Issuu on Google+

Prakiraan Cuaca Selasa (25/5) Medan 25-34 C

Berastagi 17-28 C

R. Prapat 25-34 C

Parapat 18-29 0C

P. Siantar 20-300C

Sibolga 23-33 0C

0

0

Berawan

0

Hujan guntur

BMKG Polonia

WASPADA Demi Kebenaran Dan Keadilan

http://epaper.waspadamedan.com

SELASA, Pon, 25 Mei 2010/11 Jumadil Akhir 1431 H

No: 23159 Tahun Ke-64

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 (A1-8, B1-8, C1-8) Halaman

Harga Eceran: Rp2.500,-

Polri Masih Pilkada Medan Buru Adelin Lis Mundur 19 Juni MEDAN (Waspada): Komisi Pemilihan Umum (KPU) Kota Medan kembali mengubah jadwal pemilihan calon walikota dan wakil walikota Medan periode 2010-2015 putaran kedua menjadi 19 Juni 2010.

MEDAN (Waspada): Adelin Lis, mafia pembalak hutan Mandailing Natal (Madina), Sumatera Utara, masih terus diburu Mabes Polri bekerjasama dengan interpol. Perburuan dilakukan karena bos PT Keang Nam Development Indonesia (KNDI) dan PT Inanta Timber itu, tidak hanya melakukan kejahatan kehutanan, tapi juga diduga melakukan pencucian uang (money laundering). Wakil Kepala Polisi Daerah Sumut, Brigadir Jenderal Polisi Syafruddin, di Kantor Gubernur Sumut, Senin (24/5) mengaku, dugaan kasus money laundering Adelin Lis hingga kini masih dikembangkan penyidikannya. “Memang belum ada temuannya, tapi ada dugaannya. Karena itu, kita masih terus mengembangkan penyelidikannya,” ucap Syafruddin.

Sebelumnya, KPU menetapkan 16 Juni, namun pada hari tersebut bersamaan dengan penerimaan Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) di USU dan Unimed, sehingga jadwal pilkada dimajukan menjadi 15 Juni. “Awalnya kita telah tetapkan jadwal Pilkada putaran kedua pada 16 Juni, namun berhalangan dengan adanya SNMPTN. Dan kita majukan menjadi 15 Juni, tapi tidak bisa juga karena adanya gugatan pasangan Arif Nasution-Supratikno ke Mahkamah Konstitusi (MK) yang putusannya

Jenderal berbintang satu ini membeberkan, kasus money laundering di Sumut, rata-rata didominasi kasus perbankan dengan jumlah empat kasus. Di antaranya, kasus penggelapan uang yang dilakukan KS yang laporan polisinya dibuat tanggal 21 Februari 2010, dengan jumlah tersangka 14 orang.

Lanjut ke hal A2 kol. 1

Jaksa Tetap Ingin Alter Disidang Di PN Jaksel Dakwaan yang kami bacakan sudah memenuhi syarat dan praktek peradilan hukum di Indonesia,” kata JPU, Sutikno, saat menjawab eksepsi kuasa hukum Alter di PN Jakarta Selatan, Jalan Ampera Raya, Jakarta, Senin (24/5).

Lanjut ke hal A2 kol. 1

Antara

TERDAKWA Alter Hofman (kanan) bersama isteri dan kerabatnya usai sidang di PN Jakarta Selatan, Senin (24/5).

Anas Selangkah Lagi Calonkan Diri Jadi Presiden JAKARTA (Waspada): Pengamat politik Lembaga Ilmu Pengetahuan Indonesia (LIPI) Syamsuddin Haris menilai Anas Urbaningrum laik menduduki posisi sebagai Ketua Umum Partai Demokrat periode 2010-2015. Anas tinggal selangkah lagi menuju pencalonan presiden. “Saya menduga nanti Anas akan menjadi calon presiden termuda. Setelah menjadi Ketum PD, dia memiliki peluang untuk menjadi calon presiden, karena SBY tidak mungkin maju lagi,” kata Syamsuddin kepada

detikcom, Senin (24/5). Dengan terpilih menjadi Ketum PD, Syamsuddin menilai Anas mampu membawa partainya lebih maju meski sosoknya terbilang masih muda dibanding pesaingnya. “Dia memang masih 40-an, tapi mesti diberi kepercayaan. Sehingga ada regenerasi kepemimpinan,” paparnya. Lebih jauh Syamsuddin menjelaskan, kemenangan Anas pada putaran II menunjukkan tidak adanya intervensi

inilah.com

SEJUMLAH kerabat melakukan pengajian di rumah duka Ibu Hasri Ainun Habibie istri mantan Presiden RI ke 3 B.J. Habibie di Jl Patra Jasa Kuningan 13, Jakarta Selatan. Para kerabat dan tetangga pun terus berdatangan ke rumah duka untuk mengucapkan belasungkawa.

Pesan Ainun Untuk Bank Mata JAKARTA (Waspada): Mantan ibu negara Hasri Gubernur DKI Fauzi Bowo, Presiden Susilo Bambang Ainun Habibie punya empat pesan terakhir untuk Yudhoyono dan Wakil Presiden Boediono. Tahlilan Bank Mata Indonesia yang dipimpinnya. Pertama, Karyawan PT Dirgantara Indonesia (PTDI) “Bersahabatlah dengan mata,” kenang Sekretaris Jenderal Bank Mata Indonesia, Untung Widodo, di menggelar tahlilan untuk mendoakan almarhumah Hasri Ainun Habibie. Almarhumah dikenal sebagai rumah duka, Patra Kuningan, Jakarta Selatan. Selain itu, Ainun juga berpesan agar klinik Bank sosok yang memberikan perhatian kepada karyawan. “Kami melaksanakan tahlilan selama lima hari Mata di Bogor Jawa Barat terus berjalan. “Beliau juga ingin donor mata menjadi bagian dari budaya,” kata setelah salat Zuhur,” kata Kepala Humas PT DI, dia, Senin (24/5). Untung juga menjelaskan, cita- Rakhendi Priatna. “Tadi siang tahlilan diikuti oleh cita Ainun lainnya adalah memperbanyak kornea 800 karyawan dan diikuti oleh Dirut PT DI Budi Santoso. Ini untuk penghormatan kami kepada Ibu di Bank Mata Indonesia. Untung bercerita, Ainun terakhir berkunjung Ainun,” ujarnya dihubungi wartawan melalui ke Bank Mata seminggu sebelum Ainun bertolak telefon, Senin (24/5). Selain tahlilan, sekitar 192 orang perwakilan ke Jerman. Lantas apakah Ainun juga merupakan salah satu calon pendonor? “Saya belum lihat karyawan akan diutus ke Jakarta untuk menghadiri administrasi, tetapi Beliau pernah bicara kalau Beliau pemakaman almarhumah Ainun Habibie. Mereka akan berangkat dengan menggunakan empat bus adalah seorang calon donor mata,” ujarnya. Hasri Ainun Habibie meninggal di Jerman dan beberapa mobil untuk ke Jakarta. Menurutnya almarhumah merupakan sosok minggu kemarin pukul 17:30 waktu setempat atau sekitar pukul 22.30 WIB. Sebelumnya Ainun sempat yang memberikan perhatian kepada karyawan PTDI yang berjumlah 15.700 orang. Ibu Ainun mempermenjalani 12 kali operasi di Jerman. hatikan kesejahSampai saat ini teraan para karyadi rumah duka mawan dari hal kecil sih tampak lehingga hal besar. ngang hanya keIa mencontohlompok pengajian kan Ibu Ainun beryang silih berganti sama Dharma Wadatang. Terlihat nita yang dipimpuluhan karangan pinnya selalu mebunga memenuhi JAKARTA (Antara): Jenazah Hasri Ainun Habibie, istri nyiapkan makan rumah duka, mesmantan presiden BJ Habibie, akan dimakamkan di Taman siang kepada seluki ada permintaan Makam Pahlawan (TMP) Kalibata, Jakarta Selatan, Selasa dari Habibie untuk ruh karyawan. Se(25/5) sekitar pukul 11:00. lain itu, almarhumenyumbangkan Asisten pribadi BJ Habibie, Rubijanto, di Jakarta Senin mah juga memuang duka ke yamenjelaskan bahwa jenazah Ainun Habibie dijadwalkan perjuangkan ruyasan. tiba di Jakarta Selasa sekitar pukul 05:00, bersama dengan mah untuk para Te r l i h a t k a keluarga yang mendampingi yakni sang suami, BJ. Habibie karyawan PTDI. rangan buka dari dan kedua putranya. “Dari soal gizi hingmantan Wakil PreJenazah akan langsung dibawa ke rumah duka di Jl. ga memperjuangsiden Jusuf Kalla, Patra Kuningan XIII dan dilanjutkan dengan upacara serah kan perumahan Mantan Kapolri terima dari negara yang diwakili oleh Menteri Sosial Salim untuk karyawan Sutanto, Menteri Segaf Al Jufri kepada keluarga yang diwakili oleh Sahari Luar Negeri Marty PTDI,” ujarnya. Basari. (Vivanews) Natalegawa, Lanjut ke hal A2 kol. 3

Hari Ini Jenazah Dimakamkan

Lanjut ke hal A2 kol. 1

Pengiriman TKI Ke Malaysia Capai 25.000 Orang Per Bulan Jumlah Tenaga Kerja Indonesia (TKI) yang dikirim ke Malaysia capai 25.000 orang per bulan. Jumlah itu mencapai angka 41,6 persen dari total pengiriman TKI ke berbagai negara yang berkisar 60.000/bulan. B1

Masyarakat Blokir Lagi Jalan Perintis Kemerdekaan

Ratusan PNS Aceh Singkil Mangkir Sedikitnya seratusan PNS di jajaran Pemkab Aceh Singkil tidak melaksanakan tugas alias mangkir, demikian Kepala Badan Kepegawaian Pendidikan dan Pelatihan Kab. Aceh Singkil H Mukmin Saraan, SH, MA. C5

JAKARTA (Antara): Amir Abdillah, terdakwa yang dituduh sebagai kurir teroris Noordin M Top, dituntut 10 tahun penjara karena dianggap menyembunyikan informasi rencana peledakan bom di Hotel JW Marriot dan Noordin M Top. “Terdakwa terbukti secara sah dan meyakinkan bersalah. Menjatuhkan pidana 10 tahun penjara,” kata Jaksa Penuntut Umum, Kiki Ahmad Yani, di

SALAH satu contoh lukisan karya Matisse bernilai ratusan juta dolar.

Lukisan Dicuri, Prancis Minta Bantuan Interpol MARSEILLE (Antara): Prancis meminta bantuan Interpol dalam melacak lima lukisan dengan nilai 100 juta (125 juta dolar AS) yang dicuri dari satu museum Paris, sehingga menimbulkan dugaan karya seni itu sudah keluar dari negeri tersebut. Interpol akhir pekan lalu menyatakan lembaga itu sudah memberi tahu 188 negara anggotanya mengenai pencurian besar tersebut dari Musee d‘Art Moderne di Paris dan menambahkan lukisan itu di dalam bank data karya seni yang dicuri. Lanjut ke hal A2 kol. 3

MEDAN (Waspada): Sejumlah tamu dan pengunjung Hotel Emerald Garden Jl. Putri Hijau Kec. Medan Barat, berhamburan ke luar dari hotel menyusul kebakaran kecil di ruang dapur hotel tersebut Senin (24/5) sekira pk 18:00. Namun, api berhasil dipadamkan oleh para karyawan hotel berlantai IX itu, sementara empat mobil pemadam kebakaran Pemko Medan tidak sempat menyemprotkan air. Informasi yang dihimpun di lokasi kejadian menyebutkan, peristiwa tersebut terjadi sekira pukul 18:00. Tanpa diketahui penyebabnya, tiba-tiba dapur di ruangan Meranti Coffee Shop mengeluarkan asap dari cerobong yang berada di atas dapur. Sontak saja, pengunjung yang berada di Meranti Coffee Shop dan pengunjung lainnya berhamburan keluar gedung.

Lanjut ke hal A2 kol. 6

Pengadilan Negeri (PN) Jakarta Selatan, Senin(24/5). Terdakwa diancam dengan pasal kumulatif, yakni, Pasal 15 jo Pasal 6 UU No. 15 tahun 2003 tentang Penetapan Peraturan Pemerintah Pengganti Undang-Undang (Perppu) UU Nomor 1 tahun 2002 tentang Pemberantasan Tindak Pidana Terorisme.

Lanjut ke hal A2 kol. 3

Antara

TERDAKWA kasus terorisme, Amir Abdillah saat menanti sidang tuntutan di Pengadilan Negeri Jakarta Selatan, Senin (24/5).

Saat Incumbent Paparkan Visi Misi

Empat Fraksi DPRD Pematangsiantar WO P. SIANTAR (Waspada): Rapat paripurna istimewa DPRD Kota Pematangsiantar, Senin (23/5) sempat geger, ketika empat fraksi dari lima fraksi DPRD meninggalkan ruang sidang atau walk out (WO) saat calon walikota incumbent dan pasangannya memaparkan visi dan misi mereka. Rapat paripurna istimewa dipimpin Ketua DPRD Marulitua Hutapea didampingi Wakil Ketua Timbul Lingga dan Zainal Purba, dibantu Sek-

Hotel Emerald Garden Nyaris Terbakar

BACA DI HALAMAN DALAM

Masyarakat Kecamatan Kebunlada dan Cengkeh Turi Kecamatan Binjai Utara kembali memblokir Jl. Perintis Kemerdekaan. C1

Lanjut ke hal A2 kol. 6

Kurir Teroris Dituntut 10 Tahun Penjara

Kasus Pemalsuan Identitas

JAKARTA (Waspada): Jaksa Penuntut Umum (JPU) keberatan atas eksepsi terdakwa kasus dugaan pemalsuan identitas Alter Hofman, 32. JPU menilai eksepsi Alter tidak beralasan dan tetap ingin sidang digelar di Pengadilan Negeri (PN) Jakarta Selatan. “Tidak ada alasan dakwaan batal demi hukum.

pada 11 Juni. Makanya kita mundurkan menjadi 19 Juni,” kata anggota KPU Kota Medan Divisi Hukum dan Humas Pandapotan Tamba kepada Waspada seusai melakukan pertemuan dengan kedua pasangan calon walikota dan wakil walikota Medan yang lolos putaran kedua: RahudmanEldin dan Sofyan Tan-Nelly Armayanti di Garuda Plaza Hotel Medan, Senin (24/5). Menurut Tamba, penetapan Pilkada pada 19 Juni sudah kesepakatan antara kedua

retaris DPRD JDW Tampubolon, dihadiri 27 anggota DPRD di ruang sidang guna mendengar visi dan misi 10 pasangan calon walikota dan wakil walikota 2010-2015. Sepuluh pasangan yang menyampaikan visi misinya, Mahrum Sipayung/H Evra Sassky Damanik, RE Siahaan/ H Burhan Saragih, Poltak Sinaga/Jalel Saragih, Herowhin TF Sinaga/Hj Frida Riani Damanik.

Lanjut ke hal A2 kol. 3

Waspadai Sungai Meluap Tiba-tiba

AP

DALAI Lama mengatakan, pejabat China, menganggapnya sebagai setan

Dalai Lama Tuding China Soal Sensor Dan Propaganda DALAI LAMA mencaci-maki pemerintah China atas penyensoran dan propaganda yang dilakukannya terhadap dirinya. Caci-maki itu diungkapkannya dalam satu ceramah di Hunter College Minggu (23/5) pagi. “Keterbukaan dan kebebasan berbicara adalah penting,” kata Dalai Lama, pemimpin spiritual kira-kira 20 juta umat Buddha Tibet, di depan pertemuan 230 mahasiswa China dan Tibet. “Di bawah ketakutan, dengan polisi yang terus menerus memperhatikan, bagaimana kerukunan dapat berkembang? Kerukunan dengan senjata — tak mungkin.” Lanjut ke hal A2 kol. 3

MEDAN (Waspada): Cuaca ekstrem saat ini masih melanda kawasan Medan dan sekitarnya ditandai dengan angin kencang dan hujan secara sporadis yang bisa berakibat sungai-sungai di kawasan Pantai Timur Sumut seperti Deliserdang, Langkat dan Medan bakal meluap tiba-tiba. “Masyarakat tidak boleh lengah. Kondisi udara saat ini belum bersahabat,” kata Kepala Data dan Informasi Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I

Lanjut ke hal A2 kol. 6

erampang Seramp ang - Dalai Lama dukung Rahudman - He...he...he...


WASPADA Demi Kebenaran Dan Keadilan

Banda Aceh: Cuaca : Berawan-Berawan dan berpeluang hujan lokal Angin : Timur laut s/d Tenggara Kec. 10 s/d 30 km/jam

Provinsi NAD: Lereng Timur Pegunungan, Dataran Tinggi, Pesisir Timur, Pantai Barat: Berawan dan hujan ringan

Temperatur Maks/Min: 230C - 350C BMKG Polonia

SELASA, Pon, 25 Mei 2010/11 Jumadil Akhir 1431 H

http://epaper.waspadamedan.com

No: 23159 Tahun Ke-64

Edisi Aceh

Terbit 24 Halaman (A1-8, B1-8, C1-8)

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Harga Eceran: Rp 2.500,- (belum termasuk ongkos kirim)

Penutupan Tambang Preseden Buruk Pemerintah Aceh-DPRA Bentuk Tim Terpadu

Kadisdik Aceh Selatan Tersangka Korupsi

BANDA ACEH (Waspada): Gubernur Aceh Irwandi Yusuf menegaskan, upaya berbagai pihak yang mendorong ditutupnya perusahaan tambang biji besi di Aceh Besar dapat menjadi preseden buruk bagi iklim investasi di provinsi ini.

TAPAKTUAN (Waspada): Setelah mantan kepala Dinas Pendidikan Aceh Barat Daya Drs.N menjadi terdakwa kasus korupsi pengadaan buku beberapa waktu lalu, kini giliran Kadisdik Aceh Selatan Drs.HZ ditetapkan jadi tersangka kasus korupsi pengadaan komputer. Penetapan tersangka itu dikemukakan Kepala Kejaksaan Negeri Tapaktuan, Husni Thamrin,SH kepada wartawan di ruang kerjanya di Tapaktuan, Senin (24/5). Selain Kadisdik, seorang rekanan lainnya yaitu Direktur CV Bishop Com, TSH, juga ditetapkan sebagai tersangka dalam kasus pengadaan alat penunjang pembelajaran siswa tersebut. Didampingi Kasie Intel Mukhlis, SH, Husni Thamrin menyebutkan akibat perbuatan korupsi yang dilakukan kedua tersengka, menyebabkan kerugian negara diperkirakan mencapai Rp 130 juta hingga Rp 534 juta. Jumlah itu diketahui dari rentetan kasus pengadaan komputer senilai Rp 1.747.113.500,-. Proyek itu bersumber dari dana Otsus tahun 2009, dengan DPA, SKPA Nomor:

“Kalau kita terus mendorong agar perusahaan tambang tutup, maka saya mengkhawatirkan bisa menjadi preseden buruk bagi investasi Aceh di masa mendatang,” kata gubernur di sela-sela pertemuan dengan anggota DPR Provinsi Aceh (DPRA), perusahaan tambang bijih besi PT Lhoong Setya Mining (LSM), dan sejumlah tokoh masyarakat Kecamatan Lhoong, Aceh Besar, Senin (24/5).

Lanjut ke hal A2 kol. 1

Irwandi menyatakan, upaya pemerintah untuk meningkatkan pendapatan daerah (PAD), terutama pascagas minyak dan gas (migas) adalah di sektor pertambangan, selain perikanan, perkebunan dan pertanian. “Jadi, bagaimana kita bisa mendapatkan dana membangun Aceh jika tidak adanya investasi lain terutama setelah habisnya Lanjut ke hal A2 kol. 3

Anggota Komplotan Tersangka Calo CPNSD Terus Diburu

Putra Aceh Diharapkan Isi Posisi Penting Kabinet Anas

BIREUEN (Waspada): Pasca penangkapan seorang ibu rumah tangga (IRT) yang diduga calo Calon Pegawai Negeri Sipil Daerah (CPNSD) yang paling dicari selama ini, jajaran Polres Bireuen terus memburu anggota atau konconya yang disebut-sebut ada sekitar dua orang lagi yang identitasnya telah dikantongi. Kabar terakhir yang diperoleh dari hasil penyelidikan, dua tersangka lainnya itu telah kabur ke Jakarta. Namun, pencariannya terus dilakukan hingga keduanya berhasil diciduk. Demikian Kapolres Bireuen Teuku Saladin SH melalui Kasatreskrim AKP Khairul Saleh SH SIK menjawab Waspada Senin (24/5) terkait perkembangan kasus calo CPNSD yang telah berhasil ditangkap seorang tersangka belum lama ini. “Kami sudah mencari kesejumlah lokasi yang dicurigai, namun pelaku kabarnya telah kabur ke Jakarta dua bulan lalu,” ujar Kasatreskrim Polres Bireuen itu. Sebagaimana diberitakan kemarin, seorang Ibu Rumah Tangga

BANDA ACEH (Waspada): Partai Demokrat Aceh mengharapkan terpilihnya Anas Urbaningrum dapat membawa perubahan besar di Aceh, terlebih sumbangsih Aceh dalam pemilu lalu juga merupakan harapan masyarakat Aceh. Karenanya Ketua DPW Partai Demokrat Aceh, Mawardi Nurdin yang dihubungi mengharapkan adanya kader-kader Partai Demokrat asal Aceh yang menduduki posisi penting di kepengurusan DPP Partai Demokrat yang kini dipimpin Anas Urbaningrum.

Lanjut ke hal A2 kol. 3

Polisi ‘Panen’ Kayu Ilegal 5,49 Meter Kubik Disita SIGLI (Waspada): Jajaran Reserse Kriminal (Reskrim) Polres Pidie berhasil menyita 5,49 meter kubik kayu hasil illegal logging di tiga lokasi terpisah di daerah tersebut. Minggu (23/5) dan Sabtu (22/5). Penangkapan pertama dilakukan di Jalan Dayah Bandar Baru, Pidie Jaya, Sabtu (22/5) sekira pukul 19:30 Wib. Tersangka dengan menggunakan truk mengangkut kayu olahan sebanyak 4,46 meter kubik, tanpa Faktur Untuk Angkut Kayu Olahan (Fako-red). Kayu tersebut diduga ditebang di Hutan Negara pegunungan Panton Limeng, Bandar Baru. Dalam penangkapan tersebut polisi selain menyita barang bukti berupa 4,46 meter kubik kayu juga menyita satu unit truk dan menetapkan seorang tersangka, yaitu Hamdani Bin Abdurrahman, 33 yang merupakan Kepala Desa Aki Neungoh, Kecamatan Bandar Baru, Pidie Jaya. “Tersangka bersama barang bukti telah kita amankan. Sekarang sedang dalam pemeriksaan” kata Kapolres Pidie AKBP Dumadi, SSTmk melalui Kasat Reskrim AKP. Erlin Tangjaya, Senin (24/5) di Lanjut ke hal A2 kol. 7

Antara

KONFERENSI KETAHANAN PANGAN: Presiden Susilo Bambang Yudhoyono (kanan) menyerahkan secara simbolis Peta Ketahanan dan Kerentanan Pangan kepada Gubernur Papua Barnabas Suebu (2 kiri), Gubernur Jawa Tengah Bibit Waluyo (kiri) dan sejumlah bupati lainnya dalam acara peresmian pembukaan Konferensi Dewan Ketahanan Pangan 2010 di Balai Sidang, Jakarta, Senin (24/5). Konferensi Dewan Ketahanan Pangan 2010 tersebut akan membahas strategi pengembangan ketahanan pangan nasional menuju kemandirian pangan.

Presiden: Sembilan Masalah Ketahanan Pangan

JAKARTA (Antara): Presiden Susilo BambangYudhoyono memaparkan sembilan masalah terkait ketahanan pangan yang dihadapi oleh Indonesia seiring dengan meningkatnya jumlah penduduk Indonesia menjadi 235-240 juta pascasensus penduduk 2010. Sembilan permasalahan itu dipaparkan oleh Presiden dihadapan para kepala daerah dari seluruh Indonesia yang mengikuti konferesi Dewan Ketahanan Pangan di JCC Jakarta, Senin (24/5). “Saya amati ada satu hal yang harus diperbaiki bersamasama yaitu (masalah) sinergi dan terintegrasinya sistem,” kata Presiden merujuk pada permasalahan pertama. Ia mengatakan, sinergi dan

sistem yang terintegrasi diperlukan untuk dapat mengelola keamanan makanan, energi dan air sehingga tidak menimbulkan

masalah di masa kini dan mendatang. Kepala Negara juga menyebut keterkaitan antara perta-

Waspada/Tarmizi Ripan

TANPA MASA BERLAKU: Copy sertifikat a/n SJ, SH, oknum ketua panitia tender Disdik yang mengikuti bantuan teknis /sertifikasi nasional ‘Pengadaan barang/jasa pemerintah’ tanpa masa berlaku. Berbeda dengan sertifikat yang dikeluarkan Lembaga Kebijakan Pengadaan barang/jasa Pemerintah (LKPP) yang menjelaskan masa berlaku.

nian, infrastruksi dan transportasi. Masalah kedua, lanjut Presiden, adalah upaya untuk meningkatkan sejumlah komoditas unggulan pertanian —beras, jagung, kedelai, gula dan daging sapi— menuju swasembada dan swasembada berkelanjutan. Isu ketiga dan keempat, kata dia, adalah sistem cadangan dan distribusi serta rantai pasokan dan logistik nasional yang efisien. Terkait isu ini Presiden menyoroti permasalahan mahalnya ongkos transportasi. Lalu isu kelima adalah masih ditemuinya kasus kekurangan produksi di sejumlah daerah. “Yang keenam adalah stabilitas harga,” katanya. Lanjut ke hal A2 kol. 1

“Kita harapkan ada putra Aceh menduduki posisi penting di DPP nanti,” kata Mawardi yang dihubungi, Senin (24/5) siang. Selain itu, kata Mawardi, keyakinannya bahwa akan banyak perubahan besar yang lebih baik bagi Aceh karena komunikasi dan komitmen Partai Demokrat Aceh yang sejak awal mundukung Anas sebagai Ketua Umum. “Aceh akan sangat mudah mengkomunikasikan tentang Lanjut ke hal A2 kol. 7

Presiden Pimpin Upacara Pemakaman Ainun Habibie JAKARTA (Antara): Presiden Susilo BambangYudhoyono dijadwalkan akan memimpin upacara kenegaraan pemakaman mantan ibu negara Ainun Habibie besok, Selasa (25/5) di Taman Makam Pahlawan Kalibata Jakarta. Juru bicara Kepresidenan Julian Aldrin Pasha saat dihubungi wartawan di Jakarta, Senin (24/5), mengatakan Presiden akan memimpin upacara pemakaman istri presiden RI ke-3 BJ Habibie tersebut. “Tiba di Jakarta dari Jerman pukul lima pagi kemudian disemayamkan di rumah duka. Kemudian pada pukul 11:00 WIB akan dimakamkan di Taman

Makam Pahlawan Kalibata, begitu rencananya,” kata Julian. Sementara Staf Khusus Presiden bidang luar negeri Dino Patti Djalal di Kantor Presiden Jakarta, Senin, mengatakan kegiatan Presiden sepanjang Selasa pagi hingga siang hari akan dikosongkan sehingga bisa memimpin upacara pemakaman Ainun Habibie. “Presiden akan memimpin sendiri pemakaman Ibu Ainun, tadi sempat dibahas dengan beberapa menteri dan staf khusus. Kegiatan beliau sepenuhnya dikosongkan,” kata Dino. Pada Selasa (25/5) malam, Lanjut ke hal A2 kol. 1

Kajari: ‘Ulang Tender Menyimpang Dari Keppres’

Waspada/Muhammad Riza

KAYU ELEGAL: Polisi sedang menghitung Barang Bukti (BB) Kayu hasil illegal logging di dalam truk yang berhasil di sita beberapa waktu lalu. Senin (24/5)

Baca Halaman Dalam Ratusan PNS Aceh Singkil Mangkir Sedikitnya seratusan PNS di jajaran Pemkab Aceh Singkil tidak melaksanakan tugas alias mangkir, demikian Kepala Badan Kepegawaian Pendidikan dan Pelatihan Kab. Aceh Singkil H. Mukmin Saraan SH.MA melalui Kepala Bidang Pembinaan dan Pengembangan Sumber daya Aparatur Muzakir SH kepada Waspada, Senin (24/5) di ruang kerjanya. Hal C4

SINGKIL (Waspada): Bila pelaksanaan tender pengadaan barang dan jasa pemerintah tidak sesuai dengan Keputusan presiden (Keppres) No. 80 Tahun 2003, pelaksanaan disarankan diulang kembali. Demikian ditegaskan Kepala Kejaksaan Negeri (Kajari) Singkil, Yuswadi, SH, MH kepada wartawan, Senin (24/5), di ruang kerjanya terkait pemberitaan tentang indikasi sertifikat ketua panitia tender Proyek Dinas Pendidikan (Disdik) Aceh Singkil tahun 2010 bersumber dari dana otonomi khusus (Otsus) berinisial SJ, SH yang diduga kadaluarsa. Kajari membenarkan, Kadis Pendidikan Aceh Singkil, Drs. Abdul Rakhman, MPd sebelumnya telah melakukan konsultasi terkait sertifikat ketua panitia lelang SJ, SH dalam pelaksanaan tender lingkup Dinas Pendidikan, yang telah mengumumkan perusahaan pemenang tender April 2010. “Kita telah sarankan pelaksanaan tender harus memenuhi syarat sesuai Keppres 80 tahun 2003 tentang pedoman pelaksanaan pengadaan barang/jasa pemerintah,” jelasnya. Lanjut ke hal A2 kol. 7

Kontes Kicauan Burung Di Bumi Gayo TAKENGON (Waspada): Sekitar seratusan burung berbagai jenis ikut bird kontes yang digelar di lapangan Gedung Olahraga Seni (GOS), Takengon, Aceh Tengah, Minggu (23/5) sore. Lanjut ke hal A2 kol. 3

Bahaya Sekulerisme, DDI Bekali Dai Aceh BANDA ACEH (Antara): Dewan Pimpinan Wilayah Da‘wah Indonesia (DDI) membekali para dai melalui workshop Training of Trainers (ToT) mengenai bahaya pemikiran sekularisme, pluralisme dan liberalisme di Provinsi Aceh. Ketua panitia H Abizal di Banda Aceh, Senin (24/ 5) mengatakan, kegiatan ini penting untuk memberi pemahaman yang komprehensif bagi para dai mengenai sejarah, program,

Waspada/Irwandi

Tim juri sedang serius mendengar kicauan burung.

Lanjut ke hal A2 kol. 1

Waspada/Abdul Mukthi Hasan

1 TEWAS, SATU KRITIS: Kecelakaan lalulintas di kawasan Desa Blang Bladeh, Jeumpa, Minggu (23/5) sekira pukul 22.00 WIB, selain merenggut jiwa Munidar, 17, pelajar asal Desa Kuta Meuligoe, juga menyebabkan Aminah Sulaiman, 55, penduduk Desa Cot Gadong, kritis dan Dasriadi, 15, mengalami luka parah.

Hari Ini Ustadz Jefri Al Bukhari Maulid Raya Di Sabang

8 Kampung Masih Gelap

SABANG (Waspada): Hari ini, Selasa (24/5), penceramah kondang dari Jakarta Ustadz Jefri Al Bukhari tampil pada acara perayaan peringatan Maulid Raya yang digelar Pemko Sabang di lapangan Yos Sudarso. Lanjut ke hal A2 kol. 1

REDELONG (Waspada): Delapan Kampung yang berada di Kecamatan Musidah, Kabupaten Bener Meriah yang dimekarkan dari Kecamatan Siah Utama sejak 5 Pebruari 2010, hingga kini masih tetap gelap gulita, Lanjut ke hal A2 kol. 3

Serampang - Hilangkan buruk rupa, eit buruk sangka Ustadz Jefri Al Bukhari.

Waspada/Ist

- He... he... he...


Berita Utama

A2 Presiden: Sembilan ... Presiden mengimbau para kepala daerah untuk rajin memantau harga sekalipun masa kampanye dan pemilu telah usai. Ia juga meminta adanya koordinasi antara peneliti dan kalangan industri sehingga permasalahan ketujuh yaitu penganekaragaman konsumsi pangan dapat dilaksanakan. Pada kesempatan itu Presiden juga meminta Dewan Ketahanan Pangan untuk memantau situasi pangan di seluruh Indonesia sebagai bagian dari peringatan dini apabila terjadi perubahan kondisi. “Dewan saya beri tugas untuk memantau situasi pangan,” kata Presiden merujuk pada permasalahan ke delapan. Sedangkan isu ke sembilan adalah mekanisme pasar pasokan pangan. Sesuai Peraturan Presiden No.83 tahun 2006 tentang Dewan Ketahanan Pangan (DKP) maka Dewan Ketahanan Pangan mengadakan rapat koordinasi dengaan Ketua Dewan Ketahanan Pangan Provinsi sekurang-kurangnya sekali dalam dua tahun. Konferensi itu forum tertinggi dalam tata kerja DKP sebagai mekanisme untuk mengevaluasi pelaksanaan kebijakan ketahanan pangan dan membahas permasalahan serta menetapkan langkah-langkah operasional bersama dalam membangun ketahanan pangan di seluruh Indonesia. Sejak dibentuk pada 2001, DKP telah melaksanakan konferensi sebanyak empat kali yaitu 2002,2004,2006 dan 2010.

Hari Ini Ustadz Jefri ... Panitia Pelaksana Maulid Raya, Muhammad Ikhsan mengatakan, Maulid Raya di samping kenduri maulid untuk masyarakat juga mengundang penceramah yang tak asing lagi dari Jakarta, Ustadz Jefri Al Bukhari dan hiburan yang diiringi Qasidah irama gambus yang tergabung dalam kelompok artis Lasqi Aceh. Menurut Ikhsan, acara kenduri maulid raya diperkirakan akan dihadiri sekitar 5.000 warga, dan pada malam hari di tempat yang sama digelar ceramah maulid. Acara ritual tahunan ini perlu dilaksanakan untuk meningkatkan syiar Islam dan mengambil hikmah dari peringatan Maulid Nabi Muhammad Saw. (b29)

Presiden Pimpin Upacara ... Presiden dan Ibu negara Ani Yudhoyono dijadwalkan bertolak menuju Oslo Norwegia untuk kunjungan kerja hingga 28 Mei mendatang. Hasri Ainun Habibie meninggal pada Sabtu (22/5) pukul 17.30 waktu Munich atau 22.30 WIB. Hasri Ainun Habibie lahir di Semarang pada 11 Agustus 1937 semasa hidupnya aktif di bidang sosial kemasyarakatan. Ia aktif di beberapa yayasan yang didirikan keluarga.

Bahaya Sekulerisme, DDI ... media, metode dan strategi serta bahaya sekularisme di kalangan masyarakat. Pernyataan itu disampaikan berkaitan dengan workshop TOT yang diharapkan dapat membuka dan menambah wawasan para dai provinsi ujung paling barat di Indonesia itu. Menurut dia, para dai harus membekali diri dengan kemampuan pengetahuan yang kuat sehingga dapat bekerja professional mengingat banyak tantangan dakwah yang dihadapi dai ke depan. Selain itu, para dai juga dituntut menjadi seorang yang pintar dan cerdas dalam melihat, menganalisa dan memberi solusi terhadap problematika yang dihadapi masyarakat. Dalam kegiatan yang diikuti 45 peserta se-Aceh tersebut, sudah dirancang strategi melakukan counter terhadap konsep berpikir para propagandis Ghawul Fikri serta gerakan sekularisme. “Ini kita lakukan untuk menemukan kelebihan maupun kelemahan konstruksi pemikiran dari penganjur gerakan tersebut. Kita berharap para dai daerah itu lebih memahaminya,” katanya. Workshop itu menghadirkan fasilisator dari Jakarta, yakni Dr. Adian Husaini, MA (Ketua DDII Pusat dan Peneliti di Institute For the Study Thought and Civilization-INSISTS). Fasilisator lainnya yang ikut mendukung acara itu adalah seorang kandidat doktor sebuah perguruan tinggi negeri jiran Malaysia, Adnin Armas, MA.

Kadisdik Aceh Selatan ... 1.01.1.01.01.15.19.5.2, tertanggal 5 Maret 2009 di Dinas Pendidikan Aceh. Proyek itu sebelumnya dibagi menjadi tujuh paket, masing-masing dikerjakan CV. Diva Perdana di SMKN 1 Pasie Raja senilai Rp231.902.000, CV. Bimantara Jaya di SMA Tapaktuan bernilai Rp235.400.000, CV. Doa Bersama di SMA 1 Trumon Rp229.570.000, CV. Aladin di SMA Kluet Utara senilai Rp235.400.000, CV. Bintang Asia di SMA Kluet Selatan Rp232.474.000, CV. Bishop Com, Laboratorium Terpadu Bakongan bernilai Rp296.312.500 dan CV. Aceh Lon Sayang di Laboratorium Sawang senilai Rp286.055.500. Kasus ini kata dia, telah ditingkatkan dari Lit-Intel (penyelidikan) menjadi Ditpidsus (penyidikan khusus), tentang penyalahgunaan alias penyelewengan tindak korupsi komputer. Modus operandinya ditemukan penggelembungan alias mark-up harga komputer dan pengadaan alat peraga siswa pada Dinas Pendidikan Aceh Selatan tahun anggaran 2009. Pada pelelangan tahap kedua, kata Husni, kuasa pengguna anggaran (KPA) telah memerintahkan paniJawaban Problem Catur, tia mengubah spek teknis TTS Dan Sudoku komputer, dari spek lebih Dari Halaman Sport. tinggi diubah ke spek yang lebih rendah. Praktis nilai spek yang Jawaban Problem Catur: diturunkan, harganya 1. ........, Ke2+. menjadi rendah. “Semen2. Rf1, Kg3+. tara pada spek alat peraga atau peralatan lain tidak di3. Rg1 (Jika turunkan,malahan harga2. Re1, Me2+mat), nya digelembungkan,” Mf1+. tambahnya. Padahal berdasarkan 4. BxM atau KxM, Keppres 80 tahun 2003 tenKe2+mat. tang pedoman pengadaan barang dan jasa, telah diteJawaban TTS: tapkan cara penyusunan Harga Perkiraan Sendiri TTS Topik Politik & Hukum (HPS), di mana analisis A N A S U R B A N I N G R U M E U I N E A harga satuan yang berP E M B A N T U I B T sangkutan dan harga pasar O I K E N A M U M R setempat pada waktu peT H R K I T I nyusunan. I T I G A A “Dari dasar ketentuan S U P E R S E M A R R itu, maka ditemukan pemM O A D U K belian atau harga jual komB P J S I R E M I S I S I I A puter di Tapaktuan sangat N A A J jauh berbeda dengan harJ A M I N A N S O S I A L ga yang disusun dan diteA M K tapkan KPA, sehingga telah N P S menimbulkan kerugian G A P P R O L E G N A S negara ratusan juta rupiJawaban Sudoku: ah,” sebutnya. Berdasarkan unsur pe6 8 3 5 2 4 1 7 9 langgaran yang dilaku4 5 1 9 3 7 6 2 8 kan tersangka, mereka da7 2 9 6 8 1 3 4 5 pat dijerat pasal 2 dan 3 UU Nomor 31 tahun 1999 se2 9 6 7 1 5 4 8 3 bagaimana diubah dengan 1 4 5 8 6 3 2 9 7 UU nomor 20 tahun 2001 8 3 7 2 4 9 5 6 1 tentang pemberantasan tindak pidana korupsi de5 6 8 1 9 2 7 3 4 ngan ancaman hukuman 9 7 4 3 5 6 8 1 2 satu hingga 20 tahun kurungan penjara. (b19) 3 1 2 4 7 8 9 5 6

WASPADA Selasa 25 Mei 2010

Cegah Teroris, TNI Latihan Taktik Perang Humaniter LHOKSEUMAWE (WASPADA) : Dalam rangka mencegah jalur teroris yang tidak lagi ke pedalaman atau mulai memasuki perkotaan, Senin (24/5) maka seluruh prajurit TNI di jajaran Kodim 0103 Aceh Utara gelar pelatihan Humaniter di lapangan Sudirman setempat. Pelatihan Humanis merupakan taktik perang kota untuk mencegah jatuhnya korban di pihak sipil ketika

mengejar target teroris ditengah kerumunan massa. Kegiatan ini merupakan lanjutan dari pelatihan Hukum dan HAM yang telah dibekali pada prajurit beberapa waktu lalu. Sedangkan kegiatan ini sudah dilakukan dalam tiga gelombang. “Untuk satu gelombang akan mengikuti pelatihan selama dua pekan,” ujar Dandim 0103 Aceh Utara, Letkol Taufan Akridal ketika memantau pelatihan tersebut, Senin (24/5). Dandim menjelaskan, tu-

juan dari latihan taktik perang kota ini adalah dalam upaya memaksimalkan tugas pokok satuan, hingga mewujudkan prajurit yang lebih profesional dalam melaksanakan tugas yang dihadapkan dengan era globalisasi sekarang ini. “Maksudnya, sekarang ini musuh negara lagi trendnya bukan lagi di hutan, tetapi lebih banyak di kota, contohnya serangan teroris,” jelas Dandim. Dandim menuturkan, dari setiap gelombang yang ikut pelatihan, maka akan dimu-

lai dengan teori dan dilanjutkan dengan praktek latihan taktik perang kota . Sedangkan contoh taktik yang akan dipelajari, seperti yang paling ringan, cara membawa senjata di dalam kota berbeda jauh meskipun pasukan tetap dalam kondisi siaga. “Kalau biasanya di hutan saat bertempur kondisi senjata siap tembak, sekarang ini mungkin akan lebih Humaniter meskipun posisi prajurit tetap waspada,” demikian Dandim 0103 Aceh Utara.(b15)

Jatah Pupuk Subsidi Dimonopoli Pengusaha LANGSA (Waspada): Jatah pupuk bersubsidi di Kota Langsa dilaporkan dimonopoli penyalurannya oleh salah seorang pengusaha atau distributor tertentu. Akibatnya, penyaluran pupuk subsidi yang diperuntukkan bagi para petani menjadi tidak merata. Bahkan akibat monopoli kemungkinan terjadinya penyelewengan seperti penjualan pupuk kepada pihak yang tidak berhak terbuka lebar.

