seorang pekerja. Beberapa pekerja mengatakan, dek yang runtuh merupakan bangunan paling tua di a n t a ra d u a d e k l a i n n y a . Bangunan itu, terdiri dari bangunan kayu yang di susun dengan ketinggian sekira 20 meter. Dibangun pertama kali sekira 1986 dan hingga kini tidak mengalami rehab total. Padahal, sejak dibangun dek itu sudah mengalami satu kali terbakar dan satu kali runtuh. Saat runtuh kali pertama, peristiwa itu juga memakan korban jiwa. Abang korban Tugiman, di lokasi kejadian, mengatakan keluarga meminta PT Darmek bertanggung jawab atas musibah yang menimpa adik kandungnya itu. “Kita minta perusahaan bertanggung jawab akibat yang terjadi pada adik saya,” ujar Tugiman. Dikata-

Medan Dan ....

Qiraah Sabaah putra, NPP 308 Darwin Hasibuan dari Medan, NPP 318 Nasrullah dari Batubara, NPP 328 Muhammad Asril Nasution dari Pematang Siantar. Qiraah Sabaah putri, NPP 343 Susiana dari Pematang Siantar, NPP 337 Mardiyah dari Madina, NPP 311 Nurbaiti dari Medan. Tahfiz 1 juz putra, NPP 354 Arief Umro dari Madina, NPP 384 Ulinnuha Ahmad Mutawalul dari Tebingtinggi, NPP 358 Mukopa Asbar Ridwan dari PTPN Wilayah I. Tahfiz 1 juz putri, NPP 403 Rizki Muliani dari Madina, NPP 405 Leli Susanti dari Tanjungbalai, NPP 349 Rhoudatul Jannah dari PT Lonsum. Tahfiz 5 juz putra, NPP 458 Fikri Munawar dari Medan, NPP 454 Ali Ariansyah dari Tebingtinggi, NPP 414 Fahri Rinaldi dari Binjai. Tahfiz 5 juz purti, NPP 471 Rika Kumala Sari dari Asahan, NPP 445 Aldila Sarti dari PT Lonsum, NPP 435 Muthahharotun Nur dari Madina. Tahfiz 10 juz putra, NPP 478 M Taufik Fadli dari Medan, NPP 500 Fitra Pratama Mingka dari Tanjungbalai, NPP 512 Muhammad Arif Lubis dari Pa-

DPD KNPI ....

Undang-Undang Kepemudaan No 40 Tahun 2009, maka pengurus KNPI ke depan harus usia 16-30 tahun, sehingga diharapkan Ketua DPD KNPI Tobasa segera mengkader generasi muda yang mempunyai dedikasi dan berpotensi untuk melanjutkan

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Kg5+, Rg8. 2. Me6+, Mf7. 3. MxM+mat.

Jawaban TTS: TTS Topik T E H H T S A P B K E J U L N C K O P I E S D R G F E L A L K O I

Kesehatan I J A U K A N A D E N T A L I O S A Y A M I A U V I T A M I

F E I N A A T M R M A D U E N S P T I E R R Y S A B A H K

B L U E B R A O W R U K T O S A O B N H O L A G A R A M I T D

Jawaban Sudoku:

4 1 3 5 9 2 7 6 8

6 7 5 3 8 4 9 2 1

2 8 9 7 6 1 4 3 5

8 9 7 1 3 6 5 4 2

5 6 4 2 7 8 1 9 3

3 2 1 4 5 9 8 7 6

1 3 8 9 2 7 6 5 4

7 4 2 6 1 5 3 8 9

9 5 6 8 4 3 2 1 7

dangsidimpuan. Tahfiz 10 juz putri, NPP 491 Syarifah dari Madina, NPP 505 Ameliatul Khoiriah Nasution dari Padanglawas, NPP 495 Trisna Ningsih dari Medan. Tahfiz 20 juz putra, NPP 530 Lewis Pramana Lubis dari Madina, NPP 540 Andi Zainal dari Pematangsiantar, NPP 542 Muhammad Affan Batubara dari Padanglawas Utara. Tahfiz 20 juz putri, NPP 543 Aulawiyah dari Medan, NPP 533 Basyrah Hayati dari Asahan, NPP 537 Gernawati dari Padanglawas Utara. Tahfiz 30 juz putra, NPP 586 Hendra Lubis dari Madina, NPP 568 Syaiful Bahri Lubis dari Tapsel, NPP 594 Muhammad Nazri dari Perguruan Tinggi. Tahfiz 30 juz putri, NPP 567 Eka Juliana dari Langkat, NPP 571 Nurul Husna dari Sergai, NPP 575 Muhajirah Binti Jamaluddin dari perguruan tinggi. Data tersebut masih 16 cabang/sub cabang yang diperlombakan pada final ini. Masih ada 11 cabang lagi yang belum diperoleh datanya. Informasi yang diperoleh, posisi kafilah Medan dan Madina masih terus bersaing ketat untuk meraih juara umum MTQ XXXII Sumut. (cpin/crif) generasi tua dalam membina wadah persatuan organisasi kepemudaan ini. “Organisasi kepemudaan KNPI harus independen, tidak bisa memihak dalam pelaksanaan Pemilu Kada Kab. Tobasa. Karena pada umumnya para pengurus terlantik sudah menjadi Tim Sukses ataupun Tim Pemenangan dari 5 calon Bupati Tobasa,“ kata Ketua DPD KNPI Tobasa Herbet Sibuea dalam sambutannya pada acara pelantikan. Ketua DPRD Tobasa Sahat Panjaitan mengajak pengurus KNPI yang dilantik untuk dapat menjunjung tinggi organisasi kepemudaan dan mengajak pemuda untuk mempunyai kepribadian yang tertib, aman dan kondusif untuk membawa daerah Kabupaten Toba Samosir yang sejahtera, aman dan terkendali. Terkait pelaksanaan Pemilu Kada mendatang diharapkan peran serta KNPI dalam mengawal berjalan sukses. Bupati Tobasa yang diwakili Kadis Kesbangtiban dan Linmas Eduwart Tampubolon, SE mengajak KNPI Tobasa dapat bermitra dengan pemerintah daerah mewujudkan pembangunan Kabupaten Toba Samosir. (a33)

Sri Mulyani ....

bertanggal 23 April 2010 dengan pemberian keterangan dijadwalkan Kamis 29 April 2010. “Pemeriksaan akan dilakukan Kamis (29/4), yang jelas terkait Bank Century, lebih jelasnya tanyakan pada KPK,” ujarnya. Mengenai adanya pemeriksaan tersebut, ia menambahkan, Kemenkeu meminta, kepada KPK agar pemeriksaan tersebut dapat dilakukan di

WASPADA Rabu 28 April 2010

Waspada/ist

SWEEPING: Ratusan warga Simpang Gambir berdiri di tengah jalan untuk mensweeping setiap kenderaan yang melintas. Mereka mencari warga Natal, dan demikian juga di Natal, kumpulan warga mencari warga Simpang Gambir, hingga kini suasana di dua tempat masih mencekam, Selasa (27/4).

IMSS Sosialisasi Peningkatan Kualitas SDM

Waspada/Zulfan Nasution

DIARAK: Pasangan Calon Walikota Sibolga diarak oleh ribuan massanya saat keluar dari gedung DPRD Sibolga usai menyampaikan visi dan misinya, Senin (26/4). Berita di hal. B7

Inilah Rutan ....

dakwa dan tahanan kasus korupsi segera menempati Rumah Tahanan (Rutan) Klas I Khusus Tindak Pidana Korupsi ( Tipikor), Cipinang, Jakarta Timur. “Sudah siap-siap, mungkin awal Mei mulai menempati (Rutan Khusus Tipikor),” kata salah terpidana kasus korupsi yang juga mantan anggota DPR RI, Abdul Hadi Djamal (AHD) saat meninjau Rutan Khusus Tipikor, Cipinang, Jakarta Timur, Selasa. Terpidana kasus korupsi suap pembangunan bandara dan pelabuhan di Indonesia bagian Timur itu, menyebutkan ada beberapa nama mantan pejabat yang akan menempati Rutan Tipikor. Calon penghuni Rutan Tipikor itu, yakni Sujudi (mantan Menteri Kesehatan), Gunawan Pranoto (Direktur Utama PT Kimia Farma, Tbk.), Aulia Pohan (mantan Deputi Gubernur Bank Indonesia),

Dudhi Makmun Murod (DPR RI asal Fraksi PDI Perjuangan), Anggodo Widojojo (dugaan kasus penyuapan pimpinan KPK, serta Oentarto Sindung Mawardi (mantan Dirjen Otonomi Daerah terkait kasus korupsi pengadaan kendaraan pemadam kebakaran). Namun demikian, AHD belum mengetahui dirinya menempati dan bersama siapa menghuni Rutan Khusus Tipikor itu karena penempatannya ditentukan pimpinan/ kepala Rutan Tipikor. AHD menyatakan kondisi Rutan Tipikor kurang nyaman karena tidak tersedia lemari pendingin dan pendingin udara. Menkumham Bertemu Anggodo Menteri Hukum dan Hak Asasi Manusia (Menkumham), Patrialis Akbar bertemu tersangka dugaan kasus penyuapan pimpinan Komisi Pemberantasan Korupsi (KPK), Ang-

Kementerian ....

minimal 6.500 dolar AS yang penyelenggaraan sepenuhnya menjadi tanggung jawab Penyelenggara Ibadah Haji Khusus (PIHK). Sebelumnya, Suryadharma Ali mengatakan bahwa naik turunnya BPIH dipengaruhi banyak komponen seperti harga bahan pesawat, nilai tukar, dan pemondokan. Karena itu, ia mengaku tidak bisa langsung menentukan ONH tahun ini karena masih melakukan penghitungan. “Harga avtur, nilai tukar rupiah itu ikut menentukan,” katanya. Ia mengaku pihaknya kini tengah berusaha meningkatkan kualitas pelayanan bagi calon jamaah haji tahun ini. Sebagai contoh, lebih banyak jamaah haji tahun ini yang akan tinggal di pemondokan lebih dekat dengan Masjidil Haram atau Kabah. “Pemondokan tahun 2009 terjauh tujuh kilometer, sekarang empat kilometer. Kemudian, yang tinggal di ring I (terdekat dengan Masjidil Haram) pada 2009 hanya 27 persen, sekarang 52 persen. Jadi terus

meningkat kualitasnya,” ujarnya. Pemondokan pada musim haji tahun 2010 lebih mahal dibandingkan tahun 2009 karena ada perubahan kebijakan pemerintahan Arab Saudi. Pemerintah setempat menginginkan jumlah jemaah haji dalam satu kamar lebih sedikit agar lebih nyaman dengan perhitungan empat meter luas ruang per orang. “Berubahnya aturan dari 3,5 meter per orang menjadi 4 meter per orang, tentu saja pemilik rumah mau tidak mau meningkatkan harga sewa,” katanya. Selain itu, pemerintah Arab Saudi juga melakukan pembongkaran beberapa pemondokan di sekitar Masjidil Haram untuk perluasan. Hal ini tentu saja membuat jumlah pemondokan berkurang dan mendorong kenaikan sewa inap. “Pemondokan berkurang di ring 1, maka kompetisi semakin ketat. Karena kompetisi makin ketat, maka harga semakin mahal,” katanya.

Presiden Tidak ....

fikasinya seputar perannya dalam kasus Century saat menjabat sebagai Gubernur Bank Indonesia,” tutur Yopie. Mengenai mekanisme tata cara dan tempat pemanggilan, Yopie mengatakan, masih dikoordinasikan antara Wapres dengan KPK. Pemeriksaan di Kantor Wapres Kamis Pihak Sekretariat Wapres (Setwapres) berharap Komisi Pemberantasan Korupsi (KPK) memeriksa Boediono di kantor Wapres. KPK pun setuju jika pemeriksaan Boediono dilakukan di kantornya. “Ada indikasi dari pihak Setwapres karena kesibukan beliau, pemeriksaan dilakukan di kantor Wapres. KPK, karena masih tingkat penyelidikan, bersedia melakukan (pemeriksaan) di mana saja,” ujar Wakil Ketua KPK M Jasin.

Jasin mengatakan itu usai Seminar Pembangunan Jalan di Hotel Le Meridien, Jl Sudirman, Jakarta, Selasa (26/4). Menurut Jasin, KPK sebelumnya juga pernah memeriksa Bachtiar Chamsyah saat masih menjabat Mensos di luar KPK. Asalkan status kasus yang terkait, lanjut Jasin, masih dalam tahap penyelidikan. “Pokoknya kita junjung tinggi karena Pak Wapres adalah simbol negara dan kita menghormati,” kata Jasin. Jasin menambahkan, pemeriksaan terhadap Boediono akan dilakukan pada Kamis (29/4) mendatang. Namun hingga kini KPK masih menunggu kesediaan Boediono untuk diperiksa pada tanggal tersebut. Materi yang ditanyakan? “Kalau materi saya tidak bisa sampaikan, itu nantilah,” pungkas Jasin. (ant/dtc)

lantai dua dan tiga, sedangkan lantai satu luasnya 3 X 6 meter,” ujar Ardoko. Fasilitas lainnya, yakni ruangan tambahan sekitar 25 persen dari luas ruangan untuk musalla, ruang baca, sedangkan ruangan di luar kamar tersedia ruangan untuk olahraga, menonton televisi. Sedangkan, kualitas bangunan Rutan Tipikor itu memiliki ketebalan tembok sebesar 20 sentimeter, cat tembok antibahan, ketebalan besi tralis mencapai 22 milimeter dan jarak pos jaga antar pos sekitar 10 meter. Ardoko tercatat sebagai arsitek beberapa pembangunan Lapas/Rutan di Indonesia, dan melakukan studi banding keenam negara yakni China, Austrlia, Malaysia, Singapura, Hongkong, dan Thailand. Sejumlah Mantan Pejabat Segera Pindah Sejumlah terpidana, tercost” 405 dolar AS, “safeguarding” 15,8 dolar AS dan asuransi jemaah haji sebesar Rp100.000. Dibanding tahun 2009, kata Menag, BPIH mengalami kenaikan 133 dolar AS yang diakibatkan kenaikan komponen akomodasi di Makkah yang disebabkan lokasi pemondokan yang semakin dekat dengan Masjidil Haram, paling jauh 4.000 meter dan adanya penambahan ruang per orang menjadi 4 meter persegi. “BPIH tahun 2009/1430 H sebesar 3.444 dolar AS dan tahun 2010/1431 diusulkan menjadi sebesar 3.577 dolar AS ditambah biaya asuransi sebesar Rp100.000 per orang,” katanya. Menag menambahkan, kenaikan sewa akomodasi di Mekkah juga diakibatkan masih terjadinya pembongkaran gedung-gedung di sekitar Masjidil Haram yang berdampak pada tidak seimbangnya “supply” dan “demand”. Sementara untuk tarif BPIH Khusus, diusulkan

melakukan pemeriksaan terhadap Boediono selaku mantan Gubernur Bank Indonesia saat kasus Bank Century itu bergulir. “Itu bukan surat pemanggilan untuk pemeriksaan, melainkan surat pemanggilan untuk klarifikasi dimana Bapak Boediono dimintai klariKantor Menteri Keuangan, Gedung Djuanda. “Surat pemeriksaan telah diajukan kepada pihak KPK, dan permintaan dari kami agar pemberian keterangan dapat dilakukan di Kantor Menkeu, disebabkan karena kesibukan ibu menteri” ujar Mulia. Menurut dia, dalam pemeriksaan nanti Menkeu didampingi oleh Biro Bantuan Hukum dan beberapa pejabat terkait.

SOSA (Waspada): Ikatan Mahasiswa Sosa Sekitar (IMSS) mengadakan sosialisasi dalam rangka mendorong peningkatan kualitas sumber daya manusia melalui jalur pendidikan. Hal itu dilakukan agar para pelajar yang tamat di tingkat SMA terus melanjutkan pendidikan ke jenjang yang lebih tinggi. Demikian kata Edi Harahap Alamsyah Hasibuan, Ikhwansyah dan Isharuddin, Selasa (27/4) usai melaksanakan acara sosialisasi di SMA N 1 Sosa, yang dihadiri murid kelas III yang baru saja lulus Ujian Nasional, para orangtua murid dan para guru. (a32) godo Widjojo di Rumah Tahanan (Rutan) Klas I Khusus Tindak Pidana Korupsi (Tipikor), Cipinang, Jakarta Timur. Patrialis bertemu Anggodo di depan ruang tahanan Nomor C-13 usai peresmian Rutan Khusus Tipikor. Patrialis sempat berbincang dengan Anggodo terkait fasilitas Rutan Khusus Tipikor yang pertama di Indonesia itu. Sementara itu, Anggodo menuturkan fasilitas di Rutan Khusus Tipikor itu sedikit berbeda dengan rumah tahanan lainnya karena bangunannya baru. “Mungkin karena bangunan baru dan khusus kasus tipikor jadi berbeda dengan rutan atau lapas lainnya,” ujar Anggodo seraya menambahkan dirinya belum mengetahui mau menempati ruangan tertentu. Anggodo menjelaskan penempatan ruangan tahanan itu tergantung Kepala Rutan Klas I Cipinang yang akan menentukan posisi dan lokasi tahanan khusus tipikor itu, serta tidak ada perlakuan istimewa terhadap dirinya. Sedangkan, Patrialis Akbar menambahkan seluruh terpidana, terdakwa maupun tahanan yang tersangkut kasus korupsi akan menempati Rutan Khusus Tipikor Cipinang dengan pemindahan secara bertahap. “Pe m i n d a h a n s e c a r a bertahap mulai hari ini setelah peresmian hingga selesai,” tutur Patrialis. (ant/dtc)

Warga 2 Desa ....

sebagian wilayah Kec. Natal. Padahal sebelumnya perusahaan itu hanya memiliki usaha di wilayah Kec. Lingga Bayu. Warga Natal tidak terima tan a h n y a d i g a ra p P T P S U dengan mengerahkan pekerja dari Kec. Lingga Bayu. Kapolres Madina, AKBP Hirbak Wahyu, yang dikonfirmasi wartawan sedang bersama angotanya di lapangan. Pihaknya sedang melakukan pembicaraan dengan warga agar mau berdamai. Saat ini personil Polres Madina masih terus melakukan penjagaan di dua daerah itu untuk menghindari bentrok fisik. “Kedua unsur masyarakat

akan diajak berdamai, seluruh unsur muspida dan muspika akan berkumpul dengan warga untuk melakukan pembicaraan damai,” katanya saat dihubungi wartawan lewat telefon. Kepada warga diimbaunya agar menahan diri dan tidak terpancing provokasi yang sengaja untuk memperkeruh suasana. Karena apapun yang terjadi pasti akan merugikan diri sendiri dan masyarakat. Aksi sweeping yang dilakukan kedua kubu warga tersebut mengakibatkan lalulintas macat. Setiap kendaraan yang ingin melewati Simpang Gambir dihentikan, begitu juga di daerah Natal . (a20)

Waspada/Zulfan Nasution

Paket Calon Walikota Sibolga Dr Rudolf Hamonangan Sianturi dan Ir H Ulam Raya Hutagalung MSi, Selasa (27/ 4) melepas 600 kader militannya untuk melakukan kampanye simpatik mendatangi rumah warga di 17 kelurahan di Sibolga dari lokasi centre RH-Ulam di Hotel Tapian Nauli Sibolga.

600 Kader Calon Walikota Sibolga Kampanye Door To Door SIBOLGA (Waspada): Pasangan Calon Walikota Sibolga nomor urut 5 Dr Rudolf Hamonangan Sianturi dan Ir H Ulam Raya Hutagalung, MSi, Selasa (27/4) melepas 600 kader militannya untuk melakukan kampanye simpatik men-datangi rumah-rumah warga di 17 kelurahan di Sibolga dari lokasi centre RH-Ulam di Hotel Tapian Nauli Sibolga. Ketua Tim Kampanye RH-Ulam, Ongli Siregar mengata-kan, kampanye perdana ini sengaja dilakukan dengan kegiatan simpatik tanpa rapat umum untuk mengefektifkan penggalangan massa di setiap lingkungan dan kelurahan. Sedangkan Calon Walikota Sibolga Dr Rudolf Hamonongan Santuri mengatakan, kampanye yang dilakukan bersifat mensosialisasikan dengan pengenalan yang baik ke elemen masyarakat adalah yang terbaik dalam komunikasi dengan masyarakat. (a18)


Berita Utama

A2

WASPADA Rabu 28 April 2010

267 Sekolah Lulus UN Nol Persen

Survei UI: Malaysia Paling Berpotensi Ancam Indonesia JAKARTA (Waspada): Hasil survei internal yang dilakukan Universitas Indonesia (UI) terhadap mahasiswa FISIP soal negara yang paling mengancam Indonesia cukup mengejutkan. Sebab Malaysia berada di urutan teratas. “Ada pertanyaan, negara mana yang paling berpotensi mengancam Indonesia, hasilnya 48 persen mahasiswa menjawab Malaysia,” kata Wakil Dekan FISIP UI Eddy Prasetyono saat ditemui di Kampus UI, Depok, Selasa (27/4). Selain Malaysia, empat negara lainnya yang dipersepsi mahasiswa FISIP UI sebagai ancaman keamanan utama bagi Indonesia adalah Amerika Serikat (27,6 persen), China (12 persen), Australia dan Singapura (masing-masing 3,6 persen). Survei dilakukan pada Februari-Maret 2010. Ada 250 mahasiswa dari 8 jurusan di FISIP yang jadi objek survei. Usia rata-rata mahasiswa itu 17-23 tahun dengan tema survei, “Pengetahuan dan Persepsi Mahasiswa terhadap Komunitas ASEAN 2015”.

Survei itu dibagi dalam 2 kategori yaitu pengetahuan tentang ASEAN, dengan pertanyaan antara lain kapan ASEAN dibentuk dan siapa Sekjennya. “Hasilnya baik, mereka mengenal ASEAN,” kata Eddy. Sedang pertanyaan soal negara yang paling mengancam muncul saat ditanya persepsi mahasiswa tentang negara-negara yang tergabung dalam ASEAN. Selain soal negara yang paling mengancam, para mahasiswa juga menyebut Malaysia sebagai negara kompetitor. “Pertanyaan soal negara mana yang perlu diantisipasi sebagai kompetitor, jawabannya 70 persen Malaysia,” tambah Eddy. Dia menegaskan, survei itu merupakan hasil persepsi, jadi tidak bisa diukur. Alasan yang memicu jawaban itu mungkin adalah terlalu banyaknya masalah antara Indonesia dan Malaysia. “Seperti TKI, Ambalat, illegal logging. Nah itu kan bagian masalah yang bisa dipahami oleh remaja-remaja sekarang,” tutupnya. (dtc)

Pejabat Langkat ...

SKPD pada malam hari untuk memberi penjelasakan agar mengumpulkan berkas-berkas terkait realisasi program kerja. Karena itu pada malam hari sejak kemarin, sejumlah ruang di Kantor Bupati Langkat terlihat terang karena ada beberapa aparatur yang lembur mencari berkas beberapa tahun silam. Ketidaktenangan mereka dengan kunjungan KPK karena harus ekstra keras mengumpulkan berkas yang mungkin dianggap tidak berguna lagi, tetapi penting untuk penyidikan KPK. (a38)

pembukuan penggunaan APBD sejak tahun 2000 hingga 2007. Pantauan Waspada di salah satu gudang penyimpanan berkas di kantor Bupati Langkat, Selasa, sejumlah aparatur terlihat sibuk mencari dan mengumpulkan berkas-berkas penting terkait pembukuan penggunaan APBD. Sementara informasi lain yang diperoleh, sebelum kunjungan KPK ke Langkat Senin (26/4), dua hari sebelum itu Sekda telah mengadakan rapat dengan seluruh pimpinan

Ongkos Haji ... “Pemondokan tahun 2009 terjauh tujuh kilometer, sekarang empat kilometer. Kemudian, yang tinggal di ring I (terdekat dengan Masjidil Haram) pada 2009 hanya 27 persen, sekarang 52 persen. Jadi terus meningkat kualitasnya,” ujarnya. Pemondokan pada musim haji tahun 2010 lebih mahal dibandingkan tahun 2009 karena ada perubahan kebijakan pemerintahan Arab Saudi. Pemerintah setempat menginginkan jumlah jamaah haji dalam satu kamar lebih sedikit agar lebih nyaman dengan perhitungan empat

Patrialis Resmikan ... Fasilitas lainnya, yakni ruangan tambahan sekitar 25 persen dari luas ruangan untuk musala, ruang baca, se-

PRT Indonesia ... Para tetangga ingat Puji sebagai pribadi yang ‘amat bersahabat’ yang selalu menyapa mereka, sekurang-kurangnya dengan ‘hai.’ Ny.Lam mengatakan dia ingin memperpanjang kontrak Puji bila kontraknya berakhir September. (tst/m07)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Kg5+, Rg8. 2. Me6+, Mf7. 3. MxM+mat.

Jawaban TTS: TTS Topik

T E H H T S A P B K E J U L N C K O P I E S D R G E F L A L K O I

Kesehatan

I J A U K A N A D E N T A L I O S A Y A M I A U V I T A M I

F E I N A A T M R M A D U E N S P T I E R R Y S A B A H K

B L U E B R A O W R U K T O S A O B N H O L A G A R A M I T D

Jawaban Sudoku:

4 1 3 5 9 2 7 6 8

6 7 5 3 8 4 9 2 1

2 8 9 7 6 1 4 3 5

8 9 7 1 3 6 5 4 2

5 6 4 2 7 8 1 9 3

3 2 1 4 5 9 8 7 6

1 3 8 9 2 7 6 5 4

7 4 2 6 1 5 3 8 9

9 5 6 8 4 3 2 1 7

meter luas ruang per orang. “Berubahnya aturan dari 3,5 meter per orang menjadi 4 meter per orang, tentu saja pemilik rumah mau tidak mau meningkatkan harga sewa,” katanya. Selain itu, pemerintah Arab Saudi juga melakukan pembongkaran beberapa pemondokan di sekitar Masjidil Haram untuk perluasan. Hal ini tentu saja membuat jumlah pemondokan berkurang dan mendorong kenaikan sewa inap. “Pemondokan berkurang di ring 1, maka kompetisi semakin ketat. Karena kompetisi makin ketat, maka harga semakin mahal,” katanya. dangkan ruangan di luar kamar tersedia ruangan untuk olahraga, menonton televisi. Sedangkan, kualitas bangunan Rutan Tipikor itu memiliki ketebalan tembok sebesar 20 sentimeter, cat tembok antibahan, ketebalan besi tralis mencapai 22 milimeter dan jarak pos jaga antar pos sekitar 10 meter. Ardoko tercatat sebagai arsitek beberapa pembangunan Lapas/Rutan di Indonesia, dan melakukan studi banding keenam negara yakni Cina, Australia, Malaysia, Singapura, Hongkong, dan Thailand.

Lulus Cum Laude, ... “Saya tidak pernah mengeluh soal kerjaan ini. Tapi ketika saya dinyatakan menjadi golongan III A, masak iya pemerintah menugaskan tukang pel lantai harus sarjana,” kata Jack, Selasa (27/4) di Pekanbaru. Jack yang bekerja pada bagian umum, setiap hari harus berangkat kerja lebih awal dibanding PNS lainnya yang ada di LPMP Riau. Usai salat subuh, dari rumahnya di Jl Genteng, Kecamatan Tampan, Pekanbaru, sarjana cum laude dengan nilai IPK 3,75 itu harus buru-buru ke tempat kerja. “Sebelum PNS pada masuk, saya dan teman-teman PNS yang bertugas sebagai tukang sapu, harus lebih dulu sampai dan bekerja. Setelah seluruh ruangan kami bersihkan bersama, barulah PNS lainnya tiba. Padahal idealnya, PNS masuk kerja pukul setengah delapan pagi,” kata anak kedua dari dua bersaudara itu. Bila melihat kondisi kerja Jack dibandingkan PNS di jajaran Pemprov Riau, maka hal ini sangat berbanding terbalik. Di jajaran Pemprov Riau, ataupun instansi pegawai negeri pusat lainnya, tidak ada lagi pekerja pel lantai dan membersihkan parit berstatus PNS. Sebab, pekerjaan bersih-bersih seperti itu biasanya dikontrakkan dengan pihak swasta. “Di tempat saya ini, ada 12 PNS golongan II A yang bekerja sebagai petugas cleaning service. Malah tidak hanya

Pemerintah Akan Intervensi

Antara

PM FINLANDIA: Presiden Susislo Bambang Yudhoyono memperkenalkan para Menteri Kabinet Indonesia Bersatu II saat menerima kunjungan kehormatan PM Finlandia Matti Vanhanen, di Istana Merdeka, Jakarta, Selasa (27/4). hujan lebat sekira pukul 13:30. Saat kejadian sejumlah pekerja melakukan tugasnya di lantai 1 di antaranya Nasib yang tengah merehab beton penahan bangunan bersama dua temannya. Ketika bangunan lantai empat, tiga dan dua, runtuh secara beruntun, Nasib masih sempat mengingatkan rekanrekannya dan berhamburan menyelamatkan diri. Namun naas, Nasib sendiri terjebak hingga terkubur hidup-hidup. Diperkirakan, runtuhnya bangunan itu, karena berat beban blanket basah yang melebihi kapasitas, selain daya dukung bangunan yang sudah tidak maksimal, karena terma-

kan usia. Diungkapkan, untuk satu palet blanket yang dikeringkan bisa mencapai berat 500 kg. Untuk satu kamar dek, menampung sekira 60 palet blanket. Jika yang runtuh ada tiga kamar dikalikan tiga lantai, maka beban blanket yang runtuh mencapai puluhan ton, hitung seorang pekerja. Beberapa pekerja mengatakan, dek yang runtuh merupakan bangunan paling tua di antara dua dek lainnya. Bangunan itu, terdiri dari bangunan kayu yang di susun dengan ketinggian sekira 20 meter. Dibangun pertama kali sekira 1986 dan hingga kini tidak mengalami rehab total. Padahal, sejak

jam, seperti parang dan bambu runcing. Mereka juga melarang wartawan untuk mengambil foto. Akibatnya, dua orang wartawan group MNC menjadi saasaran pukulan dan lemparan batu. Menurut Muhammad Ali Hanafiah, 26, warga Natal, aksi itu dipicu PT PSU yang bergerak di bidang perkebunan kelapa sawit menggarap sebagian wilayah Kec. Natal. Padahal sebelumnya perusahaan itu hanya memiliki usaha di wilayah Kec. Lingga Bayu. Warga Natal tidak terima tanahnya digarap PT PSU dengan mengerahkan pekerja dari Kec. Lingga Bayu. Kapolres Madina, AKBP Hirbak Wahyu, yang dikonfirmasi wartawan sedang bersama angotanya di lapangan. Pihaknya sedang melakukan pembicaraan dengan warga

agar mau berdamai. Saat ini personil Polres Madina masih terus melakukan penjagaan di dua daerah itu untuk menghindari bentrok fisik. “Kedua unsur masyarakat akan diajak berdamai, seluruh unsur muspida dan muspika akan berkumpul dengan warga untuk melakukan pembicaraan damai,” katanya saat dihubungi wartawan lewat telefon. Kepada warga diimbaunya agar menahan diri dan tidak terpancing provokasi yang sengaja untuk memperkeruh suasana. Karena apapun yang terjadi pasti akan merugikan diri sendiri dan masyarakat. Aksi sweeping yang dilakukan kedua kubu warga tersebut mengakibatkan lalulintas macat. Setiap kendaraan yang ingin melewati Simpang Gambir dihentikan, begitu juga di daerah Natal . (a20)

menyampaikan bahwa tidak memberikan respons apa pun tentang hal tersebut,” tuturnya. Presiden, lanjut Julian, memilih tidak berkomentar terhadap pemanggilan terhadap dua pembantunya di pemerintahan tersebut. Boediono akan dimintai keterangan oleh KPK sebagai mantan Gubernur Bank Indonesia, Kamis (29/4) besok juga Sri Mulyani selaku mantan Ketua Stabilitas Sistem Keuangan (KSSK).

cara reguler maupun kegiatan ekstrakulikuler lainnya. Namun, tambah mantan Kepala SMKN I Rantau Utara itu, Dinas Pendidikan L.Batu memberi waktu tiga hari kepada pihak SMAN 2 Rantau Utara untuk melakukan upaya komplain, klarifikasi ke Dinas Pendidikan Provsi terhitung sejak hari Selasa-Kamis (27-29/4). Apabila selama tenggat waktu 3 hari itu belum juga ada keputusan menyangkut perubahan hasil UN tersebut, pihak SMAN 2 Rantau Utara akan mengumumkan kelulusan para siswa peserta UN lainnya. Sebab, baik pihak SMAN 2 Rantau Utara maupun Dinas Pendidikan L.Batu tidak menginginkan adanya kendala terhadap peserta UN SMAN 2 Rantau Utara lainnya yang lulus nantinya dan akan melanjutkan pendidikan ke jenjang perguruan tinggi baik di Sumut maupun luar Sumut. Di lain sisi, tandas Iskandar, apabila upaya komplain/ klarifikasi pihak SMAN 2 Rantau Utara ke Diknas Provsu tidak membawa hasil sebagai-

mana yang diharapkan, maka ke 99 siswa tersebut masih memiliki kesempatan untuk lulus, yakni dengan mengikuti ujian ulang yang dilaksanakan pada tanggal 10-14 Mei 2010. Sementara Kepala Sekolah SMAN 2 Rantau Utara M Yusuf Rangkuti Rangkuti ketika dikonfirnasi Waspada, belum dapat memberikan keterangan. “Saya masih di Medan, maaf ya belum bisa kasi keterangan. Masih sibuk,” ujarnya. Daftar Ulang Pasca pengumuman hasil UN di SMK Islamiyah Kotapinang, Labuhanbatu Selatan seluruh siswa yang tidak lulus telah mendaftar ulang, guna mengikuti ujian ulangan. Demikian Kepala Sekolah SMK Islamiyah Ajamin Sahad menjawab Waspada, Selasa (27/4). Menurut Ajamin, SMK Islamiyah hanya satu jurusan yakni jurusan Otomotif. Semua siswa SMK gagal saat di bidang studi teori kejuruan, sedangkan bidang studi lain seperti Bahasa Indonesia, Bahasa Inggeris, Matimatika lulus semua, katanya. (a27/c05)

saya yang sarjana, ada teman satu lagi juga sarjana hukum tugasnya sama seperti saya,” kata alumni Fakultas Ilmu Sosial Politik (Fisipol) tahun 2003 itu. Minta bersabar LPMP Riau mengakui Jack Lord hanya bekerja sebagai tukang sapu dan pel. Namun, LPMP meminta Jack bersabar, sebelum ada penempatan baru. “Memang benar Jack sebagai tukang sapu. Tapi masalah ini sudah menjadi perhatian kita. Cuma dia memang harus bersabar,” kata Kabag Umum LPMP Riau, Sumide Hendri, Pekanbaru, Selasa (27/4). Sumide menyebut, pihaknya akan berencana menyerahkan urusan cleaning service ini ke pihak swasta. Hanya saja, dia tidak berani menyebut kapan hal itu dilaksanakan. “Kita sudah merancang agar cleaning service diserahkan kepada pihak swasta. Tapi kapan waktunya kami belum tahu. Hanya baru rencana saja,” kata Sumide. Pilih bertahan Banyak yang usul agar Jack cari pekerjaan baru. Tapi dia memilih bertahan. “Ini bukan kesalahan pemerintah atau instansi di tempat saya bekerja. Semua ini ulah oknum pejabat. Karena itu saya tidak akan mundur hanya karena ulah pejabatnya,” kata Jack. Dia mengatakan penempatan PNS menjadi tukang sapu adalah kesalahan kebijakan dari pimpinan LPMP. Dia me-

minta pemerintah pusat menilai langsung kondisi di lapangan. “Karena saya bukan PNS di lingkungan Pemprov Riau, mestinya kondisi ini menjadi perhatian pemerintah pusat,” kata Jack. LPMP Riau memang di bawah Ditjen Peningkatan Mutu Pendidik dan Tenaga Kependidikan (PMPTK) Kemendiknas. Selain Jack, masih ada 12 PNS lain di tempatnya yang juga menjadi tukang sapu dan pel tempat diklat itu. Jack menyebut, dia tidak pernah menolak apa yang diberikan tugas kepadanya. “Jangan salah penafsiran dulu. Saya bukan menolak tugas yang saya emban selama ini. Yang kita persoalkan adalah, mengapa PNS golongan III A dijadikan cleaning service,” kata Jack. Menurut dia, instansi pemerintah lain di Riau menyerahkan urusan kebersihan kepada rekanan swasta. Tapi mengapa LPMP Riau menyerahkan tugas bersih-bersih ini kepada PNS golongan III A. “Masih ada yang tidak sarjana di LPMP Riau, tapi kerjanya tidak bukan cleaning service. Ini membuktinya adanya permainan oknum. Oknum inilah yang semestinya harus dievaluasi pemerintah,” pungkas Jack. Biasa bersihkan kotoran anjing Jack juga tidak jarang, harus membersihkan kotoran anjing yang lengket di lantai. Na-

mun Jack tak banyak mengeluh. Usai salat subuh, Jack harus sudah berangkat kerja, saat PNS lain masih berada di rumah. Pukul 05:30, dia dan PNS lain yang menjadi tukang sapu, harus mulai membersihkan kantor agar para PNS lain nyaman saat masuk kerja pukul 08:00 nanti. Di pemukiman sekitar tempatnya bekerja, banyak warga yang memelihara anjing. Saat malam hari, banyak anjing berkeliaran termasuk masuk ke dalam pelataran kantor LPMP. Walhasil, kotoran anjing yang bertebaran pun menjadi tanggung jawab Jack Lord. “Kotoran anjing kadang banyak kita temui di koridor gedung. Tapi karena alat pembersih ala kadarnya, ya kita langsung dengan kain lap membersihkan kotoran anjing itu,” kata Jack. Alat kebersihan Jack memang ala kadarnya. Hanya ember air, sapu lidi, kain dan tongkat pel. Tidak ada sikat untuk membersihkan lantai dari kotoran anjing. “Cuma kain lap saja modalnya dengan tongkatnya. Tidak ada sikat. Tapi kami tetap bekerja maksimal,” kata Jack. “Kami baru pulang kalau perserta diklat sudah selesai. Malam itu juga kita membersihkan ruangan itu, sebab besok paginya kadang ada peserta diklat lainnya. Kita yang menjadi cleaning service ini harus stand by setiap saat,” pungkas Jack. (dtc/m05)

Dek Getah Runtuh, ... Akibatnya, seorang pekerja bernama Nasib, 35, warga Perumahan BTN Kel. Lalang, Kec. Rambutan, Kota Tebingtinggi terkubur hidup-hidup hingga diketahui tewas pada pukul 18:30. Puluhan ton blanket getah menimpa korban. Pasca runtuh, terlihat perusahaan tidak serius memberikan pertolongan kepada korban yang terkubur, karena hanya membongkar runtuhan getah seadanya. Dari keterangan yang berhasil dihimpun, bangunan dek getah itu runtuh pada kamar 2, 3 dan 4 di lantai empat, saat

Warga Dua Desa ... Di Natal, aksi sweeping dilakukan di daerah Simpang Gugung (Kampung Sawah). Sebelum melakukan aksinya, para pemuda yang ada di daerah itu berkumpul di lapangan Merdeka Natal. Selanjutnya menuju Simpang Gugung untuk menyetop semua kendaraan yang lewat, dan meminta identitas setiap penumpang. Di Simpang Gambir, ratusan warga berkumpul di depan jembatan yang mengarah ke Sumatera Barat. Mereka melakukan aksi penyetopan terhadap setiap kendaraan yang melintas. Mereka memintai kartu tanda penduduk (KTP) penumpang dan pengemudi kendaraan. Umumnya, kedua warga yang ada di daerah tersebut terlihat memegang senjata ta-

Komplain UN ... Rantau Utara, mengingat selama ini mereka merasa telah berupaya semaksimal mungkin mencerdaskan para siswa sekolah khususnya para siswa peserta UN tahun 2010 SMAN Rantau Utara. Para guru SMAN 2 Rantau Utara merasa kecewa dengan hasil UN tahun 2010 ini, sebab upaya mereka mematangkan para siswanya menghadapi UN sudah maksimal, baik kegiatan belajar-mengajar se-

Presiden ...

dibangun dek itu sudah mengalami satu kali terbakar dan satu kali runtuh. Saat runtuh kali pertama, peristiwa itu juga memakan korban jiwa. Abang korban Tugiman, di lokasi kejadian, mengatakan keluarga meminta PT Darmek bertanggung jawab atas musibah yang menimpa adik kandungnya itu. “Kita minta perusahaan bertanggung jawab akibat yang terjadi pada adik saya,” ujar Tugiman. Dikatakan, korban menanggung dua anak masih kecil dan seorang istri. Terkait itu, pengawas pekerja PT Darmek Salman Pane, mengatakan kejadian itu merupakan musibah alam. Dia mengatakan, bangunan dek itu terkena angin puting beliung dan melihat langsung kejadiannya. Pengawas itu, juga mengatakan selama 25 tahun bekerja di perusahaan, itulah pertama kali terjadinya musibah. Namun, salah seorang pekerja menyebutkan keterangan itu bohong, karena kejadian runtuh pukul 13:30, sedangkan pengawas itu datang pada 14:30. “Dia bohong itu,” ujar singkat, pekerja yang minta namanya tidak dimuat. Korban berhasil dikeluarkan pada pukul 18:30 dalam keadaan sudah tidak bernyawa. Saat ditemukan kondisi tubuh korban terlihat memar-memar pada beberapa bagian tubuh. Bagian tubuhnya terlihat gepeng dan diduga akibat ditimpa blanket (slendang getah). (a08)

Medan, Madina ... Masing-masing cabang yang diperlombakan di final diikuti tiga peserta yang lolos babak seleksi. Panitia pelaksana maupun dewan hakim tidak berani memberikan nama dan daerah asal para kafilah yang lolos ke final. Alasannya demi kerahasiaan dan objetifnya penilaian. Namun demikian, Waspada masih bisa memperoleh sejumlah nama dan kafilah yang lolos tersebut. Cabang tilawah remaja putra, NPP 176 atas nama Azrai Hasibuan dari kafilah Medan, NPP 134 Rido Riski dari Sidikalang, NPP 182 Syaiful FaI dari Madina. Tilawah remaja putri, NPP 167 Yulia Hermawati dari Medan, NPP 187 Mardhotillah Ulfa dari PTPN Wilayah I, NPP 179 Arsil Zahuri dari Sergai. Tilawah dewasa putra, NPP 248 Jaffar Hasibuan dari Medan, NPP 234 Muhammad Rahim dari Sergai, NPP 210 Madhasad dari Madina. Tilawah dewasa putri, NPP 217 Nurlaila SPdI dari Medan, NPP 247 Hj Misrawati dari Sergai, NPP 249 Nurmisbah Surya da-

JAKARTA (Antara): Kementerian Pendidikan melaporkan ada 267 sekolah dari seluruh sekolah tingkat SMA/ MA di seluruh Indonesia yang tingkat kelulusannya dalam Ujian Nasional (UN) 2010 nol persen, terbanyak di Kabupaten Kutai Timur, Kaltim, dengan 39 sekolah. Dari 267 sekolah itu siswanya berjumlah 7.648 orang, sementara peserta yang harus mengulang untuk satu hingga enan pelajaran ada 154.051 peserta, kata Menteri Pendidikan Nasional (Mendiknas) Mohammad Nuh dalam jumpa pers di Jakarta, Selasa (27/4) petang. Sekolah dengan angka kelulusan nol persen terbanyak terdapat di Kalimantan Timur sebanyak 39 sekolah dengan jumlah 1.158 siswa, Sulawesi Tenggara 26 sekolah dengan jumlah 768 siswa, Kalimantan Tengah 20 sekolah dengan jumlah 701 siswa, Maluku Utara 20 sekolah dengan jumlah 597 siswa. Mendiknas juga mengatakan, DKI Jakarta juga tidak luput dari bagian 267 sekolah yang memiliki angka kelulusan

nol persen. Di DKI terdapat 10 sekolah negeri dan swasta yang tingkat kelulusannya nol persen dengan jumlah siswa 143 siswa. “Pemerintah akan melakukan intervensi kebijakan terhadap sekolah yang angka kelulusannya nol persen ini. Bentuk intervensinya belum dapat dirinci lebih lanjut. Kami masih menunggu timnya untuk meneliti kekurangan dari masing-masing sekolah.” “Intervensi diberikan sesuai kebutuhan. Kami belum tahu apa kekurangan masingmasing sekolah, apakah kesulitan mendapat guru bermutu, buku atau fasilitas pendidikan lainnya. Setelah jelas, baru kita lakukan intervensi kebijakan sesuai dengan kebutuhan,” ujarnya. Menurut Kepala Balitbang, Kemendiknas, Mansyur Ramli, banyaknya siswa IPS yang gagal dalam mata pelajaran Bahasa Indonesia karena soal-soal yang diujikan pada UN 2010 lebih banyak mengedepankan logikanya, sehingga siswa jurusan IPA yang mampu menjawab lebih baik.

Mantan Diktator ... mengatakan penahanannya dan transfernya ke Prancis tidak punya dasar hukum. Menlu AS Hillary Rodham Clinton telah menandatangani satu penyerahan surat penangkapan untuk Noriega setelah seorang hakim federal di Miami mencabut satu pemblokadean ekstradisinya bulan lalu. Noriega tampil di depan beberapa jaksa penuntut dalam satu sidang yang dilakukan di belakang pintu tertutup di ruang utama pengadilan Paris Selasa dan mereka membacakan surat penangkapan itu untuknya, langkah pertama sebelum diambil tindakan judisial lainnya. Selasa sore, dia harus tampil di depan hakim yang akan memutuskan apakah memasukkan dia ke belakang jeruji besi atau tidak atau membebaskannya sesuai supervisi judisial sebelum diambilnya langkah lanjut. Jika Noriega dibebaskan, bahkan dikenakan tahanan ru-

mah atau berada di bawah kendali hukum yang ketat, maka itu adalah suatu kemenangan besar setelah satu generasi berada di balik tirai besi selama satu generasi. Yves Leberquier, pengacata Noriega dari Prancis, mengatakan mantan diktator itu setengah lumpuh sejak dia mengalami stroke ringan empat tahun lalu. “Pria ini nampaknya amat lemah,” kata Olivier Metzner, pengacara Prancis lainnya yang jadianggotatimpembelaNoriega. Leberquier mengatakan bahwa mengadili seorang mantan kepala negara asing yang seharusnya memiliki kekebalan hukum adalah ilegal. Noriega telah dinyatakan seorang Tawanan Perang (POW) setelah dakwaan perdagangan obat bius tahun 1992 oleh hakim federal Miami. Di Miami, Noriega memiliki ruangan tersendiri di tahanan, hak untuk mengenakan pakaian seragam militernya, lengkap dengan lambang-lambangnya, akses ke televisi dan pemantauan kelompok HAM internasional. (m07)

ri Asahan. Qiraah Sabaah putra, NPP 308 Darwin Hasibuan dari Medan, NPP 318 Nasrullah dari Batubara, NPP 328 Muhammad Asril Nasution dari Pematang Siantar. Qiraah Sabaah putri, NPP 343 Susiana dari Pematang Siantar, NPP 337 Mardiyah dari Madina, NPP 311 Nurbaiti dari Medan. Tahfiz 1 juz putra, NPP 354 Arief Umro dari Madina, NPP 384 Ulinnuha Ahmad Mutawalul dari Tebingtinggi, NPP 358 Mukopa Asbar Ridwan dari PTPNWilayah I. Tahfiz 1 juz putri, NPP 403 Rizki Muliani dari Madina, NPP 405 Leli Susanti dari Tanjungbalai, NPP 349 Rhoudatul Jannah dari PT Lonsum. Tahfiz 5 juz putra, NPP 458 Fikri Munawar dari Medan, NPP 454 Ali Ariansyah dari Tebingtinggi, NPP 414 Fahri Rinaldi dari Binjai. Tahfiz 5 juz purti, NPP 471 Rika Kumala Sari dari Asahan, NPP 445 Aldila Sarti dari PT Lonsum, NPP 435 Muthahharotun Nur dari Madina. Tahfiz 10 juz putra, NPP 478 M Taufik Fadli dari Medan, NPP 500 Fitra Pratama Mingka dari Tanjungbalai, NPP 512 Muhammad Arif Lubis dari Padangsidimpuan. Tahfiz 10 juz

putri, NPP 491 Syarifah dari Madina, NPP 505 Ameliatul Khoiriah Nasution dari Padanglawas, NPP 495 Trisna Ningsih dari Medan. Tahfiz 20 juz putra, NPP 530 Lewis Pramana Lubis dari Madina, NPP 540 Andi Zainal dari Pematangsiantar, NPP 542 Muhammad Affan Batubara dari Padanglawas Utara. Tahfiz 20 juz putri, NPP 543 Aulawiyah dari Medan, NPP 533 Basyrah Hayati dari Asahan, NPP 537 Gernawati dari Padanglawas Utara. Tahfiz 30 juz putra, NPP 586 Hendra Lubis dari Madina, NPP 568 Syaiful Bahri Lubis dari Tapsel, NPP 594 Muhammad Nazri dari Perguruan Tinggi. Tahfiz 30 juz putri, NPP 567 Eka Juliana dari Langkat, NPP 571 Nurul Husna dari Sergai, NPP 575 Muhajirah Binti Jamaluddin dari perguruan tinggi. Data tersebut masih 16 cabang/sub cabang yang diperlombakan pada final ini. Masih ada 11 cabang lagi yang belum diperoleh datanya. Informasi yang diperoleh, posisi kafilah Medan dan Madina masih terus bersaing ketat untuk meraih juara umum MTQ XXXII Sumut. (cpin/crif)


Nusantara

WASPADA Rabu 28 April 2010

A3 30 Anggota Tim Pengawas Century Disahkan JAKARTA (Waspada): Rapat paripurna DPR RI mensahkan 30 anggota Tim Pengawas Century yang akan bekerja memantau pelaksanaan tindak lanjut rekomendasi paripurna soal Century. “30 Nama anggota tim pengawas, dengan 5 pimpinan yang akan memimpin secara bergantian,” kata Wakil Ketua DPR Priyo Budi Santoso, saat membacakan keputusan dalam sidang paripurna DPR di Senayan, Jakarta, Selasa (27/4). Ke-30 anggota Tim Pengawas Pelaksanaan Rekomendasi Angket DPR tentang Pengusutan Kasus Bank Century yakni;

Fraksi Partai Demokrat 1. Ignatius Mulyono 2. Soetan Bathoegana 3. Vera Febianthy 4. Jafar Hafsah 5. Achsanul Qosasih 6. Didi Irawadi S. 7. Gede Pasek Suwardhika 8. Anas Urbaningrum Fraksi Partai Golkar 1. Ade Komarudin 2. Agun Gunanjar Sudarsa 3. Azis Syamsuddin 4. Idrus Marham 5. Melchias Marcus Mekeng 6. Bambang Soesatyo Fraksi PDIP 1. Sidarto Danusubroto 2. Hendrawan Supratikno 3. Gayus Lumbuun

4. Ganjar Pranowo 5. Trimedia Panjaitan Fraksi PKS 1. Andi Rahmat 2. Mahfudz Siddiq 3. Fahri Hamzah Fraksi PAN 1. Asman Abnur 2. Tjatur Sapto Edi Fraksi PPP 1. Aditya Mufti Ariffin 2. Epyardi Asda Fraksi PKB 1. Imam Nahrawi 2. Nur Yasan Fraksi Partai Gerindra 1. Soepriyatno Fraksi Partai Hanura 1. Akbar Faizal. (aya)

Kongres PD

Ibas Mulai Diperhitungkan

Antara

KELULUSAN UN: Seorang siswi menangis setelah mengetahui mengulang ujian nasional (UN) di SMKN 1 Pangkalan Bun, Kab. Kotawaringin Barat, Kalimantan Tengah, Selasa (27/4). Angka kelulusan ujian UN SMA di Kalteng mencapai 69 % dan SMK 72 % turun drastis dari angka kelulusan tahun lalu sebesar 96%.

Penahanan Misbakhun Sah JAKARTA (Waspada): Kepala Divisi Humas Polri, Irjen Pol. Edward Aritonang menegaskan, penahanan Muhamad Misbakhun, tersangka kasus letter of credit (L/C) fiktif sah, meski anggota DPR dari Fraks PKS itu menolak menandatangani surat penahanan. “Tidak tanda tangan tidak apa-apa, penahanan jalan terus,” kata Aritonang kepada wartawan di Mabes Polri, Selasa (27/1). Menurutnya, penyidik juga sudah membuat berita acara penolakan penandatanganan, karena yang bersangkutan menolak mendatangani surat penahanan. “Berita acara penolakan ini akan dilampirkan dalam berkas penyidikan yang nantinya akan diserahkan ke kejaksaan,” tutur Aritonang.

Waspada/Dok.

Muhamad Misbakhun

Sedangkan Wakil Kepala Divisi Humas Polri Kombes Pol. Zainuri Lubis mengatakan, penyidik Polri menahan Misbakhun dengan tujuan memudahkan pemeriksaan. “Penahanan itu hak dan wewenang penyidik agar peme-

riksaan berikutnya lebih mudah,” kata Lubis. Ancaman hukuman 8 tahun terang Lubis, merupakan alasan kuat penyidik melakukan penahanan sesuai dengan KUHAP. “Tersangka diancam hukuman penjara lima tahun atau lebih dapat ditahan,” ujarnya. Adanya rencana beberapa kolega Misbhakun di Komisi III DPR yang akan mengajukan penangguhan penahan, Zainuri Lubis mempersilahkannya. “Silahkan saja, tidak ada larangan.” Ajukan Penangguhan Sebelumnya, tim kuasa hukum Misbakhun melayangkan surat permohonan penangguhan penahanan kepada Polri. Dalam surat itu, sebanyak 33 anggota DPR menjaminkan diri agar penahanan inisiator Hak Angket Bank Century itu ditangguhkan.

Pembentukan Pansus KPK Mendesak JAKARTA (Waspada): Anggota Komisi III DPR, Daday Hudaya menegaskan bahwa pembentukkan Panitia Khusus (Pansus) Komisi Pemberantasan Korupsi (KPK) sudah sangat mendesak, mengingat kiprah KPK saat ini tidak ada yang mengawasi. Dirinya membantah bahwa upaya pembentukan pansus sebagai upaya melemahkan institusi KPK. Sebaliknya, pembentukan pansus KPK untuk melindungi institusi KPK dari hal-hal yang dapat melemahkan dirinya sendiri. Pansus ini tambahnya, justru untuk menjaga agar KPK sebagai institusi tidak melenceng dari tujuan dibuatnya lembaga tersebut yaitu memberantas korupsi. “Tujuan kita bukan melemahkan KPK, justru memperkuat dan menjaga agar lembaga ini bersih dari aparatur yang bermain-main dengan hukum,” ujar Politisi Fraksi Partai Demokrat, Selasa, (27/4) di Jakarta. Daday menjelaskan beberapa alasan pembentukan Pansus KPK dilandasi banyaknya kasus-kasus yang ditangani menimbulkan kecurigaan

banyak pihak. Tahap awal, Komisi III segera memanggil KPK, 28 April mendatang terkait penanganan kasus-kasus korupsi. “Kami mencium aroma tidak sedap dalam tubuh KPK menangani kasus-kasus korupsi. Banyak kasus terbuka yang seharusnya diusut namun tidak mereka tangani. Sebaliknya, kasus-kasus kecil yang belum jelas unsur korupsinya mereka bongkar dan ekspos besar-besaran,” ujar Daday Menurutnya, masyarakat juga perlu tahu bagaimana kiprah KPK memberantas korupsi. Selama ini KPK telah diopinikan sebagai lembaga yang bebas dari gangguan suap dan korupsi. “Untuk itulah kita perlu pansus KPK, agar masyarakat tahu bagaimana pola penangangan perkara di KPK itu. Saya sendiri melihat KPK asal mencomot kasus dan tidak terlihat pola penangannya,” jelasnya. Dicontohkanya, ketika masyarakat mendesak KPK menangani satu kasus korupsi yang barang bukti, saksi dan fakta hukum lainnya sudah lengkap, namun KPK tidak juga menin-

daklanjutinya. Misalnya kasus pemilihan Deputy Bank Indonesia, Miranda Goeltom. Ketika Agus Tjondro mengaku menerima suap dan memberikan bukti-bukti lainnya, KPK tidak langsung menanganinya. “Ini aneh.” Sementara kasus lainnya seperti Bupati Boven Digoel ditindaklanjuti, bahkan dengan penangkapan tanpa surat pemberitahuan maupun surat penahanan sebelumnya. Dia juga menilai KPK telah memainkan standar ganda dalam menegakkan hukum. Hal itu bisa dilihat ketika dua pimpinan KPK telah ditetapkan sebagai tersangka oleh kepolisian dan berkasnya telah dinyatakan lengkap, mereka berupaya menghindari upaya pembuktian di muka hukum. “Mereka membuat opini seolah langkah pembuktian tuduhan Anggodo kepada mereka tidak boleh dibuktikan di pengadilan. Sementara disisi lain, ketika seseorang dijadikan tersangka oleh KPK maka langsung ditahan tanpa perlu proses pembuktian, dan tidak boleh ditangguhkan penahanannya.”(aya)

“Malam ini tim kuasa hukum akan sampaikan permohonan penangguhan penahanan,” ucap kuasa hukum Misbakhun, Luhut Simanjuntak di Mabes Polri, Selasa (27/4) malam. Luhut menjelaskan, keputusan penyampaian surat permohonan penangguhan penahanan, setelah tim kuasa hukum melakukan rapat dengan Komisi III DPR. Di sana, 33 anggota dewan lintas fraksi bersedia menjaminkan diri. Dikatakan Luhut, 33 orang yang ikut menandatangani berasal dari Fraksi PKS, Gerindra, PDIP, PAN, Hanura dan Golkar. Anggota dewan itu diantaranya, Fahri Hamzah, Gayus Lumbun dan Budiman Sujadmiko. Salah satu inisiator hak angket Bank Century itu resmi ditahan sejak Selasa (27/4) dinihari, setelah dua kali menjalani

pemeriksaan sebagai tersangka oleh penyidik Polri. Misbakhun dijebloskan dalam Rutan Mabes Polri. Misbhakun tersangka pemalsuan dokumen saat pengajuan L/C ke Bank Century sebesar 22,5 juta dollar AS. Dimana Misbahkun pemilik dan pemegang saham mayoritas PT Selalang Prima Internasional dan Dirutnya Frenky Ongko menjadi tersangka, karena diduga memalsukan dokumen. Sedangkan Frenky telah lebih dahulu ditahan. Kontrak bisnis PT Selalang dibuat setelah L/C disetujui, padahal seharusnya kontrak dibuat sebelum L/C disetujui. Kasus itu juga menyeret mantan Dirut Bank Century Robert Tantular sebagai tersangka. Dalam kasus pidana perbankan lain, Tantutar telah divonis lima tahun penjara.(j02)

Pemerintah Harus Batasi Izin Usaha Skala Besar MEDAN (Waspada): Upaya ‘pembunuhan’ terhadap para pengusaha kecil atau pedagang pasar tradisional tengah berlangsung hampir di seluruh Indonesia. Demikian pakar hukum Putra Kaban, kepada wartawan di Medan, Selasa (27/4). Menurut dia, walaupun UU monopoli telah ada sejak lama, namun prakteknya belum dijalankan. Akibatnya monopoli modern berlaku dan mematikan pengusaha kecil serta pasar-pasar tradisional. “Bila pemerintah tidak segera mewaspadai dan menghentikan pesoalan ini, maka akan terjadi penjajahan ekonomi secara tidak langsung. Dan ini hanya tinggal masalah waktu.” Ditanya pelaku yang berupaya melakukan ‘pembunuan’ terhadap pengusaha kecil dan pasar tradisional, dia mengatakan, para pengusaha skala besar yang kini gencar membuka usaha perbelanjaan modern hingga pelosok desa. Kaban mencontohakan mulai menjamurnya swalayan atau supermarket di pelosok desa maupun derah pinggiran, yang secara perlahan mematikan usaha kecil dan pasar tradisional. Padahal menurut UU dan peraturan, tidak boleh swalayan atau supermarket masuk daerah pelosok. “Usaha skala besar hanya boleh membuka usahanya di inti kota,” katanya. Selain kurangnya sosialisasi kepada rakyat terkait UU monopoli dan persaingan usaha, pemerintah selaku pemberi izin usaha, dinilai ikut terlibat secara tidak langsung dalam pembunuhan usaha kecil dan pasar tradisional. Disamping itu, Komisi Pengawasan Persaingan Usaha (KPPU) juga dianggap tidak menjalankan tugas dan fungsinya dengan baik dan jujur. “Ini akan menjadi bom waktu. Usaha besar tetap diperbesar, sedangkan usaha kecil dibinasakan,” jelasnya. Untuk itu, pemerintah diimbau segera menghentikan praktek ‘pembunhan’ usaha kecil dan pasar tradisional ini, dengan cara membatasi izin usaha skala besar masuk ke desa-desa, agar upaya membangkitkan ekonomi kerakyatan bisa ter-laksana.(m11)

Kejagung Incar Kasus Rp629 M Di Depsos

Antara

MINTA PENANGGUHAN: Massa pendukung Bupati Boven Digoel, Yusak Malluwo berunjuk rasa di depan gedung KPK Jakarta, Selasa (27/4). Mereka mendesak KPK menangguhakan penahanan Yusak yang dijemput paksa pada Jumat (16/4) lalu karena diduga terlibat kasus korupsi keuangan daerah dan dana otonomi khusus Boven Digoel.

JAKARTA (Wasapada): Setelah angkat tangan pada kasus dugaan korupsi pengadaan sarung dan mesin jahit senilai Rp37,1 miliar di Departemen Sosial (kini Kementerian Sosial), Kejaksaan Agung mengincar kasus lain di kementerian yang sama. Nilai kerugian negaranya jauh lebih besar, ditaksir Rp629,7 miliar. Seperti diketahui, Kejagung menyetop kasus sarung itu karena penyidikan KPK ternyata jauh lebih maju dengan menetapkan mantan Menteri Sosial Bahctiar Chamsyah sebagai tersangka. Menurut Direktur Penyidikan pada Jaksa Agung Muda Tindak Pidana Khusus, Arminsyah, kasus Rp629,7 miliar yang sedang dibidik itu juga terjadi di Kementerian Sosial, yakni terkait pengumpulan dan pengelolaan dana Usaha Kesejahteraan Sosial (UKS) untuk bantuan masyarakat miskin yang mendapat bencana dan bantuan usaha ekonomi produktif. “Saat ini Kejagung melakukan penyidikan pada kasus dana UKS,” kata Arminsyah di Jakarta, Selasa (27/4). Dia menyebutkan, sejak 2002 sampai 2008 terkumpul dana Rp629,7 miliar. “Ternyata dalam pelaksanaannya dana tersebut dipergunakan tidak sesuai peruntukannya.” Dana dari pengumpulan dan pengelolaan dana UKS tersebut, kata dia, digunakan untuk insentif bulanan pegawai Depsos 2002 sampai 2005, biaya kunjungan kerja Menteri Sosial dan pinjaman/ sumbangan kepada pihak ketiga. “Serta biaya untuk bantuan uang saku perjalanan dinas pegawai Depsos ke luar negeri dan pengadaan sandang/kain sarung,” katanya. Arminsyah menyebutkan, sampai sekarang kasus penyalah-gunaan dana UKS itu belum ada tersangkanya. “Tapi kami terus melakukan pemeriksaan terhadap saksi-saksi terkait.”(kps)

JAKARTA (Waspada): Figur Edhi Baskoro Yudhoyono (foto) dikenal dengan sapaan Ibas, mulai diperhitungkan menjadi Sekjen Partai Demokrat (PD) mendampingi Andi Mallarangeng (AM) bila terpilih sebagai ketua umum PD pada kongres di Bandung, Mei mendatang Tim Pemenangan AM bidang Kominfo, Panangian Simanungkalit dalam diskusi, Senin (26/4) mengatakan, pada putaran akhir di Medan Sabtu pekan kemarin, banyak suara mengingingkan Ibas sebagai pendamping AM sebagai Sekjen periode 2010-2015. Roadshow putaran terakhir di Medan sangat luar biasa. Andi Mallarangeng terharu dengan sambutan meriah pendukungnya. Andi beserta rombongannya disambut dua lagu yang singkatannya AM yaitu Angin

Mamiri dan Anak Medan plesetan dari Anak Makassar) Bahkan Andi, Ibas dan Nachrowi Ramli, Ketua Tim Pemenangan AM diberikan ulos oleh para pendukungnya sebagai

simbol kasih sayang dan doa restu agar mereka sukses memenangi pemilihan ketua umum pada kongres di Bandung. Selain dihadiri 83 dari 88 pengurus DPD dan DPC se Sumatera, mencakup 6 wilayah provinsi yakni, Aceh, Sumut, Kepulauan Riau, Bengkulu, Riau dan Bangka Belitung, juga dihadiri DPD dan DPC dari luar wilayah Sumatera yang belum sempat hadir dalam roadshow AM sebelumnya seperti dari Sumbar, Manado, Palembang dan Bali. Meriahnya acara itu mengindikasikan peta kekuatan dukungan DPD seluruh Indonesia terhadap AM semakin meluas, hingga telah mencapai target 80%. Panangian meyakini dukungan terhadap AM semakin menguat lagi menjelang kongres di Bandung.(j03)

Penggunaan DIPA Reboisasi Hutan Di Sumut Tidak Maksimal JAKARTA (Waspada): Pelaksanaan dana reboisasi hutan Daftar Isian Pelaksanaan Anggaran (Dipa) sekitar Rp70 miliar untuk anggaran 2007-2009 sesuai rancangan teknis di Provinsi Sumatera Utara (Sumut) tidak maksimal, bahkan diduga penggunaannya tidak sampai 50 persen. Menurut anggota Direktur Green Ecosystem Organitation For Clean and Enviropment (Geaforce), Lidya AG Sangkay, di Jakarta, Selasa (27/4), anggaran untuk biaya gerakan nasional rehabilitasi hutan dan lahan (GNRHL) dari Kementerian Kehutanan ini diduga hanya direalisasikan 40 persen. Proyek multiyear di Sumut

itu menurut Lidya, diduga dipermainkan para pelaksana, mulai dari satuan kerja, yaitu pelaksana balai daerah aliran sungai Dinas Kehutanan, hingga pelaksana lainnya. “Yang jelas dana reboisasi dipergunakan untuk mereboisai sesuai rancangan teknis untuk sekitar 14 ribu hektar hutan di setiap kabupaten. Namun kondisi fisik dan lapangan, masing-masing areal untuk satu wilayah kabupaten di luar beberapa kotamadya seperti Siantar, Padang Sidimpuan dan lainnya, kemungkinan tidak sesuai.” Saat mengajukan data hutan yang akan direboisai ke Kementerian Kehutanan, memang benar sekitar 14 ribu hektar.

Namun dalam pengajuan telah dilakukan manipulasi data. Sebab dalam pengajuannya, diduga pihak kabupaten telah memberikan data wilayah yang sebelumnya sudah pernah dikerjakan. “Seperti itulah kira-kira penyeleweangan yang dilakukan satuan kerja reboisasi hutan, sehingga realisasi reboisasi itu tidak lebih dari 40 persen,” katanya. Akibat tidak maksimalnya pelaksanaan dana reboisasi hutan di Sumut, sangat berpengaruh terhadap peningkatan pemanasan global. “Yang menjadi masalah adalah dampaknya pada semua sektor.”(aya)

Artis Ikut Meriahkan Lomba Foto Di Ambon Pangdam I/BB Juri MEDAN (Waspada): Pangdam I/Bukit Barisan, Mayjen TNI M Noer Muis menjadi juri lomba foto bertema Banda Underwater Photo Rally Competition, digelar di Banda Neira, Ambon, Maluku, 23-29 April 2010. Humas Lomba Foto Meliana Salim mengatakan, selain Pangdam, juri lainnya, Christoffel Simanjuntak dari penyelam/underwater photografer Bali dan Eddy Purnomo dari Photo Journalist Jakarta. Ketiganya akan menilai hasil foto peserta berjumlah 20 orang. “Nanti foto terbaik dimuat dalam buku “Menyusuri Kepuluan Banda” yang sedang disusun Pak M Noer Muis. Buku itu akan diterbitkan Juli 2010,”

jelas Meliana, kemarin. Salah satu tujuan digelarnya lomba foto, untuk memperkenalkan keindahan alam bawah laut kawasan Banda Naira ke dunia internasional. Untuk itu sejumlah penyelam dari berbagai ngara di dunia diundang. “Tidak tertutup kemungkinan kegiatan serupa digelar di perairan Sumatera Utara. Karena sebelumnya, kegiatan serupa pernah digelar di Bali, Lombok dan Komodo. Memang tinggal perairan Sumatera saja yang belum tergarap, apalagi di Sumut ada Danau Toba dan pulau-pulau lainnya,” ucap Meliana. Selain dari berbagai daerah di Indonesia, ada juga peserta Amerika Serikat dan Singapura.

Sejumlah artis juga ikut meramaikan lomba itu, se-perti Enno Lerian dan Tommy Cokro. Sementara, M Noer Muis mengatakan, sehari sebelumnya, ke-20 fotografer diajak menjelajahi goa bawah laut Hukurila disekitar perairan kota Ambon. Dalam penjelajahan itu, ikut serta Gubernur Maluku Karel Albert Ralahalu dan sejumlah pejabat Kota Ambon. “Kompetisi foto bawah laut ini memang dipusatkan di Pulau Banda Naira, tapi mereka juga kita ajak menjelajahi goa bawah laut dan penyelaman di Laha Hukurila serta Morella, Ambon,” ujar pemrakarsa Banda Underwater Photo Rally Competition itu.(rel/ cmai)


Luar Negeri

A4

WASPADA

Rabu 28 April 2010

Chavez Kecam Laporan Pentagon

Medvedev: Rusia Tertarik Usul Pertahanan Anti-Rudal NATO MOSKOW, Rusia (Antara/RIA Novosti-OANA): Presiden Rusia Dmitry Medvedev mengatakan, Moskow tertarik dalam kerjasama dengan NATO mengenai masalah pertahanan anti-rudal di Eropa. Para menteri luar negeri NATO sepakat pada pertemuan tak resmi mereka di Estonia, pekan lalu, akan mulai berdialog dengan Rusia mengenai kerjasama di bidang pertahanan anti-rudal. Medvedev mengatakan dalam wawancara dengan lembaga penyiaran Denmark, Danish Broadcasting Corporation (DR) Senin (26/4), Moskow telah lama‘membicarakan sistem pertahanan rudal global hendaknya melindungi tidak hanya negara-negara tertentu atau kelompok negara, tetapi juga kepentingan semua negara peserta dan bertanggungjawab kepada masyarakat internasional.’ Sekjen NATO, Anders Fogh Rasmussen, menegaskan pekan lalu di Estonia mengenai pentingnya kerjasama mengenai pertahanan rudal ini, untuk melindungi penduduk Eropa dan Rusia terhadap ‘ancaman rudal secara nyata.’ Ditanya apakah Rusia akan mengatakan ‘ya’ untuk usul dari ketua NATO itu, Medvedev mengatakan ‘ya, Rusia akan melakukannya bila usulan itu benar-benar serius.’ Dia mengatakan, Rusia bersikap menentang pembentukan sistem pertahanan udara dengan negara-negara lain, karena hal itu bisa ‘merusak sistem keseimbangan yang ada saat ini di antara negara-negara nuklir besar.’ Pada Februari lalu, Romania dan Bulgaria mengatakan, mereka dalam perundingan dengan Presiden Amerika Serikat Barack Obama mengenai penyebaran unsur-unsur perisai rudal AS di wilayah mereka dari 2015. Gerakan itu muncul setelah Obama membatalkan rencana pemerintah Bush September lalu, untuk penyebaran unsur pertahanan rudal di Republik Czech dan Polandia, dalam rangka membendung ancaman dari Iran. Rusia mengecam kuat rencana-rencana itu dan menudingnya sebagai ancaman bagi keamanan nasionalnya. Pada umumnya, Medvedev mengatakan bahwa Rusia ingin mengisi tempat-tempat yang layak ditolong di dunia. Dalam perkembangan lain, Rusia mengusulkan pembentukan suatu konglomerasi nuklir dengan Ukraina, kata Perdana Menteri Rusia, Vladimir Putin, Selasa (27/4) pagi. Sebagaimana dikutip oleh kantor-kantor berita Rusia, Putin —yang berbicara setelah pertemuan di Kiev dengan Presiden Ukraina, Viktor Yanukovich— mengatakan, “Itu bisa berarti kerja sama penuh atau menyeluruh antara industri nuklir kami.” Orang kuat Rusia itu melanjutkan, “Usul kami untuk membentuk konglomerasi besar itu meliputi produksi bersama energi nuklir, konstruksi nuklir, di samping putaran bahan bakar nuklir.”

Menlu Inggris Kutuk Serangan Di Yaman LONDON, Inggris (Antara/AFP): Menteri Luar Negeri David Miliband mengutuk serangan atas utusan Inggris di Yaman, dengan mengatakan itu hanya memperkuat upaya London menanggulangi terorisme internasional. “Saya mengutuk serangan pada pagi ini di Sana’a terhadap Dutabesar Inggris di Yaman,” kata Miliband, setelah tersangka pengebom jibaku al Qaida meledakkan diri di iringan Timotius Torlot di jalan Sana’a. “Syukurlah Tim dan seluruh petugasnya tak luka. Saya bersyukur atas profesionalisme mereka dan peran petugas keamanan Yaman, yang bertindak cepat dan tenang dalam mengatasi keadaan itu,” katanya. “Kejadian itu hanya memperkuat tekad kami bekerja sama erat dengan pemerintahYaman untuk menangani terorisme internasional,” katanya. Torlot menjadi dutabesar Inggris untuk Yaman sejak Juli 2007 dan sebelumnya bertugas di kedutaan Inggris di Bagdad. Inggris, yang memainkan peran utama dalam memelopori bantuan Barat bagi perangYaman melawan gerilyawan garis keras, berikrar meningkatkan bantuannya setelah pemboman tersebut. Kementerian Luar NegeriYaman Senin menyatakan jaringan al Qaida berada di belakang serangan itu.

Presiden Terguling Kyrgyzstan Dituduh Rancang Pembunuhan BISHKEK, Kyrgyzstan (AP): Presiden terguling Kyrgyzstan dituduh merancang pembunuhan massal dalam kerusuhan mematikan yang menyebabkan dirinya tersingkir dari tampuk kepemimpinan di negara Asia Tengah itu awal bulan ini, kata pemimpin sementara negara itu Selasa (27/4). StatuskekebalandiplomatiksebagaiPresidenKurmanbekBakiyev, yang berada di pengasingan di Belarus, akan dicabut sehingga dia bisadikenakandakwaan,yangdidalamnyatermasukpenyalahgunaan kekuasaan, kata Azimbek Beknazarov, wakil PM dari pasukan oposisi yang mengambil alih kepemimpinan sementara negara itu. Bakiyev meninggalkan ibukota negaranya 7 April setelah pasukan keamanan melepaskan tembakan terhadap para pengunjukrasa dan demonstran yang menyerbu gedung-gedung pemerintah. Sedikitnya 85 orang tewas dalam kerusuhan itu. Bakiyev mencoba untuk menggalang dukungan di kawasan kampung halamannya di bagian selatan Kyrgyzstan, namun akhirnya melarikan diri dari negara itu dan muncul di Belarus minggu lalu. Beknazarov mengatakan Belarus wajib mengekstradisi Bakiyev berdasarkan perjanjian antara kedua negara bekas Soviet itu. Belum ada reaksi dari Belarus, yang presidennya, Alexander Lukashenko, mengecam aksi demonstrasi yang menyingkirkan Bakiyev. Bakiyev bersikeras mengatakan dirinya masih presiden sah Kyrgyzstan, namun bersumpah tidak akan kembali ke negara itu sebagai pemimpinnya. Stabilitas di Kyrgyzstan hal yang sangat dikhawatirkan AS dan Rusia, dua negara yang memiliki pangkalan di negara itu. Pangkalan udara AS merupakan jalur kunci bagi militer NATO dalam memerangi Taliban di Afghanistan, pangkalan itu menjadi tempat pengisian ulang bahan bakar bagi pesawat tempur dan titik transit pasukan.(m18)

KARAKAS,Venezuela (AP): Presiden Hugo Chavez mengecam satu laporan Pentagon yang mengatakan satu unit pasukan elit dari Garda Revolusioner Iran berada diVenezuela, dan mengingatkan AS hanya mencari celah untuk menyerang negaranya. Chavez Senin (26/4) menyebut laporan terdiri dari 12 halaman yang disampaikan ke Kongres AS minggu lalu adalah ‘hal yang memalukan’ dan mengatakan “inilah hal-hal yang mereka munculkan dan ulangi dalam laporan yang kemudian untuk membenarkan melakukan suatu hal lain.” Dalam laporan itu, Pentagon menyimpulkan Pasukan Oods Iran, satu unit pasukan elit di Korps Garda Revolusioner Islam, menetap dan semakin mengukuhkan kehadirannya di kawasan Amerika Latin, khususnya Venezuela. “Itu sama sekali tidak benar,” kata Chavez tentang laporan itu. LaporanPentagonitutidakmenjelaskanlebihrincikenapakehadiran PasukanOodsmakinkuatdisana. Sejakberkuasatahun1999,Chavez memperkuat hubungan dengan Iran. Kedua negara itu telah menandatangani sejumlah perjanjian kerjasama termasuk pembangunanpabrikperakitanmobildanproyekpertaniandiVenezuela. Dalam perjalanan ke Amerika Selatan awal bulan ini, Menteri Pertahanan AS Robert Gates mengabaikan ancaman militer yang mungkin muncul dari Iran terhadap kawasan negara Barat. “Saya belum melihat bukti bahwa di Amerika Latin, Iran memiliki perwakilan atau perwakilan teroris,” kata Gates. Tentang sikap permusuhan Venezuela, Gates mengatakan “Saya sama sekali tidak melihatVenezuela saat ini menjadi tantangan atau ancaman militer.” Laporan Pentagon tersebut ditujukan sebagai gambaran kekuatan militer Iran dan ancamannya bagi AS dan pasukan Amerika yang dikerahkan ke sejumlah negara.(m18)

Mau Sehat, Banyak Kegiatan Fisik Dan Hubungan Seks

The Associated Press

BAKU HANTAM DALAM SIDANG PARLEMEN UKRAINA

Para anggota parlemen oposisi dan pro-kepresidenan Ukraina baku hantam satu sama lain selama sidang ratifikasi perjanjian Armada Laut Hitam dengan Rusia, di ruang sidang parlemen di Kiev, Ukraina, Selasa (27/4). Parlemen Ukraina telah melakukan pemungutan suara untuk memperpanjang sewa pelabuhan AL Krim untuk Armada Laut Hitam dalam sidang yang riuh pada saat mana telur dan bom asap dilemparkan ke arah para anggota parlemen. Presiden kedua negara setuju pekan lalu untuk memperpanjang kehadiran AL Rusia di pelabuhan Sevastopol selama 25 tahun ke depan setelah perjanjian lama berakhir masa berlakunya pada tahun 2017.

BRASILIA, Brazil (Antara/AFP): Salah satu cara terbaik yang dapat dilakukan oleh rakyat Brazil untuk mencegah penyakit kronis ialah dengan melakukan kegiatan fisik secara rutin, terutama seks, kata Menteri Kesehatan Brazil Jose Gomes Temporao. “Orang perlu aktif. Olah raga sepak bola pada akhir pekan bukan satu-satunya kegiatan fisik bagi rakyat Brazil. Orang dewasa perlu berolah raga: jalan kaki, berdansa dan mengadakan hubungan seks,” katanya Senin (26/4). Menteri itu memberi saran tersebut saat dia melancarkan kegiatan untuk mencegah tekanan darah tinggi, yang menyerang seperempat dari 190 juta warga Brazil. Setelah menyampaikan pendapatnya, Temporao menegaskan kembali pesan hubungan seks kepada wartawan, demikian laporan jejaring berita G1. “Ini bukan kelakar. Ini sungguh-sungguh. Melakukan kegiatan fisik secara rutin juga berarti seks, tentu saja selalu dengan perlindungan,” katanya. “Berdansa, melakukan hubungan seks, mempertahankan berat badan, mengganti kebiasaan makan, melakukan olah raga fisik”, semuanya membantu menjaga tekanan darah tinggi, katanya. Dia percaya ada “bom waktu kesehatan” yang berdetak di Brazil, yang dalam waktu 20 tahun dapat menyaksikan “persentase sangat besar” penduduk yang menderita penyakit kronis, tekanan darah tinggi, diabetes dan kolesterol tinggi.

Pemrotes Baju Merah Thai Makin Ganas BANGKOK, Thailand (AP):Para pemrotes antipemerintah makin ganas setelah gagal menyeret pemerintah melakukan perundingan bersyarat, Selasa (27/4) memaksa dihentikannya pelayanan angkutan komuter Bangkok.

Mereka berjanji untuk memperluas protesnya yang telah menjerumuskan ibukota Thailand itu ke kancah kekacauan dengan mengirimkan beberapa tim demonstran di kota itu. PM Abhisit Vejjajiva, yang memutuskan perundingan dengan pemrotes yang menduduki beberapa bagian Bangkok Pusat, mengatakan dia berharap krisis itu segera berakhir tanpa penggunaan kekuatan, namun dia juga mengerahkan ratusan tentara bersenjata senapan otomatis untuk berjaga-jaga di sejumlah stasiun dan jalan-jalan raya besar lainnya. “Kamimengakuibahwaharihari berlalu, warga Thailand menderita, negara menderita, namun kami ingin untuk meyakinkan bahwa masih ada aturan hukum,” kata Abhisit kepada CNN. “Kami berusaha untuk menggunakan hukum dengan kerugian kecil dan kami akan mencoba untuk menemukan penyelesaian politik, namun itu

akan memakan waktu, menuntut kesabaran dan kerjasama.” Sekurang-kurangnya 26 orang tewas dan hampir 1.000 lainnya cedera sejak protes yang dikenal dengan Baju Merah itu mulai menduduki beberapa bagian Bangkok pada pertengahan Maret, menutup sejumlah hotel bintang lima dan beberapa pusat perbelanjaan serta merugikan industri wisata vital Thailand. “Kami akan melakukan yang terbaik kami bisa dan mencoba memajukan negara ini sesegera mungkin,” tambah Abhisit, yang telah berkantor di asrama tentara sejak Baju Merah penentang pemerintah memulai unjukrasa besar pada tengah Maret. Baju Merah —yang mengupayakan pemilihan umum segera— memperkuat penutupan jalan mereka dan membentengi tempat luas unjukrasa mereka dengan perintang terbuat dari ban truk dan pancang bambu. Abhisit menolak tawaran Baju Merah, yang sebagian besar mendukung mantan PM Thaksin Shinawatra, untuk mundur jika pemilihan umum diadakan dalam waktu tiga bulan. Dia berikrar menguasai kembali tempat unjukrasa, tanpa memberi tanda tentang kapan tindakan keras mungkin dilakukan. Ketika mencoba menyapu Baju Merah keluar dari daerah bersejarah Bangkok pa-

da tanggal 10 April, tentara mundur secara memalukan. Abhisit menyatakan diplomat asing, yang bertemu dengan Baju Merah pada ahir pekan lalu, mengimbau mereka mencari jalan keluar guna menghindari penumpasan. Pada saat kekhawatiran akan penumpasan terhadap kubu Baju Merah di pusat Bangkok berkembang, dan unjukrasa pada beberapa pekan belakangan, panglima tentara pada hari sebelumnyamenyatakanpenggunaan kekerasan bukan cara baik bagi kemelut itu. “Cara terbaik adalah menciptakan pengertian di kalangan warga. Tugas tentara sekarang adalah melindungi masyarakat dan tak mengizinkan rakyat Thailand saling serang,” kata Jend. Anupong Paojinda dalam pertemuan dengan petinggi tentara. Thaksin tetap berhubungan Mantan PM Thaksin, yang lari dari tuduhan korupsi, Senin di Podgornica menyatakan berhubungan dengan pengunjukrasa Baju Merah di Thailand. “Ya, kami berbicara. Kami hanya berjuang demi demokrasi. Biarkan mereka berjuang demi demokrasi dan keadilan. Itu saja,” kata Thaksin kepada wartawan secara singkat. Mantan perdana menteri itu, yang memegang paspor republik Adriatik tersebut, tiba di Montenegro pada ahir pekan

Lebanon Dan Spanyol Bahas Ancaman Israel BEIRUT, Lebanon (Antara/ Xinhua-OANA): PM Lebanon Saad al-Hariri membahas dalam pembicaraan telefon ancaman Israel terhadap negerinya dan Syria, dengan timpalannya dari Spanyol Jose Luis Rodriguez Zapatero. “Pembicaraan telepon tersebut dilakukan dalam kerangka kerja kontak yang dilakukan Saad dengan para pemimpin Eropa, guna menghadapi peningkatan ancaman Israel terhadap Lebanon dan Syria,” kata kantor Perdana Menteri itu dalam satu pernyataan di Beirut Senin (26/4). “Saad menekankan perlu-

nya langkah nyata Eropa guna menekan Israel, untuk mendorongnya agar menerima baik tuntutan sah dan adil rakyat Palestina, dan mematuhi upaya masyarakat internasional untuk memajukan proses perdamaian Timur Tengah,” katanya. PM Lebanon tersebut juga menyatakan Lebanon sepenuhnya terikat komitmen pada penerapan resolusi 1701 PBB, yang mengakhiri perang 2006 antara Israel dengan milisi Syiah Lebanon yang bersenjata, Hizbullah. Zapatero mengatakan kepada Saad bahwa negaranya, yang saat ini memangku jabatan presiden Uni Eropa, akan be-

kerja sama dengan semua pihak di dalam masyarakat internasional guna menghidupkan kembali jalur perundingan Palestina-Israel, dan menjadikannya prioritas pada tahap ini. Zapatero juga menekankan Spanyol terus memantau situasi di wilayah tersebut guna menjamin suasana stabil dan dialog, kata pernyataan itu. Percakapan Saad dan Zapatero dilakukan setelah beberapa media Arab dan Israel melaporkan Syria “telah menyerahkan beberapa rudal Scud” kepada Hizbullah di Lebanon, tuduhan yang telah dibantah oleh Syria dan Hizbullah.

lalu untuk melakukan pembicaraan tentang penanaman modal di negara itu. Thaksin juga membantah bahwa kesepakatan telah tercapai. (m07)

The Associated Press

Seorang demonstran pro-pemerintah memegang satu foto yang menunjukkan Raja Thai Bhumibol Adulyade dengan Ratu Sirikit ketika berlangsung satu rapat umum di Chinatown di Bangkok, Thailand, Selasa (27/4). Raja yang berada dalam kondisi sakit-sakitan, terlihat sebagai harapan paling baik untuk mengakhiri krisis, berbicara Senin malam untuk pertama kalinya sejak negara itu terjebak ke dalam krisis politik.

Polisi Afghanistan Bunuh Staf PBB Karena Salah Paham PBB, New York (Antara/ Reuters): Para penyelidik Perserikatan Bangsa Bangsa (PBB) meyakini bahwa polisi Afghanistan salah menembak dan membunuh empat pekerja PBB, pada saat terjadi seranganTaliban pada Oktober 2009, kata para penjabat. Susana Malcorra, seorang petinggi pemelihara perdamaian PBB, mengungkapkan hal itu Senin (26/4) dalam memberikan penjelasan mengenai penyelidikan badan PBB mengenai sera-ngan Taliban 28 Oktober itu, di satu wisma tamu di Kabul yang mengakibatkan lima pekerja badan dunia itu tewas. Dia menyebutkan, dalam situasi rumit pada saat para penyerang Taliban dan pasukan

keamanan Afghanistan yang membalas berpakaian sama dengan seragam polisi. Pada saat itu‘situasinya sangat, sangat kacau di tengah malam,” katanya menambahkan. Para penyelidik percaya ketiga pekerja PBB itu ditembak dan dibunuh oleh kepolisian Afghanistan, ketika sedang berusaha melarikan diri dari wisma tamu tersebut, kara Malcorra. “Tampaknya itu adalah tembakan antarkawan, satu kesalahan,” katanya. Malcorra mengatakan, bahwa perwira keamanan PBB, Louis Maxwell, seorang Amerika, mungkin juga tewas di tangan polisi Afghanistan, yang salah paham menyangkanya sebagai

Gema Internasional

Zimbabwe, Power Sharing Yang Rapuh

The Associated Press

Para petani Prancis mengemudikan traktor mereka melalui jalanan di Paris Selasa (27/4). Ribuan traktor melakukan invasi ke Paris dalam satu protes petani dari pedalaman Prancis, yang frustrasi sehubungan dengan merosotnya pendapatan mereka dan menuntut pengurangan pajak dan pemerintah membantu untuk mendapatkan kredit ekspor.

TIGAPULUH tahun menjadi sebuah negara yang merdeka dan 30 tahun setelah Robert Mugabe dengan partainya, ZANU PF, menjadi penguasa di pucuk pimpinan pemerintahan, Zimbabwe tak mampu memenuhi harapan bangsanya yang begitu mendambakan kesejahteraan setelah memperoleh kemerdekaan. Negeri yang telah menguburkan rasisme kulit putih yang minoritas, mengharapkan pemerintahan oleh bangsa sendiri yang menjadikan seluruh bangsa Zimbabwe berada dalam kesetaraan. Sayang, negeri yang pernah berlimpah hasil pertaniannya, hidup merana dan sekarang mengharapkan belas kasihan untuk memperoleh makanan.

Konflik berkepanjangan pada mulanya diharapkan akan berakhir setelah pemilihan umum tahun 2008 yang menghasilkan suatu pemerintahan persatuan dimana partai ZANU PF, dalam teori, berbagi kekuasaan dengan kelompok oposisi, MovementforDemocraticChange (MDC). Tetapi nyatanya,‘perkawinan’ dua partai yang saling berseberangan ini dan diharapkan akan membawa ketenangan lebih baik bagi bangsa Zimbabwe, tak memberi rasa kepuasan yang diharapkan dengan persatuan ini. Partainya Mugabe, ZANU PF, merasa tak seharusnya berbagi kekuasaan dengan partai MDC yang mereka anggap seba-

gai bonekanya negara Barat, sementara MDC tak mampu melaksanakan otoritasnya sebagai partner yang setara dengan ZANU PF dalam pemerintahan. Morgan Tsvangirai, ketua MDC yang telah disumpah sebagai perdana menteri, dan MDC memperoleh pembagian atas beberapa kementerian termasuk kementerian keuangan, tapi Mugabe menolak menyetujui dan melantik deputi menteri pertanian, Roy Bennett, atau member-hentikan Gideon Gono pemimpin Reserve Bank yang oleh Tsvangirai dianggap orang yang paling bertanggungjawab terhadap kemelut perekonomian dan keuangan Zimbabwe. Kekisruhan power sharing

ini terlihat pula bahwa tuntutan MDC tidak diperhatikan oleh Mugabe atau partai ZANU PF. Partainya Mugabe tetap mengontrol kepolisian, angkatan bersenjata dan kementerian kehakiman yang tidak berhasil mengajukan tuntutan terhadap partai ZANU-PF bagi tindakantindakan kekerasan terhadap partai MDC. Anggota-anggota partai MDC termasuk para anggota parlemen telah menjadi sasaran tindakan kriminal yang dianggap telah melakukan pengkhianatan. Saling mengumbar kesalahan sering muncul dari keduabelah pihak. Partai MDC menyatakan hasil pemerintahan Mugabe yang buruk dan besifat

kleptocracy selama 30 tahun menyengsarakan rakyat Zimbabwe. Sebaliknya ZANU PF menyatakan bahwa komunitas internasional harus ikut bertanggungjawab pula yang diklaim oleh Mugabe mengisolasi Zimbabwe secara ekonomi, terutama setelah Mugabe mencanangkan kebijakan land reform. Kelihatannya, kedua partai ini, ZANU PF dan MDC, saling menyangkal tentang kebenaran kondisi Zimbabwe selama tigapuluh tahun ini, dan hal ini tidak akan menjadi cara lebih baik dalam menghadapi dan memulai dekade keempat sebagai suatu bangsa/negara. (Kosky).

gerilyawan. Seorang penjabat senior PBB mengatakan kepada Reuters, dengan syarat tidak disebut namanya, bahwa ada sedikit keraguan Maxwell itu dibunuh oleh polisi Afghanistan, meskipun hal itu belum jelas siapa petugas yang membunuhnya. Kelima korban staf PBB dalam bentrokan itu mulai panik, setelah para penyerang Taliban melemparkan granat ke wisma tamu tempatnya menginap, kata Malcorra. PBB telah meminta pihak yang berwenang Afghanistan untuk melakukan penyelidikan, kata Malcorra. Penyelidikan yang dilakukan PBB dipimpin oleh Andrew Hughes, seorang Australia mantan kepala kepolisian PBB. Misi PBB di Afghanistan menolak memberikan komentar, namun mengatakan, Duta besar Zahir Tanin telah mengirimkan laporan ke Kabul. Sekjen PBB Ban Ki-moon, mengatakan dalam pernyataan, bahwa laporan penyelidikan, yang tidak akan diumumkan itu, menyoroti singkat tindakan keamanan PBB dan koordinasi antara PBB, pihak yang berwenang Afghanistan dan para mitra NATO. Para penjabat PBB mengatakan secara pribadi, bahwa insiden itu mencerminkan kurangnya latihan dan disiplin pasukan keamanan Afghanistan. Pemerintah Afghanistan semula mengatakan, Taliban yang membunuh kelima staf PBB itu. Namun setelah serangan, Ban mengecam polisi terlalu lama tiba di tempat kejadian, di mana Maxwell sedang berjuang untuk menghadapi para penyerang.


Medan Metropolitan

WASPADA Rabu 28 April 2010

B1

Dugaan Korupsi

Kejati Periksa Sejumlah Pejabat PT Askes MEDAN (Waspada): Kejaksaan Tinggi Sumatera Utara (Kejatisu) mendalami kasus dugaan korupsi dana hibah PT Askes sebesar Rp4 miliar tahun anggaran 2009 untuk pembangunan ruang rawat inap di RSU Pirngadi Medan. “Kita telah memanggil sejumlah pejabat PT Askes Sumut untuk diperiksa guna dimintai keterangannya,” kata Kepala Seksi penerangan Hukum (Kasipenkum) Kejatisu, Edi Irsan Kurniawan Tarigan, SH, Selasa (27/4). Menjawab wartawan, juru bicara Kajatisu itu mengatakan, pastinya jumlah pejabat PT Askes yang sudah diperiksa ada tiga atau empat orang. “Seming-

gu yang lalu mereka datang memenuhi panggilan untuk dimintai keterangan,” kata Tarigan, namun dia enggan menyebutkan nama dan jabatan dari pejabat PT Askes yang dipanggil. Kembali menjawab wartawan apakah GM PT Askes Wilayah Sumut telah dipanggil untuk diperiksa, kata Tarigan, kalau soal itu belum dapat informasi jelas. Pastinya, pejabat PT Askes yang diduga terlibat

Waspada/Rudi Arman

PATROLI SEPEDA: Tiga anggota Satlantas Poltabes Medan dengan pakaian seragam mengenakan helm bersiap-siap untuk menggelar patroli bersepeda terhadap pelaksanaan hari berbas kendaraan bermotor (Car Free Day) yang dilaksanakan Minggu (2/5) di Jalan Gatot Subroto Medan. Foto diambil Selasa (27/4).

Satu Lagi Tersangka RUTRK Belum Diperiksa MEDAN (Waspada): Dari empat tersangka dugaan korupsi Rancangan Umum Tata Ruang Kota (RUTRK), tinggal satu orang yang belum diperiksa penyidik Satuan III Tindak Pidana Korupsi (Tipikor) Polda Sumut. “Yang belum menjalani pemeriksaan tersangka FHB, sedangkan tiga orang yang telah menjalani pemeriksaan dan ditetapkan menjadi tersangka yakni HJ, SA, SC,” kata Direktur Reskrim Polda Sumut, Kombes Pol Agus Andriyanto melalui Kasat III Tipikor AKBP Prastiono, Senin (26/4) malam. Tersangka SC, lanjut Prastiono, sudah menjalani pemeriksaan dan pemeriksaan lanjutan dilaksanakan, Kamis (29/4). Kedatangan SC memang telah dijadwalkan, sebab dalam pemeriksaan awal yang bersangkutan tidak bisa datang karena sakit. Sementara, sebut Prastiono, FHB belum bisa menghadiri panggilan penyidik kepolisian karena masih di Jakarta. Seperti diketahui, dugaan korupsi Master Plan Kota Medan 2006-2016 tersebut dibagi dalam tiga proyek masing-masing RUTRK, Vision Plan dan Peta Garis. Dalam proyek tersebut, negara mengalami kerugian Rp1.526.062.238. Prastiono pernah menjabarkan, dua proyek yakni RUTRK dan Peta Garis selesai dikerjakan. Namun satu lainnya, Peta Garis yang telah di sub kan ke Tjong Giok Pin tapi tak selesai dikerjakan. Masalahnya pekerjaan tidak selesai malah uang telah diambil. Para tersangka, sebut Prastiono, diancam pasal 2,3,5 dan 9 Undang-undang No.31 tahun 1999 junto Undang Undang No.2 tahun 2001 tentang dugaan korupsi. Menurutnya, saat ini mereka baru menetapkan empat tersangka dalam kasus tersebut. Begitupun, tidak tertutup kemungkinan tersangka bakal bertambah. (m39)

Dua Perampok Diringkus MEDAN (Waspada): Dua perampok bersepedamotor diringkus polisi di Jalan Nusantara, Bandarkhalifah, Kec. Percutseituan, Minggu (25/4) malam. Dari kedua tersangka AGP, 17, dan Sup alias Gepeng, 20, keduanya warga Jalan Pendidikan Pasar XI Desa Bandarkhalifah, disita seuntai kalung emas senilai Rp500.000 dan sepeda motor Yamaha Zupiter tanpa plat sebagai barang buktinya. Sedangkan korbannya Sri Sudarmawati, 32, warga Jalan Nusantara, telah membuat pengaduan ke Polsekta Percut Seituan. Peristiwa perampokan itu terjadi sekira pukul 18.00 Wib. Saat itu, korban mengendarai sepeda motor berboncengan dengan anaknya dari rumah familinya bermaksud hendak pulang ke rumah. Namun, sejak dari Gang Kapuk Tembung, korban diikuti oleh kedua tersangka. Setibanya di kawasan Jalan Nusantara, sepeda motor yang dikemudikan korban dipepet kedua perampok itu dan langsung merampas kalung emas yang melekat di leher korban. Setelah barang berharga itu berhasil dikuasai, pelaku langsung tancap gas melarikan diri. Korban langsung menjerit minta tolong dan didengar Tim Serse Polsekta Percut Sei Tuan yang sedang melintas. Dalam pemeriksaan sementara, kedua tersangka membantah dituduh sudah sering melakukan aksi perampokan di wilayah hukum Poltabes MS. (cat)

dan mengetahui soal dana hibah akan dipanggil. “Kasus ini masih tahap pengumpulan bahan dan keterangan (Pulbaket) yang ditangani tim jaksa intelijen Kejatisu. Jadi kita belum bisa memaparkan siapa saja yang diperiksa,” ungkapnya. Modus kasus ini PT Askes Regional I memberikan dana hibah Rp4 miliar lebih ini pada direksi RSU dr Pirngadi Medan (RSUPM) untuk pembangunan

ruang rawat inap kelas I. Rencananya, 41 kamar kelas I lengkap dengan peralatan medisnya beserta satu unit lift akan dibangun di RSUPM di tahun 2010 ini. Itu pun bentuknya tidak dengan uang tunai. Namun dalam bentuk bangunan fisik yang sudah selesai untuk dipergunakan. Artinya, proses tender, panitia pelaksana tender hingga pengerjaannya menjadi tanggungjawab PT Askes selaku

pemberi dana hibah. Semuanya akan diatur dalam jalinan kesepakatan bersama pihak direksi RSUPM. Sumberanggarantahun2009, namun pelaksanaan proyek akan dilakukan pada tahun 2010 ini. Diketahui, kasus dana hibah ini berawal adanya dugaan suap yang dilakukan PT Askes kepada Komisi E DPRD Sumut. Namun, sebaliknya dana hibah Rp 4 miliar itu ternyata tidak disalurkan oleh PT Askes. (h05)

Pembalak Register 40 Diboyong Ke Jakarta MEDAN (Waspada): Dua tersangka kasus pembalakan liar (illegal logging) di kawasan Register 40, Selasa (27/4), diboyong ke Jakarta oleh tim gabungan dari Penyidik Pegawai Negeri Sipil Kementerian Kehutanan dan Bareskrim Polri dari Rutan Tanjung Gusta Medan. “Kedua tersangka dibawa karena diduga pelaku pembalakan liar di sekitar kawasan Register 40 di Kabupaten Padang Lawas dan Tapanuli Selatan,” kata Kepala Balai Konservasi Sumber Daya Alam (BKSDA) Sumatera Utara Djati Wicaksono kepada wartawan, kemarin. Menurut Djati, penahanan dua tersangka berawal dari penyelidikan yang dilakukan tim gabungan dari Kemenhut, Bareskrim Polri dan BKSDA Sumut terhadap lima perusahaan perkebunan di sekitar Register 40.

Dari penyelidikan itu, lanjutnya, diketahui dua perusahaan itu diduga tidak memiliki izin sehingga ditahan dengan dugaan tindakan pembalakan liar. Kedua tersangka yakni, S alias Nasib binYasa Miharza dari Koperasi Keluarga Tani Mandiri Bersatu (KTMB) dan S bin Karisman dari Koperasi Serba Guna. Sedangkan tiga perusahaan lain masih diproses yang salah satunya merupakan perusahaan yang berstatus Penanaman Modal Asing (PMA). Setelah dititipkan di Rutan Tanjung Gusta, dua tersangka akan dibawa ke Jakarta oleh tim PPNS Kemenhut dipimpin Edi Purwanto dan Bareskrim Polri untuk menjalani pemeriksaan lebih lanjut. Sementara itu, Kepala RutanTanjung Gusta Medan Thurman SM Hutapea mengatakan, dua tersangka merupakan

Waspada/Ismanto Ismail

Dira Wahyuni Br Siregar, korban perampokan, menutupi wajahnya saat mau menuju ke mobil karena pindah rumah sakit dari RSU Bina Kasih ke rumah sakit di Jalan Diponegoro Medan, Selasa (27/4). tahanan titipan dari Kemenhut terkait pembalakan liar di Register 40. Tim PPNS yang membawa tersangka ada lima orang. “Tersangka sudah dibawa,” ujarnya ketika dihubungi wartawan. Ketua tim PPNS Kemenhut Edi Purwanto ketika dihubungi mengatakan, pihaknya masih melakukan pemeriksaan kesehatan terhadap dua tersangka itu sebelum dibawa ke Jakarta. Namun Edi tidak menyebutkan nama rumah sakit yang menjadi lokasi pemeriksaan terhadap dua tersangka. “Saya tidak tahu karena pihak Rutan yang membawa jalan,” katanya. Edi juga tidak bersedia menjelaskan mengenai kemungkinan batalnya keberangkatan dua tersangka itu terkait adanya gangguan kesehatannya. (h05/m32)

Ancam Bunuh Istri Diringkus MEDAN (Waspada) : SD CH, 35, warga Jalan Pasar III, Desa Tembung, yang mengancam bunuh istrinya diringkus Polsekta Medan Barat, Senin (26/4). Pria yang mengaku wartawan di salah satu media cetak mingguan ini, mengancam akan membunuh istri keduanya, Teti Wahyuni, 25, warga Pasar III, Gang Pribadi Medan. Tersangka diadukan adik sepupunya Lina, 19. Kepada petugas, Kamis (21/4) sekira pkl 22.00 WIB, Lina mengatakan, jika kakak iparnya, TetiWahyuni diancam akan dibunuh dengan menggunakan senjata tajam oleh SD CH. Petugas yang mendapat pengaduan langsung menindak lanjutinya dan meringkus SD CH di kediaman istrinya itu. Dari mobil tersangka juga disita sejumlah barang bukti berupa, 4 senjata tajam (pisau), sebilah parang, sebo, satu gulung lakban, linggis serta satu ikat tali plastik. Kepada polisi, tersangka membantah ada mengancam istri keduanya Teti Wahyuni. “Aku tidak ada mengancam istriku dengan senjata tajam, apa lagi untuk membunuhnya,” kilah tersangka. Dikatakannya, saat itu dirinya memang bertengkar dengan istri keduanya itu. Pasalnya, malam itu dia tidak pulang ke rumah Teti, karena pulang ke rumah istri ketiganya, Ira, 30, warga Jalan Nusa Indah, Pasar VIII Marelan. SD yang tak tahan dengan omelan Teti, lantas naik darah, dan menyeret paksa Teti untuk masuk ke dalam mobil, namun saat itu dia menolak kemauan

MEDAN (Waspada): Takut diancam bunuh penjahat, Dira Wa h y u n i B r Si re g a r, 2 1 , mahasiswi Fakultas Kedokteran semester IV USU nekat lompat dari mobilnya ketika melintas di Ringroad simpang Jalan Amal Medan, Selasa (27/4). Korban warga Jalan Bajak IV Marendal Gang Perjuangan, Kel. Harjosari II, Kec. Medan Amplas, yang menderita luka pada bagian bibir, tiga jari kanan kiri luka akibat kena senjata tajam mendapat perawatan sementara di UGD RS Umum Bina Kasih di Jalan TB Simatupang, Sunggal, dan seterusnya dia menjalani perawatan di rumah sakit Jalan Diponegoro Medan. Keterangan Waspada peroleh di lapangan, perstiwa itu terjadi pukul 09:00, saat itu korban mengendarai mobil Honda Jazz BK 1299 JK warna putih datang ke kampus USU untuk mengikuti perkulihaan sebagai mana biasanya. Ketika hendak memakirkan mobilnya di tempat yang aman, tiba-tiba muncul seorang pelaku dengan ciri-ciri tubuh kurus, kulit coklat, pakai jaket dan memakai tas rangsel. Pelaku yang sudah standby menunggu sasaran mahasiswa

sejak pukul 07:00 lalu mendekati sambil menegur korban. Dira yang tidak curiga kemudian menjawab teguran pelaku. Diduga sudah kena hipnotis, korban diam saja ketika pelaku naik ke mobilnya. Selanjutnya korban menuruti perintah pelaku menyetir mobil dan membawa pelaku yang duduk di sampingnya ke luar dari kampus USU memasuki jalan Ringroard. Dalam perjalanan, korban sempat menghubungi rekannya di kampus, namun pelaku tidak senang langsung mengambil handphone itu secara paksa. Setelah sadar, korban melawan dan pelaku langsung membekap mulutnya sambil mengancam bunuh. Demi keselamatan dirinya, kemudian korban menawarkan kepada pelaku agar mengambil barang-barangnya, asal jangan dirinya dilukai. Sesampai di Ringroard simpang Jalan Amal, Medan Sunggal, korban mengurangi laju kendaraannya lalu melompat ke luar. Sementara pelaku terus mengambil alih kemudi mobil langsung melarikan diri. Petugas Patroli Polsekta Medan Sunggal yang sedang

mengatur lalulintas di kawasan itu mengetahui ada kejadian itu langsung melakukan pengejaran. Namun, petugas tidak berhasil meringkus pelaku karena kehilangan jejak di keramaian lalulintas. Pencarian terus dilakukan dan akhirnya mobil Honda Jazz warnah putih yang dinding dekat pintu depan samping kanan ada bercak darah ditemukan keadaan parkir di Jalan BeringinV, Helvetia Medan, sedangkan pelakunya sudah kabur. Kini mobil korban diamankan di Mapolsekta Medan Sunggal. Kapolsekta Medan Sunggal, AKP Faisal F Napitupulu, SH,SIK, bersama Waka Polsekta Iptu M Hasibuan dan Kanit Reskrim Iptu Anthoni Simamora, SH, serta personelnya turun ke TKP dan ke ruang UGD RS Umum Bina Kasih tempat korban mendapat pertolongan pertama. Dalam kasus ini, polisi telah mengambil keterangan saksi dan pelakunya masih dalam pengejaran. Sementara pihak keluarga korban membuat pengaduan resmi di Mapolsekta tersebut. Sedangkan, pelaku hipnotis itu berhasil mengambil dua handphone dan surat berharga lainnya. (m31)

Kejari Masih Rahasiakan Tersangka Dugaan Korupsi Di Panwaslu

Waspada/Andi Aria Tirtayasa

Kanit Reskrim Polsekta Medan, Barat Iptu H Panggabean, mengintrogasi oknum wartawan yang membawa senjata tajam dan mengancam bunuh istrinya. suaminya itu. “Aku memang saat itu naik darah, tapi aku tidak ada mengancam akan membunuh Teti, apa lagi sampai mengacungkan senjata tajam (parang),” katanya. Saat ditanya sejumlah senjata tajam dan barang bukti yang ditemukan di dalam mobilnya, SD mengatakan, dia baru pulang dari ladangnya di kawasan Tanah Karo. “Ya jelas saja di dalam mobilku ada parang dan pisau,” katanya. Walau tersangka SD membantah semua tuduhan petugas kepadanya. Namun, dia tetap saja dijebloskan ke dalam sel tahanan. Kapolsekta Medan Barat AKP R Pandiangan melalui Ka-

nit Reskrim Iptu H Panggabean ketika dikonfirmasi mengatakan, tersangka dijerat pasal Undang Undang Darurat, sesuai dengan UU No 12 Tahun 1951 tentang membawa dan memiliki senjata tajam. “Tersangka diancam hukuman penjara maksimal 12 tahun kurungan,” tegas Iptu H panggabean. Dari tempat terpisah, petugas Reskrim Polsekta Medan Barat, juga berhasil meringkus seorang jambret AND, 17, warga Jalan Pancing V, Medan Labuhan, sedangkan temannya hingga kini masih buron. Tersangka AND diringkus usai menjambret tas milik korban Dewi, 22, warga Jalan Alfakah III, Tanjung Mulia.(cat)

Anak Karyawan PTPN III Didorong Berprestasi MEDAN (Waspada): Direktur Utama PTPN III Amri Siregar memberi apresiasi dan mendorong karyawannya untuk memacu prestasi putra-putri mereka mengejar jenjang pendidikan hingga perguruan tinggi. PTPN III telah membangun kerjasama dengan Universitas Sumatera Utara melalui program kemitraan. Siregar mengatakan hal itu kepada wartawan, Sabtu (24/4), di Auditorium USU Medan saat menghadiri wisuda putranya Hendri Rizky Siregar dari Fakultas Ekonomi yang kebetulan bersamaan diwisuda dengan beberapa anak karyawan perusahaan perkebunan negara tersebut, di antaranya dr Rini Aftita Sari, putri dari Alm Rizal Effendi Saragih, pegawai Kebun Silau Dunia PTPN III dan istrinya Suliawati Purba, bidan pada RS Sri Pamela Tebingtinggi. Siregar menilai positif program kemitraan yang dimaksudkan untuk memberi kesempatan lebih luas kepada anak karyawan PTPN III berprestasi namun terbatas kemampuan ekonomi untuk bisa menuntut ilmu di USU. Dia bangga program kemitraan dirasakan manfaatnya oleh keluarga besar PTPN III. Pelayanan terbaik Sementara itu, dr Rini Aftita Sari yang juga keponakan Eddy Syofian, Kadis Kominfo Sumut, dalam bincang-bincang dengan wartawan mengucapkan rasa syukur atas berhasilnya menyelesaikan studi di Fakultas Kedokteran USU, sembari berterima kasih atas dorong kedua orangtuanya, termasuk dorongan pimpinan PTPN III.(m19)

Diancam Bunuh Penjahat Mahasiswi Lompat Dari Mobil

Waspada/Ist

Hadiri Wisuda: Dirut PTPN III dan Ny Hj Amri Siregar (2 dan 4 dari kanan) tampak gembira menghadiri wisuda putranya, Hendri Rizky Siregar, SE (kiri) yang diwisuda bersamaan dengan dr Rini Aftita Sari (3 dari kanan), Sabtu (24/4). di Auditorium USU Medan.

MEDAN (Waspada): Tim Tindak Pidana Khusus Kejaksaan Negeri Medan tengah membidik sejumlah tersangka dalam kasus dugaan korupsi dana operasional kegiatan pemilihan legislatif tahun 2009, sebesar Rp500 juta. Kepala Seksi Pidana Khusus Kejari Medan Dharmabella Timbasz kepada wartawan Selasa (27/4), menyebutkan, saat ini penyidikan mengarah kepada penetapan para tersangka. “Ini dari keterangan para saksi-saksi serta barang bukti yang diterima. Timnya menemukan adanya pemotongan dana operasional kepada para Panwas Kecamatan yang dilakukan kedua calon tersangka,” ujarnya. Namun, Dharmabella masih merahasiakan nama para tersangka serta jabatan mereka pada saat kegiatan berlangsung. Dirinya beralasan jika dibuka dapat mempersulit pemeriksaan lanjutan dan dikhawatirkan hilangnya barang bukti.

“Nanti dulu. Tidak etis kalau disebutkan saat ini siapa tersangkanya karena prosesnya masih penyidikan,” katanya. Soal adanya keterlibatan ketua Panwaslu Kota Medan dalam kasus tersebut, dia menolak berkomentar lebih jauh sembari menyatakan hal itu rahasia penyidikan. Begitu juga soal nilai dana yang diselewengkan. “Belum dapat diekspos.” Seperti diberitakan sebelumnya, Kejaksaan Negeri Medan mendapat laporan dari para ketua dan anggota Panwaslu kecamatan dan kelurahan terkait penyimpangan anggaran mencapai Rp350 juta. Dari total angaran yang diberikan pada dana revisi rincian anggaran belanja (RAB) Panwaslu 2009 untuk 21 kecamatan mencapai lebih Rp500 juta untuk biaya perlengkapan kerja berupa kertas, ballpoint dan pensil di kecamatan untuk Maret-Oktober sebesar Rp20,5 juta; biaya makan dan snack rapat internal Panwaslu di keca-

matan untuk Maret-Oktober sebesar Rp97 juta; biaya penggandaan dan penjilidan di kecamatan untuk Maret-Oktober sebesar Rp50,4 juta. Selain itu, uang makan pengawas pemilu lapangan (PPL) untuk 151 kelurahan sebesar Rp181, 2 juta, dan biaya transport pengawas pemilu lapangan mulai Maret-Oktober 2009 sebesar Rp181,2 juta. Dari kelima item ini, perkecamatan setidak-tidaknya paling kecil mendapatkan dana Rp20 juta. Namun yang diberikan itu hanya separuhnya.Tak hanya itu saja, Panwaslu Kota Medan juga tidak memberikan honorarium untuk PPL di 151 kelurahan dan 21 kecamatan untuk Januari-Februari 2009. Sementara dana pencairan ada diterima pihak Sekretariat Panwaslu Medan dengan dana mencapai Rp225,8 juta. Dari jumlah itu, ada dana honor untuk bulan Januari sekitar Rp60,4 juta yang tidak pernah diberikan kepada PPL di kelurahan. (h05)

Polsekta Medan Baru Tangkap 10 Tersangka Penjahat MEDAN (Waspada): Polsekta Medan Baru menangkap 10 tersangka kasus narkoba, judi togel, pencurian dan pemerasan dari lokasi berbeda. “Para tersangka ini berusia 16 sampai 65 tahun dan wajahwajah baru bahkan pertama kali berurusan dengan pihak berwajib,” kata Kapolsekta Medan Baru AKP Moch. Yoris MY Marzuki, Senin (26/4). Menurut Yoris, tersangka disergap petugas dalam operasi empat hari (21-24/4). Dari 10 tersangka, empat orang terlibat narkoba: ZE, 26, penduduk Jalan Stasiun, Kel. Kampung Lalang, Kec. Sunggal, Deliserdang, ditangkap di Jalan Binjai Km 10,5 Kel. Paya Geli turut disita 1 bungkus sabu-sabu; FOM, 16, warga Jalan Letjen Jamin Ginting ditangkap di Jalan Berdikari, Pasar I bersamanya 2 bungkus ganja; ASL, 36, warga Jalan Sei Sikambing Gang Patimura disergap di Jalan Hasanuddin bersa-

ma 1 bungkus sabu-sabu dan sepeda motor Yamaha Vega R warna silver hitam; ZE, 25, warga Jalan Puri Gang Repelita, Kota Matsum tertangkap di Jalan Puri Gang Seni disertai 4 bungkus ganja dan ponsel. Lalu, dua tersangka tersandung judi togel: Syt, 39, warga Desa Sidodadi, Kec. Sibiru-biru tertangkap di Jalan Masdulhak bersama barang bukti ponsel, secarik kertas terdapat nomornomor tebakan togel, uang Rp65.000; Lgs, 65, ditangkap dekat rumahnya Jalan Makmur, Desa Sunggal Kanan, Kec. Sunggal disertai 1 buku notes berisikan pasangan nomor togel, rekapan berisikan pasangan nomor togel, potongan kertas berisikan pasangan togel, pulpen dan uang Rp57.000. Sedangkan, dua tersangka kasus pencurian Sgt alias Fukli, 28, penduduk Jalan KL Yos Sudarso Gang Sri Deli dan MHM penduduk Jalan Sei Batang Hari, Pasar

I tertangkap di Jalan Sei Sikambing disertai ponsel BlackBerry. Lalu, dua tersangka lagi kasus pemerasan: JHM alias Jani, 33, penduduk Jalan Sembada, Gang Mawar II dan RTP alias Rafles, 31, warga Jalan Pintu Air IV Gang Mendiri ditangkap di Jalan Sembada bersama barang bukti uang Rp4.000. Yoris mengatakan, petugas menangkap mereka berawal dari informasi yang diterima dari masyarakat. Bahkan, tersangka Agt alias Fukli dan MHM sempat kabur dengan sepeda motor setelah merampas handphone pelajar SD, namun petugas patroli mampu melemahkannya. MenurutYoris, modus pelaku menghampiri pelajar sewaktu pulang sekolah mengendarai sepeda. Pelaku meminjam handphone siswa dengan alasan untuk menghubungitemannya.Sewaktu handphone pindah tangan, pelaku melarikan diri. (m31)


Sport

A8

WASPADA

Rabu 28 April 2010

Giliran Pelapis Suns Bersinar PHOENIX, AS (Waspada): Berbekal raihan optimal di game kelima playoff NBA, Selasa (27/4), Phoenix Suns hanya membutuhkan satu kemenangan lagi atas Portland Trailblazers untuk memastikan tiket ke semifinal. Sempat memimpin 2-1, Suns dipaksa mengakui keunggulan Portland 96-87 pada game sebelum. Namun, anak-anak asuh Alvin Gentry kembali memegang kendali berkat kemenangan

107-88 di US Airways Center. Adalah pemain cadangan Channing Frye dan Jared Dudley yang mengantarkan Suns merebut keunggulan 3-2 atas Blazers. Frye dan Dudley yang melakoni laga

dari bangku cadangan masing-masing mengemas 20 dan 19 angka. Bila Frye menambah koleksi delapan rebound, Dudley justru mencetak 15 poin bagi timnya dari garis three point. Amare Stoudemire juga membukukan 19 angka untuk Suns, sementara Steve Nash mengemas 14 poin 10 assist. Di Charlotte, Orlando Magic menjadi tim pertama yang berhasil lolos ke semifinal Wilayah Timur usai menyapu bersih empat pertandingan melawan Charlotte

Bobcats. Keunggulan 4-0 diraih Magic usai mengalahkan Bobcats 99-90 di Time Warner Cable Arena. Kali ini, Vince Carter menjadi bintang Magic dengan menoreh 21 poin. Jameer Nelson menambah 18 angka untuk Magic, sedangkan Dwight Howard mendulang enam poin plus 13 rebound. Di semifinal Wilayah Timur nanti, Magic akan ditantang pemenang antara Atlanta Hawks melawan Milwaukee Bucks. Kedua tim saat ini masih berbagi poin

Reuters

Jempol Alonso Seharga 10 Juta Euro LONDON (Waspada): Juara dunia dua kali, Fernando Alonso (foto), mengasuransikan dua jempol tangannya senilai 10 juta euro sebagai simbol kampanye keselamatan dan asuransi jiwa menjelang GP Spanyol di Barcelona, pekan depan. “Jempol Alonso adalah sebuah simbol yang penting dalam mengemudikan sebuah mobil Formula 1. Mereka merupakan simbol kemenangan, namun juga simbol bahwa semua berjalan baik dan terlindungi,” kata Santander, lembaga keuangan Spanyol yang menjadi penjamin. Alonso merupakan juara dunia 2005 dan 2006 saat masih bergabung dengan tim Renault. Kini ia bergabung dengan tim Ferrari bersama pembalap Brazil, Felipe Massa, sekaligus berharap dapat menjuarai GP pertama di Eropa. Untuk meningkatkan peluang meraih gelar juara dunia. Alonso mejuarai seri lomba pertama di Bahrain dan kini menempati peringkat ketiga dalam klasemen pembalap sementara. “Sekarang saatnya untuk memperlihatkan siapa yang berpeluang juara dan siapa yang tidak. Di Eropa, waktu penentuan telah tiba buat para pembalap dan tim untuk menunjukkan siapa yang tercepat,” ungkap Alonso. (m33/vvn)

2-2. Pada game keempat di kandang, Bucks sukses mengalahkan Hawks 111-104. Brandon Jennings menjadi top skor Bucks dengan total 23 angka. John Salmons dan Carlos Delfino membuntuti rekannya dengan total raihan masing-masing 22 poin. Di kubu tuan ru-\mah, Joe Johnson menjadi pemain tersubur setelah membukukan 29 angka di-ikuti Jamal Crawford (21) dan Joe Smith (20). (m33/ap)

AP

Pedrosa Pede Tatap Jerez AALST, Belgia ( Waspada): Dani Pedrosa (foto) percaya diri menatap GP Spanyol. Pembalap andalan Repsol Honda itu yakin bisa bangkit dan meraih prestasi maksimal di Sirkuit Jerez. Betapa tidak, Pedrosa meraih kemenangan di MotoGP Spanyol 2008 dan sudah meraih podium di Jerez sejak pertama kali tampil di balapan utama musim 2005 silam. Setelah balapan MotoGP Jepang ditunda, Pedrosa dan kru Repsol Honda fokus ke Spanyol. “Jerez merupakan tempat yang spesial buat semua pembalap Spanyol dan saya sudah tidak sabar untuk ba-

lapan di sana pekan ini,” ungkap Pedrosa dilansir paddocktalk, Selasa (27/4). “Kami memang tidak memulai balapan terbaik di Qatar, serta tidak dapat balapan di Jepang menyusul meletusnya gunung berapi. Tapi, saya mengharapkan situasi yang berbeda di Jerez,” lanjut pembalap Spanyol itu. “Rival kami adalah tim yang sangat kuat dan saya yakin mereka juga ingin mengambil keuntungan. Jadi, kami harus bekerja keras untuk sama dengan level mereka dan bisa bertarung hingga akhir,” tambahnya “Di Jerez nanti, kami akan

mencoba mengubah beberapa sasis yang membuat motor tidak gugup lagi dan saya berharap chasis baru itu bisa bekerja dengan maksimal nanti,” tandasnya. (m33/kez)

Channing Frye (8) tampil gemilang bagi Phoenix Suns kendati berperan sebagai pemain pelapis melawan Portland Trailblazers di US Airways Center, Selasa (27/4). -AP-


Medan Metropolitan

WASPADA Rabu 28 April 2010

B1

Dugaan Korupsi

Kejati Periksa Sejumlah Pejabat PT Askes MEDAN (Waspada): Kejaksaan Tinggi Sumatera Utara (Kejatisu) mendalami kasus dugaan korupsi dana hibah PT Askes sebesar Rp4 miliar tahun anggaran 2009 untuk pembangunan ruang rawat inap di RSU Pirngadi Medan. “Kita telah memanggil sejumlah pejabat PT Askes Sumut untuk diperiksa guna dimintai keterangannya,” kata Kepala Seksi penerangan Hukum (Kasipenkum) Kejatisu, Edi Irsan Kurniawan Tarigan, SH, Selasa (27/4). Menjawab wartawan, juru bicara Kajatisu itu mengatakan, pastinya jumlah pejabat PT Askes yang sudah diperiksa ada tiga atau empat orang. “Seming-

gu yang lalu mereka datang memenuhi panggilan untuk dimintai keterangan,” kata Tarigan, namun dia enggan menyebutkan nama dan jabatan dari pejabat PT Askes yang dipanggil. Kembali menjawab wartawan apakah GM PT Askes Wilayah Sumut telah dipanggil untuk diperiksa, kata Tarigan, kalau soal itu belum dapat informasi jelas. Pastinya, pejabat PT Askes yang diduga terlibat

Waspada/Rudi Arman

PATROLI SEPEDA: Tiga anggota Satlantas Poltabes Medan dengan pakaian seragam mengenakan helm bersiap-siap untuk menggelar patroli bersepeda terhadap pelaksanaan hari berbas kendaraan bermotor (Car Free Day) yang dilaksanakan Minggu (2/5) di Jalan Gatot Subroto Medan. Foto diambil Selasa (27/4).

Satu Lagi Tersangka RUTRK Belum Diperiksa MEDAN (Waspada): Dari empat tersangka dugaan korupsi Rancangan Umum Tata Ruang Kota (RUTRK), tinggal satu orang yang belum diperiksa penyidik Satuan III Tindak Pidana Korupsi (Tipikor) Polda Sumut. “Yang belum menjalani pemeriksaan tersangka FHB, sedangkan tiga orang yang telah menjalani pemeriksaan dan ditetapkan menjadi tersangka yakni HJ, SA, SC,” kata Direktur Reskrim Polda Sumut, Kombes Pol Agus Andriyanto melalui Kasat III Tipikor AKBP Prastiono, Senin (26/4) malam. Tersangka SC, lanjut Prastiono, sudah menjalani pemeriksaan dan pemeriksaan lanjutan dilaksanakan, Kamis (29/4). Kedatangan SC memang telah dijadwalkan, sebab dalam pemeriksaan awal yang bersangkutan tidak bisa datang karena sakit. Sementara, sebut Prastiono, FHB belum bisa menghadiri panggilan penyidik kepolisian karena masih di Jakarta. Seperti diketahui, dugaan korupsi Master Plan Kota Medan 2006-2016 tersebut dibagi dalam tiga proyek masing-masing RUTRK, Vision Plan dan Peta Garis. Dalam proyek tersebut, negara mengalami kerugian Rp1.526.062.238. Prastiono pernah menjabarkan, dua proyek yakni RUTRK dan Peta Garis selesai dikerjakan. Namun satu lainnya, Peta Garis yang telah di sub kan ke Tjong Giok Pin tapi tak selesai dikerjakan. Masalahnya pekerjaan tidak selesai malah uang telah diambil. Para tersangka, sebut Prastiono, diancam pasal 2,3,5 dan 9 Undang-undang No.31 tahun 1999 junto Undang Undang No.2 tahun 2001 tentang dugaan korupsi. Menurutnya, saat ini mereka baru menetapkan empat tersangka dalam kasus tersebut. Begitupun, tidak tertutup kemungkinan tersangka bakal bertambah. (m39)

Dua Perampok Diringkus MEDAN (Waspada): Dua perampok bersepedamotor diringkus polisi di Jalan Nusantara, Bandarkhalifah, Kec. Percutseituan, Minggu (25/4) malam. Dari kedua tersangka AGP, 17, dan Sup alias Gepeng, 20, keduanya warga Jalan Pendidikan Pasar XI Desa Bandarkhalifah, disita seuntai kalung emas senilai Rp500.000 dan sepeda motor Yamaha Zupiter tanpa plat sebagai barang buktinya. Sedangkan korbannya Sri Sudarmawati, 32, warga Jalan Nusantara, telah membuat pengaduan ke Polsekta Percut Seituan. Peristiwa perampokan itu terjadi sekira pukul 18.00 Wib. Saat itu, korban mengendarai sepeda motor berboncengan dengan anaknya dari rumah familinya bermaksud hendak pulang ke rumah. Namun, sejak dari Gang Kapuk Tembung, korban diikuti oleh kedua tersangka. Setibanya di kawasan Jalan Nusantara, sepeda motor yang dikemudikan korban dipepet kedua perampok itu dan langsung merampas kalung emas yang melekat di leher korban. Setelah barang berharga itu berhasil dikuasai, pelaku langsung tancap gas melarikan diri. Korban langsung menjerit minta tolong dan didengar Tim Serse Polsekta Percut Sei Tuan yang sedang melintas. Dalam pemeriksaan sementara, kedua tersangka membantah dituduh sudah sering melakukan aksi perampokan di wilayah hukum Poltabes MS. (cat)

dan mengetahui soal dana hibah akan dipanggil. “Kasus ini masih tahap pengumpulan bahan dan keterangan (Pulbaket) yang ditangani tim jaksa intelijen Kejatisu. Jadi kita belum bisa memaparkan siapa saja yang diperiksa,” ungkapnya. Modus kasus ini PT Askes Regional I memberikan dana hibah Rp4 miliar lebih ini pada direksi RSU dr Pirngadi Medan (RSUPM) untuk pembangunan

ruang rawat inap kelas I. Rencananya, 41 kamar kelas I lengkap dengan peralatan medisnya beserta satu unit lift akan dibangun di RSUPM di tahun 2010 ini. Itu pun bentuknya tidak dengan uang tunai. Namun dalam bentuk bangunan fisik yang sudah selesai untuk dipergunakan. Artinya, proses tender, panitia pelaksana tender hingga pengerjaannya menjadi tanggungjawab PT Askes selaku

pemberi dana hibah. Semuanya akan diatur dalam jalinan kesepakatan bersama pihak direksi RSUPM. Sumberanggarantahun2009, namun pelaksanaan proyek akan dilakukan pada tahun 2010 ini. Diketahui, kasus dana hibah ini berawal adanya dugaan suap yang dilakukan PT Askes kepada Komisi E DPRD Sumut. Namun, sebaliknya dana hibah Rp 4 miliar itu ternyata tidak disalurkan oleh PT Askes. (h05)

Pembalak Register 40 Diboyong Ke Jakarta MEDAN (Waspada): Dua tersangka kasus pembalakan liar (illegal logging) di kawasan Register 40, Selasa (27/4), diboyong ke Jakarta oleh tim gabungan dari Penyidik Pegawai Negeri Sipil Kementerian Kehutanan dan Bareskrim Polri dari Rutan Tanjung Gusta Medan. “Kedua tersangka dibawa karena diduga pelaku pembalakan liar di sekitar kawasan Register 40 di Kabupaten Padang Lawas dan Tapanuli Selatan,” kata Kepala Balai Konservasi Sumber Daya Alam (BKSDA) Sumatera Utara Djati Wicaksono kepada wartawan, kemarin. Menurut Djati, penahanan dua tersangka berawal dari penyelidikan yang dilakukan tim gabungan dari Kemenhut, Bareskrim Polri dan BKSDA Sumut terhadap lima perusahaan perkebunan di sekitar Register 40.

Dari penyelidikan itu, lanjutnya, diketahui dua perusahaan itu diduga tidak memiliki izin sehingga ditahan dengan dugaan tindakan pembalakan liar. Kedua tersangka yakni, S alias Nasib binYasa Miharza dari Koperasi Keluarga Tani Mandiri Bersatu (KTMB) dan S bin Karisman dari Koperasi Serba Guna. Sedangkan tiga perusahaan lain masih diproses yang salah satunya merupakan perusahaan yang berstatus Penanaman Modal Asing (PMA). Setelah dititipkan di Rutan Tanjung Gusta, dua tersangka akan dibawa ke Jakarta oleh tim PPNS Kemenhut dipimpin Edi Purwanto dan Bareskrim Polri untuk menjalani pemeriksaan lebih lanjut. Sementara itu, Kepala RutanTanjung Gusta Medan Thurman SM Hutapea mengatakan, dua tersangka merupakan

Waspada/Ismanto Ismail

Dira Wahyuni Br Siregar, korban perampokan, menutupi wajahnya saat mau menuju ke mobil karena pindah rumah sakit dari RSU Bina Kasih ke rumah sakit di Jalan Diponegoro Medan, Selasa (27/4). tahanan titipan dari Kemenhut terkait pembalakan liar di Register 40. Tim PPNS yang membawa tersangka ada lima orang. “Tersangka sudah dibawa,” ujarnya ketika dihubungi wartawan. Ketua tim PPNS Kemenhut Edi Purwanto ketika dihubungi mengatakan, pihaknya masih melakukan pemeriksaan kesehatan terhadap dua tersangka itu sebelum dibawa ke Jakarta. Namun Edi tidak menyebutkan nama rumah sakit yang menjadi lokasi pemeriksaan terhadap dua tersangka. “Saya tidak tahu karena pihak Rutan yang membawa jalan,” katanya. Edi juga tidak bersedia menjelaskan mengenai kemungkinan batalnya keberangkatan dua tersangka itu terkait adanya gangguan kesehatannya. (h05/m32)

Ancam Bunuh Istri Diringkus MEDAN (Waspada) : SD CH, 35, warga Jalan Pasar III, Desa Tembung, yang mengancam bunuh istrinya diringkus Polsekta Medan Barat, Senin (26/4). Pria yang mengaku wartawan di salah satu media cetak mingguan ini, mengancam akan membunuh istri keduanya, Teti Wahyuni, 25, warga Pasar III, Gang Pribadi Medan. Tersangka diadukan adik sepupunya Lina, 19. Kepada petugas, Kamis (21/4) sekira pkl 22.00 WIB, Lina mengatakan, jika kakak iparnya, TetiWahyuni diancam akan dibunuh dengan menggunakan senjata tajam oleh SD CH. Petugas yang mendapat pengaduan langsung menindak lanjutinya dan meringkus SD CH di kediaman istrinya itu. Dari mobil tersangka juga disita sejumlah barang bukti berupa, 4 senjata tajam (pisau), sebilah parang, sebo, satu gulung lakban, linggis serta satu ikat tali plastik. Kepada polisi, tersangka membantah ada mengancam istri keduanya Teti Wahyuni. “Aku tidak ada mengancam istriku dengan senjata tajam, apa lagi untuk membunuhnya,” kilah tersangka. Dikatakannya, saat itu dirinya memang bertengkar dengan istri keduanya itu. Pasalnya, malam itu dia tidak pulang ke rumah Teti, karena pulang ke rumah istri ketiganya, Ira, 30, warga Jalan Nusa Indah, Pasar VIII Marelan. SD yang tak tahan dengan omelan Teti, lantas naik darah, dan menyeret paksa Teti untuk masuk ke dalam mobil, namun saat itu dia menolak kemauan

MEDAN (Waspada): Takut diancam bunuh penjahat, Dira Wa h y u n i B r Si re g a r, 2 1 , mahasiswi Fakultas Kedokteran semester IV USU nekat lompat dari mobilnya ketika melintas di Ringroad simpang Jalan Amal Medan, Selasa (27/4). Korban warga Jalan Bajak IV Marendal Gang Perjuangan, Kel. Harjosari II, Kec. Medan Amplas, yang menderita luka pada bagian bibir, tiga jari kanan kiri luka akibat kena senjata tajam mendapat perawatan sementara di UGD RS Umum Bina Kasih di Jalan TB Simatupang, Sunggal, dan seterusnya dia menjalani perawatan di rumah sakit Jalan Diponegoro Medan. Keterangan Waspada peroleh di lapangan, perstiwa itu terjadi pukul 09:00, saat itu korban mengendarai mobil Honda Jazz BK 1299 JK warna putih datang ke kampus USU untuk mengikuti perkulihaan sebagai mana biasanya. Ketika hendak memakirkan mobilnya di tempat yang aman, tiba-tiba muncul seorang pelaku dengan ciri-ciri tubuh kurus, kulit coklat, pakai jaket dan memakai tas rangsel. Pelaku yang sudah standby menunggu sasaran mahasiswa

sejak pukul 07:00 lalu mendekati sambil menegur korban. Dira yang tidak curiga kemudian menjawab teguran pelaku. Diduga sudah kena hipnotis, korban diam saja ketika pelaku naik ke mobilnya. Selanjutnya korban menuruti perintah pelaku menyetir mobil dan membawa pelaku yang duduk di sampingnya ke luar dari kampus USU memasuki jalan Ringroard. Dalam perjalanan, korban sempat menghubungi rekannya di kampus, namun pelaku tidak senang langsung mengambil handphone itu secara paksa. Setelah sadar, korban melawan dan pelaku langsung membekap mulutnya sambil mengancam bunuh. Demi keselamatan dirinya, kemudian korban menawarkan kepada pelaku agar mengambil barang-barangnya, asal jangan dirinya dilukai. Sesampai di Ringroard simpang Jalan Amal, Medan Sunggal, korban mengurangi laju kendaraannya lalu melompat ke luar. Sementara pelaku terus mengambil alih kemudi mobil langsung melarikan diri. Petugas Patroli Polsekta Medan Sunggal yang sedang

mengatur lalulintas di kawasan itu mengetahui ada kejadian itu langsung melakukan pengejaran. Namun, petugas tidak berhasil meringkus pelaku karena kehilangan jejak di keramaian lalulintas. Pencarian terus dilakukan dan akhirnya mobil Honda Jazz warnah putih yang dinding dekat pintu depan samping kanan ada bercak darah ditemukan keadaan parkir di Jalan BeringinV, Helvetia Medan, sedangkan pelakunya sudah kabur. Kini mobil korban diamankan di Mapolsekta Medan Sunggal. Kapolsekta Medan Sunggal, AKP Faisal F Napitupulu, SH,SIK, bersama Waka Polsekta Iptu M Hasibuan dan Kanit Reskrim Iptu Anthoni Simamora, SH, serta personelnya turun ke TKP dan ke ruang UGD RS Umum Bina Kasih tempat korban mendapat pertolongan pertama. Dalam kasus ini, polisi telah mengambil keterangan saksi dan pelakunya masih dalam pengejaran. Sementara pihak keluarga korban membuat pengaduan resmi di Mapolsekta tersebut. Sedangkan, pelaku hipnotis itu berhasil mengambil dua handphone dan surat berharga lainnya. (m31)

Kejari Masih Rahasiakan Tersangka Dugaan Korupsi Di Panwaslu

Waspada/Andi Aria Tirtayasa

Kanit Reskrim Polsekta Medan, Barat Iptu H Panggabean, mengintrogasi oknum wartawan yang membawa senjata tajam dan mengancam bunuh istrinya. suaminya itu. “Aku memang saat itu naik darah, tapi aku tidak ada mengancam akan membunuh Teti, apa lagi sampai mengacungkan senjata tajam (parang),” katanya. Saat ditanya sejumlah senjata tajam dan barang bukti yang ditemukan di dalam mobilnya, SD mengatakan, dia baru pulang dari ladangnya di kawasan Tanah Karo. “Ya jelas saja di dalam mobilku ada parang dan pisau,” katanya. Walau tersangka SD membantah semua tuduhan petugas kepadanya. Namun, dia tetap saja dijebloskan ke dalam sel tahanan. Kapolsekta Medan Barat AKP R Pandiangan melalui Ka-

nit Reskrim Iptu H Panggabean ketika dikonfirmasi mengatakan, tersangka dijerat pasal Undang Undang Darurat, sesuai dengan UU No 12 Tahun 1951 tentang membawa dan memiliki senjata tajam. “Tersangka diancam hukuman penjara maksimal 12 tahun kurungan,” tegas Iptu H panggabean. Dari tempat terpisah, petugas Reskrim Polsekta Medan Barat, juga berhasil meringkus seorang jambret AND, 17, warga Jalan Pancing V, Medan Labuhan, sedangkan temannya hingga kini masih buron. Tersangka AND diringkus usai menjambret tas milik korban Dewi, 22, warga Jalan Alfakah III, Tanjung Mulia.(cat)

Anak Karyawan PTPN III Didorong Berprestasi MEDAN (Waspada): Direktur Utama PTPN III Amri Siregar memberi apresiasi dan mendorong karyawannya untuk memacu prestasi putra-putri mereka mengejar jenjang pendidikan hingga perguruan tinggi. PTPN III telah membangun kerjasama dengan Universitas Sumatera Utara melalui program kemitraan. Siregar mengatakan hal itu kepada wartawan, Sabtu (24/4), di Auditorium USU Medan saat menghadiri wisuda putranya Hendri Rizky Siregar dari Fakultas Ekonomi yang kebetulan bersamaan diwisuda dengan beberapa anak karyawan perusahaan perkebunan negara tersebut, di antaranya dr Rini Aftita Sari, putri dari Alm Rizal Effendi Saragih, pegawai Kebun Silau Dunia PTPN III dan istrinya Suliawati Purba, bidan pada RS Sri Pamela Tebingtinggi. Siregar menilai positif program kemitraan yang dimaksudkan untuk memberi kesempatan lebih luas kepada anak karyawan PTPN III berprestasi namun terbatas kemampuan ekonomi untuk bisa menuntut ilmu di USU. Dia bangga program kemitraan dirasakan manfaatnya oleh keluarga besar PTPN III. Pelayanan terbaik Sementara itu, dr Rini Aftita Sari yang juga keponakan Eddy Syofian, Kadis Kominfo Sumut, dalam bincang-bincang dengan wartawan mengucapkan rasa syukur atas berhasilnya menyelesaikan studi di Fakultas Kedokteran USU, sembari berterima kasih atas dorong kedua orangtuanya, termasuk dorongan pimpinan PTPN III.(m19)

Diancam Bunuh Penjahat Mahasiswi Lompat Dari Mobil

Waspada/Ist

Hadiri Wisuda: Dirut PTPN III dan Ny Hj Amri Siregar (2 dan 4 dari kanan) tampak gembira menghadiri wisuda putranya, Hendri Rizky Siregar, SE (kiri) yang diwisuda bersamaan dengan dr Rini Aftita Sari (3 dari kanan), Sabtu (24/4). di Auditorium USU Medan.

MEDAN (Waspada): Tim Tindak Pidana Khusus Kejaksaan Negeri Medan tengah membidik sejumlah tersangka dalam kasus dugaan korupsi dana operasional kegiatan pemilihan legislatif tahun 2009, sebesar Rp500 juta. Kepala Seksi Pidana Khusus Kejari Medan Dharmabella Timbasz kepada wartawan Selasa (27/4), menyebutkan, saat ini penyidikan mengarah kepada penetapan para tersangka. “Ini dari keterangan para saksi-saksi serta barang bukti yang diterima. Timnya menemukan adanya pemotongan dana operasional kepada para Panwas Kecamatan yang dilakukan kedua calon tersangka,” ujarnya. Namun, Dharmabella masih merahasiakan nama para tersangka serta jabatan mereka pada saat kegiatan berlangsung. Dirinya beralasan jika dibuka dapat mempersulit pemeriksaan lanjutan dan dikhawatirkan hilangnya barang bukti.