Salah seorang penyalur pupuk subsidi di salah satu kecamatan di wilayah Kota Langsa, Sofyan kepada Waspada, Senin (24/5), mengatakan selama ini penyaluran pupuk bersubsidi dari pemerintah dilakukan distributor CV Raja Blang pimpinan Masyitah. Dalam aturannya, penyaluran pupuk harus merata dan CV Raja Blang selaku distributor langsung harus menyalurkannya ke kios-kios pu-

puk di setiap kecamatan, guna memenuhi kebutuhan pupuk subsidi petani. “Namun kenyataannya, pimpinan Masyitah justeru melakukan monopoli dengan tidak menyalurkannya ke kioskios. Bahkan Masyitah justru membuka cabang usahanya dengan mendirikan kios pupuk miliknya,” kata Sofyan. Dikatakan, monopoli penyaluran pupuk subsidi yang dilakukan Masyitah juga sangat mencurigakan. Karena,

Anggota Komplotan ...

rus seseorang untuk menjadi PNS lalu meminta uang pengurusan pada warga terungkap. Pasalnya, aksi mereka sudah sangat meresahkan bahkan telah banyak warga yang jadi korban. Oleh sebab itu, pihaknya tidak tinggal diam dan terus mengembangkannya. Ditanya apakah ada korban lain selain 20 orang yang telah melaporkan diri dalam kasus calo itu yang telah ditangkap seorang tersangka IRT itu, Kasatreskrim mengatakan tidak tertutup kemungkinan masih ada korban lainnya, hanya saja mereka belum mela-

porkannya. “Korban yang telah melaporkan baru yang di Kecamatan Peudada. Kabar terakhir yang kami terima ada juga korban dari kecamatan lain, namun mereka belum melaporkannya kepada kami, makanya kemungkinan akan ada korban lain,” jawabnya, seraya kembali menghimbau kepada warga yang menjadi korban calo CPNSD segera melaporkan ke Polres Bireuen. “Tersangka yang telah ditangkap dijerat pasal 378 KHU Pidana junto Pasal 379 KUH Pidana,” tegas Kasatreskrim AKP Khairul Saleh SH SIK. (amh)

“Selama ini warga yang berada di Kecamatan Mesidah ini, untuk alat penerangan masih menggunakan lampu teplok karena belum meratanya jaringan listrik yang masuk. Sementara untuk kebutuhan air mereka mengandalkan air hujan yang ditampung,” terang Irmansyah. Rinci Irmanysah, delapan Kampung yang belum memilik fasilitas listrik diantaranya Kampung Uer Tingkem, Perumpaken Benjadi, Simpur, Hakim, Peteri Pintu, Wih Resap, Simpang Renggali, dan

Kampung Pantan Kuli. Dari delapan kampung itu salah satunya termasuk Ibukota Kecamatan Mesidah. “Sebagian memang telah ada masuk jaringan listrik tetapi tidak seluruhnya. Selain tidak adanya jaringan listrik di sejumlah kampung, warga di sana (Mesiadah-red) juga sangat mengharapakan adanya perbaikan sarana jalan yang saat ini kondisinya sebagian telah hancur dan sulit dilalui kendaraan,”ujar Camat Mesidah itu lagi. Untuk mengatasi kebutu-

bagi para’penggila’ burung. Namun kami berupaya mensosialisasikan kegiatan ini untuk menambah peminat,” sebut Misbah. “Event ini akan menyeleksi jenis burung dengan kicau terbaik untuk diikutsertakan mewakili daerah menuju tropy Gubernur Aceh, 13 Juni di Banda Aceh,” jelasnya. Ada beberapa kategori teknis penilaian. “ Untuk menentukan siapa terbaik, kami nilai anggunnya burung, variasi suara, gaya burung dan terakhir kelayakan sangkar,” sebut Misbah. Menurutnya, kontes burung berkicau itu memiliki dua klasifikasi, yakni kelas khusus , dan kelas campuran kecil dan besar. “Untuk kelas khusus je-

nis burung yang diperlombakan murai batu, kenari, cicempala (kacer), love bird (burung cinta), dan cucok rowo,” ungkapnya. Sementara untuk klasifikasi burung campuran besar dan kecil, seperti kutilang, kekerek Gayo, blacken, maken dan jalak. Maraknya kontes burung yang diselenggarakan di Aceh Tengah, berlangsung sebulan sekali, menambah minat pehobbi hewan berbulu dalam sangkar ini. “Pecinta burung mulai mendirikan klub-klub, bukan hanya untuk di Aceh Tengah, tetapi klub burung ini juga memacu semangat penggemar burung di Bener Meriah dan Gayo Luwes,” jelas Misbah.(cir)

eksploitasi. “Akan tetapi, saya juga minta agar masyarakat tidak `menakuti` investor dengan cara menaikkan harga jual tanah,” tambahnya. Bentuk Tim Terpadu Dalam pertemuan itu, Pemerintah Aceh dan Dewan Perwakilan Rakyat Aceh (DPRA) resmi membentuk tim terpadu yang terdiri dari pihak legeslatif, eksekutif dan sejumlah dinas terkait lainnya, bahkan aparat kepolisian, untuk menyelesaikan permasalahan antara warga dengan PT LSM. Tim yang direncanakan terbentuk setelah pertemuan itu, akan bekerja menyelesaikan permasalahan yang terjadi antara warga yang menolak kehadiran PT LSM, yang saat ini sedang mengeksploitasi biji besi di kawasan Kecamatan Lhoong, Aceh Besar. “Jadi kita perlu menyelesaikan masalah ini tanpa merugikan pihak perusahaan dan masyarakat. Untuk itu, kita bentuk tim terpadu yang nanti bisa langsung terjun ke lapa-

ngan menyelesaikan masalah antara warga dan perusahaan,” ujar Irwandi. Sementara itu Wakil Ketua Komisi B DPRA, Darmuda, dalam kesempatan itu mengatakan, untuk mempercepat penyelesaian permasalahan antara perusahaan dan warga, pihak perusahaan diminta segera menyelesaikan kewajibannya kepada pemerintah terutama terhadap masyarakat. Menjawab atas permasalahan itu, Direktur PT LSM, Jerry Patras, dalam menuturkan, pihak perusahaan mendukung keputusan yang diambil pemerintah Aceh dan DPRA. Lebih lanjut soal jadwal pembahasan anggota tim, Ketua DPRA Hasbi Abdullah meminta kepada Ketua Komisi A, B dan C bisa membuat pertemuan untuk membahas yang akan menjadi anggota tim, lalu nama-nama yang telah disetujui di forum DPRA akan diajukan kepada gubernur untuk di-SK-kan. (ant/m27/gto/b02)

(IRT ) Riz, 26, yang berlamat Desa Kuta Baroe, Kec. Kuala, Bireuen yang diduga calo CPNSD yang paling dicari ditangkap anggota Polres Bireuen belum lama ini di depan Meuligoe Bupati Bireuen yang disebut-sebut telah meraup Rp430 juta dari hasil aksinya. Menurutnya, kasus calo CPNSD yang telah mengamankan seorang tersangka terus dikembangkan. Sehingga, komplotan atau sindikat penipuan dengan modus operandinya dengan cara mengaku dirinya mampu mengu-

8 Kampung ... lantaran belum memiliki fasilitas berupa jaringan listrik. Terkait hal tersebut, Camat Mesidah, Irmansyah, SSTP, yang ditemui Waspada, Senin (24/5) mengatakan, selain belum memiliki jaringan listrik, kecamatan yang dia pimpin yang memiliki delapan kampung dengan jumlah penduduk sebanyak 3.389 jiwa, serta 939 Kepala Keluarga (KK), juga sangat memerlukan fasilitas air bersih.

Kontes Kicauan ... Kontes ‘adu merdu’ sehari di bumi Gayo itu, tidak hanya diikuti peserta Aceh Tengah, namun burung dari lembah Gayo Luwes dan Bener Meriah juga meramaikan bird kontes ini. Panpel menyediakan total hadiah Rp20 juta bagi pemenang kontes yang masuk 5 besar. Hadiah hiburan tersebut bukan berupa uang, tetapi dikemas dalam bentuk alat-alat elektronik, seperti TV 21 inch, DVD player, handphone. Demikian Ketua Panpel, Imran, melalui wakilnya, Misbah, ST menjawab Waspada disela-sela perlombaan. “Kontes ini bukan hanya sekedar menyalurkan hobby

Penutupan Tambang ... migas itu,” katanya menambahkan. Irwandi Yusuf menyatakan, PT LSM telah mengeksploitasi pasir biji besi dan produksinya diekspor ke China. Izin eksploitasi diberikan kepada PT LSM pada 2008, dengan luas areal 500 hektar di Kecamatan Lhoong. “Eksploitasi tambang biji besi itu untuk kepentingan daerah dan pembangunan. Untuk provinsi mendapatkan 15 persen yang dihitung dari laba bersih, sementara Pemkab Aceh Besar memperoleh 10 persen,” kata dia. Dalam Memorandum of Action (MoA) antara Pemerintah Aceh dan PT LSM, ia menyebutkan, pihak perusahaan harus membangun pabrik prosesing biji besi di kawasan Lhoong, paling lambat setelah dua tahun eksploitasi. Selain itu, Irwandi juga minta pihak perusahaan agar menyelesaikan pembayaran ganti rugi lahan masyarakat yang terkena dalam proyek

jatah pupuk subsidi di setiap kecamatan jadi menurun. Ada dugaan pupuk subsidi itu telah disalahgunakan dengan menjualnya kepada pihak yang tidak berhak. “Pasokan pupuk semakin langka dan ini patut dicurigai. Jangan-jangan jatah pupuk subsidi ini dijual kepada pihak lain yang tidak berhak,” katanya. Sementara Direktur CV Raja Blang, Masyitah yang dikonfirmasi Waspada, membantah tudingan tersebut. Menurutnya, jatah pupuk subsidi untuk Kota Langsa beberapa bulan terakhir hanya 50 sampai 80 ton. Dalam penyalu-rannya, Masyitah mengaku tidak memonopoli dan tetap menyalurkannya ke kios-kios pupuk di setiap kecamatan. Hanya saja, keberadaan kios pupuk subsidi di Kecamatan Langsa Kota sudah terlalu banyak dan tidak mungkin diberikan lagi. “Di Kecamatan Langsa Kota sudah banyak kios penyalur pupuk, sementara jatahnya sangat kecil. Jadi, tidak mungkin kita bagi kecuali kiosnya dipindah ke kecamatan lain,” demikian Masyitah. (ts) han masyarakat terkait dengan penerangan karena belum masuknya jaringan listrik ke beberapa kampung di daerah itu, pihak pemerintah daerah setempat telah berupaya mengajukan pembuatan Pembangkit Listrik Tenaga Surya (PLTS) sehingga masyarakat di sejumlah kampung di Kecamatan Mesidah, tidak lagi menggunakan lampu teplok untuk penerangan. “Kami dari pihak kecamatan telah mengajukan agar beberapa kampung yang tidak memiliki jaringan listrik dapat segera dibuat PLTS sehingga warga tidak lagi menggunakan lampu teplok,” kata Camat. Menurut Irmasyah, bukan hanya jaringan listrik yang saat ini sangat dibutuhkan warga disana, melainkan kondisi jalan yang belum baik dan kurangnya fasilitas kesehatan serta pendidikan masih menjadi kendala. (cih/b04)

Waspada/Abdul Mukthi Hasan

Daftarkan Diri: Sejumlah calon mahasiswa mendaftarkan diri ke kampus Universitas Al-Muslim, Peusangan, Bireuen, Senin (24/5). Hingga seminggu pendaftaran dibuka ratusan cama telah mendaftarkan di ri di kampus setempat.

Polisi Panen Kayu ... ruang kerjanya. Selanjutnya pada Minggu (23/5) sekira pukul 23: 00 Wib polisi kembali berhasil menagkap dua tersangka pelaku illegal logging di Taman Hutan Raya (Tahura-red), Kabupaten Pidie, serta menyita barang bukti kayu sebanyak 0,5 meter kubik yang dilakukan oleh T. Faisal, 33 warga Desa Jalan Teupat, Darul Makmur Nagan Raya dan Banta Umar warga Neusu Jaya, Banda Aceh. Sebelumnya Rabu (12/5) polisi menyita 0,8 meter kubik kayu illegal loging di Desa Sagoe, Kecamatan Muara Tiga, Kab, Pidie. Dalam penangkapan tersebut polisi turun menahan dua tersangka adik kakak yangmerupakan saudara kembar bernama M. Akbar, 26 dan M. Arif, 26 warga Desa Suka Jaya, Muara Tiga. Kedua tersangka saudara kembar tersebut ditangkap karena menggangkut kayu tanpa dapat menunjukkan surat-surat izin. “ Kini mereka telah kita amankan juga di Mapolres untuk dilakukan peyidikan lebih lanjut” sebut Erlintang. Menurut Erlin penebangan dan pengangkutan kayu tanpa dapat menunjukkan surat-surat atau izin akan dapat dijerat secara hukum. “ Kita akan proses secara hukum, karena mereka tidak dapat menunjukkan surat-surat dari hasil penebangan kayu secara ilega;l tersebut” tandasnya. (b20)

Kajari: ‘Ulang Tender ... Bila syarat yang telah ditentukan Keppres tidak terpenuhi, kita sarankan agar pelaksanaannya diulang, kata Yuswadi. Sesuai pasal 1 ayat 15 Keppres 80 tahun 2003 tentang pengadaan barang/jasa pemerintah, “sertifikat keahlian pengadaan barang/jasa pemerintah adalah bukti pengakuan atas kompetensi dan kemampuan profesi dibidang pengadaan barang/ jasa pemerintah yang merupakan persyaratan seseorang untuk diangkat sebagai pengguna barang/jasa atau panitia/pejabat pengadaan”. Hal itu dipertegas lagi dengan Pasal 10 ayat 4 huruf f, memiliki sertifikat keahlian pengadaan barang/jasa, merupakan persyaratan keanggotaan panitia. Kajari menuturkan, berdasarkan surat edaran Badan Perencanaan Pembangunan Nasional (Bappenas) tahun 2007, Bappenas menyarankan agar panitia tender memiliki sertifikat. “Sejak tahun 2007 saja Bappenas menyarankan panitia tender berseritifikat dengan berkode L, apalagi sekarang kan sudah tahun 2010,” ujar Yuswadi heran terkait sertifikat yang dimiliki oknum ketua panitia lelang Disdik, yang merupakan sertifikat pelatihan tahun 2006.(b30)

Putra Aceh Diharapkan ... undang-undang Pemerintah Aceh, selain soal dana pembangunan bagi Aceh yang akan kita perjuangkan,” ungkap Mawardi Nurdin yang masih berada di Jakarta. Mawardi yang juga Walikota Banda Aceh itu menyebutkan beberapa contoh upaya yang dibangun Aceh lewat perjuangan Partai Demokrat di pemerintah pusat, yakni soal ketersediaan listrik, dan pembangunan jalan dan perhatian besar para petani di Aceh. Pembanguan lewat dana pusat atau APBN serta simulus yang menjadi kewenangan DPR RI telah banyak membawa perubahan bagi Aceh, namun ada juga dana - dana tersebut tidak berjalan seperti di Kota Banda Aceh. Ini terjadi karena dana pendamping dari APBK yang minim sehingga program tidak berjalan, kondisi serupa juga terjadi di kabupaten/kota lain Aceh selain Kota Banda Aceh. Mawardi menyebut pertemuannya dengan Anas untuk mengucapkan selamat kepadanya mewakili rakyat Aceh. Bukti bahwa Partai Demokrat sebagai partai terbesar adalah karena rakyat Aceh telah mengirim 7 dari 13 wakil rakyat Aceh ke DPR RI, sebut Mawardi.(b32)


WASPADA Demi Kebenaran Dan Keadilan

Banda Aceh: Cuaca : Berawan-Berawan dan berpeluang hujan lokal Angin : Timur laut s/d Tenggara Kec. 10 s/d 30 km/jam

Provinsi NAD: Lereng Timur Pegunungan, Dataran Tinggi, Pesisir Timur, Pantai Barat: Berawan dan hujan ringan

Temperatur Maks/Min: 230C - 350C BMKG Polonia

SELASA, Pon, 25 Mei 2010/11 Jumadil Akhir 1431 H

http://epaper.waspadamedan.com

No: 23159 Tahun Ke-64

Edisi Aceh

Terbit 24 Halaman (A1-8, B1-8, C1-8)

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Harga Eceran: Rp 2.500,- (belum termasuk ongkos kirim)

Penutupan Tambang Preseden Buruk Pemerintah Aceh-DPRA Bentuk Tim Terpadu

Kadisdik Aceh Selatan Tersangka Korupsi

BANDA ACEH (Waspada): Gubernur Aceh Irwandi Yusuf menegaskan, upaya berbagai pihak yang mendorong ditutupnya perusahaan tambang biji besi di Aceh Besar dapat menjadi preseden buruk bagi iklim investasi di provinsi ini.

TAPAKTUAN (Waspada): Setelah mantan kepala Dinas Pendidikan Aceh Barat Daya Drs.N menjadi terdakwa kasus korupsi pengadaan buku beberapa waktu lalu, kini giliran Kadisdik Aceh Selatan Drs.HZ ditetapkan jadi tersangka kasus korupsi pengadaan komputer. Penetapan tersangka itu dikemukakan Kepala Kejaksaan Negeri Tapaktuan, Husni Thamrin,SH kepada wartawan di ruang kerjanya di Tapaktuan, Senin (24/5). Selain Kadisdik, seorang rekanan lainnya yaitu Direktur CV Bishop Com, TSH, juga ditetapkan sebagai tersangka dalam kasus pengadaan alat penunjang pembelajaran siswa tersebut. Didampingi Kasie Intel Mukhlis, SH, Husni Thamrin menyebutkan akibat perbuatan korupsi yang dilakukan kedua tersengka, menyebabkan kerugian negara diperkirakan mencapai Rp 130 juta hingga Rp 534 juta. Jumlah itu diketahui dari rentetan kasus pengadaan komputer senilai Rp 1.747.113.500,-. Proyek itu bersumber dari dana Otsus tahun 2009, dengan DPA, SKPA Nomor:

“Kalau kita terus mendorong agar perusahaan tambang tutup, maka saya mengkhawatirkan bisa menjadi preseden buruk bagi investasi Aceh di masa mendatang,” kata gubernur di sela-sela pertemuan dengan anggota DPR Provinsi Aceh (DPRA), perusahaan tambang bijih besi PT Lhoong Setya Mining (LSM), dan sejumlah tokoh masyarakat Kecamatan Lhoong, Aceh Besar, Senin (24/5).

Lanjut ke hal A2 kol. 1

Irwandi menyatakan, upaya pemerintah untuk meningkatkan pendapatan daerah (PAD), terutama pascagas minyak dan gas (migas) adalah di sektor pertambangan, selain perikanan, perkebunan dan pertanian. “Jadi, bagaimana kita bisa mendapatkan dana membangun Aceh jika tidak adanya investasi lain terutama setelah habisnya Lanjut ke hal A2 kol. 3

Anggota Komplotan Tersangka Calo CPNSD Terus Diburu

Putra Aceh Diharapkan Isi Posisi Penting Kabinet Anas

BIREUEN (Waspada): Pasca penangkapan seorang ibu rumah tangga (IRT) yang diduga calo Calon Pegawai Negeri Sipil Daerah (CPNSD) yang paling dicari selama ini, jajaran Polres Bireuen terus memburu anggota atau konconya yang disebut-sebut ada sekitar dua orang lagi yang identitasnya telah dikantongi. Kabar terakhir yang diperoleh dari hasil penyelidikan, dua tersangka lainnya itu telah kabur ke Jakarta. Namun, pencariannya terus dilakukan hingga keduanya berhasil diciduk. Demikian Kapolres Bireuen Teuku Saladin SH melalui Kasatreskrim AKP Khairul Saleh SH SIK menjawab Waspada Senin (24/5) terkait perkembangan kasus calo CPNSD yang telah berhasil ditangkap seorang tersangka belum lama ini. “Kami sudah mencari kesejumlah lokasi yang dicurigai, namun pelaku kabarnya telah kabur ke Jakarta dua bulan lalu,” ujar Kasatreskrim Polres Bireuen itu. Sebagaimana diberitakan kemarin, seorang Ibu Rumah Tangga

BANDA ACEH (Waspada): Partai Demokrat Aceh mengharapkan terpilihnya Anas Urbaningrum dapat membawa perubahan besar di Aceh, terlebih sumbangsih Aceh dalam pemilu lalu juga merupakan harapan masyarakat Aceh. Karenanya Ketua DPW Partai Demokrat Aceh, Mawardi Nurdin yang dihubungi mengharapkan adanya kader-kader Partai Demokrat asal Aceh yang menduduki posisi penting di kepengurusan DPP Partai Demokrat yang kini dipimpin Anas Urbaningrum.

Lanjut ke hal A2 kol. 3

Polisi ‘Panen’ Kayu Ilegal 5,49 Meter Kubik Disita SIGLI (Waspada): Jajaran Reserse Kriminal (Reskrim) Polres Pidie berhasil menyita 5,49 meter kubik kayu hasil illegal logging di tiga lokasi terpisah di daerah tersebut. Minggu (23/5) dan Sabtu (22/5). Penangkapan pertama dilakukan di Jalan Dayah Bandar Baru, Pidie Jaya, Sabtu (22/5) sekira pukul 19:30 Wib. Tersangka dengan menggunakan truk mengangkut kayu olahan sebanyak 4,46 meter kubik, tanpa Faktur Untuk Angkut Kayu Olahan (Fako-red). Kayu tersebut diduga ditebang di Hutan Negara pegunungan Panton Limeng, Bandar Baru. Dalam penangkapan tersebut polisi selain menyita barang bukti berupa 4,46 meter kubik kayu juga menyita satu unit truk dan menetapkan seorang tersangka, yaitu Hamdani Bin Abdurrahman, 33 yang merupakan Kepala Desa Aki Neungoh, Kecamatan Bandar Baru, Pidie Jaya. “Tersangka bersama barang bukti telah kita amankan. Sekarang sedang dalam pemeriksaan” kata Kapolres Pidie AKBP Dumadi, SSTmk melalui Kasat Reskrim AKP. Erlin Tangjaya, Senin (24/5) di Lanjut ke hal A2 kol. 7

Antara

KONFERENSI KETAHANAN PANGAN: Presiden Susilo Bambang Yudhoyono (kanan) menyerahkan secara simbolis Peta Ketahanan dan Kerentanan Pangan kepada Gubernur Papua Barnabas Suebu (2 kiri), Gubernur Jawa Tengah Bibit Waluyo (kiri) dan sejumlah bupati lainnya dalam acara peresmian pembukaan Konferensi Dewan Ketahanan Pangan 2010 di Balai Sidang, Jakarta, Senin (24/5). Konferensi Dewan Ketahanan Pangan 2010 tersebut akan membahas strategi pengembangan ketahanan pangan nasional menuju kemandirian pangan.

Presiden: Sembilan Masalah Ketahanan Pangan

JAKARTA (Antara): Presiden Susilo BambangYudhoyono memaparkan sembilan masalah terkait ketahanan pangan yang dihadapi oleh Indonesia seiring dengan meningkatnya jumlah penduduk Indonesia menjadi 235-240 juta pascasensus penduduk 2010. Sembilan permasalahan itu dipaparkan oleh Presiden dihadapan para kepala daerah dari seluruh Indonesia yang mengikuti konferesi Dewan Ketahanan Pangan di JCC Jakarta, Senin (24/5). “Saya amati ada satu hal yang harus diperbaiki bersamasama yaitu (masalah) sinergi dan terintegrasinya sistem,” kata Presiden merujuk pada permasalahan pertama. Ia mengatakan, sinergi dan

sistem yang terintegrasi diperlukan untuk dapat mengelola keamanan makanan, energi dan air sehingga tidak menimbulkan

masalah di masa kini dan mendatang. Kepala Negara juga menyebut keterkaitan antara perta-

Waspada/Tarmizi Ripan

TANPA MASA BERLAKU: Copy sertifikat a/n SJ, SH, oknum ketua panitia tender Disdik yang mengikuti bantuan teknis /sertifikasi nasional ‘Pengadaan barang/jasa pemerintah’ tanpa masa berlaku. Berbeda dengan sertifikat yang dikeluarkan Lembaga Kebijakan Pengadaan barang/jasa Pemerintah (LKPP) yang menjelaskan masa berlaku.

nian, infrastruksi dan transportasi. Masalah kedua, lanjut Presiden, adalah upaya untuk meningkatkan sejumlah komoditas unggulan pertanian —beras, jagung, kedelai, gula dan daging sapi— menuju swasembada dan swasembada berkelanjutan. Isu ketiga dan keempat, kata dia, adalah sistem cadangan dan distribusi serta rantai pasokan dan logistik nasional yang efisien. Terkait isu ini Presiden menyoroti permasalahan mahalnya ongkos transportasi. Lalu isu kelima adalah masih ditemuinya kasus kekurangan produksi di sejumlah daerah. “Yang keenam adalah stabilitas harga,” katanya. Lanjut ke hal A2 kol. 1

“Kita harapkan ada putra Aceh menduduki posisi penting di DPP nanti,” kata Mawardi yang dihubungi, Senin (24/5) siang. Selain itu, kata Mawardi, keyakinannya bahwa akan banyak perubahan besar yang lebih baik bagi Aceh karena komunikasi dan komitmen Partai Demokrat Aceh yang sejak awal mundukung Anas sebagai Ketua Umum. “Aceh akan sangat mudah mengkomunikasikan tentang Lanjut ke hal A2 kol. 7

Presiden Pimpin Upacara Pemakaman Ainun Habibie JAKARTA (Antara): Presiden Susilo BambangYudhoyono dijadwalkan akan memimpin upacara kenegaraan pemakaman mantan ibu negara Ainun Habibie besok, Selasa (25/5) di Taman Makam Pahlawan Kalibata Jakarta. Juru bicara Kepresidenan Julian Aldrin Pasha saat dihubungi wartawan di Jakarta, Senin (24/5), mengatakan Presiden akan memimpin upacara pemakaman istri presiden RI ke-3 BJ Habibie tersebut. “Tiba di Jakarta dari Jerman pukul lima pagi kemudian disemayamkan di rumah duka. Kemudian pada pukul 11:00 WIB akan dimakamkan di Taman

Makam Pahlawan Kalibata, begitu rencananya,” kata Julian. Sementara Staf Khusus Presiden bidang luar negeri Dino Patti Djalal di Kantor Presiden Jakarta, Senin, mengatakan kegiatan Presiden sepanjang Selasa pagi hingga siang hari akan dikosongkan sehingga bisa memimpin upacara pemakaman Ainun Habibie. “Presiden akan memimpin sendiri pemakaman Ibu Ainun, tadi sempat dibahas dengan beberapa menteri dan staf khusus. Kegiatan beliau sepenuhnya dikosongkan,” kata Dino. Pada Selasa (25/5) malam, Lanjut ke hal A2 kol. 1

Kajari: ‘Ulang Tender Menyimpang Dari Keppres’

Waspada/Muhammad Riza

KAYU ELEGAL: Polisi sedang menghitung Barang Bukti (BB) Kayu hasil illegal logging di dalam truk yang berhasil di sita beberapa waktu lalu. Senin (24/5)

Baca Halaman Dalam Ratusan PNS Aceh Singkil Mangkir Sedikitnya seratusan PNS di jajaran Pemkab Aceh Singkil tidak melaksanakan tugas alias mangkir, demikian Kepala Badan Kepegawaian Pendidikan dan Pelatihan Kab. Aceh Singkil H. Mukmin Saraan SH.MA melalui Kepala Bidang Pembinaan dan Pengembangan Sumber daya Aparatur Muzakir SH kepada Waspada, Senin (24/5) di ruang kerjanya. Hal C4

SINGKIL (Waspada): Bila pelaksanaan tender pengadaan barang dan jasa pemerintah tidak sesuai dengan Keputusan presiden (Keppres) No. 80 Tahun 2003, pelaksanaan disarankan diulang kembali. Demikian ditegaskan Kepala Kejaksaan Negeri (Kajari) Singkil, Yuswadi, SH, MH kepada wartawan, Senin (24/5), di ruang kerjanya terkait pemberitaan tentang indikasi sertifikat ketua panitia tender Proyek Dinas Pendidikan (Disdik) Aceh Singkil tahun 2010 bersumber dari dana otonomi khusus (Otsus) berinisial SJ, SH yang diduga kadaluarsa. Kajari membenarkan, Kadis Pendidikan Aceh Singkil, Drs. Abdul Rakhman, MPd sebelumnya telah melakukan konsultasi terkait sertifikat ketua panitia lelang SJ, SH dalam pelaksanaan tender lingkup Dinas Pendidikan, yang telah mengumumkan perusahaan pemenang tender April 2010. “Kita telah sarankan pelaksanaan tender harus memenuhi syarat sesuai Keppres 80 tahun 2003 tentang pedoman pelaksanaan pengadaan barang/jasa pemerintah,” jelasnya. Lanjut ke hal A2 kol. 7

Kontes Kicauan Burung Di Bumi Gayo TAKENGON (Waspada): Sekitar seratusan burung berbagai jenis ikut bird kontes yang digelar di lapangan Gedung Olahraga Seni (GOS), Takengon, Aceh Tengah, Minggu (23/5) sore. Lanjut ke hal A2 kol. 3

Bahaya Sekulerisme, DDI Bekali Dai Aceh BANDA ACEH (Antara): Dewan Pimpinan Wilayah Da‘wah Indonesia (DDI) membekali para dai melalui workshop Training of Trainers (ToT) mengenai bahaya pemikiran sekularisme, pluralisme dan liberalisme di Provinsi Aceh. Ketua panitia H Abizal di Banda Aceh, Senin (24/ 5) mengatakan, kegiatan ini penting untuk memberi pemahaman yang komprehensif bagi para dai mengenai sejarah, program,

Waspada/Irwandi

Tim juri sedang serius mendengar kicauan burung.

Lanjut ke hal A2 kol. 1

Waspada/Abdul Mukthi Hasan

1 TEWAS, SATU KRITIS: Kecelakaan lalulintas di kawasan Desa Blang Bladeh, Jeumpa, Minggu (23/5) sekira pukul 22.00 WIB, selain merenggut jiwa Munidar, 17, pelajar asal Desa Kuta Meuligoe, juga menyebabkan Aminah Sulaiman, 55, penduduk Desa Cot Gadong, kritis dan Dasriadi, 15, mengalami luka parah.

Hari Ini Ustadz Jefri Al Bukhari Maulid Raya Di Sabang

8 Kampung Masih Gelap

SABANG (Waspada): Hari ini, Selasa (24/5), penceramah kondang dari Jakarta Ustadz Jefri Al Bukhari tampil pada acara perayaan peringatan Maulid Raya yang digelar Pemko Sabang di lapangan Yos Sudarso. Lanjut ke hal A2 kol. 1

REDELONG (Waspada): Delapan Kampung yang berada di Kecamatan Musidah, Kabupaten Bener Meriah yang dimekarkan dari Kecamatan Siah Utama sejak 5 Pebruari 2010, hingga kini masih tetap gelap gulita, Lanjut ke hal A2 kol. 3

Serampang - Hilangkan buruk rupa, eit buruk sangka Ustadz Jefri Al Bukhari.

Waspada/Ist

- He... he... he...


Berita Utama

A2 4 Fraksi DPRD ....

Horas Silitonga, Hulman Sitorus/Koni Ismail Siregar, Margan RP Sibarani/Rupina Aruan, Frans Immanuel T Saragih/Rokibah Hasibuan dan Barkat Shah/Boundeth Damanik. Keempat fraksi yang meninggalkan ruang sidang itu, F-PDIP, F-PAN, F-Kebangsaan dan F-Karya Peduli Nurani, termasuk dua wakil ketua DPRD Timbul Lingga asal PDIP dan Zainal Purba asal PAN. Sehingga hanya F-Demokrat yang bertahan. Saat pasangan pertama menyampaikan visi dan misi, ke empat fraksi tetap bertahan di ruang sidang, namun keluar saat calon walikota incumbent RE Siahaan dan pasangannya Burhan Saragih memaparkan visi misi mereka. Namun sesudah calon incumbent selesai memaparkan visi visinya, 4 fraksi itu kembali masuk ke ruang sidang. Sikap meninggalkan ruang sidang diawali interupsi anggota DPRD EB Manurung, dari Partai Buruh, usai sekretaris DPRD mempersilahkan calon walikota incumbent dan pasangannya memaparkan visi misi mereka. Menurut Manurung, se-

Massa Pro ....

Pemuda untuk Reformasi dan Demokrasi, meminta agar Susno dibebaskan karena tidak terbuktisepertidituduhkan penyidik Mabes Polri. Sementara itu, massa kontra Susno meminta agar sidang praperadilan terhadap Susno Duadjo segera dipercepat atau tidak perlu ada sidang prape-

DPRD Dan ....

dikemanakan,” ujar Erwin bertanya. Kemudian, Lanjut Erwin, permasalahan sekretariat DPRD Palas yang sampai saat ini belum di nonaktifkan atau diganti oleh Bupati, Padahal pada 7 Mei 2010 Rapat dengar pendapat antara DPRD bersama Sekretaris Daerah Gusnar Hasibuan sebagai Ketua Baperjakat sudah memutuskan sekwan A Ritonga Siregar harus dinonaktifkan hari itu juga. Sedangkan Sekretararis Daerah Gusnar Hasibuan dalam rapat tersebut sudah berjanji dan mengatakan paling lambat tiga hari setelah rapat tersebut akan mengambil tindakan berupa pemberhentian sekwan atau penonaktifan sekwan “Tapi dalam kenyataannya penarikan dana anggaran DPRD dn sekretariat masih terus dilakukan, terahir tanggal

Pungutan Marak ....

yang memberatkan supir tersebut dapat diselesaikan dengan baik. “Persoalan ini harus segera dituntaskan pihak koperasi angkutan dan Organda, sehingga kami bisa kenderaan bisa beroperasi kembali dengan baik dan para agen terbantu,” tambah mereka. Sementara Alpin dan puluhan sewa yang berada di Pasar Baru Panyabungan harus menunggu berjam-jam untuk mendapatkan kendaraan 03 menuju desa mereka. “Kami berharap para sopir dan agen segera menyelesaikan persoalan mereka, sehingga masyarakat tidak terkendala,” katanya.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ........, Ke2+. 2. Rf1, Kg3+. 3. Rg1 (Jika 2. Re1, Me2+mat), Mf1+. 4. BxM atau KxM, Ke2+mat.

Jawaban TTS: TTS Topik

A N E P O T I S M R E A N J A A N G A

Politik & Hukum

A S U R B A N I N U I N E M B A N T U I I K E N A M H R K I T I G U P E R S E M A R O A B P J S M I S I S I I A A M I N A N S O S I M P P P R O L E G N

G R U M E A B T U M R T I A A R D U K I J A L K S A S

Jawaban Sudoku:

6 4 7 2 1 8 5 9 3

8 5 2 9 4 3 6 7 1

3 1 9 6 5 7 8 4 2

5 9 6 7 8 2 1 3 4

2 3 8 1 6 4 9 5 7

4 7 1 5 3 9 2 6 8

1 6 3 4 2 5 7 8 9

7 2 4 8 9 6 3 1 5

9 8 5 3 7 1 4 2 6

suai peraturan perundang-undangan, walikota yang kembali mencalonkan diri seharusnya menyampaikan LKPj kepada DPRD sebelum mendaftar ke KPUD. Namun sampai pemaparan visi misi, DPRD belum menerima LKPj walikota, sehingga tidak mengetahui perkembangan pembangunan di Pematangsiantar. “Izinkan kami meninggalkan ruang sidang ini ketua,” kata Manurung, seraya berdiri dan meninggalkan ruang sidang diikuti rekannya dari empat fraksi, termasuk kedua wakil ketua DPRD. Protes Sementara, Ketua Panwas Pilkada Fetra Tumanggor mengatakan, pihaknya tidak menerima undangan penyampaian visi misi itu. Karenanya, dia mengatakan protes keras terhadap DPRD yang menyelenggarakan rapat paripurna istimewa itu. “Kami sudah menyampaikan surat protes itu kepada pimpinan DPRD,” kata dia. Senada dengan itu, Ketua KPUD Rajaingat Saragih mengatakan, tidak hadir dalam pemaparan visi misi pasangan calon karena tidak diundang. “DPRD tidak mengerti mekanisme,” tandasnya. (a14) radilan. “Pasalnya dikhawatirkan dapat menghambat proses h u k u m t e r h a d a p Su s n o Duadji,” kata koordinator aksi, Eka Juliardi Sanjaya. Sidang praperadilan Susno dilanjutkan pada Selasa (25/5) dengan mendengarkan keterangan dari Mabes Polri selaku termohon. 1 4 Me i 2 0 1 0 s e b e s a r R p 173.000.000 dengan saldo kahir Rp72.696,” ujar Erwin. Berdasarkan hal tersebut, tegas Erwin, fakta itu menunjukkan adanya indikasi kerja sama antara Sekretaris Daerah Gusnar Hasibuan dengan Sekwan A Ritonga Siregar untuk pencairan dana tersebut. Kemudian kata Erwin, untuk mengantisifasi pencairan dana tersebut agar tidak berkelanjutan, maka DPRD hari ini membuat pemanggilan kepada Sekretaris Daerah, Kepala Dinas Pendatartan, PPAD (pengelola aset daerah), inspektorat dan A Ritonga Siregar beserta Staf DPRD. “Mereka dipanggil untuk memberikan klarifikasi tentang kinerja DPRD dan Sekretariat DPRD dan keuangan DPRD dan sekretariat,” demikian Erwin Hamonangan Pane. (crif) Masyarakat penumpang di Terminal Pasar Baru itu meminta para supir dan agen untuk duduk berembuk menyelesaikan persoalan kutipan yang memberatkan itu,sebab masyarakat yang tidak terganggu aktivitasnya,karena selama ini banyak warga yang menggunakan jasa angkutan itu. Menurut pengamatan, adanya aksi mogok para sopir Anatra itu, angkutan taksi Aek Mais dan Torsijanggut menjadi alternatif digunakan warga untuk jurusan Kotanopan-Panyabungan. Masyarakat yang kesehariannya memamfaatkan jasa angkutan umum Anatra 03 dalam aktivitasnya hari itu terganggu. (a24)

Pasar Tradisional ....

Humbahas kepada wartawan, Senin (24/5) di Doloksanggul, usai penyampaian visi dan misi tiga Calon Bupati/Wakil Bupati Humbahas periode 2010 – 2015 di Doloksanggul. TN Nainggolan menuturkan, dulunya pasar tradisinoil Doloksanggul itu dibangun diprakarsai KK Konstan Munthe, sehingga masyarakat dari berbagai daerah dapat mengadakan jual beli. Dulunya namanya “Pajak Doloksanggul” yang dibangun tahun 1980-an, dan masih berbentuk lapak yang disekat-sekat untuk tempat berdagang para saudagar. Jadi jika ada rumor berkembang bahwa Pasar Doloksanggul akan dipindahkan ke Lintong Nihuta, itu tidak benar. “Saya sudah langsung menanyakannya kepada Bupati Humbahas. Justru yang benar adalah perencanaan peningkatan pembangunannya karena sangat berpotensi besar menjadi pusat perekonomian dikawasan Tapanuli. Kita harus berpikiran jernih. Mana mungkin pasar Doloksanggul dipindahkan. Tidak semudah itu,” ujar TN Nainggolan. Menurutnya, pasar tradisionil yang paling layak ditingkatkan pembangunannya adalah Pasar Doloksanggul. Di sana setiap hari pekan (hari Jumat) perputaran uang mencapai Rp 8 miliar. Belum lagi bisnis lainnya. Komoditi pertanian yang dipasarkan sangat banyak,diantaranya, kopi, kemenyaan, kelapa sawit, karet dan sayur mayur. Semua-

GEMAPETA Demo DPRD Paluta Dan Datangi Polres Tapsel GUNUNG TUA (Waspada): Ratusan anggota Gerakan Mahasiswa dan Pers Tabagsel (GEMAPETA) demo di DPRD Padanglawas Utara di Gunungtua, Senin (24/5). Mereka menuntut agar AH sebagai oknum anggota dewan pelaku percobaan pemukulan terhadap mahasiswa dan pelaku penganiayaan terhadap wartawan diproses secara kelembagaan di DPRD. Sebelumnya, perwakilan massa datang beraudensi ke Kapolres Tapsel, AKBP Subandriya, SH.MH, didampingi Kabag Ops, Kompol H. Jamal Siregar, Kasat Reskrim, AKPWaiman dan Kapolsek Padangbolak AKP Maju Siregar, di ruang rapat

Mapolres, Jalan Merdeka, Kota Padangsidimpuan. Perwakilan mahasiswa dan insan pers menyatakan dukungannya kepada Polres Tapsel atas penegakan hukum. Kemudian berterimakasih kepada Kepolisian yang telah menerima laporan pengaduan wartawan yang mengalami penganiayaan saat melaksanakan tugas jurnalistik. Perwakilan mahasiswa dan pers kepada Kapolres juga meminta penjelasan tentang proses hukum yang berjalan saat ini atas kasus pengaduan wartawan Waspada Sori Parlah Harahap, yang diduga dianiaya oknum anggota DPRD Paluta, AH, saat meliput aksi un-

Waspada/Sarmin Harahap

Ratusan anggota Gerakan Mahasiswa dan Pers Tabagsel (GEMAPETA) demo di DPRD Padanglawas Utara di Gunungtua, Senin (24/5) terkait dugaan pemukulan/penganiayaan wartawan dan mahasiswa.

Kemesraan ....

jukrasa. Kemudian menanyakan apakah kasus itu sudah dikenakan UU Pers No.40 tahun 1999. Kapolres mengatakan, saat ini pihaknya sedang memproses pengaduan tersebut. Ditegaskannya mereka tidak bisa diintervensi pihak manapun dalam penanganan perkara. “Bersabarlah, kami juga sedang bekerja. Mengenai penggunaan UU Pers terhadap laporan ini, belum dilakukan karena Polisi bekerja berdasarkan KUH Pidana dan KUHAP,” katanya. Sementara, aksi unjurasa dihalaman gedung DPRD Paluta, massa GEMAPETA yang datang dengan mengendarai bus dan mobil pribadi menyuarakan tuntutannya di hadapan enam anggota dewan. Aksi itu dikawal ketat aparat kepolisian dan Satpol PP Pemkab Paluta. Dalam pernyataan sikapnya, GEMAPETA mendesak Badan Kehormatan (BK) DPRD Paluta segera memproses oknum dewan, AH, yang sudah jelas-jelas melanggar tata tertib dan etika legislatif. Mendesak Ketua DPRD Paluta agar segera melayangkan surat rekomendasi kepada partai oknum dewan tersebut agar menindaknya (merecall). (a20/csh/crm)

sibukan. “Masih ada beberapa proyek album yang akan diluncurkan tahun ini. Pertama album religi dengan Anang yang akan diluncurkan menjelang bulan Ramadhan. Kedua, album saya yang kedua pada akhir tahun ini,” kata Syahrini. Selain itu, Anang mengaku telah mendapatkan wanita yang cocok di atas panggung untuk berduet menyanyi dan menciptakan lagu. “Saya dan Syahrini sudah cocok di atas panggung di luar itu masih belum kami pikirkan,” kata Anang. Anang juga menolak dugaan memilih Syahrini karena suaranya mirip dengan suara

mantan istrinya Krisdayanti. “Lain orang maka lain pita suara dan lain juga suara yang dihasilkan,” kata Anang. Dalam album ini Anang ingin menunjukan daya kreativitasnya masih eksis dan tidak terperosok, walau rumah tangganya menghadapi huruhara. Ia bangkit dan terbukti mampu menempa kesuksesan melalui lagu “Separuh Jiwaku Pergi”. Dan kini, Anang terus memacu kesibukan dan menutup lembaran kelam masa lalunya dengan erat. Bahkan kini, Anang melebarkan sayapnya hingga ke negeri Jiran dengan pendamping barunya Syahrini.

Pengacara ....

jari di sekujur pinggang tersangka. Akibatnya, Akbar mengalami luka memar DI pinggang dan wajah. Bahkan dalam video tersebut beberapa oknum polisi terlihat tertawa saat korban mengerang kesakitan. Ironisnya lagi, polisi melakukan kekerasan terhadap Akbar dihadapan dua tersangka lainnya. “Kekerasan itu terjadi dihadapan dua rekan korban lainnya. Perbuatan ini seolah-olah dilakukan untuk memberi efek kepada rekan-rekan lainnya. Bisa saja karena takut, mereka yang ditahan mengakui perbuatan yang sama sekali tidak dilakukannya karena alasan takut disiksa,”ujarnya. Julheri juga menambahkan, kalau dirinya mendukung proses hukum terhadap tindakan anarkis yang dilakukan warga terhadap pengerusakan di beberapa kantor camat di Sibolga. Hanya saja, dinilai tidak benar kalau dalam penegakan hukum, kepolisian malah melanggar hukum. “Dari awal saya sudah

katakan kepada Kepolsian silahkan proses rekan-rekan yang telah melakukan tindak pidana seperti pengerusakan. Tetapi jangan menghalalkan segala cara dengan melanggar hukum dan mengangkangi hak asasi manusia,” sesalnya. Sebagai pengacara tersangka, tentunya Julheri akan melakukan langkah-langkah hukum seperti mempropamkan oknum polisi yang bekerja tidak profesional. Selain itu, dirinya akan memprapidanakan oknum polisi yang telah melanggar aturan. “Banyak celah yang akan kita lakukan untuk memprapidanakan mereka. Pertama mereka melakukan penangkapan terkesan membabibuta tanpa adanya surat penangkapan. Apalagi sebelumnya kita sudah sepakat dan bersedia membawa orang-orang yang mereka duga terkait kerusuhan. Bukan malah main bawa saja,” jelasnya lagi. Penyiksaan yang dilakukan oknum polisi kepada tersangka juga disesalkan Kepala Pusham Unimed Majda El

Muhtaj. “Tidak dibenarkan melakukan kekerasan. Tersangka memiliki HAM yang ada dalam kacamata hukum harus diposisikan sebagai tidak bersalah. Apalagi hal itu juga ditegaskan dalam Perkapolri No.8 Tahun 2009 tentang implementasi HAM dalam Tugas Kepolisian RI,”ujarnya. Kapoldasu Irjen Pol Drs. Oegroseno, SH membantah kalau telah terjadi kekerasan terhadap tersangka kerusuhan Sibolga. “Saya sudah cek ke Polres Sibolga tidak ada penganiayaan oleh polisi. Kalau ada penganiayaan silahkan dilaporkan ke Bidang Propam Poldasu dengan bukti-bukti yang cukup,” tegasnya. Seperti diketahui pelaku kerusuhan Pemilihan Kepala Daerah (Pilkada) Kota Sibolga terus bertambah. Setelah sebelumnya, polisi menetapkan 15 orang sebagai tersangka, 8 orang kembali diamankan setelah melarikan diri pasca kerusuhan tersebut. Total tersangka yang diamankan hingga kemarin tercatat 23 orang. (m39)

nya hasil pertanian rakyat. Yang datang pun juga dari berbagai Kabupaten yakni dari Sidikalang (Dairi), Kabupaten samosir, Taput, Tobasa dan Tapteng. “Jadi potensinya cukup besar jika dilakukan pembenahan pasar Doloksanggul tersebut. Kita harus dukung program Bupati Humbahas,” kata TN Nainggolan. Dia mengakui bahwa gebrakan pembangunan visi HUTAMAS yang dicanangkan Drs Maddin Sihombing sangat menyentuh perbaikan kesejahteraan masyarakat di berbagai lini. Apalagi dalam kurun waktu lima tahun ini, Kabupaten yang dimekarkan dari Kabupaten Tapanuli Utara (Taput) 28 Juli 2003 kini sudah banyak berubah seiring proses perkembangan azas demokrasi, pola pikir dan kultur masyarakat bonapasogit dalam konteks pembangunan di berbagai sektor. “Ini harus diakui, khususnya sektor ril yang menyentuh masyarakat pedesaan cukup signifikan, seperti pembangunan infrastruktur jalan ke berbagai kecamatan, desa maupun ke sentra-sentra pertanian produktif,” ungkap TN Nainggolan dan Saut Oloan Simamora. Hal senada juga disampaikan Ketua DPD KNPI Kabupaten Humbahas Miduk Purba, perencanaan peningkatan pembangunan pasar tradisionil Doloksanggul sudah tepat karena setiap hari pekan transaksi jual beli mencapai

miliaran. “K a m i u s u l k a n p e m bangunannya bertingkat sehingga dapat menampung para pedagang yang datang dari luar daerah. Adanya isu bahwa pasar Doloksanggul akan dipindahkan adalah tidak benar. Justru yang direncanakan adalah pengembangannya,” ujar Purba. Menjawab pertanyaan tentang figur Drs Maddin Sihombing MSi, menurutnya, selalu mengedepankan kebersamaan. Apalagi motivasi kepada generasi muda untuk lebih kreatif. Bahkan menyikapi potensi sumber daya alam yang dimiliki Kabupaten Humbahas, selama kurun waktu lima tahun ini mengutamakan kerja keras sehingga pembangunan yang dilaksanakan dapat menyentuh aspek hidup masyarakat pedesaan. Ditambahkannya, untuk mengolah lahan tidur menjadi lahan produktif. Sudah banyak pembinaan kepada Koptan (Kelompok Tani) yang dibuat. sehingga program pemberdayaan ekonomi kerakyatan dapat menyentuh aspek hidup masyarakat pedesaan. Ini realita,ungkap Ketua KNPI itu. Dalam mengoptimalisasi potensi alam daerah ini, ke depan Pemkab Humbahas harus terus berupaya melakukan berbagai gebrakan memperkuat struktur ekonomi dengan mengutamakan skala prioritas. Jadi semua stake holder harus mencermati visi dan misi yang digariskan Drs

Maddin Sihombing. Itu semuanya bertujuan untuk kepentingan masyarakat Kabupaten Humbahas. Barangkali hanya dengan menanamkan semangat kerja keras maka daerah ini dapat memanfatkan potensi yang dimiliki untuk meningkatkan kesejahteraan masyarakat. Di sisi lain, Miduk Purba menyebut, visi dan misi yang digariskan Maddin Sihombing menjadi landasan berpijak seluruh aparatur pemerintahan dan stake holder Humbahas dalam melaksanakan pembangunan dan pelayanan kepada masyarakat dalam mewujudkan masyarakat yang Mandiri dan Sejahtera. Yang jelas, pasar tradisionil Doloksanggul jika di tingkatkan pembangunannya sangat berpotensi besar menjadi pusat perekonomian dikawasan Tapanuli. Kalau benar Pemkab Humbahas sudah membuat perencanaan pembangunan pasar tradisonal itu, tentu harus didukung. Itu merupakan kepentingan masyarakat Kabupaten Humbahas. Apalagi Kota Doloksanggul ini berada di poros Kabupaten Taput, Tapteng, Dairi, Pakpak Bharat, To b a s a d a n K a b u p a t e n Samosir. Asisten II Pemkab Humbahas Ir Humutur Siagian mengatakan, Pasar Doloksanggul akan ditingkatkan pembangunannya. Itu sudah ada perencanaannya. Jadi tidak benar mau dipindahkan ke tempat lain. Pasar tersebut punya prospek cerah. (a13)

menyanyikan lagu “Jangan Memilih Aku”, salah satu lagu favorit dalam album mereka. Selain penampilan mereka yang sangat mesra di hadapan pers Malaysia, pakaian mereka sangat cocok dan kontras. Anang mengenakan pakaian lengan panjang hitam sedangkan Syahrini mengenakan gaun merah menyala dengan dada dan punggung sedikit terbuka. Akibatnya banyak wartawan Malaysia yang menanyakan kapan keduanya akan melangsungkan pernikahan. Syahrini kemudian menjawab bahwa dia belum akan menikah tahun ini karena ke-

WASPADA Selasa 25 Mei 2010

Babe Diancam ....

Timur. Babe didakwa dengan pasal berlapis yakni dakwaan primer pasal 340 KUHP tentang pembunuhan berencana dengan ancaman hukuman mati. Dakwaan subsider pasal 338 KUHP tentang pembunuhan yang menyebabkan hilangnya nyawa orang lain dengan ancaman 15 tahun penjara. Menanggapi dakwaan tersebut, pihak Babe yang diwakili kuasa hukumnya, Rangga B

Rikuser, tidak akan mengajukan eksepsi. Menurut Rangga, dakwaan jaksa sudah memenuhi syarat formal dan syarat materi. “Kronologi dakwaan juga sudah sesuai dengan penyidikan Polda Metro Jaya,” kata Rangga. Sementara itu Babe, tidak berkomentar sedikit pun. Sidang Babe akan dilanjutkan Senin 31 Mei 2010 dengan agenda mendengarkan keterangan saksi. (dtc)

Si Codet ....

saya ikhlas,” katanya. Si Codet memperkosa lima bocah SD di Bali pada awal tahun 2010 serta enam bocah SD di Batam pertengan tahun 2009. Sebagai ungkapan penyesalan, ia meminta maaf. “Kepada korban, keluarga korban, dari

dalam hati nurani yang paling dalam, saya minta maaf,” ujarnya berlinang air mata. Ia juga meminta kepada Presiden SBY, pejabat, maupun orang-orang yang mampu agar menyantuni para korban. (dtc)

Polri Yakin ....

lan tersebut dianggap ikut mempersoalkan substansi perkara Susno Duadji ketimbang fokus pada materi utama gugatan, yakni prosedur penangkapan terhadap Susno Duadji. “Itu bukan konteks praperadilan. Konteks praperadilan itu kan prosedurnya (penangkapan). Terlalu melebar,” kata anggota kuasa hukum Mabes Polri, Kombes (Pol) Izza Fadri, seusai persidangan. Pernyataan Izza ini merujuk pada beberapa bahasan materi gugatan yang dibacakan oleh kuasa hukum Susno Duadji, Henry Yosodiningrat. Dalam materi tersebut ada pula beberapa poin pembahasan terkait kasus Gayus Tambunan dan kasus arwana di PT Salma Arowana Lestari. Terkait dengan gugatan pemohon (Susno Duadji) yang mempersoalkan prosedur p e n a n g k a p a n Su s n o, i a mempersilakan hal itu karena setiap pihak bisa memiliki tafsiran sendiri-sendiri. Namun, ia kembali tidak sepakat bila materi gugatan praperadilan kemudian ikut mempersoalkan pokok perkara Susno terkait kasus di PT Salma Arowana Lestari. “Yang jelas kami hanya jawab sesuai konteks praperadilan, yaitu prosedur penangkapan.

Ada soal pokok perkara, ya kita buktikan di pengadilan dong,” katanya. Polri Yakin Menangi Polri yakin dapat memenangi sidang praperadilan atas gugatan yang diajukan mantan Kabareskrim Komjen Susno Duadji yang sudah ditahan dan ditetapkan sebagai tersangka dalam kasus dugaan suap. “Kalah menang kita tak bisa pengaruhi hakim, tapi penyidik-penyidik kita yakin bahwa tindakan yang dilakukan bisa dipertanggungjawabkan secara hukum,” kata Kepala Divisi Humas Polri Irjen Pol Edward Aritonang di Pekanbaru, Riau, Senin (24/5) Usai menghadiri Seminar Peningkatan SDM Humas yang digelar Kemenkominfo, Edward mengatakan, apa yang dilakukan Polri semata untuk penegakan hukum khususnya memberantas mafia hukum di Indonesia. Ia juga yakin bahwa para penyidik Polri tetap menjunjung profesionalisme dan tidak akan gegabah dalam menjalankan tugas mereka. “Kasus ini pertaruhan untuk profesionalisme penyidik dan harus bisa dibuktikan. Kalau asal-asalan, maka masyarakat yang akan menilai,” ujarnya. (kps/ant)

Demo Warnai ....

nyata dimasa yang datang. Sedangkan pasangan Maju Siregar SH.MM/Drs Thomson Sihite MM dengan visinya “Menjadi Kabupaten Yang Unggul Dibidang Pertanian, Pendidikan dan Kesehatan,Kebudayaan dan Pariwisata Modern”. Misinya, mewujudkan kualitas dan kuantitas produk pertanian melalui ketersediaan sarana/prasarana industri pusat pertanian yang bersis produk unggulan Kabupaten Humbahas. Sementara pasangan Esra Sinaga/ Hardis Simanullang SE dengan visi “Meningkatkan Kabupaten humbahas yang relegius, sejahtera dan berkeadilan”. Sedangkan misinya adalah meningkatkan pendidikan dan kesehatan. Meningkatkan peran serta masyarakat dalam pembangunan. Meningkatkan keamanan, keadilan dalam persatuan dan kesatuan. Usai penyampain visi dan misi, tiga calon bersama unsur Muspida dihadang massa yang tetap menuntut supaya aspirasi mereka dianulir. Pihak KPU Humbahas agar konsisten. Sehingga aparat yang dikerahkan untuk pengamanan terpaksa melakukan tembakan gas airmata kearah massa. Sehingga rombongan para

calon dan Muspida dapat melewati jalan yang diblokir massa. Massa yang merasa tidak puas karena dibubarkan secara paksa oleh aparat kepolisian, berangkat menuju jalan inti kota Doloksanggul, mereka memblokir jalan bahkan membakar ban di jalan Protokol, akibatnya pihak kepolisian langsung turun ke TKP untuk membubarkan massa. Yang berujungbentrok. Aparat Kepolisian yang sudah tidak tahan lagi menahan lemparan batu dari pengunjuk rasa, balas melempar dan menghujani pengunjukrasa dengan tembakan gas air mata bahkan mengejar pengunjuk rasa hingga kea areal persawahan. Akibat penembakan tersebut massa menjadi beringas bahkan massa tidak mau meninggalkan jalan menuju kota Doloksanggul. Akibat kejadian tersebut, empat unit gedung perkantoran dan satu unit kendaraan Puskesmas Keliling milik Dinas Kesehatan Humbahas yang berada di sekitar lokasi kantor DPRD rusak akibat lemparan batu dari pengunjuk rasa. Sedikitnya sepuluh orang pengunjuk rasa luka-luka dan sedikitnya empat orang dari anggota kepolisian. (a13)

Hal itu disampaikan Trimo dalam sidang dakwaan Babe di Pengadilan Negeri (PN) Jakarta Timur, Senin (24/5). Trimo mengatakan, Babe didakwa telah membunuh dan memutilasi Ardiansyah pada Januari 2010, Adi pada Juli 2007, Rio pada Januari 2008, dan Arif Kecil pada April 2008. Pada kasus Ardiansah, Babe melakukan perbuatannya di Gang Masjid, Kelurahan Pulogadung, Jakarta Si codet siap menerima hukuman terberat karena ia menyadari kesalahannya tersebut. “Saya mohon sekali untuk dimaafkan. Saya terima apapun hukumannya. Jika ada yang menginginkan saya dieksekusi,

“Penge-kangan terhadap kebebasan pemohon (Susno Du a d j i ) d i l a k u k a n t i d a k berdasarkan bukti cukup dan bukan untuk kepentingan penyidikan,” kata Henry. Padahal, lanjut Henry, penangkapan ataupun pengekangan terhadap seseorang dapat dilakukan hanya bila terdapat cukup bukti untuk peradilan sesuai cara-cara menurut undang-undang. Ia pun merujuk proses penangkapan terhadap Susno yang dilakukan dengan peliputan dan penyiaran secara langsung di televisi secara nasional. “Penangkapan bukan untuk kepentingan penyidikan, tetapi untuk menyengsarakan dan mempermalukan pemohon,” kata Henry. Lebih lanjut, berdasarkan Peraturan Kementerian Kehakiman tahun 1982, penyidikan harus segera dilakukan setelah penangkapan. “Faktanya, pemohon baru diperiksa pada besoknya tanggal 11 Mei 2010,” ujar Henry. Terlalu Lebar Sementara Tim kuasa hukum Mabes Polri menilai, materi gugatan praperadilan yang diajukan Susno Duadji, telah melebar dari pokok utama materi gugatan. Materi gugatan praperadinomor urut dua dan pasangan Maju Siregar SH.MM/Drs Thomson Sihite MM nomor urut tiga menyampaikan visi dan misinya di sidang paripurna. Pasangan Maddin Sihombing MSi/Drs Marganti Marganti dengan Visi “Menjadi Daerah Yang Mandiri Dan Sejahtera” dan Misi yang dijabarkan dalam kebijakan dan program akan ditindaklanjuti dengan rencana strategis (renstra) Pemkab Humbahas sebagai arah atau tolok ukur pelaksanaan pemerinrahan, pembangunan dan kemasyarakatan. Diuraikan, visi dan misi tersebut dapat dilaksanakan sebagaimana diharapkan jika seluruh lapisan masyarakat memahami secara mendalam untuk memberikan dukungan penuh di dalam mengimplementasinya demi terwujudnya masyarakat HUTA MAS (Humbang Hasundutan Yang Mandiri dan Sejahtera). Begitu juga dengan potensi dan permasalahan Kabupaten Humbahas, masih banyak yang harus dibenahi, seperti potensi Sumber Daya Alam (SDA) yang terus diupayakan untuk peningkatan kesejahteraan masyarakat. Menghasilkan keuntungan ekonomi


Berita Utama

A2 dian itu segera memberikan pertolongan dan mengevakuasi keduanya ke rumah sakit. Sementara itu, Evi istri S yang ditemui Waspada di rumah sakit mengatakan, suaminya selama 1,5 tahun ini berselingkuh dengan M disebut-sebut mahasiswi salah satu perguruan tinggi di Medan. Akibat itu, Evi berulangkali minta cerai dari suaminya itu. Tetapi S tidak mau menceraikan Evi. Evi rela suaminya menikah dengan M. Evi juga berulangkali memberitahukan kepada M bahwa mereka sudah memiliki 4 orang anak yang masih kecil-kecil dan butuh kasih sayang. Kapolsekta Medan Sunggal AKP Faisal F Napitupulu, SH,SIK bersama Kanit Reskrim Iptu Anthoni Simamora,SH, bersama personelnya yang mendapat laporan segera turun ke Tempat Kejadian Perkara (TKP) melakukan penyelidikan untuk mengusut kasus tersebut.(m31)

Jaksa Tetap ...

Sehingga surat dakwaan itu memberi arti lain kalau dipenggal secara tidak tepat,” papar Sutikno. Dia mencontohkan bagian terakhir dakwaan. Penasihat hukum Alter menerangkan bahwa di dalam dakwaan JPU, ada NIK nomer 9, tanggal 9 September 2008. “Padahal, NIK nomor itu pada tanggal sekian tidak ada. Kenapa mereka punya gambaran ini ada dalam dakwaan, karena memenggal dakwaannya itu salah. Yang dimaksud di sini sebenarnya adalah terdakwa berbekal data diri,” kata dia. Selain itu, lanjut dia, saat diteliti di Kejaksaan dan menandatangani berita acara pemeriksaan (BAP), Alter mengisi jenis kelamin perempuan. “Itu isinya juga jenis kelaminnya perempuan (dia akui sebagai laki-laki). Itu pertama. Kedua, surat perngiriman berkas perkara yang menjadi suatu bundelan utuh dalam dikirimkan Polda ke Kejaksaan Tinggi, itu isinya adalah terdakwa berjenis kelamin perempuan (mengaku laki2). Selanjutnya, ketiga surat bukti dari ahli melalui tes DNA bisa terbaca semuanya. “Kalau XY laki, XX perempuan, XXY itu ganda atau ada kelainan. Hasil tes DNA itu XX berarti murni perempuan,” ujar Sutikno. (dtc)

Sutikno meminta majelis hakim tetap menggelar sidang Alter di PN Jakarta Selatan, bukan di Las Vegas, Nevada atau Jakarta Pusat. “Tempat kediaman di wilayah hukum Jakarta Selatan saat terdakwa meminta Kelurahan Pondok Pinang mengganti status kelamin dari perempuan ke laki-laki,” kata Sutikno. Penggalan Salah Usai Sidang, Sutikno menambahkan, JPU juga menolak eksepsi karena materi eksepsi yang diajukan masuk pasal 156 ayat 1 KUHAP. “Penggalan-penggalan terhadap surat dakwaan yang digunakan oleh mereka sebagai keberatan, cara memenggal kalimatnya tidak tepat.

Anas Selangkah ... SBY. “Dia lebih memiliki peluang jika SBY tidak mengintervensi. Dan buktinya begitu,” tutupnya. Anas memperoleh 280 suara pada pemilihan Ketum PD di Hotel Manson Pine, Padalarang, Bandung, Minggu (23/ 5). Sementara rivalnya, Marzuki Alie hanya mengantongi 248 suara. Andi Mallarangen keok pada putaran pertama. (dtc)

Polri Masih Buru ... Kemudian kasus mengelabui uang nasabah Standard Chartered yang dilakukan berinisial S dan kawan-kawan. Sampai kini masih buron dan ditetapkan sebagai DPO (Daftar Pencarian Orang) Polda Sumut. Berikutnya kasus tindak pidana pengucuran kredit oleh berinisial P kepada CV Bahagia di Komplek Asia Mega Mas. “Pelapor sudah mencabut pengaduannya. Sementara tersangkanya sudah melarikan diri,” beber Syafruddin. Terkait tindak lanjut 24 Laporan Hasil Analisa (LHA) dari Pusat Pelaporan dan Analisis Transaksi Keuangan (PPATK) kepada Polda Sumut yang be-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ........, Ke2+. 2. Rf1, Kg3+. 3. Rg1 (Jika 2. Re1, Me2+mat), Mf1+. 4. BxM atau KxM, Ke2+mat.

Jawaban TTS: TTS Topik

A N E P O T I S M R E A N J A A N G A

Politik & Hukum

A S U R B A N I N U I N E M B A N T U I I K E N A M H R K I T I G U P E R S E M A R O A B P J S M I S I S I I A A M I N A N S O S I M P P P R O L E G N

G R U M E A B T U M R T I A A R D U K I J A L K S A S

Jawaban Sudoku:

6 4 7 2 1 8 5 9 3

8 5 2 9 4 3 6 7 1

3 1 9 6 5 7 8 4 2

5 9 6 7 8 2 1 3 4

2 3 8 1 6 4 9 5 7

4 7 1 5 3 9 2 6 8

1 6 3 4 2 5 7 8 9

7 2 4 8 9 6 3 1 5

9 8 5 3 7 1 4 2 6

lum ditindaklanjuti, Syafruddin mengaku masih perlu mempelajari materinya. 24 LHA PPATK kepada Polda Sumut itu diketahui dari penuturan Azamul Fadly Noor, salah satu anggota lembaga tersebut dalam pertemuan di Kantor Gubernur Sumut, Senin. Menurut Azamul, sampai 2010, sudah 24 LHA PPATK disampaikan ke Polda Sumut. Namun tindaklanjutnya kurang maksimal. Dia mengaku tindaklanjut yang belum maksimal itu, bukan karena Polda Sumut kurang serius, tapi karena kendala yang dihadapi belum bisa terpecahkan. Pertemuan DPRRI Kota Medan dan kota lain di Sumatera Utara menjadi sasaran investasi praktik pencucian uang. Potensinya bisa dari hasil praktik illegal logging, illegal fishing, judi dan trafficking. Ketua Panitia Khusus DPR RI, Irsal Yunus (F-PDIP) bersama tiga anggota lain, yakni Azis Syamsuddin (F-PG), Mustafa Kamal (F-PKS) dan Nasrulloh (F-PAN), mengutarakan hal itu dalam pertemuan dengan Pemprov Sumut, Poldasu, Kanwil Depkum HAM, BPKP Sumut, LBH Sumut dan lainnya di Kantor Gubsu. Maksud pertemuan untuk mencari masukan dan saran guna penyempurnaan materi Rancangan Undang-Undang Pencegahan dan Pemberantasan Tindak Pidana Pencucian Uang, yang merupakan hasil penyempurnaan UU Nomor 15 Tahun 2002 tentang Tindak Pidana Pencucian Uang, yang telah diubah dengan UU Nomor 25 Tahun 2003. “Kenapa kami memilih Medan, Sumut untuk menyempurnakan materi RUU ini ? Itu karena, Medan kami nilai punya potensi besar untuk money laundering,” ucap Irsal dihadapan Sekda Sumut RE Nainggolan yang memandu pertemuan, didampingi Wakapolda Sumut Brigadir Jenderal Polisi Syafruddin. Irsal mengaku, potensi besar itu karena ditopang geografis Kota Medan yang bisa langsung berhubungan dagang dengan pihak luar negeri. Sehingga menjadikan kota terbesar di wilayah barat Indonesia ini, sangat rentan praktik money laundering. Karenanya, dia bersama anggota Pansus perlu menyerap masukan dari pihak terkait di Provinsi Sumut, sehingga dampak money laundering yang bisa membuat instabilitas, hancurnya perekonomian, bisa dicegah lebih dini. (m19)

Selasa 25 Mei 2010

Kejatisu Usut Dugaan Korupsi Perjalanan Dinas DPRDSU Rp1,1 M

Seorang Pria Dan Selingkuhannya Kritis Akibat Membakar Diri MEDAN (Waspada): S, 41, bersama wanita selingkuhannya kritis akibat membakar diri di rumah kontrakan mereka di Jalan Medan-Binjai Km 12, Blok II, Desa Purwodadi, Kec. Sunggal, Kab. Deli Serdang, Minggu (23/5) malam. “Korban S menjalani perawatan di RS Sundari Jalan TB Simatupang, Kec. Medan Sunggal, dan M, 23, selingkuhannya dirawat di RS Haji Adam Malik,” kata Evi, 38, istri Supriadi kepada Waspada, Senin (24/5) siang. Menurut keterangan, peristiwa itu terjadi karena M merasa sudah disisihkan sehingga antara keduanya terjadi pertengkaran. Saat itulah M menyiramkan minyak tanah ke tubuhnya dan membakarnya. S yang mencoba mencegah ikut tersambar api sehingga keduanya terbakar dan kritis. Warga yang melihat keja-

WASPADA

Waspada/Ismanto Ismail

EVI setia menunggui S yang kritis akibat luka bakar di RS Sundari Jalan TB Simatupang, Kec. Medan Sunggal, Senin (24/5() siang.

Empat Fraksi DPRD ... Kemudian, Ria Novida Telaumbanua/Suriyatno, Moh Heriza Syahputra/Horas Silitonga, Hulman Sitorus/Koni Ismail Siregar, Margan RP Sibarani/Rupina Aruan, Frans Immanuel T Saragih/Rokibah Hasibuan dan Barkat Shah/ Boundeth Damanik. Ke empat fraksi yang meninggalkan ruang sidang itu, F-PDIP, F-PAN, F-Kebangsaan dan F-Karya Peduli Nurani, termasuk dua wakil ketua DPRD Timbul Lingga asal PDIP dan Zainal Purba asal PAN. Sehingga hanya F-Demokrat yang bertahan. Saat pasangan pertama menyampaikan visi dan misi, ke empat fraksi tetap bertahan di ruang sidang, namun keluar saat calon walikota incumbent RE Siahaan dan pasangannya

Hari Ini Jenazah ... Setelah serah terima, jenazah akan disholatkan yang rencananya akan dipimpin oleh Prof. Arif Rahman. Kemudian jenazah diberangkatkan ke TMP Kalibata sekitar pukul 10:00, didahului dengan upacara serah terima kembali dari keluarga ke pemerintah. Upacara pemakaman di TMP Kalibata dijadwalkan pada pukul 11:00 yang dipimpin oleh Presiden RI Susilo Bam-

Kurir Teroris ... Pasal 15 jo Pasal 7 UU Nomor 15 tahun 2003 tentang Penetapan Peraturan Pemerintah Pengganti Undang-Undang (Perppu)UUNomor1tahun2002 tentang Pemberantasan Tindak Pidana Terorisme. Pasal 15 jo Pasal 9 UU Nomor 15 tahun 2003 tentang Penetapan Peraturan Pemerintah Pengganti Undang-Undang (Perppu) UU Nomor 1 tahun 2002 tentang Pemberantasan Tindak Pidana Terorisme, dan Pasal 13 huruf b UU Nomor 15 tahun 2003 tentang Penetapan Peraturan Pemerintah Pengganti Undang-Undang (Perppu) UU Nomor 1 tahun 2002 tentang Pemberantasan Tindak Pidana Terorisme. JPU menyatakan sesuai fakta persidangan terdakwa

Lukisan Dicuri, ... Para pejabat museum mendapati bahwa kelima lukisan tersebut, yang meliputi karya Matisse dan Amedeo Modigliani, hilang Kamis, setelah menemukan kaca jendela pecah. “Pemerintah Prancis telah memastikan polisi di seluruh dunia sekarang telah menerima keterangan yang mereka perlukan untuk membantu melacak dan akhirnya menemukan kembali karya seni yang dicuri ini,” kata Jean-Michel Louboutin dari Interpol. Karya seni yang dicuri itu adalah “Dove with Green Peas” karya Picasso, “Pastorale” dari Matisse, “Olive tree near l`Estaque” karya George Braque, “Woman on the range” karya Modigliani dan “Still life with candlesticks” oleh Fernand Leger.

Dalai Lama ... Bikshu yang amat dikenal dunia itu, yang telah hidup di pengasingannya di India sejak 1959, setelah dia gagal memimpin perlawanan Tibet terhadap kekuasaan China. Dalai Lama mengatakan dia yakin ‘otonomi’ berpemerintahan sendiri bagi Tibet di dalam negara China mungkin ketimbang pemisahan total dari negara super power (adikuasa) itu — namun nampaknya dia tidak punya dukungan temantemannya untuk menduduki tempat tertinggi di sana. “Sejumlah pejabat China, menganggap saya sebagai setan — yang memiliki tanduk,” katanya, sambil menggambarkan dengan dua jarinya sebagai tanduk di kepalanya. Beberapa warga Tibet memberitahu dia bahwa mereka takut mengunjungi pemerintahnya di pengasingan

Burhan Saragih memaparkan visi misi mereka. Namun sesudah calon incumbent selesai memaparkan visi visinya, 4 fraksi itu kembali masuk ke ruang sidang. Sikap meninggalkan ruang sidang diawali interupsi anggota DPRD EB Manurung, dari Partai Buruh, usai sekretaris DPRD mempersilahkan calon walikota incumbent dan pasangannya memaparkan visi misi mereka. Menurut Manurung, sesuai peraturan perundang-undangan, walikota yang kembali mencalonkan diri seharusnya menyampaikan LKPj kepada DPRD sebelum mendaftar ke KPUD. Namun sampai pemaparan visi misi, DPRD belum menerima LKPj walikota, sehingga tidak mengetahui perkembangan pembangunan di Pematangsiantar.

“Izinkan kami meninggalkan ruang sidang ini ketua,” kata Manurung, seraya berdiri dan meninggalkan ruang sidang diikuti rekannya dari empat fraksi, termasuk kedua wakil ketua DPRD. Protes Sementara, Ketua Panwas Pilkada Fetra Tumanggor mengatakan, pihaknya tidak menerimaundanganpenyam-paian visi misi itu. Karenanya, dia mengatakan protes keras terhadap DPRD yang menye-lenggarakan rapat paripurna istimewa itu. “Kami sudah menyampaikan surat protes itu kepada pimpinan DPRD,” kata dia. Senada dengan itu, Ketua KPUD Rajaingat Saragih mengatakan, tidak hadir dalam pemaparan visi misi pasangan calon karena tidak diundang. “DPRD tidak mengerti mekanisme,” tandasnya. (a14)

bang Yudhoyono. Hasri Ainun Habibie wafat di Rumah Sakit Ludwig Maximilians Universitat, Klinikum Gro‘hadern, Munchen, Jerman Sabtu (22/5) pada pukul 17.30 waktu Jerman (atau pukul 22.30 WIB) di usia 73 tahun. Ainun Habibie lahir di Semarang 11 Agustus 1937 dan menikah dengan BJ Habibie (Presiden RI ke-3) pada 12 Mei 1962. Dari hasil pernikahannya dengan BJ. Habibie, almarhumah dikaruniasi dua orang

anak yakni Ilham Akbar dan Thareq Kemal. Semasa hidupnya, almarhumah dikenal sebagai sosok ibu yang cerdas, pandai mendidik, cinta pada keluarga, gigih, dan memiliki jiwa sosial yang tinggi. Menjelang akhir hayatnya, Ainun Habibie tetap aktif bekerja untuk Yayasan Bank Mata sebagai ketua umum. Cita-citanya adalah memasyarakatkan donor mata dan membangun klinik mata.

mengantarkan Noordin M Top dan mengetahui rencana peledakan Hotel JW Marriot pada 17 Juli 2009. “Yang memberatkan dari perbuatan terdakwa, yakni, meresahkan masyarakat dan menghalangi upaya pemberantasan tindak pidana terorisme,” katanya. Sementara itu, kuasa hukum dari terdakwa, Syafruddin A Datu, menyatakan tuntutan dari JPU tersebut terbilang wajar hingga dituntut lebih ringan dibandingkan tersangka teroris lainnya. “Selama ini, kliennya saya bersikap kooperatif dan jujur mengakui perbuatannya,” katanya. Sebelumnya, di dalam dakwaan JPU disebutkan terdakwa pada 17 Juli 2009 bertempat di Hotel JW Marriot dan Hotel The

Ritz Carlton melakukan permufakatan jahat, percobaan atau pembantuan untuk melakukan tindak pidana terorisme. JPU menyebutkan terdakwa bersama teroris lainnya, Saefuddin Zuhri menjemput Noordin M Top di daerah Sampang, Cilacap. Terdakwa juga menjemput bomber untuk peledakan bom di Hotel JW Marriot, Dani Dwi Permana, kemudian terdakwa bersama Noordin M Top, Saeufudin Zuhri dan Dani Dwi Permana menginap di kamar Nomor 15 Hotel Shanty di Kuningan, Jawa Barat. Kemudian terjadi ledakan bom di Hotel Ritz Carlton dan Hotel JW Marriot yang mengakibatkan 11 orang tewas dengan rincian 8 orang meninggal di JW Marriot dan 3 orang meninggal di Ritz Carlton.

“Lukisan yang luar biasa ini oleh para master besar ini sangat terkenal sehingga semuanya akan sulit dijual,” katanya. Para ahli telah menyatakan gerombolan penjahat yang berusaha memperoleh uang dari museum atau negara, atau yang memperdagangkan karya seni untuk membeli narkotika atau senjata, boleh jadi berada di balik pencurian itu. Pencurian Marseille Satu lagi karya Picasso dicuri Jumat di Prancis selatan dari rumah seorang kolektor seni, yang dipukuli selama aksi pencurian tersebut, kata satu sumber polisi Sabtu. Karya yang paling penting dalam peramasan itu adalah satu “lithograph”, sementara karya lain adalah karya artis yang kurang terkenal , kata sumber tersebut, tanpa menyebutkan nama artis lain itu.