“Nanti dulu. Tidak etis kalau disebutkan saat ini siapa tersangkanya karena prosesnya masih penyidikan,” katanya. Soal adanya keterlibatan ketua Panwaslu Kota Medan dalam kasus tersebut, dia menolak berkomentar lebih jauh sembari menyatakan hal itu rahasia penyidikan. Begitu juga soal nilai dana yang diselewengkan. “Belum dapat diekspos.” Seperti diberitakan sebelumnya, Kejaksaan Negeri Medan mendapat laporan dari para ketua dan anggota Panwaslu kecamatan dan kelurahan terkait penyimpangan anggaran mencapai Rp350 juta. Dari total angaran yang diberikan pada dana revisi rincian anggaran belanja (RAB) Panwaslu 2009 untuk 21 kecamatan mencapai lebih Rp500 juta untuk biaya perlengkapan kerja berupa kertas, ballpoint dan pensil di kecamatan untuk Maret-Oktober sebesar Rp20,5 juta; biaya makan dan snack rapat internal Panwaslu di keca-

matan untuk Maret-Oktober sebesar Rp97 juta; biaya penggandaan dan penjilidan di kecamatan untuk Maret-Oktober sebesar Rp50,4 juta. Selain itu, uang makan pengawas pemilu lapangan (PPL) untuk 151 kelurahan sebesar Rp181, 2 juta, dan biaya transport pengawas pemilu lapangan mulai Maret-Oktober 2009 sebesar Rp181,2 juta. Dari kelima item ini, perkecamatan setidak-tidaknya paling kecil mendapatkan dana Rp20 juta. Namun yang diberikan itu hanya separuhnya.Tak hanya itu saja, Panwaslu Kota Medan juga tidak memberikan honorarium untuk PPL di 151 kelurahan dan 21 kecamatan untuk Januari-Februari 2009. Sementara dana pencairan ada diterima pihak Sekretariat Panwaslu Medan dengan dana mencapai Rp225,8 juta. Dari jumlah itu, ada dana honor untuk bulan Januari sekitar Rp60,4 juta yang tidak pernah diberikan kepada PPL di kelurahan. (h05)

Polsekta Medan Baru Tangkap 10 Tersangka Penjahat MEDAN (Waspada): Polsekta Medan Baru menangkap 10 tersangka kasus narkoba, judi togel, pencurian dan pemerasan dari lokasi berbeda. “Para tersangka ini berusia 16 sampai 65 tahun dan wajahwajah baru bahkan pertama kali berurusan dengan pihak berwajib,” kata Kapolsekta Medan Baru AKP Moch. Yoris MY Marzuki, Senin (26/4). Menurut Yoris, tersangka disergap petugas dalam operasi empat hari (21-24/4). Dari 10 tersangka, empat orang terlibat narkoba: ZE, 26, penduduk Jalan Stasiun, Kel. Kampung Lalang, Kec. Sunggal, Deliserdang, ditangkap di Jalan Binjai Km 10,5 Kel. Paya Geli turut disita 1 bungkus sabu-sabu; FOM, 16, warga Jalan Letjen Jamin Ginting ditangkap di Jalan Berdikari, Pasar I bersamanya 2 bungkus ganja; ASL, 36, warga Jalan Sei Sikambing Gang Patimura disergap di Jalan Hasanuddin bersa-

ma 1 bungkus sabu-sabu dan sepeda motor Yamaha Vega R warna silver hitam; ZE, 25, warga Jalan Puri Gang Repelita, Kota Matsum tertangkap di Jalan Puri Gang Seni disertai 4 bungkus ganja dan ponsel. Lalu, dua tersangka tersandung judi togel: Syt, 39, warga Desa Sidodadi, Kec. Sibiru-biru tertangkap di Jalan Masdulhak bersama barang bukti ponsel, secarik kertas terdapat nomornomor tebakan togel, uang Rp65.000; Lgs, 65, ditangkap dekat rumahnya Jalan Makmur, Desa Sunggal Kanan, Kec. Sunggal disertai 1 buku notes berisikan pasangan nomor togel, rekapan berisikan pasangan nomor togel, potongan kertas berisikan pasangan togel, pulpen dan uang Rp57.000. Sedangkan, dua tersangka kasus pencurian Sgt alias Fukli, 28, penduduk Jalan KL Yos Sudarso Gang Sri Deli dan MHM penduduk Jalan Sei Batang Hari, Pasar

I tertangkap di Jalan Sei Sikambing disertai ponsel BlackBerry. Lalu, dua tersangka lagi kasus pemerasan: JHM alias Jani, 33, penduduk Jalan Sembada, Gang Mawar II dan RTP alias Rafles, 31, warga Jalan Pintu Air IV Gang Mendiri ditangkap di Jalan Sembada bersama barang bukti uang Rp4.000. Yoris mengatakan, petugas menangkap mereka berawal dari informasi yang diterima dari masyarakat. Bahkan, tersangka Agt alias Fukli dan MHM sempat kabur dengan sepeda motor setelah merampas handphone pelajar SD, namun petugas patroli mampu melemahkannya. MenurutYoris, modus pelaku menghampiri pelajar sewaktu pulang sekolah mengendarai sepeda. Pelaku meminjam handphone siswa dengan alasan untuk menghubungitemannya.Sewaktu handphone pindah tangan, pelaku melarikan diri. (m31)


Medan Metropolitan

B2 Kelulusan UN Sumut Tinggi MEDAN (Waspada): Kepala Dinas Pendidikan Sumatera Utara Bahrumsyah mengatakan, kualitas pelaksanaan Ujian Nasional (UN) tingkat SMA sederajat tahun 2010 lebih baik dari tahun lalu, sehingga masuk peringkat 10 besar tingkat kelulusan pelaksanaan UN di Indonesia. “Dari segi kuantitas kita memang kalah, tapi dari segi kualitas saya yakin tahun ini lebih halus, tertib dan lebih terjamin dibandingkan tahuntahun sebelumnya. Provinsi Sumatera Utara kemungkinan masuk 10 besar di Indonesia. Bahkan kita berada di atas Yogyakarta yang hanya memperoleh tingkat kelulusan sekitar 70 persen, sementara kita sekitar

94,77 persen,” katanya dalam keterangan persnya di Medan, Senin (26/4). Dia mengatakan, dari segi kuantitas, Provinsi Sumut mengalami penurunan tingkat kelulusan UN, namun dari segi kualitas mengalami peningkatan. Hal itu disebabkan pelaksanaan UN 2010 lebih mengedepankan kejujuran. “Kalau tahun lalu pelaksa-

naan ujiannya kurang tajam, kurang detail dan kurang serius pihak-pihak yang menyelenggarakan ujian khususnya para pengawasnya. Tapi sehubungan tahun ini lebih mengedepankan kejujuran, maka dari segi kuantitas kita menurun namun dari segi kualitas malah meningkat,” sebutnya. Bahrumsyah menjelaskan, tingkat kelulusan UN terendah di Sumut tahun 2010 berada di Kabupaten Nias. “Kalau tahun lalu Kabupaten Nias tingkat kelulusannya sama dengan kabupaten/kota yang ada di Sumut, tapi tahun ini mereka yang terendah tingkat kelulusannya. Hal ini disebabkan tahun ini pe-

laksanaannya lebih mengedepankan kejujuran dan kemungkinan kurangnya sarana dan prasarana mendukung di Kabupaten Nias dibandingkan daerah lain di Sumut,” ujarnya. Bahrumsyah memaparkan, pelaksanaan UN tahun 2009/ 2010 di Sumut tingkat SMA/MA diikuti sebanyak 123.985 orang, masing-masing dari SMA sebanyak 102.820 siswa dan dari MA sebanyak 21.165 siswa. “Tingkat SMA dan MA yang tidak lulus sebanyak 4.800 siswa atau 3,9 persen. Sementara SMK dari 63.860 siswa peserta Ujian, yang lulus ada sebanyak 58.816 siswa atau sekitar 92 persen,” sebutnya sembari menambahkan,

WASPADA Rabu 28 April 2010

bagi siswa yang tidak lulus diberikan kesempatan mengikuti ujian ulangan yang akan digelar 10-14 Mei 2010. Sistem PMB Pada kesempatan itu, Bahrumsyah mengemukakan sistem Penerimaan Siswa Baru (PMB) di masing-masing sekolah harus mengedepankan akuntabilitas, transparansi dan tidak diskriminasi. “Kkita mengimbau kabupaten/kota di Sumut agar mengedepankan ketiga sistem tersebut. Tampunglah para siswa dengan jujur dan adil serta muatan lokal berdasarkan kebutuhan dan kesanggupan daya tampung di sekolah masing,” katanya. (m41)

DPRDSU: Periksa Jawaban Siswa Tak Lulus MEDAN (Waspada): Sejumlah anggota DPRD Sumut mendesak panitia Ujian Nasional Sumut untuk mengakomodir permintaan pihak sekolah untuk memeriksa ulang secara manual lembar jawaban siswa yang dinyatakan tidak lulus. Sebab tidak tertutup kemungkinan terjadi kesalahan dalam pemeriksaan secara komputerisasi. “Jangan sampai pelaksanaan UN ini tercederai, dan siswa yang jadi korban,” kata Wakil Ketua Komisi E DPRD Sumut, Sopar Siburian didampingi anggota Komisi E lainnya, Robert Nainggolan, Khairul Fuad dan Nurhasanah kepada Waspada di gedung dewan, Selasa (27/4). Komentar tersebut disampaikan menyikapi banyaknya jumlah siswa yang tidak lulus UN di Sumut, bahkan berasal dari sejumlah sekolah favorit. Serta SMK Islamiyah di Labuhanbatu Selatan yang seluruh siswanya dinyatakan tidak lulus. Menurut Sopar, sangat wa-

jar jika pihak sekolah mencurigai adanya kesalahan teknis dalam pemeriksaan lembar jawaban siswa, karena memang proses pemeriksaan dilakukan secara komputerisasi. Sehingga, akan sangat merugikan siswa yang sebenarnya sudah mempersiapkan diri untuk menghadapi UN. “Sangat tidak fair kalau ternyata siswa yang mengikuti UN dinyatakan tidak lulus disebabkan kesalahan mesin pemeriksa, atau ternyata pensil yang mereka gunakan tidak memenuhi standar. Padahal si siswanya sendiri mampu menjawab dengan benar soal UN itu,” kata politisi Partai Demokrat itu. Karena itu, katanya, panitia UN harus membuka akses seluas-luasnya kepada sekolah yang ingin memeriksa ulang lembar jawaban siswa mereka yang tidak lulus UN. Sehingga bisa diketahui kalau ternyata ada kesalahan, dan dapat memenuhi rasa keadilan bagi para

Seluruh Siswa Amir Hamzah Lulus UN MEDAN (Waspada): Para siswa di SMA dan SMK swasta Perguruan Amir Hamzah Medan tampak bahagia saat pengumuman kelulusan Ujian Nasional (UN). Sebanyak 100 siswa SMA dan 33 orang siswa SMK yang ikut UN, keseluruhannya dinyatakan lulus. Kepala Sekolah SMA Amir Hamzah Musadad dan Kepala Sekolah SMK Amir Hamzah Azhar Umar, Selasa (27/4), mengatakan pihak sekolah merasa terharu dengan keseriusan dan ketabahan para siswa SMA dan SMK dalam menghadapi UN. Menurut Musadad, untuk tahun ajaran 2010-2011 siswa SMA Amir Hamzah yang dinyatakan lolos masuk USU lewat jalur Penelusuran Minat Prestasi (PMP) adalah Sri Syahputri, siswa jurusan IPA yang lolos ke Fakultas Psikologi lewat jalur PMP dan Dwi Susilawati, siswa jurusan IPS lolos ke Fakultas Hukum lewat jalur yang sama. Dalam menghadapi UN, lanjutnya, sekolahnya jauh-jauh hari telah mengantisipasinya. Meski UN tahun 2010 ini sama sulitnya dengan soal-soal UN tahun 2009, pihak sekolah tetap berpegang pada kisi-kisi soal yang ditetapkan Diknas. “Standar soal dibuat guru tidak lari dari kisi-kisi soal yang ditetapkan Diknas, sehingga siswa menghadapi UN tidak bingung,” katanya. (m29)

20 Tokoh Pers Di Pekan Nasional Cinta Sejarah MEDAN (Waspada): Direktorat Nilai Sejarah Pusat akan melangsungkan “Pekan Nasional Cinta Sejarah” di Museum Negeri Sumatera Utara Jalan HM. Joni No.51 Medan, mulai 19 Juli hingga 20 Agustus 2010. Tim dari Direktorat Sejarah Pusat terdiri dari Museum Provinsi Kalimantan, dari Museum Sumatera Barat, yang juga turut dihadiri Yayasan Museum Pers Sumatera Utara telah melakukan pertemuan, dipimpin Kepala Museum Negeri Sumut Sri Hartini. Wakil dari pusat dan daerah tersebut membahas mengenai materimateri yang akan ditampilkan dalam penyelenggaraan kegiatan itu. Ketua UmumYayasan Museum Pers Sumut Muhammad TWH dalam siaran persnya beberapa waktu lalu mengatakan, materimateri sejarah yang menarik akan dibawa ke Medan oleh Museum Nasional Jakarta, Arsip Nasional Jakarta, Museum Kebangkitan Nasional, Museum Sumpah Pemuda, Museum Perumusan Naskah Proklamasi, Museum Juang 45 Jakarta, Museum Wayang Jakarta dan lain-lain. “Sedangkan dari daerah yang akan ikut adalah Museum Perjuangan Rakyat Jambi, Museum Sumatera Barat, Balai Pelestarian Peninggalan Purbakala Sumatera Barat dan Provinsi Nanggroe Aceh Darussalam,” katanya. Dia menyebutkan, peserta dari Sumut, selain Museum Negeri Sumut sendiri sebagai tuan rumah adalah Museum Perjuangan Kodam Bukit Barisan, Pusat Studi Sejarah Unimed, Dewan Harian 45 Sumatera Utara dan Yayasan Museum Pers Sumatera Utara. “Yayasan ini akan menampilkan 20 tokoh pers tiga zaman dan 20 surat kabar Republikein yang terbit di daerah pendudukan Belanda yaitu Medan,” pungkas Muhammad TWH. (rel/m41)

Siswa SMK Farmasi APIPSU Adakan Perpisahan MEDAN (Waspada): Acara perpisahan siswa/i kelas III SMK Farmasi APIPSU Medan yang digelar di halaman kampus 2 Universitas Tjut Nyak Dhien (UTND)-APIPSU Jalan Binjai/Rasmi Medan, Sabtu (24/4), berlangsung meriah. Kepala SMK Farmasi APIPSU Desyanti, S.Farm.Apt mengatakan, acara sengaja dikemas layaknya sebuah pesta dengan menampilkan group band lokal dari anak-anak APIPSU juga diramaikan dengan tarian daerah etnis Melayu, Tapanuli, Aceh dan nasyid. Acara diawali pembacaan ayat suci Alquran oleh Fartahian, dilanjutkan sambutan Dewan guru Deliana, ST, ketua panpel M.Reza Pahlevi. Turut dihadiri ketua umumYayasan UNTD-APIPSU Cut Sartini, ketua I Yayasan Drs. Ilyas M. Ali, Rektor UTND Drs. M. Abdullah Jamil, Msi serta PR Awaluddin, Amiruddin, dekan, guru-guru. Serta ustadz Drs. H. Monang Rangkuty. Kata Desyanti, 109 siswa/i yang belum lama ini mengikuti Ujian Nasional (UN) berbaur menjadi satu dengan para guruguru semakin memperlihatkan suasana penuh kekeluargaan. Diharapkan, setelah para siswa/i keluar dari SMK Farmasi APIPSU Medan menjadi contoh bagi siswa/i lainnya serta dapat diterima diberbagai perusahaan maupun rumah-rumah sakit, klinik dan Dinkes. Selain itu nantinya mampu bekerja sebagai asisten apoteker handal yang profesional dan jujur. Menanggapi banyaknya pelajar wanita di SMK Farmasi APIPSU, Desyanti mengatakan, bidang kesehatan termasuk prioritas layanan publik memang pelayanannya didominasi oleh kaum perempuan. “Pemberdayaan kaum perempuan khususnya dari segi pelayanan di bidang kesehatan sangat dibutuhkan,” kata Desyanti.(m25)

siswa yang sudah dinyatakan tidak lulus. Dia juga menegaskan, pemeriksaan harus segera dilakukan sebelum pelaksanaan ujian ulangan pada 10 Mei mendatang. “Sehingga kalau ternyata nilainya ternyata mampu lulus UN, siswa bersangkutan tidak perlu lagi ikut ujian ulangan,” katanya. Desakan serupa juga disampaikan Ketua Komisi E dari Fraksi PDI Perjuangan DPRD Sumut, Brilian Moktar. “Pada prinsipnya kita hendak mencari kebenaran. Kalau sudah diperiksa secara manual, tentu akan diketahui dimana letak permasalahannya. Bisa saja memang karena memakai pensil yang salah, atau komputernya yang sedang bermasalah ketika memeriksa hasil ujian di daerah itu,” katanya. Sebabmenurutnya,tidaktertutup kemungkinan memang para siswa di daerah itu yang tidak mampu menjawab soalsoal yang diberikan, sehingga mereka harus mengikuti UN ulangan yang akan digelar 1014 Mei 2010.

Karena itu, Brilian Moktar juga meminta seluruh dinas pendidikan di Sumut untuk mengevaluasi kualitas pendidikan di daerahnya masing-masing. “Sebab persoalan kualitas pendidikan juga sudah diatur dalam beberapa peraturan pemerintah (PP),” katanya. Brilian juga menyatakan, Komisi E DPRD Sumut dalam waktu dekat akan memanggil panitia UN tingkat Sumut untuk mengetahui persoalan seputar pelaksanaan UN di daerahdaerah. Menanggapi adanya kecurigaan pihak sekolah di beberapa daerah tentang adanya kesalahan teknis dalam pemeriksaan lembar jawaban siswa, melalui proses pemeriksaan secara komputerisasi, Rektor Unimed, Prof. Dr. Syawal Gultom, M.Pd menyebutkan, proses pemindaian (scanning-red) naskah UN 2010 yang dilakukan di Unimed, hanya mengubah lembar jawaban menjadi file atau soft copy. “Jadi hanya lembar jawaban peserta UN yang dipindahkan sesuai aslinya dan kemudian di-

kirimkan ke Badan Standarisasi Nasional Pendidikan (BSNP) di Jakarta. Di BSNP tersebutlah kunci jawaban dicocokkan dengan soft copy yang dipindai untuk membaca skor. Lebih lanjut Syawal Gultom menyampaikan, akan tetap memfasilitasi pihak yang keberatan itu kepada BSNP. Sebab Unimed tidak pernah tahu sama sekali mengenai lembar jawaban tersebut, sebutnya. Hal yang sama juga disampaikan Ketua Panitia UN Sumut 2010, Anang Wibowo kepada wartawan. Dia menyebutkan, Disdik Sumut tidak memiliki kewenangan dan hak untuk mengubah hasil UN yang dikirim BSNP Jakarta. “Oleh karena itu hanya BSNP Jakarta yang bisa menjelaskan persoalan tersebut secara rinci,” ungkap Anang. Mengenai adanya surat pernyataan penolakan hasil UN dari salah satu sekolah di Labuhanbatu, Anang menyebutkan, sampai saat ini pihaknya belum ada menerima surat dari Labuhanbatu terkait persoalan itu. (h11/m41)

Siswa SMA YPSA Lulus 100 Persen MEDAN (Waspada): Siswa SMA YP Shafiyyatul Amaliyyah lulus 100 persen pada ujian nasional (UN) TA 2009/2010. Nilai tertinggi per bidang studi B. Indonesia (8.20), B. Inggris (9.60), Matematika (9.75), Fisika (10.00), Kimia (10.00), Biologi (9.5) dan rata-rata nilai tertinggi 54.85 diraih M. Aga Firza Diandra. Demikian Pembina YPSA Drs H Sofyan Raz, Ak. MM, Selasa (27/4). “Kami bangga atas prestasi siswa/i SMA yang merupakan alumni ke-4 dalam mengikuti UN TA 2009/2010 yang lalu. Untuk siswa yang lulus harus bisa membuktikan prestasinya di berbagai universitas dalam dan luar negeri dan dapat memberikan ciri khusus bahwa kalian adalah lulusan terbaik YPSA yang berdisiplin, religius dan smart,” katanya. Sofyan juga mengatakan,

ada beberapa siswa yang diterima ke perguruan tinggi negeri melalui jalur Panduan Minat dan Prestasi (PMP) dan jalur ujian masuk bersama, diantaranya 2 orang ITB, tiga IPB, tiga USU. Siswa-siswa yang masuk ke perguruan tinggi tersebut benar-benar berprestasi. Sementara Kepala SMA YPSA Drs. Daulat Siregar, MPd, MSi mengatakan, siswa yang mendapat nilai tertinggi yakni bidang studi B. Indonesia 8.20 atas nama Husnah Fadhillah Hsb. B. Inggris 9.60 atas nama M. Rifqi Nuzul Satria. Matematika 9.75 atas nama Ade Putri Radina, Beby Amalia, Husnah Fadhillah Hsb, Irina Amalia Anwar, M. Arie Wibisono. R, Maskur Ramadhan, Mentari Novria Kesumawardani, Sheila Ayu, Yudha Prawira, M. Aga Firza Diandra, Rizki Ananda.

Fisika 10.00 atas nama Ade Putri Radina, DestyVera Annisa, Husnah Fadhillah Hsb, Eryzal Kurniawan, Nurtsaniah Harahap. Kimia 10.00 atas nama M. Aga Firza Diandra, Tri Adimas Ardian. Biologi 9.50 atas nama M. Aga Firza Diandra dan jumlah rata-rata nilai tertinggi 54.85 atas nama M. Aga Firza Diandra. Hasil UN tahun ini juga lebih baik dari tahun sebelumnya. Untuk itu sudah seharusnyalah kita semua bersyukur terutama siswa/i dan menunjukkan rasa syukur itu dengan terus berusaha agar berprestasi dan dapat masuk ke universitas negeri dalam maupun luar negeri. “Pada tahun lalu 86 persen siswa masuk PTN favorit, 7 persen ke universitas luar negeri dan hanya 7 persen yang kuliah di PTS,” demikian Daulat. (m43)

Penguasaan MYOB Accounting Tenaga Didik Masih Minim MEDAN (Waspada): Tenaga didik tingkat SMA/SMK di Kota Medan khususnya dan Sumut pada umumnya, masih minim dalam penguasaan program akuntansi secara komputerisasi atau biasa disebut MYOB Accounting. “Boleh dikatakan program ini belum berjalan dan diajarkan sepenuhnya di sekolah-sekolah khususnya SMK, dikarenakan masih terbatasnya tenaga pengajar yang menguasai MYOB Accounting,” ujar Direktur Lembaga Diklat Profesi (LDP) Indonesia Tetty Juliati, SE.MSi, Sabtu (24/4). Dikatakannya, berdasarkan hal tersebut LDP Indonesia menggelar pelatihan MYOB Accounting bagi guru SMA dan SMK Kota Medan di Kampus Harapan Medan, Jl. Imam Bonjol pada 19-24 April. “Kita harapkan pelatihan ini dapat meningkatkan pengetahuan para tenaga didik untuk selanjutnya diajarkan kepada para siswa,”

katanya. Menurut Tetty, pelatihan yang digelar khusus untuk MYOB Accounting versi 18, dengan mendatangkan langsung MYOB Certifid Consultant Indonesia, Ali Mahmudi. “Pelatihan ini disambut antusiasme peserta yang tidak hanya guru, tetapi juga beberapa dosen,” katanya. Dikatakannya, pelatihan juga sangat berguna dalam menyahuti program Kementerian Pendidikan Nasional yang mewajibkan para siswa SMK mengikuti Uji Kompetensi Kejuruan bidang Akuntansi secara komputerisasi atau MYOB Accounting. Ali Mahmudi selaku Certifid Consultant Indonesia mengatakan, software MYOB sudah bersetifikasi internasional yang diciptakan di Australia dan telah digunakan jutaan perusahaan di dunia termasuk 4.000-an perusahaan Indonesia yang lebih memfokuskan perusa-

haan menengah ke bawah. “Kenapa fokusnya ke perusahaan menengah ke bawah, tidak lain karena perusahaan menengah ke bawah biasanya memiliki laporan keuangan yang kacau dan terkesan amburadul. Di sini MYOB memfasilitasi laporan keuangan yang simple, mudah tetapi biayanya cukup murah. Untuk satu software cukup hanya membayar Rp5 jutaan,” katanya. Sementara itu, Ketua STIE Prof DR H Azhar Maksum, M.Ec. Ak menyambut baik kegiatan yang digagas LDP Indonesia itu. “Ini satu ide kegiatan yang sangat positif, dimana harus kita akui masih minimnya tenaga didik yang menguasai proses laporan keuangan secara kom[puterisasi. Kita harapkan para tenaga didik yang telah mengikuti pelatihan dapat menularkan ilmunya kepada para siswanya di sekolah masingmasing,” katanya. (m41)

Waspada/Sugiarto

Para peserta pelatihan MYOB Accounting diabadikan bersama Ketua STIE Harapan, MYOB Certifid Consultant (tengah) dan Direktur LDP Indonesia (kiri), Sabtu (24/4).

Waspada/Ist

PENGHARGAAN: Gubsu Syamsul Arifin mengucapkan selamat kepada Bupati Deliserdang Amri Tambunan penerima penghargaan bersama sembilan kabupaten/kota lainnya, Senin (26/4).

Daerah Pemekaran Dievaluasi MEDAN (Waspada): Gubsu Syamsul Arifin mengigatkan jangan ada lagi istilah ‘raja-raja kecil’ di daerah, karena saat ini Pemprovsu sedang melakukan evaluasi terhadap pelaksanaan otonomi daerah bagi daerah pemekaran. Untuk itu perlu koordinasi karena Pemprovsu tidak lagi sebagai tukang legislasi, tukang stempel dan tukang teken. Gubsu mengatakan hal itu, Senin (26/4), di halaman Kantor Gubernur seusai menyampaikan penghargaan kepada 10 kabupaten/kota yang menerima penghargaan atas prestasinya dalam penyelenggaraan

pemerintahan daerah berdasarkan hasil evaluasi kinerja penyelenggaraan pemerintahan daerah Tahun Anggaran 2008. “Jangan ada lagi istilah ‘rajaraja kecil’, tak ada itu. Saat ini sedang dilakukan evaluasi. Mudah-mudahan tidak ada pergeseran lagi. Maka untuk itu, perlu koordinasi,” ujarnya. Gubsu menegaskan, bupati/walikota yang akan berakhir masa jabatannya melakukan ekspos atas kinerjanya selama lima tahun. Penghargaan ini diserahkan Gubsu atas nama Pemprovsu yang bertindak sebagai pem-

bina upacara yang dihadiri unsur Muspida, Sekdaprovsu RE Nainggolan, bupati/walikota dan instansi terkait. Sedang komandan upacara dipegang Kabiro Otda Bukit Tambunan. Tambunan dalam kesempatan itu menyampaikan daftar skor dan prestasi Evaluasi Kinerja Pemerintah Daerah kabupaten/kota se Provsu, yakni Sergai (3,469), Tebing Tinggi (3,024), Samosir (3,014), Deliserdang (2,955), Tapteng ( 2,942), Tapsel (2,933), Simalungun (2,925), Taput (2,923), Humbahas (2,903), Langkat (2,822) masing-masing prestasi tinggi. (m19)

Hastag Bahas Bangunan Tahan Gempa MEDAN (Waspada): Konferensi dan workshop internasional Pengurus Himpunan Ahli Struktur Tahan Angin dan Gempa (HASTAG) bekerjasama dengan International Rubber Research & Development Board (IRRDB) digelar di Medan. Konferensi internasional tentang penggunaan seismic bearings (bantalan karet tahan gempa) untuk bangunan akan digelar 29 April 2010 di Hotel Grand Aston Medan. Pada esoknya, 30 April 2010 dilakukan workshop dengan tema “Earthquke Resistance Structures using Seismic Rubber Bearings”. Demikian Ketua Umum Hastag Indonesia Ir Semangat Surbakti didampingi Ketua II Ir Daniel Rumbi Teruna, MT, Ketua V Ir Antony Tantono, Sekretaris Limantoba, MBA, Sekretaris I Ir Besman Surbakti, Bendahara Ir Sunarlim Satio, dalam siaran pers dikirim ke Waspada, Sabtu (24/4). Turut juga hadir pendiri Hastag Indonesia Ir Fuad Halimoen, MM dan Ir Martono Anggusti, SH, MM, MHum di kantor Hastag Indonesia, di Jalan Gaharu Medan. Ada beberapa orang pembicara antara lain, Prof JM Kelly dari University of California at Berkeley, Prof Toshio NISHIWPI-

AIMR Tohoku University Japan, Dr A Muhr TARRC England, Prof FL Zhou dari Guanghou University China, Dr Nobuo Murota dari Bridgestone Yokohama Jepang, Kimoto SAI Structural Engineering Japan. Sedangkan dari Indonesia ada Prof Bambang Budiono dan Prof Mansyur Irsyam dari ITB serta dari Hastag Indonesia Ir Nurjulisman dan Ir Daniel Renubi Teruna, MT. Peserta konferensi sekitar 100 orang. Mereka datang dari berbagai negara seperti Amerika Serikat, Korea,Taiwan, Malaysia, Thailand dan Indonesia sendiri. “Konferensi internasional mengenai masalah ini, baru pertama kali di Asia. “Kita yakin akan mendapat sambutan luas,” sebut Semangat Surbakti. Hastag menargetkan Sumatera khususnya dan Indonesia umumnya bisa lebih mengenal dengan sistem seismic bearings. Soalnya, Sumatera merupakan kawasan yang sering di landa gempa. Teknologi seismic bearings, sebut Ketua II Hastag Ir Daniel Rumbi Teruna, MT, sudah lama dikenal terutama di Jepang, Amerika Serikat dan China. Di Jepang, sistem ini terkenal pasca gempa di Kobe. Karena, saat gempa itu, sebagian bangunan

hancur kecuali dua bangunan yang memakai seismic bearings. “Sejak saat itu, tiap tahun paling tidak ada 200 bangunan di Jepang memakai sistem seismic bearings,” ujarnya. Di Indonesia sendiri, lanjutnya, struktur bangunan yang menggunakan seismic bearings masih sangat sedikit. “Di Medan hanya Grand Aston. Sedangkan di Aceh Universitas Unsyiah Kuala,” jelasnya. Menjawab pertanyaan, apakah dengan memakai sistem seismic bearings pada struktur bangunan akan memakan biaya besar, menurut petinggi Hastag Indonesia ini, jika dirataratakan 5-15 persen tambahan dari total biaya bangunan. Sangat tergantung dengan banyaknya bearings rubber yang digunakan dalam bangunan. “Tapi, di beberapa negara lebih menilai murah dengan sistem ini. Karena mereka melihat dari sisi dampak kalau terjadi gempa,” ungkapnya. Selama ini untuk memperkuat bangunan dari dampak gempadenganmenambahstruktur konstruksi bangunan termasuk memperbesar struktur yang ada, bisa menambah biaya 30 persen dari total biaya bangunan. “Jadi, lebih murah denganseismic bearings,” ujarnya. (m32)

Presiden Dan Wapres Hanya Bisa Diperiksa MK MEDAN (Waspada): Secara hukum ketatanegaraan, Presiden maupun Wakil Presiden tidak bisa diperiksa oleh kepolisian maupun Komisi Pemberantasan Korupsi (KPK), melainkan hanya bisa diperiksa oleh Mahkamah Konstitusi. Hal tersebut dikatakan Sekretaris Anggota Dewan Pertimbangan Presiden (Watimpres), Dr. Taufiqurrohman Syahuri, SH,MH ketika memberikan kuliah umum “Mahkamah Konstitusi dan Perkembangan Hukum Tata Negara” di hadapan para mahasiswa Magister Hukum Bisnis (MHB) dan Magister Administrasi Publik (MAP) Universitas Medan Area (UMA), di Kampus II UMA Jalan Sei Serayu Medan, Sabtu (24/4). “Terkait rekomendasi DPR RI tentang kasus Bank Century, secara hukum ketatanegaraan Wapres Boediono tidak bisa diperiksa oleh polisi dan KPK. Wapres hanya bisa diperiksa oleh MK. Namun untuk Sri Mulyani yang statusnya sebagai Menteri Keuangan, kepolisian dan KPK bisa memeriksanya,” kata Taufiqurrohman Syahuri. Didampingi moderator Ketua Prodi MHB UMA, Dr. Mirza Nasution, SH,MH, lebih lanjut

Taufiqurrohman menyatakan, keputusan DPR RI yang merekomendasikan kasus Bank Century ditindak lanjuti, harus dipatuhi karena memiliki kekuatan hukum. Tapi jika pemerintah merasa keputusan itu dianggap merugikan, pemerintah bisa membawanya ke pengadilan. Namun dia menegaskan rekomendasi DPR RI untuk menindak lanjuti kasus Bank Century bukan putusan hukum (vonis) pengadilan. Mantan Staf Ahli MK RI 2003 - 2006 ini menjelaskan, keputusan kemudian menjadi peraturan atau undang-undang yang dikeluarkan DPR, proses pembuatannya pasti ada bersifat politik karena pengambil keputusan merupakan anggota dari partai politik. Jika sudah diputuskan DPR, menjadi undang-undang akan mengikat untuk dipatuhi semua lembaga dan masyarakat Indonesia. Bentuk Putusan Dia juga menjelaskan ada tiga bentuk keputusan negara yang berkekuatan hukum, yakni keputusan negara yang bersifat mengatur (regelling) seperti undang-undang, keputusan negara bersifat penetapan administrasi (beschicking) seperti

keputusan KPU tentang rekapitulasi suara dan putusan hakim yang disebut vonis. Taufiqurrohman yang mengambil gelar doktor hukum tata negara Universitas Indonesia 2003, dalam makalah tertulisnya mengatakan Indonesia merupakan negara ke-78 yang memiliki lembaga MK. MK merupakan pengadilan tingkat pertama dan terakhir yang putusannya bersifat final. Negara Amerika Serikat adalah negara pertama kali memperkenalkan fungsi pengadilan konstitusionalitas dengan kasus yang terkenal waktu itu, “Marbury versus Madison” tahun 1803. Sementara itu, Wakil Direktur Bidang Akademik Pascasarjana UMA, Ir Erwin Pane MS didampingi Kabag TU, Isnaini, SH,MHum yang turut hadir dalam kuliah tersebut mengatakan, kuliah umum terkait perkembangan hukum ketatanegaraan di Indonesia, bisa membawa pencerahan kepada mahasiswa pascasarjana UMA, sehingga mereka bisa melihat dan kemudian dengan kemampuannya bisa menalar dan menganalisis setiap perkembangan dan produk hukum yang setiap saat terjadi. (m41)


Medan Metropolitan

WASPADA Rabu 28 April 2010

KPAID Merasa Dianaktirikan Pemprovsu

Mobil Calon Wakil Walikota Diserempet MEDAN (Waspada): Mobil Avanza yang ditumpangi Calon Wakil Walikota Medan Nelly Armayanti diserempet sebuah mobil Toyota Kijang Krista BK 1980 HR berwarna biru dongker, saat berhenti di lampu merah perempatan Jalan Imam Bonjol, Senin (26/4) siang. Nelly mengatakan, peristiwa itu terjadi ketika dia hendak menuju Hotel Danau Toba setelah mengikuti sidang paripurna dengan agenda acara penyampaian visi misi calon walikotawakil walikota di gedung DPRD Medan. Ketika mobilnya berhenti tepat di depan Bank Mandiri, sekonyong-konyong melesat mobil Toyota Kijang Krista yang terlihat di dalamnya tiga orang pria tidak dikenal menyerempet pintu mobil Nelly bagian kiri. Kontan, sopir dan pengawalnya (Polwan Poltabes) melakukan pengejaran. Namun sia-sia karena pelaku keburu tancap gas. “Kasus ini sudah saya laporkan ke Satlantas Poltabes dan saya berharap polisi dapat mengungkap siapa pelakunya,” katanya kepada wartawan di Kantor Satlantas seusai melaporkan kejadian tersebut. Nelly mengaku belum dapat memastikan apakah peristiwa yang dialaminya bernuansa politis. Nelly maju sebagai wakil walikota berpasangan dengan Sofyan Tan yang diusung PDIP dan PDS. Akibat kejadian itu, pintu mobil mantan ketua KPU Medan itu tergores. (m39)

Ratusan Botol Miras Disita MEDAN (Waspada): Mengantipasi terjadinya kejahatan jalanan selama masa kampanye pemilihan calon walikota dan wakil walikota Medan, Polsekta Medan Barat menggelar Operasi Penyakit (Pekat) Toba II tahun 2010. Dalam operasi itu disita 14 kardus berisikan ratusan botol minuman keras (miras) berbagai merk dari beberapa tempat dikawasan Kecamatan Medan Barat. Kapolsekta Medan Barat, AKP Robertus Pandiangan, SIK melalui Kanit Reskrim Iptu Hasian Panggabean, Senin (26/ 4) menjelaskan, Operasi Pekat Toba II Tahun 2010 ini merupakan instruksi Kapoltabes Medan, Kombes Pol Drs. Imam Margono. “Ini instruksi Kapoltabes Medan untuk lebih waspada dan meningkatkan keamanan terlebih mengantisipasi terjadinya kejahatan jalanan selama masa kampanye,” ungkap Hasian. Operasi Pekat yang sudah berlangsung selama satu minggu berhasil menyita ratusan botol miras dari empat toko di kawasan Pulo Brayan dan Glugur Kota. Selain mengamankan ratusan botol miras, lanjut Hasian, pihaknya juga mengamankan tiga tersangka pemakai sabu dari tiga lokasi. “Selain miras kita juga mengamankan tiga pelaku pemakai sabu-sabu dari Jalan Sekata, Petempuran dan Kampung Banten. Dari tiga tersangka disita 3 jie SS seharga Rp1 juta per jie,” beber Hasian.(cat)

Pembobol Rumah Dipukuli Warga MEDAN (Waspada): Seorang pelaku pembobol rumah babak belur dihajar warga ketika akan melakukan aksinya di Jalan Jermal III, Kec. Medan Denai, Selasa (27/4) siang. Tersangka Rizal Batubara, 29, warga Jalan Mandala By Pass, kemudian diselamatkan anggota Jahtanras Poltabes Medan yang datang ke lokasi dari amuk massa. Informasi di Poltabes Medan, peristiwa terjadi sekira pukul 12:00. Semula warga curiga dengan gerak-gerik tersangka yang mondar-mandir di daerah mereka. Karena sebelumnya sudah ada tiga rumah di kawasan Jalan Jermal III kehilangan harta bendanya. Namun, saat hendak beraksi, sejumlah warga yang curiga menangkap tersangka dan menghajarnya sebelum diboyong ke Poltabes Medan. “Tersangka sudah kita amankan, menurut pengakuannya lebih dari sekali melakukan pencurian di daerah Jermal dengan mengambil alat-alat elektronik,” terang Kanit Jahtanras Poltabes Medan AKP Faidir Chan. Selain itu, pihaknya juga telah menyita barang bukti berupa satu tas berisi uang tunai Rp4 juta, satu jam seharga Rp50 juta dan kartu askes.“Barang buktinya sudah disita,” tandasnya. Akibat perbuatannya itu, tersangka dijerat pasal 363 KUHPidana dengan ancaman hukuman tujuh tahun penjara. (m39)

Unimed-Labuhanbatu Teken Perjanjian Kerjasama MEDAN (Waspada): Universitas Negeri Medan (Unimed) dan Pemerintahan Kabupaten Labuhanbatu melakukan penandatanganan perjanjian kerjasama dalam peningkatan kualitas pendidikan di Kabupaten Labuhanbatu, di Biro Rektor Unimed Jl. Willem Iskandar Medan, Selasa (27/4). Penandatanganan kerjasama dilakukan oleh Bupati Labuhanbatu H. Tengku Milwan dan Rektor Unimed, Prof. Dr. Syawal Gultom, M.Pd disaksikan Kepala Dinas Pendidikan Labuhanbatu H. Heryanto, SE, MM, Pembantu Rektor I Unimed, Prof. Selamat Triono. Acara tersebut turut dihadiri para pembantu rektor, para dekan dan rombongan dari Pemkab Labuhanbatu. Prof. Syawal Gultom menyebutkan, perjanjian tersebut meliputi beberapa hal yaitu, peningkatan kualitas supervisi pelaksanaan pembelajaran, peningkatan kualitas perencanaan pengajaran, peningkatan kemampuan penyelenggaraan proses belajar-mengajar, peningkatan kualitas karya tulis ilmiah, peningkatan kualitas pembimbingan karya tulis ilmiah berbasis teknologi informasi dan komunikasi, serta peningkatan kualitas tenaga laboratorium sekolah. Dalam perjanjian tersebut dijelaskan, untuk meningkatkan peran supervisi yang dilakukan kepala sekolah dan pengawas sekolah, memberikan bekal kepada guru agar dapat membuat perencanaan pengajaran yang berkualitas, meningkatkan kemampuan profesionalisme guru dalam proses belajar mengajar, meningkatkan profesionalisme guru dalam Penelitian Tindakan Kelas, memberikan kemampuan guru agar mampu membuat karya tulis ilmiah dan lainnya. Bupati Labuhanbatu HT Milwan menyebutkan, kerjasama ini meliputi pembinaan bagi guru, pengawas sekolah dan kepala sekolah baik di tingkat sekolah dasar, sekolah menengah pertama dan sekolah menengah atas. Sedangkan bentuk program yang dilaksanakan melalui need assesment (analisis kebutuhan) pendidikan dan latihan, pendampingan, layanan (klinis) dan lokakarya/seminar. “Dengan adanya kerjasama ini, kita berharap agar kualitas pendidikan di Labuhanbatu menjadi lebih baik. Apalagi, di Sumatera Utara ini, kita tahu bahwa Unimed merupakan salah satu perguruan tinggi yang memiliki kemampuan dalam peningkatan kualitas pendidikan,” tutur HT Milwan. Usai melakukan penandatanganan perjanjian kerjasama tersebut, kedua belah pihak yakni Rektor Unimed dan Bupati Labuhanbatu saling memberikan cinderamata. (m41)

Waspada/Sugiarto

Rektor Unimed, Prof. Dr. Syawal Gultom, M.Pd menandatangani perjanjian kerjasama antara UnimedPemkab Labuhanbatu yang disaksikan Bupati Labuhanbatu, HT Milwan (dua kanan), Kadisdik Labuhanbatu, H. Heryanto (kanan) dan PR I Unimed, Prof. Selamat Triono (kiri).

B3

Waspada/David Swayana

RUANG PASIEN MISKIN TERGENANG: Hujan lebat yang mengguyur Kota Medan dan sekitarnya pada Selasa (27/4) siang, menyebabkan sejumlah ruas jalan dan pemukiman penduduk tergenang air. Di RSU Dr Pirngadi, ruang rawat inap pasien miskin ikut tergenang akibat air pada saluran limbah meluap. Genangan air limbah tersebut menggenangi salah satu ruang rawat inap pasien miskin hingga selasar yang ada di depannya.

Pengangkatan Direktur RSPM

Pejabat Eselon III Sengaja Tidak Diusulkan MEDAN (Waspada): Proses pengangkatan dr. Dewi Fauziah menjadi Direktur RSU Dr. Pirngadi terindikasi telah direkayasa sejumlah oknum pejabat di Badan Pertimbangan Jabatan dan Kepangkatan (Baperjakat) Pemko Medan. Sebab, tiga nama calon Direktur RSU Dr Pirngadi yang diusulkan ke Baperjakat Pemprov Sumut tersebut tidak ada yang berasal dari pejabat struktural eselon III. Bahkan, dua calon yang diusulkan tersebut memiliki pangkat lebih rendah dari dr. Dewi. Sumber Waspada di Badan Kepegawaian Daerah (BKD) Pemko Medan, Selasa (27/4), mengatakan, tiga calon Direktur RSU Dr. Pirngadi yang diusulkan tersebut yakni dr. Zulhelmi Bustami (golongan IV-B), dr. Dewi Fauziah (golongan IV-C) dan dr. Feraluna Nasution (golongan IV-B). Ketiga calon direktur tersebut berstatus sebagai Pegawai Negeri Sipil (PNS) non eselon di lingkungan RSU Dr. Pirngadi. Bahkan, dr. Zulhelmi dan dr. Feraluna sengaja diusulkan karena memiliki pangkat atau golongan lebih rendah dari dr. Dewi. Dengan demikian, dr. Dewi akan terlihat lebih unggul dibanding dua calon yang men-

dampinginya tersebut. Kalau Baperjakat Pemko Medan mengusulkan pejabat struktural eselon III seperti dr. Amran Lubis, SpJP (Wakil Direktur Bidang Pelayanan Medis dengan pangkat golongan IVC) atau dr. Risma SN Sinaga (Kepala Bidang Pelayanan Medis dengan pangkat golongan IV-B), tentu dr. Dewi akan kalah bersaing dalam penilaian riwayat jabatan dan penjenjangan karir. “Jadi DPRD Kota Medan bisa mempertanyakan kepada Baperjakat Pemko Medan mengapa tidak ada satu pun calon Direktur RSU Dr. Pirngadi yang diusulkan tersebut berasal dari pejabat struktural eselon III. Ini benar-benar suatu kejanggalan yang paling menyolok dan tidak bisa ditutupi lagi,” ujar sumber. Mengenai adanya oknum pejabat yang berdalih jabatan tersebut terkait dengan kepercayaan pimpinan, sumber membantahnya. “Mengangkat se-

orang pejabat itu tidak bisa hanya bermodalkan kepercayaan pimpinan, tetapi harus dilihat dari kemampuan manajerialnya. Kalau hanya bermodalkan kepercayaan pimpinan, maka akan terbuka peluang terjadinya Korupsi, Kolusi dan Nepotisme (KKN),” tambahnya. Sementara itu, Kepala BKD Pemko Medan Lahum yang dikonfirmasi Waspada di ruang kerjanya, enggan memberikan komentar seputar kasus pengangkatan Direktur RSU Dr. Pirngadi. “Coba konfirmasi ke Sekda, karena beliau adalah atasan saya,” ujarnya. Plt. Sekda Kota Medan HM Fitriyus yang ditemui Waspada di ruang kerjanya juga enggan memberikan tanggapan seputar pengangkatan dan evaluasi Direktur RSU Dr. Pirngadi. Sebelumnya, Sekretaris Baperjakat Pemprov Sumut Drs. H. Suherman, MSP mengungkapkan bahwa pihak Baperjakat Pemko Medan mengusulkan tiga nama calon Direktur RSU Dr Pirngadi yakni dr. Zulhelmi Bustami (golongan IV-B) , dr. Dewi Fauziah (golongan IV-C) dan dr. Feraluna Nasution (golongan IV-B). Ikut Bertanggungjawab Di tempat terpisah, anggota

Komisi A DPRDSU, Marahalim Harahap menegaskan, Baperjakat Pemprov Sumut ikut bertanggungjawab dalam kasus dugaan rekayasa pengangkatan Direktur RSU Dr. Pirngadi tersebut. “Karena sesuai Permendagri No.5/2005, pengangkatan Direktur RSU Dr. Pirngadi terse-but berdasarkan hasil rekomendasi dan penilaian dari Baperjakat Pemprov Sumut,” kata anggota Fraksi Demokrat DPRD Sumut itu. Seharusnya, kata Marahalim, secara moral Baperjakat Pemprov Sumut bisa mengingatkan Baperjakat Pemko Medan karena dari tiga nama yang diusulkan tersebut, tidak ada satu pun yang berasal dari pejabat struktural eselon III. Karena itu, indikasi adanya rekayasa sudah bisa diketahui. Apalagi, menurutnya, dalam proses pengusulan tiga nama calon oleh Baperjakat Pemko Medan, terkesan memang direkayasa untuk memenangkan salah seorang calon. Sebab, dua nama calon lainnya ternyata sama-sama tidak memenuhi kriteria untuk menjabat sebagai Direktur RSU Dr. Pirngadi dan memiliki golongan yang lebih rendah dari dr. Dewi. (h10/m26/h11)

FKUB Gelar Doa Bersama Agar Sumut Kondusif MEDAN (Waspada): Forum Kerukunan Umat Beragama (FKUB) Sumatera Utara, Senin (26/4) malam menggelar doa bersama di Medan Club Jalan Kartini Medan. Doa bersama itu secara umum, kata Ketua FKUB Sumut Dr H Maratua Simanjuntak, agar Sumatera Utara tetap aman dan kondusif pasca Pilkada dan sesudahnya. “Secara khusus doa bersama ini agar pemimpin Sumut tetap tegar dalam menjalankan pemerintahan di Sumatera Utara meski sedang menghadapi masalah hukum. Biarlah hukum berjalan terus namun kita berharap pemerintahan juga berjalan sebagaimana mestinya,” ujar Maratua. Kemudian secara khusus pula doa bersama ini ditujukan agar pelaksanaan pemilihan kepala daerah (pilkada) di 23 kabupaten/kota di Sumatera Utara berjalan dengan tertib

dan aman. “Pilihan boleh beda, kerukunan harus tetap terpelihara,” ujarnya. Kepada calon yang tidak terpilih Maratua berharap agar dapat menerima kekalahan itu dengan ikhlas dan kemudian melakukan introspeksi diri. Sedangkan kepada yang terpilih diharapkan dapat mengemban amanah yang diberikan kepadanya serta menempati janjijanji serta visi dan misi yang telah disampaikan. Doa dibawakan masingmasing pimpinan majelis agama yang diikuti oleh umat/ jemaatnya. Untuk Islam doa dibawakan Prof Dr H Hasan Bakti, MA, Katolik dibawakan Drs Huberstus Lumbanbatu, Buddha dibawakan Bhiku Vanya Sani, Hindu Dibawakan Pandita Chanda Boose, Kristen dibawakan Pdt Paul Wakkary dan Khong Hu Cu dibawakan James.

MABMI Sebelumnya pada Minggu (24/5) malam ratusan umat Islam Sumut bersama pengurus Pengurus Besar Majelis Adat Budaya Melayu Indonesia (PBMABMI), melaksanakan ratif adat zikir dan doa di Masjid Raya Al Mashun. Kegiatan yang digelar setelah melaksanakan shalat maghrib berjamaah, tiada henti-hentinya melafazkan permohonan ampunan kepada Allah (istigfarred), zikir, salawat dan doa kepada Allah dipandu KH Amiruddin MS, KH Zulfikar Hajar Lc, Drs H Sakhira Zandi dan ulama Sumut lainnya. Ketua Harian PB MABMI didampingi Prof Wan Syaifuddin dan Zulfikar Hajar menyampaikan, kegiatan ini dilaksanakan secara spontan dari masyarakat Melayu yang meminta kepada MABMI untuk segera menggelar ratif, zikir dan doa.

Disebutkan, sebagaimana diketahui bahwa, ratif adat zikir dan doa merupakan budaya Melayu yang bersendikan syara’ dan syara’ yang bersendikan Kitabullah. Karena itu, budaya ini perlu terus dihidupkan dan dilaksanakan manakala kita menghadapi berbagai problem, terutama dalam berbangsa dan bernegara dan untuk memberi kekuatan bagi kelangsungan pemerintahan, utamanya di Sumatera Utara ini. Sementara cendikiawan muslim Sumut, Prof Dr Hasballah Thaib MA yang dihubungi terpisah menyampaikan harapannya agar umat selalu sabar dan tidak mengikuti hawa nafsunya atas kejadian ini. Ratif diakhiri dengan pembacaan doa dan munazat kepada Allah dengan penuh keikhlasan kemudian ditutup dengan salat isya berjamaah. (m36)

Kasus Pelepasan Tanah

DPRDSU: Periksa PTPN II Dan BPN MEDAN (Waspada): Komisi A DPRD Sumut meminta instansi berwenang agar memeriksa PT Perkebunan Nusantara (PTPN) II dan Badan Pertanahan Nasional Sumut dan Deliserdang, terkait perlakuan tidak adil dalam pelepasan tanah yang sudah ditempati bertahun-tahun oleh karyawan pensiunan saat mengabdi di perusahaan milik BUMN itu. Pernyataan itu disampaikan pimpinan sidang Syamsul Hilal dalam rapat dengar pendapat antara Komisi A DPRD Sumut dengan Forum Keluarga Karyawan Pensiunan (FKKP) PTPN II, Pemerintah Provinsi Sumut, BPN Sumut dan Deliserdang serta PTPN II beberapa hari lalu di Gedung DPRD Sumut. Di depan para anggota dewan, delegasi FKKP yang dike-

tuai Tua Ginting mengaku mendapatkan perlakuan tidak adil dari pihak manajemen PTPN II dan malah diintimidasi dan teror oleh pihak tertentu sejak 2005. Selain itu, delegasi juga mengeluhkan patokan harga tanah yang dilepas kepada pihak ketiga jauh di bawah harga pasar yang semestinya mengutamakan pelepasan kepada para karyawan. Sementara menurut Syamsul Hilal, pengaduan masyarakat Dagang Kerawang diyakini bisa mengungkap adanya indikasi kuat tentang keterlibatan PTPN II melakukan penjualan tanah kepada pihak ketiga melalui praktek mafia tanah. Pihak Dewan sendiri berjanji untuk menjadikan kasus tanah tersebut sebagai prioritas Pokja tanah yang dijadwalkan

bersidang minggu pertama Mei mendatang. Sekretaris Komisi A Nurul Azhar Lubis menuding pihak direksi PTPN II tidak mempunyai hati nurani karena lahan seluas 8 hektar dituntut karyawan tetap tidak dipenuhi, malah dialihkan kepada pihak Yayasan Nurul Amalia. Pada rapat dengar pendapat yang juga dihadiri anggota dewan Hasbullah Hadi, Marasal Hutasoit, Sonny Firdaus, Mahalim Harahap, Nur Azizah Tambunan, Oloan Simbolon, Sudirman Halawa dan Tahan Panggabean, Lubis mengingatkan, sudah terlalu lama PTPN II menjadi benalu, karyawan ditindas, PBB menunggak, kasus tanah tidak kunjung selesai, malah semua hasil PTPN II tidak diperuntukkan bagi daerah.

Masalah SK BPN No.42/ HGU/BPN/2002, Marahalim Harahap meminta perlu diteliti ulang karena disinyalir sarat muatan kolisi dan korupsi. Sementara kuasa hukum PTPN II Posman Nababan (mewakili direksi) yang hendak memberikan penjelasan diminta Hasbullah Hadi agar tidak buka suara, terutama menyangkut penjelasan tuntutan karyawan terhadap lahan yang sudah ditempati bertahun-tahun. Hasbullah meminta pada rapat lanjutan menghadirkan langsung pihak direksi untuk bisa menjawab semua permasalahan tanpa harus diwakili. Dalam rapat itu, Pemprov diwakili Darwin Hutahuruk, BPN Sumut yang dihadiri langsung Maniasi S dari Kasi Sengketa. (m23)

MEDAN (Waspada): Komisi Perlindungan Anak Daerah (KPAID) Sumatera Utara mengaku kesulitan menjalankan berbagai program kerja, akibat belum turunnya anggaran Rp400 juta yang ditampung dalam APBD 2010 untuk lembaga itu. “Sudah tiga minggu berkas permohonan pencairan dana KPAID berada di meja Gubsu, tapi belum juga diteken,” kata Ketua KPAID Zahrin Piliang di Medan, Selasa (27/4). Menurut Zahrin, masalah keterlambatan dana menjadi hambatan serius untuk pihaknya melakukan berbagai program menyangkut perlindungan anak. Meski selama lima bulan terakhir ini, pihaknya sudah mengupayakan dana dari kantong pribadi, namun hal ini tidak bisa berlangsung lama. “Awalnya bisa kami talangi bersama-sama, tapi sudah lima bulan berjalan, mana mungkin lagi. Sementara program kerja terus bertambah. Sampai sekarang gaji dan biaya operasional kantor juga belum jelas,” ujarnya. Lambannya pengucuran dana operasional ini, katanya, membuat KPAID merasa dianaktirikan oleh Pemprovsu. Padahal pihaknya selalu menangani berbagai kasus anak di Sumatera Utara. Saat ini, ujar Zahrin, sedikitnya ada 48 kasus mereka menangani termasuk kasus pernikahan anak di bawah umur yang dikawinkan paksa oleh orang tuanya. Kasus lainnya seperti penanganan kuasa asuh terhadap anak warga negara asing. “Banyak sekali program kerja yang akan kami laksanakan dan pelayanan untuk anak-anak di Sumatera Utara, khususnya Kota Medan yang seolah tidak memberikan ruang perhatian kepada anak,” ujarnya. Dia menambahkan, lihat saja para calon walikota sepertinya tidak memberikan pemikiran yang konkret tentang nasib anak ke depan. Apabila dalam dua pekan ini Gubsu belum juga mencairkan anggaran KPAID, maka pelayanan terhadap perlindungan anak terancam berhenti. (m36)

Penggabungan Jaringan Atasi Keluhan Air Minum MEDAN (Waspada): Penggabungan jaringan yang dilakukan PDAM Tirtanadi pada kawasan tertentu di kota Medan, telah berhasil mengatasi keluhan masyarakat terhadap seringnya gangguan total distribusi air minum sejak pagi sampai sore, namun beberapa minggu terakhir sudah lancar. Masyarakat mengaturkan terima kasih kepada PDAM Tirtanadi atas lancarnya aliran air minum terutama di kawasan Jl. STM Gang Rahmad, Kec. Medan Maimun. “Kami merasa lega dengan lancarnya air minum mengalir ke rumah kami sejak beberapa hari belakangan, padahal sebelumnya sering tidak mendapatkan kebagian sejak pagi sampai sore menjelang malam,” kata Siregar yang merasa senang karena tidak lagi terjadi gangguan air, Jumat (23/4). Menanggapi ucapan terima kasih warga itu, Kuadi dari kantor cabang PDAM Tirtanadi Medan Amplas, menyambut gembira dan mengaku pihaknya telah melaksanakan berbagai upaya dalam mengatasi gangguan air kepada pelanggan. “Saya tidak sangka ada kalangan masyarakat yang menyatakan terima kasih karena selama ini sering didengar hanya keluhan melulu,” kata Kuadi terharu dengan program mengatasi kebocoran air yang dilakukan pada malam hari nyatanya membawa berkah. Kuadi yang didampingi Kabag Umum Yusuf Hamdani dan Kabag Jaringan pada PDAM Tirtanadi Medan Amplas Chairil dari mengaku, program mencari kebocoran pada malam hari sangat berkaitan dengan cara mengatasi gangguan air untuk masyarakat pelanggan. Menurut Kualdi, gangguan yang diatasi di Jl. STM Gang Rahmad itu merupakan salah satu manfaat dari program mencari kebocoran di tengah malam. “Program itu juga dikombinakan dengan penggabungan jaringan, seperti yang di Gang Rahmad, yang tadinya hanya bertumpu pada jaringan dua sumber namun ditingkatkan menjadi tiga sumber,” ujarnya. Dengan penggabungan jaringan sumber air, kata Kualdi, tim petugas PDAM Tirtanadi yang bekerja di lapangan pada malam hari, sudah bisa menemukan secara jelas titik-titik kebocoran pada pipa-pipa yang terpasang di bawah tanah. “Banyak air yang terbuang mubazir selama ini akibat tidak diketahui secara pasti kebocoran air PDAM itu, sehingga dampaknya pelanggan tidak kebagian air pada jam-jam tertentu,” tuturnya. Sebenarnya bukan hanya gangguan air di Gang Rahmad saja yang berhasil teratasi, tetapi juga gangguan di gang lainnya kawasan yang sama. Begitupun dia berjanji akan terus meningkatkan kinerja dalamupayamengatasigangguanairminummelaluiprogrammencari kebocoran malam hari dan cara lain yang berdayaguna. (m23)

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight

Pukul

Tiba Dari

Flight

Pukul

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-146

06.25 09.05 10.55 12.25 13.45 15.45 17.10 18.10 19.10 14.45

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-148 GA-188 GA-190 GA-192 GA-196 GA-147

06.10 08.00 09:30 10.50 11.50 12.50 14.10 16.15 19.35 18.10

AIR ASIA 1 Kuala Lumpur AK- 937 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 457 4 Kuala Lumpur AK-939 5 Penang QZ-8074 6 Jakarta QZ-7497 7 Jakarta QZ-7503 8 Jakarta QZ-7505 9 Phuket (3,5,7) FD-3991

08.50 09.40 18.00 20.10 16.05 12.20 13.30 18.40 17.45

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Jakarta Jakarta Jakarta Phuket (3,5,7)

AK-936 QZ-8055 AK-456 AK-938 QZ-8075 QZ-7496 QZ-7502 QZ-7504 FD-3990

08.25 11.55 17.40 19.40 18.05 19.15 13.05 15.40 17.15

MANDALA AIRLINES 1 Padang RI 089

17.20

Padang

RI-088

15.45

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Batam/S.baya 13 Banda Aceh 14 Penang 15 Penang

06.30 09.00 10.00 11.00 12.00 13.45 15.35 17.05 18.35 21.15 22.25 12.55 19.35 09.10 12.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Batam/S.baya Banda Aceh Penang Penang

JT-380 JT-398 JT-394 JT-302 JT-398 JT-382 JT-384 JT-396 JT-306 JT-386 JT-308 JT-971 JT-397 JT- 8289 JT-8287

08.20 09.20 10.20 11.20 10.45 13.05 14.55 16.25 19.35 21.35 23.20 12.20 08.20 11.35 15.00

MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.25

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 14.45

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

08.30 20.45

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

07.50 20.00

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Batam

7P-592 7P-598 7P-594 7P-596 7P-568

10.10 12.50 15.50 19.10 13.00

Jakarta Jakarta Jakarta Jakarta Batam

7P-591 7P-597 7P-593 7P-595 7P-567

09.35 12.15 15.15 18.25 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-017 SJ-035 SJ-041 SJ-010 SJ-102 SJ-021

10.20 15.30 19.10 15.05 15.20 11.30 07.20 16.00

Jakarta Jakarta Jakarta Jakarta Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-014 SJ-034 SJ-140 SJ-140 SJ-103 SJ-020

11.50 18.35 20.15 14.30 15.25 14.20 09.35 14.45

JT- 381 JT- 397 JT- 301 JT- 395 JT- 303 JT- 399 JT- 383 JT- 385 JT- 387 JT- 305 JT-309 JT-972 JT-396 JT-8288 JT-8286


Opini

B4

WASPADA Rabu 28 April 2010

Meninjau Tugas Kepala Daerah Oleh Dr Drs H.Ramli, MM Untuk maju dan punya nilai strategis,kota Medan perlu lebih dari sekedar kepala daerah yang menjalankan tugas secara normatif

TAJUK RENCANA

KPK Turun Tangan

K

omisi Pemberantasan Korupsi (KPK) akhirnya turun tangan dalam kasus Bank Century pasca sidang paripurna DPR yang menyimpulkan Boediono dan Sri Mulyani bersalah dalam mengambil putusan ‘’bailout’’ dana talangan ke Bank Century Rp6,7 triliun. Meskipun DPR sudah mengambil putusan politik namun masih jauh untuk bisa melengserkan Boediono sebagai Wapres karena memiliki mekanisme panjang. Beda dengan Sri Mulyani sebagai menteri nasibnya tergantung Presiden SBY. Kapan saja ia bisa diganti karena SBY memiliki hak prerogatif dalam mengangkat dan memberhentikan menterinya. Yang pasti, tidak terjadi kejutan dalam rapat Panitia Khusus (Pansus) Hak Angket Bank Century di DPR. Bahkan, Pansus bisa disebut ‘’gagal’’ menjalankan tugasnya yang ditunggu-tunggu masyarakat karena hasil yang dicapai hanya berupa imbauan belaka. Pansus Angket hanya mengimbau agar mereka yang terlibat berdasarkan LHP investigatif BPK atas kasus Century disarankan nonaktif untuk mempermudah pemeriksaan. Kalau secara politik jalan masih terjal, bagaimana dengan jalur hukumnya? Hal yang disebut terakhir kini menarik perhatian masyarakat. Walau kemarin misalnya, Rapat Paripurna DPR menyetujui pembentukan tim pengawas penyelesaian secara hukum kasus Bank Century, ternyata KPK sudah sepekan melayangkan surat ke Boediono dan Sri Mulyani. Hemat kita, sangat tepat jika KPK segera turun tangan terkait kasus Bank Century agar permasalahan hukumnya segera ditindaklanjuti dan siapa pun bersalah menerima hukuman setimpal. Di mata KPK tidak ada pilih kasih. Jika KPK melayangkan panggilan kepada Boediono dan Sri Mulyani maka hal itu harus disikapi secara positif. Siapa pun boleh dipanggil KPK, namun pemanggilan itu harus dilihat dari duduk permasalahannya, sehingga belum tentu mereka bersalah dan menjadi tersangka nantinya. Yang menarik mencermati tanggapan juru bicara Kepresidenan Julian Aldrin Pasha Intisari di Istana Merdeka, Jakart. Ia menyatakan Presiden Susilo BambangYudhoyono sudah pemanggilan terhadap BoedioDPR bentuk tim pe- mengetahui no dan Sri Mulyani oleh KPK. Kalau hingga ngawas, KPK panggil kini belum ada komentar dari kepala negara Presiden SBY bisa menerima pemeBoediono – Sri Mulyani. berarti riksaan KPK itu. Artinya, jika masih dalam karidor hukum Presiden mempersilakan KPK turun tangan, namun begitu jangan sampai turun tangannya KPK membuat kinerja Wapres dan Menkeu menjadi terganggu. Boediono sendiri akan dimintai keterangan oleh KPK sebagai mantan Gubernur Bank Indonesia (BI), sedangkan Sri Mulyani selaku mantan Ketua Stabilitas Sistem Keuangan (KSSK). Di mata Pansus DPR, BI dan KSSK patut diduga melakukan kesalahan dalam kasus pemberian dana “bail out” (dana talangan) ke Bank Century yang merugikan negara sebesar Rp6,7 triliun. Banyak oknum pejabat terlibat di dalamnya, terutama disebut-sebut Sri Mulyani dan Gubernur Bank Indonesia Boediono (saat itu) yang mengetahui persis kondisi Bank Century sudah gawat. Di mata keduanya jika tidak ditalangi bakal menimbulkan kepanikan dalam dunia perbankan. Untuk mencegah terjadinya ‘’sistemik’’ seperti krismon tahun 1997 itulah digelontorkan dana luar biasa besar, tidak sebanding dengan aset Bank Century. Anehnya, penyaluran dananya tidak proporsional, tetapi jatuh ke tangan orang-orang yang sebenarnya tidak berhak sehingga menyulut kemarahan banyak pihak. Jusuf Kalla (saat menjabat Wapres) dengan tegas mengatakan kasus Bank Century identik dengan ‘’perampokan’’. Sejumlah nama tokoh partai pun terkait, termasuk aliran dana ilegal itu katanya membantu dana kampanye SBY saat Pilpres lalu, namun hal yang disebut terakhir ini sudah dibantah tegas oleh Presiden SBY sebagai berita fitnah dan akhirnya memang tidak terbukti. Memang banyak hal yang patut diduga dan dicurigai terlibat dalam kasus Bank Century karena tidak memberikan data dan informasi lengkap kepada Menteri Keuangan sebelum memutuskan Bank Century sebagai bank gagal berdampak sistemik. Sedangkan KSSK, patut diduga melakukan kesalahan karena menetapkan Bank Century sebagai bank gagal yang berdampak sistemik hanya berdasarkan penilaian sepihak. Atas dasar itu pula KSSK melakukan “bail out” ke Bank Century tanpa memiliki dasar yang valid dan masuk akal, karena Perppu No 4 tahun 2008 tentang Jaring Pengaman Sistem Keuangan (JPSK) yang menjadi dasar hukumnya sudah ditolak DPR, pada 18 November 2008. Namun, dana talangan ke Bank Century masih tetap dicairkan hingga Rp6,7 triliun, meskipun landasan hukumnya sudah tidak berlaku lagi. Kita harapkan KPK benar-benar serius menuntaskan masalah hukum kasus Bank Century, tidak pilih kasih dalam menetakan tersangka sehingga kasus serupa tidak terulang lagi di masa mendatang. Sakit hati rakyat melihat uang negara dimanfaatkan oleh para penguasa dan penjahat ekonomi.+

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN � Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817. � Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385 � Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109 � Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan hitam-putih Rp. 33.000,Halaman depan berwarna Rp. 90.000,Ukuran kolom: 40,5 mm E-mail Iklan: iklan@waspadamedan.com

S

ecara normatif tugas seorang kepala daerah yang terpilih melaluiprosesPilkadatercantum di dalam undang-undang. Pemerintah daerah, dibawah komando kepala daerah bersama DPRD mengatur (regelling) urusan pemerintahan daerah yang menjadi kewenangannya. Pemerintah daerah mengurus (bestuur) urusan pemerintahan daerah yang menjadi kewenangannya, wajib menyebarluaskan Perda yang telah diundangkan dalam Lembaran Daerah dan Peraturan Kepala Daerah yang telah diundangkan dalam Berita Daerah. Pemerintah daerah dapat melakukan pinjaman yang bersumber dari pemerintah, pemerintah daerah lain, lembaga keuangan bank, lembaga keuangan bukan bank, dan masyarakat untuk membiayai penyelenggaraan pemerintahan daerah. Pemerintah daerah dapat melakukan pinjaman yang berasal dari penerusan pinjaman hutang luar negeri dari Menteri Keuangan atas nama Pemerintah setelah memperoleh pertimbangan Menteri Dalam Negeri. Perjanjian penerusan pinjaman tersebut dilakukan antara Menteri Keuangan dan Kepala Daerah. Pemerintah daerah dengan persetujuan DPRD dapat menerbitkan obligasi daerah untuk membiayai investasi yang menghasilkan penerimaan daerah. Pemerintah daerah dalam meningkatkan perekonomian daerah dapat memberikan insentifdan/ataukemudahankepadamasyarakat dan/atau investor yang diatur dalam Perda dengan berpedoman pada peraturan perundang-undangan. Pemerintah daerah dapat melakukan penyertaan modal pada suatu Badan UsahaMilikPemerintahdan/ataumilikswasta. Penyertaan modal tersebut dapat ditambah, dikurangi, dijual kepada pihak lain, dan/atau dapat dialihkan kepada badan usaha milik daerah. Pemerintah daerah dapat memiliki BUMD yang pembentukan, penggabungan, pelepasan kepemilikan, dan/atau pembubarannya

ditetapkan dengan Perda yang berpedoman pada peraturan perundangundangan. Pemerintahdaerahdapatmembentuk dana cadangan guna membiayai kebutuhan tertentu yang dananya tidak dapat disediakan dalam satu tahun anggaran. Pengaturan tentang dana cadangandaerahditetapkan dengan Peraturan Pemerintah. Selanjutnya pemerintah daerah wajib melaporkanposisisurplus/defisit APBD kepada Menteri Dalam Negeri dan MenteriKeuangansetiapsemester dalam tahun anggaran berjalan. Pemerintah daerah juga mengajukan rancangan Perda tentang perubahan APBD, disertai penjelasan dan dokumen-dokumen pendukungnya kepada DPRD, dapat membentuk badan pengelola pembangunan di kawasan perdesaan yang direncanakan dan dibangun menjadi kawasan perkotaan. Pada intinya, uraian tugas pemerintah daerah yang dibawahi kepala daerah terpilih adalah kewenangannya untuk mengelola pemerintahan di tingkat daerah. Oleh karena tugas mengelola daerah itu adalah pekerjaan yang tidak gampang, maka seorang kepala daerah mesti dilengkapi dengan kewenangan yang luas. Apa yang kita aplikasian dalam sistim pemerintahan daerah ini, lebih kurang sesuai konsep pembagian kekuasaan (distribution of power atau division of power). Di mana kekuasaan negara

dibagikan secara vertikal. Pada bagian lain kekuasaan juga dipisahkan secara horizontal (teori pemisahan kekuasaan/separation of power) yang dikemukakan Montesquieu. Pembangunan Medan Dalam konteks pembangunan kota Medan yang akan dilanjutkan oleh kepala daerah terpilih hasil Pilkada 12 Mei mendatang, tentunya tugas tersebut juga melekat. Kita berharap besar kepada orang yang terpilih nanti untuk melanjutkan berbagai agenda pembangunan yang tertunda. Kita mendengar berbagai visi dan misi menjelang masakampanyeinitelah dengan “nyaring” diperdengarkan melalui berbagai kesempatan. Berbagai persoalan krusial masyarakat kota Medan sepertinya sudah terangkum semua dalam visi misi 10 pasangan calon yang menjadi kandidat. Tetapisetidaknya kita bisa membagi rencana pembangunan itu kepada beberapa bagian, paling tidak ada dua hal mendasar, yaitu pembangunan dasar dan pembangunan tingkat lanjutan. Apa yang saya maksud dengan pembangunan dasar adalah persoalan-persoalan dasar yang terjadi di kota Medan. Seperti misalnya masalah pengurusan suratsurat seperti KTP, Kartu Keluarga dan lain-lain. Atau persoalan banjir, sampah dan lain sebagainya. Halmendasariniadalahhalyangharus sudah tuntas oleh siapapun yang menjadi walikota dan wakil walikota nantinya. Saya mengibaratkan kalau kota Medan ini adalah rumah besar bagi warga kota Medan. Maka kalau hujan turun, tentunya rumah tersebut sudah harus steril dari rembesan airapalagidaribanjir.Anak-anakyangmau belajar, tulis menulis bahkan bermainmain sudah harus tersedia surat-surat secara gampang dan halaman untuk bermain.