“Lithograph” adalah salinan sah dari karya yang diciptakan oleh artis itu sendiri atau karya orang lain yang ahli. Tergantung atas kualitas cetakannya atau nomor produksinya, “lithograph” dapat memiliki nilai yang cukup tinggi. Pencurian tersebut adalah satu lagi aksi kejahatan dari serangkaian pencurian di Marseille sejak Desember. Pencuri telah membawa kabur sebanyak 30 lukisan, termasuk satu karya Picasso, dari satu vila pribadi pada Januari. Satu lukisan artis impresionis Prancis Edgar Degas dicuri dari satu museum pada Desember. Menurut Art Lost Regiter, yang mendaftar sebanyak 170.000 karya yang hilang, karya Picasso adalah yang paling banyak dicuri di antara seluruh karya seni di seluruh dunia.

di Dharamsala, India, karena mereka yakin mereka selalu dibuntuti oleh mata-mata China. “Mata-mata yang mana pun disambut baik,” katanya. “Kita tidak perlu sembunyisembunyi.” Propaganda pemerintah China telah menjatuhkan hukuman paling buruk terhadap warga Tibet — yang memberikan keyakinan pada nasyarakat lainnya bahwa warga Tibet adalah orang terbelakang dan bodoh-bodoh,” kata pemenang Hadiah Nobel itu, yang mengenakan jubah bikshu yang berwarna oranye keemasan. Dia mengatakan pemerintah China telah mengajaknya kembali pulang ke Tibet pada tahun 1980an, namun dia menolak. “Masalahnya adalah hak-hak sipil. Sampai mereka memenuhi itu, maka tidak ada jalan bagi saya untuk pulang,” kata pemimpin berusia 75 tahun itu. Para pengunjung kon-

ferensi itu, baik dari kalangan China maupun Tibet merasa amat terkesan dengan pidato Dalai Lama tersebut. “Ketika dia masuk, saya merasa terpesona,” kata mahasiswi Hunter, Annie Su, 22, yang tinggal di Elmhurst, Queens. “Boleh jadi kedengarannya dangkal, namun airmata saya berlinang. Dia amat menawan.” Tenzin Gelek, 28, yang tinggal di kemp pengungsi Tibet di India sampai 2008, yang membantu penyelenggaraan pertemuan itu — yang dinamakannya Konferensi Jembatan (Bridge Conference) — untuk makin memperdalam saling pengertian antara para mahasiswa China dan Tibet di Amerika Serikat. “Sistem pendidikan Barat semuanya tentang objektivitas. Lebih mudah bagi kita untuk memahami sikap satu sama lainnya di sini di Amerika,” katanya. (daily news/m07)

MEDAN (Waspada): Kejaksaan Tinggi Sumatera Utara, kini tengah mengusut dugaan korupsi perjalanan dinas luar daerah anggota DPRD Sumut senilai Rp 1,01 miliar. Pengusutan ini berdasarkan adanya hasil audit keuangan Badan Pemeriksa Keuangan (BPK) RI tahun anggaran 2008, dimana anggaran tersebut fiktif. Surat BPK RI No.17/R/S/ I-VII_TKHP/02/2010 tanggal 4 Februari 2010 tentang dugaan tindak pidana korupsi di Sekretariat DPRD Sumut, ditujukan Kepada Jaksa Agung RI, tembusannya disampaikan kepada Kajatisu. Menurut sumber di Kejatisu, Kejatisu mencurigai dugaan penyelewengan anggaran berdasarkan hasil audit BPK RI, dimana penggunaan anggaran perjalanan dinas luar daerah senilai Rp 1.019.660.200 untuk biaya perjalanan menggunakan pesawat udara. “Hasil audit BPK RI menyebutkan ketika dicek kepada maskapai penerbangan, ternyata penerbangan ini menggunakan nama fiktif. Bukan nama anggota DPRD Sumut,” ujar sumber itu. Adanya temuan inilah ber-

potensi merugikan keuangan negara, khususnya Sekretariat DPRD Sumut. Kemudian, melanggar UU No. 31/1999 tentang pemberantasan korupsi, yang sudah dirubah dengan UU No20/2001.”Kasus ini masih tahap pengumpulan data dan keterangan,” katanya. Kepala Seksi Penerangan Hukum Kejatisu Edi Irsan Kurniawan Tarigan ketika dikonfirmasi tidak membantah adanya pengusutan dugaan korupsi di DPRD Sumut itu. Hanya saja dia mengaku belum tahu sejuahmana pengusutan kasus tersebut. Karena secara detail dirinya belum mendapatkan informasi dari tim penyidik intlijen . “Kasus ini masih dalam pendalaman bidang intelijen, dan belum melakukan pemanggilan kepada pihak terkiat dalam kasus itu,” tegas Tarigan. Ketika mantan pejabat Sekretariat DPRD Sumut Ridwan Bustan dihubungi wartawan secara terpisah, kemarin, enggan memberikan penjelasan apapun, bahkan pesan singkat yang dikirimkan ke handphonenya juga tidak ada dibalas. Korupsi Disbudpar Sementara itu, dalam ka-

sus berbeda, Tim Pidana Khusus Kejaksaan Negeri Medan, Senin (24/5), resmi menahan tersangka dugaan korupsi di Dinas Kebudayaan dan Pariwisata (Disbudpar) Kota Medan tahun 2008 senilai Rp2,4 miliar. “Kami tetapkan dua tersangka, yakni mantan Kepala Dinas Kebudayaan dan Pariwisata (Disbudpar) Syarifuddin dan mantan Kepala Subdis Sarana dan Prasarana Ramlan Nasution. Hari ini (Senin-red) kami resmi menahan Ra (Ramlan) dalam dugaan korupsi APBD Medan Tahun 2008,” kata Kasi Pidsus Dharmabella Timbasz kepada Waspada seraya menambahkan Ra yang kini menjadi staf Inspektorat Pemko Medan, sebelumnya dia menjabat Pelaksana Teknis Kegiatan (PPTK) yang melilit dirinya ke tahanan. Menurut Dharmabella, karena tersangka Syarifuddin saat masih menjalani proses penahan di Rutan T.Gusta dalam kasus korupsi Festival Budaya Islam. Kedua tersangka dijerat pasal 2 dan pasal 3 ayat (1) Jo pasal 18 UU R1 No 31 tahun 1999 tentang pemberantasan tindak pidana korupsi, dimana ancaman hukumannya maksimal empat tahun. (h05)

Waspadai Sungai ...

selama ini mengarah ke kawasan Pulau Jawa. Masyarakat harus mewaspadai kondisi cuaca ini. Massa udara kawasan di Jawa belum bertemu dengan massa udara belahan utara khatulistiwa, seperti kawasan Sumatera Utara dan sekitarnya, menyebabkan suhu panas meningkat. Hal itu, kata Firman, suhu permukaan laut juga meningkat sehingga berpeluang angin kencang dan petir menyebabkan hujan secara sporadis di

kawasan Medan. “Hujan yang terjadi pada siang bahkan sore hari sifatnya hujan lokal, namun sporadis yang disertai angin kencang, petir dan kedepan masih akan terjadi lagi,” katanya. Menurut dia, kondisi itu diakibatkan meningkatnya suhu udara panas beberapa hari belakangan ini mencapai angka 34 hingga 35 derajat Celcius bahkan lebih. Suhu panas tersebut bertahan rata-rata tiga jam menyebabkan warga Medan resah. (m32)

SNMPTN, dan 18 Juni hari Jumat. Jadi, terpaksa kita buat 19 Juni,” katanya. Ketika ditanya apakah tidak ada lagi perubahan jadwal Pilkada Kota Medan, Tamba menjawab tidak ada. “Pilkada Kota Medan sudah pasti 19 Juni.” Kampanye tiga hari Dipaparkan Tamba, dengan penetapan Pilkada pada 19 Juni, maka diberikan kesempatan kepada masing-masing pasangan calon untuk melakukan kampanye selama tiga hari mulai 13-15 Juni dan 16-18 Juni masa tenang. Sedangkan pada 20 Juni penghitungan hasil suara pa-

sangan calon walikota dan wakil walikota di tingkat Panitia Pemilihan Kecamatan (PPK) dan pada 21 Juni rekapitulasi di KPU Medan. Menurut Tamba, jika ada gugatan di MK oleh pasangan calon walikota dan wakil walikota yang maju pada putaran kedua, akan diberikan kesempatan pada 22-24 Juni nanti. Bila tidak ada, lanjutnya, maka KPU akan melakukan persiapan SK walikota terpilih dan pelantikan dilaksanakan pada Senin (19/7). “Kalau semuanya lancar, maka pelantikan walikota dan wakil walikota terpilih dilakukan pada 19 Juli,” katanya. (h10)

nggak ada api,” kilah Jimmy. Namun, Jimmy enggan menjelaskan secara rinci karena buru-buru meninggalkan sejumlah wartawan untuk melihat situasi kebakaran tersebut. Kapolsekta Medan Barat AKP Robertus Pandiangan yang ditemui di lokasi kejadian menuturkan penyebab kebakaran karena adanya gumpalan asap keluar dari cerobong asap dapur hotel tersebut. Namun pihaknya masih melakukan penyelidikan untuk mengetahui penyebab kebakaran. “Karena tersumbat terlalu banyaknya asap yang di dalam, jadi asapnya keluar dari cerobong dapur,” ujar AKP Pandiangan. Salah seorang petugas Dinas Pencegah dan Pemadam Kebakaran menuturkan sempat melihat adanya percikkan api dari cerobong asap yang merupakan tempat pengeluaran asap dari dapur. Pihaknya melakukan pendinginan dengan menggunakan alat blo-

wer untuk mengeluarkan gumpalan asap yang telah menyebar hampir ke seluruh ruangan Hotel tersebut. “Kami hanya berusaha untuk memadamkan api dengan menurunkan empat unit mobil pemadam dan gumpalan asapnya kami sedot pakai blower,” sebut petugas pemadam kebakaran itu. Pantauan Waspada, petugas hotel sempat memadamkan api dengan menggunakan beberapa tabung racun api. Dalam tempo sekejap, api berhasil dipadamkan namun kepulan asap masih terlihat berada di ruangan dapur dan menyebar ke ruang pertemuan yang letaknya berdekatan ruang dapur Meranti Coffee Shop. Petugas dari Dinas Pencegah dan Pemadam Kebakaran terpaksa menghidupkan mesin penyedot asap dari ruang pertemuan untuk menyedot kepulan asap sekaligus mensterilkan ruangan tersebut. (cat)

Stasiun Bandara Polonia Medan Firman, Senin (24/5). Kata Firman, kondisi udara tidak bersahabat dan terlihat ada penyimpangan cuaca, seperti di kawasan Pulau Jawa bahkan Jawa Timur saat ini sedang terjadi hujan lebat maupun banjir. Angin kencang dan petir disebabkan belum bertemu dua massa udara (konvergensi), sehingga hujan-hujan yang mengakibatkan terjadi banjir

Pilkada Medan ... pasangan calon, yakni Rahudman-Eldin dan Sofyan TanNelly Armayanti beserta Panwas maupun KPU Medan. “Karena kalau dipertahankan pada 15 Juni tidak memungkinkan dengan alasan adanya gugatan tersebut yang putusannya pada 11 Juni,” ujarnya. “Pencetakan kertas surat suara dilakukan harus setelah ada putusan di MK pada 11 Juni. Jadi, tidak mungkin pada 15 Juni pemungutan suara. Waktunya sangat sempit untuk melakukan pencetakan kertas surat suara. Sementara pada 16-17 Juni penerimaan

Hotel Emerald Garden ... Mengetahui hal itu, petugas koki yang berada di dapur langsung melaporkan ke pihak manajemen dan Polsekta Medan Barat. “Saya terkejut melihat ada asap yang keluar dari cerobong dapur. Jadi kami langsung keluar kasih tahu yang lain,” beber Sudarto, koki Hotel tersebut kepada sejumlah wartawan. Seorang tamu hotel, Frans, 50, karyawan Pertamina yang sedang berada di kamar 431 lantai IV mengaku sangat terkejut mengetahui adanya kebakaran di dapur. “Kami nggak tahu, tiba-tiba dikasih tahu ada terbakar, jadi kami langsung keluar kamar,” ujarnya. Sementara Jimmy, pihak manejemen Hotel mengakui jika asap keluar dari cerobong dapur yang terlalu panas sehingga mengeluarkan asap yang telah lama tersumbat. “Dari cerobong asap keluarnya,


Nusantara

WASPADA Selasa 25 Mei 2010

A3 Bukit Barisan Longsor SUMSEL (Antara): Longsor setinggi 100 meter dan panjang 400 meter di kawasan Bukit Barisan di Dusun Talang Ayik Salak, Kecamatan Jangkarmas, Dempo Utara, Kota Pagaralam, Sumsel telah merusakkan puluhan ribu tanaman kopi. Antara mengamati di lokasi, Senin (24/5) melaporkan, longsor yang terjadi Minggu (23/ 5) itu nyaris menimbun tiga pondok warga yang berjarak sekitar 1 meter dari tebing yang runtuh. Lokasi longsor berjarak sekitar 4 kilometer dari Dusun Jabat Akar, Kelurahan Jangkarmas, Kecamatan Dempo Utara. Bencana terjadi akibat hujan deras yang mengguyur Pagaralam satu minggu terakhir, mengakibatkan sejumlah daerah terutama Bukit Kayu Manis longsor cukup besar. Kemudian ada juga hutan di sepanjang sungai sudah banyak beralihfungsi dan gundul. Meskipun tidak menimbulkan korban jiwa, tapi kerusakan kebun kopi cukup parah mencapai puluhan hektare akibat longsor itu. Terdapat lima titik lokasi perbukitan itu yang mengalami longsor. “Sebetulnya sudah berulang kali terjadi longsor dan banjir bandang termasuk di daerah

Bukit Kayu Manis. Sebagian besar posisi areal perkebunan kopi dan persawahan sudah rusak akibat banjir dan longsor itu, pada saat hujan deras berlangsung,” kata Edo, warga setempat. Dia menyatakan, akan membahayakan bagi warga pemilik kebun jika tetap tinggal di sekitar lokasi longsor, apalagi ada tiga pondok hanya berada sekitar 2-3 meter saja dari lokasi tersebut. Bencana alam ini biasanya sulit dilakukan penanggulangan, mengingat lokasi ini kebanyakan kebun kopi bukan hutan. “Dampak kerusakan bukan hanya ribuan batang kopi, tapi juga membuat sawah mengecil tertimbun tanah. Daerah ini paling sering terjadi bencana alam bila memasuki musim hujan terutama banjir bandang. Kemungkinan kondisi ini dampak dari kerusakan hutan di lereng Gunung Dempo,” kata dia pula. Kepala Badan Kesbanglinmaspol dan PBA Pagaralam Yapani Rachim mengakui ada beberapa daerah cukup rawan terjadi bencana alam berupa longsor dan banjir badang. Namun sudah disiagakan tim pengendalian bencana, mulai dari tingkat kelurahan di kota termasuk tim SAR.

Gelombang Merak-Bakauheni Berpeluang Satu Meter

Antara

SABU-SABU: Sejumlah Anggota Satnarkoba Polda Kepri menunjukan barang bukti Sabu senilai satu Milyar rupiah beserta AZ (kiri) tersangka pembawa Sabu yang berhasil digagalkan di Pelabuhan Rakyat, Tanjung Sengkuang, Batam Provinsi Kepri, Senin (24/5). Sabu seberat satu kg dari Malaysia tersebut akan diedarkan di Batam.

Anemia Sebabkan Anak Sulit Berfikir JAKARTA (Waspada): Kekurangan zat besi atau anemia pada bayi dan balita akan melemahkan kualitas tumbuh kembang anak. Anak dengan anemia menjadi sulit berfikir, kehilangan konsentrasi dan sulit mengontrol emosi. Sayangnya, separuh dari 25 juta balita di Indonesia mengalami defisiensi atau kekurangan zat besi. Hal itu terjadi karena pada usia kurang dari 2 tahun,

asupan zat besi tidak diberikan. “Orang tua banyak yang tidak sadar betapa penting memberikan asupan gizi besi pada anak di masa pertumbuhan otak antara 0-2 tahun itu,” kata dokter spesialisasi anak, yang juga ketua Ikatan Dokter Anak Indonesia (IDAI) Soedjatmiko pada seminar kesehatan Hidup sehat dan semangat tanpa anemia, diadakan Sangobion di Cilandak Town Square, Jakarta, Senin (24/5).

Jika dibiarkan, kata Soedjatmiko, kualitas manusia Indonesia masa depan akan sangat terganggu. Indeks Prestasi Manusia (IPM) Indonesia bisa terus menurun atau tetap berada di bawah rata-rata kualitas manusia di antara negaranegara Asia Tenggara. Saat ini, IPM Indonesia berada di urutan 110 dari 170 negara. Singapura berada di urutan 25, Malaysia 61, Thailand 73 sedangakn Vietnam berada

Pimpinan KPK Temui Panitia Seleksi JAKARTA (Antara): Pimpinan Komisi Pemberantasan Korupsi (KPK) rencananya bertemu dengan panitia seleksi (pansel) calon pimpinan KPK pada Selasa (25/5), hari ini. “Rencananya pimpinan KPK memenuhi undangan untuk bertemu pansel besok,” kata Juru Bicara KPK, Johan Budi di Jakarta, Senin (24/5). Pimpinan KPK yang akan hadir dalam pertemuan itu, Chandra Martha Hamzah, M Jasin dan Haryono. Menurut Johan, Wakil Ketua KPK Bibit Samad Rianto tidak bisa hadir karena sedang ada tugas kedinasan. Pertemuan akan berlangsung di Gedung Kementerian Hukum dan HAM, yang juga menjadi sekretariat panitia seleksi pukul 10:00. Johan menjelaskan, pertemuan itu hanya merupakan forum diskusi tentang sosok pimpinan KPK yang ideal. Menurut dia, pimpinan KPK ke-

mungkinan akan ditanya tentang kebutuhan KPK, karena mereka yang paling mengetahui kondisi internal di KPK. Menurutnya, KPK membutuhkan pimpinan yang memiliki integritas, berani, dan memiliki rekam jejak yang baik. Johan menegaskan, KPK tidak memiliki niat untuk mengawasi panitia seleksi. KPK hanya menjalankan tugas sesuai yang diamanatkan undang-undang. “Kalau ada informasi dari masyarakat bahwa ada sesuatu yang aneh dalam pemilihan pejabat publik, itu bisa saja disampaikan ke KPK,” kata Johan menjelaskan salah satu amanat undang-undang itu. Panitia seleksi akan mencari dua calon pimpinan KPK. Kedua calon itu nantinya akan dilaporkan ke Presiden SBY dan diteruskan ke DPR untuk menjalani uji kelayakan dan kepatutan. Setelah itu, DPR akan memilih satu orang untuk dilantik

menjadi pimpinan KPK, mengisi kekosongan kepemimpinan KPK yang ditinggalkan Antasari Azhar yang terjerat kasus hukum. Ketua Panitia seleksi yang juga Menteri Hukum dan HAM Patrialis Akbar optimistis panitia seleksi mampu menjaring pendaftar untuk mengikuti seleksi pimpinan KPK. Selain memasang pengumuman terbuka di media massa, menurut Patrialis, panitia juga berwenang aktif mencari tokoh antikorupsi yang dianggap mampu untuk mendaftar dan mengikuti seleksi menjadi pimpinan KPK. Panitia mengusulkan anggaran Rp2,5 miliar untuk biaya proses seleksi. Menurut dia, sebagian besar anggaran itu dialokasikan untuk biaya pemasangan pengumuman di media massa. Sisanya untuk biaya operasional panitia seleksi. Dia memastikan panitia akan membuka pendaftaran 25 Mei 2010.

KPK Resmi Selidiki Kasus Jhonny Allen JAKARTA (Antara): KPK resmi memulai penyelidikan atas kasus dugaan suap yang diterima anggota DPR Jhonny Allen Marbun berdasarkan laporan Risco Pesiwarissa, orang yang mengaku sebagai mantan staf Jhonny. “KPK mulai melakukan penyelidikan atas laporan Risco,” kata Juru Bicara KPK, Johan Budi ketika ditanya di Jakarta, Senin (24/5). Johan menegaskan, penyelidikan itu dilakukan untuk mencaridataapakahpengakuanRisco itu benar atau tidak. Rencananya, KPK akan memeriksa sejumlah pihak terkait, termasuk Jhonny Allen untuk memperjelas kasus itu. “Kemungkinan pemeriksaan itu selalu ada,” kata Johan. Sebelumnya, tim KPK memeriksa Risco Pesiwarissa, orang yang mengaku sebagai mantan staf anggota DPR Jhonny Allen Marbun, dalam kasus dugaan suap kepada legislator tersebut. Johan menjelaskan, permin-

taan keterangan kepada Risco saat itu masih bersifat klarifikasi. Karena itu, belum ada pembuatan Berita Acara Pemeriksaan (BAP). “Dari hasil meminta keterangan itu KPK memutuskan melakukan penyelidikan,” kata Johan. Nama Risco disebut dalam kasus dugaan suap proyek stimulus fiskal 2009 di Departemen Perhubungan yang melibatkan mantan anggota DPR Abdul Hadi Djamal dan pegawai Departemen Pehubungan, Darmawati Dareho. Abdul Hadi ditangkap KPK karena menerima 90 ribu dolar AS dan Rp54,5 juta dari Hontjo Kurniawan yang disampaikan melalui Darmawati Dareho. Tetapi dia membantah berinisiatif meminta uang atau menerima suap dalam proyek itu, sebaliknya menyebut semua aliran dana atas sepengetahuan dan persetujuan anggota DPR Jhonny Allen Marbun. Menurut Abdul Hadi, uang itu rencananya akan diserahkan

kepada Jhonny Allen. “Jhonny sudah menerima Rp1 miliar melalui asisten pribadinya Risco. Uang itu adalah sebagian dari komitmen penyerahan sebesar Rp3 miliar,” kata Hadi. Ketika kasus itu mencuat, Risco menghilang. Namun akhirnya Risco muncul dan mengaku telah menyerahkan Rp1 miliar kepada Jhonny Allen. Saat mendatangi KPK, Risco membenarkan menerima uang Rp1 miliar dari Abdul Hanan, asisten Abdul Hadi Djamal. Dia kemudian menyerahkan uang itu kepada Jhonny Allen di suatu ruangan di kompleks hunian Aston Residence. “Saya sendiri yang menyerahkan,” kata pria berusia 28 itu mengaku disuruh Jhonny Allen untuk mengambil uang itu dari asisten Abdul Hadi. Sementara, Jhonny Allen sudah berkali-kali membantah dan mengaku tidak mengetahui tentang aliran dana, serta tidak mengenal Risco, Hontjo Kurniawan dan Darmawati Dareho.

di urutan 108. Kekurangan zat besi juga dialami 40 persen ibu hamil. Demikian juga perempuan usia subur, lebih 26 persen di antaranya mengalami anemia. Pada ibu hamil kekurangan zat besi menyebabkan bayi lahir prematur, cacat otak, perdarahan hingga risiko kematian saat melahirkan. “Sementara pada perempuan usia 15-49 tahun, anemia bisa membuat mereka tidak bersemangat, lemah, letih,

BANDARLAMPUNG (Antara): Badan Meteorologi Klimatologi dan Geofisika (BMKG) memprakirakan tinggi gelombang di Perairan Merak-Bakauheni berpeluang satu meter. Selain itu, prakiraan cuaca BMKG, Senin (24/5), menyebutkan cuaca di Selat Sunda bagian utara tersebut berawan, dengan angin bertiup dari timur ke tenggara dengan kecepatan 0408 knot. Di Selat Sunda bagian selatan, cuaca diprakirakan berawan, angin dari timur ke tenggara dengan kecepatan 10-20 knot dan tinggi gelombang 1,5-2,0 meter. Cuaca berawan banyak berpeluang di Selat Bangka bagian utara dan Selat Gelasa, angin bertiup dari timur ke selatan dengan kecepatan 02-10 knot dan tinggi gelombang 0,3-0,5 meter.

Di Selat Bangka bagian selatan, cuaca hujan, angin dari timur ke selatan dengan kecepatan 03-10 knot, dan tinggi gelombang 0,3-0,5 meter. Sementara di Selat Bali bagian utara (Ketapang-Gilimanuk) berpeluang hujan ringan, angin dari timur ke tenggara dengan kecepatan 03-17 knot dan tinggi gelombang 0,30,5 meter. Di Selat Bali bagian selatan dan Selat Badung tinggi gelombang berkisar 0,4-1,5 meter, cuaca berpeluang hujan ringan, dan angin dari timur ke tenggara dengan kecepatan 03-20 knot. Sedangkan di Selat Lombok bagian utara (Padang Bai-Lembar) dan Selat Lombok bagian selatan pun berpeluang hujan ringan, angin dari timur ke tenggara dengan kecepatan 0517 knot, dan tinggi gelombang 0,4-1,3 meter.

Laporan ke: 19

DOMPET PEDULI UMMAT WASPADA lesu hingga sering pingsan,” kata Soedjatmiko. Dia menyarankan ibu rumah tangga mencari tahu apa saja sumber zat besi dalam makanan yang disajikan. Sayuran seperti bayam, kangkung, kacang-kacangan serta hati dan daging adalah sumber zat besi yang sangat baik. “Tapi kalau tidak punya uang beli daging, ibu bisa sediakan bayam dan tempe di rumah. Itu sudah cukup protein dan zat besi.”(dianw)

Kembudpar Akan Revitalisasi 80 Museum SUMENENP (Antara): Kementerian Kebudayaan dan Pariwisata (Kembudpar) akan merevitalisasi 80 museum dalam jangka waktu lima tahun mendatang. Direktur Museum Direktorat Sejarah dan Purbakala Kembudpar, Intan Mardiana di Sumenep, Madura, Jawa Timur, Senin (24/5) menjelaskan bahwa kondisi sebagian besar dari 275 museum di Indonesia cukup memprihatinkan. “Oleh karena itu, kami punya program revitalisasi 79 hingga 80 museum dalam jangka waktu lima tahun mendatang,” katanya di sela-sela kunjungan ke museum daerah milik Pemkab Sumenep. Dia mengatakan, idealnya museum dikelola tenaga profesional yang memiliki tim ahli yang bisa menangani semua jenis benda peninggalan sejarah yang menjadi koleksinya. “Bicara museum itu tidak hanya bangunannya saja, akan tetapi hal paling penting adalah koleksinya yang harus dipastikan terawat, tidak rusak dan bisa dilihat sepanjang masa sebagai benda peninggalan sejarah.” Sebagai benda peninggalan sejarah, kata Intan, koleksi museum bisa menjadi sarana edukasi dalam rangka mencerdaskan anak bangsa. “Perjalanan bangsa dan negara Indonesia bisa dilihat dari benda peninggalan sejarah. Kalau bicara lokal, masa lalu Sumenep bisa dilihat dari benda peninggalan sejarah yang ada di museum ini,” katanya. Intan mengemukakan, untuk mewujudkan museum sebagai sarana edukasi sekaligus rekreasi menyenangkan, butuh komitmen dari para pemangku kepentingan, utamanya pemerintah daerah setempat. “Di tingkat pusat, kami punya komitmen mewujudkan museum yang representatif sebagai sarana edukasi dan rekreasi. Namun tentunya butuh dukungan dari pemerintah daerah. Museum sebagai wahana pelestarian dan pusat informasi budaya harus dipertahankan keberadaannya,” katanya.

Situasi Timika Tegang TIMIKA (Antara): Situasi keamanan dan ketertiban masyarakat (kamtibmas) di kota Timika, Papua hingga Senin (24/5) siang cukup tegang, menyusul kasus pembunuhan yang menimpa Lamber Ondos Rumte, 30, warga suku Kei pada Minggu (23/5) malam. Kasus itu memicu amarah keluarga korban dengan menganiaya sejumlah warga lain yang tidak tersangkut dengan masalah awal. Kimi Wenda, warga Jalur 5 Jl. Ale-ale Kwamki Lama dibacok pada kedua siku tangannya dengan parang oleh warga suku Kei di Jl. Hasanuddin Pasar Sentral Timika, Senin pukul 08:30 WIT. Saat itu Kimi Wenda berencana ke Pasar Sentral untuk berjualan. Korban sudah dibawa ke RSUD Mimika untuk dirawat. Warga lainnya, Eltinus Kiwak, 42, dan Marthen Pigome, 25, dibacok pada punggung dan telapak tangan mereka saat menumpang sepeda motor. Eltinus dirawat di Rumah Sakit Mitra Masyarakat (RSMM) Timika. Aksi main hakim sendiri dilakukan warga Kei memicu kemarahan warga Paniai. Sekitar pukul 10:30, puluhan warga Paniai bersenjatakan panah dan parang menuju Jl. Pattimura Sempan, Kampung Inauga untuk menyerang warga Kei. Namun aksi mereka digagalkan aparat kepolisian dari Polres Mimika dan Brimob Detasemen B Polda Papua dengan mengerahkan mobil barakuda dan water canon untuk meng-halau massa suku Paniai yang datang dari arah belakang Gedung Eme NemeYauware kompleks Timika Indah. Kapolres Mimika AKBP Mochammad Sagi mengatakan, situasi kamtibmas di Timika sudah kondusif. “Sekarang situasinya sudah kondusif, tadi pagi memang sempat terganggu dimana beberapa ruas jalan sempat ditutup,” kata Sagi mengatakan, empat pelaku yang menganiaya Lamber Ondos Rumte sudah diamankan di Polsek Mimika Baru.

Setiap sedeqah yang kita salurkan di jalan Allah akan menjadikan pelindung kita dari api neraka. Salurkan Zakat, Infaq dan Shadaqah Anda ke lembaga yang Amanah, Profesional & Transparan Transfer via bank, AC. Peduli Ummat Waspada

Zakat BMI 211.00002.15 BSM 006.0022407 BCA 022.1750828 BNI Syariah 0092687629 Bank Mandiri 106.0002203803

Infak/Sedekah BMI 211.00044.15 BSM 006.0008321 BNI 005.7504808 Bank Sumut 100.02.04.034144.5

ZIS terpublikasi 1 Januari 2010 s/d laporan 18

Rp 228.480.009

ZIS

ZIS

1025. H. Darwin Bagindo Pakih Rp 2.000.000 1026. Hamba Allah Rp 1.500.000 1027. Ir. H. Baginda M.A Pulungan, MM Rp 625.000 1028. Ir Hj Nurmala Dewi Hasibuan, MMRp 500.000 1029. Ir. Chairansyah Rp 500.000 1030. Ir. H.Hanif Soekasman Rp 500.000 1031. H. Rusdi Lubis, SH, MMA Rp 350.000 1032. Ir. M. Dedy Pratopo Rp 300.000 1033. Dra. Hj. Evalina Eliza Rp 250.000 1034. H. Effendi Nasution Rp 250.000 1035. Ir. Eddy Usman Rp 250.000 1036. Amir Syarifuddin Lubis, B.Sc Rp 250.000 1037. Ir. Riswan Effendi Siregar Rp 200.000 1038. drg. H. Syaiful Anwar Nasution Rp 200.000 1039. Syahruddin Ali, SH Rp 200.000 1040. Ir. Hj. Deriati, MM Rp 200.000 1041. Ir. Rizal Hotpaham Damanik Rp 200.000 1042. Ir. H. Zulham Audi, MM Rp 200.000 1043. Ir. Mohd. Abdul Ghoni Rp 200.000 1044. R. Handy Oktaruna Rp 200.000 1045. Abdul Chalik, SE Rp 150.000 1046. Drs. H.R. Triawarman Rp 150.000 1047. Ir. Mohd. Armein Daulay Rp 150.000 1048. Ir. Ilyas Armein Pane Rp 100.000 1049. Drs. H. Abdul Hadi Nasution Rp 100.000 1050. A. Rahim Purba, SE Rp 100.000 1051. H. Buana Ginting, SH Rp 100.000 1052. Ir. Rasyid Dian Rp 100.000 1053. Ir. Elfi Diana Lubis Rp 100.000 1054. Ir. Souvenir, MM Rp 100.000 1055. Ir. H. Hobol Mulia Siregar Rp 100.000 1056. Ir. H. Sriyono Susilo Rp 100.000 1057. Taufiq Qurrachman Rp 100.000 1058. Mili Mahardhika, SE Rp 100.000 1059. Haris Muda Siregar Rp 100.000 1060. Ir. Effendi Lubis Rp 100.000 1061. Dr. Mazrisyaf Muaz Rp 100.000 1062. Ir. Andi Wibisono Rp 100.000 1063. Drs. Muhtadin Harahap, SmH Rp 100.000 1064. Ir. Ansari Rp 100.000 1065. Ir. Bambang Wishnu Wardhono Rp 100.000 1066. Latifah Hanum Rp 100.000 1067. Ir. H. Dasam Marwan Saragih Rp 100.000 1068. Ir. Syaiful Amri Rp 100.000 1069. Ir. Dendi Affianto Rp 100.000 1070. Eddy Sufri Hutasuhut, SE Rp 100.000 1071. Ir. H. Muchlis Nasution Rp 100.000 1072. Ir. Agusmarthin Pane Rp 100.000 1073. Razak, B.Sc Rp 100.000 1074. Effendi Pohan, SE Rp 100.000 1075. Amrizal Rp 100.000 1076. Zainal Abidin Rp 100.000 1077. Ir. Mohd. Nur Hutabarat Rp 100.000 1078. Ir. Sudjatmiko, M.Sc Rp 100.000 1079. Bambang Agustian, ST Rp 100.000 1080. Siti Indriani K Rp 75.000 1081. Syahrul A. Siregar Rp 75.000 1082. Ir. Eka Priari Rp 75.000

1083. Rabiullah Harahap 1084. Abdul Gani 1085. Budi Susanto, SE, Ak 1086. RM. Widyawan HNKP, ST 1087. Ir. H. Makmur 1088. Ir. Muchlis Murad 1089. Ir. Ahmad Sulaiman Lubis 1090. Ir. Asral Tanjung 1091. Swelli Sholihah Nasution, SP 1092. Mhd. Ihsan Rangkuti, SE, Ak 1093. Ir. Mohd. Syafii Batubara 1094. Ir. Erwin Zulkarnain Hasibuan 1095. Wispramono Budiman, SE 1096. Ir. Hidayat Darpo, MM 1097. Ir. Nanang Sumintarsono 1098. Andry Sally, SP 1099. Surya Brata, MCP, SE 1100. Dra. Indah Triharyani 1101. Andriansyah, SE 1102. Suharso 1103. Ir. Indra Azhari 1104. Ir. Amrin Pane 1105. A. Rahim Yunus 1106. Ir. Nasrul 1107. Siman 1108. Rudi Hartono, SH 1109. Farida Jayasumarta, SE 1110. Rohana Sinaga, SE 1111. M. Asri Rambe 1112. Ir. Mazriefnal Muaz 1113. Ir. Ima Sulastri 1114. Drs. Edi Syahputra 1115. Erwin Syafii Siregar, SE 1116. M. Ridho Nasution 1117. Azwar Tanjung, BA 1118. Ishak Tupon 1119. Alamsyah Ramli, BE 1120. Suhermin 1121. Ir. M. Sueib Thahir Nasution 1122. Suroso 1123. Pranoto 1124. Ramadansyah, SP 1125. Ir. Hendri Yono 1126. Roy Kinanta Sitepu, SH 1127. Ahmad Fadli Zebua, SP 1128. Darmanto , B.Sc 1129. Lubbi Hidayat Pohan 1130. Sutrisno Saragih 1131. R.A. Hasibuan, SE 1132. Benny Alfian, SH 1133. Amiruddin Silalahi 1134. Ir. Sangkot Arsyad Lubis 1135. Khayamuddin Panjaitan 1136. Nurlely Siregar 1137. Zuluddin Manurung 1138. Ir. Taufiq Amar 1139. M. Edward Samudra, ST 1140. Fitra Rinaldy, ST

Rp 12.750.000

Jumlah laporan ke: 19

Rp 75.000 Rp 75.000 Rp 75.000 Rp 60.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 50.000 Rp 25.000 Rp 25.000 Rp 25.000

Rp 15.660.000

Penerimaan dan Pemanfaatan Dana

Penerimaan

Pemanfaatan

Saldo

Periode Mei 2000 s.d Desember 2007 Periode 1 Januari s.d Desember 2008

4.197.061.507 712.917.041

3.709.066.585 489.562.714

487.994.922 223.354.327

Total

4.909.978.548

4.198.629.299

711.349.249

Keterangan : Seluruh donatur adalah staf PTPN IV anggota Majlis Ta’lim Syiar Islam (MTSI) PTPN IV

Konsultasi Zakat Bersama Ustadz M. Nuh Abdul Muis SMS: 08126526295 e-mail: peduliummat@waspada.co.id Hubungi Kami: Lembaga Amil Zakat Provinsi Sumatera Utara Peduli Ummat Waspada Jl. Brigjen Katamso No. 1 Medan telp. 061-4511936 - 4150858 (evi) Fax. 061-4511936 E-mail: peduliummat@waspada.co.id Khusus Kodya Medan, ZIS diatas Rp 500.000,- kami siap menjemput (4511936 - 08126375062)


Luar Negeri

A4

WASPADA

Selasa 25 Mei 2010

Kompleks Pasar Myanmar Terbakar

Australia Usir Diplomat Israel

YANGON, Myanmar (Antara/Reuters): Kebakaran besar melanda satu pusat bisnis yang terdapat 4.000 toko dan kios di kota terbesar Myanmar, Senin (24/5) tetapi tidak ada korban, kata petugas pemadam kebakaran dan pedagang. Mingalar Zay, kompleks pasar berlantai lima di Yangon, terbakar sekitar pukul 09:00 waktu setempat (09:30WIB) dan belasan truk pemadam kebakaran masih berusaha untuk memadamkan api beberapa jam kemudian. “Untung tidak banyak orang di dalam gedung itu ketika api baru berkobar, saat pasar itu baru saja di buka,” kata pemilik toko farmasi di pasar itu. “Jika tidak pasti akan banyak jatuh korban.” Para pedagang lokal mengatakan mereka memperkirakan kebakaran itu disebabkan alat pengecas aki yang terlalu panas di lantai empat. Myanmar mengalami kekurangan aliran listrik setiap hari. Pabrik-pabrik, toko-toko dan rumah-rumah sakit sering mengalami pemadaman listrik. Banyak orang mengandalkan pada aki selama pemutusan aliran listrik dan kebakaran sering terjadi akibat alat pengecas aki terlalu panas. Tidak kurang 719 kebakaran melanda Myanmar tahun 2008 menewaskan 28 orang dan mencederai 52 lainnya, menurut data resmi terbaru.

CANBERRA, Australia (Antara/Reuters): Pemerintah Australia, Senin (24/5), mengatakan negara itu telah memerintahkan seorang diplomat Israel yang terlibat dalam penggunaan paspor palsu dalam pembunuhan seorang petinggi kelompok Hamas di Dubai, Januari lalu, agar meninggalkan Australia. Menteri Luar Negeri Australia, Stephen Smith, mengatakan investigasi yang dilakukan tak meragukan bahwa dinas intelijen Israel berada di balik pemalsuan empat paspor Australia yang digunakan oleh tersangka dalam membunuh Mahmoud alMabhouh di salah satu kamar hotel Dubai.

Kepala Polisi Tewas Dalam Serangan Di Afghanistan

Ahmadinejad Peringatkan Rusia Agar Hati-hati Sikapi Iran TEHERAN, Iran (Antara/IRNA-OANA): Presiden Iran, Mahmoud Ahmadinejad, memperingatkan para pejabat Rusia agar lebih berhati-hati dalam bersikap mengenai Iran, berkaitan dengan program nuklir damainya. Dia menyampaikan pernyataan itu pada saat berbicara dengan para wartawan, setelah sidang cabinet Minggu (23/ 5). Ahmadinejad mengatakan, bahwa sikap yang diberikan oleh berbagai negara akan dicatat dalam memori sejarah setiap bangsa, dan akan mempengaruhi hubungan-hubungan masa depan mereka. “Mungkin itu mudah untuk mengubah sikap bagi negaranegara yang menempatkan diri secara terpisah dari yang lain, namun hal itu tidak akan mudah bagi dua negara yang bertetangga,” kata presiden, menandaskan bahwa “Iran tidak pernah bersikap menentang rakyat Rusia.” Merujuk bahwa Iran adalah sebagai tetangga yang ‘sangat baik‘ bagi Rusia, Presiden Ahmadinejad mengatakan, “Jika saya pejabat Rusia, saya akan lebih bersikap hati-hati mengenai apa yang saya katakan, dan bagaimana saya bertindak mengenai masalah tetangga yang baik itu.” Presiden menandaskan bahwa pernyataan Teheran membuka cara baru bagi pemecahan sengketa mengenai kegiatan nuklir Iran untuk kepentingan damai. Deklarasi Teheran ditandatangani oleh Iran, Turki dan Brazilia di sela-selam pertemuan puncak G-15, yang diselenggaran di Iran pada 17 Mei. “Deklarasi Teheran transparan dan merupakan peluang baru bagi pembangunan kerjasama serta interaksi internasional,” kata presiden. “Kami berharap tetangga kami dan negara-negara sahabat untuk mendukung kuat deklarasi, serta mengizinkan pelaksanaannya,” ujarnya.

11 Tewas, 43 Cedera Dalam Tabrakan Bus Di China Selatan BEIJING, China (Antara/Xinhua-OANA): Sedikitnya 11 orang tewas dan 43 lainnya cedera setelah dua bus umum saling bertabrakan di jalan raya negara di China selatan, kata kantor berita China, Xinhua dalam laporannya mengutip polisi wilayah tersebut. Tabrakan langsung kedua bus itu terjadi pada pukul 02:00 waktu setempat Senin (24/5), diWilayah Otonomi China Guangxi Zhuang di dekat Kota Hechi. Menurut kantor berita itu, semua penumpang yang luka termasuk dua di antara mereka dalam kondisi kritis, dibawa untuk dirawat di rumah sakit terdekat. Secara keseluruhan, kedua bus itu memuat 83 penumpang pada saat kecelakaan tersebut terjadi. Tabrakan itu adalah yang kedua melibatkan bus penumpang di China dalam dua hari terakhir ini. Sedikitnya 32 orang tewas dan lebih dari 20 lainnya lukaluka setelah sebuah bus umum bertabrakan dengan truk pada Sabtu di provinsi Liaoning, China timur laut.

5 Tewas Dalam Ledakan Bom Di Bus Afghanistan KABUL, Afghanistan (Antara/AFP): Sebuah bom merobek bus mini di Afghanistan Barat Senin (24/5), menewaskan lima warga sipil dan melukai delapan lainnya, beberapa di antara mereka dalam kondisi kritis, kata kementerian dalam negeri. Bus Toyota Coaster tersebut sedang membawa penumpang dari distrik Pusht Rod di provinsi Farah ke distrik Khaki Safed. Serangan ini adalah isyarat terakhir dari meningkatnya aksi kekerasan di Afghanistan barat, yang sebenarnya relatif damai. “Lima penduduk sipil mati sahid dan delapan warga sipil lainnya cedera,” kata kementerian, yang mempersalahkan `aksi teroris` itu pada `musuh Afghanistan`- satu ungkapan yang sering digunakan pihak yang berwenang untuk menyebut gerilyawan Taliban. Beberapa dari mereka yang cedera kini dalam kondisi kritis, kata kementerian itu. Bom pinggir jalan adalah senjata pilihan bagi gerilyawan untuk menggerakkan hampir sembilan tahun perjuangannya melawan pasukan Afghanistan dan pasukan asing yang dipimpin Amerika Serikat, setelah invasi yang dipimpin AS pada 2001 menjatuhkan rezim Taliban. Dalam insiden sama Minggu, gerilyawan melepaskan tembakan terhadap sebuah bus mini di provinsi utara Baghlan, menewaskan tiga penduduk sipil, kata kementerian itu. Taliban mengancam akan mengobarkan serangan baru di seluruh negeri sejak 10 Mei, dengan menargetkan para diplomat, anggota parlemen Afghanistan, para kontraktor asing dan pasukan militer internasional.

PASAR PERBELANJAAN MINGALAR ZAY DI YANGON TERBAKAR

Reuters

Asap hitam mengepul dari Mingalar Zay, satu kompleks pasar perbelanjaan bertingkat lima di Yangon Pusat, Myanmar, terbakar Senin (24/5). Kebakaran besar terjadi di pusat perdagangan yang menampung 4.000 toko dan kiosk di kota paling besar Myanmar Senin namun tidak ada korban yang dilaporkan, demikian menurut regu pemadam kebakaran dan para pedagang.

Lee: Korut Harus Bayar Atas Serangan Torpedo SEOUL, Korea Selatan (AP/Antara/AFP): Presiden Korea Selatan mengatakan Senin (24/5) negaranya tidak akan bertoleransi lagi terhadap ‘kebrutalan’ Korea Utara dan mengatakan rezim Pyongyang akan membayar atas serangan torpedo mengejutkan yang menewaskan 46 pelaut Korea Selatan. Presiden Lee Myung-bak bersumpah untuk mengajukan Pyongyang ke Dewan Keamanan PBB sehubungan dengan penenggelamankapalperangKorea Selatan (Korsel) 26 Maret. Lee menegaskan Seoul akan memutus semua perdagangan dengan rezim komunis itu dan beberapa langkah yang bertujuan untuk membalas pada musuhnya yang terkucil itu secara diplomatik dan finansial. Presiden Barack Obama mengatakanRabuWashingtonmendukungsepenuhnyausahaKorsel untuk menyeret Korea Utara (Korut)keDewanKeamanandan akan melakukan tinjauan sendiri mengenaikebijakanASatasKorut, kata Gedung Putih. Menlu AS Hillary Rodham Clinton berada di Beijing dalam usahanya mendapatkan dukungan China untuk memberikan respon diplomatik secara terkoordinasi. China, satu negara pemegang hak veto di Dewan KeamanandansekutuutamaKorut, telahmenahandiridarimengecam negara tetangganya itu. Tenggelamnya kapal Cheonan Maret lalu merupakan bencana militer terburuk Korsel sejak Perang Korea tahun 1950-53. LimapuluhdelapanpelautdiselamatkandariperairanLautKuning yang dingin, namun 46 lainnya gugur. Satu tim penyelidik internasional menyelesaikan penyelidikannya pekan lalu bahwa satu torpedo yang ditembakkan dari kapal selam Korut merobek kapal itu dan patah jadi dua. Lee, yang berpidato dari Taman Memorial Perang, menyebutkan tindakan itu merupakan satu ‘provokasi militer’ yang merupakan bagian dari satu ‘bentuk’ serangan oleh komunis Korut, termasuk penjatuhan satu pesawat penumpang pada tahun 1987 yang menewaskan 115 orang. “Kita selalu toleransi dengan

Reuters

Satu kantor polisi di West Kingston, Jamaika, yang ada di dalam foto nampak terbakar Sabtu. Jamaika menyatakan keadaan darurat di dua bagian wilayah ibukota Kingston Minggu (24/ 5) setelah terjadi penembakan dan serangan bom api atas sejumlah kantor polisi oleh para tersangka pendukung satu kelompok pedagang obat bius.

kebrutalan Korut, pada masa dulu dan kini terulang lagi. Kita lakukan itu karena kita selalu memiliki keinginan yang panjang perdamaian di Semenanjung Korea,” kata Lee. “Namun kini segalanya telah berubah. Korut akan membayar denganhargamahalatastindakan provokatifnya itu,” katanya.“Saya akan melanjutkan langkah keras untuk menuntut pertanggungjawaban Utara.” Latihan bersama AS Sementara itu, pasukan Amerika Serikat dan Korsel akan melakukan pelatihan anti kapal selam gabungan di lepas pantai SemenanjungKorea,kataMenteri PertahananKimTaeYoung,Senin. “Kami berencana melakukan pelatihanantikapalselamdengan AS di lepas pantai dalam waktu dekat,” kata Kim , segera setelah Presiden Lee mengumumkan Seoul menangguhkan hubungan dagang dan pertukaran-pertukaran lainnya dengan Korut. Kim juga mengatakan Korsel akan secara aktif ikut serta dalam kampanye anti proliferasi nuklir pimpinan AS yang yang dikenal sebagai Prakarsa Keamanan Proliferasi, yang dikecam Korut sebagaisatuusahauntukmenggulingkan rezimnya. Dia mengatakan Korselakanmemimpinpelatihan seperti itu di wilayah tersebut akhir tahun ini, dan ikut serta dalam pelatihan yang direncanakan Australia September. Korsel juga akan memulai kembali propaganda dengan menggunakan pengeras suara

di seberang perbatasan darat, yang kedua pihak tangguhkan sesuai perjanjian tahun 2004. Menteri Luar Negeri Yu Myung Hwan dalam jumpa wartawan mengatakan Seoul akan melakukan usaha diplomatik yang intensif untuk menghukum Korut atas serangan kapal itu. Lee sebelumnya mengumumkan bahwa Seoul akan mengajukan masalah tenggelamnya kapalyangmenewaskan46pelaut itu ke Dewan Keamanan PBB. Seranganitu“adalahsatutindakan yang merusak perdamaian... ini adalah satu ancaman langsung dan tantangan pada perdamaian dan stabilitas tidak hanya di semenanjung Korea, tetapi juga di Asia Timur Laut dan sekitarnya,” kata Yu. Pemerintah akan melakukan “segala kemungkinan tindakan diplomatik,” katanya dan menyatakan21negarasudahmengecam tindakan Korut itu. Washington secara khusus melakukan konsultasi erat dengan Seoul menyangkut tindakan-tindakan penghukuman, kataYu. Akan ada perundinganyangmendalamlagi jika Menlu Hillary Clinton mengunjungi Seoul, Rabu. Korut yang komunis itu membantah terlibat dalam insiden kapal Korsel itu dan mengacam akan “melancarkan perang habis-habisan” untuk menanggapi setiap usaha untuk menghukumnya. Presiden Obama memerintahkan pemerintah meninjau kembali ‘kebijakan dan kewenangan yang ada‘ tentang Korut, setelah serangan terhadap kapal angkatan laut Korsel, Cheonan, kata Gedung Putih Senin pagi. “Dalammenjawabprovokasi Korut dan pembangkangannya terhadap hukum internasional,

presidenmemerintahkanbadanbadan pemerintah AS untuk meninjaukembalikeberadaanhubungan kebijakan dan kewenangan mereka dengan Korut (DPRK),” kata sekretaris pers Gedung Putih, Robert Gibbs, dalam satu pernyataan tertulis. “Peninjauan kembali ini bertujuan untuk menjamin bahwa kami melakukan tindakan-tindakan yang memadai, dan untuk mengidentifikasiwilayah-wilayah mana yang perlu penyesuaian yang tepat.”Tim penyelidik multinasional Kamis menyimpulkan bahwa korvet Cheonan, yang berbobot 1.200 ton, meledak dan terbelah menjadi dua setelah dihantam torpedo dari kapal selam Korea Utara, di perbatasan laut yang mereka sengketakan pada 26 Maret. Di Tokyo, Jepang Senin mengatakan pihaknya mendukung desakan Seoul agar menghukum Korut di DK-PBB berkaitan dengan tenggelamnya kapal perang Korea Selatan, dan juga mempelajari sanksi-sanksi tambahan negaranya terhadap Pyongyang. Hirano, kepala sekretaris kabinet Jepang itu, juga menyeru kepada Beijing untuk mendukung gerakan tersebut. “Itu berarti bahwa Jepang, AS dan Korsel akan melakukan upaya koordinasi sepenuhnya,” katanya dalam konferensi pers rutin. “Kami harapkan China juga akan bergabung dengan pandangan kami,” katanya menambahkan. PM Yukio Hatoyama juga menginstriksikan kepada para menterinya, dalam sidang keamanan,untukmempertimbangkansanksi-sanksitambahanterhadap Korut, sebagai puncak hukumanyangtelahdikenakanterhadap negara itu oleh Tokyo. (m07)

Oposisi Berusaha Impeach PM Thai Atas Penumpasan Pemrotes BANGKOK, Thailand (AP/ Antara-News): Para pemimpin oposisi bergerak untuk mengimpeach PM Thailand Senin (24/ 5) karena kebijakannya menangani kerusuhan dan kekerasan di Bangkok yang menyebabkan sekurang-kurangnya 88 orang tewas dalam berbagai bentrokan antara para demonstran dan pasukan selama dua bulan. Langkah itu diperkirakan akan dengan mudah dikalahkan di parlemen, yang membuat langkag yang dipandang lebih besar sebagai simbolis, pada saat ibukota Bangkok bergerak menuju ke arah normal. Sekolahsekolah dan banyak perkantoran dibuka kembali untuk pertama kalinya setelah pemerintah mengumumkan libur sepekan. Langkah itu menyusul usahausaha untuk membersihkan beberapa bagian ibukota dari puing-puing yang dipasang rintangan oleh para kelompok Kaos Merah. Tokoh oposisiWittaya Buranasiri mengatakan mosi untuk mengimpeach (memakzul) PM Abhisit Vejjajiva telah diajukan olehPartaiPheuThai—beberapa sekutu dari mantan PM terguling Thaksin Shinawatra, yang pengembaliannyadaripengasingan telah diusahakan kelompok Kaos Merah. Usaha itu juga berusaha untuk menuntut sejumlah anggota senior Kabinet.

Para anggota Pheu Thai mengajukan langkah impeachmen kepada Ketua Senat Prasopsuk Boondet.MerekamendugaAbhisitdandeputiPMtelahmenyalahgunakan kekuasaan. Korban tewas meningkat Jumlah korban tewas akibat kerusuhan di Thailand sejak pertengahan Maret meningkat menjadi 88 orang dengan 1.885 lagi luka, kata layanan kesehatan masyarakat pada Senin. Departemenitumengatakanbahwadari yang luka itu, 217 masih di rumah sakit dan 17 dalam perawatan darurat. Dua orang asing —seorang kamerawan Jepang dan seorang jurufoto Italia— adalah di antara yang tewas dalam bentrok antara pasukan keamanan dengan Kaos Merah,yangmeningkatkanunjuk rasa jalanan. Thailand Minggu memperpanjang jam malam di Bangkok dan 23 provinsi dua lagi malam dengan alasan keamanan, kata pejabat keadaan darurat. “CRES memperpanjangjammalamdua malam lagi sejak malam ini di Bangkok dan 23 propinsi dari pukul 23:00 hingga 04:00 demi keamanan,”katapejabatPusatPenanganan Keadaan Darurat (CRES). Jam malam empat malam diterapkan sesudah pembakaran dan penjarahan meledak di ibu kota itu dalam penumpasan atas unjuk rasa menentang pemerintah. Jam malam baru itu lebih

singkat daripada sebelumnya, antara pukul 21:00 hingga 05:00 selama tiga hari lalu. PMAbhisitMinggumenyatakan negaranya sudah tenang dan pulih serta sekolah, jalan dan badanpemerintahberkegiatankembali pada Senin. “Segala sesuatunya telah tenang dan kembali seperti sediakala,” kata Abhisit dalam pidato berkala di televisi. Abhisit menyatakan pemerintahkotasedangmembersihkan kawasan unjuk rasa di wilayah niaga terkenal Bangkok itu, yang secara paksa dibersihkan pekan lalusetelahenampekandiduduki penentangnya. “Lalu lintas dan apa pun akan pulih besok. Kantor pemerintah dan sekolah akan dibukakembali,”katanya,merujuk pada tindakan, yang diberlakukan, agar warga menjauh dari jalan itu saat tentara terlibat bentrok dengan pengunjuk rasa Kaos Merah. Sementara ibukota berusaha membersihkan puing setelah kerusuhan politik terburuk di dalam sejarah modern Thailand itu, Abhisit menandaskan kepentingan rujuk dalam pidato pada Jumat. Namun, dalam pidatonya itu, Abhisit tidak menawarkan penyelenggaraan pemilihan umum dini, yang menjadi tuntutan utama penentangnya, yang dua bulan menggelar unjuk rasa diBangkok,sampaitentaramembubarkan mereka. (m07)

GHAZNI, Afghanistan (Antara/AFP): Gerilyawan terkait Taliban menyerang konvoi kendaraan polisi di sebuah tempat tak aman dari gerilyawan di Afghanisatn tengah, menewaskan seorang kepala polisi distrik. Mohammad Nabi Patang, kepala polisi distrik Andar di provinsi Ghazni, sedang melakukan perjalanan ke ibukota provinsi itu, yang jugadisebutGhazni,ketikakonvoinyadiserang,katagubernurprovinsi Mohammad Musa Akharzada pada AFP Minggu (23/5). “Kepala polisi itu, Patang, tewas dan salah seorang pengawalnya luka berat,” jelasnya. Dia menyalahkan serangan itu pada “oposisi bersenjata”, istilah yang digunakan oleh para pejabat Afghanistan untuk merujuk pada Taliban.“Setelah menyerangnya, yang menyebabkan kematiannya, para penyerang meninggalkan tempat itu. Mayatnya telah dibawa ke rumah sakit di kota tersebut,” katanya. Ghazni, di jalan dari Kabul ke provinsi Kandahar di selatan, mengalami kekerasan Talinan secara tetap. Jalan raya melalui kota bersejarah itu merupakan salah jalan paling bermasalah di Afghanistan yang dilanda pemberontakan.

Tersangka Larikan Mobil Polisi Dalam Keadaan Tangan Terborgol KUALA LUMPUR, Malaysia (AP): Satu laporan mengatakan seorang tersangka pencuri mobil yang ditangkap berhasil melarikan mobil polisi meski tangannya dalam keadaan diborgol. Suratkabar The New Straits Times mengatakan, pria warga Malaysia berusia 33 tahun itu menyusup ke mobil polisi dan melarikan diri tak lama setelah penangkapannya Minggu (23/ 5), sementara polisi terus melacaknya dengan memeriksa seorang pria di Kelantan. Harian itu mengatakan, mobil tersebut ditemukan ditinggalkan begitu saja beberapa jam kemudian, namun tersangka belum juga ditemukan. Seorang polisi setempat menolak memberi keterangan tentang kasus itu Senin, namun mengatakan insiden itu dalam penyelidikan.(m18)

Pria Ditangkap, Selundupkan Heroin Di Dalam Perut MAKAU,China(Antara/Xinhua-OANA):PolisiKehakimanMakau telah menangkap seorang pria yang berusaha menyelun-dupkan 77 kapsul heroin ke kota itu dengan menyembunyikannya di dalam perutnya, demikian laporan Macao Post Daily, Senin (24/5). Tersangka yang berusia 43 tahun itu, yang pernah memasuki Makau, ditangkap setelah pemeriksaan acak saat dia tiba di Bandar Udara Internasional Makao setelah melakukan penerbangan dari Kuala Lumpur, Malaysia. Pemeriksaan dengan menggunakan sinar-X mengungkapkan bahwa tersangka tersebut yang disebutkan bermarga Jansen, telah menelan 77 kapsul heroin demikian berat 955 gram, kata Polisi Kehakiman sebagaimana dikutip harian itu. Jurubicara tersebut juga mengatakan tersangka itu mengaku dia akan dibayar 20.000 dolar Hongkong (kira-kira AS$2.500) segera setelah dia menyelundupkan narkotika tersebut ke China Daratan melalui Makau.

AP Putri Sarah Ferguson

Tabloid Inggris: Putri Sarah Tawarkan Izin Untuk Dapat Uang LONDON, Inggris (AP): Putri Sarah Ferguson mengatakan dia ‘sangat menyesal’ atas kekhilafannya setelah dirinya terekam menawarkan peluang untuk bisa bertemu dengan mantan suaminya Pangeran Andrew agar dia mendapat bayaran 500.000 poundsterling (Rp 6,7 miliar). Mantan istri Pangeran Andrew itu dalam satu pernyataan yang disiarkan Minggu (23/5) mengatakan, memang dirinya mengalami kesulitan uang, namun ‘itu bukan alasan untuk melakukan kekhilafan serius tersebut dan saya sangat menyesal pada apa yang telah terjadi’. “Saya sangat menyesalkan situasi ini dan rasa malu dari perbuatan saya,” katanya. Tabloid News of theWorld menyiarkan video di situs Internetnya yang memperlihatkan Sarah membahas kesepakatan itu. Dalam video tersebut dia terdengar berkata “500.000 Poundsterling jika Anda bersedia, lalu datanglah pada saya, pintu akan dibuka.” Ditanya apakah dia mengacu pada sang pangeran, Sarah mengatakan “Ya.” Suratkabar itu mengatakan Sarah Ferguson, 50, berbicara pada wartawan yang menyamar sebagai seorang pengusaha. Pangeran Andrews adalah seorang Dutabesar Perdagangan Inggris pada skala internasional. Laporan itu memalukan, namun tidak ada pernyataan bahwa Sarah telah melakukan kegiatan illegal. Sarah menikah dengan Andrew, pewaris keempat takhta kerajaan Inggeris, pada tahun 1986. Mereka punya dua anak, Putri Beatrice dan Eugenie, sebelum bercerai tahun 1996. Sejak itu Sarah menulis buku anak-anak, membuat film documenter televisi dan bekerja sebagai jubir untuk Weight Watchers untuk mengatasi kesulitan uang yang dialaminya. Dia juga pernah mengeluhkan uang pembagian perceraian yang diberikan kepada dirinya sangat kecil. Baru-baru ini, perusahaan yang didirikannya untuk mendukung karirnya di bidang penerbitan dan kerja media, Hartmoor LLC, bangkrut dengan hutang sekitar 1 juta dolar (Rp 9,2 miliar). Sarah dijadwalkan menerima penghargaan untuk kegiatan amalnya di Los Angeles Minggu depan.(m18)


WASPADA Selasa 25 Mei 2010

Gallas Naas PARIS (Waspada): Bek Perancis William Gallas mengalami kecelakaan di kamp latihan Tim Ayam Jantan di sebuah resor ski Tignes. Menurut Reuters, Senin (24/ 5), Gallas naas saat menjalani balapan buggy yang menjadi salah satu menu latihan skuad Raymond Domenech. Bek berusia 32 tahun terpaksa dibantu ketika keluar dari buggy. Juru bicara Les Bleus mengkonfirmasi, mantan kapten Arsenal yang juga tengah memulihkan diri dari cedera betis tersebut, hanya mengalami memar pada tangan kirinya. Bek muda Gael Clichy dan Sebastien Squillaci yakin, kondisi Gallas sudah jauh membaik dan hampir dipastikan tampil pada putaran final Piala Dunia 2010 di Afrika Selatan, 11 Juni – 11 Juli. “William pemain utama kami di lini belakang dan kami membutuhkannya. Saya yakin dia akan tampil di Piala Dunia,” ucap Clichy, yang juga rekan Gallas di Arsenal. Gallas cs sejak pekan lalu be-

AP

William Gallas dibantu dua ofisial Perancis untuk menormalkan buggy yang dikendarainya. rada di salah satu resor ski Tignes untuk menjalani latihan pemanasan Piala Dunia 2010. Skuad Domenech melakukan sejumlah aktivitas seperti mendaki perbukitan serta memperkenalkan biathlon, yang menggabungkan ski dengan olahraga menembak. Domenech sendiri belum

mencoret nama Gallas dalam daftar skuad sementaranya. Tapi Domenech juga sadar, terlalu berisiko memaksakan Gallas tampil melawan Kosta Rika pada lafa ujicoba, Rabu (26/5). “Ada kekhawatiran pada kondisi Gallas.Tapi kami optimis melihatnya bisa berlatih,” ungkap Domenech dalam Sky

Sport

Sports. “Hanya saja, latihan akan berbeda dengan laga yang sesungguhnya. Saya tidak tahu dia akan fit melawan Kosta Rika,” tambah pelatih yang pasca Piala Dunia mendatang akan digantikan Laurent Blanc tersebut. Dia akan menunggu Gallas sembuh total dan bisa tampil pada laga perdana Pangeran Biru melawan Uruguay di Grup A. Jika mantan bek Chelsea itu belum fit juga, maka Domenech akan menyiapkan Clichy dan Squillaci sebagai penggantinya. Sebelumnya, Perancis sudah kehilangan gelandang bertahan andalannya, Lassana Diarra, karena mengalami masalah pada ususnya hingga tidak dapat mengikuti latihan bersama Les Bleus. “Apa yang terjadi dengan Diarra sangat menyedihkan. Kehilangan orang seperti Diarra sangat merugikan,” ucap Domenech.“Tetapi juga berarti tanggung jawab yang lebih bagi pemain lainnya yang masih menghuni skuad,” katanya lagi, seraya meminta Thierry Henry cs agar tak terpengaruh dengan sakit Diarra demi mengulangi sukses juara 1998. (h01/rtr/sky)

Peluang Besar Hart

thesun

Joe Hart (kanan) berpeluang mengesampingkan David James (2 kanan) dari bawah mistar Three Lions. LONDON (Waspada): Kiper Birmingham City Joe Hart berpeluang besar menjadi pilihan utama pelatih Inggris Fabio Capello untuk Piala Dunia 2010 di Afrika Selatan. “Capello membuat peraturan sangat jelas bahwa Anda harus bermain secara teratur untuk membuka kesempatan membela Inggris,” ujar Hart, seperti dilansir Reuters, Senin (24/5). “Jadi apa yang terjadi di Birmingham adalah 100 persen mengapa saya memperkuat

Inggris,” ujarnya lagi, guna mengeksperesikan kegembiraannya. Kiper berumur 23 tahun itu dicampakkan Manchester City pasca mendatangkan kiper Irlandia Shay Given. Namun penampilan reguler dan konsistensi di bawah mistar Birmingham menjadi faktor utama pemanggilan Capello. Hart pun terus menunjukkan kemampuan terbaiknya sejak diberi kesempatan oleh pelatih Birmingham Alex McLeish, yang meminjamnya selama satu

musim dari Citizens. “Saya berutang banyak kepada Birmingham, karena memberikan kesempatan bergabung dan bermain di sana,” tutur Hart. “Pilihan itu terbatas di Manchester City. Alex McLeish memberi saya kesempatan besar untuk pergi dan menunjukkan apa yang bisa saya lakukan,” tambah kiper bernama lengkap Charles Joseph John Hart tersebut. Setelah menyeleksi Hart, David James (Portsmouth) dan Robert Green (West Ham United), Capello menurut Reuters, lebih kepincut dengan penampilan Hart. Bahkan minimnya pengalaman Hart di pentas internasional tidak mempengaruhi kebijakan mantan pelatih Real Madrid, Juventus, AS Roma dan AC Milan itu. “Saya memiliki keyakinan pada Joe Hart. Dia bermain di Trinidad &Tobago,” ucap Capello. “Hart telah memainkan banyak pertandingan musim ini dan meningkat pesat. Akan

sangat sama antara kiper dan pemain lain yang mulai dalam posisi sama,” katanya lagi. Tetapi kiper veteran David James tetap berusaha mencari perhatian Capello. Teraktual, James menjadikan adu penalti sebagai alat kampanyenya. “Capello selalu menekankan masalah tersebut. Dia menganalisa bahwa kami membutuhkan latihan penalti dan saya yakin Inggris mampu melewatinya sekalipun kami tidak sedang beruntung,” tegas James dalam Sky Sports. The Three Lions punya catatan buruk dalam drama 12 pas. Inggris gagal pada Piala Dunia 1990, 1998 dan 2006, semuanya karena kalah adu penalti. Pada Euro 1996 dan Euro 2004, St George Cross juga menyerah akibat tendangan 12 pas. “Jika pada babak gugur kami melewati adu penalti, saya siap 100 persen. Kiper sangat berpengaruh di adu penalti dan kami tidak boleh gagal lagi,” tukas kiper berumur 37 tahun itu. (h01/okz/rtr/sky)

Ballack Berharap Lagi BERLIN (Waspada): Setelah sempat dinyatakan bakal absen di Piala Dunia 2010, kapten Jerman Michael Ballack bisa berharap lagi pemulihannya bakal berjalan lebih cepat. Ahli tulang Jerman Dr Markus Becker menuturkan, punya metode pengobatan terbaru meski hasilnya belum tentu sukses 100 persen. “Dengan bantuan metode perawatan baru, penyembuhannya bisa dipercepat. Mungkin Ballack boleh berharap tampil di Piala Dunia,” beber Becker kepada Bild, Senin (24/5). Metodenya meliputi penyuntikan cairan kimia pada bagian ligamen yang cedera. Dokter klub Nurenberg Dr Matthias Brem, membenarkan bahwa tehnik itu pernah dilakukannya kepada salah seorang pemain hingga pulih lebih cepat. Ballack mendapat cedera engkel serius ketika membela Chelsea menang 1-0 atas Portsmouth pada final Piala FA dua pekan lalu. Setelah pemeriksaan, bintang berusia 33 tahun itu dinyatakan harus istirahat sekitar enam minggu sehingga akan absen membela Der Panser. Karenanya manajer tim Jerman Oliver Bierhoff mengaku tak terkesan dengan opini kedua dokter tersebut. “Kami menghargai dokter tim Dr Muller-Wohlfahrt yang diakui oleh para ahli internasional. Kami percaya pada keputusannya,” ujar Bierhoff. “Kami pun selalu berjuang untuk para pemain, termasuk Ballack. Jadi kami menilai diagnosis lain masuk akal,” tambah mantan bomber andalan Tim Panser itu. Pelatih Joachim Loew pun hampir pasti tak akan berubah sikap dalam mengumumkan 23 pemain finalnya pada 1 Juni mendatang. Ballack akan dicoret dan nama gelandang VfB Stuttgart Sami Khedira muncul ke permukaan sebagai kandidat utama penggantinya. “Bisa diasumsikan, Khedira kandidat nomor satu untuk posisi ini. Dia mempunyai potensi besar,” puji Loew. “Dia seorang pemain yang berpengalaman mengemban tanggung jawab besar di Stuttgart. Dia juga telah menunjukkan karakter yang dewasa,” lanjut arsitek berumur 50 tahun

tersebut. Bild mengklaim, Loew sempat berbicara panjang lebar dengan Khedira yang baru berumur 23 tahun pada sesi latihan tim di Sisilia, pekan lalu. Mantan kapten Tim Jerman U21 bakal mendampingi Bastian Schweinsteiger di lini tengah Der Panzer di Afrika Selatan. “Saya berharap pemain-pemain lain juga ikut menyesuaikan diri. Misalnya, Schweinsteiger yang akan memiliki tanggung jawab lebih besar. Begitu juga Philipp Lahm, Miroslav Klose dan Per Mertesacker, mereka harus mengerahkan kemampuan terbaik,” harap Loew. “Itulah yang biasa terjadi

AP

ketika seorang pemain utama mundur dari tim. Ini bisa menjadi kesempatan bagi para pemain lain, kami butuh reaksi seperti itu pada Piala Dunia nanti,” tambahnya. Mengenai siapa kapten baru,

dia belum memberi kepastian. “Lahm dan Schweinsteiger jelas merupakan kandidat. Begitu juga Miro Klose, dia membukukan laga internasional terbanyak,” jelas Loew. (h01/vvn/bild)

A5

Reuters

OMONGAN ELANO: Robinho (kanan) dan Gilberto Silva serius mendengarkan pembicaraan Elano Blumer (tengah) dalam sesi latihan tim Brazil di Curitiba, Minggu (Senin WIB).

Pemain Dukung Isolasi Dunga CURITIBA, Brazil (Waspada): Gelandang Brazil Gilberto Silva dan Kleberson yang tampil bersama Selecao ketika menjuarai Piala Dunia 2002, mendukung rencana pelatih Carlos Dunga untuk mengisolasi pemain. Keduanya dalam temu pers, Minggu (Senin WIB), menjelaskan perbedaan metode yang digunakan Dunga dan Luiz Felipe Scolari, yang menjuarai Piala Dunia 2002. Saat ditangani Scolari, para pemain memang diberi kebebasan untuk berbicara dengan wartawan di hotel tempat mereka menginap. Tetapi di bawah Dunga, kontak dengan media

akan dibatasi. “Mereka pelatih yang berbeda, punya filosofi berbeda. Tetapi Felipao dan Dunga keduanya adalah gauchos (berasal dari selatan negara bagian Rio Grande do Sul),” jelas Kleberson dalam Reuters, Senin (24/5). Kebijakan isolasi Dunga merupakan reaksi terhadap kebebasan yang diterapkan Parreira, saat Tim Samba harus hengkang di perempatfinal Germany 2006. Fans pun dibatasi di tengah sesi latihan dan Dunga hanya mengirim dua pemain setiap hari untuk berbicara dengan reporter. “Saya tidak melihat adanya

batasan. Jika para wartawan sekarang mengikuti tim nasional lain di luar sana, mereka akan lebih sulit menemukan berita,” timpal Gilberto. Kleberson dan Gilberto merupakan dua dari tujuh gelandang dalam skuad racikan Dunga yang sebelumnya dikritik karena dinilai kekurangan kreatifitas. “Kami telah terbiasa dengan kritik yang terkait dengan gelandang. Yang utama ketika berusaha meraih tujuan adalah tidak penting siapa yang bermain,” dalih Gilberto. “Brazil punya pemain-pemain hebat, kami tahu hanya 23 pemain yang bisa dipanggil. Saya bekerja keras untuk men-

dapatkan kepercayaan pelatih agar bisa ada di sini,” tambah Kleberson ketika ditanyai tentang absennya Ronaldinho dan gelandang Santos, Ganso. Sejak Jumat lalu, skuad Selecao terus berlatih di Curitiba dan memulai latihan fisik sejak Minggu setelah menjalani tes kesehatan selama dua hari pertama. Pasukan Dunga akan berangkat ke Afrika Selatan, Rabu (26/5), rencananya dilepas Presiden Brazil Luiz Inacio Lula da Silva. Samba akan bermarkas di Johannesburg dan menghadapi Korea Utara, Pantai Gading, dan Portugal di Grup G. (h01/ant/rtr)

Italia. Saya harap ini menguntungkan sepakbola Italia,” papar Lippi kepada Reuters. “Sukses itu agar selalu diingat kala tampil di Piala Dunia. Da-

lam kasus Inter, juara sejati telah menunjukkan kekuatan, persatuan dan tekad dalam tim,” katanya menambahkan. (h01/fi/rtr)

Berita Buruk Chiellini ROMA (Waspada): Giorgio Chiellini mengalami cedera pada betis kirinya ketika menjalani sesi latihan perdana bersama tim nasional Italia, Minggu (Senin WIB). Maka selama beberapa hari ke depan, bek Juventus itu terpaksa menjalani latihan terpisah dari rekan-rekan setimnya agar pemulihan kondisinya berjalan optimal. Menurut Football Italia, Senin (24/5), cedera itu jelas menjadi berita buruk bagi Chiellini. Pasalnya, pelatih Marcello Lippi sudah mulai menyusun daftar skuad inti yang akan dibawanya ke Afrika Selatan dengan memangkas skuadnya menjadi 23 dari 28 pemain saat ini. “Mulai hari ini, seluruh pemain akan mendapat penilaian. Tapi mereka sudah tahu siapa yang mendapat perhatian lebih

dari saya,” tutur Lippi. “Keputusan terakhir saya tergantungdarihasilevaluasiserta pengamatan saya selama 10 hari ke depan. Kabar baiknya, cuaca di sini serupa dengan musim panas di Afsel, jadi kami bisa mulai membiasakan diri,” ujarnya lagi. Gli Azzurri gabung dalam Grup F bersama Paraguay, Selandia Baru dan Slovakia di Negeri Bafana Bafana. Fabio Cannavaro cs bakal melakoni laga perdana melawan Paraguay di Stadion Green Point, Cape Town, Senin (15/6). Menatap gelaran akbar tersebut, Lippi mengaku termotivasi dengan sukses Inter Milan menjuara Liga Champions dengan menaklukkan Bayern Munich 2-0 pada final di Madrid. “Kompetisi sepakbola Eropa telah berakhir dengan kemenangan luar biasa dari satu tim

mirror


Sport

A6

WASPADA Selasa 25 Mei 2010

Mimpi Lain Milito BUENOS AIRES (Waspada): Pasca sukses membawa Inter Milan meraih treble winners musim ini, Diego Milito (foto) langsung memimpikan sukses lain.

Bintang kemenangan I Nerazzurri yang memborong gol ketika menaklukkan Bayern Munich 2-0 pada final Liga Champions akhir pekan lalu di Madrid itu, berharap bisa menuai sukses sama bersama Argentina di Piala Dunia 2010. “Sekarang mimpi saya bersama Argentina di Piala Dunia. Saya ingin membantu Argentina meraih hasil terbaik di Afrika Selatan musim panas ini,” tekadnya dalam koran Ole, yang dikutip Senin (24/5). Milito menjadi pencetak gol terbanyak La Beneamata, yang musim ini juga telah merebut scudetto Liga Seri A dan Coppa Italia. “Perasaan saya sangat fantastis. Tapi tetap saja sukses ini adalah milik seluruh tim dan bukan saya saja,” tutur abang dari bek Barcelona Gabriel Milito

tersebut. Milito sendiri akan mendapat peluang sama seperti para ujung tombak Tim Tango lainnya di Negeri Bafana Bafana. “Saya tidak kaget oleh Milito. Dia menjalani musim yang luar biasa, tetapi kami juga punya yang lainnya,” jelas pelatih Argentina Diego Armando Maradona. “Lio (Messi), (Carlos) Tevez, Kun (Sergio Aguero),” tambah Maradona dalam temu pers di Buenos Aires, Minggu (Senin WIB). Selain nama-nama dimaksud, Albiceleste juga masih punya Martin Palermo dan Gonzalo Higuain. “Milito telah membuktikan saya benar memilih dia. Siapa pun yang berada dalam kondisi terbaik akan main,” janji Maradona, yang sepertinya bakal

AP

memprioritaskan Messi dan Higuain. “Tidak ada pemain utama dan tidak ada cadangan (dalam tim),” dalih El Diego, yang menyeka wajahnya dengan handuk se-telah para pemainnya berlatih di bawah guyuran hujan lebat di basis latihan mereka.

Pos Indonesia Sosialisai Perangko PD SEMARANG (Antara): Kantor Pos Besar Semarang menyosialisasikan perangko seri Piala Dunia 2010 yang diterbitkan sejak 1 Mei 2010 untuk menyemarakkan pergelaran olahraga sepakbola tingkat dunia di Afrika Selatan. “Penerbitan perangko seri Piala Dunia 2010 bernominal Rp1.500 ini diharapkan juga dapat memacu perkembangan dunia persepakbolaan di Tanah Air,” kata Kepala Kantor Pos Besar Semarang, Suryadi, Senin (24/5). Benda filateli lain yang juga diterbitkan PT Pos Indonesia terkait kegiatan empat tahunan tersebut adalah empat perangko yang dikemas dalam satu paket kecil dan Sampul Hari Peringatan Penerbitan Pertama yang dicetak sebanyak empat ribu

lembar. Satu set perangko Piala Dunia 2010 terdiri atas 50 buah perangko bernominal Rp1.500 dijual dengan harga Rp72.000, sedangkan harga satu paket perangko adalah Rp6.000, dan Sampul Hari Peringatan Penerbitan Pertama dijual seharga Rp8.000. Dia menyebutkan, PT Pos Indonesia telah mencetak perangko seri Piala Dunia 2010 sebanyak 300 ribu buah yang diedarkan ke seluruh Tanah Air. “Di Kota Semarang sendiri telah diedarkan sebanyak tiga ribu perangko bergambar maskot Piala Dunia 2010 dan beberapa pemain sepakbola internasional,” ujarnya. Menurut dia, minat kolektor perangko di Kota Semarang yang sering disebut filatelis cukup

banyak dengan diterbitkannya perangko seri Piala Dunia 2010 ini. “Sejak pertama diterbitkan, beberapa filatelis sudah ada yang memesan dengan jumlah yang cukup banyak,” jelasnya lagi. Selain di Kantor Pos Besar Semarang yang terletak di Jalan Pemuda Nomor 4, benda filateli terkait Piala Dunia 2010 juga dapat dibeli masyarakat di seluruh kantor pos cabang yang tersebar di ibukota Jawa Tengah. Salah seorang wisatawan asing asal Belanda, Doldu Mosch (82) mengatakan dirinya membeli perangko seri Piala Dunia 2010 yang diterbitkan PT Pos Indonesia ini sebagai koleksi dan kenang-kenangan saat berkunjung ke Kota Semarang, Jawa Tengah.

Semangat besar Maradona yang membawa timnya lawan Kanada pada pertandingan perpisahan di River Plate Monumental Stadium, Selasa (25/5) pagi ini, mengaku para pemainnya dalam semangat besar. “Mereka semua sangat ingin

Burung Tabrak Pesawat Meksiko MEXICO CITY (Antara): Tim Piala Dunia Meksiko mengalami penangguhan tiga-jam di Jerman setelah seekor burung menabrak kaca depan pesawat yang akan membawa mereka ke London. Tim Sombrero dijadwalkan melakoni pertandingan pemanasan Piala Dunia 2010 melawan Inggris dinihari tadi di Stadion Wembley. Itu merupakan pertandingan pertama dari empat laga pemanasan yang harus dimainkan Meksiko di Eropa, sebelum bertolak menuju Afrika Selatan, tempat mereka akan bertemu tim tuan rumah dalam duel pembukaan Piala Dunia pada 11 Juni 2010 di Johannesburg. “Seekor burung menabrak kaca depan pesawat yang akan menjemput tim nasional (Meksiko) di Nuremberg, saat pesa-

Suns Gagalkan Sapu Bersih PHOENIX, AS (Waspada): Lewat permainan yang ketat, Phoenix Suns berhasil menundukkan Los Angeles Lakers 118109 pada game ketiga final Wilayah Barat NBA, Senin (24/5). Bermain di US Airways Center, Suns bermain ngotot sejak kuarter pertama. Maklum tim besutan Alvin Gentry ini tertinggal 2-0 dari Lakers dalam seri best of seven. Kunci sukses Suns pada pertandingan ini adalah memotong jalur dukungan kepada tiga bintang Lakers, yakni Kobe Bryant, Pau Gasol dan Derek Fisher. Ketiga pemain tersebut tidak mendapat dukungan sepenuhnya, seperti yang mereka dapatkan di dua pertandingan awal. Kobe memang mencetak 36 poin, Gasol (23) dan Fisher (18), namun pemain lainnya tidak mampu mencetak lebih dari 12 poin. Tidak ada dukungan dari pemain-pemain seperti Lamar Odom, Andrew Bynum dan

AP

Ron Artest. Para pemain cadangan Lakers sendiri hanya mencetak total 18 angka secara keseluruhan. Suns sendiri patut berterima kasih kepada Amare Stoudemire yang mencetak 42 angka pada pertandingan ini. Ini adalah poin tertinggi Stoudemire di pertandingan playoff sepanjang karirnya. Kendati demikian, Suns masih tertinggal atas Lakers 2-1. Robin Lopez juga tampil gemilang bagi Suns setelah membantu Stoudemire dengan menghasilkan 20 poin. Jason Richardson menyusul dengan torehan 19 angka dan Steve Nash menambah 17 poin 15 assist. Praktis, kemenangan ini tidak hanya membatalkan ambisi Lakers untuk menyapu bersih Suns di final Wilayah Barat. Nash cs juga berpeluang menyamakan kedudukan karena game keempat kembali berlangsung di US Airways Center, Rabu (26/5) besok. (m33/ap)

Torehan 42 angka dari Amare Stoudamire (1) membawa Phoenix Suns sukses menggagalkan ambisi sapu bersih LA Lakers dalam final NBA Wilayah Barat, Senin (24/5).

Kematangan Kunci Sukses Lorenzo LE MANS, Perancis (Waspada): Jorge Lorenzo (foto) membukukan kemenangan keduanya di ajang MotoGP musim ini pada seri MotoGP Perancis, Minggu (23/5) lalu. Usai balapan, pembalap Fiat Yamaha itu mencoba membocorkan resep kesuksesannya. Menurut Lorenzo, sikap lebih dewasa atau kematangan yang kini menuntunnya ke arah lebih baik. Salah satu contoh nyata yang bisa dilihat adalah keberhasilannya menaklukkan rekan setim sekaligus juara bertahan Valentino Rossi di Sirkuit Le Mans. “Jika ini terjadi pada saya tiga atau empat tahun lalu, maka saya pasti melakukan hal gila. Sekarang saya lebih percaya diri. Saya juga lebih kalem dan melakukan balapan jauh lebih baik,”

ujar Lorenzo seprti dikutip autosport, Senin (24/5). “Saya mencoba sabar. Saya tahu akan menekan rem agak lambat, jadi menunggu lawan melakukan kesalahan. Dia memang sedikit sekali melakukannya, tapi saya terus mengamati dan mencari celah. Saat berhasil melakukannya, saya merasa itu lebih mudah dari yang dibayangkan,” tutup rider asal Spanyol tersebut. Sementara itu, Rossi mengakui kecepatan motor Lorenzo yang berhasil menjadi jawara di MotoGP Perancis. Rossi berada di pole position dan mampu mengamankan posisi terdepannya, namun Lorenzo berhasil menyalipnya di pertengahan lomba dan membuat The Doctor tertinggal 5,672 detik. (m33/auto)

bermain di Afrika Selatan. Pada 1986 kami menjalani persiapan selama 70 hari, hari ini kami hampir 20 hari lagi dan saya masih belum punya 23 pemain penuh,” ujar Maradona. Rekan setim Milito di Inter, bek Walter Samuel dan bek Bayern Martin Demichelis belum bergabung dengan tim Tango. “Para pemain mengerti bahwa Anda mengalami Piala Dunia seperti kita menjalaninya,” papar Si Tangan Tuhan, yang menjadi kapten ketika menjuarai Piala Dunia 1986. “Saya ingin mereka semua tajam... Kami bisa memberi siapa pun perlawanan bagus, pertarungan sepakbola, karena kami mempunyai permainan dan pemain yang bagus. Tim ini mirip dengan tim 86 karena mereka sangat lapar akan kemenangan,” optimisme El Diego. Argentina akan menghadapi Nigeria, Korea Selatan dan Yunani pada babak penyisihan Grup B Piala Dunia 2010. (h01/ole/ant/rtr)

AP

wat itu mendarat,” jelas pernyataan Federasi Sepakbola Meksiko, Senin (24/5). “Tanpa konsekuensi apa pun, namun peraturan mewajibkan pesawat itu harus diperiksa sebelum diijinkan terbang ke Inggris,” tambah pernyataan tersebut. Meksiko juga akan bermain melawan Belanda pada Rabu (26/5), Zambia pada Minggu (30/5), dan Italia pada 3 Juni.

Waspada/Jonny Ramadhan Silalahi

Marketing Manager CV Indako Trading Co Leo Wijaya SE MBA, Senin (24/5), pose bersama Honda Tiger yang menjadi hadiah utama kuis Tebak Top Skor Piala Dunia 2010.

Honda Sponsori Kuis PD 2010 Waspada MEDAN (Waspada): CV Indako Trading Co selaku main dealer motor Honda di Sumatera Utara akan menyeponsori kuis Piala Dunia 2010 yang diselenggarakan PT Harian Waspada. “Kita siap menyemarakkan Piala Dunia dengan menjadi sponsor penyedia hadiah motor buat semua kuis yang akan digelar Waspada,” tegas LeoWijaya SE MBA, Marketing Manager CV Indako Trading Co di kantornya, Jln Pemuda Medan, Senin (24/5). Kesediaan menjadi sponsor, menurut Leo, sesuai komitmen Honda yang ingin terus dekat dengan konsumennya melalui penyelenggaraan berbagai event, khususnya yang berskala besar seperti halnya Piala Dunia. “Komitmen kita memang ingin terus dekat dengan masyarakat dan konsumen kita. Piala Dunia merupakan salah satu sarana yang tepat untuk melakukannya,” jelas Leo. Menurut Wakil Pemimpin Perusahaan Waspada Drs H Bahtiar Tanjung, pihaknya akan menyelenggarakan empat kuis sebelum dan selama pergelaran Afrika Selatan 2010, semuanya berhadiah sepeda motor Honda. “Kita sengaja memilih opsi memperbanyak hadiah sepeda motor dalam hal ini Honda, supaya jumlah pemenangnya bisa lebih banyak dibanding menyediakan hadiah mobil,” beber Bahtiar. Redaktur Olahraga Waspada Jonny Ramadhan Silalahi SH menambahkan, Waspada nantinya akan menggelar empat kuis yang semuanya akan diundi secara terbuka buat umum. Keempat kuis dimaksud adalah Classic Match World Cup 2010 dan Tebak Top Skor Piala Dunia 2010 bekerjasama dengan PT Pos Indonesia (Persero) serta Tebak Juara Piala Dunia 2010 dan The Best Player World Cup 2010.

“Classic Match World Cup 2010 yang sepertinya bakal sangat menarik dan merangsang, karena materi kuisnya memilih enam pertandingan yang bersifat klasik. Hadiah utamanya juga lumayan, enam unit Honda BeAT,” jelas Jonny. Mulai 1 Juni Sesuai kesepakatan Waspada dengan Pos Indonesia, tuturnya, kuis Classic Match akan dibagi enam periode dengan rincian dua periode untuk babak penyisihan, serta masing-masing satu periode untuk babak perdelapanfinal, perempatfinal, semifinal dan final. “Kupon untuk periode pertama rencananya akan diterbitkan mulai 1 Juni 2010 dengan materi kuis Belanda vs Denmark di Grup E, yang dilangsungkan 14 Juni mendatang di Johannesburg,” ungkapnya. Khusus untuk babak penyisihan pilihan jawabannya tiga, sedangkan pada babak knouckout cuma dua alternatif. “Misalnya pada pertanyaan Belanda vs Denmark, peserta kuis cukup mengisi pilihan Belanda menang, seri atau Denmark menang. Panduannya nanti akan disediakan pada kupon kuis tersebut,” papar Jonny. Seperti halnya Classic Match, kupon kuis TebakTop Skor Piala Dunia 2010 juga akan dimulai pemuatannya pada 1 Juni. Hadiah utamanya satu unit Honda Tiger, satu unit Honda Mega PRO dan satu unit Honda Vario. Tebak Top Skor, menurut Jonny, diundi sekali saja seusai penyelenggaraan Afrika Selatan 2010. Begitu pula dengan kuis Tebak Juara Piala Dunia 2010 dan The Best Player World Cup 2010, yang kuponnya baru mulai dimuat pada 11 Juni mendatang. (h01)


Sport

WASPADA Selasa 25 Mei 2010

A7

PSMS Proses Pembentukan Tim MEDAN (Waspada): Pengurus PSMS Medan telah memiliki konsep untuk membentuk skuad Ayam Kinantan ke kompetisi Divisi Utama Liga Indonesia 2011/2012, dan sementara masih diproses Ketua Umum sebelum dibahas dalam rapat pengurus. Demikian dikatakan Sekretaris Umum PSMS Idris SE di Medan, Senin (24/5). Menanggapi posisi asisten pelatih Suyono, sifatnya hanya ditugaskan memimpin latihan 17 pemain yang masih terikat kontrak dengan PSMS. Untuk memberikan referensinya terhadap pemain kepada pengurus, bukan berarti itu final karena ditentukan akan Waspada/Khairil Umri Batubara

Asisten Pelatih PSMS, Suyono (kanan), mendampingi M Affan Lubis dan kawan-kawan dalam sesi latihan di Stadion Kebun Bunga Medan baru-baru ini.