Seorang walikota sebagai kepala rumah tangga adalah orang yang harus bisa menuntaskan persoalan mendasar seperti ini. Tidak perlu waktu berlamalama untuk ”berkutat” pada persoalan seperti ini. Selanjutnya pembangunan tingkat lanjutan adalah pembangunan yang bervisi kuat ke depan. Seorang walikota dan pasangannya harus sudah punya konsep yang jelas dan terukur atas wujud kota Medan ke depan. Harus sangat kuat tergambar bagaimana bentuknya dan bagaimana cara mencapainya. Dalam bidang pendidikan misalnya, perguruan tinggi di Medan harus sudah setara dengan perguruan tinggi tingkat internasional. Dalam bidang kesehatan, 10tahunkedepan,Medanharusbisamenjadi alternatif utama tempat berobat masyarakat masyarakat internasional, minimal masyarakat regional. Dan banyak ragam contoh lainnya. Inilah yang disebut prestasipembangunandanuntukmencapai prestasi ini maka hal-hal mendasar harus sudah tuntas tanpa masalah. Penutup Merujuk pada tugas seorang kepala daerahdalamstratalanjutanmakatidaklah mudah.Kedudukansebagaiseorangkepala daerah adalah sebuah tanggung jawab besar dan bukan sekedar pemegang kekuasaan. Tugasnya menjadi tidak sederhana dan tidak lagi merupakan hal yang normatif karena memerlukan berbagai inovasi, kreasi juga ketegasan dalam mengambil setiap kebijakan strategis. Seorangkepaladaerahyangmenjalankan tugasnya secara normatif tentu bukan sebuah pelanggaran hukum. Tidak ada hukum yang bisa menjerat seorang kepala daerah yang hanya menjalankan tugas secara normatif. Tapi untuk kelanjutan pembangunan yang bermanfaat bagi seluruh warga kota Medan, maka diperlukan lebih daerah sekedar pemerintahan yang menjalankan tugasnya secara normatif. Karena hanya dengan itu kota Medan yang merupakan ibukota provinsi yang punya nilai strategis bisa menjawab tantangan jaman dan bisa melesat maju ke depan mengejar ketertinggalannya dengan ibukota provinsi lain dalam lingkup regional. PenulisadalahWakilWalikotaMedanNonAktif

Anak Itu Bertanya Tentang Sebuah Negeri Oleh Dr. Ir. Satia Negara Lubis, MEc Kekisruhan yang terjadi sesungguhnya adalah cermin dari lahirnya kebenaran di negeri ini

A

nak laki-laki itu begitu berang menyaksikan berita di televisi. Ketika banyak penegak hukum ”dikuliti” penegak hukum lain atas dosa mereka karena korupsi, kejahatan pencucian uang, manipulasi dan penindas rakyat. Dia jadi teringat bagaimana ibunya meninggal karena tidak mampu dirawat dengan baik oleh rumah sakit hanya karena bermodalkan Jamkes alias jaminan kesehatan. Dia jadi berang karena jika saja pejabat-pejabat itu tidak korup maka ibunya pasti dapat disembuhkan dan hak ibunya untuk hidup sehat ternyata telah dirampas oleh penjahat yang dilihat di TV. Selesai berita satu muncul berita mengerikan lainnya. Anak laki-laki itu bertambah berang melihat wajah beberapa kepala daerah yang lesu dan loyo, tidak gagah seperti waktu kampanye hanya karena mereka harus menjadi tersangka kasus korupsi. Dia bertambah berang karena kemarin ibunya walau dalam keadaan sakit masih sempot mencoblos untuk memilih kepada daerah yang dianggapnya baik. Tetapi kini jeblos ke dalam tahanan. Sakin berangnya, anak laki-laki itu mematikan televisinya. Dan diapun beralih membaca harian koran. Tetapi, baru saja dia membaca sedikit halaman koran dia keningnya berkerut. Rupanya dia membaca berita bagaimana serang-menyerang dan bela membela antar mereka yang tertuduh sebagai penjahat di negeri ini. Polisi memeriksa jaksa, jaksa diperiksa jaksa agung, jaksa menuntut polisi dan penjahat menjerat KPK yang sedang menangkapi para koruptor. Ke-marin dia juga mendengar DPR menyerang menteri dan wakil presiden, menteri menyerang pengempalng pajak, pekerja pajak mengantongi uang haram para pengempelang, dan anggota DPR pun diserang juru bicara presiden. Sakin muaknya koranpun dia tutup. Sambil meletakkan kedua tangannya pada dagu, anak laki-laki itu berpikir tentang keheranannya… Entah karena apa, presiden menunjuk Satgas untuk menyikapi semua kasus itu..? Entah karena apa Satgas seperti menjadi pahlawan tunggal untuk memeriksa para penegak hukum, dan para penegak hukumpun menggunakanpengacarauntukmembeladiridengan bermacam-macampasaldanalatpraduga

tidak bersalah. Entah kenapa, akhirnya hukum menyerang hukum, sementara lapar menyerang rakyat. Hemh... Anak laki-laki itu menghampiri ayahnya yang baru saja selesai Sholat Maghrib. Dilihatnya wajah ayahnya lembut, berseri, sepertitanpabebanwalaupunibunyabaru saja pergi. Padahal ayahnya juga melihat semua berita aktual itu diTV dan ayahnya jugaseringmembacakoransepertidirinya. Dan mulailah dialog ini terjadi. Anak laki-laki itu mulai bertanya pada ayahnya “Ayah, tidakkah ayah mendengar dan melihat bagaimanakah kekisruhan di negeri kita? Bagaimana mungkin para penegak hukum, seperti polisi, jaksa dan hakim yang semestinya menjadi timbangan buat rakyat dalam menegakkan kebenaran kini seperti sedang dilanda badai yang sangat kuat? Kemanakah lagi rakyat akan mengadukan nasibnya?” Ayah anak itu memandang anak lakilakinya yang masih SMU. Sambil tersenyum sang ayah berkata “Wahai anakku, negera kita seperti sedang dalam kekisruhanyangsangatmengkhawatirkan… Tetapi kekisruhan yang kamu lihat itu sesungguhnyaadalahcermindarilahirnya kebenaran di negeri ini.Timbangan yang kau lihat kadang miring ke kiri miring ke kanan dan bergerak dengan cepat sesungguhnya adalah cermin bahwa arah kebenaran sedang bertahan dari serangan kesalahan. Ketika timbangan itu oleng ke kiri artinya kaum penjahat sedang berlomba-lomba menutupi semua borok-boroknya. Dan ketika timbangan itu oleng ke kanan artinya penegak hukum yang baiksedangmenumpukkebenarandiatas lantai timbangan kanan….Dan jika tidak lagi ada tempat mengadu maka sebaikbaik peraduan mengadu hanya pada Allah yang Maha Benar dan Adil.” Anak laki-laki itu memahami pandangan sang ayah, tetapi masih ada satu pertanyaanyangsangkutdilidahnyauntuk diucapkannya, “Ayah…tidakkah mereka yang dipercaya untuk mengemban amanah rakyat itu mengerti bahwa mereka hidup untuk memberikan yang terbaik buatrakyatsepertiapayangpernahmereka janjikan dahulu dan mereka katakan pada saat mereka di sumpah..?” Ayah itu itu menutup matanya pelan…. Ditariknya nafas dalam-dalam, sambil melihat mata anaknya yang masih lugu itu diapun berkata ”Sebuah negeri

yang bertuan dicari tuannya hanya karena begitubanyaknyarakyatyangmerasatidak dapat berlaku adil antar mereka tanpa arahan dari sang tuan. Sebuah negeri membangun sistim pemerintahan agar tiap-tiap sub sistim itu dapat bekerjasesuai fungsinya. Sebuah sistim pemerintahan yang dibuat oleh sang tuan menunjuk orang lain untuk menjalankan sistim dengan penuh amanah, integritas dan loyalitas tiada tepi agar rakyat yang menuntut keadilan dapat dilayani sesuai hak-hak mereka. Jika di antara mereka lalu menjadi pembohong dan penipu maka tiada tempat yang layak lagi bagi mereka untuk hidup di negeri yang bertuan ini. Dan jika ini semua terbiarkan maka jadilah sebuah negeri tanpa tuan….. Dan yang demikian itu bukanlah contoh yang baik. Sifat amanah, integritas dan loyalitas itu lahir dari ruh yang bersih dan dia terus saja meminta ampun pada Allah karena sesungguhnya tiap tarikan nafas kita cenderung untuk berbuat kesalahan….Jika semua itu tidak lagi kamu lihat, maka cukuplah bagimu berdo’a agar Allah memberi petunjuk. Anak laki-laki itu mengerutkan keningnya tanda kurang sependapat, dia pun menggejar dengan pertanyaan ; ”Wahai ayah bukankah semua polah tingkah mereka dalam menjalankan roda pemerintahan ada pengawasnya..? Mengapa pengawasan itu seperti tidak mampu bertindak dan parang tajam yang diberikan padanya seperti tumpul ?” Ayah anak laki-laki itu tersentak, lalu dibukanya matanya sembari tersenyum dia berkata : Wahai anakkku, pendapatmu layak mendapat pujian. Adalah benar tiap-tiap yang kotor harus dibersihkan dan tiap-tiap yang bersih haruslah dirawat dari kekotoran. Tetapi tidaklah mudah membersihkan kotoran yang menumpuk, dan tidaklah mudah mengenali sosok bayangan. Kotoran yang menumpuk tidaklah dapat dibersihkan hanya dengan beberapa orang sementara mencari mereka yang ingin membersihkan kotoran tidaklah mudah. Hari ini dibersihkan besok kotoran sudah bertambah. Tidaklah mudah mengenali bayangan karena bayangan sering berubah bentuk sesuai keinginan. Tidakkah kamu lihat baggaimana Satgas memerangi markus ? bukankah itu bentuk pengawasan yang paling dipercaya saat ini, tetapi mereka tetap saja harus waspada karena mereka juga bernafas seperti kita dan selalu saja ada manusia yang tidak setuju agar mereka bernafas dengan bersih. Anakku, pengawasan yang paling hakiki ada dalam diri mereka sendiri dan karena tiap manusia memiliki hati dan hati itulah yang akan mereka

bersihkan setiap mereka selesai bernafas. Anak laki-laki itu memandangi wajah ayahnya yang sudah menua. Dia bangga memiliki ayahnya karena dia lahir dari sebuah kejujuran yang amat sangat. Dia rela kemiskinan yang menyelimuti mereka sekarang adalah hasil yang diperoleh secara jujur oleh ayahnya yang hanya pensiunan golongan II D. Namun, anak laki-laki itu masih ingin terus bertanya, diapun bertanya lagi : … ayah, masihkah ada orang baik di negeri ini ? Sang ayah terkaget mendengar pertanyaan yang juga sering menjadi pertanyaan dalam dirinya. Sebagai seorang ayah maka tidak pantas baginya mematahkan semangat anaknya, diapun menjawab, ”Anakku.., masih begitu banyaknya orang baik di negeri ini. Banyak di antara kita yang masih mengerti (Bersambung ke hal C7)

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Sekjen Dephub: Bandara Kwalanamu harus selesai Juni 2011 - Harus belum tentu selesai * Calon Walikota Medan tandatangani Pilkada damai - Karena semua calon teman * Polemik Direktur RSPM perburuk citra pemerintah - Salah siapa, dosa siapa?

oel

D Wak

WASPADA

Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Plt. Redaktur Opini: Dedi Sahputra. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba, H. Halim Hasan, Diurna Wantana (Sumatera Utara), T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Handaya Wirayuga, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

� Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �


Opini

WASPADA Rabu 28 April 2010

B5

Wartawan: Dilahirkan Atau Diciptakan? Buat Calon Walikota Medan

Jangan Lagi KTP, KK Dll Bikin Rakyat Susah Buat para calon walikota Medan yang salah satunya bakal menjadi walikota. Saya cuma titip pesan yang sangat mendasar. Agar jangan pengurusan KTP atau kartu keluarga (KK) terus-menerus memberatkan rakyat. Sudah harus ada sistim yang efektif dan efisien dan benar-benar gratis. Sudah harus tidak ada lagi waktu berminggu-minggu bahkan berbulan-bulan hanya untuk mengurus selembar kertas. Sudah harus tidak ada tatapan mata ataupun permintaan “menodong” dari aparat keluarahan kepada rakyat yang datang mengurus berbagai keperluannya. Ini adalah hal yang sangat mendasar. Kalau Anda yang terpilih nanti tidak berhasil mengatasi hal ini dengan baik maka langkah yang paling baik adalah mengudurkan diri. Kalau masih ada aparat desa atau aparat kecamatan yang “memeras” rakyat dalam mengerjakan tugas yang menjadi kewajibannya, sebaiknya walikotanya yang mundur dari jabatannya secara jantan. Karena dalam logika sederhana kita bisa fahami, kalau hal sepele seperti ini saja tidak bisa diatasi apalagi mengatasi masalah yang lebih besar seperti membangun kota sebesar Medan ini. Gak bakalan mungkin. Paling lama setahun dalam masa pemerintahan walikota yang baru (ini juga sebenarnya sudah kelamaan), persoalan pengurusan surat-surat di kelurahan sudah harus tuntas dan tidak ada lagi masalah. Rakyat harus dilayani secara sungguh-sungguh dan mendapat pelayanan yang seharusnya; mendapat senyuman, tidak harus menunggu lama dan tidak harus membayar sama sekali. Itu saja dulu pesan dari saya. Walaupun sebenarnya masih banyak halhal normatif yang seharusnya jadi perhatian seorang walikota untuk diselesaikan semisal masalah banjir, penggunaan trotoar yang semrawut, izin trayek yang bejubal hingga kelihatan lebih banyak Angkot dari penumpangnya. Belum lagi mengatur mental para sopir Angkot yang seenaknya di jalan raya. Jadi para calon walikota gak perlu banyak-banyak visi misi yang ujungujungnya tak jelas juga. Buktikan saja Anda bisa melakukan pemenuhan kebutuhan mendasar warga kota Medan, itu saja sudah hebat. Kalau hal-hal mendasar sudah bisa dipenuhi, setidaknya itu juga prestasi yang justru sering dilupakan. Walaupun untuk menjadi Walikota Medan sebetulnya tidak bisa disederhanakan hanya untuk mengurus hal-hal yang sepele seperti itu. Nama dan alamat ada pada redaksi

Konflik UISU Kok Belum Selesai Universitas Islam Sumatera Utara kini telah berusia 58 Tahun didirikan pada tanggal 7 Januari 1952. Universitas tertua di Sumatera dan di luar pulau Jawa ini merupakan universitas kebanggaan umat Islam. Kalau pada 1960 silam orang diserahkan jabatan sebagai pimpinan Yayasan Pimpinan Fakultas, jelas banyak yang menolak dan tidak bersedia menduduki jabatan tersebut. Sebab mahasiswanya sangat sedikit fasilitas belajar mengajar tidak memadai dan yang utama gaji tidak mencukupi ditambah lagi pembayaran kurang lancar. Yang mau beramal untuk UISU pandangan yang luas dan iman yang kokoh seperti Alm M.Natsir, Alm M.Roem, Alm Syarifuddin Prawira Negara, Alm H.Bahrum Jamil, Alm H.Adnan Benawi dll. Mereka dapat dikatakan syuhada yang berjuang untuk kepentingan Islam tanpa mengharapkan balas jasa, sesuai dengan firman Allah yang artinya : apa yang dikorbankan pada jalanNya maka Allah akan membalasnya berlipat ganda sesungguhnya sebaik-baik pemberi rezekinya. Ibarat Bunga Mekar . . . Kalau dulu orang tidak bersedia punya jabatan di UISU, sekarang orang berebut agar duduk sebagai pimpinan dengan berbagai cara karena di UISU ada duit dengan jumlah mahasiswa 14 ribu orang. Fasilitas belajar mengajar sudah lengkap gaji tukang sapu dua kali gaji UMR Sumatera Utara. Ibarat Bunga Mekar tentu banyak kumbang yang ingin. Sekiranya dibuat ketentuan setiap pengurus Yayasan, Rektorat, Dosen, dan Karyawan tidak boleh makan gaji/ honor sebaiknya harus menyumbang (walau Rp5 satu hari) niscaya UISU akan sunyi konflik karena tidak ada orang di sana. Semua kabur….. Sebab terjadinya konflik yang buat malu Umat Islam mungkin masih ada yang lupa dengan Hadist Nabi yang mengatakan : Inamal Mukminuna Ikhwah Almukminu Kalmukminu Lilbulyanu Assadhuhu Bakdhuhu Bakdan. Yang artinya : orang Mukmin dan Mukmin itu bersaudara sebagai sebuah batu atas tembok antara satu batu dengan batu lainnya saling kuat mengkuatkan. Tak kunjung Kalau kita perhatikan konflik-konflik yang terjadi di beberapa PTS atau Perguruan Tinggi Swasta di Sumatera Utara maupun di Pulau Jawa seperti Universitas HKBP Nomensen di Medan, Universitas Satya Wacana di Salatiga, Universitas Tri Sakti di Jakarta, di mana konflik-konflik tersebut dapat diselesaikan dengan baik tidak sampai ke pengadilan, terjadi pertumpahan darah atau saling membuka aib di antara satu dengan yang lainnya baik melalui media cetak maupun elektronik. Timbul pertanyaan mengapa sampai saat ini konflik UISU hampir 3 Tahun belum selesai. Penulis yang sejak mahasiswa sudah menjadi pegawai di UISU tepatnya 38 Tahun lalu melihat terjadinya konflik karena nama UISU sudah cukup terkenal. Alumninya sudah tersebar di berbagai negara dan banyak yang punya jabatan baik di pemerintahan maupun swasta. Seperti Syamsul Arifin, kini Gubernur Sumatera Utara sarjana mudanya dari Fakultas Ekonomi UISU. Drs.Kasyim Siyo Presiden Pujakesuma dan juga calon Wakil Walikota Medan, Prof.Dr.H.Bomer Pasaribu yang juga Alumni Fakultas Ekonomi UISU, Drs.H.Surya Paloh Alumni Fakultas Sospol UISU dan banyak lagi yang tidak dapat disebutkan satu persatu. Jelasnya UISU yang didirikan para syuhada tokoh Islam internasional hancur berantakan, orang takut mendengar nama UISU, orang takut masuk UISU karena ijazahnya tidak sah dengan demikian jumlah mahasiswa UISU akan turun dan kalah bersaing dengan PTS yang baru didirikan. Namun niat jahat tersebut tidak di kabulkan Allah Swt. Islah di yayasan UISU Agar nama UISU tetap jaya sesuai dengan niat pendirinya maka para pengurus yayasan perlu islah terutama dalam keluarga Alm H.Bahrum Jamil Cs, dan Ibu Hj.Syariani Cs dengan melibatkan Muspida Plus, MUI, dan Kopertis Wilayah I duduk dalam satu meja dengan niat yang ikhlas. Ingat umur kita sudah tua tidak ada masalah yang dapat diselesaikan kalau kita berpikiran jernih kalau kita ingin islah, hilangkan perbedaan yang ada dan mari saling maaf memaafkan. Konflik dalam bidang akademik antara kedua pihak maka perlu diadakan pemilihan ulang dalam berbagai jabatan, Rektor, Pembantu Rektor, Dekan dan Pembantu Dekan, Ketua-ketua jurusan demikian pula dengan pemerintahan mahasiswa dan Badan Aspirasi Mahasiswa, Himpunan Mahasiswa Jurusan dan Pengurus Alumni di adakan pemilihan ulang dan siapapun serta dari pihak manapun yang terpilih harus kita terima dengan lapang dada dan dihormati sehingga konflik UISU dapat selesai dan UISU tetap satu semoga apa yang kita harapkan mendapat petunjuk dari Allah Swt, Amin. Drs.Rusdi Nasution,MM

Ada Apa Dengan DPS Pilkada Binjai Tahun 2010 Pemilu Walikota dan Wakil Walikota Kota Binjai tahun 2010 di jadwalkan pelaksanaannya tanggal 12 Mei 2010. Dalam konteks ini, mohon dapat dijelaskan : 1. Khusus untuk calon PPS diminta harus diajukan sebanyak 6 (enam) orang, dengan maksud 3 (tiga) orang sebagai anggota PPS dan 3 (tiga) orang untuk cadangan anggota PPS setelah melalui ujian atau tes tertulis, tetapi menurut informasi ada calon PPS yang diajukan cuma 3 (tiga) orang dan tidak ada masalah. 2. Kenapa DPS Pemilu Walikota dan Wakil Walikota Kota Binjai tahun 2010 yang sampai saat ini tidak diumumkan di Kantor Lurah atau tempat-tempat tertentu seperti Pemilu-pemilu yang lalu ? Atas penjelasan Pak KPU diucapkan terima kasih. Binjai, 14 April 2010 Hormat saya, Drs. Amiruddin

Oleh Maman Natawijaya Sejarah pendidikan jurnalistik di Medan dimulai 1959 dengan berdirinya Yayasan Akademi Pers Indonesia yang diketuai Alm.H.Mohammad Said, wakil ketua Almh.Hj.Ani Idrus

R

encana PersatuanWartawan Indonesia (PWI), untuk mendirikan sekolah jurnalistik di Sumatera Utaradisambutbaikolehkalangan organisasi wartawan tertua ini, termasuk dukungan dari gubernur Sumut. Rencana tersebut disampaikan ketua umum PWI, Margiono, pada Konferensi PWI Cabang Sumut di Medan baru-baru ini. Persatuan Wartawan Indonesia (PWI) enam provinsi di Indonesia bekerjasama denganpemerintahsetempatberencanamembangun sekolah jurnalistik untuk meningkatkan profesionalisme wartawan. Menurutnya, sekolah jurnalistik diharapkan bisa memberikanpendidikanbagiwartawanyang bekerja di perusahaan pers. Saat ini dan masa yangakandatang,kataMargiono,perusahaan pers dan wartawan dituntut semakin profesional untuk menghasilkan karya jurnalistik yang memenuhi atau sesuai dengan kode etik jurnalistik. Kemerdekaan pers, katanya,sesungguhnya dari dan untuk masyarakat bukan untuk perusahaan dan wartawan apalagiuntukkepentingankelompoktertentu (Waspada, 4/4). Pernyataan ketua Umum PWI ini, dianggap ‘telat’ oleh sejumlah kalangan, yang mengeluhkan sikap ketua PWI yang tidak menyadari (tidak tahu) tentang eksistensi lembaga pendidikan jurnalistik yang telah hadir terlebih dahulu. Seperti SekolahTinggi Ilmu Komunikasi pembangunan (STIK-P ) di Medan yang sejak tahun 1987 telah mulai mendidik masyarakat Sumut dan Aceh dan menghasilkan lebih dari 500 sarjana yang saat ini mendominasi industri pers di Sumatera Utara. Hal senada juga disampaikan Ronny Simon, yang menyarankan kepada PWI agar berkonsultasi sebelum mendirikan sekolah jurnalistik, agar memperoleh memperoleh masukan ideal. Hingga saat ini, sesungguhnya di Sumatera Utara telah berdiri lembaga-lembaga yang berkonsentrasi pada pendidikan jurnalistik,selainSTIK-Psebagailembagaperintis pendidikan jurnalistik, saat ini tercatat di fakultas-fakultas Ilmu Sosial dan Politik yang ada UMSU,UISU dan USU juga menyediakan jurusan kekhususan jurnalistik. Pentingnya pendidikan jurnalistik Terlepas dari ‘ketidaktahuan’ Ketua Umum PWI, tentang eksistensi lembagalembaga pendidikan jurnalistik yang telah ada di Medan, disadari bahwa wartawan itu seharusnya di ciptakan bukan sekedar dilahirkan dari adanya bakat yang melekat dari seseorang. Bakat itu berupa kemampuan menulis novel, cerpen, puisi dan karangankarangan sastra lainnya. Bakat saja belum cukup,karenamenjadijurnalisatauwartawan memerlukan beberapa persyaratan lain yang berkaitan dengan tugas-tugasnya sebagai seorang pemberi kabar (wartawan). Menjadi wartawan, bukan sekedar memilikikemampuanmerangkaikata-katayang indah. Tetapi di dalamnya juga terdapat keberanian, naluri dan tekad‘perjuangan’ pribadi seseorang yang memutuskan untuk terjun dalam dunia jurnalistik. Menjadiwartawan tidakdapatdilakukan dengan cara sambilalu, menunggu pekerjaan lain yang lebih tepat. Mengaku menjadi

wartawan secara‘kebetulan’ mungkin hanya pernah diakui oleh wartawan tiga zaman RosihanAnwardalamotobiografinyaMenulis Dalam Air. Tetapi, Rosihan Anwar yang sebelum menjadi wartawan telah gemar menulis karang mengarang, membutuhkan waktusetahununtukdinyatakansiapmenjadi wartawan. Sebelumnya beragam profesi di belakang meja redaksi seperti menjadi editor bahasa Indonesia untuk harian Asia Raya, kemudian dia berpindah dari satu redaksi ke redaksi lain, seperti menjadi penterjemah berita dan dengan beragam tugas keredaksian. Pembelajaran langsung di belakang meja dan pergaulannya dengan tokoh-tokoh pergerakan kemerdekaan, membuatnya jatuh cinta pada profesi ini dan menjadi “kuli tinta”adalahpilihanhidupnya;tekadnya untuk fortherestofmy life,profesi yang digelutinya hingga detik ini dan melupakan cita-citanya menjadi seorang jaksa. Pentingnyapendidikan, juga dikatakan Pulitzer, tokoh wartawan dunia (Amerika), bahwa pendidikankewartawanan bukan untuk secepat kilat melahirkan seorang menjadiwartawan. Pulitzerberpendapatwartawanmustbe madebukanmustbebornyang berbasis bakat. Pendidikan kewartawananadalahupayauntuk menuju wartawan yang paripurna dalam pengabdian profesinya.Wartawan paripurna artinya seorang wartawan dalam praktek menggeluti profesinya mampu memahami dan cerdas dalam kegiatan praktisi jurnalistik. Mereka juga pandai memanfaatkan dan mendayagunakan fungsi teknologi komunikasi dalam kecepatan menyebarinformasiditengahmaraknyaperanan dan pengaruh multi media di tengah dinamika kehidupan manusia. Ketrampilan, kecermatan wartawan mengolah dan menyebarkaninformasi makin menjadi syarat penting dan utama. Masyarakatakan senang dan percaya menerima informasi yang akurat dan terpercaya adalah bagian dari proses tugas wartawan mencerdaskan kehidupan bangsa. Bukan membodohi atau menipu masyarakat.Wartawan memang perlu wawasan yang luas dan berbasis etika. (Drs.Ismail Djalili-pwi.or.id) Sejarah pendidikan kewartawanan di Medan Merunut jauh ke belakang, di Sumatera Utara, khususnya di Medan, ada sosok Almarhummah Hj.Ani Idrus, tokoh wanita pejuangpers,yangsudahmelihatpentingnya pendidikan bagi wartawan. Sebagaimana yang ditulis Drs.Trida Bangun dalam buku biografi Hj.Ani Idrus ‘Tokoh Wartawati Indonesia ’. CV Haji Masagung Jakarta. Sebagai Ketua PWI periode 1953-1963, Ani Idrus tahu benar tentang liku-liku kewartawanan, termasuk kelemahan skill para wartawan. Maka ia pun bercita-cita mendiri-

kan sekolah tinggi kewartawanan di kota Medan. Dasar pemikirannya adalah dalam zaman kemajuan, di mana peran media massa surat kabar, majalah atau jawatan cukup penting, tentu memerlukan manusia yang pintar dalam bidang pekerjaan yang diembannya. Untuk itu kepada mereka perlu diisi ilmu-ilmu pengetahuan yang berkaitan dengan pekerjaan agar tidak ketinggalan roda kemajuan zaman, terutama bagi wartawan di Medan yang jumlah sudah cukup besar saat itu, tetapi rata-rata berpendidikan menengah saja. Pada tahun 1958, Ani Idrus membicarakan rencana pendirian akademi pers/ wartawan dengan wartawan-wartawan seniordantokoh-tohohcendekiawandiMedan seperti Mohammad Said (Waspada), Arif Lubis (Mimbar Umum), Amarullah Ombak Lubis (Antara), A.Dahlan, Joesoef Sou’yb, Mr.Mahadi, Mr.Zulkarnain, Mr.Suhunan Alamzah dan Harun Lubis. Pada tahun 1959 berdirilah Yayasan Akademi Pers Indonesia, dengan ketua Mohammad Said dan wakil ketua Ani Idrus dan Amarullah Ombak Lubis, sekertaris A.Dahlan dan bendahara Arif Lubis. Akademi ini awalnya ditujukan untuk meningkatkan kemampuan anggota PWIyangberpendidikan setingkat SMA. Sambutan terhadap kehadiran akademi ini cukup baik, tak hanya anggota PWI tetapi juga pemuda-pemuda yang belum menjadi wartawan. Pada awal berdirinya, tak kurang dari 50 orang yang menjadi mahasiswanya, dengan dua mata kuliah setiap harinya dan jam kuliah dimulai sore hari, karena sebagian besar mahasiswanya sudah bekerja. Pendirian akademi ini benar-benar murni atas tekad untuk memperbaiki kualitas wartawan tanpa unsur komersialisasi, sehingga untuk menghidupi akademi yang membutuhkan biaya besar,tidakdapathanyamengandalkan sumber pembiayaan dari mahasiswanya.AniIdrusharuspandai-pandaimelobi pihakpemerintahdanpengusaha.Takkurang kemudian akhirnya sejumlah pejabat tinggi dan pengusaha membantu pembiayaan akademi ini dan akhirnya akademi mampu memberikan imbalan yang memadai bagi tenaga-tenaga pengajarnya. Namun di penghujungtahun1966,karenasituasipolitik, akademi yang telah susah payah dibangun oleh Ani Idrus dan kawan-kawan harus ditutup. Untuksementara,cita-citaAniIdrusharus dipendam dan 28 tahun kemudian, cita-cita Ani Idrus untuk meningkatkan kemampuan wartawan baru dapat terwujud kembali. Sejalan dengan perubahan waktu dan perubahan revolusioner dalam bidang pengelolaan media massa dan elektronik di mana masyarakat semakin cerdas karena tingkat pendidikannya juga semakin baik, dengan demikian dibutuhkan wartawan yang handal danjugapejabathubunganmasyarakat harus mengimbanginya dengan meningkatkan pengetahuan, skillyang tinggi dalam mencari dan mengolah pemberitaan. Pada tanggal 18 Mei 1987, diresmikan SekolahTinggi Ilmu KomunikasiPembangunan(STIK-P) dengan jurusan : Jurnalistik,Hubungan Masyarakat dan Penerangan.

daerah lain di luar Jawa melakukannya. Jadi ketua PWI Pusat memang sedikit ‘telat’, padahal sejumlah seniornya telah memiliki hubungan yang cukup lama dengan lembaga pendidikan jurnalistik yang ada di Medan dalam hal ini STIK-P misalnya. STIK-P sendiri bagi penulis, merupakan sekolah yang unik, dengan bangunan kampusnya yang berada di jantung kota Medan denganluaskampusyangterbilangpas-pasan dengan warna khas jaket almamaternya berwarna orange. Namun mahasiswanya secara mandiri mampu menjadi bagian dari perubahan sosial dan politik yang terjadi SumateraUtarakhususnyadannasionalpada umumnya. Di sepanjang waktu perkuliahan penulis, mahasiswanya banyak berperan dalam aksiaksi yang digagas lembaga-lembaga swadaya masyarakat (LSM) yang ada di Medan. Hubungan dengan kelompok-kelompok mahasiswa dari kampus-kampus lain juga terjalin dengan baik. Tak heran, karena tenaga-tenaga pengajarnya terdiri dari kalangan akademisi, praktisi dan juga aktivis. Kesempatan perkuliahan, sering dijadikan arena untuk berdiskusi tentang hal-hal yang berkembang, mulai dari jurnalistik itu sendiri hingga politik. Bila dicermati lagi, ada saat-saat tertentu, sebagian mahasiswanya tidak berada di bangku kuliah, tetapi berada di jalanan atau daerah-daerahyangmembutuhkanbantuan aksi demontrasi, investigasi dan tuntutantuntutan keadilan sosial lainnya. Kebebasan dan dukungan pengelola di dalam kampus pada saat itu cukup memadai walau dengan sarana yang sederhana, kelompok-kelompok diskusi, unit kegiatan alam bebas, teater, fotografi dan kepenulisan, tumbuh subur menjadi pemicu terhadap meningkatnya perhatian mahasiswa terhadap masalah-masalah sosial. Belajar di kampus itu, tak cukup hanya menerima materi perkuliahan mencari dan menulis berita, tetapi juga beraksi langsung terhadap masalah sosial yang terjadi. Boleh dikatakan, aksi-aksi di sepanjang kurun waktu 1990-an yang terjadi di Medan, mulai dari aksi anti Orde Baru, pelanggaran HAM, pencemaran Sei Deli, perburuhan, Indorayon, anak jalanan, petani, nelayan, penutupan SDSB hingga kasus-kasus sengketatanahbanyakmelibatkanmasiswaSTIKP. Bahkan sejumlah mahasiswanya, pernah masuk dalam daftar pengawasan karena menjadi aktivis anti Orde Baru dan kemudian diawasisertadiburuaparatintelijen.Takheran, hingga kini, sejumlah alumninya memilih bekerja di sektor-sektor lembaga swadaya masyarakat yang bermitra dengan media. Cita-citaBundaHajjahAniIdrus,melebihi apa yang pernah diimpikan, selain menghasilkan jurnalis-jurnalis muda terlatih dan terdidik, yang tersebar di seluruh jenis media massa lokal dan nasional, juga menghasilkan orang-orang yang memiliki kepedulian terhadap sosial sebagaimana yang dimiliki wartawan. Bedanya, wartawan menggunakan ‘pena’ untuk menyuarakan kebenaran, sementara alumninya yang bergiat di LSM menyuarakannya lewat aksi-aksi langsung. Pilihan-pilihan hidup tersebut, merupakan pengayaan dari apa yang diyakini selama duduk di bangku kuliah tentang wartawan :awalnya wartawan adalah orang yang tahu sedikit tentang banyak hal dan keyakinan ini dirubah menjadi wartawan tahu banyak tentang banyak hal, melalui bangku pendidikan.Wartawan memang harus diciptakan, tak cukup hanya dilahirkan.

Penutup Medan sudah melakukan, sebelum

Penulis adalah Badan Pengurus Yayasan KKSP Medan dan Alumni STIKP

Jurnalisme Infotainment,Jurnalisme Klarifikasi Oleh Febrie Hastiyanto Prinsip cover both sides jurnalisme infotainment sangat lemah

T

anpa kita sadari, setiap hari kita disuguhi tayangan gosip selebritis yang belakangan telah diakui sebagai jurnalisme infotainment; informasi dan entertainment. Beberapa waktu lalu, kita banyak berdebat soal wacana apa yang dimaksud sebagai infotainment. Ada yang mengartikan informasi dari pelaku entertainment; selebritis, atau pekerja dunia hiburan termasuk seniman. Hal-hal yang dilakukan oleh pekerja seni, utamanya dalam proses kreatif mereka mencipta dan berkarya dianggap layak untuk diketahuipublik.Namunolehindustrimedia, infotainment dimaknai sebagai informasi yang ‘menghibur’ (entertaintment). ‘Menghibur’ kemudian disederhanakan sebagai memindahkan‘sinetron’,‘catwalk’,danpentas hiburan selebritis ke dalam ‘berita’. Dalam banyak pemberitaan, sesuatu yang‘menghibur’ ini kemudian bergeser menjadi gosip. Tidak bermanfaat Dominasi gosip yang menyita sebagian besar tayangan infotainment telah meresahkansejumlahpihak.Tidaktanggung-tanggung, Pengurus Besar Nadlatul Ulama merilis fatwa haram menonton tayangan infotainment. Infotainment dianggap sebagai tayangan yang tidak mendidik, sekaligus tidak banyak memberi manfaat. Coba kita perhatikan tayangan infotainment di televisi kita. Hampir setiap stasiun televisi—kecuali TVRI dan Metro TV—me-

Anak Itu... Sambungan dari hal.C6 membedakan kebaikan dengan keburukan. Namun sedikit yang mampu menjalankan kebaikan di tengah kekuasaan yang dikelilingi oleh sistim yang buruk. Ketika pembunuhan karakter menjadi senjata, maka mereka yang baik akan disudutkan pada tempat yang mereka tiada kuasa menegakkan kebenaran. Ketika mereka ingin

berita yang ditayangkan, dan dilakukan selebritis lain yang tidak ada hubungan dengan selebritis sumber berita juga ditayangkan. Narasi berita juga banyak disampaikan dengan gaya bahasa puitis yang panjang, berlebihan, sekaligus tidak mencerminkan berita karena mengandung opini, menggurui, bahkan menyalahkan.

miliki program infotainment setiap hari dengan durasi yang lebih lama dibanding tayangan pemberitaan (news).Waktu tayang program pun hampir bersamaan pada masing-masing stasiun televisi. Sejak pagi hari hingga siang dan sore hari, bahkan hingga tengah malam.Tidak jarang, sebuah stasiun televisi memiliki beberapa program acara infotainment. Perbedaan di antara masingmasing program hampir tidak jelas. Namun, isinya hampir melulu gosip selebritis. Kompetisi program acara infotainmet memang sangat ketat hampir seperti tayanganpemberitaan(news)padaumumnya.Wartawan infotainment tak ubahnya wartawan berita televisi lain dalam memburu narasumber. Karena variasi program yang demikian beragam dalam mata acara yang berbeda dan durasi waktu tayang kumulatif sehari yang tidak singkat, membuat banyak tayangan program infotainment kedodoran. Kadang-kadang informasi yang disajikan sebenarnya sedikit, namun oleh pengisi acara ‘dipanjang-panjangkan’ hingga durasi program berakhir. Akibatnya kita disuguhi tayangan banyak gambar dengan sedikit berita.Tidak jarang gambar yang ada diulangulang.Termasuk gambar sang selebritis yang tidak berhubungan dengan berita, atau gambar dokumentasi. Soaldokumentasiberita,seringkali‘berita’ tentang artis yang tidak relevan dengan berita yang ingin disampaikan juga ditampilkan. Tidak jarang berita dengan isu sejenis dengan

Gosip dan klarifikasi Infotainment dianggap sebagai jurnalisme karena dianggap telah memenuhi kaidahjurnalistik.5W1Hsebagairumuspemberitaan yang berisi apa, di mana, siapa, kapan, mengapa dan bagaimana, juga digunakanolehwartawan infotainment.Untuktidak disebut gosip, infotainment juga melakukan prinsip-prinsip jurnalistik check and recheck, cover both sides, dan klarifikasi. Namun, prinsip cover both sides jurnalisme infotainment sangat lemah. Tidak jarang wartawan saat melakukan klarifikasi ke sumber lain, informasi—tepatnya gosip— dimentahkan oleh sumber tersebut.Wartawan biasanya tidak kalah cerdik. Pertanyaan ‘misalnya’, atau‘seandainya’ sering digunakan hanya untuk memancing statement sumber. Sehingga bila sang suami ditanya gosip istri yang diduga selingkuh—dan kemudian dibantah suami—wartawan biasanya mengembangkan pertanyaan menjadi:‘bagaimanaseandainyaistriAndabenarselingkuh?”. Bila sang sumber terpancing mengeluarkan statement, wartawan akan mengembangkan menjadi pertanyaan lain yang tidak relevan. Banyak juga ‘berita’ infotainment yang berisi ‘berita seandainya’, misalnya seandainya artis terpilih menjadi presiden maka ia akan melakukan apa. Sang artis dapat berceloteh apa saja, dan kemudian menjadi‘berita’. Bandingkan dengan analis, maupun

membersihkan kekotoran maka mereka diberi sapu yang kotor. Ketika ingin berteriak memanggil penegak hukum maka sisi hukum yang berbelit malah menyumbat mulutnya. Tetapi satu yang pasti anakku, kebaikan tidaklah menuntut apa-apa kecuali kebaikan itu benar di Sisi Allah. Dan tidaklah pernah dalam sejarah kebathilan mampu menang dari kebaikan….” Anak laki-laki itu sangat paham. Dia paham kenapa sebuah negeri dari dahulu

hingga kini selalu saja bertukar konflik. Penyelesaian satu konflik bukanlah berarti menyelesaikan seluruh konflik, dan dia juga paham bahwa keamanan, kesejahteraan dan keadilan bagi rakyat yang hidup adalah sebuah dinamika yang harus dijalani tanpa tuntutan. Sesungguhnya berdoa agar mereka yang bathil diberi petunjuk adalah selemah-lemah iman. Dia juga ingat pesan ayahnya dulu: Rasululah sedikit marah tetapi kita sedikit-sedikit marah (demo).

pengamatyangberkomentarprediktifnamun dengananalisisyangmemilikidasarkeilmuan tertentu. Prinsip klarifikasi sering dilakukan wartawan hanya agar ‘berita’ tidak dianggap sebagai gosip. Narasi pembawa acara dalam tayangan infotainment lebih banyak dimulai dengan pernyataan-pernyataan negatif. Seperti dugaan perselingkuhan selebritis karena diketahui pernah jalan bersama selebritis lain, dugaan hubungan selebritis sedang di ujung tanduk dengan pasangannya karena dalam suatu acara ia hadir sendiri. Setelah berpanjang-panjang dalam narasi, menganalisis dugaannya sendiri dengan logika dangkal,baruditampilkanstatementselebritis. Kebanyakan selebritis membantah. Biasanya pertemuan dengan selebritis lain yang diduga pasangan selingkuh karena mereka sedang bekerja dalam acara yang sama— dan memang diakui oleh publik wajar, atau pasangan selebritis tidak menemaninya karena sedang ada acara lain, atau sakit. Setelah klarifikasi seperti ini biasanya pembawa acara tayangan infotainment akan ‘membantah’ sendiri narasinya. Berita-berita klarifikasi seperti ini yang banyak menghiasi tayangan infotainment kita. Prinsip-prinsip jurnalistik memang telah dipenuhi, namun pada praktiknya menjadi disederhanakan. Herannya, meski dikritik dalambanyakartikelmaupunsuratpembaca, tayangan infotainment—seperti halnya sinetron—masih saja disuguhkan kepada kita: pemirsa yang dianggap oleh pengelola media tidak memiliki hak untuk memberi saran dan request tayangan yang bermanfaat, bermutu, namun tetap menghibur. Penulis adalah Pegiat Kelompok Studi IDEA, Alumnus Sosiologi FISIP UNS Solo

Rasullullah sedikit tidur tetapi kita sedikitsedikit tidur (malas ibadah). Rasullullah sedikit makan, tetapi kita sedikit-sedikit makan (rakus dan korup), Rasululah sedikit-sedikit sedekah tetapi kita sedikit sedekah (pelit), dan Rasulluah sedikit-sedikit istighfar kita sedikit istighfar (sombong). Hemh…ayahku adalah tauladanku bisiknya. Anak lelaki mencium tangan ayahnya dengan gembira. Penulis adalah Dosen FP USU


Pentas Pilkada

B6

WASPADA Rabu 28 April 2010

Jurkam Diminta Menaati Norma Agama Dan Etika BK4 Berpeluang Menang Satu Putaran

MEDAN (Waspada): Direktur Lembaga Pengkajian Pemukiman dan Pengembangan Kota (LPPPK), yang juga mantan anggota DRPD Sumut, Rafriandi Nasution mengatakan, pasangan nomor 4 Bahdin Nur Tanjung dan Kasim Siyo (BK-4) berpeluang memenangkan pemilihan walikota Medan 2010 dengan satu putaran, karena selain memiliki basis massa yang riil juga punya track record bagus. “Mereka (BK-4) berpeluang menang satu putaran dengan rekam jejak yang dimiliki, tergantung bagaimana mampu meyakinkan ormas keagamaan untuk bersatu,” katanya kepada wartawan di Medan, Senin (26/4). Menurut dia, Bahdin punya basis massa yang kuat terutama di kalangan Muhammadiyah, di samping organisasi kepemudaan dan di kalangan dunia pendidikan. Namun tantangan untuk mencari dukungan penuh dari kalangan Muhammadiyah juga tak mudah karena ada kader Muhammadiyah lain yang sekarang ikut maju dalam pemilihan walikota Medan, yakni, Delyuzar, Syahrial R Anas dan Ahmad Arief. Bahdin bersama Kasim Siyo, kata dia, juga harus mampu meyakinkan warga Alwashliyah, bukan hanya di tingkatan elit tapi sampai akar rumput. Pendekatan yang selama ini sudah dilakukan terhadap ormas-ormas keagamaan sudah cukup tepat, namun perlu lebih intensif guna lebih memperkuat jaringan. Dia jelaskan, Bahdin juga memiliki potensi besar menggalang dukungan dari kalangan pendidikan karena pernah tercatat sebagai ketua Badan Perguruan Swasta, Badan Pembina Olahraga Mahasiswa serta Asosiasi Perguruan Tinggi Swasta Indonesia (APTISI) Sumut. Namun katanya, perlu juga digarisbawahi, dalam pemilihan walikota, Bahdin juga harus bisa melepaskan diri dari kesan sebagai tokoh pendidikan agar lebih leluasa melakukan pendekatan kepada etnis.Peran ini sebenarnya bisa lebih mudah dijalankan dengan memanfaatkan keberadaan Kasim Siyo yang merupakan presiden Pujakesuma. “Pertanyaannya, apakah warga Jawa di Medan khususnya masih setia dengan presidennya karena ada tokoh Jawa lain yang juga maju dalam pemilihan walikota Medan kali ini,” katanya. Sementara Bahdin bisa masuk menggalang dukungan di Badan Musyawarah Masyarakat Minang (BM3) sebagai basis massa dari kelompok etnis. Kiprah Bahdin di banyak organisasi sudah menjadi modal kuat untuk melakukan pendekatan etnis. “Saya rasa Bahdin dan Kasim tidak akan kesulitan melakukan pendekatan dengan kelompk etnis karena track record yang dimiliki menunjukkan, pasangan ini cukup egaliter dan Bahdin harus menunjukkan diri sebagai pemimpin yang plural,” katanya. Rafriandi juga menyarankan perlunya program kampanye cerdas guna lebih meyakinkan pemilih. “Kampanye yang dilakukan calon walikota selama ini terkesan monoton sehingga kurang menarik perhatian. Hal ini juga untuk mengantisipasi Golput, pemilih pemula dan swing votters (kelompok mengambang),” katanya. Calon walikota Medan, katanya, juga harus membaca format APBD sebagai dasar untuk menyampaikan program kampanyenya, sehingga materi yang disampaikan benar-benar menantang sekaligus sesuai dengan kebutuhan masyarakat. (rel/h05)

MEDAN (Waspada): Forum Ker ukunan Umat Beragama (FKUB) Sumut menyerukan para juru kampanye (jurkam) pada pilkada di 23 kabupaten dan kota se Sumut menaati norma agama dan norma etika. Ini salah satu seruan FKUB yang disampaikan kepada masyarakat melalui Kadis Kominfo Sumut, Eddy Syofian,

Selasa (27/4). Seruan itu ditandatangani Pimpinan FKUB Sumut, masing-masing Ustadz DR H Maratua Simanjuntak, Naran Sami, SH, JA Ferdinandus, Pastor Benno Ola Tage Pr, Drs Kendro Yahya dan Js Ir Djohan Adjuan. FKUB menyerukan kepada masyarakat Sumut yang telah memiliki hak pilih dapat menggunakan haknya dengan penuh tanggung jawab, dengan

motto; pilihan boleh berbeda kerukunan tetap terpelihara. Kepada seluruh pasangan calon bupati dan walikota yang akan berkompetisi, agar dapat menghadapi pemilu kada ini dengan arif dan bijaksana, serta mengarahkan tim sukses dan juru kampanyenya menjaga norma dan etika, baik norma agama, hukum, sosial, adat, budaya, kearifan lokal dan norma lainnya demi terwujud-

nya kesatuan dan persatuan. Diharapkan KPUD, Panwaslu dan seluruh penyelenggara pemilu melaksanakan tugasnya dengan penuh amanah, bertanggungjawab dan tetap menjaga kesatuan dan persatuan serta memelihara kondusifitas Sumatera Utara. Kepada aparat pemerintah dan penegak hukum (PNS, TNI dan Polri) agar mengawal jalannya pilkada, dan bersikap netral

kepada semua pasangan calon. Kepada majelis-majelis agama, pemuka-pemuka agama, tokoh masyarakat dan tokoh adat kiranya dapat membentengi masyarakat agar tidak terprovokasi oleh pihak-pihak yang tidak bertanggungjawab agar kondusifitas Sumut dapat terjaga dengan baik. Kepada insan pers (media cetak dan elektronik) agar menyampaikan berita-berita

tentang pelaksanaan pilkada secara seimbang dan obyektif. Mengimbau kepada seluruh pasangan calon bupati/wakil bupati, calon walikota/wakil walikota mempersiapkan diri dengan sebaik-baiknya, siap menang dan siap kalah. ”Yang menang agar dapat menjalankan amanah dengan baik, dan yang kalah dengan ikhlas menerimanya demi menjaga kondusifitas Sumatera Utara.”(m19)

Sofyan Tan Jadikan Nelayan Pahlawan Kesehatan MEDAN (Waspada): Calon walikota Medan Sofyan Tan menganggap nelayan sebagai pahlawan kesehatan yang nyaris tak terlindungi dan luput dari perhatian akan kesejahteraan. Sangat ironis, menurut Sofyan Tan, ketika nelayan yang memberikan masyarakat sumber protein tinggi tak bisa memberikan kesejahteraan bagi keluarganya. Bahkan keluarga nelayannya sendiri pun tidak mendapatkan ikan sebagai konsumsi rumah tangga. “Ikan itu sumber protein paling tinggi yang bisa mencerdaskan manusia. Jadi wajar jika nelayan dianggap sebagai pahlawan kesehatan yang belum disejahterakan,” kata calon nomor urut 10 itu, saat bersilaturahmi dengan nelayan di Tempat Pelelangan Ikan (TPI) Bagan Deli, Kec. Medan Belawan, kemarin. Apalagi lanjutnya, nelayan pada umumnya melaut hingga berhari-hari dan tidak mungkin sempat berurusan dengan administrasi pemerintahan jika ingin mendapatkan pelayanan kesehatan dan pendidikan gratis. Untuk itu dia bertekad urusan pendidikan dan kesehatan gratis tidak akan melalui prosedur administrasi yang rumit. Nelayan tetap akan bisa berkonsentrasi melaut mencari nafkah, sedangkan kebutuhan kesehatan dan pendidikan keluarga dan anak-anaknya akan diurus dan dilayani Pemko.

Tidak perlu bolak-balik mengurusnya ke kantor lurah. Tapi pegawai pemko yang mendatangi langsung ke rumah warga untuk melayaninya. Hutajulu, warga Belawan I yang berprofesi sebagai nelayan, mengatakan, jika pergi ke laut mencari ikan maka mereka akan meninggalkan keluarga sekitar 15 hari. Karena itu terkadang tidak bisa memberikan perhatian terhadap kondisi kesehatan dan pendidikan anak-anaknya. Dia berharap Sofyan Tan tidak sekadar berjanji tapi langsung memberikan realisasi. Sebab kehadirannya di tengah-tengah masyarakat nelayan yang spontanitas tanpa harus melakukan pengerahan massa, sehingga banyak warga yang terganggu aktivitas

kerjanya sudah menjadi bagian penilaian positif. Muhammad Saher, nelayan lainnya mengatakan, bahwa persoalan yang dihadapi nelayan Bagan Deli adalah jembatan ke TPI yang sudah lapuk dan rusak. Sehingga sulit mengangkat hasil tangkapan. Selain itu, pencemaran laut akibat kebocoran minyak mengakibatkan banyak ikan yang hilang dan tangkapan pun sedikit. Sofyan Tan menyambut keluhan para nelayan untuk segera memperbaiki titi yang rusak usai pilkada berlangsung. “Ini kebutuhan mendesak. Saya tidak akan menunggu pelantikan ataupun menunggu APBD cair untuk memperbaiki titi ini. Usai pilkada dan penetapan calon akan segera diperbaiki,” tegasnya.(rel/h03)

Waspada/Surya Efendi

Calon walikota Medan Sofyan Tan berdialog dengan nelayan saat mengunjungi Tempat Pelelangan Ikan (TPI) Bagan Deli, Kec. Medan Belawan, kemarin.

Kampanye Perdana Nomor 3 Bakti Sosial Di 7 Lokasi MEDAN (Waspada): Pasangan calon walikota Medan nomor urut 3, Indra Sakti Harahap dan calon wakilnya Dr Delyuzar akan memulai kampanye perdana dengan bakti sosial di tujuh lokasi berbeda yang ditentukan KPU Medan pada zona A1. Ketua Tim Pemenangan Ideal (Indra Sakti-Delyuzar) Ashadi Yushnan didampingi Ketua Divisi Tim Lintas Masyarakat Zulkarnain Harahap, Selasa (27/4) mengatakan, kampanye perdana dilaksana-

kan, Rabu (28/4) hari ini. “Bakti sosial di tujuh lokasi itu diiringi dengan pengerahan massa dari masyarakat sekitar lokasi, sambil melakukan pengobatan gratis untuk umum yakni orang dewasa dan anakanak,” ujarnya. Ashadi menjelaskan, kampanye simpatik yang dilakukan pasangan ini, agar lebih bermanfaat langsung bagi masyarakat dibanding cara yang dilakukan seperti biasa. “Masih banyak masyarakat pinggiran yang tingkat kesejahteraannya

minim, diantaranya fasilitas pelayanan kesehatan yang dinilai mahal,” tuturnya. Rencana kampanye yang dimulai sejak pagi, juga dibarengi orasi pasangan calon walikota yang dilakukan secara marathon di tujuh tempat berbeda hingga selesai. Tujuh titik kampanye pasangan ini, di antaranya, Lapangan Merdeka, Lapangan PJKA Jl. Mandala By Pass, Lapangan Jl. Air Bersih, Lapangan Kwala Bekala, Lapangan Jl. Rebab dan Lapangan Jl. Bunga Rinte.(m40)

Waspada/Ist

Calon walikota Medan Sigit Pramono Asri pada silaturahim akbar masyarakat Medan Tuntungan.

Masyarakat Tuntungan Komit Menangkan Sigit-Nurlisa

Waspada/Ist

Calon walikota Medan Maulana Pohan, saat acara silaturahmi bersama warga Kel. Tegal Rejo, Medan Perjuangan, Minggu (25/4) malam.

Pemko Medan Harus Evaluasi Kinerja Jajarannya MEDAN (Waspada): Keberadaan para kepala lingkungan di kota Medan kembali menuai protes masyarakat. Persoalan sulitnya memperoleh kartu tanda penduduk (KTP) dan berbagai surat menyurat lain yang diterbitkan Pemko Medan menjadi pemicu. Hal itu terungkap dari keluhan sejumlah masyarakat yang hadir dalam kunjungan silaturahmi calon walikota Medan, H Maulana Pohan di Jl. Masjid Taufik, Kel. Tegal Rejo, Medan Perjuangan, Minggu (25/4) malam. Warga Kelurahan Indra Kasih, Medan Tembung yang hadir, Muhammad Yahya, mengatakan, untuk mengurus izin usaha ke kantor kelurahan dia diwajibkan membayar Rp200 ribu. “Kemudian surat itu dibawa ke Dinas Perindustrian dan Perdagangan Medan, pastinya juga harus diwajibkan membayar sejumlah uang,” kata dia.

“Sebagai pengusaha kecil, uang Rp200 ribu harusnya dapat kami manfaatkan sebagai tambahan modal. Tapi karena kami berharap usaha kami bisa legal, terpaksa uang itu harus dibayarkan pada pihak kelurahan,” kata dia mengeluhkan pengalamannya ketika mengurus izin di kelurahan. Pengusaha bidang jasa yang baru merintis usahanya itu menambahkan, izin itu sangat dibutuhkan. Tanpa itu akan menyulitkan mereka ketika mengembangkan usaha. Para rekanan umumnya menjadikan persoalan perizinan sebagai syarat sebelum menandatangani kontrak kerjasama. Warga Jl. Masjid, Taufik Piliang, 60, juga mengeluhkan persoalan birokrasi yang harus dibayar mahal di Pemko Medan. Wanita itu mengeluhkan biaya yang harus dikeluarkan untuk pembuatan KTP dan kartu keluarga.Warga kelurahan

itu wajib membayar antara Rp50 ribu-Rp70 ribu pada kepala lingkungan. ”Kalau tak dibayar, bisa-bisa entah kapan KTP atau KK kami siap,” keluhnya. Menanggapi itu, Maulana Pohan mengatakan, keluhan masyarakat tadi merupakan persoalan paling banyak disampaikan padanya. Untuk ke depan, walikota harus dapat mengevaluasi kinerja seluruh jajarannya hingga level kepala lingkungan. ”Evaluasi ini penting guna mewujudkan pemerintahan yang baik dan tercapainya target pemerintah sesuai program kerja yang telah dicanangkan,” tegasnya. Dari evaluasi itu pula, nantinya walikota dapat menentukan sikap lanjutan. Dalam bentuk kebijakan meningkatkan kesejahteraan para aparatur pemerintahan atau memberi sanksi tegas kepada oknum yang mencoba menyimpang dari kebijakan.(rel/m11)

MEDAN (Waspada): Masyarakat disekitar Kompleks Kejaksaan, Medan Tuntungan komitmen mendukung dan memenangkan pasangan calon walikota nomor 2, Sigit Pramono Asri dan Hj Nurlisa Ginting. Demikian kebulatan, Jumat (23/4), pada silaturahim akbar masyarakat Medan Tuntungan, dihadiri seribuan masyarakat. Tampak tokoh masyarakat, Sehat Kaloko, Ustad Salim Daulay dan H Zainuddin. Sedangkan Sigit dan dan Hj Nurlisa didampingi Tim Pemenangan, H Surianda Lubis dan H Salman Alfarisi. Menurut Ruslan, tokoh pemuda Medan Tuntungan, masyarakat tidak ragu mendukung dan mencoblos pasangan ini. “Itu karena mas Sigit dan Hj Nurlisa sosok yang bersih dari korupsi, sopan dan berwibawa,” katanya. Terkait program pasangan itu, Ruslan mengakui lebih unggul dari pasangan lainnya. “Kita tidak ragu dengan janji keduanya, karena selama ini mereka sudah membuktikan membela kepentingan masyarakat. Jadi kami semua yakin program KTP gratis beransuransi kesehatan, sekolah berkualitas gratis, kredit modal usaha untuk rumah tangga dan gratis pengurusan izin usaha bisa terwujud,” tambahnya.(m17)

Nurlisa Ginting Lebih Diminati

MEDAN (Waspada): Nurlisa Ginting, calon wakil walikota Medan yang berpasangan dengan Sigit Pramono Asri ternyata lebih diminati dibanding calon wakil walikota perempuan lainnya. “Ini temuan survei yang kami lakukan terhadap orientasi kecenderungan pemilih perempuan dalam pilkada Medan 2010,” ujar Ketua Lembaga Pengkajian dan Penelitian Independen (LPPi), Drs Zainal Azis, MM, Msi kepada wartawan di Medan, Selasa (27/4). Survei dilakukan awal April terhadap 1.000 responden perempuan di seluruh kecamatan di Medan dengan tingkat kepercayaan 96 % dan tingkat kesalahan pengambilan data 4%. Pengontrol data dilakukan secara proporsional yang disesuaikan dengan persentase suku dan agama. Zainal Azis melanjutkan, dari survei itu sebanyak 72% responden memilih Nurlisa Ginting sebagai calon wakil walikota yang disukai dan dianggap layak dan selebihnya 28 % memilih Nelly Armayanti. Hasil itu juga menunjukkan meski ada upaya pembusukan terhadap salah satu calon wakil walikota perempuan, tapi ternyata tidak berpengaruh terhadap persepsi pemilih perempuan terhadap calon perempuna itu. “Ini juga didukung oleh kriteria yang diinginkan perempuan yang menghendaki calon pemimpin perempuan yang berpendidikan, berpengalaman dan dekat dengan masyarakat,” lanjut Azis yang juga dosen Statistik di beberapa PTS kota Medan. Temuan itu juga dibenarkan Alucyana, S.Psi, psikolog yang sedang mengambil S-2 di Psikologi USU dan sudah melakukan survei tentang Psikologi Pergerakan Pemilih Perempuan dalam Pilkada Medan 2010.(m11)

Waspada/Sahrizal

Ratusan masyarakat Jl. Veteran/Krakatau dari anak-anak hingga orang dewasa bergembira dengan calon walikota Indra Sakti Harahap, beberapa waktu lalu.

Dukungan Masyarakat Kecil Kian Menguat Ke Indra Sakti Harahap MEDAN (Waspada): Menjelang kampanye Pilkada Medan, dukungan masyarakat kecil dan bergai elemen lainnya dari arus bawah kian menguat ke pasangan calon walikota Medan Indra Sakti Harahap dan calon wakil walikota Dr Delyuzar. Salah seorang tokoh masyarakat, Letkol (Purn) Abdul Rahim Siregar, Senin (26/4), menguatnya dukungan itu terlihat dari banyaknya pembicaraan di antara masyarakat terhadap pasangan ini. Disamping itu, sambutan masyarakat dalam belasan pertemuan diadakan kedua pasangan calon walikota itu di tempat berbeda, pekan lalu, juga membludak, diantaranya di Jl. Veteran/Krakatau, Belawan dan Jl. HM Joni. “Visi dan misi pasangan tersebut juga lebih ril dan dekat di masyarakat, dengan penyampaian bahasa rakyat

sehingga mudah dipahami masyarakat bawah dan telah dilaksanakan dalam beberapa tahun lalu sebelum menjadi calon walikota,” tuturnya. Hal senada dikatakan Taufik Siregar, SH,Mhum dosen Universitas Medan Area. Menurutnya, ratusan masyarakat menyambut kedatangan pasangan calon walikota bersama wakilnya Dr Delyuzar di Medan Belawan. Sambutan antusias masyarakat terlihat dengan menyediakan berbagai makanan khas laut, seperti ikan bakar, kepiting dan lainnya sambil mengisi acara hiburan yang tampil bebas dan bersahaja. Kedekatan masyarakat nelayan di Belawan terhadap pasangan itu ternyata bukan terjadi secara instant, akibat ada kepentingan menjadi calon walikota, tetapi sudah berlangsung beberapa tahun lalu. Hubungan tersebut berlandaskan

memperjuangkan kaum miskin di pinggiran kota untuk mendapat pelayanan kesehatan dan peningkatan kesejahteraan. Diantaranya program pelayanan air bersih terhadap 7.000 kk lebih di Medan Utara dan pelayanan kesehatan dan perbaikan gizi keluarga tak mampu dengan menggerakkan 2.000 ibu-ibu kader tuberkulosis dan penyakit ISPA di Belawan. Abu Bakar Sidik, warga Gang Tinggi Batu, Jl. Serdang mengatakan, berterimakasih atas kepedulian pasangan calon walikota yang telah membantu usaha kecil mereka dengan memberi bantuan modal. Menurutnya, para pelaku usaha tidak mengukur berapa banyak bantuan yang disumbangkan, tetapi kelikhlasan dan kesungguhan untuk peduli terhadap masyarakat kecil yang dijadikan ukuran besarnya pemberian.(m40)


Pentas Pilkada

WASPADA Rabu 28 April 2010

B7

Cabup Asahan Ditantang Tak Korupsi KISARAN (Waspada): Tujuh pasangan calon bupati dan wakil bupati Asahan ditantang untuk tidak korupsi bila terpilih, dan mau menandatangani kesepakan itu pada kontrak moral, Senin (26/4). Ta n t a n g a n d i b e r i k a n sejumlah aktivis mahasiswa mengatas namakan Komite Bangkit Asahan (Asahan Rising Commite) saat unjukrasa di kantor DPRD D Asahan, saat tujuh pasang calon tersebut menyampaikan visi dan misinya

di depan anggota dewan dan jajaran pejabat Kabupaten Asahan. Aksi itu sempat memanas, karena para pengunjukrasa membakar ban bekas, dan memaksa masuk ke kantor dewan, sehingga aksi saling dorong dengan petugas tidak dapat dihindarkan. Karena tidak dibolehkan masuk, para pengunjukrasa menunggu di luar gedung sambil membentang spanduk sebagai kontrak moral yang akan ditandatangani oleh tujuh pasang

calon itu. “Kontrak moral ini mengatas namakan Tuhan, sehingga bila para calon terpilih menjadi bupati melakukan korupsi, mereka akan mendapat ganjaran dari Tuhan,” ujar koordinator aksi Hidayat Tufiq. Merasa tertantang, para pasangan calon bupati dengan senang hati menandatangani nota kesepakatan itu, karena Asahan memerlukan pemimpin yang berani melawan korupsi.(csap)

Upah Melipat Kertas Suara Rp50/Lembar KISARAN (Waspada): Kertas suara pilkada Asahan terancam tidak terlipat dengan baik. Para pekerja yang melipat kertas suara itu sedikit mengeluh. Mereka mengaku menerima upah Rp50 per lembar, padahal sebelumnya Rp100. “Upah sudah menurun, jadi kami harus bekerja cepat untuk memenuhi target agar mendapatkan uang yang cukup untuk kebutuhan keluarga,” ujar seorang pekerja ditemui di Aula Sekolah Penyuluhan Pertanian (SPP), Desa Rawang, Kec. Rawang Panca Arga, Asahan, Waspada/Sapriadi

MELIPAT KERTAS SUARA: Sejumlah kaum ibu melipat kertas suara calon bupati dan wakil bupati Asahan, Selasa (27/4). Upah yang mereka terima menurun menjadi Rp50 per lembar dari harga sebelumnya Rp100 per lembar.

Pemasangan Atribut Kampanye Banyak Langgar Aturan TEBINGTINGGI (Waspada): Memasuki hari kedua masa kampanye pilkada kota Tebingtinggi, Senin (26/4), ditemukan pelanggaran di antaranya berupa pemasangan atribut alat peraga kampanye di tempat terlarang, seperti taman, media jalan dan tempat lainnya. Berdasarkan pantauan saat itu, pelanggaran pemasangan

atribut kampanye seperti yang terdapat di tugu simpang empat kota, median jalan Jendral Sudirman serta tanjakan jalan menuju jembatan Sei Padang, nyaris dipenuhi berbagai macam gambar pasangan calon. Anggota Panwaslu Kota Tebingtinggi Suarno Arifin dan Ridwan Napitupulu mengakui banyaknya atribut pasangan calon pilkada “bergentayangan” di tempat yang dilarang.

Menurutnya, pelanggaran pemasangan atribut atau alat peraga kampanye selain merusak keindahan tata kota, juga dapat mengganggu pengguna jalan. Penertiban belum dapat dilakukan karena sejak dilantik 21 Januari 2010, dana panwas belum turun sehingga tidak ada dana operasional. “Selama ini kami masih menggunakan dana sendiri, dan mengutang, bagai-

mana mau bekerja, demikian dengan panwas kecamatan,” ucap Suarno, mengharapkan anggaran panwas segera turun agar dapat bekerja dengan baik. Humas Panwaslu, Efendy Lubis mengatakan, pelanggaran pemasangan atribut kampanye juga ditemukan di rumah ibadah, seperti masjid dan gereja. Tanpa menyebutkan gambar pasangan calon mana yang melanggar, Fendi mengimbau

masing-masing tim sukses pasangan calon walikota dan wakil walikota untuk menarik pemasangan atribut kampanye di tempat yang dilarang itu. Sebagaimana kesepakatan kampanye damai dari masingmasing calon pada hari kedua kampanye terbuka di Lapangan Merdeka, Senin (26/4) hendaknya hal itu dijaga agar menimbulkan simpati masyarakat, tandasnya. (a09)

Keputusan KPUD Pakpak Bharat Tak Berubah

Waspada/Eddi Gultom

Peserta Rakerda I DPD Pujakesuma diabadikan bersama Ketua DPW Pujakesuma Sumut Suherdi dan Bupati Sergai HT Erry Nuradi di Balai Karyawan PTPN3 Kebun Rambutan Desa Paya Bagas Kec, Tebingtinggi, Sabtu (24/4).

DPD Pujakesuma Rekomendasikan Erry Nuradi-Soekirman TEBINGTINGGI, Sergai (Waspada): Dewan Pimpinan Daerah Paguyuban Keluarga Besar Putra Jawa Kelahiran Sumatera (DPD PKB Pujakesuma) Kab. Serdang Bedagai melalui rapat kerjanya, Sabtu (24/4) di Balai Karyawan PTPN 3 Kebun Rambutan, Kec. Tebing Tinggi menghasilkan beberapa rekomendasi, di antaranya mendukung dan siap memenangkan pasangan HT Erry Nuradi dan H Soekirman pada pilkada, 12 Mei 2010. Hasil Rakerda I pengurus DPD, DPC dan Ranting Pujakesuma Sergai yang dibacakan

Wakil Ketua DPD Pujakesuma Sergai Darwanto, juga merekomendasikan pelestarian seni budaya Jawa, khususnya tata krama dan adat istiadat serta memberikan kesempatan seluas-luasnya kepada putraputri Jawa dalam penerimaan lapangan kerja. Ketua DPD Pujakesuma Sergai Sayutinur dihadapan sekira 300-an peserta Rakerda, mengatakan bahwa Rakerda merupakan keputusan tertinggi setelah musyawarah daerah (Musda), sehingga diharapkan memperoleh program kerja yang dapat menyentuh lapisan

Pandawa Dukung Umar-Irham

Kampanye Pilkada T. Tinggi Dimulai

TEBINGTINGGI (Waspada): Persatuan Pemuda Jawa Kota Tebingtinggi menyatakan dukungan kepada pasangan H Umar Zunaidi Hasibuan dan H Irham Taufik Umri pada pilkada kota Tebingtinggi, 12 Mei 2010. Ketua Pandawa Riadi didampingi Sekretaris Riyanto, Senin (26/4) mengatakan, dukungan Pandawa terhadap pasangan Marhamah, karena menilai pasangan itu paling kredibel di antara kelima pasangan yang maju. Apalagi Umar dan Irham sejak lama menjadi penasehat Pandawa, dan banyak memberikan kontribusi bagi perkembangan organisasi itu. Riadi mengklaim Pandawa Kota Tebingtinggi saat ini, menghimpun sekira 5.000 pemuda Jawa yang bergerak di berbagai profesi. “Dengan kekuatan itu kita siap mengusung pasangan Umar-Irham,” tegasnya.(a08)

TEBINGTINGGI (Waspada): Lima pasangan calon walikota dan wakil walikota yang bakal “berlaga” pada pilkada kota Tebingtinggi mengikuti kampanye damai yang diselenggarakan KPUD, Senin (26/4), di Lapangan Merdeka. Pilkada damai ditandai penandatanganan kampanye damai, pelepasan burung dan balon oleh unsur Muspiko dan Ketua KPUD serta pawai jalanan kelima pasangan. Mereka, pasangan No. 1 Umar-Irham, No. 2 Adi Harianto-Sara Bintang Saragih, No. 3 Amril-Irwandi, No.4 Shafri Chap-Hafaz Fadillah dan No. 5 Syahril-Gunadi. Ketua KPUD Tebingtinggi Hatta Ridho mengatakan, kegiatan itu sebagai bentuk apresiasi KPUD terhadap kampanye damai yang mengedepankan akal sehat. Namun kampanye damai itu tercederai sikap seorang anggota DPRD dari PDIP yang menggunakan mobil dinas dewan mengikuti kegiatan itu.

masyarakat, khususnya warga Jawa di Sergai. Hal sama diungkapkan Ketua DPW Pujakesuma Sumut, Suherdi. Menghadapi pesta demokrasi yang akan digelar di beberapa daerah di Sumut, termasuk di Sergai, Suherdi mengharapkan jajarannya bersikap netral. Namun kata dia, keluarga besar Pujakesuma berhak menentukan sikap politiknya dengan memperjuangkan kader-kader Pujakesuma untuk tampil sebagai pemimpin. “Salah satu kader Pujakesuma yang maju menjadi calon wakil bupati Sergai periode

2010–2015 adalah H Soekirman. Untuk itu kader Pujakesuma diminta mensosialisasikan kepada keluarga besar Pujakesuma Sergai memberikan dukungan kepada pasangan itu.” Sementara, HT Erry Nuradi mendukung upaya DPD Pujakesuma melestarikan budaya, khususnya budaya Jawa. Khusus menghadapi pilkada, Erry Nuradi mengharapkan seluruh keluarga besar Pujakesuma tidak terprovokasi dengan isuisu yang dapat memecah-belah persatuan dan kesatuan, yang sudah terbina baik selama ini.(a07)

Waspada/Abdul Khalik

PILKADA DAMAI : Calon walikota Tebingtinggi mengikuti kampanye damai yang diselenggarakan KPUD, Senin (26/4). Kampanye damai merupakan awal kegiatan kampanye pilkada Tebingtinggi yang berlangsung selama dua pekan. Mobil Toyota Avanza BK 1128 N warna hitam, terlihat sejumlah wartawan, digunakan Parlindungan Rajagukguk, yang ikut pada rombongan pasangan Syahril-Gunadi. Ketua Panwas Pilkada Supriadi didampingi Ridwan Napitupulu, mengatakan, akan segera memanggil yang bersangkutan untuk diminta pertang-

gungjawabannya atas penggunaan mobil dinas itu. Prosedurnya, kata Ridwan, Panwas akan memanggil anggota DPRD itu, kemudian memprosesnya, dan jika ditemukan ada pelanggaran pilkada, akan melimpahkannya ke Polresta. Supriadi menjelaskan, penggunaan kendaraan dinas dalam pilkada merupakan bentuk pelanggaran.(a08)

SALAK (Waspada): Ketua KPUD Kabupaten Pakpak Bharat, Nazir Salim Manik menegaskan, pihaknya tidak akan mengubah keputusan penetapan nomor urut pasangan calon bupati dan calon wakil bupati Pakpak Bharat. Nazir menngatakan itu dalam siaran pers, yang diterima wartawan, Senin (26/4), seperti tertuang pada surat edaran KPU No:149/ KPU-PB/IV/2010. Diutarakannya, tahapan, program dan jadwal penyelenggaraan pilkada tidak ada perubahan, sehingga pelaksanaan pemungutan suara per 12 Mei 2010 tetap sesuai jadwal. Pemberitahuan kepada warga melalui surat edaran itu merupakan klarifikasi atas kesimpangsiuran informasi di masyarakat, khususnya yang berdomisili di Pakpak Bharat. Seperti diketahui, pasangan bakal calon bupati/ wabup Jusen Berutu dan Zuhri Bintang ( Juzur) di diskualifikasi KPUD Salak saat verifikasi faktual, karena tidak memenuhi persyaratan berkas pencalonan. Oleh pasangan ini, KPUD kemudian diadukan ke Pengadilan Tata Usaha Negara (PTUN) di Medan. Sambil menunggu hasil keputusan PTUN, pihak Juzur tetap berkeyakinan dan optimis masih bisa turut serta dalam bursa pencalonan. Persoalan ini kemudian mengemuka, dan isu di tengah-tengah masyarakat bahwa pilkada diundur. “Untuk meluruskan perma-salahan itu, kami merasa perlu mengeluarkan surat edaran supaya seluruh masyarakat tidak bingung,” tambahnya. Meskipun ada penuntutan ke aparat penegak hukum, ujar Nazir, pihaknya tetap pada keputusannya dengan mene-tapkan peserta pilkada sebanyak enam pasangan, karena KPUD menetapkan ke-6 pasangan itu dengan merujuk Peraturan KPU No. 68/2009 dan mengacu Pedoman Teknis pelaksanaan Pemilukada pasal 39 ayat (5), (6) dan (8).(c08)

Selasa (27/4). Menurutnya, harga melipat kertas itu tidak sesuai dengan resiko, karena bila terjadi sesuatu pada surat suara, mereka yang pertama kali menjadi sasaran. “Tapi tak apalah, yang penting dapat kerjaan, ketimbang nganggur. Tinggal lempit sana, lempit sini udah selesai satu lembar,” ujar mereka tersenyum. Ketua KPUD Asahan, Edi Pranyitno melalui Divisi Logistik Syafrial Syah dikonfirmasi Waspada menjelaskan, untuk harga pelipatan per lembaranya telah mereka serahkan kepada

pihak ketiga, tapi tetap dipantau KPUD sehingga diharapkan tidak ada kesalahan. “Sebelum melipat kami memberi arahan bagaimana melipat dengan baik, dan memberikan sanksi bila terjadi kesalahan,” ujar Syafrial. Jumlah kertas suara yang akan dilipat sebanyak jumlah DPT 471.792 lembar ditambah 2,5 persen untuk cadangan, dan akan diusahakan tiga hari selesai. “Kita memperkerjakan 250 orang yang terbagi 10 orang dalam satu tim untuk satu kecamtan,” tambahnya.(csap)

Syahrul Pasaribu ‘Simbol’ Masyarakat Marancar MARANCAR (Waspada): Calon bupati Tapsel Syahrul M Pasaribu yang berpasangan dengan Aldinz Rapolo Siergar (SARASI), merupakan “symbol” masyarakat Kec. Marancar. Syahrul, putra daerah Marancar, sudah berbuat banyak dalam pembangunan daerah dan masyarakat Marancar. “Dia sudah seperti anak bagi kami. Karena itu masyarakat Marancar mendukungnya menjadi bupati Tapsel 2010-2015 melalui pilkada 12 Mei nanti. Kemenangan Syahrul adalah harga diri kami,” kata Raja Luat Marancar, Paruhum Siregar. Masyarakat Marancar sebelumnya telah membulatkan

tekad memenangkan pasangan bernomor urut 4 ini, karena diyakini mampu membuat perubahan dan percepatan pembangunan daerah. Sebagai anggota DPRD Sumut periode ketiga, dia telah merealisasikan Rp13 miliar dana APBD Sumut untuk pembangunan jalan di Maran-car sejak 2005 hingga 2010. Bantuan pembangunan berbagai sektor sudah banyak pula yang diperbuat Syahrul, termasuk abang dan adiknya. Syahrul, meski berasal dari pelosok desa di kaki bukit Lubuk Raya sukses meniti karir. Abangnya Bomer Pasaribu, mantan menteri tenaga kerja, Panu-

sunan Pasaribu mantan bupati Tapteng dan Kadispenda Sumut, Ibrahim Pasaribu bekerja di pertambangan minyak milik Amerika di Kalimantan. Adiknya Gus Irawan Pasaribu saat ini menjabat Dirut Bank Sumut untuk tiga periode, Jhon Pasaribu, pimpinan BNI Syahriah Bumi Serpong Damai, Banten. Sedangkan adik perempuan satu-satunya, Hj Lisliwati Pasaribu, pegawai negeri di Pemko Padangsidimpuan. “Kita yakin jika Syahrul memimpinTapsel, akan dibantu abang dan adiknya dalam halhal positif,” tambah Mahmud Lubis, Ketua Komisi III DPRD Tapsel.(a20)

PAN Labusel Targetkan Pasangan Wil-Mas Raih 62% Suara KOTAPINANG (Waspada): Dewan Pimpinan Daerah Partai Amanat Nasional (DPD PAN) Kabupaten Labuhanbatu Selatan menargetkan peme-nangan pasangan calon bupati/wakil bupati, H Wildan Aswan Tanjung– H Maslin Pulungan (Wil & Mas) sebanyak 62%. Target itu disampaikan pada Rapat Koordinasi (Rakor) Pemenangan Pemilukada DPD PAN Labusel, Minggu (25/4) di Kotapinang. Rakor dihadiri Ketua Tim Pilkada PAN Sumut Wempy Saragih dan Sekretaris Husni Lubis, seluruh pengurus harian DPD, DPC PAN dan DPRt PAN se Labuhanbatu Selatan. Target 62% memenangkan pasangan Wil & Mas ini, kata Ketua DPD PAN Labusel Anang Anas Azhar sangat beralasan. Pertama, Wildan merupakan putra daerah yang lahir di La-

busel. Kedua, selama di Labusel Wildan juga merupakan pengusaha cukup dikenal kepopularitasannya. “Pasangan ini maju melalui jalur partai. Target yang kita canangkan akan tercapai dan harus didukung seluruh “mesin partai”, mulai DPRt, DPC sampai DPD. Insya Allah, PA N Labusel tetap optimis,” kata Anang. Komitmen memenangkan pasangan ini juga disampaikan Ketua DPC PAN Silangkitang, DPC PAN Kota Pinang, DPC PAN Sei Kanan, DPC PAN Torgamba dan DPC PAN Kampung Rakyat. Wempy Saragih mengatakan, dari 22 kabupaten/kota yang akan melaksanakan pilkada sepanjang 2010, DPW PAN Sumut sudah menetapkan 15 pasangan calon kepala daerah. Salah satunya pasanganWildan

Aswan Tanjung dan Maslin Pulungan. “Kita sangat bangga, karena dari 15 pasangan yang sudah ditetapkan, hanyaWildan Tanjung yang maju sebagai bupati. Wildan kader PAN dari Labusel, menjabat sebagai Ketua Fraksi Reformasi di DPRD Paluta,” kata Wempy. Pasangan Wil & Mas saat menyampaikan visi dan misi di hadapan peserta Rakor Pilkada berjanji memberikan yang terbaik kepada masyarakat Labuhanbatu Selatan. Salah visi yang menjadi prioritas pasangan ini, membangun infrastruktur, kesehatan dan pendidikan. Tiga masalah ini menjadi prioritas utama bagi pembangunan fisik dan SDM di Labusel, sebagai daerah pemekaran yang baru dimekarkan dari Labuhanbatu Induk.(c05)

5 Pasangan Calon Walikota Sibolga Sampaikan Visi Misi Massa Afifi-Halomoan Mendominasi SIBOLGA (Waspada): Lima pasangan calon walikota dan wakil walikota Sibolga menyampaikan visi dan misinya dalam sidang paripurna di Gedung DPRD, Sibolga yang dibuka Ketua DPRD Sibolga, Syahlul Umur Situmeang, Senin (26/4). Kelima pasangan calon walikota itu rata-rata menyampaikan visi dan misinya membangun dan mensenjahterakan Sibolga lima tahun ke depan. Sesuai nomor urut masingmasing, Wilpren Gultom dan H Azmi Arif Simatupang menyampaikan terlebih dahulu visi misinya, dilanjutka HM Syarfi Hutauruk-Marudut Situmorang, H Afifi Lubis -Halomoan P Hutagalung, Hotman Silalahi

-Syahril Piliang, Rudolf Hamonangan Sianturi-H Ulam Raya Hutagalung, Mereka diberi kesempatan 15 menit. Kedatangan lima paket calon walikota Sibolga itu mendapat sambutan hangat dari masing-masing massanya. Namun, massa pasangan calon walikota Sibolga nomor urut 3 Afifi Lubis dan Halomoan Hutagalung paling banyak. Bahkan keduanya digendong ribuan massa begitu keluar gedung DPRD Sibolga Afifi dan Halomoan dalam visinya bertekad menjadikan Sibolga kota jasa yang berdaya saing, didukung pemerintahan yang bersih dan aspiratif menuju masyarakat sejahtera. Sedangkan misinya, me-

wujudkan tata kelola pemerintahan yang baik, mempersiapkan sumber daya manusia yang handal dan berdaya saing, meningkatkan aktivitas jasa dan perniagaan di tingkat regional, nasional dan internasional, penataan kawasan perkotaan serta pengembangan infrastruktur perkotaan dan fasilitas publik. Prioritas keduanya adalah reformasi birokrasi guna mewujudkan profesionalisme aparatur, restrukturisasi pemerintahan dalam mewujudkan birokrasi pemerintahan yang berintegritas, berkompetisi, efisien dan professional. Usai menyampaikan visi misinya, kelima pasangan calon melakukan pawai damai berkeliling kota Sibolga.(a18)

SARMA Akan Bangun Masyarakat Sibolga SIBOLGA (Waspada): Pasangan calon walikota dan wakil walikota Sibolga nomor urut 2, HM Syarfi Hutauruk dan Marudut Situmorang “SARMA” menyampaikan 10 point visimisi membangun kota Sibolga, pada rapat istimewa DPRD Sibolga, Senin (26/4). Penyampaian visi misi dilakukan secara bergantian, didahului oleh Syarfi kemudian dilanjutkan oleh Marudut. Dalam visinya, pasangan ini akan membangun masyarakat Sibolga yang sehat, cerdas, sejahtera dan beradab, dengan 10 point misi, diantaranya

mengembangkan potensi pariwisata dengan memperkuat infrastruktur perhubungan, telekomunikasi dan akomodasi. Menyediakan fasilitas pengolahan perikanan dan industri kreatif rumah tangga, untuk mendukung Sibolga sebagai salah satu daerah destinasi pelancongan dan jasa perdagangan di Sumut. Lalu memperkuat sistem dan kemudahan akses untuk mendapatkan harga sembilan bahan pokok, kredit tanpa agunan kepada nelayan, penarik beca, industri kreatif rumah tangga, pedagang kecil dan mikro.