Asisten Pelatih PSMS Berkualitas MEDAN (Waspada): Sekretaris Umum PSMS Medan, Idris SE mengakui, asisten pelatih PSMS Suyono memiliki kualitas yang bisa dipertimbangkan. Pengalamannya menjadi asisten beberapa sosok pelatih ternama seperti Suimin Diharja dan Zulkarnain Pasaribu merupakan modal yang cukup. “Di skuad Ayam Kinantan, Suyono diangkat Suimin sebagai pelatih. Saat posisi Suimin digantikan Kustiono, dia tetap diberi tempat sebagai asisten. Begitu juga pada saat Zulkarnain Pasaribu yang jadi pelatih tetap

diberi kepercayaan jadi asisten,” ujar Idris di Medan, Senin (24/5). Idris juga menyebutkan, pengurus dan manajemen PSMS tidak pernah mengintervensi pelatih untuk menentukan asisten pendampinginya. Semuanya merupakan wewenang pelatih. Pengurus mempercayakan Suyono untuk memimpin latihan pemain sebagai awal dari seleksi pemain PSMS di musim mendatang sekaligus memberi laporan kepada pengurus atau pelatih nanti agar bisa mem-

pertimbangkan pemain tersebut dipertahankan atau tidak. Idris menegaskan, kepercayan dua mantan pelatih PSMS tersebut kepada Suyono merupakan sebuah bukti bahwa Suyono layak. “Terlepas lisensi yang dikantongi saat ini, dia terbukti dipercaya para pelatih sebagai asisten,” seru manajer tim Sumut FC ini. Secara terpisah, Suyono menyebutkan berbagai program latihan tengah dipersiapkan untuk 17 pemain yang ada saat ini dengan fokus pada kemampuan teknik pemain.

“Saat ini kita terus menguji kemampuan shooting dan crossing pemain sekaligus development position. Minggu depan, kita akan geber metode membangun serangan dari sepertiga lapangan,” sebutnya. Kendati posisinya sebagai asisten pelatih tak tergoyahkan pada dua pergantian arsitek PSMS selama kompetisi Divisi Utama 2009/2010 lalu, Suyono mengaku dirinya hanya diberi komando mempersiapkan latihan pemain dan penentuan strategi kendali sepenuhnya berada di tangan pelatih. (m24)

Grasstrack PAG 2010 Palas Sukses SIBUHUAN (Waspada): Untuk pertama kalinya tahun ini, kejuaraan otomotif motorcross dan grasstrack digelar di Kabupaten Padanglawas (Palas) yang turut dimeriahkan sejumlah pembalap dari berbagai kabupaten termasuk Provinsi Riau. Perlombaan yang berakhir Minggu (23/5) itu memperlombakan kelas Bebek Lokal Tapanuli, yakni bebek standar pemula, bebek empat tak open, bebek campuran Tapanuli, bebek open, grasstrack lokal dan grasstrack open. Juara umum grasstrack open diraih Naim Ritonga dari Tim Dewa Kota Pinang dengan perolehan 50 poin, sedangakan Jupri Siregar dari team Tran Cell Racing meraih predikat juara umum grasstrack lokal. Kejuaraan yang masuk dalam pengawasan Ikatan Motor Indonesia (IMI) Sumut tersebut berlangsung melalui pertaru-

Waspada/Syarif Ali Usman

Para pembalap adu ketangkasan untuk memperebutkan gelar juara di Sirkuit Sigalagala, Kecamatan Barumun, Kabupaten Palas, Minggu (23/5). ngan yang sengit. Pada lintasan kedua setiap kelas perlombaan,

kepulan debu sempat menghambat penglihatan dan seba-

gian penonton pun terpaksa mengenakan masker. (crif)

Taekwodoin Putri Medan Harapkan Perhatian MEDAN (Waspada): Dua taekwondo putri masa depan Kota Medan mengharapkan supaya event yang ada diperbanyak frekwensinya. Supaya atlet bisa menjadikannya sebagai arena meningkatkan pengalaman dan menambah jam terbang. “Tanpa adanya kejuaraan, kualitas atlet akan sulit berkembang. Selain itu, perhatian pemerintah terhadap atlet-atlet taekwondo supaya bisa lebih ditingkatkan lagi,” ucap Suzi Amanda S Chan didampingi rekannya Meidy Sundari R Chan. “Kejuaraan-kejuaraan harus diperbanyak lagi, demi mengasah kemampuan para atlet taekwondo di kota ini,” tambah keduanya di Medan, kemarin. Di Sumatera Utara sekarang ini, khususnya Medan, sebut Suzi, talenta-talenta usia muda di cabang taekwondo sangat banyak. “Buktinya setiap ada kejuaraan dan ujian kenaikan tingkat,

Waspada/ist

Suzi Amanda S Chan dan Meidy Sundari R Chan bersama pelatih. selalu disambut positif dengan banyaknya peserta. Juga di setiap kejuaraan lahir juara-juara baru dan mereka potensial untuk dikembangkan,” jelas Suzi. Kedua taekwondoin yang masih duduk di kelas II SMA

Problem Catur Hitam melangkah, mematikan lawannya dalam empat langkah.

Jawaban di halaman A2.

merupakan atlet taekwondo peraih medali emas di Porkot (Pekan Olahraga Kota) 2009 lalu untuk Kecamatan Medan Area. Suzi meraih emas di kelas Bantam, sedangkan Meidy dari kelas Feather.

TTS TOPIK

Namun keduanya sedikit mengeluh, karena pihak kecamatan Medan Area kurang memberikan perhatian. “Kami mengharapkan dukungan dan bantuan dari pihak Camat dan KONI Kecamatan Medan Area, terutama saat latihan,” harap Suzi dan Amanda. Camat Medan Area M Sofyan yang dikonfirmasi mengatakan, urusan terhadap atlet, terutama pemberian bonus dan bantuan adalah wewenang KONI Medan. “Soal pemberian bantuan dan bonus bukan urusan kecamatan, tapi KONI Medan,” ujar Sofyan. Ke-16 taekwondo dipersiapkan adalah Suzi, Meidy, Delviyanto, M Fachri, Fernando Utama, Angelia S, Sebastian, Taufik Rukhayat, Putri Dwi Litari, Loyal Hamzah, Fani Syahputra, Rizky Andriani, Dedek Asmara, Azhar Abdilah, Fahrul Rozi dan Tondi Rahmad. (h09)

dipakai kembali tidaknya pemain dalam rapat pengurus. “Begitu juga terhadap keseriusan pemain menyongsong liga musim depan menjadi target pengurus, karena PSMS musim depan memiliki target menembus Liga Super, makanya pemain harus bisa menunjukkan keseriusan dalam latihan. Untuk referensi dari Suyono,

itu bukan harga mati. Referensinya akan menjadi pembahasan lanjutan,” sebut Idris. Mantan pelatih PSMS Suimin Diharja menilai rekomendasi asisten pelatih PSMS Suyono perihal layak tidaknya pemain kembali direkrut sebenarnya belum tepat. “Suyono belum pantas untuk memberi rekomendasi dan melatih pemain PSMS yang ada saat ini, karena lisensi yang dia punya masih C. Artinya, dia baru bisa melatih sekolah sepakbola (SSB),” tambahnya. Dengan lisensi C ini yang dimiliki Suyono dikhawatirkan

akan banyak kendala di kemudian hari, belum lagi tentang ketidakcocokannya dengan pelatih baru ataupun dengan pemain yang direkomendasikannya. Terkait itu, Suimin mengingatkan agar pengurus PSMS tidak salah menentukan langkah persiapan bagi skuad Ayam Kinantan menghadapi kompetisi mendatang. Suimin menyarankan pengurus PSMS terlebih dahulu membentuk manajemen yang bertugas mengangkat pelatih, baru melakukan pencarian pemain. (m24)

Tinju Binjai Juara Umum Porwilsu BINJAI (Waspada): Kurangnya perhatian Pemko dan KONI Binjai ternyata tak menyurutkan semangat anak didik Juliadi Mustafa Perangin-angin yang menurunkan enam petinju pada Pekan Olahraga Wilayah Sumatera Utara (Porwilsu) 2010 sekaligus menjadikan Pertina Binjai keluar sebagai juara umum, Sabtu lalu. Dari keenam atlet itu, lima di antaranya meraih medali emas dan satu lagi perak. Kelima peraih emas adalah Suwandaru (kelas 54 kg), Firman Syahputra (48 kg), M Azmi (69 kg), Ardiansyah Nasution (64 kg) dan Mustian H Piliang (51 kg), sedangkan medali perak disumbangkan Fuad (kelas berat 91 kg). Usai kegiatan, kontingen yang tidak dibekali uang saku dan akomodasi itu bersama pelatih dan Ketua Pertina Binjai langsung bersilaturahim ke Kantor DPD IPK Kota Binjai yang disambut Ali Susanto. Pada acara itu, Ketua Pertina Binjai, Lettu B Simamora, tak kuasa menahan haru semenjak dimulainya Porwilsu pada 21-23 Mei lalu di Gelanggang Remaja Medan, di mana Pertina Binjai keluar sebagai juara umum yang juga berkat dukungan dan perhatian Ali Susanto. “Sebenarnya kami telah cukup melakukan upaya, agar petinju Binjai mendapat perhatian serius khususnya dari KONI dan Pemko Binjai sebagai institusi yang berkepentingan. Namun kenyataannya sejak training center (TC) hingga akhirnya Porwildasu, tak ada satupun atensi yang diberikan lembaga tersebut kepada Pertina Binjai,” terang Simamora. Ketua DPD IPK Kota Binjai, Ali Susanto seusai makan siang bersama mengatakan kepeduliannya terhadap olahraga karena ingin senantiasa berkarya untuk memasyarakatkan olahraga dan mengolahragakan masyarakat. (a04)

AP

Barcelona Tantangan Besar Mourinho MADRID (Waspada): Calon entrenador Real Madrid Jose Mourinho (foto) mengeluarkan komentarnya soal persaingan La Liga Primera. “Akan menjadi tantangan besar untuk bisa melawan Barcelona. Mereka tim yang hebat dan bahkan nyaris merebut seratus poin,” kata Mourinho kepada Portuguese TV. Dia pun ngaku akan memulai negosiasi dengan El Real langsung bersama Presiden Florentino Perez, Senin (25/5), setelah menjadi pelatih ketiga yang mampu menjuarai Liga Champions dengan dua klub berbeda. “Kini saya ingin menjadi pelatih pertama yang menjuarai Liga Champions dengan tiga klub berbeda. Jadi, saya akan pindah dan Real Madrid adalah satu-satunya tujuan berikut,” ujar Mourinho. Mantan manajer Chelsea dan FC Porto itu memberi gelar Liga Champions pertama pada Inter Milan sejak 1965 dengan menaklukkan Bayern Munich 2-0 pada final akhir pekan lalu di Madrid. “Saya sudah meraih segalanya di Italia. Tapi banyak hal yang tidak saya senang di Italia dan itu sudah saya pikirkan selama empat-lima bulan,” ungkapnya. Mourinho sejak sebulan lalu sudah memberi sejumlah syarat mutlak buat Real, yang tak bisa diganggu gugat. Dua di antaranya adalah tak ada intervensi dari manajemen klub terhadap skuad dan kritikan terhadap gaya main. Kini dia mengajukan syarat tambahan, yakni meniadakan proyek pemain bintang.

“Saya belum tahu apa proyek mereka. Itu hal pertama yang akan saya cari tahu sebelum melatih mereka,” papar pelatih asal Portugal itu, seperti dikutip AFP, Senin (24/5). “Saya pelatih Inter dan bangga dengan status itu. Jika saya melatih Madrid, itu juga atas dasar ambisi untuk menang dan mengatasi tantangan hebat. “Jadi jika Madrid berambisi juara, maka tak perlu ada proyek bintang dan uang. Ini soal kesiapan mental untuk bermain demi klub dan kekompakan. Itulah kunci saya di Inter, kebahagiaan bersama keluarga fantastis,” tegasnya lagi. Dia kabarnya akan menandatangani kontrak dengan durasi empat tahun. Tiap tahunnya The Special One akan mendapat bayaran 10 juta euro atau sekitar Rp116 miliar. Koran AS malah melaporkan, Mourinho telah mencapai kesepakatan dengan Perez, Jumat lalu, tepat sehari sebelum final Liga Champions di Santiago Bernabeu. Surat kabar Spanyol lainnya, Marca, bahkan memasang judul “Real Madrid Rekrut Sang Juara”. Los Blancos, menurut Marca, akan memperkenalkan Mourinho kepada publik pertengahan pekan ini. Koran itu juga mengklaim, The Special One akan membawa bek Inter Douglas Maicon dan bomber Diego Milito, sehingga Los Blancos juga harus melepas beberapa pemainnya. (h01/bb/afp/goal)

Chris Tetap Ke Australia SEMARANG (Antara): Pemegang gelar Super Champions kelas bulu WBA, Chris John, tetap akan berlatih ke Sasana Herry‘s Gym di Perth, Australia, meskipun cedera bahu kiri. “Cedera saya belum sembuh 100 persen dan kalau tangan kiri digerakkan masih terasa sakit,” jelas Chris ketika dihubungi di Semarang, Senin (24/5). Menurut dia, selain untuk berlatih, kehadirannya di Australia juga untuk menjalani proses penyembuhan cederanya supaya fit 100 persen melawan Fernando David Saucedo dari Argentina. Dia tambahkan, sebenarnya Senin kemarin mesti ke Australia menjalani latihan di bawah asuhan pelatih sekaligus manajernya, Craig Christian, tetapi ditunda sehari karena kehabisan tiket pesawat. “Saya berangkat dari Semarang pukul 06.00WIB menuju Jakarta kemudian Denpasar, dan baru terbang ke Perth,” kata ayah Maria Luna Ferisha dan Maria Rosa Christiani tersebut. Sepulang dari Australia, latihan akan dilanjutkan di Bali atau di Jakarta. “Saya belum tahu apakah berlatih di Sasana Mirah Boxing Camp Bali atau Senayan Jakarta,” tambahnya.

Sudoku

POLITIK & HUKUM Mendatar

1. Nama ketua umum Partai Demokrat terpilih dalam kongres, Minggu 23 Mei. 8. RUU Perlindungan PRT dibahas DPR. Kepanjangan PRT adalah _____ Rumah Tangga. 11. Dalam RUU Perlindungan diatas, PRT bekerja (Pilih: Tiga, Lima atau Enam) hari seminggu. 12.Dalam RUU diatas, PRT menerima gaji sesuai Upah Minimum Regional atau dikenal dengan singkatan _____. 13.Dalam RUU diatas, PRT juga menerima Tunjangan Hari Raya atau dikenal dengan singkatan ______. 14.Majikan yang melanggar UU Perlindungan PRT, diancam hukuman maksimal (Pilih: Tiga, Lima atau Enam) tahun penjara. 16.Surat Perintah 11 Maret. 18.Lapor. 19.Pengurangan hukuman pada narapidana. 20.Singkatan Badan Penyelenggara Jaminan Sosial. 22.RUU tentang Pembentukan BPJS memberikan masyarakat (Pilih: Hukuman Sosial, Jalinan Sosial atau Jaminan Sosial) melalui satu badan saja. 24.Jurang pemisah. 25.Singkatan Program Legislasi Nasional.

Menurun

2. Perilaku yang memperlihatkan kesukaan berlebihan kepada kerabat dekat atau sanak saudara, terutama di jabatan pemerintahan. 3. Perkara singkat, seperti menyidangkan pelanggaran lalulintas. 4. Gerakan mengombak, gelagat. Pribahasa: Air ____ tanda tak dalam, artinya orang yang sombong, besar cakap, biasanya tak berisi. 5. Orang yang diperalat, kaki tangan. 6. Rampas; Dalam bahasa Inggris artinya menanggapi statement lawan politik dalam perdebatan. 7. Sistem sosial yang memberi kekuasaan kepada wanita; Lawan kata patriarki. 9. Singkatan United Nation. 10.Kantor mengeluarkan paspor, dibawah kementerian hukum. 14.Singkatan Trade Mark. 15.Orang yang dibicarakan, tidak termasuk pembicara dan kawan bicara; Dia. 17.Jabatan tinggi organisasi PB Nahdlatul Ulama. 19.Kata benda (noun) dari kata kerja (verb) berseranjang (bersetubuh); Adegannya dalam filem disensor. 20.Berpihak dalam argumentasi. 21._____ Penuntut Umum (JPU). 23.Singkatan Partai Golkar.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: mudah (**). Jawaban di halaman A2 kolom 1.

6 8 4 1

9 3

9 3 1

9

8

9

2

7

7 1 5 3 8 2 4 9 3

7

6

3

7 9 8 8

7

6

7

2 5 6


Sport

A8

WASPADA

Selasa 25 Mei 2010

Federer Nyaris Tanpa Cacat PARIS (Waspada): Unggulan utama tunggal putra, Roger Federer (foto), memulai perjuangannya mempertahankan gelar di Perancis Terbuka dengan mulus. Tampil di lapangan utama Roland Garros, FedEx menghempaskan petenis Australia Peter Luczak 6-4, 6-1, 6-2, Senin (24/5).

AP

Unggulan Belum Terhadang PARIS (Waspada): Langkah para petenis unggulan di babak pertama turnamen Grand Slam Perancis Terbuka 2010 belum menemui hambatan berarti. Sebagian besar dari mereka sukses lolos ke babak kedua, Senin (24/5). Venus Williams (foto) merupakan salah satu unggulan yang sukses lanjut ke babak kedua. Menghadapi petenis Swiss Patty Schynder, unggulan kedua asal Amerika Serikat tersebut menang 6-3, 6-3. Pada pertandingan lain, petenis Argentina Gisela Dulko menang mudah 6-1, 6-2 atas Victoria Azarenka asal Belarus. Selain itu, petenis Perancis Aravane Rezai ikut meloloskan diri usai mengalahkan Heidi El Tabakh (Kanada) 6-1, 6-1. Para unggulan lain yang lolos tanpa hambatan di antaranya adalah Dominika Cibulkova (Slowakia), Maria Kirilenko (Rusia) dan Flavia Pennetta (Italia). Nasib sial justru dialami Maria Jose Martinez (Spanyol) yang tumbang di tangan petenis A. Amanmuradova 2-6, 4-6. Hasil serupa juga dipetik oleh Svetlana Kuznetsova. Juara bertahan asal Ru-

sia tersebut berhasil mengandaskan perlawanan petenis non unggulan Sorana Cirstea (Rumania ) 6-3, 6-1. Petenis Denmark Caroline Wozniacki pun menyusul rekan-rekannya. Di babak awal, Wozniacki mengalahkan petenis Rusia Alla Kudryavtseva 6-0, 6-3. Jawara Olimpiade 2008 asal Rusia, Elena Dementieva, meraih hasil serupa usai menuntaskan perlawanan Petra Martic (Kroasia) 6-1, 6-1. (m33/ap)

Sepanjang permainan, Federer hanya tercatat melakukan 11 unforced errors dan kehilangan 14 dari 64 poin saat melakukan servis. Luczak sendiri gagal memperbaiki rekornya di Roland Garros setelah terus kalah dalam empat tahun terakhir di babak awal. Selanjutnya, Federer akan meladeni tantangan

Pasang Iklan Hub.

☎ 4528431 HP. 081370328259 Email:iklan_waspada@yahoo.co.id

AP

petenis Kolombia Alejandro Falla di babak kedua. Perjuangan mempertahankan gelar setidaknya kini berkurang bagi Federer setelah petenis Latvia Ernests Gulbis angkat koper meninggalkan Paris. Unggulan ke-23 ini tersingkir di babak pertama karena menyerah dari petenis tuan rumah Julien Benneteau. Cedera hamstring menjadi penyebab utama Gulbis mundur sebelum menyelesaikan pertandingan dalam keadaan tertinggal 4-6, 2-6, 0-1. Sejumlah pemain yang diunggulkan sukses lolos ke babak berikutnya juga melaju mudah. Petenis Swedia Robin Soderling, unggulan kelima, menjadi petenis pertama yang memastikan

langkahnya ke babak kedua. Tanpa kesulitan, Soderling meredam Laurent Recouderc 6-0, 6-2, 6-3. Keberhasilan Soderling rupanya diikuti oleh dua petenis unggulan lainnya, Ma-

rin Cilic dan Jo-Wilfried Tsonga. Tampil sebagai unggulan ke-10, Cilic cukup dibuat kerepotan oleh Ricardo Melio meskipun akhirnya menang 6-1, 3-6, 6-3, 6-1. Situasi yang tak kalah

alot ditemui Tsonga kala melawan Daniel Brands. Salah satu favorit publik Perancis tersebut dipaksa bermain lima set sebelum meraih kemenangan 4-6, 6-3, 6-2, 6-7, 7-5. (m33/ap)


Medan Metropolitan

WASPADA Selasa 25 Mei 2010

B1

Jembatan Sudirman Berbiaya Rp11,9 M Rampung Akhir Desember MEDAN (Waspada): Ditutupnya Jalan Sudirman Medan sejak sebulan terakhir, menimbulkan protes banyak warga. Penutupan jalan itu karena jembatan di alur Sei Babura peninggalan Belanda tersebut, persisnya di depan rumah dinas Gubernur Sumatera Utara, perlu dibangun baru. Kepala Balai Besar Pelaksanaan Jalan Nasional (BBPJN) I-Medan Dirjen Bina Marga Departemen Pekerjaan Umum, Winarno MS dihubungi kemarin mengaku, pembangunan jembatan sepanjang 36 meter dengan lebar lapis 14 meter, menelan dana Rp11.971.705.000. “Dana pembangunan sebenarnya tidak sebesar itu. Karena nilai kontraknya kepada PT Hariara sebesar Rp8,5 miliar. Tapi karena jembatan ini berada di

inti kota, maka pembangunannya disesuaikan dengan ciri kota, termasuk sejumlah ornamenornamen khusus,” jelasnya. Namun, Winarno tak merinci seperti apa ornamen khusus dimaksud. Tapi dia memastikan, jembatan itu sudah bisa dipakai akhir Desember 2010. “Jembatannya bisa saya pastikan sudah dioperasionalkan Desember 2010. Karenanya, penutupan jalan di ruas tersebut terpaksa dilakukan agar proses

Hemat Sumber Daya Alam MEDAN (Waspada): Kaban Lingkungan Hidup Kota Medan, Ir Purnama Dewi, MM (foto) mengungkapkan, sudah saatnya kita melakukan penghematan sumber daya alam. “Selain hemat energi, masyarakat juga diharapakan mau membiasakan diri memamakai produk daur ulang 3R (Reduce, Reuse, Recikling),” tutur Purnama Dewi saat mengunjungi lahan pembuatan Kompos dari sampah di Kelurahan Hamdan Belawan, Minggu (23/5). Purnama Dewi yang didampingi kader lingkungan serta beberapa anggota Komunitas Pemuda Peduli Lingkungan (Koppling) mengatakan, bahwa produk 3R saat ini sudah banyak terdapat di pasaran, bahkan sebahagian masyarakat Medan sudah mampu membuatnya sendiri. Aneka sampah kemasan yang dapat dijadikan aneka kerajinan, seperti pot bunga, frame foto, bahkan wadah serba guna. Selain itu, sampah basah dapat dijadikan kompos seperti yang dilakukan Bahtiar yang telah berhasil menjual kompos dari sampah organiknya sebanyak 5 ton perbulan. Kertas daur ulang sudah mengisi banyak super market, lanjut Purnama, banyak cara dapat dilakukan untuk menghemat sumber daya alam. Dengan membudayakan memakai produk-produk daur 3R, yakni mendaur ulang sampah ditiap rumah tangga, hal itu sama dengan melakukan upaya penyelamatan bumi. Ingat, kata dewi, bumi kita sangat rentan. Sekarang tidak ada kata terlambat untuk menyelematkan lingkungan dengan berbagai upaya dan tindakan. (h10)

pembangunan tidak mengganggu pekerjaan,” ujarnya. Winarno mengaku, dampak ditutupnya ruas jalan tersebut memang menyebabkan arus lalu lintas dari Jalan Patimura atau Jalan S Parman menuju Jalan Cik Ditiro atau ke Jalan Diponegoro Medan, terganggu total selama lima bulan ke depan. Namun untuk solusi masalah ini, Winarno mengaku

sudah dikordinasikan dengan pihak terkait di Pemko Medan. “Itu (antisipasi kemacetan) tugas pihak terkait di Pemko Medan. Tugas kita hanya membangun jembatan,” jelasnya. Di tempat terpisah, Wakil Ketua Komisi D DPRD Medan, Remon Simatupang menyayangkan penutupan ruas jalan tersebut kurang disosialisasikan Dinas Perhubungan Medan.

Pengiriman TKI Ke Malaysia Capai 25.000 Per Bulan MEDAN (Waspada): Jumlah Tenaga Kerja Indonesia (TKI) yang dikirim ke Malaysia mencapai 25.000 orang per bulan. Jumlah tersebut mencapai angka 41,6 persen dari total pengiriman TKI ke berbagai negara yang berkisar 60.000 per bulan. Demikian dikatakan Kepala Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia (BNP2TKI) Jumhur Hidayat saat melepas keberangkatan 375 TKI Formal dari PT. Mutiara Karya Mitra (MKM) Medan untuk dipekerjakan di Western Digital (M) SDN BHD, Malaysia, baru-baru ini. Menurut Jumhur, setiap bulan Indonesia memberangkatkan 60.000 TKI untuk dipekerjakan di berbagai negara. Dari jumlah tersebut, sekitar 25.000 di antaranya bekerja di Malaysia. “Bahkan, sebelum adanya kebijakan penundaan pengiriman TKI untuk rumah tangga (informal), ada sekitar 5.000 orang yang bekerja sebagai pembantu rumah tangga (PRT) di sana,” ujar Jumhur di

dampingi Komisaris Utama PT MKM Medan Parlindungan Purba, SH, MM. Jumhur menegaskan, pemerintah terus berupaya mendorong agar pengiriman TKI yang masuk kategori formal, baik semi skill maupun skill terus meningkat setiap tahunnya. Sebab, perlindungan atas Hak Asasi Manusia (HAM) yang diterima TKI formal jauh lebih baik dibanding TKI yang bekerja di sektor informal. Berdasarkan data BNP2TKI, dari 60.000 TKI yang dikirimkan ke berbagai negara setiap bulan, sekitar 60 persen di antaranya merupakan TKI yang bekerja di sektor informal (PRT). Sementara Kepala BNP2TKI Sumut H Sumadi mengatakan, pada tahun 2008, tercatat 14.000 lebih TKI asal Sumut yang berangkat ke Malaysia. Namun karena ada krisis global, pengiriman TKI di tahun 2009 turun menjadi sekitar 11.000 orang. “Sedangkan pada tahun 2010 periode Januari-Mei, tercatat ada 5.646 yang diberangkatkan

Dirjen Hubla Serahkan Izin Approval MEDAN (Waspda): Direktorat Jendral Perhubungan Laut (Dirjen Hubla) menyerahkan “Approval”, perpanjangan izin penyelenggaraan pendidikan dan pelatihan pelayaran kepada Akademi Maritim Indonesia (AMI) Medan. Direktur AMI Medan Yuris Danilwan, SE.MSi.PhD, Sabtu (22/ 5), dalam jumpa Pers di kampus AMI Medan Jalan Brigjen Bejo Pl. Brayan mengatakan, penyerahan Approval dari Direktorat Jendral Perhubungan Laut yang ditandatangani Sunaryo, SH kepada AMI Medan merupakan upaya untuk meningkatkan mutu pendidikan pelaut. “Proses untuk memperoleh Approval ini tidak gampang karena ada tahapan-tahapan yang harus dipenuhi institusi pendidikan pelaut. Pemberian Approval itu sendiri berlaku untuk lima tahun, akan tetapi setiap satu tahun sekali akan terus dievalusi,”kata Yuris. Sampai saat ini, jelas Yuris, ijazah para taruna dari jurusan teknika dan nautika yang kuliah di AMI Medan dikeluarkan oleh Direktorat Jendral Perhubungan Laut yang mendapat rekomendasi dari International Maritime Organization (IMO). Oleh karenanya ijazah pelaut hasil didikan di Indonesia baik dari AMI Medan maupun Sekolah Tinggi Ilmu Pelayaran (STIP) Jakarta adalah sama dan berlaku internasional. “Artinya, pelaut-pelaut lulusan institusi pendidikan di Indonesia tidak perlu diuji lagi atau diragukan kompetensinya, karena ijazah pelaut asal Indonesia yang dikeluarkan Direktorat Jendral Perhubungan Laut tersebut telah berlaku internasional,” kata Yuris yang saat ini institusi pendidikannya telah menjalin kerjasama dengan sejumlah perusahaan pelayaran nasional dan asing untuk ikut mensukseskan gerakan kampanye IMO “Go To Sea”. Beasiswa Dijelaskan Yuris, untuk tahun 2010/2011 AMI Medan memberikan beasiswa kepada lulusan SMU yang ingin melanjutkan pendidikan di jurusan Nautika dan Teknika serta lulusannya akan langsung mendapatkan kesempatan ikatan dinas terbatas. “Peluang ini hendaknya dimanfaatkan sebaik-baiknya oleh para lulusan SMU mengingat jurusan Nautika dan Teknika saat ini sangat dibutuhkan dan jumlah lulusannya belum mampu memenuhi kebutuhan pasar kerja di sektor pelaut,” sebut Yuris yang menegaskan tiga jurusan yang dikelola AMI Medan yakni Nautika,Teknika serta Ketatalaksanaan Niaga telah memperoleh akreditasi B dari BANPT sesuai syarat dari sejumlah perusahaan pelayaran baik nasional maupun asing. (m29)

Sebab, penutupan yang sudah terjadi, menyebabkan sejumlah ruas jalan di tempat lain menjadi macet pada jam-jam tertentu. “Kalau sosialisasi dilakukan lebih maksimal, saya kira kemacetan yang terjadi hingga hari ini, pasti bisa diatasi. Tapi, karena itu tidak dilakukan, ya kemacetan harus terjadi dan warga pengguna jalanlah yang menjadi korban,” ujarnya.(m19)

Waspada/ist

Komisaris Utama PT PT Mutiara Karya Mitra (MKM) Medan Parlindungan Purba, SH, MM, (kanan) menerima cindera mata dari Kepala BNP2TKI Jumhur Hidayat (kiri) saat melepas keberangkatan 375 TKI ke Malaysia, baru-baru ini.

ke Malaysia,” jelasnya. Terkait pengiriman TKI ke Malaysia oleh PT Mutiara Karya Mitra (MKM) Medan, Sumadi mengatakan, perusahaan tersebut memberikan kontribusi hingga 20 persen dari total TKI yang dikirim ke Malaysia. Sedangkan Komisaris Utama PT MKM Medan Parlindungan Purba, SH,MM mengatakan, dalam waktu 5 tahun terakhir, pihaknya telah memberangkatkan sekitar 6.534 TKI ke Malaysia. “Untuk tahun 2009, PT MKM Medan mengirimkan sebanyak 1.815 TKI ke Malaysia. Sedangkan pada tahun ini, TKI yang sudah dikirimkan berkisar 1.496 orang,” ujarnya. Menurut Parlindungan, pihaknya sudah lama menjalin kerjasama dengan perusahaan elektronik Western Digital (M) SDN BHD. Bahkan sekitar 4.500 TKI yang bekerja di perusahaan itu, diberangkatkan melalui PT MKM Medan. Selain mendapat fasilitas gaji yang memadai, para TKI tersebut juga mendapat perlindungan hukum. Dengan demikian, para orang tua diharapkan tidak khawatir terhadap anaknya yang menjadi TKI di perusahaan tersebut. Acara pemberangkatan TKI tersebut disaksikan oleh para orang tua TKI, Konjen Malaysia di Medan Norlin Binti Othman, Senior ManagerWestern Digital (M) SDN BHD S Fauzi Ahmad dan jajaran PT MKM Medan serta undangan.(m26)

Waspada/ist

PENANAMAN POHON: Guru Besar Fakultas Pertanian USU Prof. Dr. Ir. Abdul Rauf, MP, didampingi Kaban Lingkungan Hidup Kota Medan Ir Purnama Dewi, MM, serta ketua Tim Relawan MDGC Dewi Teruna J Said, melakukan penanaman pohon di Desa Timbang Deli Marelan, Kec. Medan Marelan, yang diprakarsai oleh Komunitas Pemuda Peduli Lingkungan (Koppling).

Hijaukan Lahan Pasang Surut MEDAN (Waspada): Prof. Dr. Ir. Abdul Rauf, MP (Guru Besar Fakultas Pertanian USU) mengatakan, tidak ada alasan untuk tidak menghijaukan daerah pasang surut pantai, apalagi suhu panas di daerah itu umumnya lebih tinggi karena berdekatan dengan laut. “Pilihlah jenis pohon yang tahan salinitas (kadar garam) seperti Bakau, Ketapang Laut dan beberapa pohon komersial seperti Cemara Udang dan lainnya,” kata Prof Abdul Rauf pada acara Bedah Lingkungan di Desa Timbang Deli Marelan, Kel. Labuhan Deli, Kec. Medan Marelan, Minggu (23/5), yang di prakarsai oleh Tim Relawan Medan Green And Cleans. Prof Rauf yang didampingi Kepala Badan Lingkungan Hidup Kota Medan Ir Purnama Dewi MM, serta ketua Tim Relawan MDGC Dewi Teruna J Said mengharapkan agar lapisan masyarakat seperti LSM, pemerintah, praktisi, mau ber-

sama-sama secara berkala melakukan upaya penghijauan, dimana dan kapan pun, karena bumi sudah semakin rentan, kebutuhan akan oksigen semakin meningkat dengan terjadinya pemanasan global. Pohon, sebut Pakar Ilmu Tanah Fakultas Pertanian USU ini, satu-satunya cara ampuh murah dan mudah menghasilkan oksigen. Khusus melakukan penghijauan di lahan pasang surut/pantai gunakanlah jenis pohon yang tahan terhadap salinitas (kadar garam) tinggi, selain jenis tanaman/pohon mangrove (Bakau, kayu api-api dan lain-lain). Beberapa jenis tanaman pohon komersial lainnya juga dapat digunakan, diantaranya pohon Nyamplung (Ketapang Laut), Cemara Udang (Cemara Laut), dan lain-lain. Sementara itu, Purnama Dewi berjanji akan memperhatikan penghijauan bagi masyarakat setempat. Selaku Kepala Badan Lingkungan Hi-

dup Kota Medan, dia akan mengadakan komunikasi dengan tokoh-tokoh masyarakat serta pengusaha setempat agar lebih giat lagi melakukan upaya perbaikan lingkungan. “Saya akan menghimbau sesering mungkin dalam penghijauan ini,” ungkapnya. Khusus untuk daerah pantai yang berpasir dapat di tanam/ dihijaukan dengan menggunakan pohon Trembesi. Guna mengatasi kelangkaan air tawar di daerah pantai, terutama untuk menyiram pohon/tanaman hias di pekarangan dapat dilakukan pemanenan air hujan (water harvesting) dengan cara membuat tampungan pada talang rumah, atau membuat bak-bak penampung air hujan. Hadir juga dalam kesempatan itu Ketua Yayasan Hayati Indonesia Sumut Marwan Harahap dan juga Kepling Lingkungan 7 Azhar, serta anggota Komunitas Pemuda Peduli Lingkungan (Koppling). (h10)


Medan Metropolitan

B2 Calon Penumpang Kepanasan

WASPADA Selasa 25 Mei 2010

Kipas Angin Di Pintu Masuk Bandara Polonia Tak Maksimal MEDAN (Waspada): Para pengguna jasa Bandara Polonia Medan meminta Angkasa Pura II selaku pengelola bandara dapat memberikan pelayanan maksimal. Pasalnya, di pintu masuk bandara menuju ruang check in tiket di terminal dalam negeri terasa gerah dan panas. Padahal Bandara Polonia salah satu bandara terbesar dan bertaraf internasional di wilayah barat Indonesia.

Salahseorangyangmenyampaikan keluhan itu anggota DPRD Sumatera Utara Sonni Firdaus kepada wartawan di Bandara Polonia menjelang bertolak ke Jakarta, Senin (24/5). Kata Firdaus, dengan cuaca panas di luar, diperparah deng-

Musda Kosgoro 57 Harus Kondusif MEDAN (Waspada): Ketua DPD Partai Golkar Sumut Syamsul Arifin meminta Musda Kosgoro 1957 berjalan kondusif. “Siapa pun yang keluar menjadi Ketua Daerah Kolektif Organisasi Serbaguna Gotong Royong (PDK-Kosgoro) Sumut ke depan, harus diterima,” katanya saat membuka pertemuan silaturahim Keluarga Besar Kosgoro 1957 Sumut di Medan Club, Sabtu (22/5). Syamsul Arifin yang juga Gubsu mengaku yakin Kosgoro 1957 bisa bangkit kembali asalkan tetap pada khittahnya kegotongroyongan. Gubsu mendukung penuh rencana digelarnya Musda Kosgoro 1957 yang akan dilaksanakan pada 29 Mei 2010 di Polonia Hotel. Dia berharap, hasil Musda Kosgoro menjadi lebih baik lagi dari kepengurusan sebelumnya dan menghasilkan pogram kerja yang jitu. Hadir dalam pertemuan itu, Ketua panitia Musda Irwansyah Nasution,Daudsyah,MPLTobing,RizaFakhrumiTaher,HardiMulyono dan para pimpinan Kosgoro 57 Kabupaten/Kota se-Sumut. Rencana Musda Kosgoro 57 itu menindaklanjuti hasil rapat panitia dengan karetaker PDK Kosgoro 1957 Sumatera Utara, Leo Nababan beberapa waktu lalu. (m32)

Hari Ini Ketua Komnas HAM Di Unimed MEDAN (Waspada): Ketua Komisi Nasional Hak Asasi Manusia RI Ifdal Kasim, hari ini (25/5), membekali peserta Diklat di Ruang Sidang Gedung Lembaga Penelitian Universitas Negeri Medan. “Hak atas Pembangunan Berbasis HAM” sebagai judul materi yang akan disampaikannya dalam acara yang berlangsung dua hari itu, bertajuk “Pembangunan Berbasis HAM”, diselenggarakan oleh Pusat Studi Hak Asasi Manusia (Pusham) Unimed. Kepala Pusham Unimed Majda El Muhtaj mengatakan, kegiatan ini sangat strategis untuk mendiseminasi HAM atas pem-bangunan melalui Deklarasi PBB tentang Hak atas Pembangunan Tahun 1986. Sementara itu, Ketua Panitia yang juga Sekretaris Pusham Unimed Arief Wahyudi, kemarin, menjelaskan, kegiatan ini merupakan salah satu kegiatan Pusham tahun 2010 yang bertujuan untuk membangun wawasan dan kesadaran masyarakat akademis terhadap konsep HAM dan kebutuhan hadirnya pembangunan Indonesia yang berbasis HAM. “Untuk itulah Pusham menggelar Diklat sebagai upaya membekali kemampuan peserta dalam menganalisis dan merekonstruksi konsep-konsep pembangunan Indonesia yang berbasis HAM,” ujarnya. Diklat ini akan diikuti lebih kurang 30 peserta, yakni Pengurus Pusham Unimed, dosen-dosen muda di lingkungan Unimed, Humas dan Satuan Pengamanan Unimed. Diklat ini akan dipandu oleh fasilitator Wina Khairina dari KontraS Sumut. Selain ketua Komnas HAM RI, pembicara lain yang akan hadir adalah Sekretaris Eksekutif Fitra Indonesia (Akuntabilitas & Penganggaran APBD Berbasis HAM); Kepala Bapedasu Riadil Akhir Lubis (RPJM Sumatera Utara & Implementasi Pembangunan Sumatera Utara Berbasis HAM); Direktur Eksekutif PKPA (Perlindungan HAM Anak dalam Pembangunan Berbasis HAM) dan Kakanwil Kemenhuk dan HAM Sumut Mashudi (Perlindungan HAM Narapidana dalam Reformasi Lembaga Pemasyarakatan di Sumatera Utara). (m15)

an buruknya pelayanan bandara. Masyarakat tetap merasa gerah ketika masuk ke bandara akibat tidak maksimal dan buruknya penataan peralatan kipas angin. “Saya pikir kurang dinginnya kondisi di pintu masuk akibat kurang penataan, sehingga para penumpang merasa kurang nyaman. Padahal mereka sudah membayar airportax,” katanya. Firdaus berharap Bandara Polonia masih dapat dikembangkan secara maksimal, walaupun bakal dipindah ke lokasi baru di Kualanamu, Deliserdang. “Pembangunan bandara

baru belum tentu selesai cepat. Saya berharap manajemen APII memberikan pelayanan maksimal kepada para penumpang melalui bandara itu,” ujar Ketua DPD Partai Indonesia Baru (PIB) Sumut itu. Dia juga mendapat laporan, pada terminal keberangkatan luar negeri kerap tergenang air hujan. Namun pihaknya yakin di bawah kepemimpinan Kolonel (Pnb) Bram Bharata Tjiptadi, GM AP-II Bandara Polonia akan mendapatkan pelayanan terbaik. “Masyarakat sudah membayar tiket maupun airportax, harus dibarengi pelayanan yang baik pula,” ujarnya.