Terpenting juga, memperkuat sistem dan pengembangan basis pajak daerah untuk peningkatan PAD dan meningkatkan pengawasan internal dan eksternal untuk menghindari kebocoran, serta melakukan reformasi birokrasi dan tata kelola pemerintahan untuk pelayanan publik. Rapat istimewa dipimpin Ketua DPRD Sibolga, Syahlul Situmeang. Setelah itu, seluruh pasangan calon menandatangani kesepakatan “kampanye dan pelaksanaan pilkada damai dipandu Ketua KPUD Sibolga Nadzran.(a34)


Agenda Hollywood Akan Dijual, Bos Playboy Keluarkan Rp 8 M B8

Tulisan ‘Hollywood’ yang legendaris itu terancam punah keberadaannya.Tanah menaungi kawasan itu, akan dijual untuk dibangunsebuahrumahmewah. Bos Playboy, Hugh Hefner pun turun tangan. Ia merogoh US$ 900 ribu atau sekitar Rp 8 miliar dari koceknya. Uang itu dikeluarkan Hefner untuk membantu sebuah perusahaan non profit,The Trust for Public Land, membeli tanah tersebut. The Trust harus mengumpulkan uang US$ 12,5 juta untuk membeli tanah yang dulunya milik Howard Hughes. Sumbangan US$ 900 ribu diberikanHefnerkarenaiamerasa punya keterikatan emosional dengan ‘Hollywood’. Katanya, impian dan fantasinya selama ini datang dari film-film diproduksi di Hollywood. Film-film tersebut

punya pengaruh besar untuk hidupnya dan Playboy. “Tulisan Hollywood menurutku seperti Menara Eiffel-nya Hollywood. Aku pun senang bisa membantu melestarikan salah satu monumen budaya ini,” tuturnya, seperti dilansir AFP, Selasa (27/4). Selain Hefner, ada juga orang dan perusahaan terkenal lainnya ikut memberikan sumbangan. Di antaranya aktor Tom Hanks, sutradara Steven Speilberg, perusahaan Sony Pictures Entertainment, the Walt Disney Company, Warner Bros. Entertainment dan Tifanny & Co. Seluruh sumbangan tersebut, menurut pihak The Trust membantu mereka memenuhi target untuk membeli tanah legendaris itu. Dengan bantuan banyak pihak, ‘Hollywood’ pun diselamatkan.(dth)

Hollywood

Syahrini Menuju Imej Glamour SIAPA sangka kalau karir Syahrinisebagaipenyanyimelonjak begitu cepat. Apalagi saat Anang Hermansyah menunjuknya jadi pasangan duet. Syahrini pun perlahan berubah dari imej seksi menjadi glamour. Dara berpipi cubby itu memulai karir bernyanyi lewat salah satu lagu menjadi album soundtrack film ‘Cokelat Stroberi’ pada tahun 2007. Setelah lagu‘Tatapan Cinta’ yang menjadi soundtrack itu Syahrani tidak perlu waktu lama membuat album utuhnya. Setahun kemudian sarjana hukum Universitas Pakuan Bogor itu merilis album perdananya bertajuk‘My Lovely’. Syahrini pun mulai berkibar dan dilirik pendengar musik Indonesia. Belum puas dengan menelurkan album, Syahrini pun merambahkedunialayarlebar.Meski pun bertindak sebagai pemain tambahan di film ‘The Maling Kuburans’, Syahrini sukses memikat mata penonton dengan keseksiannya.Iapunmengandalkankeseksiannyauntukmemikat para penggemarnya sebagai penyanyi. Menurut Syahrini, ia berpenampilan seksi hanya untuk keperluan manggung semata. Sebagai penyanyi solo, keseksian menjadi salah satu caranya menghibur penonton.

Syahrini

“Aku kan seksi tapi bukan berarti bisa dijamah,” ujarnya di Studio DetikTV, Jl.Warung Buncit Raya No. 75, Jakarta Selatan pertengahan 2009 lalu. Pertama kali muncul di blantikamusikIndonesia,Syahrini memang tampil begitu maksimal dengan menonjolkan keseksiannya. Kalau pun bernyanyi, anak kedua dari tiga bersaudara itu selalu berkostum ketat dan

terkesannakal.Lagu-lagunyapun cenderung dengan beat yang tinggi. NamunpenampilanSyahrini mulai berubah setelah menjadi pasangan duet Anang Hermansyah. Perempuan kelahiran Kota Hujan Bogor 1 Agustus 1982 itu mulai dekat dengan duda Krisdayanti itu saat acara Dashyah di Semarang, Jawa Tengah, Desember 2009. Anang saat itu

melantunkan lagu ‘Separuh Jiwaku Pergi’. Sedangkan Syahrini menyanyikan ‘Pusing Setengah Mati’. Saat itu, Syahrini minta Anang agar dibuatkan lagu. Permintaan Syahrini disambut baik Anang. Ia pun diminta datang ke studio Anang, di Radio Dalam, Jakarta Selatan. Setelah dites, Anang merasa cocok dengan karakter suara Syahrini. Selanjutnya Anang pun memilihSyahriniuntukpasangan duetnya. Juri Indonesian Idol itu menampik suara Syahrini mirip suara Krisdayanti. “Saya pilih Syahrini itu memang suaranya bagus, justru suara itu keluar dari dirinya sendiri,” kata Anang. Setelah sering tampil duet dengan Anang lewat lagu ‘Jangan Memilih Aku’, penampilan Syahrini pun berubah. Ia tidak lagi menonjolkan keseksiannya. Lihat saja sekarang, Syahrini lebih terlihat tenang dan berpenampilan glamour dalam bernyanyi. Bahkanbanyakyangberpendapat sekilas Syahrini mirip dengan Krisdayanti. “Aku nggak mengharapkan jadi pengganti KD. Aku mau jadi diri aku sendiri. Tidak mau jadi orang lain,” ujarnya saat ditemui di hotel Grand Mahakam, Jakarta Selatan, Rabu 24 Februari 2010 lalu.

Sekarang, Syahrini bak seorang selebritis yang tidak jauh dari gosip skandal percintaan. Sama siapa lagi kalau bukan dengan lawan duetnya, Anang Hermasnyah. Bukan hanya sekadar menjadi teman berduetnya, Anang digosipkan menyimpan hati untuk Syahrini. Namun keduanya samasama membantah. Mereka mengaku hanya berhubungan selayaknya pasangan duet biasa. Hanya saja bantahan Anang tidak sejalan dengan gerak-geriknya di hadapan publik. Kerap kali Anang memberikan ciuman untukpasanganduetnyaitu.Namun Anang lagi-lagi mengganggap itu bagian dari konsep duetnya. “Kayaknya aku nggak mau bicara masalah aku dengan Syahrini lebih jauh, aku sedang melakukan bagaimana aku bekerjasama dengan Syahrini,” kata Anang saat pertama kali mencium Syahrini di Studio Dashyat, RCTI pada 26 Februari 2010 silam. Semakin lama kedekatan mereka semakin tampak. Dalam waktu dekat ini, Anang dan Syahrini akan umroh bersama. Mereka pun dikabarkan akan melangsungkan pernikahan di Mekkah, Arab Saudi. Namun semua isu itu dibantah pihak Syahrini.(dth)

Animax Hadirkan Romeo-Juliet Rasa Baru Televisi saluran Animax akan menghadirkan kisah cinta terlarang antara Romeo dan Juliet dengan nuansa baru yang penuh aksi, intrik dan ketegangan, dijadwalkan tayang setiap Rabu pukul 19.00 mulai 28 April 2010. Bertajuk Romeo X Juliet, serial anime itu merupakan interpretasi (terjemahan) baru dari karya klasik Shakespeare tentang hubungan asmara di antara dua insan keturunan keluarga bangsawan Montague dan Capulet, yang saling bermusuhan. Romeo X Juliet adalah visi menakjubkan, baru dan berani dari kisah cinta klasik telah menggema ke seluruh dunia dari generasi ke generasi hingga saat ini. “Tokoh dan kejadian-kejadian kunci dalam drama asli Romeo dan Juliet diimajinasikan kembali secara berani dan dipadukan dengan unsur dari karya terkenal Shakespeare lainnya serta dunia kaya fantasi seputar drama perseteruan politik dan kekuasaan,” kata Vice President dan General Manager Animax Asia, Gregory Ho dalam siaran pers, Sabtu. Ho mengungkapkan, serial anime tersebut mengambil setting kota fiktif Neo Verona yang terapung di udara, dimana

07.30 Si Doel 09.00Musik Dahsyat 11.00 Silet 12.00SeputarIndonesia 12.30Sergap 13.00ParadeFilmKEluarga 15.00Cek&Ricek 16.00MintaTolong 17.00SeputarIndonesia 17.30CurhatTheChangcuters 18.00KemilauCintaKamila 19.00SafaDanMarwah 20.30DiaBukanAnakku 22.00 Masihkah Kau Mencintaiku 23.30RoadToFIFAWorldCup 00.30 Seputar Indonesia Malam 01.30SemifinalUEFAChampions Barcelona vs Inter Milan

CATATAN

07.30 Musik : Inbox 09.30 Halo Selebriti 10.00 FTV Pagi 12.00 Liputan 6 Siang 12.30 FTV Siang 14.30 Status Selebriti 15.00 FTV Sore 17.00 Liputan 6 Petang 17.30 Uya Emang Kuya 18.00 Buku Harian Baim 19.00 Mawar Melati 20.00 Cinta Fitri 21.30 Kesetiaan Cinta 22.30 Barometer 23.30 Sigi 30 Menit 00.00 Eksis! 00.30 Liputan 6 Malam

kepemimpinan dinasti Capulet telah berkuasa secara damai selama beberapa generasi terguling dalam sebuah kudeta berdarah dipimpin keluarga bangsawan Montague. Tidak puas merebut kekuasaan Capulet, Montague membantai semua keturunan musuhnya. Namun, seorang anak perempuan Capulet yang masih kecil, Juliet, berhasil diselamatkan pembantunya yang setia dengan cara menyamarkannya sebagai seorang anak lakilaki bernama Ordine. 14 tahun berlalu, Juliet pun tumbuh menjadi gadis remaja yang cantik dan penuh pesona di dalam sosok Ordine, yang pemberani dan pandai bertarung dengan pedang. Ia melakukan berbagai aksi gagah berani demi membela rakyat jelata yang menderita akibat kebengisan Montegue, terlebih setelah mengetahui masa lalunya yang semula dirahasiakan. Berbekal pedang peninggalan ayahandanya, Juliet yang dikenal rakyat sebagai Crimson Tornado (Halilintar Merah) bertekad terus memerangi Montesgue demi mengembalikan kekuasaan Capulet dan kedamaian di Neo Verna. Dalam perjuangan Juliet bertemu dengan Romeo, anak Lord Montague yang hidup penuh kekayaan dan kemewahan namun tidak menyukai kekejaman ayahnya.

07.00 Disney Club : 08.00 Cerita Pagi 09.00 Layar Pagi 11.00 Sidik 12.00 Layar Kemilau 13.30 Cerita Sore 14.30 Go Show 15.00 Tom & Jerry 15.30 Disney Club 17.00 Zona Juara 18.00 Gatot Kaca 19.00 Upin & Ipin 19.30 Kisah Fantasi 21.00 Arisan Dangdut 23.00 Sinema Malam 01.00 Peque Prix

07.00 Pororo The Little Penguin 07.30 Kartun Animal Mechanicals 08.30 Espresso 09.30 Sinema Religi 11.30 Topik Siang 12.00 Musik : Klik 13.00 Espresso 14.00 Tawa Sutra XL 15.00 Djarum Indonesia Persitara vs Persib 17.30 Topik Petang 18.00 Dapet Deh 18.3 Super Family 19.30 Segeerr Beneerr 20.30 Tawa Sutra 22.00 Sinema Legenda 00.00 Topik Malam 00.30 Lensa Olahraga Malam

Getar asmara di antara kedua anak muda itu bersemi tanpa disangka, dan Juliet harus menghadapi kebimbangan dalam hati ketika mengetahui rahasia kehidupan masa lalunya. Bagaimanapun, ia harus memilih antara revolusi dan rasa cintanya kepada Romeo. Berbeda dari versi aslinya, serial ini mengupas petualangan Romeo dan Juliet yang penuh aksi dan ketegangan dalam mencapai misi dan hubungan percintaan mereka. Juliet meneruskan peran sebagai pendekar Crimson Tornado untuk memulai revolusi melawan Montague, sedangkan Romeo harus dibuang ayahnya sendiri untuk bekerja di sebuah tambang. Belakangan, Romeo pun menyulut pemberontakan di tambang tempatnya bekerja sebagai orang buangan, lalu kembali ke Neo Verona untuk menghadapi sang ayah. Diproduksi studio anime GONZO (Witchblade, Full Metal Panic!) dan SKY Perfect Well Think, serial anime Romeo X Juliet diadaptasi dari kisah ditulis Reiko Yoshida. Selain serial anime, Romeo X Juliet telah diadaptasi dalam bentuk serial manga dan drama radio, yang disiarkan melalui streaming internet pada 2007.(ant)

07.00 Ben 10 08.00 Jiran 09.30 FTV Drama 11.30 Patroli 12.00 Fokus Siang 12.30 Happy Song 14.30 KiSS 15.30 FS My Fair Lady 17.00 Nurhaliza 18.00 Putri Duyung Marina 19.00 Terdampar 20.30 Take Celebrity Out 00.00 Fokus Malam 00.30 FS. The Sword

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07.05 Bedah Editorial Media 08.05 Healthy Life 09.05 Indonesia This Morning 09.30 Market Review 10.30 Metro Xin Wen 11.05 MDG’s Insight 11.30 Megapolitan 13.30 Jakarta Jakarta 15.00 Bisnis Hari Ini 15.30 Public Corner 16.05 Discover Indonesia 17.05 Metro Hari INi 19.05 Suara Anda 21.05 Top Nine News 21.30 Otoblitz 22.05 Mata Najwa 23.05 Metro Realitas 00.05 Metro Malam

WASPADA Rabu 28 April 2010

Polisi Selidiki Pembuatan Film Cowboys in Paradise JAJARAN Kepolisian Daerah Bali akan menyelidiki asal usul pembuatan film Cowboys in Paradise yang diduga dalam pengambilan gambarnyadikawasanPantaiKutatidakmeminta izin kepada instansi berwenang. “Tentang `Cowboys in Paradise`, kami dari kepolisian sedang mengumpulkan sejumlah materi tentang film tersebut. Untuk selanjutnya akan dipelajari apakah ada pelanggaran pidana atau unsur pornografinya,” kata Kabid Humas PoldaBaliKombesPolGdeSugianyardiDenpasar, Selasa. Polisi juga akan mendalami film tersebut termasuk mencari keterangan dari para aktor yang berperan dalam adegan film mengisahkan praktik para gigolo atau “lelaki tuna susila (LTS)” di Pantai Kuta itu. “Kami akan telusuri apakah para aktor dalam keadaan sadar atau tidak saat dirinyadiambilgambaruntukpembuatansebuah film doku-menter. Ini yang akan kami telusuri dan pelajari,” ujar Kombes Sugianyar. Bila dalam keadaan tidak sadar untuk sebuah film tontonan untuk umum, tentu hal itu adalah sebuah pelanggaran yang dapat dipidanakan. Mengenai kemungkinan film tersebut tidak memiliki izin shooting di Bali, Kabid Humas menyebutkan, sepanjang ada bukti dan saksi yang mendukung, pemrakarsa dari film tersebut dapat dijerat pidana. “Kami bisa menetapkan sutradaranya sebagai tersangka pelaku tindak pidana, bila menyusul ditemukan cukup bukti bahwa film tersebut tak mengantongi izin,” katanya. Polisi bekerja sama dengan Satgas Pantai

Kuta akan melakukan pengumpulan berbagai fakta dan data menyangkut film yang sempat mengebohkan penduduk Bali itu. Selain itu, atas kerja sama pihaknya dengan satgas juga telah melakukan langkah-langkah penertiban terhadap para gigolo yang diduga masih beroperasi di Kuta. “Terhadap mereka, orang-orang yang tidak berkepentingan di Pantai Kuta,kamisudahmelakukanpenertiban,”ujarnya menjelaskan. Seperti diketahui banyak orang, sebuah film dokumenter mengenai pria penghibur wanita di Pantai Kuta, kini beredar di Internet. Film yang dapat diakses dalam sebuah situs itu, menuai banyak protes dari kalangan masyarakat Bali. Masyarakat protes lantaran film yang pengambilan gambarnya dilakukan di Pantai Kuta itu, dianggap telah merusak citra pariwisata Pulau Dewata yang lebih mengedepankan seni dan budaya. Film Cowboys in Paradise garapan sutradara AmitVirmani merupakan film dokumenter yang mengisahkan sepak terjang para gigolo hingga menjadikan Bali sebagai tujuan wisata yang menarik bagi para turis asing perempuan. Salah satu cuplikan yang kontroversial adalah pernyataan istri salah seorang gigolo merelakan begitu saja suaminya “tidur” dengan para pelanggan asingnya, yakni turis perempuan. Menurut polisi, film tersebut belum dirilis atau diputar di bioskup-bioskup dalam negeri, namun cuplikannya dengan durasi yang tidak begitu lama sudah muncul di Internet.(ant)

Sandra Bullock Tak Akan Sembunyi Lagi ARTIS cantik Sandra Bullock tampaknya mulai pulih dari skandal perselingkuhan suaminya, Jesse James. Ia siap menghadapi dan menghadang semua akan terjadi. Ia tidak akan bersembunyi lagi. “Ia butuh waktu untuk dirinya sendiri. Sekarang ia sudah siap berhenti bersembunyi dan akan melawan balik,” kata sumber yang dekat dengan Sandra Bullock seperti dilansir contactmusic, Selasa (27/4). Sebelumnya Sandra menghilang sejak perselingkuhan Jesse dengan sejumlah perempuan dibeberkan media massa. Bintang ‘The Blind Side’itumembatalkansemuaagenda dijadwalkan untuk dihadirinya. Ia hanya beredar di kalangan keluarga dan teman dekatnya saja. Sejauh ini Sandra telah 2 kali terfoto muncul di depan publik. Pertama ia mengunjungi temannya, Gabriel Brener, di Los Angeles. Brener merupakan bos the Brener International Group, LLC, sebuah firma investasi pribadi berbasis di Beverly Hills. Yang kedua, ia terlihat di California. Saat itu Sandra sudah tidak mengenakan cincin kawin. Sang sumber menegaskan Sandra sudah mantap mengakhiri hubungannya dengan Jesse. Awalnya Sandra seperti akan memaafkan suaminya. Namun setelah menghabiskan waktu sendirian untuk berpikir, Sandra memutuskan menceraikan si pengusaha motor itu. “Sudah berakhir antara Sandra dan Jesse. Begitu banyak yang terjadi. Dan setelah ia sendirian, Sandra sadar ia seharusnya diperlakukan lebih baik,” kata sumber itu.

Sandra Bullock (Gettyimages/dth)

Sementara itu Jesse James telah keluar dari pusat rehabilitasi kecanduan seks. Jesse kembali ke rumahnya. Pria yang berselingkuh sedikitnya dengan 4 perempuan itu sempat mengantar anaknya ke sekolah.(dth)

Geliat Optimis KSP Band KENDATI lebih dari satu dasawarsa tak melansir album rekaman, Kelompok Suara Parahyangan atau KSP band tetapoptimismenggeliatkembalidiblantikamusiknasional. Lewat album terbaru mereka antaralainmengandalkandua lagu lawas Hasrat dan Cinta karya Fariz RM serta TandaTandanya milik Oddie Agam aransmen musiknya didaur ulang, grup musik berformat Big Band digawangi 13 personel ini, telah siap memberi warna berbeda industri musik pop nasional. “Lewat 13 lagu pop progresif bernuasa R & B, KSP band siap menawarkan warna musik berbedayanglebihmengedepankanharmonisasi di tengah industri musik nasional sedang seragam. Konsep inilah membuat kami bertiga-belas, tetap optimis memulai geliat ulang dengan melansir album terbaru atau ketiga,” papar Iyok, satu dari empat vokalis KSP band kepada Waspada di Jakarta, baru-baru ini. Ditemui disela-sela pemotretan untuk cover album terbaru KSP di Backstages Ancol – Jakarta Utara, pilihan bandnya “melawan arus” pasar musik, sudah diperhitungkan secara matang. Beberapa lagu andalan, terutama lagu Hasrat dan Cinta sertaTanda-Tandanya yang aransmen musiknya disesuaikan dengan tren kekinian, telah berulang-kali disuguhkan saat manggung di hadapan penonton kaula muda mendapat sambutan luar biasa. Kenyataan menggembirakan ini membuktikan, ada kerinduan penggemar musik akan suguhan musik bermutu yang mengandalkan harmonisasi serta dimainkan dalam format Big Band, ujar vokalis band asal bandung bersuara

07.30 Suami Suami Takut IStri 08.30 Angel’s Diary 09.00 Musik Derings 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Online 14.30 Sketsa 15.00 Missing Lyrics 16.00 Mr Bean 16.30 Orang Ketiga 17.00 Reportase Sore 17.30 Insert 18.30 Kejar Tayang 19.00 Distrik 86 20.00 Realigi 21.00 Bioskop Trans TV 23.00 Bioskop Trans TV 01.00 Reportase Malam

06.30 Apa Kabar Indonesia 10.00 Nuansa 1000 Pulau 10.30 Pariwara 11.00 Opini 12.00 Kabar Siang 13.00 KAbar Keadilan 13.30 Expose 14.00 Opini 15.00 Kabar 15 15.30 Kabar Pasar 16.00 Menyingkap Tabir 16.30 Fakta & Data 17.00 Khabar Hari Ini 17.30 Kabar Petang 20.00 Debat 20.30 Telusur 21.00 Apa Kabar Indonesia 23.00 Backpacker 23.30 Kabar Arena

KSP Band

bas yang bersama 12 rekannya – terakhir melansir album bertajuk Mimpiku tahun 1998 ini. Tentang alasan debut ulang mereka mengandalkanlagukaryaFarizRM, MartinSaba–pentolan KSP band berkomentar, lagu Hasrat dan Cinta mengandungmaknamendalamdanmasihsesuai dengan kondisi masyarakat saat ini. “Di tengah himpitan kemiskinan dan keruwetan yang hidup di negeri ini, lagu ini bisa menjadi semacam harapan sekaligus doa untuk terwujudnya perubahan. Kelebihan lainnya, lagu ini pun berkisah tentang cinta dengan segala romantikanya,” kilah pemilik suaraTenor seraya menambahkan KSP pun tak melulu menyuguhkan lagu-lagu lawas. “Kami punya delapan lagu baru. Antara lain lagu Aku, Mencintainya, dan Cinta Tak Harus Memiliki,” jamin Martin Geliat optimis KSP band didudukung formasi solid berkonsep Brass Section – Diana Saralely dan Brury (Terompet), Ivan (Trombon), duo Keyboardis Lucky Soeryo dan Donny Herdanto, Reza “Icha” Syafrilan (Perkusi), Arif (drum), Iyus Yusuf (gitar) dan Abimanyu Karyana (bas), sangatlah beralasan. (AgusT)

07.00 Spongebob 08.00 Eyeshield 09.00 Monchows 09.45 Obsesi 10.30 Bukan Sinetron 11.30 Pengakuan Terlarang 12.00 Bukan Abdel & Temon Biasa 13.00 Global Siang 14.30 Amel Cemal Cemil 15.30MTVMusisiJalanan 16.00 MTV Getar Cinta 16.30 Berita Global 18.00 Naruto 19.00 Awas Ada Sule 20.00 Big Movies 22.00 Big Movies 00.00 Global Malam 00.30 FIFA World 01.00 MTV Insomnia

07.30 I Gosip Pagi 08.00 DUAAR 09.00 Inspirasi Dorce 10.30 60 Minutes 11.30 Redaksi Siang 12.00 I Gosip Siang 12.30 Bocah Petualang 13.00 Laptop Si Unyil 13.30 Jalan Sesama 14.00 Cita Citaku 14.30 Dunia Binatang 15.00 Koki Cilik 15.30 Asal Usul Fauna 16.00 Jejak Petualang 16.30 Redaksi Sore 18.00 On The Spot 19.00 OKB 20.00 Opera Van Java 21.00 Mariam Mikrolet 22.00 Bukan Empat Mata 23.30 Doctor’s Files 00.30 Sport 7 Malam 01.00 Redaksi Malam **m30/B


Sumatera Utara

WASPADA Rabu 28 April 2010

B9

Kejari Gunungsitoli Mulai Periksa Kasus Korupsi Proyek RRKN

Waspada/Syarif Ali Usman

MAULANA PRODUCTION: Produk Maulana Production yang bergambar potensi wisata dan budaya Madina, terpajang di arena stand pameran MTQ Ke XXXII Sumut di lapangan Aek Godang Kec. Panyabungan, Selasa (27/4).

Maulana Production

Promosikan Budaya Dan Wisata Madina Lewat Kaos Oblong MOMEN Musabaqah Tilawatil Quran (MTQ) XXXII tingkat Provinsi Sumatera Utara di Panyabungan, Kab. Mandailing Natal, selain untuk pengembangan dan pelaksanaan syiar Islam juga bermanfaat untuk memperkenalkan bakat dan karya seni bernuansa wisata dan budaya. Kedua hal inilah, yang menjadi salah satu daya tarik tersendiri di arena stand MTQ lapangan Aek Godang, Panyabungan yang banyak dikunjungi kawula muda dan orangtua.Wisata dan budaya Madina tidak dipamerkan dalam bentuk kaset atau disc, tapi diabadikan dalam bentuk baju bermutu bagus. Harga terjangkau mulai Rp 50 ribu sampai Rp 70 ribu. Seperti di stand Maula Production. Berbagai jenis warna baju, model dan ukuran terpampang rapi di dinding ukuran 4 x 4 meter. Pada baju-baju itu

dapat dilihat berbagai peninggalan budaya Madina, ada gambar Bagas Godang Mandailing, Gordang Sambilan dan Masjid Agung. Di bidang wisata, ada kaos dengan latar pemandangan wisata, seperti Bendungan Sungai Batang Gadis, Bukit Sopotinjak, Pantai Sikara-kara, Danau Marambe, Sumur Multatuli, Sampuran Batumundom. Itulah wujud kecintaan Sobir Lubis, SH, warga Panyabungan, terhadap budaya leluhur dan wisata Madina, yang diekspresikan lewat karya seni, terencana, dan terprogram rapi dalam wadah Maulana Production di Panyabungan. Maulan Production diambil dari nama putra sulungnya Maulana Arisaputra Lubis, usaha itu dirintis sejak 2008 lalu dan terus berkembang sampai sekarang. Produk Maulana Production tidak hanya dipasarkan di

kawasan Madina dan sejumlah daerah di Sumut, tapi juga merambah pasaran ke Sumatera Barat, Bandung, dan lainnya di Pulau Jawa. Selain darah seni yang mengalir dalam dirinya, itu dilakukan agar Madina tidak akan lekang oleh waktu. Ia berharap dengan promosi kaus bermotif budaya Madina itu, mampu menggugah hati dan nurani orang-orang Madina di perantauan untuk peduli kampung halaman. Dengan harapan, mereka yang telah sukses bisa membantu dan bermanfaat untuk tanah leluhurnya. Sedangkan motif wisata adalah upaya untuk mensupport pemerintah sehingga wisata di Madina yang potensial bisa dikembangkan untuk menambah Pendapatan Asli Daerah (PAD) dan lapangan kerja. Sarmin Harahap

Segera Usut Dugaan Korupsi Pj. Bupati Nias Barat GUNUNGSITOLI (Waspada): Sejumlah kalangan di Nias mendesak pihak penegak hukum untuk segera menuntaskan kasus dugaaan korupsi miliaran rupiah Pj. Bupati Nias Barat, FD, S.Pd saat menjabat sebagai Kadis Pendidikan Kabupaten Nias Selatan. Selain itu juga diminta untuk mengusut kecurangan pada pelaksanaan seleksi penerimaan CPNS Formasi 2009 dibawah kepemimpinan Pj. Bupati Nias Barat tersebut sehingga menimbulkan kerugian dari ratusan peserta. Berbagai kasus dugaan korupsi yang melibatkan Pj. Bupati Nias Barat, FD, S.Pd terjadi saat dia menjabat sebagai Kadis Pendidikan Kabupaten Nias Selatan. Sesuai temuan BPK RI Cabang Medan pada Tahun Anggaran 2006, terjadi penyalahgunaan anggaran yang belum dipertanggungjawabkan dan pemborosan keuangan negara pada pemberian transportasi dan akomodasi sebesar Rp53.600.000,00 dari biaya jasa pihak ketiga yang dibayarkan kepada pejabat dan staf di lingkungan Dinas Pendidikan Pemerintah Kabupaten Nias Selatan. Dalam penjabaran APBD Tahun Anggaran 2006 telah terealisasi biaya perjalanan dinas dan pada Dinas Pendidikan untuk melaksanakan

kegiatan yang sama. Pada tahun yang sama terjadi dugaan korupsi penyelewengan dana biaya pendidikan pada Dinas Pendidikan Nias Selatan sebesar Rp381.200. 000,00 dengan realisasi 100 persen dari anggaran. Namun dari anggaran itu sebesar Rp216. 000.000 digunakan untuk pembayaran biaya kuliah/SPP bagi 155 mahasiswa PGSD setara D-II selama 2,5 tahun tatap muka kepada pihak UNIMED

padahal belum pernah ada perjanjian kontrak antara Pemkab Nias Barat dengan UNIMED yang mengatur tentang rincian biaya kuliah tersebut. Kasus dugaan korupsi lainnya yang diduga melibatkan Pj. Bupati Nias Barat, FD, S.Pd pada SKPD yang sama sesuai temuan BPK RI Tahun Anggaran 2007 yakni pada pelaksanaan Dana Alokasi Khusus yang diduga belum selesai dilaksanakan. (a35)

Pasien Usus Buntu Kecewa Dipulangkan Dari RS KABANJAHE (Waspada) : Pasien miskin penderita usus buntu terpaksadipulangkandariRSUmumKabanjahe,Selasa(27/4).Suratno, 24, penduduk Aji jahe merasa dikucilkan karena tidak memiliki biaya untuk operasi. Suratno yang sudah hampir seminggu dirawat di RS Umum Kabanjahe untuk menjalani perawatan atas penyakit yang dideritanya, namun dengan berjalannya masa pengobatan yang dialaminya tiba-tiba pihak rumah sakit menyarankan pulang dengan alasan si pasien sudah membaik dan dapat menjalani rawat jalan. Saat wartawan menanyakan hal itu pada pihak rumah sakit, pihak RSUD Kabanjahe mengatakan karena si pasien sudah membaik dan sudah dapat dirawat jalan. Demikian kata Dr Karim Bangun yang menangani pasien selama dirawat di RSUD Kabanjahe. Namun sekira pukul 13:00 Suratno kembali mengalami kesakitan yang lebih parah dan kembali ke RSUD Kabanjahe dengan diantar pihak kepolisian Polres Tanah Karo dan pihak Rumah sakit langsung memberi pertolongan. Pihak RSUD Kabanjahe menyarankan agar pasien segera dirujuk ke Medan untuk dioperasi karena tidak adanya ahli bius di RSUD Kabanjahe. (a17)

Sidang Perkara Pengadaan Pakaian Dinas Dan Atribut PNS

Pengacara Minta Bupati Taput Dihadirkan TARUTUNG (Waspada): PN Tarutung, Jumat (23/4) kembali menggelar sidang perkara pengadaan pakaian dinas PNS dan guru di jajaran Pemkab Taput tahun anggaran 2007 dengan terdakwa I Joni Manalu (Kabag Umper) dan terdakwa II, Renald Manalu (sekretaris panitia) menghadirkan 4 orang saksi. Pengacara terdakwa pada saat acara pemeriksaan saksi meminta kepada majelis agar memerintahkan JPU untuk menghadirkan Bupati Taput dalam perkara itu. Sidang dipimpin hakim ketua Gosen Butar-butar dan dua anggota masing-masing Derman Nababan, SH.M.Hum dan Paul Belmando Pane, SH. MHum dibantu Panitera Pengganti (PP) Anderson Sijabat, SH. Jaksa Penuntut Umum (JPU) masing masing Marcos Simaremare, SH.M.Hum, RA. Kataren SH, RO. Damanik SH. Terdakwa pertama didampingi pengacara Rinaldi, SH, dkk sementara terdakwa kedua didampingi Raja Induk Sitompul, SH, Tongam Manalu, SH. Sidang dihadiri puluhan pengunjung dengan agenda pemeriksaan terhadap empat orang saksi. JPU dalam surat dakwaannya menyatakan terdakwa de-

ngan sengaja telah merugikan keuangan negara untuk kepentingan pribadinya serta saksi Drs NSB, MM (kontraktor) dari pos APBD Taput tahun 2007, untuk pengadaan pakaian dinas dan atribut bagi PNS/CPNS/tenaga administrasi dan guru tahun 2007 sebesar Rp 373. 233. 831. Proyek itu antara lain pengadaan pakaian dinas PNS dan atribut sebanyak 2.500 stel, Rp 380 juta. Pengadaan pakaian dinas guru dan tenaga administrasi sekolah sebanyak 3768 stel, Rp501. 144. 000 dan pengadaan pakaian dinas guru swasta dan atribut 2025 stel Rp. 269 juta. Di persidangan sebelunya terungkap ersangka I, adalah selaku wakil ketua panitia pelelangan barang dan terdakwa II, adalah sekretaris panitia lelang. (SK Bupati Taput N).117/2007, tertanggal 7 Juni 2007, bersama saksi Drs NSB,MM selaku Direktur CV PA/pemborong. Namun pelelangan gagal karena tidak ada perusahaan yang memenuhi syarat spesifikasi. Dan akhirnya kedua terdakwa-terdakwa dengan kemauan sendiri membeli barang pakaian dinas ke Jakarta . Sebanyak empat orang saksi telah memberikan kesaksian yang berbeda. Keempat saksi antara lain Amrizal (kontraktor),

Charles Silalahi (staf Bank Sumut cabang Tarutung, Rindu Sianturi (kuasa bendahara umum) Dispenloka Taput dan Ir. James Simanjuntak (kadis Dipenloka Taput). Saksi Amrizal dalam keterangannya mengakui seluruh dokumen lelang termasuk kontrak ditandatangani di Medan bukan di kantor Bagian Umum Pemkab Taput. Dan saksi juga mengakui telah terjadi proses negoisasi/ proyek. Kata saksi pihaknya selaku peserta pelelangan pengadaan pakaian dinas PNS Taput benar ada menerima uang (fee) sebesar Rp juta dari panitia, dan uang diterima saksi dari Nelson (pemenang proyek bermasalah). Saksi Charles Silalahi mengakui tidak mengenal terdakwa I dan II. Saksi hanya berkapasitas sebagai pelayan transaksi rekening koran atas rekening Pemkab Taput. Saksi mengakui telah terjadi penarikan uang oleh Nelson sebesar Rp440 juta, melalui transfer dari Bank Sumut cabang Tarutung ke bank Sumut cabang USU Medan, pada Desember 2007. Dalam persidangan terdengar ada bantahan dari terdakwa I, II atas kesaksian dari para saksi. Sedangkan Sidang ditunda hingga Kamis (29/4). (c12)

GUNUNGSITOLI (Waspada): Kejaksaan Negeri Gunungsitoli seksi pidana khusus mulai melakukan pemeriksaan terhadap orang yang diduga terlibat padakasusdugaankorupsipelaksanaanproyekRehabilitasiRekonstruksi Kepulauan Nias (RRKN) Tahun Anggaran 2009 yang telah dilaporkan oleh masyarakat. Pihak Kejari Gunungsitoli, Senin (26/4) Seksi Pidana Khusus mulai melakukan pemeriksaan terhadap Direktur PT Ledy, AZ selaku kontraktor pelaksana yang didugaterlibatdalamkasustindak pidana korupsi paket proyek RRKN Pekerjaan Lanjutan Pembangunan Jalan Ruas Sawo-Botombawo-Bogali Kecamatan Sawo dan Kecamatan Sitolu Ori Kabupaten Nias Utara senilai Rp.2,5 miliar. Direktur PT Ledy, AZ mulai diperiksa langsung oleh Kasi Pidsus,NoferiusLombu,SHsekira pukul 10:00 di ruang Seksi Pidana Khusus Kejari Gunungsitoli. AZ diperiksa atas laporan masyarakat kepada Kejari Gunungsitoli terhadap pelaksanaan proyek pembangunan jalan ruas Sawo-Botombawo-Bogali Satker RRKN dari sumber dana APBN 2009 senilai Rp. 2,5 miliar. Pada

pelaksanaan proyek diduga terindikasi tindak pidana korupsi dengan melakukan mark up dan dilakukanpembayaranpekerjaan 100persenpadahalfaktalapangan belum selesai tepat waktu. Disebutkan pada akhir Desember 2009 pekerjaan telah dilaporkantelahselesai100persen sesuai PHO atau berita acara serahterimayangditandatangani Direktur PT Ledy, AZ, Konsultan Pengawas PT Citra Diecona Consultant, Ir. YMS, PPK Jalan dan Jembatan , BN, ST, ME, dan Kasatker RRKN, Ir. BS. Dari hasil laporanmasyaraktdanfaktalapangan pada Januari 2010 pekerjaan proyek dimaksud baru mencapai 90 persen. Data yang didapatkan pada 31 Agustus 2009 Direktur PT. Ledy, AZ mengajukan CCO perubahan item pekerjaan yang sebelumnya tidak tercantum dalam kontrak perubahan sekaligus harga satuan baru yang disetujui PPK Jalan dan Jembatan RRKN Nias, BN, ST, ME serta pernyataan dari Panitia Peneliti Kontrak dan Konsultan Pengawas yang ditindak lanjuti persetujuan CCO pada 30 September 2009. Pada kasus dugaan korupsi proyek RRKN ini terungkap harga

yang diajukan rekanan pasca penawaran rata-rata melebihi HPSatauOEdantidakberdasrkan analisa lapangan dengan mark up yang bertujuan menguntungkan kotraktor secara sepihak. Lebih tingginya harga yang diajukan kontraktor pada pemasukan penawaran saat pelelangan sebelumnya dari HPS atau OE dengan keputusan panitia tender memenangkan PT Ledy untuk mengerjakan paket proyek tersebut merupakansuatukeputusanmelawan hukum dan terkesan sengaja diposisikan sebagai pemenang dengan tidak berdasarkan penilaian pada proses tender dan evaluasi. PHOyangdibuattidakberdasarkan keadaan atau kondisi pekerjaan yang sebenarnya pada akhir Desember 2009 maupun mark up harga volume dan CCO melebihi20persenatasperubahan analisa harga satuan patut diduga PPK, Kasatker RRKN , TimTeknis danTimPHOkonsultansupervisi, Pengawas lapangan, Panitia Peneliti Kontrak bekerjasama kontraktor Pelaksana secara bersama-sama melakukan tindak pidana korupsi. Masyarakat juga menduga praktek KKN tidak hanya terjadi

pada paket proyek dimaksud tetapi terindikasi kuat terjadi hal yang sama dilakukan pada 12 paket proyek RRKN lainnya. Untuk itu pihak penegak hukum diminta agar melakukan penyelidikan terhadap 12 paket proyek RRKN lainnya pada tahun yang sama serta memeriksa semua pihak yang diduga terlibat yang dapat merugikan keuangan negara miliaran rupiah. Plt Kajari Gunungsitoli melalui Kasi Pidsus, Noferius Lembu, SH yang dikonfirmasi Waspada, Selasa (27/4) membenarkan pihaknya mulai memeriksa sejumlah pihak terkait dugaan tindakpidanakorupsipelaksanaan

proyek RRKN 2009. Noferius mengungkapkanpihaknyamulaimengusut kasus itu. Selain kontraktor pelaksana, Seksi Pidana Khusus Kejari Gunungsitoli juga melakukan pemeriksaan terhadap PPK Jalan dan Jembatan Satker RRKN, BN, ST, ME dan Kasatker RRKN, Ir. BS, MT Selasa (27/4). Seterusnya untuk mengungkap kasus dugaan korupsi ini Kejari Gunungsitoli akan melakukan pemeriksaan terhadap sejumlahorangyangterlibatpada pelaksanaan 13 paket proyek tersebut diantaranya konsultan, pengawas lapangan, panitia peneliti kontrak, tim teknis dan Kasatker RRKN.(a35)

Pencuri Material Bangunan Gereja Ditangkap TARUTUNG (Waspada): HSP,19, satu dari lima pelaku pencurian material pembangunan Gereja Katolik Ortodokss Lubuk Pakam, (Deliserdang) ditangkap dan diamankan Tim Serse Polsek Sipoholon, Selasa (27/4), sekira pukul 12:00 di salah satu door smer Pansur Sitandiang, Kecamatan Sipoholon, Taput. “Tersangka HSP kita tangkap, karena adanya laporan dari pihak gereja. Pihak gereja memberikan informasi ke kita, mereka kehilangan besi beton yang diperuntukkan untuk pembangunan Gereja Ortodoks Lubuk Pakam dan pelaku HSP kabur ke wilayah hukum Polsek Sipoholon,� terang Kapolsek Sipoholon AKP. RL Hoetagaol didampingi Kanit Reskrim Bripka W. Barimbing, Selasa (27/4), di Sipoholon. KataW. Berimbing, tersangka dijerat pasal 363 junto 55, 56 KUHP, dengan ancaman penjara maksimal 7 tahun. (c12)


Sumatera Utara

B10

WASPADA Rabu 28 April 2010

Dua Terdakwa Penganiaya Wartawan Divonis Beda

Mantan Lurah Bebas, Mantan Kabag Umum 12 Tahun Penjara TANJUNGBALAI (Waspada): Dua mantan pejabat Pemko Tanjungbalai yang disidang dalam perkara penganiayaan wartawan, divonis berbeda pada persidangan di Pengadilan Negeri setempat, Selasa (27/ 4). Sidang Mantan Lurah Karya Kecamatan Tanjungbalai Selatan, Baharuddin Sinaga, dinyatakan bebas, karena dakwaan primair, subsidair, lebih subsidair, dan lebih subsidair lagi, tidak terbukti. “ Terdakwa Baharuddin Sinaga, tidak terbukti secara sah dan meyakinkan bersalah melakukan tindak pidana penganiayaan berencana dan bersama-sama yang mengakibatkan korban Imbang Tua Siregar cacat permanen,” ucap Majelis Hakim. Oleh sebab itu, kata Hakim, terdakwa dibebaskan dari segala dakwaan, dan dipulihkan kembali nama dan jabatannya serta memerintahkan agar terdakwa dikeluarkan dari tahanan. Atas putusan itu, penasehat hukum terdakwa menyatakan pikirpikir, begitu juga dengan Jaksa

Penuntut Umum, Karyawan Sagala. Sementara, mantan Kabag Umum yang disidang dalam perkara sama, Dahniel, dijatuhi hukuman penjara selama 12 tahun. Dalam amar putusannya, Majelis Hakim Djoni Iswantoro dibantu hakim anggota Nurhadi dan As’ad Rahim Lubis, Panitera Pengganti Maraden Silalahi, menyatakan terdakwa Dahniel terbukti secara sah dan meyakinkan telah melakukan tindak pidana berencana dan bersama-sama sehingga mengakibatkan korban Imbang Tua cacat permanen, sesuai pasal 355 ayat 1 JUHPidana jo pasal 55 ayat 1 ke-2 KUHPidana. Majelis hakim mengatakan, tidak ada yang meringankan terdakwa Dahniel, sedangkan yang memberatkan, korban mengalami cacat berat dan permanen, terdakwa berstatus PNS, perbuatannya meresahkan masyarakat, dan terdakwa tidak merasa bersalah. Atas putusan majelis hakim itu, terdakwa Dahniel langsung menyatakan banding, sementara Jaksa Penuntut Umum hanya menyatakan pikir-pikir. Seusai sidang, korban Imbang Tua Siregar, mengatakan, supremasi hukum di Pengadilan

Negeri Kota Tanjungbalai belum dijalankan secara adil. “ Saya mengikuti sampai sidang ke 16, dan terdakwa Baharuddin Sinaga mengakui perbuatannya mencarikan eksekutor kepada terdakwa Dahniel untuk menganiayaku hingga cacat permanen. Saya tidak terima putusan itu,” kata Imbang Tua Siregar. Sidang sebelumnya, Majelis Hakim Pengadilan Negeri Kota Tanjungbalai menjatuhkan vonis masing-masing 12 tahun penjara kepada dua eksekutor penganiaya wartawan, Senin (26/4).Terdakwa Syamsul Fadli Sinaga alias Syamsul dan Muhammad Syafii Siagian alias Fii, dinyatakan bersalah dalam kasus penganiayaan terhadap wartawan, Imbang Tua Siregar, Januari 2009 lalu. Kedua terdakwa dinilai majelis hakim terbukti secara sah dan meyakinkan telah melakukan tindak pidana berencana dan bersama-sama sehingga mengakibatkan korban Imbang Tua cacat permanen, sesuai pasal 355 ayat 1 JUHPidana jo pasal 55 ayat 1 ke-1 KUHPidana. Atas dasar itulah, majelis hakim diketuai Djoni Iswantoro dibantu hakim anggota Nurhadi dan As’ad Rahim Lubis, Panitera

Waspada/Ist

POLTAN : Penduduk Tanjungbalai, tak perlu jauh-jauh lagi melanjutkan pendidikan ke perguruan tinggi, karena sejak 2008 lalu telah berdiri Politeknik Tanjungbalai dengan fasilitas lengkap dan tenaga pengajar berkualitas.

Mengangkat Mutu Pendidikan Tanjungbalai PENDIDIKAN, kunci utama membangun negeri dan mengejar ketertinggalan. Membangun pendidikan berkualitas, butuh kesungguhan dan kesadaran penuh. Hal inilah yang disadari penuh oleh dr H Sutrisno Hadi, SpOG. Makanya, dalam kurun waktu sepuluh tahun menjabat sebagai Walikota, mantan dokter desa itu, membangun pendidikan di Kota Tanjungbalai dengan sungguh-sungguh. Misinya, meningkatkan pemerataan dan kesempatan memperoleh pendidikan, meningkatkan mutu pendidikan, meningkatkan sarana dan prasarana serta manajemen pendidikan, dan meningkatkan kesadaran maupun kemauan warga mendapatkan pendidikan berkualitas. Teori yang dibarengi realisasi itu, membuat kondisi pendidikan di kota kerang itu cukup menggembirakan. Program pembangunan pendidikan kian mengembangkan suasana belajar mengajar di berbagai jenis dan jenjang pendidikan, bahkan pelayanan pendidikan telah terjangkau di seluruh wilayah administrasi Tanjungbalai. Kini, sekolah formal di Kota Tanjungbalai berjumlah 147 unit, 24 di antaranya sekolah menengah atas atau sedejat, terdiri atas 10 SMA, 5 SMK, dan 7 MA. Ratusan sekolah itu tersebar di seluruh kecamatan, dengan jumlah siswa untuk SMA/ sederajat pada tahun 2006/2007 adalah 7.128 dan 4.173 di antaranya siswa SMU, 1461 SMK, dan 1.494 siswa MA. “ Upaya meningkatkan kesejahteraan warga Tanjungbalai, Pemerintah Kota menyediakan berbagai sarana fisik pendidikan, di antaranya keberadaan sekolah negeri mulai tingkat SD sampai SMA di seluruh kecamatan, serta pendirian Politeknik Negeri,” kataWalikota Tanjungbalai, Sutrisno Hadi. Perguruan Tinggi Menurut Sutrisno Hadi,

untuk mewujudkan Tanjungbalai sebagai pusat pendidikan, tidak cukup dengan keberadaan TK, SD, SMP, dan SMA di seluruh kecamatan, tapi juga harus ada aksesibilitas yang mudah bagi masyarakatnya untuk melanjutkan pendidikan ke tingkat perguruan tinggi. Oleh sebab itu, Sutrisno pun menggebrak dunia pendidikan Sumut dengan mendirikan Politeknik Tanjungbalai (Poltan) berdasarkan SK Operasional No 105/D/O/2008 tentang Pembangunan Politeknik Tanjungbalai (Poltan) yang dikeluarkan oleh Mendiknas, kala itu dijabat Bambang Sudibyo. Pendirian Politeknik Tanjungbalai, sasarannya memberikan kesempatan dan akses lebih luas kepada masyarakat untuk memperoleh pendidikan berkualitas sehingga dapat bersaing di era globalisasi ini. “ Jadi untuk masuk perguruan tinggi dan memperoleh pendidikan yang bagus, penduduk Tanjungbalai tidak perlu pergi ke kota-kota besar, karena sudah ada Politeknik Tanjungbalai yang memiliki fasilitas lengkap,” kata Sutrisno Hadi. Latar belakang utama didirikannya Poltan ini, antara lain mendayagunakan potensi sumber daya alam dan sumber daya Kota Tanjungbalai sekitarnya. Kemudian, permintaan industri nasional dan daerah, penyerapan tenaga kerja serta memberikan kesempatan lapangan kerja baru guna mendukung pertumbuhan ekonomi dan sosial masyarakat. “ Butuh perjalanan panjang ditopang semangat juang tinggi merealisasikan Poltan ini,” kata Sutrisno. Dijelaskan Sutrisno, perjuangan awal, Pemko menyediakan lahan seluas 10 hektare guna membangun gedung perkuliahan. Selain itu, melalui satuan tugas pendirian politeknik, diinventarisir sumberdaya manusia yang akan mendukung penyelenggaraan pendidikan di Politeknik Tanjungbalai. Salah satunya menjalin kerjasama dengan Institut Teknologi Bandung, Universitas Gajah Mada dan Institut Teknologi

Sepuluh November serta USU untuk tenaga pengajar di tiga program studi, yakni Teknik Mesin Perawatan dan Perbaikan, Pendingin dan Pengolahan Hasil Perikanan. Pada tiga tahun pertama, tiap program studi di Poltan hanya akan menerima satu kelas dengan kapasitas masingmasing 30 orang mahasiswa, sehingga diperoleh jumlah mahasiswa pada tahun ketiga sebesar 270 orang. Mulai tahun keempat, Poltan akan menerima dua kelas untuk masing-masing program studi, maka jumlah mahasiswa baru akan menjadi 2x3x30 = 180 orang. “ Pada tahun yang sama juga, Poltan mulai menghasilkan lulusan sebanyak 90 orang. Jadi, jumlah mahasiswa pada tahun tersebut akan menjadi 360 orang. Dan pada tahun 2014-2015, jumlah mahasiswa akan mencapai 540, di mana masing-masing program studi telah memiliki 2 kelas,” kata Sutrisno. Prediksi Sutrisno, jumlah lulusan SMA di Tanjungbalai tahun 2006/2007 adalah 1103 orang, terdiri atas 610 lulusan SMA negeri dan 493 lulusan SMA swasta. Lulusan SMK pada tahun 2006/2007 berjumlah 341, terdiri atas 126 lulusan SMK negeri dan 215 lulusan SMK swasta. “ Jika 20 persen saja lulusan sekolah menengah di Tanjungbalai memilih Poltan sebagai perguruan tinggi tempat mereka melanjutkan pendidikan, maka jumlah peminat akan mencapai 288. Tiga tahun pertama (2008-2011) Politeknik Tanjungbalai hanya akan menerima 90 orang mahasiswa baru, maka tingkat persaingan lulusan sekolah menengah untuk menjadi mahasiswa Politeknik Tanjungbalai adalah 1 : 3,3. Dan, pada tahun keempat dan seterusnya, Poltan diharapkan akan semakin dikenal oleh masyarakat di luar Tanjungbalai, sehingga calon mahasiswa tidak saja datang dari dalam kota, tetapi juga dari luar kota, seperti Labuhanbatu, Serdang Bedagai, Asahan, Tebingtinggi dan Pematangsiantar.” Rahmad F Siregar

Pengganti Maraden Silalahi, dan Jaksa Penuntut Umum Kadlan Sinaga, menjatuhkan putusan 12 tahun penjara. Dalam amar putusannya itu, majelis hakim menilai tidak ada satupun yang meringankan kedua terdakwa. Atas putusan majelis hakim itu, kedua terdakwa menyatakan banding setelah berunding dengan penasehat hukumnya, Berkat Ali,SH. Sementara Jaksa Penuntut Umum, Kadlan Sinaga, masih pikir-pikir. Seusai sidang, penasehat hukum kedua terdakwa, Berkat Ali, mengatakan, putusan majelis hakim bahwa tidak ada yang meringankan kedua terdakwa, sama sekali tidak benar. “ Banyak yang meringankan kedua

terdakwa, di antaranya berterus terang, bahkan korban pun sudah memaafkan kedua terdakwa pada persidangan sebelumnya,” kata Berkat Ali. Penganiayaan terhadap wartawan mingguan, Imbang Tua Siregar, terjadi di Jalan Jenderal Sudirman Km 2, atau di dekat SPBU Kec Datuk Bandar, Jumat, 16 Januari 2009 sekira pukul 22:30. Korban dianiaya dengan cara disiram benda cair H2So4 (asam sulfat) ke wajahnya. Akibat penganiayaan itu, korban tidak mampu beraktivitas seperti biasa, karena cacat tetap total pada wajah, hidung tertutup sebelah, mata kanan tidak dapat melihat, telinga, leher dan sebahagian perut berkerut. (a37)

Waspada/Rahmad F Siregar

BEBAS : Mantan Lurah Karya Kecamatan Tanjungbalai Selatan, Baharuddin Sinaga, divonis bebas oleh majelis hakim PN Tanjungbalai dalam perkara penganiayaan wartawan, Selasa (27/4).


Sumatera Utara

WASPADA Rabu 28 April 2010

Persoalan Konsesi Tapal Batas TPL Dairi Selesai

Waspada/Syarif Ali Usman

SEPI: Ratusan pedagang di arena MTQ XXXII ketar-ketir untuk menghabiskan barang dagangannya. Selain daya beli masyarakat yang rendah, tiap malam hujan deras mengguyur arena tersebut. Seperti pada gambar, barang yang dijajakan sepi pengunjung, Senin (26/4).

Pedagang MTQ Ketar-ketir, Daya Beli Warga Rendah RATUSAN pedagang yang datang dari dalam dan luar daerah untuk mengadu nasib di arena MTQ XXXII tingkat Prov. Sumatera Utara, di Kab. Mandailing Natal, merasa ketar-ketir untuk menghabiskan barang dagangannya. “Pasalnya, tingkat daya beli masyarakat sangat rendah dan ditambah cuaca yang tidak bersahabat di tiap malamnya. Hasil penjualan sejak pembukaan MTQ sangat rendah, bahkan lebih rendah dari MTQ tingkat kabupaten kota,” kata Novis, pedagang aksesoris di kaki lima asal Pekanbaru, Prov. Riau, Senin (26/4). Keresahan pedagang akan rendahnya penjualan tersebut semakin bertambah, setelah adanya informasi yang menyebutkan bahwa arena utama MTQ di lapangan Aek Godang, pada malam penutupan nanti akan dibersihkan dari segala aktifitas pedagang tenda maupun kaki lima. Hal senada diungkapkan Safarin Dalimunthe, pedagang pakaian berlogo MTQ XXXII Sumut dari Medan. Sejak dua hari sebelum pembukaan, dia sudah menggelar dagangannya di seberang jalan arena utama MTQ di Kelurahan Dalan Lidang. Hingga kini separoh modal pun belum didapatnya. Padahal hampir seluruh pakaian anakanak yang dijualnya itu telah disablon MTQ XXXII Sumut. “Kami sangat takut andai pakaian ini tidak laku. Sangat sulit menjualnya di luar daerah, karena sudah disablon logo MTQ XXXI,” tutur pria yang tiap hari tidak pakai alas kaki karena di depan tempat jualannya berlumpur.

Keresahan yang dialami Novis dan Safarin juga dialami Rafi, pedagang mainan anak dari Bukit Tinggi, Prov. Sumatera Barat. Dia menggelar barang dagangannya di bawah tenda utama yang pada pembukaan dan penutupan MTQ akan digunakan sebagai tempat duduk tamu. “Masih payah Bang, sejak enam hari lalu penjualan saya masih Rp 800 ribu. Padahal di MTQ tingkat kabupaten kota saja, dalam enam hari itu sudah bisa mendapat penjualan sekitar Rp 5 juta,” tuturnya sambil memandangi dagangannya yang tidak ada pengunjung. PantauanWaspada, selama pelaksanaan MTQ ini hanya pedagang nasi, makanan, dan minuman yang memperoleh banyak penjualan. Pasalnya, selain melayani pengunjung, para pedagang di MTQ ini juga menjadi langganan tetap mereka. Semua pedagang ini berusaha mengadu nasib di arena MTQ. Mereka telah mengeluarkan banyak uang untuk bisa sampai ker Pasnyabungan, dan modal jualan. Namun akibat tingkat daya beli masyarakat yang rendah dan ditambah guyuran hujan tiap malam, seluruh pedagang yang jumlahnya ratusan orang menjadi ketar-ketir.“Jangankan mendapat untung, mengembalikan modal saja belum tentu bisa,” kata mereka. Karenanya, seluruh pedagang di arena utama MTQ ini memohon kepada panitia pelaksana dan Pemkab Madina agar memberi kesempatan dan fasilitasberjualanpadamerekadimalampenutupan nanti. Sukri Falah Harahap

Masalah Tower PT Smart Di Pematangsiantar Belum Tuntas PEMATANGSIANTAR (Waspada): Masalah pembangunan tower PT Smart di salah satu rumah di Jalan Merdeka, Kota Pematangsiantar belum tunta karena warga sekitar tetap meminta agar tower dibongkar. Hal itu terungkap saat berlangsung pertemuan difasilitasi Komisi I DPRD Pematangsiantar di ruang sidang DPRD, Senin (26/4) dihadiri enam utusan warga Jalan Merdeka, Kel. Dwikora, Kec. Siantar Barat, Edi dan Jamaluddin dan kawankawan mewakili PT Smart, PT TM Brata dan pihak BPPT Pemko masih menemui jalan buntu. Pertemuan dipimpin Ketua Komisi I DPRD Ibnu Harbani dihadiri Lurah Dwikora Alwi, SSTP mencoba mengakomodir keluhan Johan dan kawan-kawan, warga Jalan Merdeka, Edi dan Jamaluddin dari PT Smart dan PT TM Brata serta Sekretaris BPPT Pemko Dra Fatimah Siregar serta pendapat sejumlah anggota Komisi I seperti Ir Rudolf Hutabarat, Rudi Wu, SPd, dr Maruahal Sinaga, SpOG dan H Aulul Imran, SPdI. Johan dengan tegas mengatakan tower yang sudah sempat dibangun di lantai atas rumah salah seorang warga setempat agar dibongkar, karena warga merasa trauma dampak tower bila beroperasi. “Kami trauma bila sewaktu-waktu tower itu bisa ambruk disambar petir,” kata

warga itu. Sementara, Edi dan Jamaluddin dari PT Smart mengutarakan pembangunan itu sudah menerapkan kajian atau analisis cermat, termasuk penerapan tekonologi mengantisipasi seraangan petir. “Bila tower itu diizinkan beroperasi tentu pihak perusahaan akan memenuhi pemberian standar kepada warga setempat seperti asuransi. Perusahaan akan membuka kantor melebarkan usaha,” ujar Edi. Anggota DPRD Aulul Imran, Rudolf Hutabarat, Maruahal Sinaga dan Rudi Wu mencoba memberikan pandangan ke depan apakah penting perangkat provider PT Smart diizinkan dibangun. Sekretaris BPPT Fatimah Siregar mengatakan, PT Smart sudah mengajukan permohonan dengan mendaftarkan surat izin untuk diproses, namun advis planning dari Dinas PU belum ada hingga proses penerbitan izin belum dikeluarkan BPPT. Karena belum ada titik temu, pertemuan berakhir deadlock dan Ketua Komisi I Ibnu Harbani menawarkan kepada pihak-pihak terkait bersedia hadir bila diundang DPRD kembali. Pertemuan yang belum dijadwalkan itu akan menghadirkan Dinas PU, Komisi III DPRD dan ditutup tanpa ada kesimpulan.(a14)

MEDAN(Waspada):Direktur PTToba Pulp Lestari,Tbk, Juanda Panjaitan, SE mengatakan persoalan tapal batas lahan perusahaanitudenganmasyarakatDesa Parbuluan,Dairiakhirnyaberhasil diselesaikan, setelah trayek tata batas konsesi TobaPulp sudah ditandatangani panitia tata batas yang diketuai Bupati. “Saat ini tinggal menunggu penetapannya dari Baplan. Mei atau Juni mungkin sudah akan turun,” kata Juanda didampingi Kepala Seksi Informasi Sumber Daya Hutan BPKH Wilayah-I Medan Ir Ully Budiwanto MM itu ketika menerima kunjungan kerja Komisi B DPRDSU diketuai Layari Sinukaban, di kantor TobaPulp di Uniplaza, Medan, Selasa (27/4). Turut hadir sekretaris Komisi, Aduhot Simamora, dan anggota dewanlainnya, PalarNainggolan, SH, Tiasiah Ritonga, Hj Ida Budiningsih SH, Richard Eddy M Lingga, SE, Taufik Hidayat, Ir Syahrial Harahap, Tohonan Silalahi dan IrWashington Pane, serta Kabid Rehabilitasi Hutan dan Lahan Dishut Sumut , Ir Didim Ilyas MSi dan Kasie Rehabilitasi, Ir Herianto, MSi. Dalam pertemuan itu, Ully Budiwanto menunjukkan garis batas tanah diatas peta trayek tata batas berskala 1:25.000 yang disaksikanseluruhanggotaKomisi

B DPRD Sumut. Menanggapi penjelasan itu, Ketua Komisi, Layari Sinukaban mengatakan masalah konsesi TobaPulp di Dairi sudah clear (jelas). Karena tinggal menunggu penetapan Jakarta untuk dijalankan tata batas sesegera mungkin. Layari berharap dengan adanya penata-batasan garis pemisahyangjelasdankasatmata antara konsesiTobaPulp dengan lahan masyarakat, dapat menetramkan hati masyarakat, pemerintah dan juga pengusaha. “Komisi B mendukung sepenuhnya proses-proses bisnis yang legal dan memenuhi aturan main,” katanya. Kunjungan kerja ke kantor Tobapulp tersebut merupakan lanjutandarikunjunganlangsung yang dilakukan Komisi B ke Desa Parbuluan, Dairi pada, Selasa (6/ 4) lalu. Dalam kunjungan itu mereka sempat melakukan rapat dengar pendapat (hearing) di ruang rapat kantorWakil Bupati Dairi, di Sidikalang, yang dihadiri Wakil Bupati Irwansyah Pasi, serta anggota Komisi B DPRD Dairi, perwakilan masyarakat yang pro dan kontra terhadap keberadaan HTI (hutan tanaman industri) TobaPulp dan timTobaPulp sendiri yang dipimpin langsung Juanda Panjaitan. Dalam sesi perdebatan diketahui, tata batas konsesi lah yang

menjadi salah satu sumber sekaligus kunci pemecahan persoalan yang terjadi di daerah itu. Karena masyarakat mengklaim areal kerja perusahaan masuk dalam tanah ulayat atau dalam bahasa lokal “tombak raja” masyarakat. Karenaitu,dalampertemuan itu DPRD Sumut mendesak pihak berkompeten agar tata batas secepatnya diwujudkan guna menghindari eskalasi masalahyangtidakperludilapangan. Pemkab Dairi dan pihak-pihak terkait, termasuk TobaPulp, juga diminta agar merespons keinginan“damai kembali” masyarakat Parbuluan yang sempat terpolarisasi akibat perbedaan sikap (pro-kontra) terhadap keberadaan TobaPulp. Dalam peninjauan ke Parbuluan, DPRD Sumut juga tidak menemukan adanya penyimpangan kinerja TobaPulp. Sebab areal kerja perusahaan berada di dalam RKT (rencana kerja tahunan) yang disahkan, serta dijalankan sesuai ketentuan izin. DPRD Sumut juga berharap TobaPulp selaku perusahaan berskala global— bersedia melakukan terobosan dalam membantu meningkatkan kesejahteraan masyarakat sekitar hutan, misalnya membina sampai berhasil penanaman tanaman unggul. (h11)

Perlu Pengawasan Proyek Jalan Negara Kabanjahe-Merek KABANJAHE (Waspada): Sejak beberapa hari lalu, pihak rekanan mulai mengerjakan proyekdijalannegaraKabanjaheMerek yang sudah lama mengalami kerusakan yang cukup parah. Namun untuk menghindari terjadinya penyimpangan pengerjaan di lapangan, pihak berkompeten perlu mengadakan pengawasan di lapangan. Karena ada dugaan di titiktitik tertentu pengerjaannya tidak sesuai dengan spesifikasi teknis pekerjaan. Antara lain pelapisan badan jalan dengan aspal hotmix dilakukan tanpa mengadakan penyisipan dengan pengerasan alat berat yang standar dan pengaspalanpadalubang-lubangyang ada. Pekerjaan antara lain, perbaikan parit beton yang rusak, penimbunan beram jalan yang berlobang dan pengaspalan ba-

dan jalan di titik-titik tertentu, terutama di kilometer 76 hingga 78 di Kecamatan Kabanjahe. Menurut warga setempat, lubang-lubang di badan jalan yang mengalami penurunan hanyaditimbundenganbatusirtu dan digilas dengan mesin penggilas ukuran satu ton. Selanjutnya ditimpa dengan aspal hotmix. Ada dugaan warga, mekanisme dan teknis yang dilaksanakan tersebut tidak sesuai dengan yang sebenarnya. Karena menurut warga sesuai dengan pengamatannyaselamaini,untukpengerjaan pelapisan badan jalan, terlebih dahulu dilakukan penyisipan badan jalan yang berlobang dengan batu yang digilas dan di ikat aspal curah. Sedangkan pengerjaan pelapisan badan jalan antara kilometer 76 hingga kilometer 78, persisnya dekat simpang gedung

zentrum GBKP hingga jembatan Lau Dah Kabanjahe, pelapisan badan jalan dengan aspal hitmix, tanpa terlebih dahulu menyisip atau mengaspal badan jalan yang berlobang. Sehingga diduga ada penyimpangan. Untuk itu warga mengharapkan pihak berkompeten ke lapanganuntukmengawasipelaksaan proyek jalan Kabanjahe-Merek tersebut. Anggota DPRD Sumut Ricard E Lingga yang dihubungi wartawan melalui telefon, Selasa (27/4) mengatakan, pihak kontraktor atau rekanan harus melaksanakan pekerjaan sesuai denganbestekataupunspesifikasi teknik pekerjaan. Menyinggungtentangpengawasan lapangan,dia mengatakan semua pihak berhak untuk mengawasi pekerjaan proyek yang dananyabersumberdarianggaran negara atau pemerintah. (c06)

Merampok, Oknum Mahasiswa Babak Belur Dihajar Massa P. SIANTAR ( Waspada): Seorang mahasiswa IMT, 20, warga JalanTerong, Kel.Tomuan, Kec.Siantar Timur, Kota Pematangsiantar bersama MR, 14, warga Jalan Kasti, Kel.Bantan, Kec.Siantar Barat, merampok seorang ibu rumah tangga. Saat mengebut dengan sepedamotornya,tiba-tibasepeda motor dikemudikan IMT selip dan terjatuh hingga keduanya menjadi bulanan-bulanan warga dam babak belur dihajar massa. Polisiyangmenerimalaporan tentang perampokan itu tiba dan mengamankan keduanya dari amukan massa .

Perampokan itu terjadi terhadap korban Rumondang Sihombing, 55, warga Jalan Bah Bolon, Kel.Sigulanggulang, Kec.SiantarUtara,saatitu melintas di Jalan Sisingamangaraja Atas, persis di samping Mapolresta Pematangsiantar, Senin (26/4) pukul 22:30. Saat itu, korban dengan mengendarai sepeda motor hendak kembali ke rumahnya. Tiba-tiba dari arah Jalan Rakutta Sembiring meluncur sepeda motor yang dikemudikan IMT

denganmemboncengMR.Ketika berpapasan,MRmenariktasmilik korban yang digantung di stang sepeda motor dan IMT segera tancap gas menuju arah Jalan Sisingamangaraja Bawah. Kapolresta AKBP Fatori SIK saat dikonfirmasi melalui Pabungpen AKP Muslim dan Kasat Reskrim AKP AY Harahap di Mapolresta, Selasa (27/4) menyebutkan keduanya diduga melakukan pencurian sesuai Pasal 363 (1) ke 4e KUH Pidana. (a14)

B11 199 Peserta UN SMA/SMK Di Karo Tidak Lulus KABANJAHE (Waspada): Dari 3.916 siswa peserta Ujian Nasional (UN) tingkat SMA/SMK dan Madrasah Aliyah (MA) sederajat di Kabupaten Karo, tercatat 199 siswa peserta dinyatakan tidak lulus. Di SMA Negeri 1 Kabanjahe, pengumuman disampaikan kepada orangtuasiswa/walimelaluisurat.Parasiswayanglulusmelampiaskan kegembirannya dengan bersorak gembira seraya memeluk orang tuanya maupun sesama teman begitu mengetahui lulus UN. Namun sebaliknya di sejumlah sekolah lain ada juga siswa yang terisak-isak menangis karena tidak lulus UN. Orang tuanya dan teman-temannya yang lain berusaha menenangkannya dengan mengatakan masih ada kesempatan untuk mengikuti ujian ulangan. Kepala Dinas Pendidikan Kabupaten Karo Drs Seruan Sembiring melalui Kabid Pendidikan Menengah Drs Sugianta Ginting, Senin (26/4) di ruang kerjanya mengatakan, dibanding tahun lalu tingkat kelulusan UN SMA tahun ini meningkat. Namun untuk SMK kelulusan tahun ini menurun untuk mata ujian baru, yaitu teori kejuruan. Adapun kelulusan UN 2010 tingkat SMA/SMK dan MA sederajat di Karo adalah, tingkat SMA peserta UN jurusan IPA jumlah peserta 1.382 siswa, lulus 1.362 siswa, tidak lulus 20 siswa, persentase kelulusan 98,55 persen. SMA jurusan IPS peserta sebanyak 1.271, lulus 1.238, tidak lulus 33 siswa, persentase kelulusan 97, 40 persen. Madrasah Aliyah (MA), jurusan IPA peserta sebanyak 24 siswa, lulusan 24 siswa, persentase kelulusan 100 persen, jurusan IPS 99 siswa,tidaklulus29siswa,persentasekelulusan70,70persen.Sedangkan untuk Sekolah Menengah Kejuruan (SMK) peserta UN sebanyak 1.140, lulus 1.023 siswa, tidak lulus 117 siswa, persentase kelulusan 89,9 persen. Dikatakan, sesuai Petunjuk Operasional Standar (POS) Ujian Nasional (UN) 2010, bagi siswa yang tidak lulus UN diberi kesempatan untuk mengikuti ujian ulangan yang akan dilaksankan 10 Mei 2010. Sementara dari Berastagi, hasil pengumuman terakhir di STMN 1 Berastagi, dengan dihadirkan perwakilan orang tua murid yang begitu antusias untuk mengetahui kelulusan anaknya. Dari seluruh siswa–siswi STMN 1 berjumlah 270, namun yang hadir mengikuti ujian sekitar 260, dan yang tidak lulus 35 murid dari jurusan Listrik 17 siswa, jurusan Bangunan 10, jurusan Lokomotif 6, jurusan elektro 2 siswa. KepalaSekolahSTMN1BerastagiSedekGinting,SPd,mengatakan, jumlah kelulusan tahun ini lebih banyak sekitar 64,5 persen dibanding tahun lalu. (c06a17)

463 Peserta UN Di Taput Tidak Lulus TARUTUNG (Waspada): Dari 5.376 peserta Ujian Nasional (UN) setingkat SM dan SMK se-Taput 463 orang dinyatakan tidak lulus atau sebesar 8, 60 persen. Demikian Kadiknas Taput Mariani, MPd, melalui Kabag Humas dan Keprotokolan PemkabTaput Jahormat Lumbangaol SH, kepada Waspada, Selasa (27/4) di Tarutung. Berdasarkan daftar kelulusan yang ditandatangani Kadiknas Taput tanggal 26 April 2010, persentase tidak lulus lebih banyak pada SMK dibanding SMA. Untuk tingkat SMA jumlah yang tidak lulus sebanyak 19 orang, atau persen dari jumlah peserta UN sebanyak 3.515 orang, atau 0.55 persen. Untuk SMK yang tidak lulus sebanyak 444 dari jumlah peserta UN 1.861 orang atau 23,86 persen. Persentase kelulusan UN SMA/MA dan SMK di Taput tahun 2009/2010 menurun bila dibandingkan pada tahun kurikulum 2008/ 2009. (c12)

Tingkat Kelulusan SMA Di Pakpak Bharat 99,2 Persen SALAK, Pakpak Bharat (Waspada) :Tingkat kelulusan siswa Sekolah Menengah Atas (SMA) se-Kabupaten Pakpak Bharat tercatat 99,2 persen. Sedikitnya 367 dari 370 siswa/siswi yang mengikuti UN dinyatakan lulus. Tiga siswa yang tidak lulus itu berasal dari SMA Kerajaan. Sementara di SMK Kecupak, dari 130 siswa yang mengikuti UAN yang lulus hanya 108 siswa atau 83,4 persen. Demikian data yang diperoleh dari Kabid Pendidikan Menengah Dinas Pendidikan Pemkab Pakpak BharatViktor Sinamo yang diterima wartawan, Senin (26/4) di Salak. Menurutnya, kelulusan yang diraih para siswa SMA pada tahun ajaran ini mengalami peningkatan dari tahun sebelumnya. (c08)

Conrad Jangan Asbun MEDAN (Waspada): Ketua DPD FSPSI-KSPTI Sumut Sugianto Situmeang, SH mengatakan, Condrat P. Nainggolan jangan asal bunyi (Asbun). “Kita mempersilahkan saudara Condrat P. Nainggolan apabila SPSI bapak Yacob Nua Wea ilegal laporan saja ke pihak berwajib,” tegas Sugianto Situmeang di skcretariat DPD FSPSI-KSPTI di Jalan SM Raja Medan, Selasa (27/4). Pernyataan ini disampaikan Situmeang, karena ada statemen yang bersangkutan menyebutkan FSPSI-KSPTI versi Yacob Nua Wea ilegal saat berada di P. Siantar membuka Muscab V di kota itu. “Saya sangat menyayangkan seorang anggota dewan membuat pernyataan di salah satu media tanpa ada bukti dan saya menganggap saudara Condrat kurang sehat pikirannya,” tegas Situmeang. Menyikapi pernyataan ini Sugianto Situmeang dalam waktu dekat akan mengambil langkah-langkah hukum terhadap yang bersangkutan tentang pernyataannya yang menyatakan SPSI pimpinan Yacob Nua Wea ilegal. “Saya akan membuat laporan ke pihak berwajib karena sudah cukup bukti,” jelasnya. (m39)


B12 Salahi Aturan, Kontraktor Desak Pelelangan Diulang MEDAN (Waspada) : Pengusaha konstruksi di Medan meminta penetapan pemenang pelelangan proyek jasa pelaksana konstruksi pembuatan IntakedanBendungdiSungaiBinjai,Bingeiagardilakukan pelelangan ulang. Hal itu terkait dengan terjadi rekayasa dan pelanggaran terhadap UU No. 5/1999 tentang praktik monopoli dan persaingan usaha tidak sehat dan UU Jasa Konstruksi No. 18/1999 dan Keppres No. 80/2003 tentang tata cara pengadaan barang dan jasa pemerintah. Effendy, Dirut PT Tombang di Medan, kemarin, menyatakan, pelelangan proyek konstruksi pembuatan Intake dan Bendung di Sungai Binjai, Bingei telah terjadi pelanggaran, dimana panitia menunjukkan perusahaan pemenang yang tidak kredibel. “Pemenang yang diumumkan panitia merupakan perusahaan yang tidak memiliki surat izin tempat usaha (SITU) dan Izin Gangguan (HO) dari Pemko Medan. Padahal, perusahaan berada di kota Medan,” ujar dia. Hal ini, jelasnya, telah melanggar undang-undang dan peraturan tentang perseroan terbatas (PT) atau sesuai dengan Perlem 11a/ 2008 dimana badan usaha nasional yang berbadan hukum adalah perseroan terbatas. “Selain itu, sesuai dengan Keppres 80/2003, sebelum menetapkan pemenang, panitia harus melakukan pembuktian kualifikasi dengan uji kompetensi di lapangan yang ditujukan kepada calon pemenang lelang,” ujarnya. Namun, lanjutnya hal ini tidak ditemukan did alam pelelangan proyek tersebut. “Kami telah membuat surat sanggahan No. 59/ PT.T.SGH/IV/2010 yang ditujukan kepada pejabat pembuat komitmen dengan tembusan pengembangan ari batu SNVT, pelaksana pengelola SDA Sumatera II, Provinsi Sumatera Utara, Balai Wilayah Sungai Sumatera II,” lanjutnya. Ketua Aspekindo Sumut, Binsar Marbun menyatakan, sesuai data pengalaman perusahaan pemenang lelang yang tercantum di website LPJKN yang menandatangani kontrak adalah orang yang pernah menjadi pengurus sesuai akte perubahan perusahaan. “Namun orang-orang yang tercantum di dalam kontrak tidak dimasukkan atau dimunculkan dalam susunan pengurus perusahaan. Berarti ada indikasi monopoli pemenang, menyalahi data dan merugikan Pemko Medan,” ujarnya. Dengan demikian, lanjutnya, kita mendesak agar hal itu dilakukan proses ulang sesuai dengan undang-undang atau peraturan yang berlaku sesuai dengan tata laksana pelelangan proyek jasa konstruksi. “Jika hal ini tetap dilangsungkan, Aspekindo akan mendesak KPPU (Komisi Pengawas Persaingan Usaha) untuk meninjau pelaksanaan lelang,” lanjutnya kembali. (m38)

Otda Alami Pasang Surut TARUTUNG (Waspada): Menteri Dalam Negeri (Mendagri) Gamawan Fauzi dalam sambutan tertulis dibacakan Asisten I Pemkab Taput Poltak Tambunan dalam peringatan Otda XIV di Tarutung, Senin (26/4), mengatakan, desentralisasi dan Otda mengalami pasang surut sesuai dinamika politik, ekonomi dan sosial. SambutanMendagriitudisampaikanpadaapelpagiPNSSetdakab Taput serangkaian peringatan Otonomi Daerah (Otda). Menurut Gamawan, hingga 2009 jumlah daerah otonom di Indonesia 5245. Itu terdiri dari 33 provinsi, 398 kabupaten, 93 kota, 5 kota administrasi dan 1 kabupaten administrasi. ‘’Sejak 1999 sampai saat ini 205 daerah otonom baru telah terbentuk,’’ katanya. (c12)

Saleh Adri Ketua STAI UISU P.Siantar Periode 2010-2014 PEMATANGSIANTAR (Waspada): Ketua Umum Yayasan UISU Prof Dr H. Usman Pelly, MA melantik dan mengambil sumpah Saleh Adri, SAg.MA sebagai Ketua STAI UISU Pematangsiantar periode 2010-2014 menggantikan Dra Rokiba Hasibuan , MA . Pengambilan sumpah dan pelantikan itu berlangsung di kampus STAI UISU di Jalan Asahan, Pematangsiantar berdasarkan SK No. 20 tahun 2010 tanggal 21 April 2010, ditandatangani Ketua Umum Yayasan UISU dan Sekretaris Umum Muhammad Idris, MA yang dibacakan Ketua Badan PerwakilanYayasan UISU Pematangsiantar Dewi Kirana, SE.MM. Hadir saat itu, para pengurus Yayasan UISU, mewakili Kakan Depag, mewakili Kadis Pendidikan, keluarga besar alumni STAI UISU, seluruh jajaran dosen, para kepala madrasah/sekolah, pengurus senat, para mahasiwa dan undangan lainnya. (a14)

Sumatera Utara

WASPADA Rabu 28 April 2010

Kisruh Pasar Sangkumpal Bonang, DPRD Surati Lagi Walikota P. Sidimpuan P.SIDIMPUAN (Waspada): DPRD Kota Padangsidimpuan akan menyurati kembali Walikota Padangsidimpuan Drs H Zulkarnaen Nasution, MM, menyangkut status Pasar Sangkumpal Bonang. Hingga sekarang, status pengelola sah pasar itu belum jelas. Padahal, kontrak kerjasama Pemko Padangsidimpuan dengan PT Anugrah Tetap Cemerlang (ATC) selaku rekanan berakhir 13 Januari 2010.