Bahkan Firman, S.Com, Kepala Data dan Informasi (Datin) pada Badan Meteorologi dan Klimatologi (BMKG) Wilayah I Stasiun Bandara Polonia Medan mengakui belakangan ini suasana udara di kawasan kota Medan gerah sekali, menyebabkan warga masyarakat tidak tenang. Kondisi udara rata-rata 34 hingga 35 derajat Celcius berlangsung bebarapa jam, membuat warga masyarakat siang dan malam tidak tenang beristirahat. “Saya mengimbau masyarakat lebih baik melindungi diri di tempat-tempat lebih nyaman,” ujarnya. (m32)

Pengangkatan Dirut Perkebunan Sesuai Mekanisme MEDAN (Waspada): Partai Patriot Sumut menilai pengangkatan Dirut PT Perkebunan Sumut, Darwin Nasution oleh Gubsu Syamsul Arifin, sudah sesuai mekanisme dan peraturan yang berlaku. Mereka meminta semua pihak agar tidak berusaha mengintervensi kewenangan Gubsu dalam tata kelola pemerintahan. Hal tersebut disampaikan Sekjen Partai Patriot Sumut, Rismansyah Siregar, didamping Wakil Ketua, OK Amir Syam dan Edison Sianturi di sekretariat partai tersebut, Minggu (23/5), menanggapi statemen Sekretaris Fraksi Partai Keadilan Sejahtera, Hidayatullah soal pergantian Dirut PT. Perkebunan. Rismansyah mengatakan, tudingan yang dilontarkan PKS bahwa Darwin adalah orang partai sangat menyesatkan. Karena terhitung sejak 6 Januari lalu, Darwin sudah mengundurkan diri dari partai, dan Ir Togar Nero ditunjuk sebagai Plt Ketua Partai Patriot Sumut. Memang peraturan melarang orang partai menduduki jabatan PT Perkebunan. Namun sebenarnya Surat Keputusan DPP No.327/SI/DPP-Patriot/I/2010 yang ditandatangani Ketua Japto Soerjo Soemarno dan Sekjen Sulistyanto menegaskan pergantian Darwin. “Jadi saya ingatkan PKS jangan mencampuri urusan partai lain ka-

lau tidak tahu,” kata Rismansyah. Dia menambahkan, penunjukan Darwin juga sudah melalui fit and profer test (uji kelayakan) yang dilakukan tim independen dari Universitas Sumatera Utara dalam beberapa bulan terakhir. Jadi dimana letak ketidaksesuaian dengan peraturannya, ujarnya. Mengenai latar belakang, Rismansyah menjelaskan, Darwin adalah seorang profesionalis muda yang memiliki pengalaman managerial yang dibuktikan dengan menjabat sebagai salah satu Perusahaan PMA (Penanaman Modal Asing) asal Jepang, PT. Marumitsu di Medan. Dan memang alasan Darwin mundur dari Partai Patriot juga untuk berkonsentrasi di bidang wiraswasta yang digelutinya jauh hari sebelum masuk partai. “Lagi pula kalaupun PKS mencurigai pengangkatan Darwin karena dia Ketua Tim Pemenangan Syampurno waktu Pilgubsu lalu, lalu bagaimana dengan pengangkatan mantan Presiden PKS, Tifatul Sembiring menjadi menteri. Bisa jadi karena PKS bagian dari koalisi,” sindirnya. Sementara Edison Sianturi menambahkan, bahwa Partai Patriot bersama 11 partai kecil lainnya dengan jumlah suara 13,6 persen lah yang pertamatama memberikan dukungan

kepada Syamsul Arifin maju sebagai Cagubsu. Setelah itu baru diikuti, PBB, PPP dan PKS. “Tapi kami tidak pernah sekalipun meminta dan mengintervensi Syamsul untuk memberikan jabatan apapun kepada kami. Kalaupun Syamsul menerima Gatot Pujonugroho sebagai calonWagub dari PKS itu juga hak mutlak Syamsul,” katanya. Mengenai pernyataan, bahwa penunjukan Dirut tersebut tidak dilaporkan kepada DPRD Sumut, menurut Edison yang juga mantan anggota DPRD Sumut periode 2004-2009, tidak ada peraturan yang mengatakan Gubsu harus melaporkan setiap pergantian pejabat kepada DPRD Sumut. Apalagi PT Perkebunan adalah BUMD yang sudah berbentuk Perseroan Terbatas, sehingga mutlak menggunakan UU PT yang mana pergantian direksi dilakukan melalui Rapat Umum Pemegang Saham (RUPS). Edison juga menghimbau kepada para pendukung Syampurno jangan menghujat pemimpin yang telah sama-sama didukung sebelumnya. Dan marilah berbicara lebih santun dan beretika. “Partai Patriot yang sering dicap orang sebagai partai preman tidak pernah menggunakan kata-kata kasar seperti, ‘pakai otak’ atau katakata kasar lain,” katanya.(h11)

Politeknik LP3I Terapkan ICT Dalam Perkuliahan

Politeknik MBP Gelar Seminar Tingkatkan Kualitas Dan Efisiensi MEDAN (Waspada): Politeknik MBP Jurusan Bahasa Inggris menggelar seminar mengenai kewirausahaan menghadirkan tiga pemakalah dari kalangan praktisi bisnis di Aula AMIK MBP Jl. Letjen Jamin Ginting Medan, Sabtu (25/5). Direktur Politeknik MBP, Drs Tenang Malem Tarigan, SE, M.Si Ak yang diwakili Purek II Mardaus Purba, SE mengatakan, seminar itu digelar menambah wawasan para mahasiswa, khususnya Jurusan Bahasa Inggris dengan harapan nantinya setelah tamat tidak lagi punya ketergantungan untuk mencari pekerjaan melalui lamaran melulu. Dengan seminar itu, kata Mardaus Purba, mahasiswa akan mengetahui perjalanan seorang praktisi usaha yang juga mempunyai latar belakang pendidikan di bidang bahasa Inggris, akhirnya berhasil menciptakan lapangan pekerjaan yang bukan hanya untuk dirinya sendiri tetapi untuk orang lain. Seminar yang menampilkan tiga pemakalah yakni Maruli Daminik, SE Direktur Lovely Holidays, Tevrian Valenitine Damiri, SS dari praktisi usaha jus daun sirih, serta DR. Isfendi Sodatia, SE,MA dari Akademis Kewirausahaan USU. Maruli Damanik di depan ratusan peserta memaparkan mengenai liku-liku perjuangannya dalam merintis usaha biro perjalanan, mulai dari tahap sebagai karyawan hingga hengkang yang akhirnya menjadi pengusaha. SementaraTevrianValentine Damiri, SS menguraikan mengenai suka-duka dalam merintis usaha jus daun sirih yang kini telah mendapat pasar dalam dan luar negeri. Dia mengakui, dari laterbelakang pendidikannya, yaitu lulusan Sastra Inggris, tidak mungkin akan menjadi pengusaha. Namun, katanya, perlu digarisbawahi, pengetahuan bahasa Inggris bisa dikombinasikan dengan berbagai bidang, termasuk untuk dunia usaha seperti yang dijalaninya itu. Sedangkan Isfendi Sodatia lebih banyak memaparkan tentang diri seorang mahasiswa yang mesti mampu membangkitkan jiwa entrepreneurship. Tiga kiat yang mesti ditumbuhkan dalam diri seseorang, katanya, yakni sebagai pencipta peluang, punya jiwa innovasi, dan mampu menjadi pengambil resiko penuh perhitungan. (m23)

MEDAN (Waspada): Dalam memanfaatkan kemajuan teknologi yang terus berkembang saat ini, Politeknik LP3I Kampus Gajah Mada Medan menerapkan Information, Communication dan Technology (ICT) dalam perkuliahan. “Penerapan ICT dalam kegiatan belajar-mengajar merupakan ajang penambah wawasan dan pembekalan kualitas pembelajaran. Sehingga dalam implementasinya hal ini lebih efisien dan efektif,” kata Kepala Kampus Politeknik LP3I Jalan Gajah Mada Medan, Syahril Sutan Saidi, di sela-sela dilaksanakannya perkuliahan dengan teknologi jaringan jarak jauh, Sabtu (22/5). Syahril menyebutkan, penerapan ICT dalam perkuliahan ini sudah dilaksanakan sejak Februari 2010 lalu kepada para mahasiswa di semua jurusan, namun untuk tahap awal ini, masih dilaksanakan bagi para mahasiswa jurusan manajemen informatika komputer. “Pemanfaatan ICT ini dilakukan menggunakan media seperti video conference,” ujar Syahril yang didampingi Head of Marketing Dept, Hafizd, SE dan

Head Finance & HRD, Aidil Kurniawan, SE. Dalam pelaksanaan perkuliahan yang digelar Sabtu kemarin, Politeknik LP3I Gajah Mada menghadirkan praktisi designer web atau web programming, Alfa, SE dengan materi pelajaran pembuatan website dan web desain yang diikuti 90 mahasiswa jurusan manajemen informatika komputer. Dia menjelaskan, dalam proses pembelajaran tersebut, nara sumber atau dosen memberikan materi perkuliahan jarak jauh dengan menggunakan video conference, sedangkan mahasiswa bisa mendengarkan dan menerapkan secara langsung materi yang disampaikan nara sumber tersebut. Efektif dan Efisien Menurutnya, dengan memanfaatkan ICT ini, tingkat kualitas pembelajaran akan semakin baik, bahkan dapat dilaksanakan dengan efektif dan efisien, karena mahasiswa dapat melakukan sharing seperti dengan dosen terkemuka yang berada di luar kota, layaknya mewujudkan dosen bersangkutan di dalam kampus. Dia menyebutkan, untuk

menghadirkan narasumber terkemuka dari luar daerah secara langsung di dalam kampus untuk memberikan materi perkuliahan, masih terasa sulit. Selain itu, mengingat jarak yang jauh serta kendala biaya dan kesempatan waktu yang dimiliki para narasumber dari luar kota tersebut, dapat menjadi penghalang untuk dapat hadir. Syahril merencanakan kegiatan ini dapat dilaksanakan sebulan sekali, mengingat dalam pendalaman materi perkuliahan mahasiswanya membutuhkan para pakar pendidikan yang saat ini banyak tersebar di berbagai daerah. Bahkan hal ini tidak menutup kemungkinan belajar lewat pendidik luar negeri. Selain pemanfaatan ICT dengan menggunakan video conference dalam kegiatan perkuliahan, Politeknik LP3I Kampus Gajah Mada, saat ini juga menggunakan teknologi dengan fasilitas Broadcast website video streeming, dimana setiap kegiatan yang dilakukan di dalam kampus dapat disaksikan secara live melalui website: www.lp3imedan.co.nr. (m41)

Warga Laksana Keberatan Bangunan Di Atas Parit MEDAN ( Waspada): Warga Jalan Laksana Gang Kadi Lingkungan I, Kel. Komat I, Kec. Medan Area, keberatan dengan berdirinya bangunan di atas parit sehingga menyebabkan banjir apabila hujan turun. “Surat keberatan telah kami kirimkan kepada Camat Medan Area meminta agar turun ke lapangan melihat langsung keadaan parit kami yang tersumbat dikarenakan bangunan kio jok mobil HAWAI yang berdiri di atas parit,” tutur seorang warga yang datang ke Redaksi Waspada, Senin (24/5). Menurut warga itu, kondisi parit di Jalan Laksana sudah bertahun-tahun tersumbat, sejak bangunan tersebut berdiri. Apabila hujan turun kawasan itu banjir dan air masuk ke rumah warga. Disebutkannya, bangunan kios itu telah mengambil tanah jalan/Gang Kadi dan warga pernah memberikan teguran kepada pemilik kios namun tidak ditanggapi. “Selain itu, akibat tersumbatnya parit itu, air menjadi tergenang, tentunya hal ini bisa berakibat fatal seperti berkembangnya sarang nyamuk demam berdarah (DBD) atau penyakit menular lainnya,” ujarnya. Warga, katanya, sangat mengharapkan Camat Medan Area menindak tegas pemilik kios agar membongkar sebahagian bangunan kiosnya ataupun tidak mendirikan bangunannya di atas Gang Kadi. “Kami warga Jalan Laksana mengharapkan Camat Medan Area memberi tegoran kepada pemilik kios agar membongkar bangunannya. Surat keberatan kami juga tembuskan kepada

Waspada/Sugiarto

Waspada/ist

Tim Media Pertunjukan Rakyat Sumut binaan Dinas Komunikasi dan Informatika (Kominfo) Provsu foto bersama Sekdaprovsu DR RE Nainggolan, MM, di Kantor Gubsu, Jumat (21/5).

Festival Petra Nasional

Sumut Tonjolkan Kolaborasi Harmonisasi Budaya MEDAN (Waspada): Tim Media Pertunjukan Rakyat Sumut binaan Dinas Komunikasi dan Informatika (Kominfo) Provsu akan menonjolkan kolaborasi kesenian dan budaya Sumut yang mencerminkan kerukunan dan harmonisasi masyarakat provinsi ini pada Festival Media Pertunjukan Rakyat (Petra) tingkat Nasional di Pekanbaru, Riau, 24 hingga 26 Mei 2010. Kadis Kominfo Sumut, Drs H Eddy Syofian, MAP selaku penanggungjawab Tim Pertunjukan Rakyat Sumut yang pernah meraih juara nasional di Makasar tahun 2007 lalu, bersama fungsionaris dan beberapa pemain melaporkan hal itu kepada Gubsu diwakili Sekdaprovsu DR RE Nainggolan, MM, di Kantor Gubsu, Jumat (21/5). Sembari mohon doa restu atas keberangkatan tim menuju Pekanbaru, Eddy Syofian didampingisutradaraDahriUhum, Wakil Penanggungjawab Hj Pipih Shopiah dan Ketua Tim Hj Rosmidar, SAg, MPd melaporkan, festival ini digelar serangkaian Pekan Informasi Nasional (PIN) yang dilaksanakan Kementerian Komunikasi dan Informatika RI.

Pada festival yang juga diisi sarasehan nasional Petra tersebut, sesuai hasil seleksi oleh tim pusat maka sembilan kelompok Petra dari sembilan provinsi memenuhi kriteria untuk menampilkan kebolehannya masing-masing tim dari Riau, Sumut, Sumbar, Jawa Tengah, Bali, Kalimantan Selatan, Sulawesi Barat, Nusa Tenggara Timur dan Papua. Selain juara nasional di Makasar tahun 2007, Tim Petra Sumut juga Juara III Regional Sumatra di Sumbar tahun 2008 dan tahun 2009 Juara I Eksibisi Festival Petra Tingkat Nasional di Malang Jawa Timur tahun 2009. Sekdaprovsu DR RE Nainggolan, MM menegaskan, Pemprovsu mendukung penuh dan memberi apresiasi tinggi terhadap semangat maupun kesungguhan tim ini untuk tetap berjuang meraih prestasi di tingkat nasional demi membawa harum nama Sumut. Meski obsesi juara selalu ada pada setiap anggota tim, namun Sekdaprovsu mengemukakan, pihaknya merestui tim ini ke even dimaksud tidak sekedar mengejar juara melainkan bernilai lebih strategis sebagai

duta-duta Sumut dalam menggelorakan semangat pelestarian budaya dan kesenian Sumut di tingkat nasional. “Jadi yang lebih strategis adalah semangat melestarikan budaya karena sesungguhnya pendekatan budaya merupakan unsur penting dalam memperkokoh persatuan dan kesatuan. Dengan kokohnya kolaborasi budaya tersebut akan terbangun kondisi kemasyarakatan yang harmonis,” ujarnya. Melalui kolaborasi budaya dan seni, lanjutnya, maka keanekaragaman dan heterogenitas itu semakin indah dan saling hormat menghormati serta saling menghargai antar budaya sehingga kehidupan yang lebih harmonis akan semakin kokoh. “Semua budaya indah, baik dan sama tinggi atau nilainya. Karena itu, kolaborasi budaya melalui unsur kesenian sebagaimana yang ditampilkan tim pertunjukan rakyat Sumut ini, merupakan komponen strategis memperkokoh harmonisasi tersebut, sekaligus dimanfaatkan sebagai media untuk menyampaikan pesan-pesan pembangunan kepada masyarakat,” ujarnya.(m19)

Pembangunan Gedung GSG Segera Dituntaskan MEDAN (Waspada): Kepala Dinas Tata Ruang Dan Pemukiman (Distarukim) Sumut Syafrudin Siregar mengatakan, pihaknya berencana menyelesaikan pembangunan gedung Gedung Serba Guna (GSG) di Jalan Willem Iskandar Medan pada April tahun 2011. “Rencananya kita dapat menyelesaikan gedung GSG pada April 2011, dengan dana yang ada,” ucapnya menjawab wartawan di Aula Transfaransi Dinas Kominfo Sumut, Senin (24/5). Dia mengatakan, untuk tahun 2009, 2010 sampai 2011 pihaknya telah menerima dana APBD Rp53 miliar. Sedangkan sebelumnya juga telah diterima sebesar Rp57 miliar yakni sejak tahun 2002 hingga 2007. Pembangunan gedung tersebut berhenti tahun 2008 karena sempat diprotes DPRD sehingga anggarannya tidak ditampung. Syafrudin mengaku, anggaran itu masih kurang, karena belum termasuk untuk pembangunan listrik, genset, AC dan lapangan parkir. Dia juga me-

ngaku, proses pembangunan terkesan terlambat, sebab pada awal pembangunan dana yang ditampung APBD terbilang sedikit.“Makanya sekarang dananya besar, karena memang harga bahan juga sudah mahal,” ucapnya. Untuk saat ini, kata dia, kondisi gedung tinggal memperbaiki bagian luar saja seperti parkir, genset, daya dan perlengkapan lain. “Sedangkan untuk perlengkapan olahraga disiapkan Dispora,” katanya. Secara umum, kata Syafruddin, pembangunan GSG Sumut itu cukup banyak yang telah selesai secara fisik, kecuali lapangan parkir dan penyediaan beberapa fasilitas pendukung pendingin ruangan (AC) dan perlengkapan olahraga. Karena itu, Dinas Tarukim Sumut dapat menargetkan penyelesaian pembangunan GSG pada April 2011. Syafruddin menyebutkan, GSG Sumut merupakan bangunan yang memiliki sarana olahraga indoor seperti futsal, bola basket, bulu tangkis dan bola voli. “Jika telah selesai, GSG

Sumut dapat menampung pengunjung sebanyak 7.500 orang,” katanya. Kepala Dinas Komunikasi dan Informatika Sumut Eddy Syofian mengatakan, bangunan yang berlokasi di Jalan Willem Iskandar itu bukan sekadar dimaksudkan untuk kegiatan olahraga. GSG Sumut juga dapat dimanfaatkan untuk kegiatan lain seperti konser musik atau kegiatan-kegiatan lain yang diizinkan sesuai peraturan. Keberadaan GSG Sumut dinilai sangat bermanfaat untuk mendukung penyelenggaraan berbagai kegiatan yang menghadirkan pengunjung di atas 5.000 orang. “Saat ini, belum ada gedung di Medan yang mampu menampung pengunjung di atas 5.000 orang,” katanya. Bangunan GSG itu, ternyata sudah menghabiskan dana APBD Rp110 miliar lebih. Anehnya, meskipun tiap tahun ditanggung APBD miliaran rupiah, tapi masih terbengkalai. Hingga kini bangunan itu tampak seperti rumah hantu. (m19)

Buku Putih Muammar Tawarkan Perdamaian Israel-Palestina MEDAN (Waspada): Solusi perdamaian antara IsraelPalestina yang ditawarkan dalam “Buku Putih Muammar Al Qazzafi” merupakan salah satu upaya mengakhiri konflik dua negara di Timur Tengah. Namun solusi yang ditawarkan tersebut perlu dipertajam agar pemikiran Muammar Al Qazzafi yang dicetuskannya dalam sidang PBB 23 September 2009 dapat diwujudkan. Dalam seminar internasional dan bedah pemikiran “Buku Putih Muammar Al Qazzafi” yang dilaksanakan di Kampus I UMA Jalan Kolam Medan Estate, Sabtu (22/5), terungkap upaya mempertajam pemikiran Muammar Al Qazzafi dengan memberikan keleluasaan kepada otoritas internasional secara damai dan adil. Selain itu, peran negaranegara Arab dan kelompok negara Islam bisa memberikan kontribusi nyata agar konflik berkepanjangan di Timur Tengah segera berakhir. Tidak itu saja, negara sekutu pendukung Israel juga harus memiliki komitmen dan memainkan peranan dalam mewujudkan perda-

bicara dari Libya, yakni Rajab Muammad Asytibah, Almahdi Ulwan, Ahmeid Muhammad Ahmeid dan dari Indonesia: Heri Kusmanto, Ramli Abdul Wahid dan Fajar Hasan dengan moderator Arifuddin. Guru Besar IAIN Sumut Ramli Abdul Wahid mengatakan, sebenarnya yang merampas Palestina bukan hanya Israel tapi para pendukungnya termasuk Amerika Serikat. Israel tidak bisa diusir karena ada suatu kepercayaan keimanan dari para Yahudi, yakni Palestina merupakan tanah leluhurnya, menguasai keilmuan dan didukung Amerika Serikat. Sedangkan Rajab Muammad Asytibah mengatakan, Palestina berada di ‘jantung’ negara -negara Arab dan sebenarnya dalam sejarah tidak ada peperangan antara Israel dan Palestina. Konflik awal tersebut dimulai semenjak Israel mendirikan negaranya tahun 1948. “Karenanya sangat logis, Muammar Al Qazaffi menawarkan perdamaian dengan mendirikan negara Isratina, yakni perpaduan antara Israel dan

Sementara Direktur Pascasarjana UMA Heri Kusmanto mengatakan, dalam pemikiran memang tidak mungkin menyatukan Israel dan Palestina dalam satu pemerintahan/ negara yang disebut Isratina, namun hal itu bisa saja diwujudkan jika belajar dari berdirinya negara Libanon dengan memberikan kewenangan otoritas internasional dalam mewujudkan perdamaian Israel dan Palestina. Rektor UMA A Yakub Matondang menyebutkan, jika perdamian Israel dan Palestina terwujud maka peta peradaban dunia berubah dan akan kembali kepada negara-negara Arab (Timur Tengah). “Seminar intenasional ini guna mempertajam pemikiran Muammar Al Qazzafi dan sebagai salah satu bentuk kepedulian UMA melihat perkembangan dunia internasional di Timur Tengah,” ujarnya. Turut memberikan sambutan pada kegiatan itu Gubsu diwakili Kadis Infokom Sumut Eddy Sofyan, PengurusYayasan Pendidikan Haji Agus Salim diwakili HM. Erwin Siregar,


WASPADA Selasa 25 Mei 2010

Medan Metropolitan PNS Setubuhi Siswi SMA Diringkus

Laporan Rahmat Shah Terganjal Saksi MEDAN (Waspada): Kasus pencemaran nama baik anggota DPD RI Rahmat Shah yang melaporkan Gubernur Sumut ke Polda terganjal saksi-saksi dari pelapor itu sendiri. “Dari beberapa saksi yang diundang oleh penyidik untuk dimintai keterangan hanya dua saksi yang bersedia memenuhi panggilan. Sedangkan lainnya tidak bersedia dengan alasan tidak jelas,” kata Lakhar Bidang Humas Polda Sumut AKBP MP Nainggolan, Kamis (20/5). Hanya dua saksi yang bersedia memenuhi undangan tidak dapat memberikan keterangan terkait laporan dari Rahmat Shah tersebut dengan alasan tidak mengetahui permasalahnnya. “Kita telah undang beberapa saksi untuk dimintai keterangan, tapi hanya dua yang bersedia hadir dan itupun mengaku tidak tahu,” ujarnya. Menurut Nainggolan, laporan pengaduan pencemaran nama itu sendiri dilaporkan oleh Rahmat Shah selaku Anggota DPD RI dengan melaporkan Gubernur Sumatera Utara Syamsul Arifin ke Sentral Pelayanan Kepolisian (SPK) Terpadu Poldasu beberapa waktu lalu akan tetap ditindaklanjuti. “Kami tidak ada memandang siapa yang melapor dan siapa yang dilaporkan. Dalam hal ini polisi tetap netral dalam melakukan penyelidikan dan tidak ada intervensi,” ujarnya. Sumber di Polda menyebutkan, pengaduan Rahmat Shah ini dilakukan terkait pencemaran nama baik dengan statement dan konfrensi pers Gubsu tanggal 22 April lalu di Kantor Gubsu Lantai VIII. (m39)

Perampok HP Ditangkap MEDAN (Waspada): Polsekta Medan Baru menangkap tersangka perampok HP di Jalan Darussalam simpang Sei Kapuas, Minggu (23/5) siang. Dari tersangka BK, 31, penduduk Jalan Perluasan Timur Serbelawan, Siantar, disita barang bukti sepeda motorYamaha Mio tanpa plat BK dan hasil kejahatannya. Saksi mata kepada Waspada di Tempat Kejadian Perkara (TKP) mengatakan, perampokan HP itu terjadi pukul 14:30, berawal saat korban Delima, 33, penduduk Jalan Binjai Km 13,5, Kec. Sunggal, Kab. Deli Serdang, yang berjalan kaki di Jalan Gatot Subroto simpang Barat sambil memegang handphone sedang mengirim SMS, Tanpa disadari korban, tersangka langsung merampas HP dari tangannya lalu melarikan diri. Petugas Reskrim Polsekta Medan Baru yang sedang berada di lokasi melihat kejadian itu langsung mengejar tersangka. Setiba di Jalan Darussalam, tersangka berhasil ditangkap karena sepeda motornya mogok diduga kehabisan minyak. Selanjutnya tersangka bersama barang buktinya diboyong ke Mapolsekta Medan Baru dan sedangkan korban membuat pengaduan. (m31)

Maling Satroni Toko Roti MEDAN (Waspada): Empat pencuri mengendarai mobil beraksi di toko Roti Brandhead berlantai dua Jalan Skip Medan, Sabtu (22/5). Dalam aksinya tersebut, satu diantara pelaku sempat buang hajat di toko itu. Keterangan Waspada peroleh di lapangan, pelaku yang mengendarai mobil datang ke toko roti disaat suasana sepi. Selanjutnya mereka masuk ke dalam toko yang terlebih dulu merusak gembok pintu toko tersebut. Dari dalam toko roti itu, kawanan maling mengambil 2 set komputer, laptop merek ACE, kamera digital, printer kasir, UCD, handphone merek Esia, mesin absent, meja, kursi, uang Rp657.000 dan barang berharga lainnya. Sebelum mereka kabur membawa hasil kejahatan, seorang pelaku buang air besar di dalam roti tersebut. Pemilik toko roti, Andi, 33, penduduk Jalan Kruing Medan, mendapat laporan tempat usahanya disatroni maling langsung membuat pengaduan ke Polsekta Medan Baru. Petugas Reskrim Polsekta Medan Baru mendapat laporan segera turun ke Tempat Kejadian Perkara (TKP) melakukan pemeriksaan dan hingga kini pelakunya masih buron. (m31)

Waspada/Surya Efendi

GEDUNG TUA DIRUBUHKAN: Pekerja dan alat berat merubuhkan gedung tua di Jalan Ahmad Yani V Simpang Jalan Gwangju, Kel. Kesawan Medan, Senin (24/5). Penghancuran gedung bersejarah ini sudah yang kesekian kalinya dilakukan swasta tanpa ada perlindungan dari Pemko Medan.

Komplotan Curanmor Ditangkap MEDAN (Waspada): Sindikat pencurian sepeda motor (Curanmor) dengan modus ingin mendapatkan asuransi dibongkar Polsekta Medan Timur, sekaligus menciduk para tersangkanya, Senin (24/5) dinihari. Para tersangka yang ditangkap yakni AS, 20, warga Jalan Perjuangan Gang Aman Medan Perjuangan RA, 18, warga Jalan Pimpinan Medan Perjuangan, AH, 19, warga Jalan Gurilla Medan Perjuangan, GS, 23, warga Jalan Sukaria Medan Tembung dan Mu, 41, warga Jalan Rakyat MedandanSS,48,wargaJalanSukariaMedan,keduanyapenadah. Dari para tersangka disita barang bukti berupa satu unit sepeda motor BK 5619 WV, satu tanki dan stang sepeda motor. Sedangkan tersangka DS, 21,

warga Jalan Pertemuan Medan Timur, yang pura-pura speda motornya hilang masih diburon. Kapolsekta Medan Timur, AKP Yatim Syahri Nasution menjelaskan, modus operandi yang dilakukan DS (buron) terbilang baru. “Sebab, DS selaku pemilik sepeda motor sengaja menyuruh temannya AH untuk mencuri sepeda motor miliknya,” jelas AKP Yatim kepada Waspada, Senin (24/5). Dijelaskan Yatim, awalnya petugas Reskrim Polsekta Medan Timur curiga melihat ter-

sangka AS bersama temannya mendorong sepeda motor, Minggu (23/5) sekira pk 21:00, di Jalan Krakatau. Ketika didekati polisi, pria yang mendorong sepeda motor melarikan diri, sedangkan AS segera diamankan petugas. Saat diperiksa, AS yang berstatus mahasiswa Fakultas Hukum di perguruan tinggi swasta ini, mengaku sepeda motor tersebut miliknya dan mogok karena businya hilang. Polisi mendengar pengakuan AS tak percaya begitu saja, ternyata sepeda motor tersebut hasil curian. Selanjutnya tersangka AS dijebloskan ke dalam sel. Dari pengakuan AS, diketahui sepeda motor tersebut milik DS yang direkayasanya sendiri seolah-olah hilang di depan

Penjambret Penumpang Angkot Ditangkap MEDAN (Waspada): Reskrim Unit Jahtanras Poltabes menangkap dua penjambret penumpang angkutan kota (angkot) usai melakukan aksinya di kawasan Asia Mega Mas, Sabtu (22/5) malam. Dari tersangka MF, 30 dan FW, 27, keduanya warga Jalan Utama Gang Setia, disita barang bukti kalung emas bersama mainannya serta sepeda motor Shogun BK 5496 OT. Kasat Reskrim Poltabes Kompol Jukiman Situmorang didampingi Kanit Jahtanras AKP Faidir Chan kepada wartawan, Senin (24/5) mengatakan, saat melakukan aksinya, kedua tersangka sudah mabuk narkoba. “Karena sudah terkena narkoba, makanya timbul keberanian tersangka untuk berbuat kejahatan,” jelasnya. Disebutkan Faidir, peristiwa perampokan yang dilakukan kedua tersangka terjadi sekira pukul 20:30 di Asia Mega Mas. Malam itu korban Dedek Karlina, 30, warga Jalan Berdikari, Medan Baru, menyetop angkot bermaksud pulang ke rumahnya. Setelah itu, korban masuk ke dalam angkot dan duduk dekat jendela. Kemudian dari arah belakang muncul kedua tersangka mengendarai sepeda motor mendekati korban. Setelah dekat, salah seorang diantara tersangka merampok kalung dan mainannya yang dikenakan korban. Korban kemudian berteriak rampok. Anggota Jahtanras Poltabes Medan dan warga sekitar mendengar teriakan itu, terus mengejar kedua tersangka dan berhasil meringkusnya tidak jauh dari lokasi kejadian. Dalam pemeriksaan sementara di Poltabes Medan, kedua tersangka mengaku hasil rampokannya untuk dibelikan narkoba. “Usai beraksi, kami menjual hasil rampokan untuk dibelikan sabu-sabu. Sebelum beraksi kami menggunakan SS agar lebih berani saat merampok,” jelas tersangka MF. MF juga mengaku sudah sering melakukan aksinya di wilayah hukum Poltabes Medan. “Terakhir beraksi di kawasan Padang Bulan,” katanya. Faidir menjelaskan, dalam kasus ini tersangka dikenakan pasal 365 subsider 363 dengan ancaman hukuman 7 tahun penjara. (m39)

Poltabes Ambil Sidik Jari Di Mobil G4S MEDAN (Waspada): Pasca raibnya uang Rp100 juta lebih dari dalam mobil pengangkut uang (G4Securicor Tbk). Sabtu (22/5), petugas dari Poltabes Medan mengambil sidik jari laten yang terdapat di mobil tersebut. “Pencarian pengembangan sidik jari laten untuk pemeriksaan lanjutan dan bahan banding dengan sidik yang dicurigai,” kata sumber Waspada di kepolisian. Menurut sumber, pengambilan sidik jari laten yang terdapat di TKP harus benar-benar teliti agar lebih sempurna. Kapolsekta Medan Baru AKP Moch. Yoris MY Marzuki mengatakan, pihaknya sudah melakukan pemeriksaan terhadap petugas yang membawa uang tersebut. Mereka diperiksa sebagai saksi dan masih menunggu pengembangan lainnya karena personel sedang bekerja mengumpulkan berbagai informasi, baik di TKP maupun lainnya. Uang itu hilang Jumat (21/5). Mobil Fanther B 9540 BK warna biru bertuliskan G4S dengan nomor panel 332 dikemudikan Eki didampingi rekannya, Awaludin Hasibuan, 34, dan seorang anggota Poldasu Briptu Tanta K. Dari kantor perusahaan itu, mereka mengangkut empat karung/tas warna coklat (kain terpal) senilai Rp3 miliar lebih. Kemudian, mereka menuju sebuah kantor asuransi untuk mengambil uang Rp100 juta lebih yang dikemas dalam tas warna coklat. Selanjutnya, mobil itu menuju Kantor Cabang Utama Bank Central Asia dan parkir di basement. Di BCA itu, dua karyawan dan petugas kepolisian membawa empat karung uang senilai Rp3 miliar lebih untuk disetor ke BCA. Sementara satu karung lagi berisikan uang baru tetap berada di dalam mobil yang diparkir di basement pukul 10.00. Selesai menyetor uang, mereka balik ke basement sekitar pukul 13.00 dengan menemukan pintu mobil terbuka dan uang Rp100 juta lebih raib. (m31)

B3

Waspada/Andi Aria Tirtayasa

Enam tersangka pencurian sepeda motor dan penadah diperiksa petugas Reskrim Polsekta Medan Timur sebelum dijebloskan ke dalam tahanan, Senin (24/5).

warnet Dyeng Jalan Prof HM Yamin Medan pada 2008 lalu. Saat itu, DS berboncengan dengan tersangka RA menuju warnet Dyeng, namun sebelum sampai ke warnet, tersangka turun di tengah jalan sedangkan DS langsung menuju warnet. Setelah memarkirkan sepeda motornya, DS bergegas masuk ke warnet, kemudian menyusul tersangka RA datang ke warnet dan mencuri sepeda motor BK 2808 OH dengan menggunakan kunci duplikat yang diberikan DS. Selanjutnya, sepeda motor hasil curian tersebut disimpan di rumah AS. Di rumah itu sepeda motor ‘disate’, beberapa bagian onderdilnya dijual kepada penadahnya Mu dan SS. Menurut Yatim, begitu mengetahui temannya tertangkap, DS selaku pemilik sepeda motor langsung melarikan diri.”Tersangka DS berhasil mengklaim asuransi kehilangan sepeda motornya dari salah satu perusahaan leasing tempatnya mengambil kredit sepeda motor tersebut,” jelasnya. Dari pengembangan kasus tersebut, tersangka AH menyebutkan inisial GS, yang akhirnya diciduk dari kediamannya. Tersangka GS mengaku pernah mencuri sepeda motor milik temannya di halaman parkir Fakultas Pertanian Kampus USU pada 20 September 2009 lalu. Menurut tersangka GS, sepeda motor tersebut milik temannya Hasan Hasibuan, 20, warga Jalan Harmonika Padangbulan. “Untuk tersangka GS, berkasnya akan dilimpahkan ke Polsekta Medan Baru, karena tempat kejadian perkara (TKP) di wilayah hukum Polsekta Medan Baru,” jelas Yatim Syahri Nasution. (cat)

Masyarakat Diminta Manfaatkan Perpustakaan MEDAN (Waspada): Gubernur Sumatera Syamsul Arifin mengingatkan masyarakat untuk memanfaatkan perpustakaan untuk membaca. Bisa dikatakan perpustakaan adalah sarana pembelajaran sepanjang hayat. “Perpustakaan dapat mengembangkan potensi masyarakat agar menjadi manusia beriman dan bertaqwa, berakhlak mulia, berilmu, kreatif dan mandiri,” kata Gubsu dalam sambutan tertulis dibacakan Sekdaprovsu RE Nainggolan dalam kegiatan Pemasyarakatan Perpustakaan dan Minat Baca Tahun 2010 diikuti pelajar, guru, kalangan perpustakaan rumah ibadah dan pemerhati perpustakaan serta elemen masyarakat, di gedung Badan Perpustakaan, Arsip dan Dokumentasi (BPAD) Sumut Jalan Sultan Ma’mun Alrasyid Medan, Jumat (21/5). Hadir Dinas Kominfo Sumut Eddy Syofian, Kabiro Binsos Pemprovsu Hasbulah Hadi, Plt Kepala Baperasda Sumut Chandra Silalahi, Kepala Dinas Pendidikan Sumut Bahrumsyah diwakili stafnya Amrin, dan Ketua Komisi E DPRD Sumut Brilian Moktar. Gubsu menyatakan dengan ditetapkannya UU No 43 Tahun 2007 tentang perpustakaan maka pembangunan perpustakaan yang dilakukan bertujuan memberikan layanan kepada pemustaka, meningkatkan kegemaran membaca serta memperluas wawasan dan pengetahuan untuk mencerdaskan kehidupan bangsa.