Hampir tiga bulan lebih status Pasar Sangkumpal Bonang masih “abu-abu”. Walaupun aktivitas pedagang tetap berjalan seperti biasa, namun kondisi itu mengundang image negatif warga Kota Padangsidimpuan terhadap lembaga eksekutif maupun legislatif. Bahkan, kalangan mahasiswa dari berbagai elemen dan Lembaga Swadaya Masyarakat (LSM) di kota salak itu, sering menggelar aksi unjuk rasa aki-

bat kecewa dengan kinerja kedua institusi pemerintah,yang dinilai lamban dalam menuntaskan persoalan pasar. “Kitarencanakanhariini,surat ke Walikota Padangsidimpuan akan disampaikan,” jelas Ketua DPRD Kota Padangsi-dimpuan Aswar Syamsi, SE, kepada Waspada, Selasa (27/4) di ruang kerjanya Jalan Sutan Soripada Mulia. Ketua DPRD saat itu didampingi Sekwan Drs Marwasih Lubis dan Ir Indra Sakti,ST. (csh)

Penjudi Di Padangsidimpuan Didenda Rp25 Juta P.SIDIMPUAN (Waspada): Polres Kota Padangsidimpuan menyebarkan surat imbauan larangan dan pemberantasan judi di daerah itu. Imbauan itu ditempel di warung kopi dan tempat umum. Itu dibuat sebagai tindaklanjut hasil pertemuan antara Polres Kota Padangsidimpuan, legislatif, eksekutif, mahasiswa dan masyarakat, saat digelarnya

Rapat Dengar Pendapat Umum (RDPU) tentang pembahasan judi, warnet dan objek wisata Simarsayang di Padangsidimpuan di dewan beberapa hari lalu. Surat imbauan ditandatangani Kapolres Padangsidimpuan AKBP Roni Bahtiar Arief, Ketua MUI Drs HA Saukani, Ketua Lembaga Adat H Baginda Tambangan Harahap dan Ketua

PMK Dr Mustafa Ramadhan. Bunyi imbauan antara lain masyarakat agar tidak melakukan permainan judi jenis apapun. Bagi pelaku yang menyediakan tempat atau memberikan kesempatan berjudi pada orang lain didenda Rp25 juta atau dihukum 10 tahun penjara, sesuai KUHP Pasal 303 subsider 303. (csh)

Pemkab Paluta Diminta Tegas Tentang Pengalihan Alih Fungsi Lahan GUNUNG TUA (Waspada): Pemkab Padanglawas Utara diminta tegas menjaga alih fungsi lahan pertanian terutama areal persawahan di sekitar perkantoran Bupati Paluta, Jalan Raya Gunungtua-Padangsidimpuan tepatnya di Tobat. Demikian anggota DPRD Paluta Ashar Efendi Hasibuan kepada Waspada, Selasa (27/4) di Gunungtua. Dikatakan, sawah di samping sebagai mata pencarian masyarakat Padanglawas Utara, juga sebagai tempat yang me-

miliki nilai budaya dan sosial, walaupun harga tanah pasca pemekaran di Gunungtua yang juga pusat ibukota Paluta sangat mahal, akan tetapi perlu ketegasan Pemkab untuk membuat Peraturan Daerah (Perda). “Amatan saya, yang mampu menghalangi jual beli areal persawahan adalah Pemkab Paluta dengan Perda, untuk melindungi petani, karena jika lahannya terjual, maka petani akan tercabut dari akar sosial budayanya,” ucapnya. Lebih lanjut dijelaskannya,

ketersediaan pangan ditentukan lahan. Penambahan areal persawahan sangatlah tidak mudah karena pasti mengorbankan areal lain yang juga hijau dalam hal ini hutan yang sangat penting dalam menjaga iklim dan ekosistem. Namun demikian, kita minta agar Pemkab Palut membuat Peraturan Bupati (Perbup) atau Peraturan Daerah (Perda) untuk melindungi areal persawahan di sepanjang komplek persawahan Tobat Indah. Sehingga kebutuhan pangan di Paluta terjaga. (csp)

Siswa SMPN 4 P. Sidimpuan Gelar Perpisahan P.SIDIMPUAN (Waspada): Para siswa dan guru SMPN 4 Padangsidimpuan menyelenggarakan acara perpisahan di halaman sekolah, Senin (26/ 4). Siswa berbaur dengan para guru dalam memeriahkan acara perpisahan. Ketua panitia pelaksana Itman Abdullah Jambak menyatakan, acara dilaksanakan atas partisipasi seluruh siswa,

mulai dari kelas VII,VIII dan IX. Adik kelas menyumbang Rp5.000 dan kelas terakhir Rp25 ribu. Rangkaian acara perpisahan itu dihibur serta dimeriahkan alunan musik keyboard, tarian Melayu, tor-tor somba-somba dan lainnya. ‘’Walau nanti lulus dan ada yang berpisah, namun diharapkan silaturrahmi terjaga baik,’’ ungkap Itman.

Sedangkan Drs H Ramadan Harahap, SH selaku kepala sekolah, mengatakan, kegiatan ini sudah rutin dan bukan hanya tahun ini. (crm)

Waspada/Syarif Ali Usman

BUNGA CINTA: Kasman, satu-satunya penjual bunga di arena utama MTQ XXXII Lapangan Aek Godang, Panyabungan, Madina. Bunga cintanya itu Rp1.000 per tangkai, Senin (26/ 4).

Bunga Cinta Bersemi Di Arena MTQ XXXII Sumut RAGAM bentuk barang dagangan digelar para pedagang di Lapangan Aek Godang, Kec. Panyabungan, Kab. Mandailing Natal, sebagai arena utama MTQ XXXII tingkat Prov.Sumatera Utara. Mereka datang dari berbagai penjuru daerah di Pulau Sumatera dan Jawa. Beragam strategi mereka lakukan untuk bisa menarik perhatian pengunjungstandpameranagarmembelibarang dagangannya. Seperti Kasman, 38, dari Padang, Sumatera Barat. Pria berambut ikal ini menjual bunga hias yang tangkainya terbuat dari lidi pelepah kelapa, berbalut kertas plastik dan manik-manik. Kasman menjajakan dagangannya di kaki lima depan standWaspada. Profesi ini dilakoninya sejak tiga tahun lalu. Pada MTQ ini dia sudah menjual ratusan tangkai bunga hias. Per tangkai Rp1.000. Bunga hias itu diberi nama ‘Bunga Cinta

Bersemi Siang Malam’. Bunga dengan aneka ragam warna itu asli kreasi putra-putri Bali, dan cukup menarik perhatian pengunjung wanita. Kasman menata bunga ‘ecek-eceknya’ pada sejumlah pot plastik. Dia berharap barang dagangannya ini laku keras, dan di awal penjualannya sudah ada tanda-tanda ke arah tersebut. Tapi itulah Kasman, lulusan SMA ini belajar bisnis kecil-kecilan di lapangan. Berpindah dari satu daerah ke daerah lain. Satu kesimpulan buat Kasman, trik bisnis yang dilakukannya ini sudah mulai menunjukkan hasil. Kasman hanya satu dari ratusan pedagang di arena MTQ ini. Tapi dia merupakan satusatunya pedagang bunga, karenanya para pengunjung wanita selalu tertarik dan membeli dagangannya. Apalagi bandrol harga yang dikenakan cuma seribu rupiah. “Murah meriah, tapi anggun,” katanya. Alpin Lubis

Di Paluta, Siswa Gagal UN Kalah Di Bahasa Indonesia-Matematika GUNUNGTUA (Waspada) : Nilai mata pelajaran Bahasa Indonesia dan Matematika di sejumlah sekolah di Kab. Padanglawas Utara anjlok, sehingga menjadi penyebab utama ketidaklulusan beberapa siswa pada Ujian Nasional (UN) 2010 pasca pengumuman, Senin (26/4). Demikian Kabid Dikmenum Paluta yang juga Ketua Penyelenggara UN Drs Bahrain Siregar, Selasa, (27/4). Dijelaskan, secara umum para siswa yang tidak lulus UN memiliki nilai mata pelajaran Bahasa Indonesia dan Matematika di bawah standar. Seperti jurusan IPA, pelajarannya didominasi mata pelajaran Matematika dan Bahasa Indonesia. Sementara program IPS dominan dengan mata pelajaran Bahasa Indonesia. Lebih lanjut dikatakannya, siswa yang tidak lulus agar mempersiapkan diri mengikuti ujian

ulangan 10 Mei hingga 14 Mei 2010. Data yang dihimpun dari Dinas Pendidikan Paluta menyebutkan, dari 1.962 siswa SMA/ MA yang ikut UN, 60 siswa atau sekitar 3,06 persen dinyatakan tidak lulus. Itu terdiri dari SMA Negeri 1 Batang Onang, nihil. SMA Negeri 1 Padangbolak Julu 3 siswa tidak lulus dari Jurusan IPS, SMA Negeri 1 Padang Bolak Satu tidak lulus dari Jurusan IPA, SMA swasta Jabal Thariq nihil. SMA Negeri 1 Portibi 4 tidak lulus, SMA Negeri 1 Halongonan 5 tidak lulus, SMA Negeri 1 Dolok 11 siswa tidak lulus, SMA Negeri 1 Doloksigompulon 1 tidak lulus, SMA Negeri 1 Simangambat 1 siswa tidak lulus. Sementara, tingkat kelulusan MA di Paluta yang terbanyak siswanya tidak lulus UN dari Madrasah Aliyah Swasta (MAS) Darussalam Kampung Banjir, Kec.Padangbolak, yakni 5 siswa. (csp)


Sumatera Utara

WASPADA Rabu 28 April 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane

Zhuhur 12:25 12:38 12:26 12:33 12:32 12:29 12:25 12:21 12:28

‘Ashar 15:42 15:53 15:42 15:48 15:48 15:47 15:43 15:39 15:45

Magrib 18:32 18:48 18:33 18:42 18:41 18:34 18:33 18:28 18:35

‘Isya

Imsak

Shubuh Syuruq

Kota

19:43 19:58 19:44 19:52 19:51 19:44 19:43 19:38 19:46

04:48 04:59 04:49 04:54 04:54 04:55 04:49 04:45 04:51

04:58 05:09 04:59 05:04 05:04 05:05 04:59 04:55 05:01

Langsa 12:27 L.Seumawe 12:31 L. Pakam 12:24 Sei Rampah12:23 Meulaboh 12:35 P.Sidimpuan12:22 P. Siantar 12:23 Balige 12:23 R. Prapat 12:20

06:15 06:26 06:16 06:21 06:21 06:21 06:16 06:12 06:18

Zhuhur ‘Ashar 15:44 15:46 15:41 15:40 15:51 15:41 15:41 15:41 15:38

C1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:36 18:40 18:32 18:31 18:43 18:28 18:30 18:30 18:26

19:46 19:51 19:42 19:41 19:53 19:38 19:40 19:40 19:36

04:50 04:52 04:47 04:46 04:58 04:48 04:47 04:48 04:45

05:00 05:02 04:57 04:56 05:08 04:58 04:57 04:58 04:55

Sabang Pandan Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan

12:38 12:24 12:24 12:26 12:36 12:28 12:25 12:32 12:20 12:31

18:48 18:30 18:30 18:33 18:45 18:35 18:33 18:41 18:27 18:38

19:58 19:40 19:40 19:43 19:56 19:45 19:43 19:51 19:38 19:48

04:59 04:50 04:50 04:50 04:57 04:53 04:49 04:54 04:45 04:54

05:09 04:00 05:00 05:00 05:07 05:03 04:59 05:04 04:55 05:04

Tarutung 12:24 T.Tinggi 12:23 Panyabungan 12:21 Teluk Dalam12:28 Salak 12:26 Limapuluh 12:22 Parapat 12:24 GunungTua 12:21 Sibuhuan 12:21 Lhoksukon 12:30

06:17 06:19 06:14 06:13 06:24 06:15 06:14 06:15 06:12

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

15:53 15:43 15:42 15:43 15:51 15:46 15:42 15:48 15:38 15:48

06:26 06:16 06:16 06:17 06:24 06:20 06:15 06:21 06:11 06:21

Zhuhur ‘Ashar 15:42 15:40 15:40 15:47 15:44 15:39 15:41 15:39 15:39 15:46

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:30 18:30 18:26 18:33 18:33 18:29 18:30 18:26 18:26 18:39

19:40 19:41 19:36 19:43 19:43 19:39 19:41 19:37 19:36 19:50

04:49 04:47 04:48 04:55 04:51 04:46 04:48 04:47 04:47 04:52

04:59 04:57 04:58 05:05 05:01 04:56 04:58 04:57 04:57 05:02

06:15 06:13 06:14 06:21 06:17 06:12 06:15 06:13 06:13 06:19

Bupati Sergai Kembali Lantik 72 Pejabat Eselon IV

Christoph Munthe Ketua Barnas T. Tinggi

SEI RAMPAH (Waspada): Untuk mengisi beberapa jabatan struktural yang masih lowong karena perubahan nomenklatur Satuan Kerja Perangkat Daerah (SKPD) Pemkab Sergai termasuk penyegaran bagi sejumlah pejabat, Sekdakab Sergai Drs H Haris Fadillah, M.Si atas nama Bupati Sergai kembali melantik 72 pejabat eselon IV yang ditempatkan di beberapa SKPD di daerah ini. Pelantikan 72 pejabat itu dilaksanakan di aula Sultan Serdang kompleks kantor Bupati Sergai di Sei Rampah, Jumat (23/4), dihadiri para asisten, staf ahli bupati, para Kepala SKPD di lingkungan Pemkab Sergai dan sejumlah camat. ParapejabateselonIVyangdilantikitudiantaranyaTuahSembiring sebagai Pj. Kasie Perbengkelan dan Alat Berat Dinas Bina Marga, Suryadi Singarimbun ,S.Pi Pj. Kepala UPT Balai Benih Air Payau Pantai Klang Kecamatan Perbaungan, Leni Harianti, ST Pj. Kasie Pembinaan Kerajinan Daerah dan Promosi Dinas Perindagpas, Syamsul Sijabat ,SE Pj. Kasubbid Pembinaan Usaha Ekonomi dan Pengentasan Kemiskinan Masyarakat pada Badan PMPD, Meliyati Sembiring Pj. Kasubbid Peningkatan Kualitas Hidup Perempuan dan Anak Badan PPAKB. Kemudian Ade Andrawina, SH Pj. Kasubbid Pembinaan Mental dan Disiplin Pegawai BKD, Rashidah, SE Pj. Kasubbag Perencanaan Program/Akuntabilitas Dinas Perindagpas, Drs Pandapotan Siahaan sebelumnya Kepala SMPN 1 Dolok Masihul menjadi Kacabdis Pendidikan Kecamatan Tebing Syahbandar, Sarmauli Pasaribu sebelumnya Kacabdis Pendidikan Kecamatan Sei Bamban menjadi Kasie Eksosbud Kecamatan Sei Bamban dan Freddy, SPd sebelumnya Pengawas TK/SD Kecamatan Tebing Syahbandar diangkat menjadi Kacabdis Pendidikan Kecamatan Sei Bamban. Sementara drg Mayangsari diangkat menjadi Kepala Puskesmas Kotarih, dr T Moh. Syafrin sebelumnya Kepala Puskesmas Kuala Bali, Kecamatan Serba Jadi dipindahkan menjadi Kepala Puskesmas Sialang Buah, Kecamatan Teluk Mengkudu, drg Cut Putri Elna Minarbach Pj. Kepala Puskesmas Kuala Bali. (a07)

T. TINGGI (Waspada): Anggota DPRD Kota TebingtinggiChristophMuntheterpilih menjadi Ketua Partai Barisan Nasional menggantikan Sapta NugrahaIsa.Pergantianitumerujuk pada SK DPP Partai Barnas ditandatangani Ketua Umumnya Vence Rumangkang dan Sekretaris Jenderal Muhammad Arfan. SK No.60.32.28.Rev.2/ SKEP/DPP-P.Barnas/SPC/IV/ 2010 tertanggal 12 April 2010 tentang Pengesahan Penyempurnaan Susunan Pengurus DPC Partai Barnas KotaTebingtinggi, menetapkan Christoph Munthe sebagai Ketua, Edwin Dhani sebagai Sekretaris dan Nafsiah Damanik sebagai Bendahara. Sedangkan ketua lama Sapta Nugraha Isa menduduki jabatan baru sebagai Dewan Pembina. Christoph Munthe mengatakan, Minggu (25/4) akan segera melakukan konsolidasi organisasi dan melakukan pembenahan ke dalam.(a08)

Bupati DS Sampaikan Permasalahan Ke Komite I DPD RI LUBUK PAKAM (Waspada) : Tim Komite I DPD RI dipimpin DR H Rahmat Shah melakukan kunjungan kerja (kunker) ke Pemkab Deliserdang diterima Bupati Drs H Amri Tambunan didampingi Sekdakab Drs H Azwar, MSi, unsur Muspida serta pimpinan SKPD (satuan kerja perangkat daerah) di ruang rapat kantor bupati, Selasa (27/4). Dalam pertemuan itu, pimpinan rombongan DR H Rahmad ShahdidampingianggotaDPDRIlainnyaDraHjJuniwati,TMasychum Sofwan, Hj Sri Kadarwati, H Aksa Mahmud, HT Bahrun Manyak serta H Among Syafrudin LC menyebutkan kunjungan mereka ke Deliserdang untuk memperoleh berbagai masukan dan permasalah yang ada guna mencari solusi penyelesaiannya. Bupati pada kesempatan itu juga menguraikan lahan eks PTPNII dimana dari 62.214,799 ha yang HGU-nya berakhir tahun 1997 telah mendapat perpanjangan seluas 54.981,06 ha. Sedangkan sekira 5.873,06 ha yang terletak di wilayah Kabupaten Deliserdang, Langkat dan Binjai HGU-nya tidak diperpanjang. Dari 5.873,06 ha, HGU yang tidak diperpanjang itu seluas 4.423,68 ha berada di wilayah Kabupaten Deliserdang, papar Amri Tambunan.(a05)

Rumah Kos Terbakar Di P. Siantar P. SIANTAR (Waspada) : Satu unit rumah kost milik Apul Munthe, 64, pensiunan PNS di Jalan Kain Selendang I, Kel. Bane, Kec. Siantar Utara, Kota Pematangsiantar, Minggu (25/4) hangus terbakar. Tidak ada korban jiwa dalam kejadian itu, namun kerugian materil diperkirakan mencapai Rp 300 juta terdiri dari rumah permanen ditambah perabotan rumah tangga termasuk milik penyewa rumah. Kapolresta Pematangsiantar AKBP Fatori melalui Pabungpen AKP Muslim dan Kasat Reskrim AKP AY Harahap menyebutkan, Senin (26/4) peristiwa kebakaran diketahui pihaknya sesudah petugas piket dari Polsek Siantar Utara yang menangani kasus itu menerima laporan dari TKP. Keterangan diperoleh, asal api belum jelas diketahui secara pasti, namun maraknya api bermula dari bagian depan bangunan rumah kos yang pada sore itu dalam keadaan kosong. (a14)

Waspada/dede

Grup tari SMK Istiqlal Delitua yang akan go internasional ke Malaysia unjuk kebolehan pada perpisahan di sekolahnya, Senin (26/4).

Siswa SMK Istiqlal Delitua Harus Bisa Kerja Dan Siap Pakai DELITUA (Waspada): Sekolah Menengah Kejuruan (SMK) Istiqlal Delitua harus bisa bekerja dan siap pakai untuk mengisi lowongan kerja tingkat menengah yang sudah tersedia. Tunjukan kalau siswa SMK mampu melahirkan karya-karya kreatif dan inovatif yang bermanfaat bagi masyarakat. Karena itu, mari kita tunjukan kalau SMK bisa maju dengan motto SMK Bisa!!!. Demikian Kepala SMK Istiqlal Delitua Dra Rosmida dihadapan ratusan siswa/i SMK Istiqlal jurusan Akutansi, Sekretaris, Multimedia, Teknik Komputer Jaringan dan Teknik Otomotif saat melakukan perpisahan di halaman sekolahnya, Senin (26/4). Tampak hadir KetuaYayasan Perguruan Istiqlal Drs Jumino Suhadi, MA. PhD, beserta istri, para kepala sekolah di lingkungan Perguruan Istiqlal, dewan guru dan orangtua. Dikatakan Rosmida, tidak mudah memang menyiapkan tenaga kerja siap pakai, siap kerja, namun berkat dorongan dan motivasi dari yayasan, siswa SMK Istiqlal mampu bersaing dan siap pakai di dunia tenaga kerja. “Hal itu berkat upaya dari Yayasan Perguruan Istiqlal Delitua yang telah memenuhi berbagai kebutuhan siswa untuk praktek dengan memberikan berbagai fasilitas alat praktek seperti satu unit mobil, perangkat teknologi informasi (TI). Ini semua ditujukan agar alumni SMK Istiqlal benar-benar menciptakan manusia yang siap kerja, cerdas dan kompetitif,” katanya. Menurut Rosmida itu merupakan langkah tepat, untuk itu kami mengucapkanterimakasihkepadapihakyayasanyangtelahmenyahuti kebutuhan para siswa akan pentingnya fasilitas praktek untuk kompetensi siswa agar bisa bersaing di tingkat lokal, nasional dan internasional,” katanya. Pada kesempatan itu, Rosmida juga mengucapkan selamat 4 siswa yang lulus masuk perguruan tinggi negeri melalui jalur PMP dan kepada grup tari SMK Istiqlal yang akan go internasional di Malaysia. “Hal ini menunjukan bahwa alumni siswa SMK bisa, bisa bersaing di perguruan tinggi negeri, bisa terampil dan memiliki skill untuk bersaing di pasar kerja,” demikian Rosmida. (m43)

Waspada/Abdul Hakim

DITAHAN: Manajer BMT Sejahtera Langkat (baju hitam) resmi ditahan Penyidik Kejari Stabat diduga melakukan tindak pidana korupsi bantuan dana dari Kementerian Perumahan Rakyat tahun 2008 senilai Rp1,7 miliar, sekira pukul 16:30, Selasa (27/4).

Dugaan Korupsi, Manajer BMT Sejahtera Langkat Ditahan STABAT (Waspada): Penyidik Kejari Stabat resmi menahan Manajer Baitul Maal wattamwil (BMT) Sejahtera Langkat terduga korupsi bantuan dana Kementerian Perumahan Rakyat, Selasa (27/4). Penahanan dilakukan sekira pukul 16:30 dan tersangka dibawa ke LP Tanjungpura mengendarai mobil BK 5 HY dikawal polisi serta penasehat hukumnya.

PTPN-II Harus Lunasi Tunggakan PBB Rp 44 M Ke Pemkab DS LUBUK PAKAM (Waspada): Tunggakan Pajak Bumi dan Bangunan (PBB) PTPN II Tanjungmorawa ke Pemkab Deliserdang mencapai Rp 44 miliar lebih sangat mengganggu pelaksanaan pembangunan daerah. Karenanya, pihak Badan Usaha Milik Negara (BUMN) yang bergerak di sektor perkebunan ini harus segera membayar tunggakan PBB-nya terhitung tahun 2005-2009 mencapai Rp 44 miliar lebih agar program pembangunan untuk masyarakat dapat berjalan dengan baik. Tidak ada alasan wajib pajak tidak membayar pajak dan semua wajib pajak, baik itu BUMN harus melunasi pajaknya. Kalau PTPN-II memiliki tunggakan cukup besar mencapai Rp 44 miliar lebih, diharapkan Pemkab Deliserdang segera mengundang pihak Kanwil Ditjen Pajak duduk bersama mengambil langkah-langkah dan solusi sehingga pajak yang tertunggak dapat dilunasi, kata Ketua Komite I DPD RI DR H Rahmat Shah saat melakukan kunjungan kerja ke Deliserdang, Selasa (26/4) siang. Menurutnya, dalam penagihan pajak tertunggak ada ketentuan-ketentuan yang lazim dilakukan misalnya memberikan peringatan pertama mungkin hingga ketiga kepada wajib pajak yang belum melunasi pajaknya. Kalau hal itu sudah dilakukan dan wajib pajak tak juga mampu membayar tunggakan pajaknya mungkin bisa dilakukan penyitaan yang dilanjutkan dengan pelelangan aset. Berdasarkan data dihimpun di Dinas Pengelola Keuangan Daerah (PKD) Kabupaten Deliserdang, tunggakan PBB PTPNII ke Pemkab Deliserdang pada tahun 2005 sebesar Rp7.504. 472.608 dibayar sebesar Rp 248

juta. Tahun 2006 tunggakan naik menjadi Rp12.900.061.989 dan dibayar Rp333 juta. Tahun 2007 turun menjadi Rp10.079.469.604, dibayar Rp1,6 miliar. Begitu juga tahun 2008 tunggakan sebesar Rp10.103.221.756 dan dicicil sebesar Rp4,4 miliar. Namun di tahun 2009 tunggakan naik menjadi Rp10.696. 300.850 dan yang dibayar hanya Rp569 juta, sehingga total tunggakan PBB BUMN yang bergerak di sektor perkebunan itu mencapai Rp44 miliar. Wakil Ketua Komisi A DPRD Deliserdang Rahmadsyah, SH menilai PTPN-II sudah bisa masuk dalam kategori pembangkang pajak. Karena berdasarkan UU No 12/1994 atas perubahan UU No 12/1985 tetang pajak bumi dan bangunan seluruh wajib pajak (WP) sesuai pasal 10 ayat (3) dan ayat (4) disebutkan bahwa pajak terhutang harus dilunasi selambat-lambatnya satu bulan sejak diterimanya surat ketetapan pajak terhutang. Jika sudah jatuh tempo maka dikenakan denda sebesar 2 persen sebulan.Termasuk sanksi pidana bagi yang tidak mentaati peraturan tersebut. “Saya terkejut setelah mengetahui kalau tunggakan PBB PTPN-II ke Pemkab Deliserdang sebesar Rp 44 miliar.Ini tidak bisa kita diamkan” ujar Rahmat Shah seraya minta Kanwil Dirjen Pajak I Sumut agar benar-benar tegas. Soalnya ini menyangkut keuangan negara. Bila perlu dilakukan sita asset untuk melunasi tunggakan pajak itu. Jika PTPN-II memang tidak lagi sanggup membayar tunggakan pajak, pihak terkait harus melakukan langkah-langkah hukum sesuai undang-undang dan peraturan yang berlaku, kata Rahmat Shah. (a05)

Dijelaskan Kajari didampingi Kasi Intel Gloria Sinuhaji dan Kasi Pidsus Firmansyah SH, setelah penyidik memeriksa 200 orang anggota koperasi sejak empat pekan silam, tersangka akhirnya ditetapkan dan ditahan dengan bukti akurat. Hasil penyidikan sementara, tersangka AB memalsukan tandatangan ratusan anggota koperasi untuk persetujuan pemotongan dana Rp2 juta per orang, padahal masing-masing anggota membantah menandatangani dan mengaku tidak mengetahui adanya bantuan dari Kementerian Perumahan Rakyat tahun 2008 senilai Rp1,7 miliar itu.

Bantuan yang diterima senilai Rp7 juta per orang untuk masyarakat berpenghasilan rendah (MBR) tersebut, menurut Kasi Pidsus seharusnya tidak boleh dipotong apapun alasannya. Penyidik menyimpulkan kerugian negara atas perbuatan itu sekitar Rp400 juta dan tersangka telah mengembalikan Rp173 juta. Penyidik masih menunggu hasil audit badan pengawasan dan keuangan pembangunan (BPKP) Sumut. Bantuan teknis dari Kementerian Perumahan Rakyat itu untuk peningkatan kapasitas pelaksana subsidi perumahan. Diharapkan akan memberi pe-

ngaruh besar bagi program pemenuhan perumahan nasional khususnya bagi masyarakat berpenghasilan rendah. Dengan adanya bantuan itu peran para pengurus BMT maupun koperasi sangat dibutuhkan masyarakat yang pokok pinjamannya disediakan oleh lembaga keuangan non bank (LKNB). Sementara itu Kajari Stabat juga menjelaskan, penyidikan dugaan korupsi di KPU Langkat senilai Rp23 miliar tetap lanjut. ‘’belum ditahannya tersangka karena masih mengikuti proses hukum lebih lanjut,’’ ujarnya. (a38)

Walaupun Sudah Ada Perbaikan

Kerusakan Jalan Medan-Berastagi Masih Tetap Parah KABANJAHE (Waspada ) Di beberapa ruas tertentu jalan negara yang menghubungkan Medan-Berastagi Kabupaten Karo yang sudah lama mengalami rusak parah, mulai diper-baiki. Namun di beberapa titik yang mengalami kerusakan paling parah dekat Desa Bandar Baru menuju Tanah Karo, belum juga diperbaiki. Pengamatan Waspada, Senin (26/4), ruas jalan yang sudah diperbaiki dengan lapisan aspal hotmix berada di kilometer 3839 Desa Sembahe mulai dari ujung jembatan Sungai Petani menuju Berastagi. Pekerjaan yang sama juga telah dilakukan

di kilometer 48-49 dekat Desa Bandar Baru, Kecamatan Sibolangit, Kabupaten Deliserdang. Menurut warga setempat, pelapisan badan jalan dengan aspal hotmix itu dikerjakan beberapa hari lalu. Setelah itu tidak ada kegiatan lagi di lapangan. Tidak jelas diketahui apakah perbaikan jalan hanya sampai di situ saja atau masih ada lanjutannya. Untuk menghindari penyimpangan pengerjaan di lapangan, masyarakat setempat sangat mengharapkan isntansi dan pihak berkompeten dapat mengawasi pelaksanaan pekerjaan di lapangan.

Salah satu penyebab rusaknya badan jalan Medan-Berastagi, karena sering digenangi air. Bahkan di titik-titik tertentu di badan jalan mengalir air limbah dari tempat pencucian kendaraan yang banyak beroperasi di pinggir jalan Medan-Berastagi. Menurut para sopir dan warga setempat,kalaupun jalan negara Medan-Berastagi diperbaiki,namun kalau tidak dibarengi dengan pembuatan parit yang memadai, dikhawatirkan cepat rusak. Hal itu terbukti beberapa ruas jalan yang sudah ditambal beberapa waktu lalu, hanyadalamwaktuhitunganhari sudah hancur kembali. (c06)

Kasus Pemotongan Dana DAK Di Langkat

Bupati Bentuk Tim Investigasi STABAT (Waspada) : Masalah penyalahgunaan anggaran dari Dana Alokasi Khusus (DAK) bagi sejumlah sekolah di Langkat kembali mencuat. Kali ini sejumlah kepala SD di daerah itu disebut-sebut membayar upeti lebih dari Rp 100 juta kepada beberapa oknum di DPRD Langkat maupun di lingkungan Dinas Pendidikan dan Pengajaran Kabupaten Langkat. Padahal kasus korupsi anggaran dil ingkungan Dinas P dan P masih belum dilupakan orang, kini hal yang sama kembali terulang.

Bahkan, Senin (26/4) sejumlah mahasiswa dari Himpunan Mahasiswa Langkat (Himala) berunjukrasa ke kantor DPRD dan kantor Bupati Langkat. Pengunjukrasa meminta kasus pemotongan dana DAK tersebut segera ditindaklanjuti. Menanggapi adanya suarasuara sumbang seputar pemotongan dana DAK tersebut, Bupati Langkat Ngogesa Sitepu akhirnya membentuk tim investigasi yang diketuai Ka. Inspektorat Sedar Sembiring, SH. Dalam pertemuan bersama tim yang berlangsung di rumah

dinas bupati di Stabat, Selasa (27/4), Ngogesa Sitepu menginstruksikan untuk segera mengambil langkah terkait tudingan yang ditujukan terhadap para pejabat dengan meminta keterangan kepada semua pihak dalam lingkup kewenangan Pemkab Langkat. “Kita perlu menyelusuri akar permasalahan yang sesungguhnya,” ujar bupati seraya menambahkan agar hasil investigasi tim segera dilaporkan, dan bila dilakukan oleh oknum di luar PNS bukan menjadi kewenangannya dan diserahkan ke aparat penegak hukum. (a01)

Bupati Sergai Canangkan Bulan Bhakti Sosial IBI – KB Kesehatan 2010 SEI RAMPAH (Waspada): Bupati Sergai HT Erry Nuradi didampingi Wakil Bupati H Soekirman dan Sekdakab Drs H Haris Fadillah, MSi,pekan lalu mencanangkan program sosial bulan bhakti Ikatan Bidan Indonesia (IBI)–KB–Kesehatan dan temu mitra kerja KB 2010 di aula Pangeran Bedagai kantor Bupati di Sei Rampah. Bulan bhakti yang dilaksanakan Pengurus Cabang IBI dan Badan Pemberdayaan Perempuan, Anak dan KB serta Dinas Kesehatan Kabupaten Sergai itu digelar sejak 1 Maret hingga 30 Juni 2010 di seluruh kecamatan di Sergai.

Hadir dalam pencanangan itu Pengurus Cabang IBI kabupaten, KUPTD kecamatan, Kepala Puskesmas, PLKB, Bidan Koordinator, PPKBD, para camat, pengurus PKK kecamatan, Dharma Wanita Persatuan, GOPTKI dan perwakilan SKPD Pemkab Sergai. Untuk menunjang tugastugas pelayanan kemasyarakatan khususnya pelayanan KB dan kesehatan, HT Erry Nuradi menyerahkan enam unit laptop kepada Penyuluh Lapangan KB dari enam kecamatan yaitu Nurhaidah dari Kecamatan Tebingtinggi, Nurhawati Purba (Sipispis), Sri Rusnidawati (Sei

Bamban), Murniati (Sei Rampah), Gibson Butar-Butar (Tanjung Beringin) dan Jurna Elvida (Perbaungan). Kepala Badan Pemberdayaan Perempuan, Anak dan KB (BP2AKB) Sergai Hj Irwani Jamilah, SH melaporkan, kegiatan bhakti sosial ini merupakan kegiatan rutin tahunan berupa pemeriksaan kesehatan bagi masyarakat, pelayanan KB gratis bagi keluarga pra sejahtera dan sejahtera I terutama di wilayah legok yaitu desa tertinggal, desa terpencil, desa di wilayah pesisir pantai dan desa-desa di wilayah perbatasan (galciltaitas). (a07)

Waspada/Eddi Gultom

LAPTOP UNTUK PLKB : Bupati Sergai HT Erry Nuradi didampingi Wabup H Soekirman menyerahkan perangkat laptop kepada 6 PLKB pada pencanangan bulan bakti sosial IBI – KB – Kesehatan Sergai di aula Pangeran Bedagai kompleks kantor Bupati Sergai di Sei Rampah, pekan lalu.

STAI Al Islahiyah Binjai Buka Program Perbankan BINJAI(Waspada):Sekolah Tinggi Agama Islam (STAI) Syeh HAbdHalimHasanAlIslahiyah Binjai membuka program S1 jurusan perbankan syariah, mulai tahun akademik 2010/ 2011. Ketua STAI Al Islahiyah Binjai Drs HYundiser, MPd menjelaskan, Senin (26/4) izin prodi baru berdasarkan SK Dirjen Pendidikan Islam Kementerian Agama RI No. Dj.I/756/2009 dan prodi Perbankan Syariah merupakan satu-satunya di Sumut. STAI Al Islahiyah Binjai tengah mempersiapkan dosen perbankan syariah dari IAIN SumateraUtara,ditambahpraktisibank.Penyusunankurikulum dan penyediaan referensi. Dibukanya prodi Perbankan Syariah oleh STAI Al Islahiyah Binjai diharapkan kelulusannya bisa mengembangkan karier di bank konvensional maupunbanksyariah,lembaga keuangan syariah, asuransi syariah yang berkembang saat ini. (a03)

FSU Sumut Harapkan Perkokoh Pondasi Ibadah BINJAI (Waspada): Ketua Forum Silaturahmi Ummat (FSU)SumateraUtaraIrSuseno WP Putra menyebutkan, ketidakstabilanpolitik,menguatnya egoisme dan menyebar fitnah, menyebabkanmasyarakatharus memperkuat pondasi ibadah. Hal itu dikemukakan Suseno dalam pertemuan silaturahmi kaum perempuan di Binjai, Senin ( 26/4). Dikemukakan Suseno, pelaku bisnis bisa membuat kelicikan. Kehidupan rumah tangga yang bahagia bisa berubah jadibencana,halitudisebabkan keterpurukan akhlak. “Akhlaqmampudiperbaiki jika potensi ibadah diperkuat dankemauanmemperbaikidiri. Sebab dengan ibadah dan akhlak yang tangguh akan terpeliharadariperbuatankezaliman. Tanpa akhlak dan iman masyarakat akan mengalami ketidakstabilan,” kata Suseno. (a03)

Kejari Binjai Masih Sidik Proyek Aladin BINJAI (Waspada): Kejari Binjai sudah menetapkan tiga tersangka kasus korupsi proyek atap,lantaidandinding(Aladin) tahun2009,namunmasihtetap melakukan penyidikan di tiga kecamatan lagi. Duakecamatanyangditeliti KejariBinjaiyakniBinjaiSelatan dan Binjai Utara dan sudah diperoleh pembuktian terjadinyapenyelewengandanmenetapkan tiga tersangka ZA selaku PPK, dan dua kontraktor HN alias HK dan SP. Kini Kejari Binjai meminta keterangan dari pengawas proyekAladinditigakecamatan yaitu Binjai Timur, Binjai Barat dan Binjai Kota . Sumber di Kejari Binjai, Selasa (27/4) menyebutkan , tidak tertutup kemungkinan jumlah tersangka bertambah. Dari dua kecamatan saja sudah ditetapkan tiga tersangka. (a03)


C2 Masyarakat Diminta Ikut Awasi Bantuan Pusat Ke Labura AEKKANOPAN (Waspada) : Kelompok Kerja (Pokja) B DPRD Labuhanbatu Utara rapat dengar pendapat dengan Dinas Pertanian Labura, membahas perkembangan persiapan swasembada beras Labubanbatu Utara 2011 di DPRD, Senin (26/4). Ketua Pokja B Edi Susanto diwakili Eri Gusri Sianipar anggota Pokja B dari Fraksi PDI Perjuangan kepada Waspada seusai dengar pendapat, mengatakan sangat berterima kasih dengan adanya bantuan dari pusat yang di berikan ke Pemkab Labura, melalui Dinas Pertanian berupa bibit durian yang akan di salurkan di Desa Hasang. Juga bantuan irigasi senilai Rp2,1 miliar. ‘’Diharapkan kepada masyarakat untuk ikut mengawasi proses pegerjaannya agar dana bisa mendongkrak hasil pertanian di Labura,’’ tegasnya. Dijelaskan, Labura memiliki luas lahan pertanian 29.170 hektare dan ini merupakan potensi untuk mewujudkan swasembada beras di Labura serta dapat meningkatkan pendapatan masyarakat bila sarana dan prasarana pertanian bisa difasilitasi dengan baik. Sebagai contoh, irigasi, pengadaan bibit unggul dan pestisida yang tepat ditambah hasil gabah yang di kontrol pemerintah sehingga para petani tidak lagi terjerat ijon atau meminjam uang berbunga tinggi untuk mengolah sawahnya. Dengan demikian, katanya, Pokja B akan melanjutkan undangundang yang sudah ada, lahan pertanian tidak dialihfungsikan menjadi lahan kelapa sawit. “Bila prasarana pertanian dapat difasilitasi maka 1 hektare padi akan lebih besar hasilnya dengan lahan 1 hektare sawit,” jelasnya. Dikatakan, dalam waktu dekat Pokja B akan merekomendasikan kepada Pemkab Labura agar di bentuk Balai Benih untuk menunjang program peningkatan pertanian di Labura. (csi)

Mhd. Hipni Pimpin MUI Talawi TALAWI (Waspada) : Ustadz Mhd. Hipni, LC.MA terpilih sebagai Ketua Majelis Ulama Indonesia (MUI) Kec. Talawi, Kab. Batubara periode 2010-2015 di kantor Camat Talawi yang dihadiri Wakil Ketua/Komisi Fatwa MUI Batubara Ustadz Ridwan Hamsal,LC, Minggu (25/4). Susunan Pengurus MUI Talawi terdiri dari Ketua I, II, III: Muhammad Hipni,LC. MA, Drs. Mhd. Tauhid, Ramlan Siregar. Sekretaris I,II: Adlin, SH, Idris Hadi, Bendahara I,II :Ismail, SPd, Amansyah Seksi Fatwa; Abdulah Effendi (Ketua), M.Kamil, SHi (Sekretaris). Sementara, anggota Mhd.Ramli (Lobai Amat), Seksi Sosial Abd.Karim (Ketua), Musliadi, S.Hi (Sekretaris), anggota;Thalib S.Pd, Rudi Abbas, Seksi Pendidikan H. Ishak Ismail (Ketua), Ananta Maruf, S.Pd (Sekretaris), anggota Helmi Misri, Azrai. (a30)

DPP Intel Surati SBY RANTAUPRAPAT(Wasada): Dewan Pimpinan Pusat Organisasi Intelektual Labuhanbatu (DPP-Intel) surati SBY perihal telah dibentuknya wadah organisasi kaum intelektual Indonesia, serta meminta dukungan moral serta menjadi komite khusus di bawah koordinasi Menteri Sekretaris Negara (Mensesneg). Surat DPP INTEL ditembuskan antara lain Wakil Presiden Indonesia, seluruh menteri Kabinet Indonesia Bersatu, seluruh lembaga tinggi negara RI, Dewan Pertimbangan Presiden RI, KPK , Satgas Pemberantasan Mafia Hukum, Panglima TNI, Kapolri, Kejagung RI, Kepala BIN RI, Ketua MA RI, seluruh duta besar negara sahabat, seluruh rektor perguruan negeri/swasta se Indonesia, seluruh pimpinan redaksi media surat kabar serta media elektronik, gubernur, bupati/walikota dan ormas. Ketua Umum DPP INTEL Edison Sipahutar didampingi Sekretaris Jenderal Sabar M Purba, M Sulaiman Saleh, sebagai Pembina, Senin ( 26/4 ), mengatakan, setelah dilantiknya pengurus DPP Intel, Jumat (26/3) telah melakukan audensi kepada Muspida Plus setempat dan menyampaikan siap bekerjasama membangun Labuhanbatu lebih baik dan khususnya memberantas mafia perpajakan yang ada di bumi Labuhanbatu,” tegas Edison. (c01)

Warga Labura Kembali Keluhkan Pembuatan KTP AEKKANOPAN (Waspada): Masyarakat kembali mengeluh sejak Dinas Catatan Sipil dan Kependudukan kembali memberlakukan pemotoan untuk urusan KTP di kantor itu. Keterangan beberapa warga yang ingin mengurus KTP di Kantor Dinas Catatan Sipil dan Kependudukan kepada Waspada, Selasa (27/4) mengatakan, mereka terpaksa meluangkan waktu dan biaya untuk datang ke kantor itu untuk foto KTP. “Saya datang dari Merbau ke Aekkanopan untuk foto KTP,” ujar warga yang mengaku bermarga Saragih dan menambahkan biasanya masyarakat yang ingin mengurus KTP cukup berfoto sendiri dan diserahkan Dinas Capil. Kadiscapil dan Kependudukan Pemkab Labura Rustam Hasibuan ketika dikonfirmasi membenarkan, urusan KTP setiap warga harus difoto langsung oleh petugas. “Jika masyarakat yang mau mengurus KTP, anggota kami siap mendatangi masyarakat untuk memfoto,” ujarnya. Ketika ditanya mengenai biaya, Hasibuan mengungkapkan sesuai Peraturan Bupati (Perbub) untuk urusan selembar KTP Rp20 ribu dan KK Rp 11 ribu. “Jadi foto langsung ini selain alat scanner kita rusak juga untuk menghindari calo yang meminta biaya urusan KTP dan KK Rp200 ribu,” katanya. (a29)

Sukseskan Sensus Penduduk Di Tanjungbalai TANJUNGBALAI (Waspada) : DPD II Partai Golkar Tanjungbalai mengimbau seluruh kader partai dan lapisan masyarakat Kota Tanjungbalai untuk berperan aktif mensukseskan Sensus Penduduk 2010. “Mari kita sukseskan sensus penduduk yang masih dalam tahap pemeraan teritorial atau pencacahan di seluruh wilayah Tanjungbalai,” kata Sekretaris DPD II Partai Golkar Kota Tanjungbalai, Faisal Fahmi didampingi Wakil Sekretaris Azwin S Damanik kepada Waspada, Selasa (27/4). Faisal menegaskan, data hasil sensus penduduk itu, sangat dibutuhkan untuk penyusunan program pemerintah dan masyarakat dalam pembangunan ke depan. Makanya Faisal menegaskan agar memberikan jawaban kepada petugas sensus penduduk. “Berikan jawaban yang benar kepada petugas yang datang,” ujar Faisal. Dikatakan Faisal, DPD II Partai Golkar Tanjungbalai telah mengeluarkan surat kepada pimpinan se-kecamatan di Tanjungbalai untuk berperan aktif, termasuk instruksi kepada 6 anggota Fraksi Partai Golkar di DPRD Kota Tanjungbalai guna mengampanyekan sensus penduduk tersebut. (a37)

Artis Ibukota Ramaikan Pelantikan Partai Golkar Batubara LIMAPULUH (Waspada): Pelantikan kepengurusan DPD II Partai Golkar Batubara periode 2010-2015 di lapangan Dolok Estate, Kec. LimaPuluh, Kamis (29/4) dimeriahkan dengan artis ibu kota dari Jakarta. Hal itu terungkap dalam rapat teknis panitia pelaksana pelantikan yang dipimpin Sekretaris DPD II Partai Golkar Selamat Arifin, SE didampingi pengurus harian Ir Lokot Ridwan Batubara dan Bendahara Suwardi, S berlangsung di sekretariat partai di Limapuluh, Selasa (27/4). Selain mendatangkan artis ibu kota diantaranya ‘Gong 2000’ Ahmad Albar dan Dlowid diperkirakan hadir dari DPP dan DPD I antara lain Aburizal Bakrie, Agung Laksono, Leo Nababan, Syamsul Arifin beserta utusan korda Sumut. Acara pelantikan juga diisi dengan pemberian cenderamata kepada 20 orang tokoh Golkar di Batubara yang diserahkan secara simbolis oleh Ketua DPD II OK Arya Zulkarnain, SH,MM. Kemudian menyangkut teknis pelaksanaan pelantikan kepada panitia terlibat dan lebih menanamkan kerjasama dan kesolidan kader dalam menyukseskan acara itu. (a11)

Sumatera Utara

WASPADA Rabu 28 April 2010

SMA Teladan Indrapura Lulus UN Di Bawah 50 Persen INDRAPURA (Waspada): Tingkat kelulusan ujian nasional (UN) tahun ajaran 2009/2010 di SMA Teladan Indrapura, Kabupaten Batubara di bawah 50 persen. Pengumuman hasil UN di SMA Teladan, satu di antara dua sekolah di Sumut yang harus melaksanakan UN pengganti ini akibat dugaan adanya kebocoran pada pelaksanaan UN. berlangsung di komplek perguruan itu Jalan Datuk Umar Palangki

Tanahmerah, Indrapura, Senin (26/4) pukul 15:00, serentak dengan SMA/MA dan SMK lain di Batubara. Kepala SMA Teladan Drs M Butar-butar menjawab Waspada di sela-sela acara pengumuman mengatakan, peserta UN SMA Teladan berjumlah 118 dan 78 di antaranya jurusan IPS dan sisanya 40 jurusan IPA. Tingkat kelulusan terendah dialami jurusan IPS, hanya 25 siswa yang lulus (28 persen). Sedangkan jurusan IPA yang lulus 28 (69 persen). Secara keseluruhan siswa SMA Teladan yang lulus hanya 53 dari 118 peserta atau hanya 44,9 persen.

Menanggapi rendahnya tingkat kelulusan di sekolahnya, M. Butar-butar tidak banyak komentar. “Sudah begitu sistemnya.Ya, hasilnya seperti inilah,” ujarnya prihatin. Menurut Butar-butar, tingkat kelulusan kali ini merupakan yang terendah selama pelaksanaan UN. Biasanya tingkat kelulusan sekolah ini rata-rata 97 persen. Diakui, ketidaklulusan siswanya disebabkan tidak lulusnya nilai mata pelajaran

yang dilaksanakan UN penggantinya. Yaitu mata pelajaran Bahasa Indonesia dan Sosiologi untuk jurusan IPS, serta Bahasa Indonesia dan Biologi untuk jurusan IPA. Butar-butar mengatakan, siswanya yang tidak lulus 65 itu, akan mengikuti UN ulangan Mei 2010. Pantauan Waspada, pelaksanaan pengumuman hasil UN di SMA Teladan berlangsung tertib aman dan lancar. Tidak terlihat petugas kepolisian ber-

pakaian dinas mengamankan pengumuman itu. Hanya terlihat ada seorang aparat Polsek Indrapura di lokasi sekolah dengan berpakaian preman. Pengumunan diberikan lewat amplop tertutup yang diterima orang tua/wali siswa. 100 Persen Sementara, hasil UN di SMK Negeri 1 Airputih mencapai 100 persen. Kepala SMKN 1 Airputih Drs Muswardi kepada Waspada mengatakan, 89 siswa

SMKN 1 Airputih yang ikut UN, lulus semuanya. Ke 89 siswa itu berasal dari jurusan Teknik Komputer Jaringan dan Teknik Mesin Otomotif. Hasil UN sekolah lain di Batubara yang tercatat Waspada, SMAN 1 Airputih, jumlah peserta jurusan IPA 116, tidak lulus satu. Jurusan IPS 117 peserta, tak lulus 6. SMA Daerah Airputih lulus 100 persen dengan jumlah peserta 32. SMK Teladan Indrapura, peserta 73 tidak lulus 9. (a25)

Proyek Bermasalah, KTP Dan Pukat Harimau Jadi Sorotan LIMAPULUH (Waspada): Proyek fisik bermasalah dan tidak terselesaikan sepanjang 2009 sampai harga pembuatan KTP/KK dan pukat harimau sejenisnya menjadi sorotan DPRD Kab. Batubara dalam sidang paripurna, Selasa (27/4). Sidang dipimpin Ketua DPRD Selamat Arifin, SE dengan Wakil Ketua Drs Suwarsono dan Asmadinata dihadiri Bupati OK Arya Zulkarnain, SH. MM, Sekdakab Drs H. Sofyan, MM, Kadispenda, Yoesrauke, Kadis/Kabag dan camat beserta anggota dewan. Seperti disampaikan juru bicara daerah pemilihan (dapil) Batubara IV Kec. Tanjungtiram dan Talawi Ahmad Badri dalam laporannya mengatakan, kegiatan reses sebagaimana diatur dalam tata tertib dewan No. 01/ DPRD/2010 dan Surat Keputusan DPRD Batubara No.170/ 0450/Tahun 2010 mulai melakukan pertemuan dengan komponen masyarakat sampai hasil peninjauanlangsungkelapangan. ‘’Kami berkesimpulan segala proyek bermasalah baik yang belum terselesaikan bersumber APBD tahun 2009 untuk ditindaklanjuti seperti pembangunan drainase, pembangunan jalan menuju Kampung Alei Desa Sentang dan jembatan komposit Desa Bagan Dalam sampai

pendistribusian air bersih dari pembangunan PDAM belum sepenuhnya dirasakan masyarakat, Kec. Tanjungtiram,’’ sebutnya. Selain untuk ditindaklanjuti sekaligus meminta pertanggungjawaban dari kontraktor ‘hitam’ yang mengerjakan. Sedangkan pembuatan KTP/KK melebihi harga ditetapkan Perda mencapai Rp50 ribu dan penertiban pukat harimau sejenisnya karena meresahkan nelayan kecil. Selain ketidakjelasan masukan kontribusi dari Samsat Kelautan sehingga pungli terhadap nelayan. Maupun alih fungsi kawasan hutan dan pertanian di Kec. Tanjungtiram/Talawi menjadi perkebunan kelapa sawit. Ketua DPRD Batubara Selamat Arifin meminta laporan reses yang disampaikan masing-masing dapil (daerah pemilihan) untuk ditindak lanjuti komisi yang membidangi.Terkait Ranperda tentang pemekaran desa yang diusulkan eksekutif diperlukan kejelian membahas terutama menyangkut tapal batas wilayah. ‘’Ini sesuai masukan diberikan Bupati Batubara OK Arya Zulkarnain yang disampaikan dalam sidang paripurna,’’ ujarnya. (a11)

DPC F.SPTI-K.SPSI T. Balai Masih Dipimpin Hasnan Marpaung TANJUNGBALAI (Waspada) : Hasnan Marpaung hingga kini masih dipercayakan memimpin DPC F.SPTI-K.SPSI Kota Tanjungbalai. Hal ini dibuktikan dengan keluarnya surat DPD F.SPTIK.SPSI Sumut No. 2747/ORG/ DPD-SU/IV/2010 tanggal 26 April 2010 tentang pengakuan keberadaan DPC F.SPTI-K.SPSI Tanjungbalai di bawah kepemimpinan Hasnan Marpaung. “Jadi tidak benar Hasnan Marpaung dicopot sebagai Ketua DPC F.SPTI-K.SPSI Tanjungbalai, itu hanya isu yang sengaja dihembuskan orang-orang yang mengaku pengurus KSPSI dan FSPTI illegal,” kata Pjs Ketua DPC F.SPTI-K.SPSITanjungbalai, Haidir Siagian, didampingi Sekretaris Edi Fahrizal Nasution, kepada Waspada di kantornya, Selasa (27/4). Haidir menegaskan, dalam surat DPD F.SPTI-K.SPSI Sumut itu disebutkan, Hasnan Marpaung tetap sebagai Ketua F.SPTI-K.SPSITanjungbalai yang sah, berdasarkan hasil Muscab 5 Mei 2007, dan telah ditetapkan melalui Surat Keputusan DPD F.SPTI-K.SPSI Sumut No. KEP. 60/)RG/DPD-SU/V/2007 tanggal 15 Mei 2007.

Selain itu, lanjut Haidir, DPC F.SPTI-K.SPSITanjungbalai pimpinan Hasnan Marpaung telah tercatat di DisnakerTanjungbalai dengan nomor surat 560-7/626/ TBP 17 tanggal 21 Nopember 2001. Bahkan Pemerintah Kota Tanjungbalai melalui surat No. 560/9270 tanggal 30 Mei 2008, secara tegas menyatakan, kepengurusan organisasi pekerja yang telah terdaftar atau tercatat di Disnaker itu belum dinyatakan bubar. Oleh sebab itu, Edi Fahrizal Nasution menambahkan, mereka akan menempuh jalur hukum atas munculnya SK DPD F.SPTI-K.SPSI illegal yang menyatakan Hasnan Marpung tidak lagi sebagai ketua DPC F.SPTI-K.SPSI Tanjungbalai. “Kita akan tempuh jalur hukum, karena SK ilegal itu telah mencemarkan nama baik ketua kami, Hasnan Marpaung,” tegas Edi Fahrizal. Lebih lanjut ditambahkan Edi Fahrizal, DPD F.SPTI-K.SPSI Sumut juga masih dipimpin Conrad P Nainggolan dan Sekretaris Ramlan Purba, bukan Rizaldimavi dan Hendra Mika Siahaan. (a37)

Nanas Bercabang Lima Ditemukan Di Asahan KISARAN (Waspada): Nanas bercabanglima,memilikisembilan mahkota ditemukan Asahan, dan kehadirannya membuat heboh warga sekitar. Buah nanas tersebut diperkirakan mencapai dua bulan, dan tumbuh dengan sendirinya di atas sumur tua yang sudah tertimbun, tepatnyadiJalanJuanda,Kelurahan Gambirbaru, Kisaran Timur, Asahan.Salahsatubuahnyamembesar Waspada/Sapriadi dan memiliki lima mahkota, sedangkan di pangkalnya tumbuh empat nanas yang masih kecil, sehingga bila dilihat dengan seksama maka buah ini seperti tangan dengan lima jari. “Pohonnanasinisudahadaduatahunlalu,namunbarupertama kali ini buahnya bercanag lima, dengan salah cabang memiliki lima mahkota, dan empat cabang lainnya masing-masing memiliki satu mahkota, sehingga kami agak heran, dan tidak berani memetiknya,” ujar Mastia,60, warga yang tinggal di dekat nanas itu tumbuh, kemarin. Oleh sebab itu, kata Mastia, ia dan warga lainnya tetap merawat nanas,agartidakdicuriorangkarenabuahinimenurutnya,mungkin fenomena alam yang belum pernah mereka lihat, atau sebuah pertanda akan terjadi sesuatu. “Sudah 60 tahun saya hidup, saya belum pernah lihat nanas seperti ini, oleh sebab itu, kami akan merawatnya,” ujar Mastia. (csap)

Waspada/Nurkarim Nehe

AKSI MASSA: Aksi massa Komite Bangkit Asahan saat menyampaikan surat terbuka dan surat Ali bin Abi Thalib saat demo di gedung DPRD Asahan, Senin (26/4).

Surat Ali Untuk Pejabat KOMITE Bangkit Asahan dalam demo di gedung DPRD Asahan, Senin (26/4) mensinyalir Pemilukada Asahan hanya akan melahirkan para penjajah baru yang suatu saat siap ‘menerkam dan memangsa rakyatnya sendiri.’ Dikatakan, bukan rahasia lagi, kondisi ril yang terjadi menunjukkan kontestan, elite dan perangkatnya melakukan caracara haram, menghalalkan segala cara untuk merusak nilainilai, etika dan tatanan demokrasi hanya demi meraih kekuasaan semata tanpa berorientasi kemaslahatan secara umum. Pimpinan Komite Bangkit Asahan Hidayat Taufiq dalam kesempatan itu, selain menyebarkan surat terbuka untuk Calon Bupati/Calon Wakil Bupati Asahan dan seluruh rakyat Asahan, juga nasihat untuk pejabat dan calon pejabat. Pada tahun 38 Hijriah, ujar Hidayat Taufiq, Ali Bin Abi Thalib menujuk Malik Bin Al Harits sebagai Gubernur Mesir dengan membuat surat sebagai pedoman Malik untuk menjalankan pemerintahan. “Ketahuilah hai Malik. Kukirimkan engkau ke suatu daerah yang telah memiliki pemerintahan sebelumnya, baik yang adil maupun yang zalim. Rakyat akan melihat tindakan mu sebagaimana mereka telah memperhatikan tindakan para penguasa sebelum kamu. Rakyat akan mengkritik kamu sebagaimana kamu mengkritik mereka. Sesungguhnya orang-orang baik dikenal dari keharuman namanya. Karena itu, perbendaharaan yang harus kamu kumpulkan adalah amal shaleh. Maka kendalikanlah hawa

nafsumu dan tahanlah hatimu dari berbuat sesuatu yang tidak boleh kamu lakukan. Biasakanlah hatimu menyayangi rakyatmu. Janganlah berdiri di atas mereka seperti binatang rakus yang ingin menerkam mereka. Ada dua jenis rakyatmu, satu saudaramu dalam satu agama, yang satunya lagi saudaramu sesama makhluk. Sewaktu-waktu mereka berbuat salah, baik sengaja atau tidak sengaja, ulurkanlah maafmu sebagaimana Allah mengulurkan ampunan kepada mu. Mereka berada di bawah mu, kamu berada di bawah iman mu, dan Allah berada di atas segala kuasa mu yang menunjuk mu. Cuplikan lain surat Ali bin Abi Thalib yang dikutip Komite Bangkit Asahan, uruslah kepentingan orang- orang yang tidak sanggup menemuimu karena penampilan mereka yang jelek dan menganggap diri mereka sendiri rendah. Tunjuklah para pejabat yang bertakwa dan rendah hati untuk mengurus mereka. Peliharalah anak-anak yatim, orangtua yang melarat dan tidak sanggup mencari nafkah. Jauhkanlah dari kamu para pengawalmu yang membuat orang takut untuk berbicara kepadamu, karena Rasulullah beberapa kali pernah berkata. “Orang-orang yang tidak dapat menjaga hak orang lemah dalam menghadapi orang-orang kuat tanpa rasa takut, maka tidak akan pernah mencapai kesucian.” Massa Komite Bangkit Asahan di sela orasi melakukan atraksi fragmen, nyanyian, bakar ban bekas dan spanduk kontrak moral dengan Cabup/Cawabup Asahan 2010-2015 yang hari itu menyampaikan visi misi dalam sidang paripurna DPRD Asahan. Nurkarim Nehe

Waspada/Armansyah Abdi

PEMILU DAMAI: Pasangan Calon Bupati-Wakil Bupati L.Batu Hj Adlina-Drs Trisno menandatangani Naskah Kesepakatan Pemilu Damai.

Peserta Pilkada L. Batu Tandatangani Naskah Kesepakatan Pemilu Damai Pasangan HATI Siap Patuhi RANTAUPRAPAT (Waspada): Pasangan Calon Bupati dan Wakil Bupati Labuhanbatu Hj Adlina-Drs Trisno yang lebih dikenal dengan julukan “HATI” dengan nomor 1 ini menandatangani naskah kesepakatan Pemilu Damai Pemilu Kada yang diselenggarakan KPU bekerjasama dengan Polres L.Batu, Selasa (27/4) di halaman Mapolres setempat. Hadir saat itu Wakil Bupati H Sudarwanto, S.SP, Ketua DPRD Hj Ellya Rosa Siregar, Ketua dan anggota KPU, Ketua Panwas, unsur Muspida serta partai pendukung dan Tim Sukses Pasangan Hj.Adlina-Drs Trisno. Dalam naskah kesepakatan Pemilu Damai yang ditandatangani tiga pasang calon itu, di antaranya pasangan Hj AdlinaDrsTrisno. Ada tiga poin ketentuan yang harus ditaati, Pertama, KPU L.Batu selaku penyelenggara Pemilu Kada Tahun 2010 melaksanakan tahapan tepat waktu berdasarkan ketentuan perundang-undangan dan peraturan yang berkaitan dengan tugas dan kewenangan penyelenggara. Kedua, peserta Pemilu Kada tahun 2010 melakukan kegiatan sesuai jadwal yang ditetapkan KPU L.Batu berdasarkan ketentuan

perundang-undangan dan peraturan yang berkaitan dengan hak dan kewajiban peserta. Ketiga, pelanggaran terhadap ketentuan perundang-undangan dan peraturan yang berkaitan dengan tugas penyelenggara serta hak dan kewajiban peserta diselesaikan melalui jalur hukum. Wabup L.Batu H Sudarwanto, S.SP mengatakan, kesepakatan Pemilu Damai ini merupakan itikad baik para calon untuk melaksanakan Pemilukada secara damai. Penandatanganan ini bukan seremonial semata, tetapi merupakan pemikiran yang datang dari hati masing-masing calon. Abdul Hakim Lubis ditemui dalam acara itu mengatakan sebagai tim sukses nomor urut I Hj Adlina-Trisno beliau berharap para tim sukses dan pendukung masing-masing calon untuk tampil elegan dan santun, jangan arogan, jangan melanggar rambu-rambu yang ada, jangan sakiti hati rakyat, jangan tebar janji muluk-muluk dan raihlah suara rakyat dengan cara simpatik. Ketua KPU L.Batu Hj Ira Wirtati, S.Ag,M.Pd mengingatkan, siapapun nanti yang menang atau kalah harus sepakat melaksanakan Pemilu Damai ini. (a27/a26)


Aceh

WASPADA Rabu 28 April 2010

C3 Warga ‘Banjiri’ Malam Penggalangan Dana

Mahasiswa Jangan Terjebak Konflik Kepentingan

TAKENGON (Waspada): Diperkirakan sekitar seribuan warga ‘banjiri’ lokasi acara penggalangan dana pembangunan masjid besar di Kecamatan Bies, Aceh Tengah. Acara yang dikemas Panpel (Muspika dan tokoh masyarakat-Red) untuk mencari dana tambahan perampungan sarana ibadah umat muslim itu, melalui pagelaran seni budaya dari berbagai etnis. Kegiatan yang dipusatkan di Kantor Camat Bies pada Sabtu (25/4) malam, mulai diramaikan warga yang datang secara berlahan.” Kami sengaja datang ke sini. Bukan hanya sekedar menyaksikan pertunjukan yang dikemas Panpel berupa Didong, Ketoprak dan Rebana, namun tujuan utama kami lainnya, bersama keluarga, menyumbang dana seikhlasnya untuk pembangunan mesjid Al-Jihad,” jelas Sumadi, seorang warga. Pantauan Waspada, acara pagelaran seni budaya, untuk menggalang dana pembangunan mesjid itu, dibuka Bupati Aceh Tengah, Ir. Nasaruddin, MM, sekira pukul 22:00. Kemudian berbagai pertujukan pun dimulai, seperti Ketoprak( seni etnis Jawa) yang dipentaskan selama 2 jam, dilanjutkan Didong. (cir)

SIGLI (Waspada): Mahasiswa Universitas Jabal Ghafur (Unigha) Sigli, Kabupaten Pidie diminta berhati-hati menyikapi persoalan somasi terhadap yayasan, karena dikhawatirkan terjebak konflik kepentingan. “Pandangan kami, mahasiswa tidak perlu mendukung salah satu kubu. Artinya mahasiswa jangan sampai terjebak konflik tersebut. Namun mahasiswa harus terus memantau sejauhmana konflik itu berlangsung,” kata Ketua Dewan Pimpinan Wilayah Partai Rakyat Aceh (DPW-PRA) Kab. Pidie, Afifuddin kepada Waspada, Minggu (25/4). Menurut dia, yang perlu dilakukan mahasiswa segera meningkatkan tuntutan menegrikan kampus Unigha kepada pemerintah, supaya persoalan itu lekas selesai dan Unigha dapat diambil-alih Pemkab. “Bila serius meningkatkan kwalitas pendidikan, maka Pemkab Pidie akan menindaklanjutin dan mengambil-alih yayasan Unigha,” kata Afifuddin, Lanjutnya, Pemkab tidak ada niat baik untuk meningkatkan kwalitas pendidikan. Membiarkan kasusnya berlanjut. Karena itu mahasiswa harus mendesak Pemkab mengambil-alih yayasan. “Mahasiswa jangan sampai ditunggangi pihak tertentu demi kepentingan kelompok di tubuh yayasan,” ujarnya. Menurut Afifuddin, pihak yang paling bertanggungjawab di tubuh Yayasan Unigha adalah Pemkab Pidie, yang dinilainya tidak serius menangani kasus Unigha. Malah menurut dia, kesannya Pemkab Pidie membiarkan konflik terus terjadi. Padahal konflik ini sangat berpengaruh terhadap pendidikan di Pidie.(b20)

Memperingati Hari Kartini, Ibu-ibu Donor Darah

Warga Minta Pantai Kuala Raja Dibuka BIREUEN (Waspada ): Warga Bireuen minta Pemkab membuka kembali untuk umum tempat wisata Pantai Kuala Raja Kecamatan Kuala, yang ditutup berapa bulan lalu. “Untuk mengisi hari libur bersama keluarga, kami butuh tempat rekreasi pantai. Biasanya anak-anak suka sekali berenang di laut, namun sejak ditutup kami bingung karena anak saya setiap hari libur minta rekreasi ke pantai,” ujar Bukhari, 38,Warga Kota Juang, Minggu (25/4). Bukhari menilai alasan Camat Kuala menutup Pantai Kuala Raja dengan alasan akan jadi sarang maksiat tidak beralasan. Sebab pantai tersebut terbuka sehingga tidak mungkin orang berbuat maksiat di hadapan umum. Pemerintah juga bisa melibatkan Polisi Wilayatuh Hisbah (WH) dan pemuda setempat untuk berjaga-jaga. Menanggapi itu, Camat Kuala M. Jamil, S.pd mengatakan pihaknya akan melakukan musyawarah dengan tokoh masyarakat Kuala untuk mencari jalan ke luar yang terbaik. “Saya juga akan berkoordinasi dengan pemerintah, dinas-dinas terkait membicarakan hal ini,” jelasnya.(mi)

14 Juni STAIN Malikussaleh Terima Mahasiswa Baru KOTA LHOKSEUMAWE (Waspada): Darmadi Sulaiman, S.Sos.i, Kepala Humas dan Kerjasama Antar Lembaga, Sekolah Tinggi Agama Islam Negeri (STAIN) Malikussaleh Lhokseumawe mengatakan, mulai 14 Juni pihaknya kembali membuka penerimaan mahasiswa baru untuk tahun ajaran 2010-2011. Jadwal kegiatan SPMB secara nasional mulai dilaksanakan pada tanggal 14 sampai dengan 30 Juni. Validasi data peserta ujian 5 Juli. Sementara pelaksanaan ujian tulis pada 6 Juli, dan pengumuman kelulusan dikeluarkan pada 23 Juli. Biaya ujian ditetapkan senilai Rp150 ribu. Disebutkan, untuk tahun ajaran 2010-2011, STAIN Mali kussaleh menerima mahasiswa baru melalui jalur undangan bagi siswa berprestasi di tingkat SMU dan sederajat. Undangan dikirim ke sekolah di wilayah Kota Lhokseumawe, Aceh Ut ara, dan Bireun. Jumlah siswa yang diundang sebanyak tiga orang, dengan rinciannya 1 oran g untuk jurusan Tarbiyah, 1 oran g Jurusan Syari’ah, dan 1 orang untuk Jurusan Dakwah. “Syarat yang harus dilengkapi siswa berprestasi yaitu terbaik peringkat tiga besar dibuktikan dengan surat keterangan kepala sekolah, disertai foto copi rapor dan memperlihatkan rapor asli. Khusus untuk mahasiswa undangan, pendaftaran mualai dibuka tanggal 3-7 Mei 2010, di kampus STAIN Mali kussaleh. Pengumuman hasil seleksi ADM 19 Mei, pengumuman tes bacaan Al-Qur’an 26 Mei, pengumuman tes tulis 31 Mei dan pendaftaran ulang 5-7 Juli 2010. Bagi mereka dibebaskan biaya pendaftaran,” jelas Darmadi Sulaiman.(cmun)

Ketua Partai Golkar Aceh:

Aceh Utara Jauh Tertinggal ACEH UTARA (Waspada): Partai berlambang pohon beringin menilai Kabupaten Aceh Utara semakin hari semakin jauh tertinggal dari kabupaten lain. Hal ini disebabkan berbagai sumber PAD dari proyek vital tak mampu dikelola dengan baik. Kesalahan dalam menjalankan amanah rakyat dalam hal bagi hasil Migas dan otonomi khusus, berpengaruh pada perkembangan kabupaten itu. Demikian Ketua DPD Partai Golkar Aceh, Sulaiman Abda ketika melantik Ketua DPD Golkar Aceh Utara, H. Nasarudin Daud periode 2010-1015 di Hotel Lido Graha, kemarin. Nasarudin menggantikan H. Zulkifli Hanafiah. Fenomena turunnya dana bagi hasil Migas dan Otsus setiap tahun, dengan grafik tahun 2009 Rp9 triliun kini menjadi Rp7,6 triliun, harus dilakukan pembenahan oleh pemerintah daerah dari sumber sektor potensial. Ini perlu ditindaklanjuti secepatnya, bila Aceh Utara tidak ingin mengalami devisit Anggaran Pendapatan Belanja Kabupaten (APBK) seperti Kab/Kota lainnya. “Bupati harus mencari sumber PAD baru atau dana baru, disebabkan sebelumnya daerah ini pemasok terbesar dari dana perimbangan Migas dan Otsus. Untuk itu amanah besar wajib diusung Golkar sebagai pioner pembangunan di Aceh,” katanya. Kepada semua partai politik diminta terlibat dalam kancah perpolitikan di Aceh, kiranya dapat mensinergikan pemahaman dalam mendongkrak perekonomian masyarakat di daerah bekas konflik ini. Meski memiliki warna berbeda, tetapi tetap memiliki satu tekad demi kepentingan masyarakat Aceh ke depan.(cmun)

MPD Bireuen Minta Direkonstruksi BIREUEN (Waspada): Majelis Pendidikan Daerah Kabupaten Bireuen sudah sekian lama vakum alias mati suri. Kevakuman MPD berdampak buruk terhadap kemajuan pendidikan. Ketua PGRI Drs. Zainuddin, M.Pd dan Ketua Kobar-GB Bireuen mengemukakan hal itu kepada Waspada, Minggu (25/ 4). Dikatakan, kesimpulan informal meeting yang digelar tim inisiator PGRI dan Kobar-GB, Kamis lalu, diminta merekonstruksi dan mereposisi Majelis Pendidikan Daerah (MPD) Kabupaten Bireuen yang sekian lama vakum diharapkan terlaksana sebelum TA 2010. Informal meeting merekonstruksi dan mereposisi keberadaan MPD di aula SMAN-2 Bireuen, diikuti 60 peserta terdiri dari tim inisiator Kobar-GB, PGRI dan elemen masyarakat, LSM Bidang Pendidikan, tokoh pendidikan, perwakilan Komite Sekolah, penyelenggara pendidikan sekolah, luar sekolah, madrasah, dunia usaha industri/asosiasi profesi, akademisi, unsur birokrasi dan legislatif. Tim perumus yang sudah terbentuk terdiri dari tim inisiator PGRI, Kobar-GB, Drs. Abdullah Amin, MM, Drs. Iskandar Yusuf, MM, Drs. HA Wahid Hasan, Drs. Asnawi Hasan, Drs. Afriadi, M.Pd (guru teladan), Drs. M. Yusuf, M.Pd dan Dra. Rosnidar, akan disampaikan kepada Bupati Bireuen. Ketua Kobar GB Bireuen Drs. M. Jakfar dan Ketua PGRI Drs. Zainuddin, M.Pd menyebutkan, pemilihan calon ketua dan pengurus MPD dengan kriteria mengerti masalah pendidikan, punya wawasan, energik, dikenal masyarakat, mampu membawa MPD dalam memajukan pendidikan dan berdomisili di Kabupaten Bireuen.(b16)

Waspada / H. Rusli Ismail

DIBERSIHKAN : Lima pekerja membersihkan kolam ikan Masjid Raya Baiturrahman, Kota Banda Aceh dari kotoran sampah dan lumpur yang mengendap, Senin (26/4). Setelah dibersihkan akan dilepas kembali sekitar 4.000 bibit ikan mas dan nila ke dalam kolam. Biasanya benih ikan yang dilepas dipanen kembali setelah 3 sampai 4 bulan. Hasil panen dijual dan biayanya untuk kemakmuran masjid, kata seorang pekerja menjawab Waspada.

Aceh Butuh Kopertis BANDA ACEH (Waspada): Ketua Majelis Pendidikan Aceh (MPA), Prof. Dr. Warul Walidin AK, MA minta pemerintah pusat membentuk Koordinator Perguruan Tinggi Swasta (Kopertis) tersendiri bagi Aceh, karena selama ini 105 perguruan tinggi swasta di Bumi Serambi Mekkah tunduk kepada KopertisWilayah I di Medan, Sumatera Utara. “Kami harapkan di Aceh ada Kopertis tersendiri sehingga memudahkan proses administrasi, pengawasan dan pembinaan PTS di Aceh, karena kalau ke Medan itu jauh,” ujar Prof.Warul Walidin dalam pertemuan dengan Komite 3 DPD RI yang diketuai Abdul Aziz Kahar Muzakar, yang diikuti seluruh SKPA, Senin (26/4) di ruang serbaguna, Setda Aceh, Banda Aceh. Pada pertemuan yang dipimpin dan dibuka Gubernur Irwandi Yusuf tersebut, Warul Walidin menambahkan, sesuai

dengan semangat UU Nomor 11Tahun 2006 tentang Pemerintahan Aceh, sudah selayaknya Aceh punya Kopertis sendiri. “Jadi kami berharap Komite 3 DPD RI dapat membantu dan mendorong lahirnya kopertis di Aceh,” pintanya. Sementara Kepala Baital Mal Aceh, menyampaikan bahwa di Aceh berdasarkan pasal 192 UU Nomor 11 Tahun 2006 menyebutkan zakat yang dibayar menjadi pengurangan pajak bagi wajib pajak. “Ini yang sampai hari ini masih menjadi permasalahan karena ini belum bisa diterima dan menyetujui dilaksanakan di Aceh,” ungkapnya. Dari Badan Pendidikan dan Pembinaan Dayah juga menyampaikan kepada anggota Komite 3 DPD RI tentang kebutuhan anggaran untuk sarana fisik dayah-dayah di Aceh. Dalam pertemuan itu juga dike-

mukan bahwa jumlah jamaah haji Aceh yang waiting list sampai 23 April 2010 sebanyak 34.006 orang yang membutuhkan perhatian pemerintah pusat. Sampai saat ini, perhitungan quota haji Aceh masih dihitung dengan jumlah penduduk 3,5 juta sehingga jatah Aceh tiap tahun hanya 3.500. Padahal jumlah penduduk Aceh saat ini mencapai 4,6 juta jiwa kalau dihitung satu permil maka jumlahnya bisa mencapai 4.500 orang. Tentang hal ini telah disampaikan dengan surat kepada Menteri Agama. Gubernur Aceh Irwandi Yusuf yang pada acara yang turut dihadiri Ketua DPRA Hasbi Abdullah, menambahkan, bahwa pemerintah pusat masih berhutang dengan Aceh dalam pelaksanaan UU Nomor 11 Tahun 2006 tentang Pemerintah Aceh. Karena sampai saat ini

masih ada peraturan pemerintah dan peraturan presiden belum dikeluarkan. “Terkait dengan implementasi UU Nomor 11 Tahun 2006, dari sembilan peraturan pemerintah itu baru dua PP yang sudah diundangkan pemerintah, tiga RPP masih dibahas dan empat lagi RPP asih belum ada drafnya,” ujar Irwandi menambahkan disela-sela pertemuan yang lebih banyak disampaikan para SKPA tersebut. Selain itu, tambah Irwandi, bahwa masih ada tiga peraturan presiden yang harus diterbitkan dalam pelaksanaan UU Nomor 11Tahun 2006 tentang Pemerintah Aceh. Dua diantaranya sudah ditetapkan dan satu lagi Perpres tentang Badan Pertanahan Nasional (BPN) masih belum diterbitkan. Kita harapkan pusat segera menerbitkan PP dan Perpres ini,” pinta Gubernur Aceh ini. (b04)

Dua Harimau Aceh Ke Taman Safari BANDA ACEH (Waspada): Dua ekor Harimau Sumatera (Panthera Tigris Sumatrae) asal Aceh dibawa ke Taman Safari Indonesia, di Bogor, Jawa Barat untuk dipelihara. Dua harimau jinak itu sebelumnya berada di Badan Konservasi Sumber Daya Alam (BKSDA) Aceh. Kepala BKSDA) Aceh, Ir. Abu Bakar kepada wartawan, Senin (26/4) mengatakan, penitipan kedua penguasa hutan itu sudah mendapat persetujuan kepala daerah, dalam hal ini Gubernur Aceh. “Ke dua harimau

dititipkan ke Taman Safari Indonesia,” jelas Abu Bakar. Dia menjelaskan, ke dua harimau ini berasal dari Aceh Selatan dan Subulussalam.Yang kakinya diamputasi karena terkena jeratan babi ketika ditemukan pada Juli 2009. Satunya lagi dari Tapaktuan yang dipelihara warga sejak kecil juga dibawa ke BKSDA Aceh di Banda Aceh pada Juni 2009. Ke dua satwa betina itu bernama Cut Nyak berumr 5 tahun dan Salamah 3 tahun. Keduanya diangkut ke Bogor dengan me-

numpang pesawat Garuda Indonesia melalui Bandara Sultan Iskandar Muda, Blang Bintang, Aceh Besar, Dia mengatakan, ke dua harimau tak mungkin lagi dilepas ke habitatnya karena sudah jinak. “Jika dilepas, potensi matinya sangat besar. Jadi ini akan di bawa ke sana (Taman Safari) untuk diperanakkan,” katanya di Banda Aceh. Abu mengatakan, pihaknya dalam pengiriman ke dua satwa sudah memberitahu gubernur. “Yang kita inginkan adalah

Darwis, SH Tangani Kasus Kadin Banda Aceh BANDA ACEH (Waspada): Pengacara Darwis, SH ditunjuk 150 anggota Kadin Banda Aceh untuk mengadvokasi polemik Mukota Kadin Banda Aceh, dan diharapkan dapat memberikan titik terang dari kasus tersebut. “Kami sudah menyampaikan semua persoalan itu kepada Pak Darwis. Dan beliau pun menyatakan kesiapannya untuk mengusutrekayasaitukepadapublik sesuai kebenaran yang ada,” ungkap salah seorang anggota Kadin Banda Aceh, Samsul B, Ibrahim di Banda Aceh, Senin (26/4). Bersama dengan 150 anggota Kadin Banda Aceh yang telah memberikan kuasanya secara tertulis, Samsul menyebutkan pihaknya tak akan berhenti membongkar rekayasa itu. Apalagi jumlah pemberi kuasa yang juga menuntut transparansi

Musyawarah Kota (Mukota) IV Kadin lalu, dipastikan akan mencapai 300 anggota lebih. Dengan dukungan yang besar itu, kata Samsul, tentunya indikasi rekayasa dan pelanggaran AD/ART yang dilakukan oleh Panitia Mukota dan Plt. Kadin nilainya bukan sekedar isapan jempol belaka. “Apalagi sejak polemik ini diketahui publik, berbagai ancaman dan teror mulai dialami sejumlah pihaknya yang lantang mengeluarkan berbagai protes,” imbuhnya. Samsul menyebutkan, beberapa rekannya yang selama ini sering melontarkan pernyataan kepada publik mulai diteror oleh oknum tertentu dan diminta tidak berbicara apapun terkait kasus ini dengan ancaman tertentu pula. “Karenanya, kamibertambahyakinuntukme-

ngajukan kasus ini ke meja hijau. Apalagi saat ini bersama kami ada PakDarwisyangseringmenuntaskan berbagai kasus korupsi di Aceh,” ungkapnya optimis. Adanya upaya teror dan ancaman yang ditujukan kepada anggota Kadin Banda Aceh, ini tak pelak membuat Ketua Komisi B DPRK Banda Aceh, Ir Yusmaizal, terkejut. Pihaknya menyayangkan aksi teror itu meski nuansa tersebut tidak asing dalam kasus tertentu yang melibatkan “kalangan berduit”. Yusmaizal juga meminta kepada anggota Kadin yang mengalami teror itu untuk tidak gentar. Selama pernyataan dan bukti yang disampaikan benar, DPRK Banda Aceh khususnya Komisi B yang membidangi perekonomian, akan senantiasa mendukung. (b07)

genetikanya itu tetap terjaga dan dikembangbiakkan. Dan kita belum memiliki sarana yang cukup untuk itu,” ujarnya. Dokter Hewan dari Taman Sari, Bongot, memastikan ke dua si belang itu dalam kondisi sehat dengan berat, Cut Nyak 71 kg dan Salamah 45 kg. Hanya saja, harimau bernama Salamah kondisi kakinya sebelah cacat akibat kena jeratan babi yang dipasangwargatahunlalu.Keduaharimaudibawadengandimasukkan ke kerangkeng besi usai dibius. Menurut Bongot, secara pemeriksaan fisik, pada keduanya tidak ditemukan kelainan kecuali cacat kaki. Mengenai pemeriksaan darah pihaknya belum mendapat hasil DNA hewan tersebut. Informasi dari BKSDA Aceh menyebutkan, ke dua harimau itu ditangkap usai terkena jeratan babi yang dipasang warga masing-masing di hutan Aceh Selatan dan Subulussalam. Pada 2009, konflik antara harimau dengan warga cukup tinggi di kedua wilayah. Kepala BKSDA Aceh Abu Bakar memperkirakan jumlah populasi harimau Sumatera di Aceh kini tinggal antara 147 hingga 154 ekor lagi. Jumlah ini setara 22 persen dari populasi harimau di Indonesia yang diperkirakan hanya 540 ekor. Sejauh ini, tercatat tujuh ekor harimau pernah dikandangkanpihakBKSDA.Limaekor sudah dibawa ke Lampung dan empat di antaranya sudah dilepasliarkan di sana. Kali ini, pihaknya menitipkan dua ekor lagi ke Taman Safari Indonesia. (b05)

SABANG (Waspada): Dalam memperingati Hari Kartini 21 April lalu, ibu-ibu tergabung dalam berbagai organisasi wanita, Minggu (25/4) pagi ramai-ramai mendaftarkan diri agar darahnya bisa diambil secara sukarela untuk disumbangkan kepada pihak yang membutuhkan. Acara donor darah dipusatkan di lapangan Play Ground diprakarsasi Badan Pemberdayaan Masyarakat, KB dan Pemberdayaan Perempuan Kota Sabang bekerjasama dengan PMI Cabang Sabang dan RSAL J Lilipory dan jajaran TNI serta organisasi wanita di kota ini. Sekda Kota Sabang, Drs. Sofyan Daud mengatakan, sebenarnya pihaknya tidak setuju setetes darah ibu dijadikan donor, sebab ibu-ibu sudah banyak mengorbankan darahnya dengan mempertaruhkan nyawa yakni ketika melahirkan bayi. Dia mengimbau PMI untuk menyuratinya agar seluruh PNS khususnya yang pria harus diambil darahnya sebagai tenaga donor sukarela. Sekda Sabang minta kepada KTU Unit Transfusi Daerah Banda Aceh Hasballah. Sekda berharap darah tersebut dapat diprioritaskan untuk membantu perempuan yang memerlukan stok darah, khususnya saat-saat kritis ketika menjalani pesalinan. Dia bersyukur melihat antusias masyarakat terutama kaum perempuan yang menyumbangkan darahnya hingga bisa mencapai 100 kantong. Sementara mantan Menteri Negara Pemberyaan Perempuan Khofifah Indar Parawansa menyatakan, kegiatan donor darah untuk perempuan yang dikaitkan dengan peringatan Hari Kartini cukup relevan. Kartini meninggal pada usia 25 tahun karena komplikasi pesalinan, mengakibatkan pendarahan tak terkendali. (b29)

Panglima Armada Wilayah Barat TNI-AL Kunker Ke Sabang SABANG (Waspada): Panglima Armada Wilayah Barat TNI AL (Pangarmabar) Laksamana Muda TNI Marsetio, MM melakukan kunjungan kerja (Kunker) ke Kota Sabang, kemarin. Pangarmabar tiba di Bandara Maimun Saleh sekira pukul 12:41 dengan pesawat khusus Casa 212 (U-611) didampingi Danlantamal I Laksamana Pertama TNI Syarif Husin beserta sejumlah perwira menengah di jajaran Armabar dan Lantamal I. Pangarmabar sempat menggelar pertemuan internal dengan jajaran anggota TNI AL di Mako Lanal. Kemudian melanjutkan kunjungan ke Dermaga Lanal dan Fasharkan.(b29)

Calon Independen Diperdebatkan, Pasal 256 UUPA Diseminarkan BANDA ACEH (Waspada): Polemik calon independen di Aceh masih terus bergulir. Terjadi tarik-menarik pada pasal 256 Undangundan Pemerintahan Aceh (UUPA) yang mengatur hal tersebut. “Pasal 256 UUPA telah melahirkan pro kontra dalam masyarakat Aceh. Kelompok kontra meminta agar pasal tersebut perlu judicial review (red, pengkajian ulang). Sedangkan kubu yang pro meminta agar pasal 256 UUPA itu dipertahankan, karena dinilai partai politik local cukup akomodatif untuk menampung aspirasi tersebut,” tutur Ketua Umum Gerakan Persaudaraan Muslim Indonesia (GMPI) Aceh, Hamdani Hamid, pada konfrensi pers mengenai Peluang danTantangan TerhadapYudicial Review UUPA, Sabtu (24/4) di Banda Aceh. Ia mengatakan, GMPI sebagai fasilitator atas persoalan tersebut. Jadi, “Kami tidak boleh berpihak. Kami akan merumuskan masalah itu dalam seminar ini. Selanjutnya, DPRA lah yang akan memutuskan. Akan tetapi, GMPI tak berkepentingan menyangkut permasalahan pasal 256 itu, sayangnya, kini cenderung muncul pemikiran adanya kepentingan dari berbagai kelompok mengenai hal tersebut,” ungkapnya. Melalui forum ini, kata Hamdani, akan lahir mekanisme dan formula sebagai langkah menjembatani komunikasi berbagai kepentingan kelompok di Aceh. Sehingga akan bermuara pada kepentingan bersama.(gto/bah/b02)

Bawa Sabu, Pegawai Honorer Ditangkap Polisi BANDA ACEH (Waspada): Seorang pegawai honorer diringkus Tim Satuan Narkoba Polisi kota besar (Poltabes) Banda Aceh, di rumahnya di kawasan Jalan Mohd. Hasan, Kecamatan Lueng Bata, Kotamadya Banda Aceh. Pemuda berusia 23 tahun itu kedapatan memiliki sebungkus plastik kecil bening berisi butiran sabu. FS Bin I, pegawai honorer yang bertugas di Dinas Bina Marga dan Cipta Karya Provinsi Aceh itu, ditangkap Kamis (22/4) malam, sekitar pukul 22.00. Menurutnya saat ditemui wartawan di Mapoltabes Banda Aceh, Sabtu (24/4), barang haram itu diperoleh dari seorang kenalan bernama Age yang merupakan warga Medan, Sumatera Utara, dibeli seharga Rp300 ribu. Age masih dalam pengejaran Polisi. Kapoltabes Banda Aceh Kombes Pol Armensyah Thay menyebutkan, penangkapan tersangka berkat laporan masyarakat. Selain menangkap pemilik sabu, pada Jumat (24/4) sekitar pukul 23.00 Polisi juga menahan MDY Bin S, 29, wiraswasta, warga STA Mansyur Syah, Peuniti, Kecamatan Baiturrahman, Banda Aceh, dan JBB, 24, juru parkir, warga Pulau Brayan, Medan Sumatera Utara. Keduanya diringkus di jalan Tanggul, Kecamatan Kuta Alam Banda Aceh, saat asyik menggunakan narkotika jenis ganja. Bersama kedua tersangka, petugas menemukan delapan bungkus plastik warna bening yang didalamnya berisi biji, ranting dan daun ganja, serta dua puntung rokok yang telah diisi dengan ganja. Berikut barang bukti keduanya langsung ditangkap dan dibawa ke Mapoltabes guna dilakukan penyidikan lebih lanjut. (gto/b02)

Irwandi Tak Setuju Dayah Disebut Pesantren Salurkan Rp240 M Untuk Beasiswa Anak Yatim ACEH UTARA (Waspada): Drh. H. Irwandi Yusuf, Gubernur Provinsi Aceh di hadapan para ulama tujuh kabupaten/kota di Aceh pada peresmian dayah Darul Islah di Gampong Ulee Blang, Nisam, Aceh Utara, kemarin, mengatakan tidak setuju dayah disebut dengan pesantren. Alasannya, pesantren berasal dari kata Puntren yaitu tempat belajarnya putri-putri raja. “Karena itu, saya secara pribadi tidak setuju dayah disebut dengan pesantren, karena pesantren merupakan tempat belajar atau tempat berkumpulnya putri-putri raja. Kalau seperti itu artinya, apakah kita masih mau me-

namakan dayah dengan pesantren. Kalau ke depan ada dayah yang menamakan pesantren, maka tidak boleh diberi bantuan, setuju,” tanya Irwandi kepada para ulama. Irwandi menyebutkan, pada 2009 pihaknya mengucurkan bantuan kepada 629 dayah yang telah terdaftar, dan Pemprov Aceh menyediakan anggaran Rp240 miliar pada 2009 untuk beasiswa anak yatim yang jumlahnya mencapai 140 ribu orang. Setiap anak memperoleh Rp1.8 juta. Sementara pada 2008, Pemerintah Aceh membantu beasiswa sama untuk 80 ribu anak yatim. “Program ini

jangka panjang. Karena seorang anak masih menyandang yatim sampai berumur 18 tahun atau tamat SMA. Dan setiap hari muncul anak yatim baru. Mudah-mudahan ke depan tidak ada anak yatim seperti sebelum tahun 2005, yang setiap hari jumlahnya ratusan oran g,” kata Irwandi. Kalau program beasiswa tidak dicanangkan, maka ke depan akan banyak anak yatim putus sekolah (DO) karena berbagai alasan, di antaranya tidak punya uang transportasi dan tidak ada jajan di sekolah. “Kalau saja di setiap rumah ada tiga anak yatim yang ibunya bekerja sebagai buruh,

makajelasdiatidaksanggupmemberijajan dan ongkos transport kepada anaknya. Karena setiap anak paling sedikit membutuhkan uang Rp5000. Atas dasar inilah bantuan kita berikan, apa lagi, pendidikan hak setiap warga negara,” sebut Irwandi. Pendidikan bagi warga Aceh cukup penting, karena tanpa pendidikan, warga Aceh akan mudah dibohongi dan jika pendidikan tidak ada, warga Aceh akan mudah menerima setiap hal-hal aneh, seperti terorisme dan lainnya. “Bisa baca tulis saja kita sudah tidak mampu dibohongi lagi. Pendidikan sangat penting,” sebutnya lagi. H. Ahmad Sabil, Pimpinan Dayah

Darul Islah meminta Irwandi Yusuf membantu bangunan 25 pin-tu bilik dan satu sekilah tingan MIN untuk empat lokal. “Kami hanya butuh bangunan. Mohon dibantu. Kami akan mengajari anak-anak pada hari minggu dan malamnya Bahasa Inggris. Kemudian setiap hari Jumat belajar Bahasa Arab. Kami tidak butuh uang, cukup bantu bangunan saja,” harapnya. Hadir pada acara tersebut para ulama tujuh kabupaten/kota yakni Ulama dari Bireuen, Aceh Utara, Lhokseumawe, Pidie. Pidie Jaya, Aceh Timur, Kota Langsa dan Aceh Tamiang.(cmun)


Aceh

C4

WASPADA Rabu 28 April 2010

Sopir Avanza Lakukan Tabrak Lari

Ratusan Penderita Katarak Dan Sumbing Operasi Gratis BIREUEN (Waspada): Rastusan penderita katarak dan bibir sumbing mendapat pengobatan grastis di RSUD Bireuen. Pengobatan tanpa biaya ini kerjasama Yayasan Sambinoe, pimpinan Ny. Darwati A. Gani berlangsung 23-25 April 2010 di RSUD Dr. Fauziah. KetuaYayasan Sambinoe, Darwati mengatakan, pengobatan gratis, operasi katarak dan bibir sumbing di Bireuen merupakan bagian mewujudkan rasa kepedulian terhadap masyarakat yang bernasib kurang beruntung. Menurut isteri Irwandi Yusuf ini, Yayasan Sambinoe juga terus berpartisipasi untuk ikut berkontribusi mewujudkan rakyat Aceh lebih bermartabat. “Melalui kegiatan kemanusiaan yang intens, akan meningkatkan solidaritas dan menggugah kepedulian kita untuk saling membantu. Sasarannya terutama masyarakat Aceh dari kalangan rentan, agar potensi mereka dapat terus berkembang,” ucapnya. Sebelumnya Sekdakab Bireuen, Ir. Nasrullah Muhammad MT, M.Si menjelaskan, bantuan bidang kesehatan yang dilaksanakan Yayasan Sambinoe sangat bermanfaat bagi masyarakat. Selain meringankan upaya Pemkab mengatasi permasalahan kesehatan daerah, juga diharap memotivasi para donatur untuk melakukan hal serupa. (cb03/b16)

Warga ‘Serbu’ Kenduri Maulid Akbar

Jalan Rusak Ancam Jiwa Warga SIGLI (Waspada): Pemkab Pidie terkesan menutup mata terhadap pembagunan sarana jalan di daerah pedalaman yang kondisinya rusak parah. Buruknya sarana tersebut acap kali mengancam jiwa warga yang melintas. Buruknya pemandangan pembangunan jalan di Kabupaten Pidie, dapat dilihat di Desa Geunteng Glumpang Payong, Kecamatan Glumpang Baro. Jalur ini menghubungkan Kecamatan Kembang Tanjong sampai ke Teupin Raya, Kecamatan Glumpang Tiga. Namun akibat sering keluar masuk truck ukuran besar melebihi tonase menyebabkan jalan tersebut mengalami rusak parah. Truk-truk raksasa tersebut juga menghancurkan Gorong-gorong di tengah-tengah jalan, yang sebelumnya digunakan warga petani untuk mengairi air ke sawah. Akibat hancurnya Gorong-gorong tersebut hubungan transportasi jadi terputus dan warga petanipun kesulitan mengairi air ke sawah. “Gorong-gorong itu pecah akibat digilas ban truck ukuran besar yang sering keluar masuk jalur ini” kata Muhammad salah seorang warga setempat, beberapa waktu lalu.(b20)

Normalisasi Kuala Mendesak Dilaksanakan BIREUEN (Waspada): Normalisasi kuala atau jalur lalulintas nelayan di beberapa kecamatan di Kabupaten Bireuen dianggap mendesak pelaksanaannya. Hal ini bertujuan meningkatkan hasil tangkap nelayan sekaligus menyahuti keluhan tentang kesulitan mereka saat pergi atau pulang melaut. Menjawab Waspada, Kamis (22/4), Kepala Dinas Perikanan dan Kelautan Kab Bireuen, Ir. T. Syamsuarsyah, MM menyebutkan, pada 2010 sedikitnya tiga kuala akan dinormalisasi menggunakan kapal keruk. “Kita sudah memiliki Kapal Keruk ‘Raja Jeumpa I’, makanya untuk melakukan normalisasi kita sudah memiliki alat sendiri,” terang Syamsuarsyah. Dia menyebutkan, kuala yang akan dikeruk sekira awal Mei nanti adalah Kuala Peudada, Kuala Pa nte Rehung Kecamatan Samalanga, dan Kuala Pl imbang Kecamatan Plimbang. Dengan demikian, diharapkan dapat meningkatkan pendapatan petani nelayan yang pada gilirannya akan meningkatkan kesejahteraan mereka. “Ini program Bupati, saya hanya melaksanakan,” papar T. Syamsuarsyah.(cb03)

F-LSM ACEH Dengan SERASIUSAID Seminar Musrembang BIREUEN (Waspada): Forum Lembaga Swadaya Masyarakat (F-LSM) Aceh, bekerjasama dengan SERASI-USAID menggelar seminar sosialisasi Musyawarah Rencana Pembangunan (Musrenbang) di aula MA Jangka, Universitas Al-Muslim(Unimus)Peusangan,Bireuen,Jumat(23/4),diikuti seluruh Geuchiek (Kades) di Bireuen, unsur Muspida. Perwakilan Satuan Kerja Perangkat Kabupaten (SKPK), Badan Reintegrasi Aceh (BRA), serta stakeholder di wilayah itu. Sekretaris Jenderal F-LSM Aceh Sudarman, . mengatakan, seminar selain memberi pemahaman dan pengetahuan bagi geuchik dan stakeholder mengenai proses pelaksanaan, juga bertujuan menyamakan persepsi dari sudut pandang beragam dan diharapkan adanya persamaan persepsi antara pengambil kebijakan dan pelaku dalam proses Musrenbang sejak dari gampong hingga kabupaten. “Kegiatan ini lanjutan workshop review Musrenbang Rabu 14 April 2010 di Hotel Graha Buana, Kota Bireuen. Hasil worshop diharap memberi masukan dan solusi strategis bagi peningkatan kualitas perencanaan dan penganggaran di Bireuen,” jelas Sekretaris Jenderal FLSM ACEH itu.(amh/cb03)

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 398 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *

FireFly

GeMPA Ancam Pemerintah Aceh Jaya

Waspada/Muhammad Riza

BIREUEN (Waspada): Ribuan warga dan undangan ‘menyerbu’ kenduri Maulid yang diadakan di Dusun Pasar Sabtu, Meunasah Kulah Batee, Bandar Bireuen, Kecamatan Kota Juang, Minggu (25/4), yang menyebelih sedikitnya dua ekor kerbau dan satu ekor sapi dari bantuan yang dikumpulkan senilai Rp75 juta. Kenduri Maulid akbar diisi kegiatan keagamaan, seperti mengundang belasan qari lima kabupaten yaitu Pidie Jaya, Aceh Tengah, Bireuen, Kota Lhokseumawe dan Aceh Utara. Grup zikir juga menyantuni sekitar 114 anak yatim dan acara diisi dakwah oleh penceramah Tgk Wahid dari Tualang Cut, Aceh Tamiang. Ketua panitia, Marzuki Usman disela-sela menyantuni anak yatim mengatakan, Maulid ini inisiatif warga.“Kami biasa mengadakan Maulid dengan dukungan semua pihak,” katanya. Sementara Dandim 0111/Bireuen, Letkol Inf R Suharto, pada malam pembukaan Maulid mengatakan, Bireuen selain berjuluk Kota Juang juga berjuluk Kota Syariat, karena Bireuen merupakan kota pertama melaksanakan hukum cambuk di Aceh. Dia juga mengajak masyarakat senantiasa menjaga dan memelihara kondisi kondusif ini, serta meningkatkan toleransi antar sesama.(amh)

Ketibaan (flight, asal, waktu):

BIREUEN (Waspada): Kecelakaan lalulintas kembali terjadi di lintasan Medan-Banda Aceh Kabupaten Bireuen, Senin (26/4) sekira pukul 15.00, di kawasan Desa Pante Pisang Kecamatan Peusangan. Akibatnya, seorang remaja putri pengendara sepeda motorYamaha Yupiter Z BL 3175 DT mengalami luka dan patah tulang paha. Sementara sopir Toyota Avanza BL 684 ZW dilaporkan melarikan diri dari Tempat Kejadian Perkara (TKP). Informasi yang dihimpun, sopir minibus yang naas itu melarikan diri ke kawasan perumahan masyarakat. ‘Mungkin dia lari takut dihajar massa, padahal kami tidak bermaksud demikian,’ ucap seorang warga. Sementara informasi dari apaerat kepolisian di Mapolsek Peusangan, kasus kecelakaan ini sudah ditangani polisi. ‘Kapolsek dan Kanit sudah ke TKP,” ucap seorang anggota piket di Polsek Peusangan.(cb03)

TERANCAM KARAM: Kondisi Desa Pasie Lhok, Kecamatan Kembang Tanjong, Kab. Pidie yang terancam karam bila tiba musim pasang purnama. Jarak rumah warga dengan bibir pantai terpaut enam meter lagi. Bila tidak segera dibangun batu penahan obak digaris pantai, niscaya akan ditenggelamkan oleh pasang purnama. Foto diambil Selasa (26/4).

Kampung Nelayan Terancam Karam SIGLI (Waspada): Sedikitnya dua desa pesisir di Kecamatan Kembang Tanjong, Kab. Pidie terancam karam. Pasalnya, jarak bibir pantai tempat jatuhnya deburan obak terpaut enam meter lagi dari perumahan penduduk. Bahkan warga setempat kini mulai cemas dengan fenomena alam itu. Kedua desa antara lain, Pasie Lhok dan Jeumeurang. Pada saat musibah tsunami 2004 silam, ke dua perkampungan nelayan miskin itu terparah merasakan gelombang laut raksasa tersebut. Kini warga dua desa kembali dihantui munculnya air pasang purnama yang dalam sekejap dapat kembali merenggut nyawa mereka. “Kami sangat takut pak, bila datang musim pasang purnama air laut akan naik dan dalam sekejap dapat me-

nenggelamkan perkampungan kami ini,” kata Nuraini, warga Jeumeurang. Saiful Saad, warga Pasie Lhok, Kec. Kembang Tanjong kepada Waspada, Selasa (26/4) mengungkapkan, terkait kondisi laut yang semakin hari terus meluas ke daratan ini. Beberapa tokoh masyarakat dari kedua desa telah beberapa kali melaporkan ke pemeriuntah, baik kepada camat setempat maupun kepada Bupati Pidie melalui dinas terkait. Namun belum ada upaya mengantisipasi. Padahal, sebelumnya Badan Rekonstruksi dan Rehabilitasi (BRR) Aceh-Nias telah membangun batu pemecah ombak di desa tetangga Pasie Lhok. Tetapi pembagunan batu pemecah ombak tersebut dibangun terbatas oleh pihak BRR kala itu. “Karena itu menurut saya, Pemkab Pidie atau Pemerintah Provinsi Aceh harus melanjutkan pembangunan batu pemecah obak itu hingga sampai ke garis pantai Desa Jeumeu-

Pemilik Tanah Pelebaran Jalan Pertanyakan Sertifikat BIREUEN (Waspada): Sejumlah pemilik tanah di Desa Meunasah Capa dan Kommes, Kecamatan Kota Juang, dikawasan jalan lintas Bireuen-Takengon yang terkena pelebaran jalan mempertanyakan kejelasan pengembalian Sertifikat Tanah diminta Pemkab Bireuen sebagai syarat pembayaran ganti rugi, tapi sudah tiga bulan belum juga dikembalikan. Asisten I Setdakab Bireuen H. Hamdani A. Gani, SH, M.Hum mengatakan, penyelesaian pengekrosan luas tanah semula disesuaikan kembali dengan luasan tanah sudah diganti tersebut merupakan wewenang Badan Pertanahan Negara (BPN) Kabupaten Bireuen. Menurut keterangan sejumlah warga, sertifikat dan Akte Jual Beli tanah sebagai persyaratan utama sudah diserahkan dan juga telah menerima biaya ganti rugi. Biaya untuk merubah sertifikat sesuai dengan luas tanah sudah diganti rugi juga sudah diberikan. Namun, sudah tiga bulan mengapa belum dikembalikan juga sertifikat mereka. “Kami pertanyakan sertifikat kami karena telah tiga bulan belum juga kami terimannya,” seorang pemilik tanah kepada Waspada, Senin (26/4). Menurutnya, sebagian dari pemilik tanah, semula sertifikat tersebut telah

diangunkan ke Bank lalu dipinjam kembali untuk persyaratan ganti rugi itu dan sekarang diminta kembali oleh pihak perbankan karena mereka ada mengambil kredit di bank dan suarat tanahnya itu sebagai agunan. Sementara itu, Asisten I Setdakab Bireuen H. Hamdani A. Gani, SH, M. Hum yang dikonfirmasi, Senin (26/ 4) di ruang kerjanya mengatakan, penyelesaian pengekrosan luas tanah semula disesuaikan kembali dengan luasan tanah sudah diganti tersebut merupakan wewenang Badan Pertanahan Negara (BPN) Kabupaten Bireuen. Namun, kata Hamdani, pada prinsipnya, tanah yang sudah dibayarkan ganti ruginya itu baru sebagian kecil dari luasan tanah yang ada untuk pelebaran badan jalan.“Karena tanah yang dibayar itu sudah jadi aset, tentunya sertifikat tanah maupun akta jual belinya harus ditahan dulu guna dikuranggi luas aset yang sudah dibayar,” jelasnya. Ditanya mengenai biaya perubahan sertifikat, Hamdani mengatakan, sesuai kesepakatan bersama karena tidak ditanggung Pemkab Bireuen maka sepenuhnya ditanggulangi para pemilik tanah, dan langsung dikoordinir

16:30

11:15 JT 397 Medan/Jakarta 16:00 JT 307 Jakarta 19:50 JT 399 Medan/Jakarta

07:20 11:55 16:35

12:50 SJ011 Medan/Jakarta

13:20

12:20 AK 306 Kuala Lumpur *

12:45

FY 3401 Penang 13:50 FY 3400 Penang * Setiap Senin, Rabu, Jumat dan Sabtu.

SIGLI (Waspada): Bangunan Doking Kapal Mutor (KM) diduga bantuan Departeman Kelautan dan Perikanan (DKP) di komplek Pangkalan Pendaratan Ikan (PPI) Kuala Pasi Peukan Baro, Kota Sigli, Kab. Pidie dinilai nelayan mubazir. Pasalnya, hingga kini bangunan doking tidak dapat dimanfaatkan untuk memperbaiki kapal motor atau perahu. Bangunan tidak terurus dan terbengkalai. Selain itu, fasilitas doking juga tidak dapat digunakan memperbaiki KM ukuran besar, karena bangunannya kecil. Nelayan yang ingin memperbaiki kapal motornya terpaksa memperbaiki di Pulau Sabang, atau memilih di bawah Jembatan Benteng, depan Pendopo bupati Pidie, Kota Sigli. “Bangunan ini sejak dibangun beberapa tahun lalu belum pernah digunakan nelayan. Bangunan dibangun asal-asalan, sehingga tak dapat dimanfaatkan. Mubazir itu bang,” kata Muhammad, nelayan. Muhammad menyebutkan, banyak bantuan fasilitas nelayan yang dibangun di komplek PPI Kuala Peukan Baro tidak jelas sumber dananya. “Kami tidak tahu sumber dananya dari mana. Ada yang bilang bantuan DKP, BRR entah dari mana saja. Tetapi yang jelas fasilitas itu tidak bisa kami nikmati.” “Di sini sangat banyak fasilitas atau aset Pemkab Pidie bantuan donatur. Tapi jangankan dibangun baru, dirawat saja supaya dapat dimanfaatkan rakyat tidak bisa,” kata Muhammad sambil merajut jaring yang koyak.(b20)

Waspada/Muhammad Riza

DOKING: Seorang ibu warga nelayan berjalan di depan Doking Kapal Motor (KM) yang rusak parah dan dibiarkan terbengkalai di komplek PPI Kuala Peukan Baro, Sigli, Pidie. Minggu (25/4).

Petani Tertindas Kenduri Syukuran PASCA penetapan tapal batas oleh Bupati Aceh Utara, puluhan petani tradisional tertindas kenduri syukuran,jamu makan 27 yatim korban konflik, Senin (26/4). Sebagaimana diberitakan, konflik lahan sawit antara warga eks trans Bola Mas, Kec Langkahan dengan Gampong

Matang Serdang/Buket Jrat Manyang, Kec. Tanah Jambo Aye, Aceh Utara, sudah berlangsung sekitar 22 tahun terakhir. Bermula dari PIR/plasma kebun Cot Girek, diduga telah mencaplok lahan non program Perusahaan Inti Rakyat (PIR) tersebut, pada zaman orde baru (tahun 80 an).

Waspada/M Jakfar Achmad

14:20

oleh geuchik setempat. “Untuk mengkros sertifikat itu wewenang BPN tapi kalau akta jual beli ditangani kecamatan,” tambahnya. Pada kesempatan itu, Hamdani menerangkan, untuk membayar pembebasan tanah tidak mencapai satu kilometer itu total anggarannya sudah termasuk biaya administrasi Rp4 miliar menggunakan dana APBA. Harga tanah yang dibayarkan ganti rugi itu, per meter Rp1,5 juta, belum termasuk bangunan dan tanaman. “Khususnya untuk ganti rugi bangunan seperti pagar dan lainnya serta tanaman itu ada rumusnya. Anggaran dibutuhkan guna membayar ganti rugi hingga ke Km 35, sekitar 80 miliar sampai 100 miliar. Kami mengharapkan Pemerintah Aceh dapat memberikan porsi lebih untuk Bireuen karena harga tanah di Bireuen agak berbeda dengan Kabupaten Bener Meriah ataupun Aceh Tengah ,” harapnya, seraya menambahkan, harga tanah di Bireuen hampir bersaing dengan harga tanah di provinsi, jadi kalau anggaran yang diberikan hanya 5 miliar sampai 10 miliar saja, tentunya butuh waktu lama untuk menyelesaikan ganti rugi tanah. (amh/cb03)

Doking KM Bantuan DKP Mubazir

Pasca Penetapan Tapal Batas Oleh Bupati Aceh Utara:

Keberangkatan (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta

rang,” kata Saiful. Sekdes Jeumeurang Tgk. Saifullah, yang diminta keterangannya, kemarin mengharapkan, Pemkab Pidie dan Pemrov Aceh segera membangun batu pemecah obak di garis pantai Pasie Lhok dan Jeumeurang, supaya kedua desa itu dapat selamat dari terjangan obak laut pada pasang purnama yang akan mucul tidak akan lama lagi. Penduduk di dua desa tersebut sudah sangat cemas dan was-was dengan kondisi air laut yang selama ini terus menepi hingga airnya masuk ke dalam dapur rumah warga. Bahkan sebut Tgk. Saiful, pada pasang laut biasa saja yang terjadi setiap hari sekira pukul 10 pagi, air laut sudah menghempas sampai ke badan jalan lintasan Desa Jeumeurang Kembang Tanjong. “Kami mengharapkan pemerintah segera membangun batu pemecah ombak dalam upaya mengantisipasi terjadinya musibah yang lebih besar kelak,” kata Sekdes Jeumeurang. (b20)

BANDA ACEH (Waspada): Massa yang tergabung dalam Gerakan Mahasiswa Peduli Aceh Jaya (GeMPA) mendesak pemerintah setempat untuk serius membangun dan menata masa depan kabupaten itu. Tuntutan itu diteriakkan dalam aksi unjukrasa di bundaran Simpang Lima, Banda Aceh, Senin (26/4). Dalam tuntutannya, mereka mendesak pemerintah Aceh dan Pemerintah Kabupaten Aceh Jaya untuk serius mengejar ketertinggalan dalam segala bidang. “Dengan lemahnya realisasi pembangunan, berarti pemeintah gagal membawa perubahan bagi Aceh Jaya,” ujar Ferdiansyah, juru bicara GeMPA. Dalam aksi tersebut, para mahasiswa membawa beberapa poster bertuliskan “HUT Aceh Jaya ke 8 tahun, Aceh Jaya tidak sejaya namanya”. “Ini merupakan bentuk kekecewaan para mahasiswa terhadap pemerintah Aceh Jaya yang hanya bicara belaka,” sebutnya. Dalam aksi itu, GeMPA memberikan lima petisi kepada pemerintah Aceh dan Pemkab Aceh Jaya untuk segera menuntaskan permasalahan pokok yang dihadapi di sana. Petisi yang dimaksud berisi, indikasi serta resolusi terkait lemahnya pembangunan, pendidikan, ekonomi, kesehatan dan pelayanan publik. Unjukrasa itu diwarnai dengan aksi mandi lumpur. Ini sebagai bentuk sindirankepadapemerintahterkaitlambannyapembangunanjalandanjembatan akses Lamno-Calang yang belum rampung. Akibat belum tuntas pembangunan, membuat masyarakat yang melintas di sana harus bermandi lumpur. “Setiap mobil yang melintas di jalan Aceh Jaya Meulaboh, yang berwarna putih berubah jadi coklat,” ungkap Habibi, koordinator GeMPA. Bukan hanya itu, lambannya pembangunan jalan dan jembatan di kabupaten tersebut, juga berdampak negatif terhadap pertumbuhan masyarakat Aceh Jaya. “Bila dilihat dari segi transportasi, maka imbasnya ke segi ekonomi seperti mahalnya barang-barang,” tambahnya kecewa. Kata dia, tidak hanya pembangunan, dari segi pendidikan, ekonomi, kesehatan dan pelayanan publik pun juga tidak memadai. Ini perparah lagi dengan kurangnya mutu, sarana dan prasarana di kawasan yang sempat luluh-lantak oleh bencana. Pada akhir aksi ini, GeMPA juga mengancam akan melakukan aksi yang lebih besar dengan massa yang lebih banyak jika pemerintah tidak merespon desakan mereka. (b05/gto/b02)

SYUKURAN: Kapoktan tradisional tertindas, Zaini (pakai topi), pada kenduri syukuran yatim korban konflik dan fakir miskin, di lahan sawit bermasalah Gampong Matang Serdang, Kec. Tanah Jambo Aye, Aceh Utara, Senin (26/4).

Setelah tanaman sawit rimbun di atas lahan di luar areal PIR/plasma dimaksud, petani tradisional hanya mampu mengurut dada, melihat lahannya dinikmati hasil oleh orang lain tanpa hak. Kubun sawit itupun dikonversi oleh PIR/plasma Cot Girek, sekaligus dikeluarkan sertifikat oleh Badan Pertanahan Negara (BPN) Aceh Utara, atas nama warga trans Bola Mas, Kec Langkahan. Petani tradisional tertindas di Gampong Matang Serdang-Buket Jrat Manyang (Jambo Aye), ketika itu gencar memprotes dengan membawa surat hak garap kepada Geuchik/ Kepala Desa (Kades) lama almarhum A Rahman Umar. Kendati Kades hanya mampu menyalurkan aspirasi petani lemah itu lewat pemberitaan media massa, saat itu, jelas ketua kelompok tani (Kapoktan), Zaini kepadaWaspada di sela-sela kesibukan kenduri syukuran, Senin kemarin. Pase demi pase konflik Aceh, membuat status lahan sawit ini semakin terbenam. Kendati para petani tradisional tetap menyimpan surat garap, sebagai bukti kepemilikan secara adat. Selain surat garap, petani juga menyimpan surat keterangan rekanan penanam sawit PIR/plasma Cot Girek, CV Mahligai Lhokseumawe. Dalam surat No 27/M/V tanggal 7 Mei 1988 CV Mahligai menerangkan dan mengakui, seluas 50 hektar dari

areal yang ia kerjakan itu, merupakan lahan milik Gampong Matang Serdang (non PIR/plasma) berlokasi pada Blok 14/15. Dalam surat itu rekanan tadi menyebutkan, pengakuannya itu berdasarkan pengukuran PIR/plasma yang saat itu di bawah pengelolaan PTPN IX Cot Girek, Aceh Utara. Ketelanjuran menanam sawit di areal non PIR/plasma saat itu, disanyalir tidak saja dialami oleh rekanan CV Mahligai Lhokseumawe, tapi juga rekananrekanan lain pada lokasi yang berbeda, sehingga ratusan hektar lahan Gampong Matang Serdang dan Gampong Buket Jrat Manyang tercaplok. Faktor kekeliruan itu sangat beralasan, karena waktu itu tapal batas antara Kec Langkahan dengan Kec Tanah Jambo Aye belum begitu jelas, karena belum terjadi pemekaran antara dua kecamatan tersebut. Menyusul Surat Keputusan (SK) Bupati Aceh Utara, Ilyas A Hamid No 146/ 51/2010, 12 April lalu, tentang penetapan tapal batas Kec Langkahan – Kec Tanah Jambo Aye, para petani tradisional tertindas yang tergabung dalam beberapa kelompok tani (Poktan) merasa lega, karena persoalan masa lalu itu menjadi terang. “Secara defakto (fakta) sekarang lahan sawit non PIR/plasma Cot Girek ini sudah kembali ke kita, namun secara deyure (aturan) masih merupakan milik warga eks trans Bola Mas Kec Langkahan, karena sertifikat lahan sawit masih

di tangan mereka, alias belum ditarik oleh BPN Aceh Utara, berikut diganti sertifikat lain atas nama petani non PIR/plasma Cot Girek,” kata juru bicara Poktan, Zaini dalam pengarahannya di depan masyarakat Gampong Matang Serdang, pada acara kenduri syukuran, Senin. Kapoktan Zaini menyebutkan, “pada rapat perdamaian yang dimediasi Muspika Tanah Jambo Aye dan Muspika Langkahan dib alai pertemuan kantor camat Langkahan, 11 Juni 2007, kepala BPN Aceh Utara lama, Drs H Moezakir Hoesien menyatakan, akan mencabut seluruh sertifikat lahan sawit Gampong Matang di tangan warga eks trans Bola Mas.Warga itupun dalam rapat dengan dua Muspika menyatakan sudah rela, kendati realisasi perjanjian itu sampai saat ini belum terwujud,” ujarnya. Kapoktan Zaini, mengaku memiliki keseluruhan lahan di Gampong Matang Serdang, seluas 45 hektar di sisi batas dua kecamatan tetangga, Kec Langkahan dan Kec Baktiya. Keseluruhan lahan sawit non PIR/plasma Cot Girek di Gampong Matang Serdang dan Gampong Buket Jrat Manyang (Kec Tanah Jambo Aye), meliputi ratusan hektar, kini di bawah pengelolaan beberapa Poktan lainnya. M Jakfar Achmad


Aceh

WASPADA Rabu 28 April 2010

C5 50 Ribu Benih Ikan Ditebar Ke Danau

11 Tahun Aceh Singkil SINGKIL (Waspada): Bupati mengajak seluruh elemen masyarakat untuk berbenah diri, bersinerji dan berkelanjutan dalam membangun Kabupaten Aceh Singkil. Ajakan tersebut disampaikan H. Makmursyah Putra dalam sambutannya pada upacara perayaan Hari Ulang Tahun Kabupaten Aceh Singkil, Selasa (27/4) di lapangan Gor Ketapang Indah Singkil Utara. Hari ulang tahun, kata Makmur, bukan hanya untuk melihat keberhasilan pembangunan selama 11 tahun usia kabupaten, namun hakikatnya untuk mewujudkan rasa syukur kepada Allah SWT atas nikmat yang telah diberikan. Sebelas tahun usia Kabupaten Aceh Singkil diakui telah banyak perubahan, perjalanan waktu membawa Aceh Singkil sejajar dengan kabupaten /kota lain di Aceh. Begitu pun menurutnya, tugas belum selesai sebab diakui atau tidak masih ada kekurangan. Makmur menguraikan bidang pembangunan pemerintahan, di usia ke sebelas Aceh Singkil telah mampu melahirkan Pemerintahan Kota Subulussalam dan sebagai kado ulang tahun ke sebelas, Pemkab Aceh Singkil juga telah memekarkan Kecamatan Pulau Banyak Barat yang merupakan kecamatan ke – 11. Bidang pembangunan tarsportasi udara,

jalan dan jembatan Pemkab Aceh Singkil menurut Makmur, telah membuka hubungan Kuala Baru-Trumon Aceh Selatan, SingkilMuara Situlen Aceh Tenggara, dan pembukaan trayek Singkil -Tapteng serta Singkil-Nias dan rencana pembangunan pelabuhan CPO. Begitu juga bidang pendidikan selain berdirinya STIPYasafa dan Staisar Batukorong Pemkab Aceh Singkil juga segera meresmikan pesantren perbatasan yang berlokasi di Biskang Kecamatan Danau Paris serta Islamic Center di Kecamatan Suro. Tidak ketinggalan bidang kesehatan, berbagai peralatan canggih serta penempatan dokter dan dokter specialis juga akan terus dilakukan, begitu juga bidang pertanian, perkebunan dan kelautan potensi yang ada, jelas Makmur harus terus dikembangkan. Ini, merurut Makmur, sebagai tanggungjawab moral kepada masyarakat. Sementara itu Wakil Bupati Aceh Singkil H. Khazali melakukan pengguntingan pita di stand perusahaan perkebunan Aceh Singkil, tanda dimulainya pameran pembangunan. Hadir pada acara ulang tahun Kabupaten Aceh Singkil ke – 11 Muspida dan Muspida Plus Aceh Singkil para pejabat pemkab TNI/ Polri, seluruh camat serta ribuan masyarakat dari 11 Kecamatan di Aceh Singkil.(cb02)

Hasil UN Abdya Terendah Se Aceh BLANGPIDIE (Waspada): Buruknya pencapaian hasil Ujian Nasional (UN) setingkat SMA/ SMK Sederajat di Ace Barat Daya (Abdya) membuat sejumlah kalangan melontarkan kecaman dan tudingan bernada keras. Bahkan salah seorang anggota DPRK Abdya minta pertanggungjawaban Pemkab terhadap buruknya hasil UN tersebut. Kepala Dinas Pendidikan Abdya Drs. Sulaiman, MM, disebutnya hanya pintar mengumbar retorika dan bermain pantun. “Hari ini terjawab sudah komitmen peningkatan mutu pendidikan Abdya yang sering didengungkan pihak dinas ternyata hanya hiasan kata. Masyarakat Abdya benar-benar sedih dengan hasil ini,” sebut Muslizar, MT, SP, anggota DPRK Abdya dari Partai Amanat Nasional (PAN) yang menghubungiWaspada, Selasa (27/4). Sedangkan Reza Mulyadi, Anggota DPRK Abdya dari Partai Aceh (PA) minta Pemkab Abdya serius membenahi Dinas Pendidikan yang dinilai masih belum memperlihatkan perkembangan berarti. Bahkan Kepala Dinas direkomendasi untuk dicopot dari posisinya karena dinilai tak mampu mengangkat mutu pendidikan di Abdya yang hingga kini masih terpuruk. “Sungguh hasil yang sangat ironis, dinas terkait harus bertanggung jawab terhadap hasil UN,” ujar Reza, Ketua Forum Komunikasi Pemuda Abdya (FKPA) di Banda Aceh Imran Mahfudi, SH kepada Waspada, Selasa (27/4). Dia minta Bupati Akmal Ibrahim melakukan pembenahan serta mengevaluasi secara

menyeluruh Dinas Pendidikan Abdya. Hasil pencapaian UN dengan kelulusan di bawah 50 persen dinilai sebagai ‘taruhan’ yang sangat mahal yang telah dilakukan Bupati Akmal Ibrahim. “Bupati harus melakukan evaluasi besarbesaran di Dinas Pendidikan Abdya, ini sungguh sebuah hasil (UN) yang sangat memalukan dan kami kira bupati harus meminta maaf kepada masyarakat Abdya,” tegas Imran Mahfudi. Dari data yang diterima Waspada pada Senin (26/4) kemarin, jumlah peserta UN SMA/SMK sederajat di Abdya tercatat 2.072 siswa, sedangkan yang lulus 1.070 Siswa, sehingga angka kelulusan UN di Abdya hanya 49,55 persen dan menurut data dari dinas pendidikan provinsi, posisi Abdya paling rendah dari seluruh kabupaten di Aceh. Terkait buruknya hasil tersebut, kepala dinas Pendidikan Abdya Drs. Sulaiman, MM, pada Senin (26/4) menyatakan kesiapannya untuk “lengser” jika hasil UN tersebut dianggap sebagai bentuk barometer kegagalan dirinya dalam mengembangkan peningkatan pendidikan di Abdya. “Saya siap menerima apa pun atas hasil (UN) ini, kepada atasan (Bupati) saya juga telah jauh-jauh hari melaporkan kondisi ini dan menyatakan siap menerima keputusan nantinya jika memang hasil ini menjadi permasalahan yang dianggap serius,” ujar Sulaiman.(sdp)

Aktivitas Pelabuhan Krueng Geukeuh Belum Maksimal REDELONG, Bener Meriah (Waspada): Aceh sudah memiliki pelabuhan internasional yang digunakan untuk eksport dan impor hasil bumi dan lainnya, juga untuk pasokan kebutuhan masyarakat Aceh. Namun sayangnya, pelabuhan yang sudah diresmikan dan mulai beroperasi sejak Desember 2009 itu masih belum maksimal pemanfaatannya. Hal tersebut dikatakan Zulkiram Hanafiah, Tim Pengembangan Untuk Perdagangan Eksport-Import Pelabuhan Krueng GeukeuhAceh, Selasa (27/4), pada forum penyelenggara bisnis yang mendorong pertumbuhan dunia usaha sebagai penggerak perekonomian daerah di ruang pertemuan Sekretaris Daerah Kabupaten Bener Meriah. Kegiatan ini kerjasama antara The Asia Fondation, KPPOD dan bagian perekonomian Pemkab Bener Meriah. Disebutkan Zulkiram, saat ini pelabuhan hingga kapal yang akan melakukan ekspor import sudah ada. Tapi barang yang dieksport masih kurang, untuk itu para pengusaha Bener Meriah yang saat ini ada di Medan dan aktivitasnya melakukan eksport diharap menggunakan fasilitas pelabuhan yang ada di Aceh. “Ini selain untuk mengurangi biaya angkutan juga untuk menghidupkan pelabuhan yang ada,” sebut Zulkiram.

GAMBA TANYO

> Kirim foto dari kamera handphone ke 08192

Ketua Pengembangan Untuk Perdagangan Eksport-Import Pelabuhan Krueng Geukeuh ini mengakui, awalnya sangat sulit menda-tangkan kapal yang mau ke pelabuhan Aceh. Karenanya, pihaknya tidak ingin kalau kapal-kapal pengangkut barang tersebut sudah beroperasi, tetapi tidak ada barang. Hal sama juga dikatakan Edy Agustri General Manager Pelindo wilayah satu, saat ini pelabuhan Krueng Geukeuh sudah memiliki fasilitas, walau belum maksimal. Namun perlengkapan pelabuhan untuk eksport dan import sudah ada. “Kami juga berharap agar pengusaha Aceh yang selama ini ada di luar daerah untuk melakukan ekport-import silahkan memanfaatkan pelabuhan dan fasilitas yang telah kita miliki,” ungkapnya. Walaupun kegiatan eksport-import masih minim, Zulkiram menjelaskan banyak hasil bumi dari Bener Meriah sangat potensial untuk dijual ke negara tetangga, seperti Malaysia. Seperti pengembangan ubi rambat dan lainnya. Karenanya, hendaknya petani dan pelaku bisnis haru memahami dan tau informasi apa yang dibutuhkan masyarakat di negara lain, agar bisnis yang dijalani tidak siasia.(cb04)

11 01 47

TAKENGON (Waspada): Guna menjaga kelestarian serta menghindari kepunahan ikan tawar, 50 ribu bibit ikan tawar terdiri dari ikan mas dan ikan nila ditebar ke Danau Laut Tawar Takengon, Aceh Tengah. Kepala Balai Benih Ikan (BBI) Sentral Toweren Mudarisa, Spi, Senin (26/4) ketika ditemui di kantor BBI Lukub Badak mengatakan, bibit ikan tawar yang ditebar ke dalam Danau Laut Tawar terdiri dari 30 ribu ikan mas dan 20 ribu ikan nila jenis wanayasa. “Ikan nila jenis wanayasa ini, termasuk spesies baru untuk Provinsi Aceh, ikan nila tersebut sudah dikembangkan oleh Balai Benih Ikan Sentra Toweren dan Balai Benih Ikan Lukub Badak,” jelas Mudarasi. Kata Kepala Balai Benih Ikan (BBI) Sentral Toweren itu lagi, program tersebut dinamakan Restocking yang tujuannya untuk melestarikan ikan tawar agar tidak mengalami kepunah. Program itu juga dilakukan dua kali setiap tahun. “Dalam Restocking pihak BBI tidak dibenarkan menebar benih ikan yang masuk dalam katagori predator, karena dapat memusnahkan ikan tawar lainnya,” ujar Mudarasi, sembari menambahkan, acara pelepasan 50 ribu bibit ikan tawar langsung dilakukan Kabid Perikanan Budidaya Provinsi Aceh, serta Kadis Peternakan dan Perikanan Kabupaten Aceh Tengah.(cih)

Waspada/Mansurdin

UCAPAN SELAMAT DATANG: ‘Rokh ke Kaum Beakku khatana’, ucapan selamat datang kepada pengunjung di stand Kecamatan Singkil dengan bahasa daerah yang ditulis pada pintu masuk stand, Selasa (27/4).

DPRK Langsa Hamburkan Uang Rakyat LANGSA (Waspada): Aksi jalan-jalan ke luar daerah yang dilakukan seluruh anggota DPRK Langsa dengan uang rakyat, mendapat respon dan kritikan berbagai kalangan. Bahkan ‘Wisata’ para wakil rakyat yang dikemas dengan nama ‘Kunjungan Kerja’ atau Study Banding ke sejumlah daerah di seluruh Indonesia itu dinilai sama sekali tidak bermanfaat dan hanya menghambur-hamburkan uang rakyat. Tokoh eksponen 66 Kota Langsa H. Sulaiman Bardan kepada Waspada, Senin (26/4), mengatakan program kunjungan kerja para anggota dewan yang dilakukan rutin setiap tahun hanya sebuah upaya pembenaran untuk menggerogoti uang rakyat. “Padahal, kenyataannya, kunjungan kerja atau study banding itu hanya menghasilkan omong kosong dan wujud dari‘Wisata’ para anggota dewan dengan memanfaatkan uang rakyat,” kata Sulaiman Bardan. Dikatakan, saat ini kondisi ekonomi rakyat Kota Langsa sedang membutuhkan perhatian

serius dan upaya kongkrit dari suara wakil rakyat yang duduk di kursi dewan, agar angka kemiskinan rakyat bisa dikurangi. Apalagi kondisi defisit APBK Langsa tahun 2010 yang mencapai Rp35 miliar lebih, membuat Pemko Langsa terpaksa memangkas beberapa pos anggaran untuk kepentingan publik, termasuk memangkas 50 persen lebih pos anggaran aparatur pemerintah di setiap Satuan Kerja Perangkat Daerah (SKPD). DPRK Langsa Hamburkan Uang RakyatAnehnya, dengan kondisi keuangan yang sedang tidak stabil, para anggota Dewan malah ‘berfoya-foya’ ke luar daerah dengan memanfaatkan anggaran daerah dengan jumlah yang tidak sedikit. “Masih banyak rakyat kita yang hidup di bawah garis kemiskinan yang menjadi prioritas perhatian dewan. Seharusnya para anggota dewan memangkas anggaran Studi Banding atau Kunjungan Kerjanya itu, dan mengalihkannya untuk kepentingan lain yang lebih menyentuh kepentingan rakyat. Apalagi program studi banding telah dilakukan setiap tahun olehdewan,tapitidakadafaedahnya,” tegas Sulaiman Bardan. Hal senada dikatakan Ketua Pelajar Islam Indonesia (PII) Kota Langsa M. Saleh. Menurutnya, program studi banding anggota dewan adalah proyek

yang dibungkus nama yang bagus, tapi tidak membawa dampak positif untuk kepentingan rakyat.Yang ada, uang rakyat terus terkuras dalam jumlah yang besar ditengah defisit APBK Langsa yang jumlahnya puluhan miliar. “Kita mohon para anggota dewan punya hati nurani untuk melihat kebutuhan mana yang perlu mendapat prioritas,” kata M. Saleh. Ketua Satma PP Langsa Edy Syahputra, mengaku kecewa terhadap anggota dewan yang sedang “melancong” keluar daerah ditengah ekonomi rakyat masih membutuhkan pertolongan. “Kita tidak ingin mengomentari terlalu banyak, tapi hanya satu yang menjadi pertanyaan kami, yaitu ke mana sebenarnya hati nurani wakil rakyat kita,”demikiankataEdiSyahputra. Sementara itu Ketua DPRK Langsa Muhammad Zulfri ST yang ingin dikonfirmasi Waspada, Senin (26/4) tidak berhasil. Menurut staf di Sekretariat DPRK Langsa, Muhammad Zulfri berada di luar daerah. Waspada coba meminta tanggapan atau konfirmasi Ketua DPRK Langsa itu via ponsel. Namun berulangkali ditelepon, Muhammad Zulfri tidak mengangkat ponselnya. Bahkan Waspada mengirimkan SMS kepada yang bersangkutan sebagai upaya konfirmasi. Namun tak ada kabar.(ts)

Waspada/ Bahtiar Gayo

SERIUS: Anak SD dari Kecamatan Bintang Aceh Tengah serius mengikuti perlombaan melukis dalam rangka hari menyelamatkan bumi se dunia.

Para siswa SMU yang lulus pada Ujian Nasional meluapkan kegembiraan mereka tak hanya di sekolah tapi juga pada warga kota di mana para siswa berkonvoi. Tampak pada gambar para siswa SMU meluapkan kecerian mereka di Jl. T Daud Beureueh Banda Aceh Senin (26/4). Pengirim Azhar, Jl. Kuwera I, Lamprit, Banda Aceh, 0812688239xx

BLANGPIDIE (Waspada): PemkabAceh Barat Daya (Abdya) akan melakukan acara syukuran menyantuni dan do’a bersama anak yatim dalam rangka perayaan hari ulang tahun (HUT) Abdya yang ke-8. Acara akan dilaksanakan di seluruh kecamatan dengan alokasi dana mencapai Rp40 juta per kecamatan. Informasi yang diterimaWaspada melalui salah seorang panitia, Selasa (27/4), dikemukakan perayaan HUT Abdya ke-8 dengan agenda utama menyantuni anak yatim akan berlangsung serentak di seluruh kecamatan pada Kamis (29/4) mendatang. Selain memberi santunan Pemkab Abdya juga melakukan acara tafakkur berupa do’a bersama dan kegiatan lainnya. “Acara akan dipusatkan secara merata di seluruh kecamatan, agenda utama nantinya tetap berupa syukuran bersama anak yatim dan panitia telah melakukan persiapan di semua kecamatan untuk hari puncak perayaan, Kamis mendatang,” ungkap salah seorang panitia yang juga staf di Setdakab Abdya. Sebelumnya sejumlah kalangan melontarkan kecaman terkait sikap Pemkab yang dinilai tidak mensyukuri lahirnya Kabupaten Abdya dengan tidak melakukan acara apapun terkait hari jadi kabupaten tersebut. Bakan Ketua FKPA (Forum Komunikasi Pemuda Abdya) Imran Mafudi menyebutkan sikap Pemkab Abdya “lupa diri” sehingga tidak menghargai hasil rintisan para tokoh masyarakat yang menjadikan kabupaten ini defenitif sejak delapan tahun lalu.(sdp)

PII Langsa Gelar Pengabdian Masyarakat LANGSA (Waspada): Pengurus Daerah Pelajar Islam Indonesia (PII) Kota Langsa, Senin (26/4), menggelar kegiatan pengabdian masyarakat dalam bentuk bakti sosial di Desa Matang Setui, Kecamatan Langsa Timur. Bakti sosial itu dilakukan dalam bentuk gotong-royong dan lomba kreativitas serta dakwah islamiyah. Ketua PD PII Langsa Muhammad Saleh, mengatakan kegiatan tersebut dilakukan dalam rangka memperingati hari kebangkitan PII yang ke 63. Juga sebagai wujud dari kepedulian PII terhadap lingkungan dan pendidikan anak-anak desa. “Dalam kegiatan baksos ini PII bekerjasama dengan Organisasi Siswa intra Sekolah (OSIS) tingkat SMP dan SMA se-Kota Langsa. Kita melihat adik-adik siswa sangat antusias dalam bakti social ini, dimana mereka dengan tekun terus melakukan baktinya sebagai bentuk tanggung jawab kepada masyarakat,” sebut Saleh. Dijelaskannya, kegiatan ini merupakan salah satu aplikasi tanggungjawab pelajar terhadap masyarakat serta gerakan solusi sosial untuk mengatasi problematika masyarakat, khususnya masyarakat pedesaan di Kota Langsa. “Masyarakat setempat sangat antusias menyambut Baksos yang kami lakukan ini karena mereka menilai “ruh islami” dan “semangat mencari ilmu” kembali dibangkitkan melalui kegitan sosial ini,” sebutnya lagi.(ts)

Pemotong Rumput Sambar Kaki Bocah Hingga Putus TAKENGON (Waspada): Kaki kanan bocah berusia empat tahun putus disambar mesin pemotong rumput di Kampung Paya Pelu, Kecamatan Silih Nara, Kabupaten Aceh Tengah. Subhan Arbi, dan Zulaikha orang tua korban di Rumah Sakit Datu Beru Takengon, Senin (26/4) menceritakan, musibah yang menimpa Riduansyah anaknya itu terjadi Sabtu (24/4) sekira pukul 08:00, saat Subhan (ayah korban-red) memperbaiki satu unit mesin babat rumput milik tetangganya. “Saat itu saya sedang memperbaiki mesin pemotong rumput, ketika mesin di hidupkan, teman saya menarik gas mesin sehingga pisau mesin beradu dengan tanah. Mesin pun langsung berputar tak tau arah, menyambar kaki anak saya yang saat itu berada di belakang saya,” kata ayah korban. Melihat anaknya meronta-ronta dengan konsisi kaki berdarah, ayah korban langsung melarikannya ke Puskesmas Angkup. Namun lantaran peralatan kurang memadai korban pun dirujuk ke RSU Datu Beru Takengon. “Sesampai di rumah sakit ini, dokter mengatakan kaki anak saya harus segera diamputasi, lantaran tulang kaki telah hancur. Kami hanya pasrah dan merelakan kaki putra kedua kami itu diamputasi.”(cih)

Lomba Lukis Hari Bumi Se Dunia

2010 Kuota Beasiswa SMP 1.470 Orang

TAKENGON (Waspada): Anak-anak SD di Aceh Tengah memperingati hari bumi sedunia, mengikuti perlombaan melukis dengan tema menyelamatkan bumi. Selain diselenggarakan perlombaan melukis, juga dilaksanakan penanaman 500 pohon pinus, serta penghijauan di seputar kota. 80 Anak SD dibagi dalam dua kelompok untuk mengikuti lomba melukis. Untuk kelas 1 sampai kelas 3 dan kelas 4 sampai kelas 6. Ternyata pesertanya bukan hanya dari SD di seputar

REDELONG (Waspada): Pada 2010 kuota penerima beasiswa dalam katagori miskin dan berprestasi yang diperuntukkan bagi pelajar Sekolah Menengah Pertama (SMP-red) di Kabupaten Bener Meriah mencapai 1.470 orang. Hal tersebut disampaikan Kabid Dikdas Kabupaten Bener Meriah Aswat, Spd didampingi Staf Kurikulum Salhadi saat di temui waspada di Kantor Dinas Pendidikan Pemuda dan Olah Raga, Selasa (27/4). “Jumlah 1.470 terbagi dua katagori, untuk beasiswa miskin jumlahnya 340 orang, sedangkan beasiswa berprestasi 147 orang,” rinci Aswat. Lanjutnya, selain 1.470 kuota yang di berikan Dinas Pendidikan Provinsi Aceh, Kabupaten Bener Meriah juga akan mendapat kuota tambahan dari Dirjen Pembinaan Sekolah Menengah Pertama Pusat sebanyak 485. “Kalau dana beasiswa untuk 1.470 penerima sudah jelas ada, namun untuk kuota tambahan hingga saat ini belum kami ketahui. Kalau sistem pendataannya, pihak Dinas Pendidikan Pemuda dan Olah Raga Bener Meriah selama ini hanya menerima data dari setiap kepala sekolah tentunya berdasarkan hasil rapat pihak sekolah dan komite sekolah masing-masing,” ujar Kabid Dikdas. Sementara pada 2009 jumlah penerima beasiswa untuk tingkat Sekolah Menengah Pertama 720 orang terdiri dari 716 penerima beasiswa miskin, dan empat orang untuk beasiswa berprestasi.(cih)

kota Takengon, namun murid kelas 1, SD 7 Bintang, Kecamatan Bintang juga ikut dalam perlombaan itu. Untuk klasifikasi kelas 1 sampai 3 SD, juara pertama dirah Silvia Nita, Padila Pebrina dan juara 3 direbut Reina Dewi Aprilia. Untuk kelas 4 -6 SD, juara pertamadiraihMuhammadRizki Koto, Nadia Triana dan Ivanka. Menurut ketua panitia Edi Saputra dari Radio Amanda menjawab Waspada disela hiruk pikuknya anak SD itu melukis, Minggu (25/4) menyebutkan,

pihaknya yang bekerja sama dengan LSM Green Hill, PMI dan Rapi, serta Dinas Pertamanan, juga melaksanakan penanaman 500 pohon pinus. Penanaman pohon pinus itu dilaksanakan di Kampung Mendale Takengon oleh pemuda setempat dan pelajar. Selain itu juga dilaksanakan penanaman pohon palm di seputar kota Takengon. Bupati Aceh Tengah Ir. Nasaruddin MM dan Dandim 0106 Letkol. Inf. Bokiyar langsung melaksanakan penanamannya.(b18)

Pengesahan Qanun Gampong Terlalu Dipaksakan

PARADE SISWA LULUS UN

Pemkab Abdya Adakan Syukuran HUT Ke 8

LHOKSEUMAWE (Waspada): Pengesahan Qanun (peraturan daerah/Perda) No. 40/ 2009 tentang pemerintahan gampong di Aceh Utara dinilai terlalu dipaksakan. Salah satu pasal tentang penggabungan (regrouping) gampong dapat menimbulkan konflik. Dalam workshop kerjasama USAID dan LSM Bytra, Senin (26/4) di Lhokseumawe terungkap sejumlah item dalam peraturan daerah tersebut yang dapat menimbulkan persoalan di masyarakat. Menurut Ketua Komisi-A DPRK Aceh Utara, Amiruddin B, salah satunya pasal

tentang kriteria sebuah gampong (desa). Dalam salah satu pasal ditegaskan, gampong yang tidak memiliki penduduk minimal 1.000 jiwa atau 200 KK akan digabung. “Menggabungkan sebuah gampong bukan hal mudah karena mereka telah memiliki pemerintahan sendiri secara turun temurun,” tegas Amiruddin. Apalagi sebuah gampong, bukan hanya terdiri dari unsur pemerintahan yang dibentuk pemerintah daerah, namun lebih dari itu merupakan kelompok masyarakat secara adat. Sehingga dalam menggabung gam-

pong dapat menimbulkan konflik di masyarakat. Sementara Direktur LSM Bina masyarakat sejahtera (Bytra), Saifuddin mengatakan, pada dasarnya Qanun Gampong memiliki arti signifikan untuk perkembangan desa. Karena dalam peraturan tersebut dapat memberi kekuasaan lebih luas kepada pemerintahan desa. Di antaranya, dalam qanun itu pihak desa bisa mengelola anggaran sendiri. “Dengan pengelolaan anggaran bersumber dari pemasukan desa, dapat dipergunakan seluas-luasnyauntukpembangunan,” ujar Saifuddin.(b17)

Peringati Hari Bumi, KSU Flora Potensi Tanam 2000 Pohon Bakau LANGSA (Waspada): Koperasi Serba Usaha (KSU) Flora Potensi menanam 2000 phon bakau di kawasan pantai Kuala Parek, Desa Alue Lhok, Kecamatan Peureulak Timur, Kabupaten Aceh Timur, Senin (26/4). Penanaman itu dilakukan dalam memperingati hari bumi Tahun 2010 bekerja sama dengan masyarakat yang tergabung dalam kelompok tani Desa Alue Lhok. Ketua KSU Flora Potensi, Agus Riady, SE didampingi humas, Muktazillah mengatakan, kegiatan tersebut berlangsung satu haripenuhdenganluaswilayahtanammencapaisatuhektare.Kegiatan penanaman hutan Manggrove dipilih dalam rangka memperingati hari bumi tersebut, kata dia, seiring untuk mendukung program Pemerintah Aceh yang sedang menggalakan penghijauan. (b22)


C6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

Bursa

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BIMANTARA Cakra Th. 97. Warna Hijau metalic mulus, VR, BR, AC, Tape, Harga Nego. Peminat Hub. Telp. 4151086 - 0813 61300 441 TP.

BMW 320i M/T Thn. 95. Hijau met. Plat B. Rp. 50 Jt Net. Hub. 0813 9655 7102 CHEVROLET Optra 1.8 M/T Thn. 2005. Coklat Met, BK Ex Mutasi Rp. 89 Jt. Hub. 7786 3981 CHEVROLET Trooper Diesel 4x4 Thn. 89. Cantik, mulus, lengkap. Warna biru tua. Harga Rp. 45Jt. Hub. 0815 3020076 DAIHATSU FEROZA TH. 94 PW, CL, Sound Komplit, TV, AC, Hg. Nego. 46Jt. Hub. 0813 7593 5777 TP. DAIHATSU Zebra Espass (MB) 2004 Harga 52Jt. Bisa Bantu Kredit. DP 15Jt-an Hub. HP. 061.76287492 DAIHATSU Feroza SE Thn ‘96 Merah, Abu Tua, AC dingin, Original, Peminat serius hub. 0813.9665.6961, TP DAIHATSU Neo Zebra Pick Up Master ‘06. HTM. Tgn-1, BK Mdn, Mulus DP 12 Jt, Angs. 1,63Jt. Isuzu Panther 2.5 HI Sporty ‘97, Green Army, AC DB, PS, Dll. DP 20 Jt. Angs. 2,08Jt. Hub. 76700976 PROMO DAIHATSU HADIAH & DISKON Xenia DP 11 Jt-an, Angs. 2,9 Jt Terios DP 13 Jt-an, Angs. 4 Jt-an Luxio DP 12 Jt-an, Angs. 3,9 Jt Gran Max. Pick Up & MB DP 5 Jt-an, Angs. 2,5Jt. Hub. Ger y 0813 76941988 / 77722561

DAIHATSU Taft GT 4x4 Th. 85. VR, AC Dingin, sehat. H. 39 Jt. Zebra MB. Th. 96. Sehat. H. 25Jt. Hub. 061-9110 3207 “GEBYAR ASTRA DAIHATSU”

Xenia (AC + Tape + PS ) DP 12 Jt-an Terios (AC + Tape + PS ) DP 20 Jt-an Hub. KEMAL. 0813 9787 8303 / 061.77714606

DAIHATSU 100% BARU PAKET MURAH...!!

Xenia Li....DP 11 Jt-an....Angs. 3 Jt-an Terios....... DP 14 Jt-an.... Angs. 4 Jt-an Pick Up ...DP 5 Jt-an...... Angs. 2Jt-an Luxio....... DP Ringan...... Angs. Ringan

Full Diskon & Hadiah. Proses Cepat & Data Dijemput Hub. JOSUA. 061-77004944/0812 6311 0820

“DAIHATSU PAKET MURAH “

Gran Max Pick Up DP 5 Jt’an Angs. 2 Jt’an Xenia 1.0 DLX DP 12 Jt’an Angs. 3 Jt’an Terios TS Xtra DP 16 Jt’an Angs. 4 Jt’an Luxio M DP 16 Jt’an Angs. 3 Jt’an Hub. Erwin HP.0812 6315 4132 061.77402067

DAIHATSU Zebra Pick Up 1.3 Th. 90 Mulus. Hub. 0812 6418 4656 FORD TX 5 Thn. 84 (BL) AC, TP, VR, BR, MRH, 22 Jt. 0815 3316 8155 / 061.8456676 -HYUNDAI Verna M/T 02. Coklat Met 68Jt -Hyundai Avega SG A/T 08 Abu Met 103 Jt Hub. 0813 7508 8798

HYUNDAI Atoz GLS 2001 Hub. 0852 621 666 88 HONDA CRV THN. 03/02 Warna merah, Kondisi sangat bagus. Hrg. 150Jt. Hub. Jl. Manunggal No. 58. Dr. Zazili HP. 0813 7675 0891

5 CM 6 CM

Rp. 65.000 Rp. 78.000

DIJUAL SALAH SATU

ISUZU Panther Miyabi Short Pendek Thn. 94. AC, PW, Remot, Alarm. Mobil Orisinil. Mulus Cantik. H. 46 Juta Nego. Hub. Ibu Hajjah Mualimah. 061.7757 2509 - 0812 6359 9200 (Maaf SMS TP)

ISUZU Panther Royal 2.5 Thn. 96. AC, CD, VR, PS, CL, Jok kulit, Hijau met. BK Mdn Asli Rp. 65 Jt. Hub. 91144382 ISUZU Pick Up ELF 77 PS. Th. 97. W. Putih metalic. Bak Besi. Roda 4. Seksi Kepala Kaleng. Mulus. H. Nego. Hub. 061-6967 2753 ISUZU New Panther 2.5 Pick Up ‘04. BK Mdn Tgn - 1. President Blue, mulus, DP 15 Jt (BW PLG) Angs. 2.36Jt. Hub. 061.76700.976

KIA Carens II M/T Thn. 2005. Hitam Km. 33 Rb. BK Mdn. Rp. 97Jt. Nego. Hub. 0812 6477 3715 Super Hemat BBM DP Super Murah Hub. 0813 7589 6778

KIA Picanto

Standard Euro KIA Mobil DP Super Murah

Picanto

Hub. 0813 7589 6778

MITSUBISHI GLS Solar Thn. 99, Silver Mutiara, Mdn asli a/n. Sendiri. MP3, PW, CL, AC DG. BR, VR 15 Inc. Grandia, Mulus, Mesin sehat, Interior rapi. Siap pakai. Hrg. Nego. Hub. 0812 605 1232 MITSUBISHI BARU

L300. Angs. 3Jt-an. Pajero Sport (Ready Stock). T120 SS, Cold Diesel 110 PS, 125 PS, Triton. Serius Hub. (061) 76728071 / 0812 653 3319

MITSUBISHI V6 24 THN. 98 Warna silver, full original. Hub. 0812 6422 7771 - 061.7637 0666 NISSAN X-TRAIL 2.5 STT, A/T, Thn. 2007. Hitam. Hubungi: 0811617908 SUZUKI APV ARENA GX. M/T. Thn. 2009, bln. 09. Over Kredit. Warna Silver Metalik. Kondisi mulus 95% Spt. Baru, BK Pilihan. Balik DP 40 Juta Net. Sisa 15x7.143.000,- BU Serius Hub. 0819 202 2156 SENSASI SUZUKI 100% BARU Carry PU DP Hanya 5 Jt-an Splash ST DP Hanya 15 Jt-an APV GL DP Hanya 14 Jt-an Ready Stock Swift, SX4, G. Vitara 2.4. Hub. 0812 654 0809 - (061) 77722121

SWIFT, SX4, GRAND VITARA, SUZUKI SPLASH, APV, ESTILO,CARRY PU & REALVAN

Dapatkan DP Min. Mulai 10% + bonus Hubungi: 061-77007396 / 0812 6509 - 2080

SUZUKI APV ‘05/’06 Boleh DP Aja Rp. 37 Jt. Sisa 29x2,8 Rb. Mbl Mulus, Asli BK Mdn, Type L. W. Silver. Lengkap, Hub. Pemilik langsung. 0813 7043 0346. Maaf TP.

SUZUKI APV Tipe X 2005 Hitam. BU. Hub. 0812 6910 463 TOYOTA BARU

AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. DP + Bunga Ringan. Hub. 0813 7512 7297 - (061) 7795 1428

TOYOTA Avanza Thn. 06 Dijual. Km. 43 ribu. Warna silver. Hub. 0813 6246 2166 Jl. Garu II Gg. Seroja No. 6 A Medan. TOYOTA Kijang G Thn. 1994, Abu-abu, Medan, Komplit, SGE. Hub. Jl. Eka Surya Titi Kuning. Telp. 77591820 - 0831 9742 0124 TOYOTA KIJANG INNOVA

Type G, bensin, warna grey mica. Thn. 2009. Bln 3. STNK full 1 tahun baru Perpanjang. Kondisi mulus, BK Pilihan. BU. Balik DP Rp. 83Juta (net). Sisa 22x7.057.000,Serius Hub. 0819 2022 156

7 CM 8 CM

Rp. 91.000 Rp. 104.000

TOYOTA Kijang LGX Thn. 2000. Diesel. Warna abu2 metalik. BK Medan. Mobil terawat. Hrg. Rp. 120Jt. Nego. Hub. 0812 6425 6317 Maaf TP.

TOYOTA KIJANG THN. 95.

Warna abu2 metalik. BK Asli Medan, Full sound interior. Full Cream. M. Bitec. Hub. 0812 64227771, 76370666

9 CM Rp. 126.000 10 CM Rp. 140.000

MOBIL Antik Jeep Willys 1950 Hijau Mulus Orisinal. Hub. 0812 6333 9938

Bursa

SEPEDA MOTOR

TOYOTA Corona Twin Cam 2.0 Thn. 91. PS, PW, AC, TP, Jok asli, Bawaan mulus sekali. Medan asli. H. 32Jt/TP. 0812 602 5621 Nego Ditempat.

HONDA Sport Tiger 2000, Thn. 2005, warna hitam, Velg Racing. Harga Net. Rp. 11 Jt. Hub. 0811 642 510

TOYOTA Kijang LGX Diesel Th. 2001/2002. Warna biru mika metalic. AC Blower, Tape Clock. P. Window. Velg Rac. B. Radial. Cat Orisinil. Hub. 0813 600 75 306

BUTUH DANA

TOYOTA Corolla SE Salon Thn. 1987 Warna hitam, BK Medan, mobil kaleng, mesin sehat, siap huni. AC Dingin, Tape, orisinil. Hrg. Rp. 30Jt. Hub. 0812 6348 3373

TOYOTA TWIN CAM 88 DIJUAL Body mulus, original, mesin siap pakai. Lengkap, AC Power Window, Tape. Hub. 0812 600 31100 TOYOTA Avanza G, VVTi, 1300cc, Warna Hitam, AC, Tape, TV, VR, BR, Original, Satu tangan dari baru, a/n. Saya Sendiri. Tahun 2006, Hub. HP. 0811 648 358 - Toyota Kijang LGX Thn. 2004/2003 Warna Baru - Bensin/Diesel - Toyota Kijang SGX Thn. 2002 Warna Hitam - Bensin - Toyota Kijang LGX Thn. 2000 Warna Biru - Bensin/Diesel - Suzuki Grand Vitara Thn. 2008. Tipe JLX W. Abu2 - Daihatsu Espass Thn. 2004 Warna coklat Cash/Kredit Tukar (+) Hub. Jl. Mustafa Depan Bulog Telp. (061) 6624884

Bursa

ANDA BUTUH DANA

Jaminan Apa Saja, Sertifikat Tanah. Proses Cepat, Syarat Mudah. Hub. 061-8222774, HP. 0816 314 1807

BUTUH DANA CEPAT Jaminan BPKB Mobil. Thn. 93 Up. Proses Cepat. Hub. Mr. Yans. 061-77631725 - 0812 6357 6669 DANA CEPAT, BPKB & * PM = 8 MENIT T. OVER: D. TRUK + AB + TRAILER + TT & DP * Mobil/Sp. Motor Th. 1980 - 2010 & BM = 0,56%/bln Mr. JG. 0813 7548 5990, 777 90 557

PINJAMAN TUNAI TANPA AGUNAN Hub. 0813 7660 2730 Syarat: Ada Usaha BUTUH DANA

TOYOTA Corolla Twincam 1600cc Thn.89. BK Mdn (Ex Mutasi) Warna Biru. Hrg. 33 Jt. Hub. Komp. Villa Gading Mas F-15 Marindal. HP. 0813 6178 6100 / 77772601

PT. SINAR MAS MULTIFINANCE. Jaminan Khusus BPKB Sepeda Motor Bunga 1,5 %, Discon, 1x cicilan Hub. 0813 6101 7444.

TOYOTA Kijang Commando Long 87. AC, Tape, VR, Wr. Merah, Mulus. BK Medan Asli. 1 Nama dari baru. Power Steering, Mobil siap pakai. Hub. 0811 650674

Khusus Surat Tanah (Kota Medan, Binjai)Bunga Rendah, 1 Hari Cair Proses Cepat dan Tdk Bertele2

TOYOTA Kijang Jantan 92. Asli Medan, Pajak Full 1 thn (Nama Sendiri) Hijau Metalik. AC, RT, VR, BR, Sangat terawat. 47 Jt. Untuk Pemakai Hub. 061-6626731. HP. 0813-979779.30. TOYOTA Kijang Model LGX New Bensin 1.8 Pemakaian Th. 2003. BPKB 1 NM, Orisinil, Asli Mdn, VR, BR, PS, PW, CL, RMT, E. Miror. Sound Power, AC DB, Hrg. 125Jt. Nego. Spt. Baru. Hub. 0813 7550 1012

TOYOTA YARIS Type S, 2010, Hitam, Manual (built up). Jarang pakai, Mobil spt. baru, KM dikit, BK Pilihan, REM ABS + AIR BAG. balik DP 40 Juta net. Sisa 32x5.486.000 BU. Hub. 081 361 062211

TOYOTA Kijang Capsul LGX Diesel Th. 99 Akhir Pemakaian Jan. Th. 2000. Biru metalik, Rp. 108 Jt. Nego. HP. 0812 63787337 / 0812 6310 760 (Lsg Pemilik Pak Harahap Jl. Bajak 3)

TOYOTA Kijang G 95 BK Medan. Hub. 0813 6121 8974 TOYOTA Kijang Krista Thn. 1998. W. Biru metalik. BK Tunggal. Medan asli. AC DB, PS, PW, Sangat mulus. Siap pakai. Hub. 061-6630842 - 0812 6453 223

TIMOR SOHC Thn. 1997. Warna merah maron. Hub. Jl. G. Krakatau Gang Berkat I No. 6. HP. 0813 6104 7788

KEMBAR MOBIL Jl. Tritura No. 9 HP. 0812 6058 6666

Type Kendaraan Mits Strada Ford Ranger Double Cabin Ford Ranger PU Mazda Ambulance E 2000

Thn Wrn Harga 2006 Hitam Mutiara 25Jt 2002 Putih 100Jt 2005 Hitam 76Jt 2000 75Jt

11 CM Rp. 165.000 12 CM Rp. 180.000

DANA EXPRESS

Terima Take Over Bank / Kredit Macet Bank)

Terpercaya Aman dan Terjamin Hub. Family Finance: 0812 6095 5531

061. 76854885 Pak Anwar.

BUTUH UANG

Boleh Tanpa Usaha. Khusus Surat Tanah Tercepat No. 1 Di Dunia KSU UA & CO Jl. Pasundan No. 78 Hub. 0812 6333 9987

MINI & EFEKTIF IKLANKAN PRODUK ANDA

WASPADA

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Bursa

SER VIS SERVIS

Hub. Senang Hati: 4517509 - 7707 3637

AC

KAMERA TERSEMBUNYI

1.Kamera Bentuk Pulpen (High Resolution) Rp. 700.000. 2. Kamera Bentuk Gantungan Kunci Mobil/Kereta (High Resolution) Rp. 700.000.

Kamera ini Bisa digunakan untuk merekam. Seseorang/Suatu tempat tanpa mencurigakan. Bisa merekam Gambar dan Suara dengan Jelas (Gambar Berwarna) Dengan Kapasitas Memory Max 6 Jam (4 GB). Kamera ini bisa dibawa / diletakkan dimana saja tanpa mencurigakan. Hasil Rekaman Dapat Dilihat Melalui Komputer / Laptop. Hub: 0813 7550 6908

Bursa

KOMPUTER

HARGA BELUM TERMASUK PPN 10%

ELEKTRONIK

AC, KULKAS, M.CUCI, P. CLINER, GENSET

Jl. Sekip 67 A (Bisa T.T. Baru/Bekas)

FAX.4561347

Service

ELEKTRONIK AC 1 pk, 1,5 pk, 2 pk=1,3Jt s/d=1,9Jt, AC Window. 700rb, AC, Air Cooler=1,2Jt. Kulkas Show Case 5 Rak = 1,7 Jt. Kulkas 1 pt=450rb s/d =900rb 2 pt=650rb s/d=1,3Jt, K. Mini=500rb. K. 2 pt Jumbo=2Jt, M. Cuci 2 tb =600rb. 1 tb = 900rb s/d =1,4Jt. V. Cliner = 900rb, Genset 9000 W, 7500W, 1200 W =950rb s/d 6000 Jt.

Rabu, 28 April 2010

AC

CUCI AC, ISI FREON, BONGKAR PASANG. REPARASI, KULKAS, MESIN CUCI Hub. DIFA SERVIS 0813 9735 7061 061-69644786

MADIN A SER VICE MADINA SERVICE SERVICE - REPARASI - SPAREPART

AC - KULKAS - MESIN CUCI

SIAP DITEMPAT& BERGARANSI

HUB. 061 77972065 HP. 0812 6566 7521

AC

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

AC

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat

KHUSUS REPARASI / SERVICE Kulkas, M. Cuci, Sanyo Air, Dispencer, Bongkar pasang AC

Hub. PRATAMA ELECTRIC

GARANSI Telp. 7343789

SERVICE GAS Kompor + W. Heater GAS Hub. AHOK 77770544

SERVICE KOMPUTER, CPU, PRINTER, MONITOR, DLL. BERSEDIA DIPANGGIL. JUAL KOMPUTER BARU DAN BEKAS Hub. 456 2282, 76562900

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

UMROH MULTAZAM 1. 2. 3. 4. 5.

SAHABAT MENUJU BAITULLAH UMROH 9 - 13 - 14 HARI UMROH PLUS AQSHO 24 JUN ‘10 UMROH PLUS MESIR 15 MEI ‘10 UMROH PLUS TURKEY UMROH RAMADHAN 9 HARI - 2 MINGGU - 1 BULAN

MANASIK HAJI MULTAZAM SETIAP HR. SABTU JAM 15.00-16.00 HR. MINGGU JAM 09.00-11.00 DAFTARKAN SEGERA KE: KANTOR PUSAT MULTAZAM JL. TITI PAPAN PERTAHANAN NO. 10 SEI SIKAMBING TELP. (061) 457.6116 - 7731.3385 HP. 0812.6566.807 - 0813.6137.2321

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

Bursa

PHOTO COPY

OBRAL OBRAL OBRAL BARU GARANSI FULL 1 TAHUN Speek: PIV INTEL 3.0 GHZ M. MEDIA Rp. 2.458.000 PIV INTEL DUO CORE 1.8 GHZ M. M Rp. 2.518.000 Case USB, 512MB, HD80GB PIV INTEL DUO CORE 2.2 GHZ M.M Rp. 2.558.000 DVD, RW (Black) PIV INTEL DUO CORE 2.6 GHZ M.M Rp. 2.618.000 Mont ‘17 SAMSUNG PIV INTEL DUO CORE 2.7 GHZ M.M Rp. 2.678.000 Key, Mouse, Speaker PLUS BONUS PIV INTEL CORE 2 DUO 2.9 GHZM. M Rp. 3.128.000 SEKEN GARANSI 1 BULAN PIII - 800 256 MB/10GB/CDROOM/M.M Rp. 958.000 MON 15” DIG CASE USB, PIV - 1,7 256MB/10GB/CDROOM/M.M Rp. 1.058.000 KEYBOARD, PIV - 1,8 256MB/40GB/CDROOM/M.M Rp. 1.188.000 MOUSE, PIV - 2,0 256MB/40GB/CDROOM/M.M Rp. 1.228.000 SPEAKER PIV - 2,4 256MB/40GB/CDROOM/M.M Rp. 1.288.000 BARU PIV - 2,6 256MB/40GB/CDROOM/M.M Rp. 1.328.000 PIV - 2,8 256MB/40GB/CDROOM/M.M Rp. 1.328.000 MONT 15” 17” FLAT PUTIH/HITAM MULUS (DELL, LG, SAMSUNG) MURAH....

NB: TERIMA VISA & MASTER CARD TERIMA SERVICE COMP & PRINTER

ADHIKA COMP COMP.. (4150371) Jl. M. IDRIS 23 (77426432)

TERCECER TERCECER

Surat Sertifikat Tanah An. Zulkarnain Lbs. Alamat Jl. Seroja 3 No. 153 Perumnas Helvetia Lt. 8x15m. Bagi yang menemukan Hub. 0813 6140 4422 akan diberi imbalan sepantasnya.

TELAH HILANG

BPKB Sepeda Motor Honda Supra Tahun 2003. No. Rangka: MH1 KEVA 103 K 445100 No. Mesin: KEVAE - 1440240. Atas nama Muharam Harahap. No. HP. 0813 7625 1780

xpress

Service

KONSTRUKSI

WC

WC

Tumpat Sedot

TUMPAT/ SAL. AIR

845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F Jl. Brayan Medan

8442246 08126427 1725 Ada Garansi ADI

WC

Telp.:

ANDA TUMPAT - SEDOT

Hub. 8219951 Jl. Setia Budi No. 2

WC

TUMPAT

8442271 0813 7035 7291 Jl. Setia Budi

PRIMA SERVICE

WC TUMPAT - SEDOT WC 061-8451176 7777 1100 WC TUMP AT, Sal. AIR, K. Mandi TUMPA Tel. 081361718158, 77008458 NARO SERVICE Jl. Sisingamangaraja

MINI & EFEKTIF IKLANKAN PRODUK ANDA

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:

Harian

WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347

Bursa

PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - 1 Set Sofa Kain/ Kulit Rp. 1 Jt-an Hub Telp. (061) 6616802 - (061) 661.8116

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Spring Bed 5 kaki 2 lapis Spring Bed 4 kaki 2 lapis Spring Bed 3 kaki 2 lapis Spring Bed 3 kaki Dorong

Rp. 1.100.000 Rp. 1.075.000 Rp. 1.000.000 Rp. 900.000 Rp. 1.000.000

Garansi Per 10 tahun Hub. 061- 6616802 - (061) 661.8116

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

JEPARA FURNITURE

Menujual/ Menerima Tempahan & Reperasi Ukuran Jepara, Kursi, Lemari, Alat-alat pengantin Jl. Denai no. 205 HP. 0852.9708.6572 Cabang Tj. Morawa - L. Pakam Km. 18,5 No. 40 Telp. (061) 9123.5306 Medan

FD CD

KIRIMKAN... DATA IKLAN ANDA DALAM BENTUK DIGITAL

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)


Ekonomi & Bisnis

WASPADA Rabu 28 April 2010

Pemasaran Biosolar Di Medan Bertahap MEDAN (Antara): Pemasaran biosolar di SPBU wilayah Medan dan sekitarnya dilakukan secara bertahap untuk menggantikan bahan bakar solar yang rata-rata penyalurannya mencapai 1.800 kilo liter per hari. “Penggantian biosolar dari solar selama ini dilakukan secara bertahap agar konsumen tidak kaget sejalan dengan edukasi penggunaan BBM ramah lingkungan itu,” kata Assistant

External PT Perta-mina Pemasaran Region I, Rustam Aji, di Medan, Selasa (27/4). Menurut dia, pasokan biosolar dipastikan mencukupi alokasi yang dibutuhkan karena manajemen sudah menjalin kerja sama dengan produsen minyak nabati di Dumai, Riau. “Jadi pemasaran bertahap lebih karena kepentingan untuk edukasi pemakaian BBM yang ramah lingkungan itu ke konsumen dan termasuk pengelola SPBU,” katanya. Dia optimistis, tidak terlalu sulit melakukan edukasi kepada konsumen, mengingat harga jual biosolar itu sama

dengan harga solar bersubsidi yang dijual selama ini dan pemasaran juga sudah dilakukan di beberapa kota lain seperti Jakarta dan Surabaya.. Perluasan pemasaran biosolar di SPBU sesuai Peraturan Presiden No.5 Tahun 2006 tentang Kebijakan Energi Nasional dan Instruksi Presiden No.1 Tahun 2006 tentang Penyediaan dan Pemanfaatan Bahan Bakar Nabati sebagai Bahan Bakar Alternatif. Biosolar dihasilkan dari pencampuran antara minyak solar dengan minyak nabati yang berasal dari tanaman atau lemak hewani yang diproses.

Perbankan Harapkan Biro Informasi Kredit Baru

Biosolar yang akan diluncurkan di Medan adalah Biosolar B-5 dengan kandungan 95 persen minyak solar dan 5 persen FAME (Fatty Acids Methyl Ester). Dengan cetane number 48, produk ini dapat digunakan untuk kenderaan bermesin diesel pada umumnya tanpa perlu modifikasi. Dia menjelaskan, seperti biofuel, biosolar termasuk bahan bakar ramah lingkungan yang dapat diperbaharui dan terurai secara alami. Emisi gas buang biosolar lebih baik karena pembakaran yang lebih sempurna sehingga dapat mengurangi polusi udara.

Bursa

Bibit sawit Marihat DXP (Sertifikat Asli), Kualitas unggul umur 14 bln Siap tanam, Lokasi Namorambe Hub. 0819.889.808 / 0812.602.3396

LOWONGAN KERJA Wanita (Gadis/ Janda) Menjadi - Prwt anak (gaji 600 Rb - 1 Jt) - Prwt org tua (Gaji 650 - 1,2 Jt) Bersih/ ditambah uang kerajinan/ bln Hub. “Cahaya” (061) 453.1124/ 0852.7552.3457 Jl. Ayahanda 73C Medan

DICARI MEKANIK DINAMO MOBIL UTK GABUNG, Bersama kami & terima kost pria muslim Hub. 0812.646.2960

LOWONGAN KERJA

2 orang Karyawan Doorsmeer mobil Hidrolik Hub. 0812.6333.9938 No SMS

DIBUTUHKAN

Tukang masak mie aceh, yang berpengalaman alamat Jl. Jamin Ginting No. 52 Padang Bulan Medan Hub. 0815.6107.2513 Segera

DIBUTUHKAN

DICARI SGR U/ BKRJ DI MASKAPAI/ TRAVEL

Min. Lls SMU/ sdrj Hub: Diklat airlines Hub Jl. Karya Wisata No. 23A Johor Ph. 786.1690 Medan

DICARI TEKNISI

Syarat: - Tamatan STM Elektronik (minimal) - Mengerti AC dan Kulkas - Gaji Rp. ± 1 Jt/ bulan/ nego - Bonus Lamaran ditujukan/ diantarkan ke: CV. ARIMBI Jl. Rinte Raya No. 121 Komp. Kejaksaan Blok C Telp/ HP: (061) 836.1328/ 0812.653.6314

DIBUTUHKAN 2 Orang PRT, Minimal SMA Wanita, Usia min. 20 thn Hub. 788.3872 - 788.3957 787.9533 Dgn Ester DIBUTUHKAN SEGERA

Beberapa orang Pegawai Toko di Pusat Pasar, dengan syarat sbb: 1. Wanita, usia 18 - 26 tahun 2. Berpengalaman, min SMA 3. Jujur, teliti, rapi, tanggung jawab 4. Rajin, bersih, gesit dan kreatif 5. Berpenampilan menarik 6. Dapat mengerti bahasa batak Bagi yang memenuhi syarat silahkan kirim lamaran kepada Jl. Pasundan No. 73 Medan (Cap pos), paling lambat 3 hari setelah iklan terbit

DIBUTUHKAN

S e b u a h p e r u s a h a a n y g b e rg e r a k dibidang Distribusi makanan/ minuman membutuhkan SPG, dengan syarat sbb: 1. Wanita 2. Tamat SMU sederajat 3. Berpenampilan menarik 4. Tinggi: 155cm 5. Pasphoto berwarna 4x6 (2 lembar) 6. Photo seluruh badan Lamaran dapat dikirimkan ke alamat sbb:

GOLDEN GATE

DICARI SGR Lls SLTA/ sdrj Unt diddk

UT. 8x10, UB. 8x8, Type 64m², SK Camat Jl. Karya Jaya Gg. Eka Dame Gedung Johor Harga 185 Jt Hub. 0813.7056.6299

DIBUTUHKAN

RUMAH Dijual LB. 70/ LT. 141, disudut, Telpon, SHM di Graha Deli Permai Blok A6/ 11 Jl. Tani Saudara Johor Hub. 0812.6523.8948

Sebuah Lembaga Pelatihan membutuhkan beberapa orang karyawan untuk posisi: 1. ADMINISTRASI 2. OFFICE BOY Persyaratan: 1. Wanita max. 25 tahun 2. Pendidikan min. SMK/ D3 3. Pengalaman min. 1 tahun 4. Mampu menggunakan komputer Lamaran lengkap diantar ke: GRAND EDUCATION CENTRE Jl. Kapten Muslim No. 227B Helvetia Medan Telp. (061) 845.2872 Paling lambat tanggal 30 April 2010

LOWONGAN KERJA RESMI KE MALAYSIA

Dibutuhkan Tenaga Kerja Wanita untuk ditempatkan bekerja pada perusahaan Elektronik Multi Internasional di Malaysia seperti berikut: ASE ELECTRONICS (M) SDN. BHD di Bayan Lepas Penang (COMPANY) Syarat-syarat untuk pendaftaran/ seleksi: 1. Wanita, Umur 18 s/d 35 tahun 2. Pendidikan minimal SMP/ sederajat 3. Membawa asli + Foto copy Ijazah dan KTP masing-masing 1 lembar 4. Membawa pasphoto berwarna ukuran 3x4: 2 lembar Fasilitas-fasilitas yang akan diterima TKI sbb: - Asrama dan perlengkapannya - Transportasi dari asrama - kilang - asrama - Perlindungan asuransi kecelakaan kerja 24 jam - Klinik Kesehatan - Pajak / levy ditanggung majikan sepenuhnya SELEKSI DILAKSANAKAN TGL. 05 MEI 2010 Untuk informasi selengkapnya hubungi:

PT. KARYATAMA MITRA SEJATI SIUP No: KEP645/MEN/2006 Jl. William Iskandar/ Jl. Pancing No. 41-42 Medan Telp. (061) 735.9868 (Hunting) Flexi: (061) 7754.3399

Bursa PROPERTY Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

LB LT RM RT

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

DIJUAL CEPAT

RUMAH DIJUAL

B. GAJI:

ˆ Untuk bagian Operator: - Basic RM 650/ bulan - Shift petang RM 4 - Shift malam RM 8 - Tunjangan kehadiran RM 50/ bulan - Tunjangan makan RM 50/ bulan - Biaya perobatan untuk gigi dan mata RM 100/ tahun - Subsidi makan dikantin RM 2/ hari kerja - Bonus tahunan 1 bulan gaji pokok ˆ Untuk bagian Manufacturing: 1. 8 Jam kerja 12 Jam kerja Gaji Pokok RM 1.150/ bulan RM 1.150/bulan Shift pagi Shift petang RM 4 Shift malam RM 4 Shift malam RM 8 RM 15 Subsidi makan di kantin RM 2/ hari kerja RM 3/ hari kerja OSRAM 2. Tunjangan makan RM 2/ hari kerja 3. Tunjangan kehadiran RM 50/ bulan 4. Perubatan gigi dan mata RM 100/ tahun 5. Bonus tahunan 1 bulan gaji pokok C. FASILITAS - Levy subsidy 100% - Asrama, tiket pulang, kemudahan kesehatan, asuransi, berangkat naik pesawat terbang D. JADWAL PENDAFTARAN/ JADWAL SELEKSI: - Pendaftaran : Setiap hari kerja - Seleksi : Rabu/ 5 Mei 2010 Segera daftarkan diri anda sekarang juga ke:

PT. MUTIARA KARYA MITRA

SIUP NO: 629/MEN/2006 JL. KAPTEN MUSLIM NO. 89C MEDAN Telp. (061) 845.2956 - 847.1840 - 846.8759 (dekat RSU SARI MUTIARA) Contact person: Mega 0812.6408.0074 0813.67646.7222 - 0878.6827.7444 (Ibu Veronika)

RUMAH BARU DIJUAL

& lsg dislrkan mjd Guru PG/TK Hub: Jl. KH. Wahid Hasyim 92 Medan Tp. 7623.5314 - 9158.3487 - 4533.875 - 456.9269 Jl. Karya Wisata No. 23A Johor Tp. 786.1690 Medan

LOWONGAN KERJA RESMI KE MALAYSIA OSRAM Opto Semiconductor (M) Sdn. Bhd (Bukan Perusahaan Outsourcing/ Contract)

AHLI KUSUK URAT & LULUR MBAK DINA

RESTO/ HOTEL

HP. 0812.6499.1979 BERSEDIA DIPANGGIL

PIJAT SEHAT KUSUK & Lulur Bersedia dipanggil

Hub. Mbak Tari (061) 9167.1526

Bursa

Rumah LT. 8x24 Jl. Karya Sehati Gg. Sehati 4 Medan Johor Hub. 0812.6542.2876

A. SYARAT PENDAFTARAN: 1. Wanita Umur 18 s/d 26 tahun 2. Pendidikan: - Minimal SMU sederajat (untuk Operator) - Lulusan D3 Elektronik, Mesin, Listrik, Komputer (untuk bagian manufacturing) 3. Membawa foto copy ijazah, KTP, Kartu keluarga (asli dibawa sewaktu interview) 4. Membawa pasphoto warna 3x4: 3 lbr 5. Menguasai bahasa Inggris (untuk bagian manufacturing) 6. Tinggi badan 150cm (untuk operator), dan 153cm (untuk bagian manufacturing)

Bursa

PAGAR OTOMATIS

Model dorong dan engsel dilengkapi 4 bh remote control, 2 bh kunci release manual (listrik mati), Harga terjamin Hub. 7766.4096

SEWA ALAT PESTA

Kode “GG” Komp. Perhubungan Udara Jl. Penerbangan IV No. 81 Medan 20131

Perusahaan Elektronik Terkemuka di Bayan Lepas, membutuhkan Tenaga Kerja Wanita:

membentuk biro kredit milik negaranya. Selama ini, ada beberapa biro kredit yang dimiliki oleh swasta namun cakupannya sangat kecil. Pelaku perbankan nasional, baik konvensional, syariah dan BPR, dapat meningkatkan kontribusi dalam upaya mendukung perkembangan sektor riil serta perekonomian nasional Indonesia. Pada Apconex 2010 esok, dapat disaksikan perkembangan perbankan nasional maupun teknologi pendukung perbankan, sebagaimana dapat dijumpai pada anjungan pameran beberapa perusahaan, seperti Securemetric technology yang mengusung spesialisasi di sektor sekuriti digital, Lalu ada Sybase dengan spesialisasi di bidang mobile messaging and mobile commerce. APC solutions mencakup uninterruptible power supplies (UPS), precision coolingunits, racks physical security and design and management software, termasuk APCs. lnfraStruxure®, architecture, solusi manajemen yang komprehensif dan terintegrasi. lnternetprovider diusung oleh 3 perusahaan lcon plus, 3G Network ( PT Citra-Sari Makmur) dan Biznet.(dtc)

DIKOTA MEDAN? HUBUNGI: UD. PARLINDUNGAN AGEN PT. PERTAMINA GASDOM REGION I JL. SM. RAJA KM. 5,5 NO. 10 MEDAN (DEPAN UNIVA) TELP: 788.2870/ 0813.9796.6059

Berpengalaman, Islam, Jaminan 45.000, Alamat Dahrul Pangkas Ruko Jl. Cemara P. Brayan Medan Hub. 0813.6165.3465

Tukang masak mie aceh, yang berpengalaman Alamat Jl. Jamin Ginting No. 520 Padang Bulan Medan Hub. 0813.6107.2513 Segera

JAKARTA (Waspada): Industri perbankan di Indonesia mengharapkan munculnya biro kredit baru di Indonesia, yang merupakan bentuk sempurna dari sistem informasi debitur (SID) yang dibentuk Bank Indonesia (BI). Wakil Direktur Utama PT Bank Danamon sekaligus steering committe Apconex VI Jos Luhukay mengatakan, acara Acara Asia Pacific Conference & Exhibition (Apconex) VI yang akan diadakan besok diharapkan akan menelurkan munculnya biro kredit baru tersebut. “Tapi pembentukan Credit Bureau for Indonesia ini akan menjadi bentuk yang lebih sempurna dari SID yang selama ini ada di BI,” kata Jos dalam jumpa pers di JCC Senayan, Jakarta, Selasa (27/4). Menurutnya, selama ini SID yang ada saat ini hanya mencakup perbankan saja, biro kredit yang diharapkan bisa terbentuk tersebut nantinya akan memiliki cakupan lebih luas, mulai dari multifinance hingga ke berbagai jenis asuransi. “Jadi, jauh lebih lengkap dari yang sekarang. Ini kita harapkan menjadi terobosan dari Apconex VI tahun ini,” ujarnya. Dia menambahkan Indonesia menjadi negara yang paling lambat di Asia dalam

INGIN JADI SUB AGEN GAS LPG 3 KG

DIBUTUHKAN TK. PANGKAS

Informasi hub. DIURMA FOTO VIDEO Sdr. Rio (061) 7755.3503. Hari/ jam kerja

Biosolar juga mampu memperpanjang umur mesin karena memiliki sifat detergensi atau pembersih. Dengan memasarkan produk tersebut, selain memberi kontribusi dalam pelestarian lingkungan dan ketersediaan energi, Pertamina juga memberi dampak pada pengembangan masyarakat terutama petani penghasil tanaman nabati. Ketua Yayasan Lembaga Konsumen Indonesia Medan, Abubakar Siddik, mengatakan, Pertamina harus menjaga kepercayaan dan melindungi konsumen.

DIJUAL SEGERA BIBIT SAWIT

LOWONGAN KERJA

DIBUTUHKAN Fotografer Wedding (F) dan Asisten Foto Video (A) utk foto wedding event, min. S1 utk (F) dan SMU utk (A), lebih disukai dari latar belakang Ilmu Komunikasi/ Jurnalistik (F), memiliki sense of art yg baik dan memiliki contoh karya foto (wedding diutamakan utk F).Berpenampilan menarik, energik, loyal dan disiplin, siap dikontrak pada setiap event wedding

C7

Komplek Menteng Indah Blok C1 No. 20 HP. 0811.630.864

DIJUAL CEPAT PINDAH

RUMAH + KLINIK, LT. 10x33m, LB. 9,5x17 + 4x7m, SHM, Harga 450 Jt/nego Letak Jln ke Percut Psr. 6 Sampali Hub HP. 0812.6455.9800

RUMAH Dijual Jl. Eka Rasmi No. 15, Luas Tanah 683, Luas Bangunan 175m, SHM Hub. 0813.9727.7746 RUMAH/ Tanah Dijual Luas ±219m², Rumah Permanen, Fasilitas Air PAM, PLN, Telp, AC, Surat Seritifikat yang terletak di Marelan Psr. I Tengah Gg. Peribadi No. 24 Ujung Perumahan Grand Marelan Peminat serius hub Telp. 685.2349

RUMAH 2½ TINGKAT DIJUAL CEPAT Uk. 5x17m, Jl. Denai Gg. 1 No. 21, Sertifikat, Siap huni Hub. 736.2974 HP. 0811.656.445

RUMAH DIJUAL CEPAT

Jl. Medan Area no. 414 sebelah Masjid Taqwa, Lt. Keramik, Belakang 2½ Tingkat SHM, Uk. 8,5x25m, Siap huni Hub. 0812.6019.6116 - 0813.6240.7220

RUKO 3 GANDENG DIJUAL Jl. Gagak Hitam, 12x18m 3 Tkt, SHM, PLN, Air, Full keramik, Superdek Hub. AHI 0812.605.1943 (061) 7793.3382

RUMAH BARU Type 50, Lt. 56, 2 Kt, 1 Km, SHM, PLN, Jl. Persatuan Pasar 9 Tembung. Sisa 2 Unit. Hrg. 79Jt/unit. Utk muslim, Hub. 0812 6307 2300 RUMAH BARU Type 50, Lt. 6 x 18,2 Kt, 1 Km, Tamah pagar Kllg, Jl. Denai Ujung / Jl. Datuk Kabu Gg. Bukori (aspal) 2 unit hrg 130jt/unit. utk muslim. Hub. 0812 6307 2300

GRAND SETIA RESIDENCE Type 45, 54 dan 70 Lokasi Bandar Setia ±3 Km dari UNIMED/ IAIN Hub. 0813.9786.5410 0813.6219.0478

DIJUAL CEPAT/ B.U

Rumah Jl. Karya Tani Gg. Baru (bisa msk mobil) No. 50A, Uk. Tanah 398m², 3 KT, 4 KM, Carport, Garasi luar, Pagar keliling, Full keramik, SHM, Cuma 5 menit ke Polonia Airport, Harga 485 Jt/nego Hub. (061) 7660.0555 / (061) 738.8418

PADANG SIDIMPUAN

DIJUAL CEPAT RUMAH BERTINGKAT

GRAND ALGERIA RUMAH MEWAH HRG TERJANGKAU !

DP 12 Jt, Angs: 900 Rb-an, Kolam renang, Angkot ±2 Km RS, Pasar tradisional, 3 Km tol Bandar Selamat Hub. 0812.6360.1869 (Ahmad), Dptkan Disc. Khusus

TANAH TANAH KOSONG DIJUAL

Uk. 8x14m, Jl. Marelan Raya Psr. II Barat Gg. Berani, SK Camat, TP Hub. 0812.6010.3321/ 7634.4221

TANAH DIJUAL

Luas 3250m²/ SHM, Cocok U/ Perumahan, Sekolah Jl. Mencirim ±2Km dari Kp. Lalang, HP. 250 Rb/m² Hub. 0812.6577.2845

Bursa

BUSANA/ASESORIS

PECI MAHKOTA MENJUAL PECI TEMPAHAN Berbagai Model Dan Warna Jl. Prof. H.M. Yamin SH. No. 340 / Jl. Serdang Depan Gg. Sadu Medan

Bursa

BUSANA/ASESORIS

KONVEKSI KAOS Menerima Tempahan:

KAOS KAMPANYE PILKADA - KAOS OLAH RAGA, DLL.

CEPAT DAN EKONOMIS

Jl. Amal Luhur Gg. Kuini No. 129J (061) 847.5648/ 0811.659.235 Mdn

Bursa

PELUANG BISNIS #PELUANG SEHAT, HEMAT, HEBAT#

Produsen air minum berkualitas Extra Oxygen rendah mineral an-organik, kemasan galon 19 liter, mencari agen/ outlet wilayah Sumut-NAD

PENGOBATAN

JUAL BIBIT TANAMAN + ALAT PENYIRAM

BUTUH ALA TB ANTU DENGAR? ALAT BANTU TRA HEARING AID Hub. MEL MELTRA Jl. Kediri No. 36 Medan Tel. 4516161

PERKEBUNAN Karet, Sawit ,Coklat, Buah-buahan, Sengon, Jabon, Gaharu, Jati, Alat siram Sumi Sansui Hub. (061) 664.408 - 0878.6802.1426

Jl. Gajah Mada Baru No. 10 Medan, Luas 405m², Sertifikat Harga 800 Jt/nego, Maaf TP Hub. 0811.640.687

SEDIA:

- Dolomite Halus (100 mesh) - Dolomite Kasar - Kaptan (Kapur Pertanian) Hubungi: - Acheng Flexi : (061) 7772.0395 HP : 0812.6543.530 - Yansen Flexi : (061) 7677.1359 HP : 0819.835.138 - Aseng Flexi : (061) 7770.0380 HP : 0811.600.380

NINA JAYA

Lokasi Kavlingan Jl. Flamboyan Raya Gg. Harahap Tj. Selamat, Medan Lebar Gang Harahap 7 meter, bisa juga masuk dari Gang Tower dan Gang Manggis Jarak Kavlingan dari Jalan Besar ±100m. Ukuran Kavlingan yang dijual Lebar Bebas, Panjang ±20M. Harga Permeter Rp. 500.000 Alas surat: SHM dan SK Camat Hubungi Pemasaran:

NINA JAYA MOTOR

Jl. Flamboyan Raya No. 12 A/B Tj. Selamat, Medan Telp: (061) 836.4405 Flexi: (061) 7707.8255 HP: 0813.7517.2300 HP: 0852.6221.5953 HP: 0812.636.6055

ATAP ZINCALUME

BPK. HARYONO ASLI DARI BANTEN

Hub. (061) 7786.0168

HI-TEN

PELUANG USAHA

Jl. Timor No. 26 Medan Telp: (061) 456.9309 Fax. (061) 455.4173

Harian

JADILAH VEGETARIAN BERTINDAKLAH HIJAU www.SupremeMasterTV.com Info: (061) 451.4656

Ukuran yang dapat dipilih: - Panjang 15xm Diameter 3 - Panjang 17cm Diameter 4 - Panjang 20cm Diameter 5 Alamat Praktek: HOTEL AMPLAS No. 507 Jl. Panglima Denai No. 1 depan Terminal Amplas Medan Hub. M. SULAEMAN 0813.7703.7772 DINKES-503/04BATRI/KPPT/2008

Media yang Tepat untuk Iklan Anda

BALAI PENGOBATAN TRADISIONAL

ALAT VITAL DITANGANI OLEH AHLINYA: M. SUHERDI

DARI PELABUHAN RATU SUKABUMI JABAR

Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat

MENANGANI KELUHAN: MENAMBAH UKURAN Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

SECRET YIN-YANG HIDUP SEHAT DENGAN EXTRACT HERBAL ALAMI 100%

Mengamati penyakit secara menyeluruh. Yang dianggap penting. Bukan hanya simtom-sintom yang dikeluhkan. Melainkan juga keseimbangan Yin-yang dan keseimbangan jiwa raga. Ramuan Extract Herbal ini sangat efektif dalam pengobatan penyakit kronis karena ternyata hasilnya sangat memuaskan. - Gagal ginjal - Nyeri berlebih - Stroke - Maag/ lambung - Parkinson - Kanker/ Tumor - Gondok, struma - Diabetes - Impotensi - Sindrom Usus dll Praktek : Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun No. 42 (Samping INDOMARET) MEDAN Telp/ Fax. (061) 736.6292 HP. 0852.333.80800

Bpk. PHOZAN HARUN RISEH

Buka Praktek: Senin - Sabtu Pagi 08.00-12.00 (Istirahat) Sore 14.00-20.00 Minggu 16.00-21.00 Izin Dinkes No. 503/TRD-02/dkk/I/2010 NB. Ikuti dialog interaktif di: Deli TV, Tgl. 7/4-2010 Jam 20.00 s/d 21.00 WIB TVRI Medan Tgl. 10/4-2010, Jam 20 s/d 21 WIB

Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663 NB. MOBIL BISA MASUK/ GARASI PAKEM. B-346/DSP.5/11/2008

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

M. SULAEMAN

Mengatasi keluhan solusi penyembuhan yang paling tepat paten dan permanen asli terapi nampak hasil ditempat ±30 menit langsung besar dan panjang bisa di rasaka nkhasiatnya KHUSUS PRIA: PRIA/ WANITA - Pengasi kecantikan/ ketampanan TERAPI M. SULAEMAN - Memperbesar TDK MENEBAR JANJI2 - Memperpanjang - Pelaris dagang Tapi bukti yg nyata - Impotensi total - Memperlancar dapat rizki - Mempercepat dapat jodoh mampu mmberikan - Ejakulasi dini solusi penyembuhan - Ritual nikah batin - Kurang keras keluhan alat vital, - Ritual pengikat suarat - Kurang ereksi sekaligus perubahan - Lemah syahwat - Ruwatan samber lili ukuran otot vital anda - Ilmu pelet cakra buana - Mani encer - Buka aura dan buang sial - Diabetes

Telp. 7882870, 0813 7666 7601 Medan

-

WASPADA

Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

AHLI PENGOBATAN TERAPI ALAT VITAL DAN PENGASIH PRIA/ WANITA ASAL SUKU BADUI ASAL BANTEN DITANGANI

Agen Minyak Tanah PT. Pertamina Retail I Jln. SM. Raja Km. 5,5 No. 10 (Depan UNIVA)

WASPADA

G-550

PT. Surya Panca Lestari

SELAMATKAN BUMI

Ingin Promosikan Produk Anda Harian

R

JARAK TUMPUAN LEBIH BESAR TAHAN KARAT DAYA TAHAN LEBIH LAMA PRODUK WARRANTY BlueScope Lysaght Indonesia Authorized Distributor:

Siapapun anda, dimanapun anda bisa bergabung bersama kami, bidang jasa dan pemasaran (bukan sales & bukan MLM) Alamat Jl. Setia Budi No. 190/ 04 Medan Telp. (061) 822.5237 Website: www.usahaabadi.co.id

Call Center: 0818 090 73481

PUSAT PENGOBATAN SPESIAL ALAT VITAL DITANGANI LANGSUNG

Bursa

FREE DEMO PEMISAH EMAS Dari PASIR dg. Air Tercepat di Indonesia. www.isggold.com 0819 3833 3959

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

JL. KLAMBIR V NO. 152 KP. LALANG MEDAN

MATERIAL BANGUNAN

Hubungi:

TANAH DIJUAL

IKLANKAN PRODUK ANDA

MENGOBATI GANGGUAN KESUBURAN (BELUM MEMPUNYAI KETURUNAN) HUB. 0813.6115.0061

UMUR 22 TAHUN LOKASI MEDAN HUB. 0812.601.2290

UD. TUJUH PULUH

3 KT, 2 KM, LISTRIK 900 WATT AIR PAM - SURAT SHM LUAS TANAH 213M² LANTAI KERAMIK HUBUNGI: 0813.6132.0784

MINI & EFEKTIF

AHLI MENGOBATI KANKER/ TUMOR PAYUDARA

DIJUAL 171 BATANG POHON MAHONI

BUTUH MINYAK TANAH NON SUBSIDI?

RUMAH DIJUAL

Bursa

Bursa

A. AMARUDIN

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG: 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6409.1777

TERAPI JIWA MENTAL & KEROHANIAN KEJATI B. 109/DSP4.3/11/2009

KI TUBAGUS ROHMAN TOHA Mengatasi Penyakit & Problem antara lain: ˆ ˆ ˆ ˆ

Kelainan sex, bysex (homo/ lesbi) Gangguan jiwa/ mental, kegelisahan, gila Kurang percaya diri, stres berat Buka setiap hari jam 08.00 s/d 21.00 WIB Dendam, marah, cemas, dll hari libur tetap buka

Penyakit yang dapat disembuhkan secara langsung ditempat seperti: Lumpuh/ struk (komplikasi) bisa kembali normal, gondok, liver, amandel, hernia, ginjal, rematik, tumor, impoten, diabetes, spilis, singa, dll

MOTTO:

ˆKENALILAH HATI NURANI (fitroh dirimu) karena disitulah kunci kebahagiaan, ketentraman, kesuksesan yang hakiki, abadi dan pasti PRAKTEK: Jl. SM. Raja, samping UISU masuk Jl. Sempurna, 300m No. 49 Medan HP. 0812.682.77999


Ekonomi & Bisnis

C8

WASPADA Rabu 28 April 2010

Pemerintah, DPR Sepakat TDL Naik 10 Persen

PLN Janjikan Perbaikan Layanan JAKARTA (Waspada): Direktur Utama PT PLN (Persero) Dahlan Iskan menyerahkan keputusan kenaikan kenaikan Tarif Dasar Listrik (TDL) kepada pemerintah. Yang pasti, Dahlan berjanji PLN akan memperbaiki layanannya setelah kenaikan TDL 10 persen mulai Juli 2010 nanti. Menurut Dahlan, kenaikan TDL memang tidak dapat dihindari karena pemerintah tidak mungkin membiarkan harga listrik paling murah diantara barang-barang lainnya. Apalagi, dari hasil penelitian menunjukkan pendapatan masyarakat pasti akan naik. Kenaikan tersebut, lanjut Dahlan, tentu saja akan diperebutkan oleh siapapun misalnya sektor telekomunikasi atau industri rokok. “Kalau listrik ini tidak ikut memperebutkan ini, maka diambilkan pihak-pihak lain

yang tidak penting jika dibanding listrik. Saya setuju listrik tidak naik kalau buat beli susu atau biaya pendidikan, Namun kalau untuk beli pulsa atau rokok akan sangat rugi kalau listrik tidak ikut berebut,” kata Dahlan Dahlan dalam rapat kerja dengan Komisi VII DPR, di Gedung DPR, Senayan, Jakarta, Selasa malam (27/4). Untuk itu, Dahlan mengusulkan agar kenaikan TDL sebaiknya tetap dilakukan pada tahun ini, karena masyarakat sendiri sudah mengetahui bahwa pada bulan Juli tahun ini TDL akan naik. Namun, dia berjanji kenaikan TDL tersebut akan diikuti dengan perbaikan layanan dan pasokan listrik ke seluruh pelanggannya di tanah air. “Lebih baik tahun ini. Toh masyarakat juga sudah tahu, supaya sakitnya sekalian. Kami berjanji akan sembuhkan luka masyarakat dengan meningkatkan pelayanan. Tapi ini terserah karena hak ini ada di pemerintah. PLN inikan seperti film kartun. Artinya kelindes hidup, kejepit juga hidup,” ungkap Dahlan. Namun Dahlan mengingat-

kan, sebenarnya kenaikan TDL tidak memberikan pengaruh apapun terhadap keuangan PLN dan juga pasokan listrik di tanah air. Menurutnya, jika TDL tidak dinaikkan maka imbasnya yaitu besaran subsidi listrik dalam APBN akan membengkak. “TDL naik atau tidak naik PLN tidak masalah karena listrik akan terus hidup. Dampaknya kalau TDL tidak naik, paling subsidi listrik di APBN akan naik atau paling tidak jumlah utang PLN ke Pertamina untuk pembelian BBM akan bertambah,” kata Dahlan disambut tawa seluruh peserta rapat kerja yang berlangsung alot tersebut. Pernyataan Dahlan tersebut langsung ditanggapi oleh Direktur Utama PT Pertamina Persero, Karen Agustiawan yang duduk tidak jauh dari Dahlan. “Saya agak keberatan itu (tambah utang-red) pak Dahlan,” ungkap Karen . PT PLN (Persero) meraup tambahan pendapatan sebesar Rp270,7 miliar setiap bulannya dari penerapan tarif baru untuk pelanggan kaya di seluruh Indonesia. “Data tersebut rata-rata dari rekening Februari dan Maret

2010,” ujar Kepala Divisi Niaga PLN, Benny Marbun. Sementara itu, Direktur Listrik dan Pemanfaatan energi J. Purwono memperkirakan, penerapan tarif baru untuk pelanggan kaya tersebut dapat menghemat subsidi listrik sebesar Rp3,1 triliun sepanjang tahun ini. “Kalau setahun itu penghematannya sekitar Rp3,1 triliun,” kata Purwono. Seperti diketahui, sejak 1 Januari 2010, PLN telah memberlakukan pengurangan batas subsidi pelanggan 6.600 VA ke atas dari sebelumnya 80 persen menjadi 50 persen dari rata-rata pemakaian listrik secara nasional. Dengan begitu, kini para pelanggan kaya hanya dapat menikmati tarif subsidi untuk pemakaian listrik 50 persen dari rata-rata nasional, sementara sisanya akan dikenakan tarif keekonomian sekitar Rp1.380 per Kwh. Penerapan tarif ini sempat menuai kontroversi karena BUMN listrik ini tanpa berkonsultasi dengan Komisi VII DPR. Sosialisasi yang dilakukan PLN ke masyarakat pun dinilai masih kurang.(dtc)

Eksportir Sayur, Buah Pertanyakan Tax Rebate China JAKARTA (Waspada): Para pelaku eksportir sayur dan buah Indonesia mengakui keunggulan harga produk-produk buah-buahan dan sayur mayur China yang sangat kompetitif. Murahnya produk sayur dan buah China karena kebijakan tax rebate atau pengembalian biaya ekspor sebesar 5 persen setiap 3 bulan sekali kepada para petani oleh pemerintah China. Ketua Umum Asosiasi Eksportir Sayur dan Buah Indonesia (AESBI) Hasan Johnny Widjaja mengatakan keunggulan China terhadap produk buah dan sayur juga ditopang oleh teknologi yang canggih di bidang pertanian. Dalam kasus persaingan produk sayur dan buah di Singapura, produk sayur dan buah Indonesia tersisih jauh oleh China. “Setiap per tiga bulan sekali petaninya dikasih 5 persen

rebate oleh pemerintahnya,” kata Hasan di kantor Kadin, Jakarta, Selasa (27/4). Selain masalah harga yang sangat miring, kualitas produk buah dan sayur China sangat terjaga baik karena memiliki sistem untuk mempertahankan kualitas produk yang baik mulai dari pemetikan di tingkat petani sampai proses pengapalan. Sementara di Indonesia, kata dia, banyak yang harus dibenahi, termasuk gudang pendingin yang dimiliki Kementerian Pertanian banyak yang tak berfungsi. “Masalah infrastruktur juga masih menjadi masalah besar, contohnya di Pelabuhan Belawan, kalau kita mau kirim barang, crane-nya rusak itu sering terjadi jadi buah dan sayur tak bisa diangkut ke kapal,” katanya. Hasan mengatakan khusus untuk sayuran, Indonesia hanya mampu menyuplai 60.000 ton

per hari dengan harga 2-3 dolar AS per kg, rencananya target tahun ini bisa mencapai 100.000 ton per hari. Beberapa negara tujuan ekspor produk sayuran Indonesia seperti Timur Tengah, Taiwan, Jepang sudah dilakukan tapi masih dalam jumlah yang sangat kecil. “Orang Singapura sadar, hasil sayuran kita lebih gurih dari negara-negara lain. Rasanya lebih enak karena tanahnya vulkanis, tapi memang harganya tidak kompetitif,” jelasnya. Berdasarkan hasi riset Lembaga Penelitian Independen Frost & Sullivan, ada temuantemuan menarik terkait produk buah dan sayur Indonesia tidak kompetitif di pasar Singapura. Hasil survei pada 2009 ada trend perusahaan-perusahaan logistik kurang berminat mengangkut produk sayur dan buahbuahan karena memiliki risiko tinggi dengan margin yang tipis.

Dari 112 perusahaan yang disurvei, hanya ada 12 persen masih mau mengangkut produk ekspor sayur dan buahbuahan dari Indonesia, selebihnya lebih berminat mengangkut produk-produk furnitur atau produk yang tak memiliki risiko rusak yang tinggi. Selain itu masa pengiriman dari Indonesia ke Singapura relatif lama. Misalnya berdasarkan hasil penelitian, pengiriman sayur dan buah dari Jawa Timur ke Singapura melalui kapal memakan waktu 72-90 jam dan lewat udara 18 jam. Untuk Jawa Tengah melalui kapal 72-84 jam dan melalui udara 12 jam. Jawa barat masa pengiriman 60-72 jam melalui kapal laut dan 12 jam melalui udara, Kepulauan Riau 36-48 jam melalui kapal dan 9 jam melalui udara, Sumatera Utara 72 jam lewat kapal laut dan 12 jam melalui udara.(dtc)

Presiden Ingin Pejabat Sektor Keuangan Kebal Hukum JAKARTA (Waspada): Presiden SBY kembali mengajukan surat berisi RUU tentang pencabutan Perppu tentang Jaring Pengaman Sistem Keuangan (JPSK), karena surat serupa pernah ditolak DPR karena kesalahan tanggal penolakan Perppu JPSK. Surat tersebut berisi rencana pemberian imunitas hukum pejabat sektor keuangan. Surat bernomor R-28/Pres/ 04/2010 tertanggal 7 April 2010 perihal penyampaian kembali RUU tentang pencabutan Perppu No.4 Tahun 2009 tentang JPSK diterima pimpinan DPR beberapa hari yang lalu. “Esensi dari surat Presiden tersebut intinya Presiden mengembalikan kembali surat berisi RUU pencabutan Perppu

tentang JPSK yang beberapa waktu lalu dikembalikan kepada Presiden,” ungkap Wakil Ketua DPR Priyo Budi Santoso dalam jumpa pers di Gedung DPR, Senayan, Jakarta, Selasa (27/4). Menurut Priyo, surat tersebut dikembalikan persis surat serupa yang sebelumnya dikembalikan DPR 7 Januari 2010. Dalam surat tersebut, Priyo menjelaskan, masih ada kesalahan tanggal penolakkan Perppu JPSK yang seharusnya tanggal 18 Desember 2008 ditulis 30 September 2009. Surat tersebut berisi rencana memberi imunitas hukum kepada pejabat keuangan. “Selisihnya berbeda setahun. Isinya pejabat sektor keuangan akan kebal hukum be-

HP Targetkan Pangsa Pasar Meningkat MEDAN (Waspada) : PT Hewlett-Packard Indonesia (HP) menargetkan market share nya meningkat lima persen dibanding 2009 yang mencapai 43 persen dari pangsa pasar tinta di Indonesia. Market Development Manager HP Indonesia Adrian Lesmono di Medan, Selasa (27/ 4) menyatakan setiap tahunnya telah terjadi peningkatan di atas lima persen. Dimana pada 2008, HP merebut pasar mencapai 35 persen, dan 2009 meningkat menjadi 43 persen. “Artinya dari 2008 ke 2009 meningkat delapan persen, dan untuk tahun 2010 dalam hal ini kita tidak akan muluk-muluk mencapai sepuluh persen, namun hanya lima persen mengingat persaingan atau competitor tidak hanya dari produsen ternama melainkan bajakan, atau refill cukup tinggi,” ujarnya. Untuk mencapai hal tersebut, lanjutnya, HP akan melakukan investasi sebesar 10 juta dolar AS untuk edukasi terhadap enam negara seperti Indo-

nesia, Thailand, Filipina, Korea, India, dan China yang bertujuan membantu para pelanggan di kawasan Asia Fasifik memutuskan pilihan terhadap pembelian tinta. “Kampanye dengan model edukasi ini didasari hasil studi yang dilakukan di enam negara tersebut yang membuktikan kartrid tinta HP Original mampu menghasilkan page yield yang lebih tinggi atau dua kali lebih banyak dibanding dengan kartrid isi ulang,” ujarnya. Selain itu, lanjutnya, hasil studi juga menunjukkan tingkat kegagalan yang tinggi pada kartrid tinta isi ulang yang diuji. Artinya, terbukti menjadikan biaya maupun waktu yang dikeluarkan konsumen menjadi lebih boros. “Persaingan di pasar sebenarnya membawa dampak positif terhadap perkembangan produk tinta hal itu dikarenakan produsen akan berlombalomba memproduksi yang terbaik dengan keunggulankeunggulannya,” lanjutnya. (m38)

gitu disahkan DPR,” jelas Priyo. Untuk menindaklanjuti surat Presiden tersebut, Priyo segera menggelar rapat pimpinan DPR dengan pimpinan fraksi DPR. “Karena esensi kami mengadakan rapim mendadak, dan rapim memutuskan untuk minggu ini, mudah-mudahan hari Kamis bisa dilaksanakan rapat konsultasi dengan pim-

pinan fraksi. Pimpinan dewan dengan pimpinan fraksi akan memberikan solusi,” tutupnya. Wacana mengenai imunitas hukum bagi pejabat di sektor keuangan sudah lama berkembang. Tujuannya adalah agar pejabat tersebut berani mengambil keputusan, dan dijamin tidak akan diusut secara hukum seperti kasus-kasus yang sbelumnya terjadi.(dtc)

Stok Beras Bulog Sumut Melimpah Hingga Lima Bulan MEDAN (Waspada): Stok beras Perum Badan Urusan Logistik Divre Sumut melimpah. Jumlah cadangan yang tersimpan di gudang penimbunan dapat menjaga ketahanan pangan hingga lima bulan ke depan. Kepala Humas Perum Bulog Divre Sumut Rusli Siregar menjelaskan, stok beras Bulog Sumut hingga pendataan pertengahan April cukup banyak mencapai 58.374 ton,’’ jumlah ini dapat menjaga ketahanan pangan hingga lima bulan ke depan.’’ Menurut Rusli, Selasa (27/ 4), stok beras sebanyak itu merupakan cadangan beras pemerintah (CBP) yang akan dipergunakan untuk berbagai keperluan sesuai dengan program nasional diantaranya pembagian beras untuk program pengetasan kemiskinan (raskin) dan untuk cadangan pangan apabila terjadi kelangkaan beras dan musibah bencana. Untuk pembagian jatah beras bagi keluarga miskin, seluruh jajaran Bulog di seluruh kabupaten dan kota telah menyalurkannya sebanyak 27.603 ton dari realisasi selama tahun 2010 berjumlah 50.3010 ton, sehingga program beras raskin itu telah terlaksana hingga 54 persen lebih, jelasnya. Walau stok melimpah pemerintah melalui Bulog pusat masih terus membagikan beras

dari daerah lain yang surplus beras ke Sumut. Berdasarkan data yang diperoleh di PT Pelabuhan Indonesia I (Persero), Senin (26/4), selama April ini saja jumlah beras yang masuk ke Sumut melalui Pelabuhan Belawan mencapai 11.174 ton. Beras ini diangkut dari Jawa Timur melalui dua kapal. Melimpahnya stok beras ke Bulog Divre Sumut ini seiring dengan mulai lancarnya pengadaan beras secara nasional yang telah mencapai 25.000 per hari, sehingga jumlah yang telah terealisasi menjadi 546.786 ton. Direktur Pelayanan Publik Perum Bulog Sutono mengakui walau telah lancar namun jumlah realisasinya masih kecil hanya 17 persen dari target nasional 3,2 juta ton, sedangkan target pengadaan beras Bulog selama bulan ini sebanyak 701.242 ton dan baru tercapai 350.158 ton. Mengenai pembagian raskin, Bulog ke depan akan memperbaiki kinerja terutama soal kualitas raskin. Jumlah raskin yang akan dibagikan ke seluruh tanah air pada 2010 sebanyak 2,7 juta ton dan telah terealisasi secara nasional 821.242 ton. Sementara itu, pasaran beras konsumsi masyarakat di beberapa pasar di Sumatera Utara hingga saat ini dalam kondisi normal, harga beras kualitas medium Rp5.950 per kg (m35)

Antara

LAYANAN GADAI EMAS

Seorang petugas melakukan taksir emas di layanan gadai emas Bank CIMB Niaga Melawai, Jakarta, Selasa (27/4). Layanan gadai emas prioritas CIMB Niaga menawarkan fasilitas mmperoleh dana tunai dengan menjaminkan emas perhiasan dan batangan.

Bunga Bank Haram, Nasabah Rame-rame Pindah Ke Syariah JAKARTA (Waspada): Fatwa haram bunga bank yang ditetapkan Ormas Islam PP Muhammadiyah beberapa waktu lalu memberikan keuntungan besar bagi perbankan syariah. Sejumlah nasabah bank konvensional pun memilih pindah ke bank syariah. Direktur Bisnis Bank Syariah Bukopin Eriandi mengatakan, sejak keluarnya fatwa haram tersebut banyak nasabah bank Bukopin konvensional yang p i n d a h k e Ba n k Sy a r i a h Bukopin. “Banyak nasabah yang pindah ke syariah dari kovensional. Yang pasti ada dampak akibat fatwa bunga haram,” kata Eriandi, dalam diskusi Perbankan Syariah, di FX Plaza, Jalan Sudirman, Jakarta, Selasa (27/ 04). Eriandi mengatakan, di cabang Padang banyak nasabah yang beramai-ramai berpindah ke bank Syariah sejak keluarnya fatwa haram bunga bank tersebut. “Pengalaman spiritualnya ada. Nasabah itu bilang katanya lebih tenang dibandingkan di konvensional. Bisnisnya juga justru berkembang setelah pindah ke syariah,” katanya. Dilihat dari pertumbuhannya, aset bank Syariah Bukopin

juga melonjak hampir Rp2 triliun pada 2009 dibandingkan tahun 2008 yang hanya Rp606 miliar. Selaras dengan kecenderungan global, industri keuangan syariah di Indonesia juga mengalami perkembangan yang signifikan. Setelah berdirinya bank syariah pertama pada tahun 1992 lalu, kini pertumbuhan jaringannya terbilang luar biasa. Hingga pertengahan tahun 2009, terdapat lima Bank Umum Syariah, 25 Unit Usaha Syariah dari bank konvensional, 133 Bank Perkreditan Rakyat Syariah (BPRS), 1107 jaringan kantor, dan 1679 kantor layanan unit syariah. Dalam lima tahun terakhir, pertumbuhan aset perbankan syariah rata-rata mencapai 60 persen tiap tahunnya. Dalam kesempatan yang sama, Ketua Umum Asosiasi Bank-Bank Syariah Indonesia (Asbisindo) A Riawan Amin mengatakan walaupun saat ini modal perbankan syariah masih sangat jauh jika dibandingkan dengan konvensional namun jika terus ada dukungan diharapkan bisa terus tumbuh. “Seperti fatwa bunga bank yang diharamkan, sehingga memperkuat persepsi riba di

bank konvensional. Modal seluruh perbankan syariah Rp2,5 triliun dimana jauh sekali dibandingkan dengan konvensional yang mencapai Rp250 triliun akan terus tumbuh dengan adanya penambahan DPK bank syariah,” papar Riawan. Seperti diketahui, Muhammadiyah baru saja secara resmi mengeluarkan fatwa haram bunga bank pada Sabtu 3 April 2010. Fatwa haram terhadap bunga bank tersebut sebenarnya sudah diputuskan pada Musyawaran Nasional Muhammadiyah pada tahun 2006 lalu. Sementara Majelis Ulama Indonesia (MUI) telah mengeluarkan hukum haram bunga bank pada 2003. Asosiasi Bank-Bank Syariah Nasional (Asbisindo) memang berpendapat ketertarikan masyarakat terhadap bank-bank syariah masih minim. Ini diakibatkan oleh sumber daya manusia di industri perbankan syariah yang belum mumpuni serta ketidakseriusan Bank Indonesia (BI) mengembangkan industri syariah di Indonesia. “Masyarakat cenderung masih belum percaya terhadap bank syariah di Indonesia. Apakah memang menggunakan prinsip syariah atau tidak,

karena jika dilihat sumber daya manusianya di level pimpinan masih banyak masalah,” ujar Riawan. Dia mencontohkan, di level pimpinan di bank-bank syariah masih ada perilaku yang tidak pas dalam tatanan syariah. “Cara berperilaku, dan janganjangan hanya bisa bicara halal atau haram saja. Kita masih melihat perilaku konvensionalnya masih terbawa,” ungkapnya. Apalagi, lanjut Riawan, regulator-pun turut mensuburkan gaya konvensional tersebut. Riawan juga menyesalkan sikap ketidakseriusan BI. “Bank syariah hanya diberikan Direktorat kecil untuk mengurusi yakni Direktorat Perbankan Syariah. Kalau serius seharusnya jangan dikasih direktorat kecil, apalagi jika direktorat tersebut tidak memahami giroh syariah,” jelasnya. Dikatakan Riawan, minimal bank syariah seharusnya diurusi oleh Deputi Gubernur Senior. “Kalau direktorat perbankan syariah tidak cukup lingkupnya terlalu kecil. Seharusnya direktorat tersebut tidak diperlukan, yang diperlukan adalah insan-insan syariah di dalam sumber daya manusia Bank Indonesia,” katanya.(dtc)

Realisasi Ekspor Kakao Hanya 5 Persen MEDAN (Waspada) : Pasca diberlakukannya bea keluar (BK) terhadap komoditi kakao efektif di April dan berujung pada penundaan, realisasi ekspor komoditi itu secara nasional turun tajam. Sekjen DPP Asosiasi Kakao Indonesia (Askindo) Zulhefi Sikumbang, Selasa (27/4), menyatakan anjloknya volume ekspor tergambar dar pencapaian pengiriman hanya terealisasi lima persen dari total April tahun sebelumnya. “Yang jelas, ekspor kakao pada April sangat turun. Malah bisa dibilang tak ada sama sekali. April ini, 95 eprsen tak ada ekspor, hanya lima persen realisasi,” ujarnya via telefon selular dari Jakarta. Penurunan volume ekspor, dinilainya, akibat eksportir menahan stok kakao di gudang pasca rencana pemberlakuan bea keluar yang akan diterapkan pemerintah. Sehingga, volume ekspor yang sebelumnya mencapai 40 ribu per ton drastis turun. “Untuk saat ini, eksportir hanya memenuhi kontrakkontrak yang sebelumnya telah disepakati namun belum ada untuk menambah mengingat pemerintah terkesan mendadak memberlakukan aturan tersebut,” ujarnya. Jika penambahan nanti dilakukan oleh eksportir melalui pengapalan, lanjutnya, dikhawatirkan perkiraan merugi yang harus ditanggung pengusaha semakin besar seandainya bea keluar diterapkan.

“Kebijakan pemerintah sepertinya tidak memihak terhadap industri kakao nasional baik hulu maupun hilir atau petani. Wajar sikap protes yang dilakukan oleh petani maupun pengusaha menahan bahan baku tersebut karena dampak atas pemberlakuan bea keluar tersebut menekan harga di tingkat petani,” lanjutnya. Dalam hal ini, lanjut Zulhefi, Askindo sendiri merasa keberatan dengan diterapkan bea keluar tersebut selain dibuat dengan dadakan, juga tidak melibatkan petani maupun pengusaha. Padahal, akibat dari kebijakan tersebut dirasakan oleh pengusaha dan petani. “Alhasil, jangka panjang dari dampak tersebut berakibat petani berpikir untuk beralih ke tanaman lain karena dianggap sudah tidak lagi menguntungkan bagi peningkatan perekonomian keluarga,” ujarnya kembali. Sekjen DPP Asosiasi Kakao Indonesia beranggapan seandainya nanti terjadi penundaan BK, namun kondisi ini tetap meresahkan bagi pemain di industri ini. Dan dikhawatirkan target ekspor 2010 yang mencapai 300 ribu ton, seperti tahun sebelumnya lalu, dikhawatirkan tak tercapai. “Begitu juga dengan target produksi yang diharapkan bisa naik lima persen menjadi 575 ribu ton, dari total tahun lalu yakni 550 ribu ton pun terancam tak terkejar. Sementara di petani meski harga relatif naik yakni Rp20 ribu per kilo, tapi posisi ini

jauh turun sebelum rencana BK yang bisa terjual Rp25 ribu per kg,” ungkap dia. Kasubdis Bina Perdagangan Luar Negeri Dinas Perindustrian dan Perdagangan Sumatera Utara Muzanni Lubis mengatakan ekspor kakao Sumut pada kuartal I tahun 2010 malah naik dibandingkan 2009 pada periode sama. “Bisa jadi peningkatan itu disebabkan eksportir mengejar pengiriman sebelum rencana BK pada April diberlakukan.

PTPN III Salurkan Dana Kemitraan Rp2,9 M MEDAN (Waspada): PTPN III melalui bagian Kemitraan dan Bina Lingkungan (KBL) kembali melakukan pelatihan atau training khusus kepada para penerima dana pinjaman bergulir sebanyak 109 orang di Wisma Pamitran, Sei Karang, Deli Serdang. Mereka merupakan angkatan XXII triwulan I tahun 2010 ini melakukan akad kredit pada 15 April 2010, sementara pelatihan berlangsung tiga hari sejak 16-17 April. Kabag KBL PTPN III Mailanta Bangun menyebutkan penyaluran dana pinjaman bergulir kali ini diserahkan sebesar Rp2.973.500.000 kepada para calon mitra binaan baru maupun yang lanjutan untuk wilayah Pemko Medan, Serdang Bedagai, Simalungun, Batubara, Asahan, Labuhanbatu Utara, Tapanuli Selatan dan Tapanuli

Harga Emas Di Medan Jenis

Kadar 99%

Rp328.000

London

97%

Rp320.000

24 Karat

90 s/d 93%

Rp280.000

Emas Putih

75 %

Rp260.000

22 Karat

70%

Rp230.500

Suasa

20 s/d 35%

Rp170.000

Tengah. Menurutnya sampai dengan saat ini dana kemitraan yang telah disalurkan Rp72.252.819.238 kepada 3.032 pengusaha UKM. Kaur Perencanaan dan Pembinaan di Bagian KBL PTPN III Nokman Sarip menegaskan kepada para penerima dana bantuan bergulir ini agar memanfaatkan pelatihan ini semaksimal mungkin dan membayar cicilan tepat waktu. Koko Wahyu Utama, salah seorang pengusaha industri pembuatan pupuk kompos yang menerima bantuan mengungkapkan terima kasihnya kepada PTPN III atas kepeduliannya membantu pinjaman dana bergulir untuk industri UKM. “Semoga dengan adanya bantuan ini, kami para pengusaha UKM semakin kuat dan usaha kami maju,” katanya. (m05)

Valuta Asing Di Medan

Harga

London Murni

Tapi setelah April ini, kita belum tau gimana ekspor kita, masih harus menunggu data dulu,” jelas Muzanni tanpa menyebut volume ekspor tersebut. Dikatakannya, Sumut tergolong sedikit mengekspor kakao, mengingat daerah ini bukan sentra produksi komoditi itu. Dengan lima perusahaan ekspor kakao, salah satu diantaranya Cacao Ventura, daerah penghasil kakao Sumut berada di Asahan, Simalungun dan Langkat. (m38)

(m40)

Mata Uang

Jual

Beli

Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

9.080 8.439 8.615 14.034 1.173 98,34 6.544 12.384 2.805

8.930 8.265 8.450 13.750 1.152 95,86 6.413 12.152 2.780

Waspada, Sealasa 28 April 2010  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you