Lebih lanjut dia menyebutkan dalam RPJMN (perencanaan pembangunan jangka menengah) 2010-2014, pembangunan perpustakaan merupakan bagian dari prioritas nasional ke-11. “Prioritas tersebut mengamanatkan perlunya revitalisasi perpustakaan dalam berbagai jenis untuk peningkatan minat dan budaya gemar membaca masyarakat,” ucapnya. Menurutnya, kebijakan pembangunan perpustakaan diarahkan kepada peningkatan minat dan budaya gemar membaca. Strateginya dilakukan dengan menyelenggarakan dan mengelola perpustakaan sebagai sarana pembelajaran sepan-

jang hayat bagi masyarakat. Selain itu dengan merevitalisasi perpustakaan, meningkatkan ketersediaan layanan perpustakaan secara merata, meningkatkan kualitas dan keberagaman koleksi perpustakaan. Penting juga dilakukan, lanjutnya, meningkatkan promosi gemar membaca dan pemanfaatan perpustakaan serta peningkatan kompetensi dan profesionalisme tenaga perpustakaan. Gubsu mengakui membangun minat dan budaya bacabukanlahpekerjaanmudah, Justru itulah peranan perpustakaan mengkampanyekan minat dan budaya baca bagi masyarakat perlu ditingkatkan. “Kegiatan seperti ini ter-

Waspada/Anum Saskia

BERFOTO BERSAMA: Sekda Provsu RE Nainggolan berfoto bersama seusai menyerahkan buku kepada Kadis Kominfo Sumut Eddy Syofian, Kabiro Binsos Hasbulah Hadi, Ketua Komisi E DPRDSU Brilian Moktar didampingi Plt Kepala Baperasdasu Chandra Silalahi.

masuk strategis dalam mewujudkan komitmen Pemprovsu membangun masyarakat Sumut agar rakyat punya masa depan dan tidak bodoh melalui peningkatan pemasyarakatan perpustakaan dan minat baca masyarakat,” katanya seraya mengajak untuk meluangkan waktu untuk membaca. Minimal satu jam. Plt Kepala Baperasda Sumut Chandra Silalahi menyebutkan minat, kebiasaan, kegemaran dan budaya baca bukan bawaan lahir. Menurutnya budaya baca masyarakat masih tergolong rendah karena masih didominasi budaya lisan masyarakat. “Peningkatan minat, kebiasaan dan budaya bangsa dilakukan melalui keluarga, lingkungan, pendidikan dan perpustakaan,” tuturnya. Sedangkan upaya menumbuhkan minat baca dapat juga dilakukan dengan mempromosikan minat baca dalam berbagai kegiatan. Acara Pemasyarakatan Perpustakaan dan Minat Baca Tahun 2010 itu dirangkai dengan penyerahan buku berjudul “Potensi Ekonomi Sumut dan Peluang Investasi” ditulis Chandra Silalahi Msi dengan pengarah Syaiful Syafri (mantan Kepala Baperasda Sumut) oleh Sekdaprovsu RE Nainggolan kepada para narasumber. Sebelumnya Plt Kepala Baperasda Sumut menyerahkan kartu keanggotan perpustakaan kepada Sekdaprovsu RE Nainggolan. Kartu itu dibuat dalam waktu beberapa menit saja di gedung Baperasda Sumut Jalan Brigjen Katamso Medan. (m36)

MEDAN (Waspada): Unit Perlindungan Anak dan Perempuan (UPPA) Sat Pidum Dit Reskrim Poldasu meringkus oknum PNS yang tidak mau bertanggung jawab setelah menyetubuhi siswi kelas 3 SMA, dalam penyergapan di rumah mertuanya di Jalan Bandar Kalippa, Tembung, Sabtu (22/5) malam. Tersangka SPS, 30, warga Mandala, kemudian dijebloskan dalam sel tahanan Mapoldasu. Kanit UPPA, Kompol Fransisca Munthe, ketika dikonfirmasi wartawan membenarkan pihaknya mengamankan tersangka terlibat perbuatan asusila, namun Fransisca enggan merincinya. Terbongkarnya perbuatan asusila yang dilakukan tersangka berawal dari laporan pengaduan korban ke Mapoldasu, April lalu. Diterangkan korban, awal perkenalannya pada tersangka terjadi sekira Februari 2007. Kala itu, tersangka yang masih berstatus honorer di Dinas Pertamanan Medan, sering main ke daerah rumah Santi (nama samaran) di Kel. Bandar Selamat, Kec. Medan Tembung. Kebetulan beberapa rekan tersangka ada yang menetap satu gang dengan rumah korban. Perkenalan waktu itu, melalui perantara salah seorang rekan wanita tersangka. Sebulan kenal, Santi yang kala itu masih duduk di bangku kelas II SMK “ditembak” untuk menjadi pacar SPS. Sejak sehari diterima jadi pacar, tersangka selalu mengantar jemput dirinya ke sekolah. Dari kebaikannya itu, Santi percaya saja saat diajak bertamasya bersama rekan-rekannya ke pemandian Sibiru-biru. “Ternyata Aku dibohongi. Katanya rombongan, enggak tahunya cuma kami berdua saja yang berangkat ke sana,” kenang Santi yang kala itu dibawa ke sebuah losmen, tak jauh dari tempat pemandian. Awalnya Santi protes, namun karena beralasan untuk menghilangkan capek, akhirnya tersangka berhasil mengajaknya masuk kamar yang disewa seharga Rp25 ribu perhari itu. Di dalam kamar, tersangka SPS langsung mencumbu korban. Walau diprotes Santi, namun dengan bujuk rayu dan paksaan, tersangka berhasil melakukan hubungan layaknya suami istri. Dari kejadian itu, mereka jadi rutin ke Sebiru-biru hingga Maret 2010. Setiap ke lokasi wisata itu, mereka selalu melakukan persetubuhan. Dari perbuatan itu, sekitar Oktober 2009 lalu, tersangka sempat membuktikan keseriusannya. Dirinya sempat bertanya pada ibu korban untuk meminangnya. Ternyata janji tersangka tidak ditepatinya, malah dia lari dari tanggung jawab. Ternyata setelah diselidiki tersangka sudah punya kekasih baru. Karena tak terima, Minggu (11/4), korban bersama ibunya ke rumah tersangka untuk meminta pertanggungjawaban. Karena tidak mau bertanggung jawab akhirnya kasus ini dilaporkan ke UPPA Poldasu, Rabu (14/4) lalu. Tersangka dijerat Pasal 293 KUHPidana.(m39)

Ngaku Polisi Peras Empat Mahasiswa UNSAM Langsa MEDAN (Waspada): Empat mahasiswa Fakultas Hukum Universitas Samudra Langsa (UNSAM) mengadu ke Poltabes Medan, karena diperas seorang pria mengaku polisi, Minggu (23/5). Keempat mahasiswa yakni Baliyah, 21, Rahmad Hidayat, 23, Zulmi, 21 dan Dekzul, 21, semua warga Aceh Timur, mengaku mengalami kerugian berupa uang tunai Rp1 juta bersama dua unit Handpone Nokia N-70. Rahmad Hidayat, mahasiswa semester II, menuturkan, dia dan teman-temannya saat itu sedang jalan-jalan ke Medan. Setibanya di Jalan Thamrin mereka berkenalan dengan seorang wanita mengaku bernama Nita, 19. Kemudian Nita mengajak mereka masuk ke salah satu diskotik di Jalan Thamrin. Tanpa curiga ajakan wanita tersebut dituruti mereka. Saat asik menikmati musik dan minuman, ke empat mahasiswa itu membayar bill sebesar Rp2,7 juta. Ketika itu uang mereka hanya Rp2 juta dan kekerungannya dibayar Nita. Selanjutnya Nita mengajak keempat mahasiswa tersebut menginap di salah satu hotel di kawasan Jalan Amaliun Medan. Paginya, Nita mendesak ke empat korban segera mengembalikan uangnya Rp700 ribu. Awalnya Nita meminta STNK dan mobil milik korban sebagai jaminan. Namun mereka tidak memberikannya. Kemudian wanita tersebut memanggil seorang pria yang mengaku polisi. Kemudian pria tersebut memaksa para korban menyerahkan 2 unit handphone sebagai jaminan. Selanjutnya, Rahmad Hidayat pergi ke rumah saudaranya di Binjai mengambil uang untuk menebus handponenya. Rahmad memberikan uang Rp1 juta kepada Nita dan pria ngaku polisi itu. Setelah uang Rp1 juta diterima Nita, pria ngaku polisi itu menyuruh para korban sholat dan berjanji akan mengembalikan handphone korban usai sholat. Namun, saat mereka usai sholat Nita dan pria tersebut sudah melarikan diri. Kemudian ke empat korban melaporkan kasus tersebut ke Reskrim Poltabes Medan. Hingga saat ini pengaduan korban masih dalam proses penyelidikan. (m39)

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight

Pukul

Tiba Dari

Flight

Pukul

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-146

06.25 09.05 10.55 12.25 13.45 15.45 17.10 18.10 19.10 14.45

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-148 GA-188 GA-190 GA-192 GA-196 GA-147

06.10 08.00 09:30 10.50 11.50 12.50 14.10 16.15 19.35 18.10

AIR ASIA 1 Kuala Lumpur AK- 937 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 457 4 Kuala Lumpur AK-939 5 Penang QZ-8074 6 Jakarta QZ-7497 7 Jakarta QZ-7503 8 Jakarta QZ-7505 9 Phuket (3,5,7) FD-3991

08.50 09.40 18.00 20.10 16.05 12.20 13.30 18.40 17.45

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Jakarta Jakarta Jakarta Phuket (3,5,7)

AK-936 QZ-8055 AK-456 AK-938 QZ-8075 QZ-7496 QZ-7502 QZ-7504 FD-3990

08.25 11.55 17.40 19.40 18.05 19.15 13.05 15.40 17.15

MANDALA AIRLINES 1 Padang RI 089

17.20

Padang

RI-088

15.45

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Batam/S.baya 13 Banda Aceh 14 Penang 15 Penang

06.30 09.00 10.00 11.00 12.00 13.45 15.35 17.05 18.35 21.15 22.25 12.55 19.35 09.10 12.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Batam/S.baya Banda Aceh Penang Penang

JT-380 JT-398 JT-394 JT-302 JT-398 JT-382 JT-384 JT-396 JT-306 JT-386 JT-308 JT-971 JT-397 JT- 8289 JT-8287

08.20 09.20 10.20 11.20 10.45 13.05 14.55 16.25 19.35 21.35 23.20 12.20 08.20 11.35 15.00

MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.25

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 14.45

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

08.30 20.45

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

07.50 20.00

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Batam

7P-592 7P-598 7P-594 7P-596 7P-568

10.10 12.50 15.50 19.10 13.00

Jakarta Jakarta Jakarta Jakarta Batam

7P-591 7P-597 7P-593 7P-595 7P-567

09.35 12.15 15.15 18.25 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-017 SJ-035 SJ-041 SJ-010 SJ-102 SJ-021

10.20 15.30 19.10 15.05 15.20 11.30 07.20 16.00

Jakarta Jakarta Jakarta Jakarta Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-014 SJ-034 SJ-140 SJ-140 SJ-103 SJ-020

11.50 18.35 20.15 14.30 15.25 14.20 09.35 14.45

JT- 381 JT- 397 JT- 301 JT- 395 JT- 303 JT- 399 JT- 383 JT- 385 JT- 387 JT- 305 JT-309 JT-972 JT-396 JT-8288 JT-8286


B4 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

Bursa

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive PS PW RT VR EW

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

5 CM 6 CM

Rp. 65.000 Rp. 78.000

ISUZU New Panther Pick Up ‘04, PS, BK Mdn. Tgn-1, mulus, DP 15 Jt, Angs: 2,37Jt Isuzu Panther Hi-Sporty ‘97. Green Army, AC DB, PW, CL, RPM, DP 19Jt. Hub. 76700 976

KIA Visto Matic Thn. 2001 Biru, Ban Baru, BK Mdn Rp. 60 Jt. Hub. 0813 750 88 798

7 CM 8 CM

Rp. 91.000 Rp. 104.000

TOYOTA Corolla GL Thn ‘84 Biru Metalic, AC, Tape, VR 14, Jok klt, Ban baru/ 21,5 Jt 0852.6125.5154

BIMANTARA Cakra Thn. 97 Dijual. Orisinil, satu tangan dari baru, warna ungu, tape CD, AC, Jok kulit, Velg 17 Inci, sangat mulus. Harga 47 Jt Nego. Hub. 0853 6102 6740

MAZDA Vantrend Thn. 95. Hijau met. PS, PW, AC, TP, VR, Asli Medan. Mulus, siap pakai. H. 25Jt/Nego Tempat. 0812 602 5621 TP

TOYOTA KIJANG PU THN. ‘04 Wrn. Hitam, bensin Rp. 83 Jt. Mobil cantik, siap pakai. Kembar Mobil. Jl. Tritura No. 9 HP. 0812 6058 6666/ 0857 6243 8888

DAIHATSU Espass Minibus Thn. 95. 1.3cc. Velg Racing, Jok kulit. BK Medan, kondisi siap pakai. HP. 061-77400033 (TP)

MITSUBISHI BARU

L300. Angs. 3Jt-an. Pajero Sport (Ready Stock). T120 SS, Cold Diesel 110 PS, 125 PS, Triton. Serius Hub. (061) 76728071 / 0812 653 3319

TOYOTA BARU

AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. DP + Bunga Ringan. Hub. 0813 7512 7297 - (061) 7795 1428

DAIHATSU Tatt Hiline. Family Wagon Minibus Thn. 96. Kondisi 90%, siap pakai. Biru tua (simpanan) TP. HP. 061-6962 9312

MITSUBISHI L300 Minibus Sparta Dijual Thn. 2004. BK - Medan - Ada TV. DVD. Power Sub Wofer. Velg Racing. Hub. 0813 6150 3449

TOYOTA Kijang LGX 2,0 Silver ‘02/’03, BK Mdn, Mulus, AC DB, VR 15, BR Maxxis, PW, CL, DP 30Jt Angs. 3,89Jt. Hub. 76700976

DAIHATSU 100% BARU PAKET MURAH...!!

MITSUBISHI Evo 3 Thn. 94. Warna biru, BK Medan asli atas nama sendiri. Pajak panjang. Mesin ok. Mobil mulus. Jl. Starban 52. 061-77948752

TOYOTA Kijang Kommando Thn. 1989. Long, Medan, 6 Speed, Lampu Grand. H. 42,5 Jt. - 0812 6400 747

- Mits. L300 Box Th. ‘95 Hrg. 51Jt - Isuzu Panther Box Th. ‘04 Hrg. 79Jt - Mits. Colt Diesel Box 4 Roda Th. ‘93 Hrg. 75 Jt - Kijang PU Th. ‘04 Hrg. 85 Jt - Ford Ranger PU Th. ‘05 Hrg. 71 Jt - Mits. Colt Diesel Dump Truck 4 Unit - Mits L.300 PU Th. ‘08 Hrg. 117 Jt

TOYOTA Kijang Capsul Model LGX New Bensin 1,8 Th.2003. Silver met, Mulus, orisinil, VR, BR, PS, PW, CL, E. Miror. RTP, AC Double, Hrg. 133Jt. Nego. Hub. 061-6967 9753

Xenia Li..........................DP Mulai 12 Jt-an Terios TS Extra ................DP Mulai 13 Jt-an Gran Max Pick Up...........DP Mulai 5 Jt-an Hub. Josua Pane. 061-77004944 / 0812 6311 0820 PROMO DAIHATSU HADIAH & DISKON Xenia DP 11 Jt-an, Angs. 2,9 Jt Terios DP 13 Jt-an, Angs. 4 Jt-an Luxio DP 12 Jt-an, Angs. 3,9 Jt Gran Max. Pick Up & MB DP 5 Jt-an, Angs. 2,5Jt. Hub. Gery 0813 76941988 / 77722561

# ASTRA DAIHATSU BARU # * Xenia DP: 10 Jt Terios DP: 13Jt * Pick - Up DP: 5 Jt Luxio DP : 9 Jt Proses Cepat. Data dijemput + Hadiah Hub: Kalpin 0852 7041 9000

DAIHATSU Taft Badak Pick Up 1983 Dijual. AC Dingin, Siap pakai. Hub. 0813 9734 3498 - 7700 1497

DAIHATSU Feroza Th. ‘94. Wrn. Hi Metalik. AC, BR, CL, PS, PW, VR, Tape. Hub. 0852 6189 4858. Bagi yang Serius. # FORD BARU #

New Everest, DVD Touch Screen, GPS. Head Rest Monitor, Kamera Parkir, Jok kulit. Ready: Pick Up 4x2, 4x4, Double Cabin, Escape. Hub: IVAN FORD. HP. 0812 6334 1976, 061-7759 2003

HYUNDAI Accent GLS 1997. Ungu metalik. Siap pakai. Hub. 0813 7644 6612 HONDA New City, IDSI Matic. Thn. 2003. Biru met, BK Mdn Asli, BPKB Duplikat Rp. 105 Jt. Hub. 0812 6594 2789 HONDA Accord Cielo Thn. 94 Hitam, Asli Medan, AC, Tape, VR, BR, PS, PW, Mulus, siap pakai. Harga 55 Jt. Damai. Hub. 0812 6508819

ISUZU Panther Miyabi Thn. 1996 W Silver/ Biru met, BK Mdn (panjang). AC, TP, VR, BR, PS, PW, CL, Jok kulit. Mobil sehat, terawat & mulus skl. Siap pakai. Hrg. Rp. 51 Jt Nego. Hub. 0812 650 6623 (A Seng) Way of Life

DP 5 Jutaan Kredit 1 s/d 4 tahun C as h Ba 4 JU ck TA

KEMBAR MOBIL Jl. Tritura No. 9 0857 6243 8888

MITS. L300 Thn. 08. Wrn. Hitam, Power Steering Rp. 117Jt. Mbl Sht, mulus, siap pakai. Kembar Mobil Jl. Tritura No. 9 HP. 0812 6058 6666 / 0857 6243 8888 OPEL Blazer Montera 2001. Mulus, Orisinil, BK Medan. Lengkap. Siap pakai. H. 70Jt. Lanjut Kredit Balik DP 30 Juta. Sisa 2.600.000. x 14 Bulan. Hub. 0812 6477 946

OVER KREDIT SUZUKI Carry GRV ‘97. Wr. Hijau met. AC DB, VR, BR, DP 20Jt. Angs. 1250Jt. 35x lagi. Hub. 0812 659 2358

SUZUKI Katana GX 94 Dijual Warna biru metalik. Luar dalam cantik. Hub. TP.0812 6035 887

SUZUKI BERHADIAH HP NOKIA (061) 77612356 Carry PU...DP 12,5 Jt Ang. 2.7x3 thn & 2.2 x 4 thn APV Arena..DP 16Jt Ang. 4.4x3 thn. & 3.7 x 4 thn. Splash...DP 27 Jt Ang. 4.5 x 3 thn. & 3,8 x 4 thn New SX4 DP 30 Jt ang. 6.2 x 3 Thn. & 5.2x4 thn.

SUZUKI APV Tipe X Hitam Th. 2006. Mulus. Hrg. : 98Jt. Nego. Hub. 0813 7550 1012 TOYOTA Kijang G Thn. 95 Asli Medan, AC, Tape, VR, BR, PS, Mulus, siap pakai. Harga 63Jt. Hub. 0812 650 8819 TOYOTA Kijang Grand Rover Diesel Thn. 98. AC, Central, Tape, VR, PS, PW, CL, Jok kulit, Biru, BK Mdn Ex Mutasi Rp. 87 Jt. Hub. 0812 659 42789

TOYOTA Sedan Twin Cam Th. 90. Wr. Abu-abu met, 1300cc. VR, BR, AC, Hub. 0813 6139 7002 TOYOTA Kijang Grand Extra Thn. 94. Short, mulus. W. Abu2 tua met. BK Mdn Asli, lengkap. Hub. 061-76654120 - 0811 618906

TOYOTA Corolla SE Salon Thn. 1986, warna hitam. Mobil siap pakai. AC, VR, Ban Radial. Hubungi 0813 9604 0559 KREDIT VIA:

Hubungi Dealer

SUZUKI

ADA JADI MOBIL

JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN

TOYOTA Corolla Great Thn. 93 Merah, Medan, Original. Velg 16” Remot, Radio Tape. Jl. Ternak. 0816 3152 917 TOYOTA Kijang Commando Long Thn. 1988. Warna hijau, tinggal pakai. AC, Tape, Velg Racing, harga nego. Hubungi HP. 0813 6166 8951 - (061) 77001187

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

BUTUH DANA BUTUH DANA

BUTUH DANA

DANA EXPRESS SHM, SK Camat 1 Hari Clear 061-7685 4885, 0812 6095 5531 (Anwar) ANDA BUTUH DANA

Jaminan Apa Saja, Sertifikat Tanah. Proses Cepat, Syarat Mudah. Hub. 061-8222774, HP. 0816 314 1807

BUTUH DANA CEPAT

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633

WASPADA

Bursa

KOMUNIKASI

FAX.4561347

Bursa

MUSIK KN 2600 + Sound System + Power 2 Bh, Equalizer 2 BH, Tape Rekam, SLD, Efek dan Mixer Peavey, Speaker 6 Kotak. Isi 2 (AVDAX) 2 Bh. Speaker, Komplit set. Hrg. 30 Jt. Hub. 0812 650 5045

Bursa

KOMPUTER

Bursa

LAPTOP BARU =2598RB + CAMERA + WIFI+G1TN

FOTO COPY

CORE2 TOM 1GB160GB

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

DIJUAL KEYBOARD 100% MULUS

PT. SINAR MAS MULTIFINANCE. Jaminan Khusus BPKB Sepeda Motor Bunga 1,5 %, Discon, 1x cicilan Hub. 0813 6101 7444.

SERVIS: LAPTOP & PROJECTOR (GROSIR LAPTOP-WARNET) PH.7718-8318.JL. RANTANG 20S LAPTOP BARU ACER / HP: 2.795 JT-an. - WARNET: AMD + VGA =1 JT GAME KENCANG CAMERA SONY 10 MP =999RB - PROJECTOR LG = 4.795 RB - LCD : LG =895RB

TERCECER/ HILANG

BPKB STNK Mbl, BK 8759 TN, BK 8329 BN, BK 8794 CA, BK 9782 BY, BK 9045 BR, BK 9116 BI. Bagi yg menemukan harap menghubungi HP. 0813.9779.9900, akan diberi hadiah sepantasnya dan tdk akan dituntut

TERCECER / HILANG

Sebuah Surat Rumah / SK Camat dengan ukuran panjang: 15,5m. Lebar: 13m. a/n.: IBU SABARIAH. Jl. Keruntung No. 71C Medan Kel. Sidorejo Kec. Medan Tembung. Yang menemukan harap Hub. 0813 7531 1571 akan diberi imbalan sepantasnya & tidak dituntut. TERCECER

Telah tercecer Akte JUAL BELI DAN PENGOPERAN HAK, tertanggal 7 Juli 1987. No. 6. dibuat dihadapan NURLIAN, SE. dahulu Notaris di Medan, dapat menghubungi M. Yusuf. No. HP. 0816 3103 144

MAU JUALAN PULSA *) Harga SUPER Murah

Harian

*) Transaksi SUPER Cepat & 24 Jam *) Pelayanan SUPER Handal *) Jika Tidak PUAS, Deposit dikembalikan.

TOYOTA Kijang Krista Th. 2002 New Mulus. 0819 623 957 BETOR Honda Win 100 Th. 2004 Htm BK, Medan, Ijin MKS Surat2 Hidup + Speksi + Bak Bagus. Jual BU Rp. 13Jt. Hub. 061-6623605/0813 8222 9822 P. Brayan Kota.

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Selasa, 25 Mei 2010

Bursa

MATERIAL BANGUNAN

MOMENTUM Refill

Jl. Kol. Bejo No. 26 A P. Brayan. 061-76216595 / 0813 7670 4595 Medan Mall - 0812 6455 7274 Millenium Plaza - 0813 9693 0390 Medan Plaza - 0852 6109 4014 Aksara Plaza - 0813 9742 2213 Binjai Super Mall - 0813 9798 3820 Carrefour Garden - 0812 6534 4059 Siantar Plaza - 0813 9650 7030 Office: Jl. HM. Yamin 41 - V Mdn - 4553023

Pasang Iklan “WASPADA” Telp: 061 - 4576602 xpress

DIJUAL SERVER PULSA (Perangkat Komplet) Sofware VRE dan FM NEGO, Berminat? Call: 0813 70444 544 (no SMS)

ATAP & DINDING EURODEK ALUMINIUM ZINC - AZ - 150

Bursa

PERCETAKAN PAGAR EURO

A C

EUROMESH BAJA U-50

R

KOLOM PRAKTIS EURO R

PT. REZEKI PRIMA JAYA ABADI

Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

ATAP ZINCALUME

Hub. SUMATERA JAYA Jl. Gatot Subroto No. 401 dkt simp Barat Tel. 0812 6413 9993

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat

Service

ELEKTRONIK

AC

AC

JAYA TEHNIK

SERVICE: AC, KULKAS, TV, M. CUCI, B. PASANG, BERGARANSI. HUB: 77913537 - 0813 7553 3375

KHUSUS REPARASI / SERVICE Kulkas, M. Cuci, Sanyo Air, Dispencer, Bongkar pasang AC

Hub. PRATAMA ELECTRIC

GARANSI Telp. 7343789

SERVICE GAS Kompor + W. Heater GAS Hub. AHOK 77770544

Jl. Brayan Medan

8442246 WC 08126427 1725

PRODUKSI:

HARGA MURAH

Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Jl. Gatot Subroto Medan Ada Garansi

Tumpat Sedot

BAJA U-50 SIAP PAKAI LEBIH PRAKTIS & HEMAT DARI BESI BETON

CUCI AC Rp. 20.000 AC Baru 100% 1 Pk Rp. 2.190.000 Menerima Bongkar - Pasang, Isi Obat, Tukar Tambah

AC

WC

TUMPAT/ SEDOT

77442112

ADI

CUCI AC, ISI FREON, BONGKAR PASANG. REPARASI, KULKAS, MESIN CUCI Hub. DIFA SERVIS 0813 9735 7061 061-69644786

REPARASI AC, KULKAS, MESIN CUCI

Service

KONSTRUKSI

Telp.:

ELEKTRONIK

AC

R

GALVANIS

Service

SER VIS SERVIS

WASPADA

TERCECER HILANG BPKB Mobil Civic Wonder a/n. Junaidi Jum’at. BK 1720 HD. Warna Merah tua, Nomor Rangka: SB 4 - 54871192 Nomor Mesin: N7401192, No. BPKB: 714 2501-B

TELAH TERCECER Satu Buah SK Bupati Thn. 73 Atas nama UMAMAH NAMBUK Dengan Luas +/14x16M. Lokasi Jln. Pinang Baris No. 53 A

LYSAGHT SPANDEK II

LYSAGHT AUSDEK

HI-TEN R G-550 JARAK TUMPUAN LEBIH BESAR TAHAN KARAT DAYA TAHAN LEBIH LAMA PRODUK WARRANTY BlueScope Lysaght Indonesia Authorized Distributor:

PT. Surya Panca Lestari

Jl. Timor No. 26 Medan Telp: (061) 456.9309 Fax. (061) 455.4173

Ada Garansi

WC TUMP AT, Sal. AIR, K. Mandi TUMPA Tel. 081361718158, 0813 6230 2458 NARO SERVICE Jl. Sisingamangaraja

Harian

WASPADA Tempat Iklan Anda Hub.

4576602


Agenda

WASPADA Selasa 25 Mei 2010

Aditya Herpavi Geser Nico Siahaan

Brad Pitt Ingin Jadi Presiden Amerika Aktor Brad Pitt tertarik terjun ke dunia politik. Pitt rupanya mulai merasa bosan dengan karir sebagai aktor di Hollywood. “Dia merasa tidak ada yang bisa dilakukannya lagi di Hollywood,” ujar sumber dekat Pitt, seperti dilansir Showbiz Spy, Senin (24/5). Dengan berkarir di politik, Pitt berpikir banyak yang bisa dilakukannya. Apalagi belakangan ini banyak hal buruk yang terjadi di dunia. “Brad akan ikut pemilihan sebagai Senator dan jika semuanya berjalan lancar dia akan bertarung menjadi Presiden di 2016,” lanjut sumber. Keinginan Pitt untuk berkarir di dunia politik ini kabarnya didukung pasangan hidupnya, Angelina Jolie. Jolie pun rupanya sama dengan Pitt, sudah bosan dengan Hollywood. “Dia sudah mulai bersiap untuk ada di Washington,” beber sumber lagi.(dth)

07.30 Kecil-Kecil Jadi Manten 09.00 Dahsyat 11.00 Silet 12.00 Seputar Indonesia 12.30 Sergap 13.00 Sinema Siang 15.00 Cek & Ricek 16.00 Minta Tolong 17.00 Seputar Indonesia 17.30 Curhat Changcuters 18.00 Kemilau Cinta Kamila 19.00 Safa Dan Marwah 20.30 Seindah Senyum Winona 2 2 . 0 0 Me g a Ko n s e r Terdahsyat 01.00 Seputar Indonesia

CATATAN

07.30 Inbox 09.30 Halo Selebriti 10.00 FTV Pagi 12.00 Liputan 6 Siang 12.30 SCTV FTV Siang 14.30 Status Selebriti 15.00 Uya Emang Kuya 15.30 Sensasi Artis 16.30 Bajaj Bajuri 17.00 Liputan 6 PEtang 17.30 Cinta Juga Kuya 18.00 Get Married The Series 20.00 Mawar Melati 20.30 Cinta Fitri 22.00 Kesetiaan Cinta 23.00 SCTV FTV 01.00 Liputan 6 Malam 02.30 Buser

Brad Pitt (GettyImages/dth)

07.00 Disney Club 08.00 Cerita Pagi 09.30 Layar Pagi 11.00 Sidik 12.00 Layar Kemilau 13.30 Cerita Sore 14.30 Go Show 15.00 Tom & Jerry 15.30 Disney Club 17.00 Zona Juara 18.00 Gerhana Jadi 2 19.00 Upin & Ipin 19.30 Teater Paradiso 20.30 3 Kumbang Cari Kembang 22.30 Sinema Malam 01.00 Luar Biasa

07.00 Pororo The Little Penguin 07.30 Animal Mechanicals 08.30 Espresso 09.30 Sinema Religi 11.30 Topik Siang 12.00 Musik : Klik 13.00 Tawa Sutra XL 14.30 Street Football 15.00 All About Asia 16.00 Mantap 17.30 Topik Petang 18.00 Dapet Deh 18.30 Super Family 19.30 Super Deal 2 Milyar 21.00 Seger BEneer 22.00 I Sinema 23.30 Lensa Olahraga 00.00 Topik Malam 00.30 Makmur

07.30 Ben 10 08.00 Jiran 09.30 FTV Drama 11.30 Patroli 12.00 Fokus Siang 12.30 Happy Song 14.00 KiSS Sore 15.30 FS : My Fair Lady 17.00 Nurhaliza 18.00 Putri Duyung Marina 19.00 Terdampar 20.30 FTV Utama 22.00 Sinema Asia 00.00 Fokus Malam 00.30 FS The Sword And The Ches

LANGKAH besar tengah dilakoni presenter Aditya Herpavi di dunia pertelevisian. Pria kelahiran Jakarta, 20 September 1981 yang selama ini lebih dikenal sebagai pemain sinetron dan host sebuah infotaiment, kini dipercaya ANTV merangkap presenter kuis “Superdeal 2 Miliar”. Lewat audisi ketat, Aditya mampu menggeser posisi Nico Siahaan dan sederet presenter berpengalaman lainnya. “Menur ut produser Superdeal 2 Miliar, saya terpilih menggantikan Nico Siahaan lantaran banyak disukai kalangan ibu-ibu. Saya sungguh beruntung lantaran kuis ini memang untuk para ibu dan usia penonton yang sudah matang,” papar Aditya Herpavi Rachman dengan nada

07.05 Bedah Editorial Media Indonesia 08.05 Healthy Life 09.05 Indonesia This Morning 10.05 Metro Realitas 11.05 Sentilan Sentilun 12.05 Metro Siang 13.00 Kreasi 15.30 Public Corner 16.05 Discover Indonesia 17.05 Metro Hari Ini 20.05 Suara Anda 20.30 Metro 10 21.05 Top Nine News 21.30 Autozone 22.05 Today’s Dialogue 23.05 Newsmakers 23.30 Metro Sports 00.05 Metro Malam

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Bursa

PENDIDIKAN PRIVATE AL’QURAN

Pedoman tata cara membaca Al Qur’an dengan baik dan benar Untuk anak-anak dan dewasa.

BERSEDIA MENGAJAR KE RUMAH Call. H. JALALUDDIN HP. 0812 6576 065

KURSUS MANDARIN Rood To Succeess Jl. Danau Sentani No. 1A Guru Tamatan Beijing

Hubungi (061) 661.7425 - 662.9354

PENERIMAAN MAHASISWA/I BARU

T.A 2010/ 2011 AKBID SEHAT MEDAN

Terakreditasi BAN PT. dan DEPKES Izin No. 191/D/0/2002 Jl. Gaperta Ujung No. 58 Telp. 0811.649.533 - 0811.600.285 0812.6335.972 - (061) 846.9815 NB. Disediakan Akomodasi dan Penginapan bagi Mahasiswa dari luar kota

PENERIMAAN MAHASISWA/I BARU T.A. 2010/ 2011

AKBID KHOLISATURRAHMI - BINJAI Terakreditasi BAN PT dan DEPKES Izin No. 50/D/0/2002 Jl. Samanhudi Pasar III Binjai Telp. (061) 882.3834 0813.6176.4117 0811.649.533 - 0811.600.285 NB: Disediakan Akomodasi dan Penginapan Bagi Mahasiswa dari luar kota

PENERIMAAN MAHASISWA/I BARU T.A. 2010/ 2011

AKBID HAFSYAH MEDAN

IZIN NO. 85/D/O/2006 Jl. Letda Sujono No. 241 Medan Telp. (061) 735.1236 (061) 7750.9333 0811.649.533 - 0811.600.285

NB: Disediakan Akomodasi dan Penginapan Bagi Mahasiswa dari luar kota

Bursa

LOWONGAN KERJA LOWONGAN KERJA Wanita (Gadis/ Janda) Menjadi - Prwt anak (gaji 600 Rb - 1 Jt) - Prwt org tua (Gaji 650 - 1,2 Jt) Bersih/ ditambah uang kerajinan/ bln Hub. “Cahaya” (061) 453.1124/ 0852.7552.3457 Jl. Ayahanda 73C Medan

DIBUTUHKAN SEGERA

Kami Perusahaan yang bergerak di Bidang Genset dan Mesin Diesel Industri dengan Merk CUMMIN, MTU, MITSUBHISI, CAT, dll. Membutuhkan tenaga handal yang berpengalaman untuk posisi: 1. Kepala Tekhnik/ Mekanik Senior Mesin Diesel (10 Org) 2. Mekanik Mesin Diesel (3 org) 3. Bag. Pembelian (2 org) Dengan kriteria sbb: 1. Tamatan STM atau sederajat (1, 2) SMA (3) 2. Menguasai system kerja mesin diesel secara teori dan praktek (1) 3. Pengalaman Over houl Mesin diesel minimal 5 tahun (1), 3 tahun (2) 4. Jujur, rajin, disiplin, berinisiatif dan bertanggung jawab (1, 2, 3) 5. Dapat bekerja secara team work (1, 2, 3) 6. D a p a t m e m i m p i n d a n m e n g k o o r d i n i r bawahan (1) 7. Diutamakan yang sudah berpengalaman minimal 1 (satu) tahun (3) Lamaran lengkap dapat dikirim ke: Harian Waspada dengan kode: DIESEL

MENERIMA MAHASISWA BARU TAHUN AKADEMIK 2010/ 2011 INFORMASI PENDAFTARAN JL. PUTRI HIJAU NO. 17 MEDAN TELP. 061 - 4550069 FAX. 061 - 4550069

Email: akperkesdam1bbmedan@yahoo.com

(Komp. Rumkit Tk II Putri Hijau Medan) WAKTU

TGL. 3 Mei S.D 6 Juli 2010

PENDAFTARAN: SETIAP HARI KERJA Pukul: 08.00 s/d selesai Syarat-syarat pendaftaran:

Lulus SMA dan sederajat Jurusan IPA/ IPS, Lulusan SPK, SPRG, SMF dan SMAK, Lulusan Sekolah Menengah Kejuruan

MINI & EFEKTIF IKLANKAN PRODUK ANDA

DIBUTUHKAN SEGERA

UNTUK DILATIH MENJADI TENAGA THERAPIST REFLEXOLOGY dan MASSAGE PROFESSIONAL OLEH TRAINER BERSERTIFIKAT INTERNATIONAL 1. PRIA/ WANITA USIA MAXIMUM 30 TAHUN 2. PENDIDIKAN MINIMAL SMU/ SEDERAJAT 3. BERKEPRIBADIAN BAIK SELANJUTNYA BERGABUNG DENGAN PUSAT THERAPY BERNUANSA MODERN CHINESE LAMARAN DIANTAR LANGSUNG SELAMBATLAMBATNYA 29 MEI 2010 KE: JL. RADEN SALEH DALAM NO. 44 MEDAN (INDAH COLOR PHOTO)

DIBUTUHKAN SEGERA ASISTEN APOTEKER

DIBUTUHKAN SEGERA PEGAWAI TOKO FOTO COPY

Bursa PROPERTY

Dengan syarat-syarat sbb: 1. Wanita umur 18 s/d 24 thn 2. Belum menikah 3. Berkelakuan baik, jujur, rapi 4. Suku Jawa/ Batak Toba 5. Agama Islam/ Kristen 6. Pendd. Tamat SMA sederajat 7. Diutamakan pernah bekerja di toko fotocopy 8. Pengalaman tidak diutamakan 9. Diutamakan mahir mengendarai sepeda motor 10. Bersedia menginap ditempat kerja

Surat lamaran diantar langsung ke: TOKO NIAGA JAYA Jalan Letjen Ginting No. 75 Medan

WE ARE IN MANUFACTURING

AKPER KESDAM I/ BB MEDAN

DIBUTUHKAN

Orang Kerja, Laki² yang pandai goreng mie dan pandai bungkus, Tinggal ditempat di Jl. Jamin Ginting No. 520 Hub. 0813.6107.2513 Segera

Syarat: 1. Tamatan SMF (Sekolah Menengah Farmasi) 2. Wanita 3. Berpengalaman minimal 1 tahun Lamaran diantar ke: APOTIK YAKIN Jl. Sutomo Ujung No. 193 Medan

Beberapa karyawati wanita untuk ditempatkan sebagai:

INDUSTRIES OF BATTERY IN BATAM LOOKING FOR HIGHLY MOTIVATED INDIVIDUALS TO JOIN US AS: 1. STAFF: REQUIREMENTS: 1. Female, Male 2. Min. S1 Industries Engineering, Electro Engineering, Engineering Mechine, Accounting, Management, Law 3. E x p e r i e n c e a n d F r e s h Graduate are welcome 4. Fluent in English 5. Computer Literature 6. G o o d P e r s o n a l i t y , H i g h Responsibility and can working under pressure PLEASE SEND YOUR APPLICATION, RESUME WITH RECENT PHOTOGRAPH WITTIN 1 WEEK SINCE THIS ADVERTISEMENT TO EMAIL: horasmunthe@gmail.com. pancasinergyutama_p@gmail.com Contact Person: 0811.693.811

B5

Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

LB LT RM RT

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH Dijual, LT. 15x42: ±634m², SHM di Jl. Garu III No. 54 Medan, Rp. 850 Jt/nego Hub. Ibu Evi HP. 0811.653.404, TP

MENERIMA KOST

MAHASISWI/ KARYAWATI DEKAT RSU - PIRNGADI

HUB. 457.0929 MEDAN

GRAND ALGERIA RUMAH MEWAH HRG TERJANGKAU !

DP 12 Jt, Angs: 900 Rb-an, Kolam renang, Angkot ±2 Km RS, Pasar tradisional, 3 Km tol Bandar Selamat Hub. 0813.6240.7444 (Lia), Dptkan Disc. Khusus

RUMAH DIJUAL TYPE 36/ 120

Psggrhn Salam Tani P. Batu Blok A/ 33, 2 KT, 1 KM, PLN 900 Va, Smr Bor Hub. Buya 0812.6726.5033, TP

RUKO DIJUAL 3 LANTAI

Hak Milik Jl. Besar Tembung Kota N. 19B Kios di P. Pasar, Lantai dasar dekat Pintu besar disewakan jual Hub Telp. 453.7861/ 0852.7525.0819, TP

RUMAH BARU 2 UNIT DIJUAL Model minimalis Type 60 Jl. Karya Jaya Gg. Eka Dame

Hub. 0812.6048.6898 - 6993.5807 RUMAH PERMANEN DIJUAL

Luas 11x21, Kmr Mandi 3, Kmr Tidur 3, R. Sholat 1, Ada AC, lantai keramik anti gores, Garasi mobil, H. nego Hub Telp. (061) 847.3165 Jl. Perwira / Jl. Satria Gg. Lima No. 3 depan Kodam I BB Gatot Subroto HP. 0812.647.7946

UMAR BAKI RESIDENCE

Jl. Umar Baki dekat Inti kota BINJAI, Type 43 & 45, SHM, Siap huni plus tanaman, Rp. 100 Jt-an, Bisa KPR, Bonus Parabola Yes TV, Type yang unik tinggal 4 unit lagi Hub. 0813.9668.7998 - 0813.7533.5853 0878.9187.4944

RUMAH DIJUAL

Uk. Tanah 13x23m, Surat SHM Jl. Ampera I Gg. Pribadi No. 53 Mdn (dekat Mesjid) Hub. (061) 7715.5922

RUMAH DIJUAL

Type 45, 54 & 70, Harga murah

Lokasi ±3Km dari Unimed & IAIN Hub. 0813.7592.7374 - 0813.6163.2505 0812.6519.7232

RUMAH MEWAH DIJUAL MURAH

LT. 540m², LB. 600m², SHM, 7 K. Tidur, Garasi 1 mobil, Carport 3 mobil, 1 Km Pembantu, 1 Gudang, 2 Dapur (kotor & bersih), Air panas/ dingin, 8 AC, Lengkap perabot, Lokasi di Boulevard Blok YY 188 Tasbi HRG 4,3 M HUB. (061) 7766.1001

merendah kepada Waspada di Jakarta, baru-baru ini. Diakui pemain sederet sinetron dan film yang mengawali karir dari dunia model ini, pada awalnya dirinya merasa terbebani menggantikan posisi Nico yang sosoknya begitu melekat dengan kuis pernah tayang sekitar dua tahun silam. “Nico itu sudah membawakan kuis Superdeal sekitar 600 episod. Untungnya, saya bisa keluar dari bayang-bayang nama besarnya karena mampu membawakan dengan gaya saya sendiri hingga ada perbedaan,” ujar pemain sinetron Cahaya, Rafika, ImpianYang Terpilih, Putri Cantik dan film Cinta-puccino ini seraya menambah-kan, beban berat lainnya lantaran kuis ini tayang di jam prime time ketika

07.30 Suami Suami Takut Istri 08.30 Angel’s Diary 09.00 Derings 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Online 14.30 Sketsa 15.00 Missing Lyrics 16.00 Mr Bean 16.30 Orang Ketiga The Series 17.00 Reportase Sore 17.30 Insert Sore 18.30 Kejar Tayang 19.00 Bioskop Indonesia 21.00 Bioskop Trans TV 23.00 Bioskop Trans TV 01.00 Reportase Malam

Orang Bijak akan memilih penyelenggara Umroh yang Berizin

GELORA INDAH Tour & Travel

IZIN DEPAG NO. D/416 TAHUN 2008 09H Umroh Ziarah 19/ 21 Jun 12H Umroh Plus Turky 25 Jun 12H Umroh Plus Cairo & Alexandria 29 Jun 16H Umroh Plus Al Aqsho 19 Jul 11H Umroh Ramadhan Awal 12 Agt 14H Umroh R. Lailatul Qadar 25 Agt 30H Umroh Ramadhan 12 Agt Umroh bayar Rp. 4.000.000,- Langsung berangkat, Sisanya cicil 12 - 24 Bln Segera Mendaftar ke: Jl. Dr. Mansyur No. 9B (sebelah Cikal USU), Medan Telp. (061) 8222800 (Hunting), (061) 77477888 RUMAH Dijual/ B.U, LB. 100m, LT. 12x22m², SHM, Listrik 900 Watt, PAM, Bbs banjir, Hrg 300 Jt/nego Jl. Rahmadsyah Gg. Sekolah No. 416P Komat I (Bisa masuk mobil) Hub. Bpk Gafar 0813.9756.7567

RUMAH Tempat tinggal dijual Jl. Damai/ Jl. STM No. 30A Medan, Uk. Tanah 320m², Uk. Rumah 225m², Harga 700 Jt, SHM Hub. 0811.656.710, TP

DIJUAL/ DISEWAKAN

Rumah Jl. Karya Wisata Komp. Johor Indah Permai Blok X No. 18 Fas. PAM, Telp, AC, SHM Hub. 0812.648.6084

TANAH

TANAH DIJUAL

Jl. Anggrek/ Percukaian Binjai Kel. Pahlawan HP. 0812.6392.1374

TANAH Dijual 20x39 (SHM) Jl. Dr. Hamka No. 57 Desa Bulian T. Tinggi Harga 300 Jt HP. 0813.6219.0476 - 0813.6161.8316

DIJUAL CEPAT

Tanah Seluas ±3000m². Terletak di Jl. Jend. Sudirman Km 2 (Batu 2) Kota Tanjung Balai Hub. 0813.7519.6416 0811.607.921

TANAH DIJUAL Uk. 25x272, SK Camat di depan Akper Harapan Mama Percut Sei Tuan Hub. 0813.6217.8773

06.30 Apa Kabar Indonesia 10.00 Nuansa 1000 Pulau 10.30 Backpacker 11.00 Fakta & Data 11.30 Titik Rawan 12.00 Kabar Siang 13.00 Kabar Keadilan 13.30 Opini 15.00 Kabar 15 15.30 Kabar Pasar 16.00 Menyingkap Tabir 17.00 Kabar Hari Ini 17.30 Kabar Petang 20.00 Janji Wakil Rakyat 20.30 Zona Merah 21.30 Apa Kabar Indonesia Malam 22.30 Highlight Barclays Premier 23.30 Kabar Arena

HARGA PROMO USD. 1550 Sahabat Anda Menuju Baitullah

- UMRAH REGULER 9, 13, 14 HARI BERANGKAT 04 JUNI, 24 JUNI, 05 JULI DAN 20 JULI - UMRAH PLUS CAIRO BERANGKAT 24 JUNI ‘10 - UMRAH PLUS AQSHA BERANGKAT 12 JULI ‘10 - UMRAH PLUS TURKEY BERANGKAT 25 JUNI - UMRAH PLUS INDIA KASHMIR (ON RQ) - UMRAH RAMADHAN 9 HARI - 2 MINGGU - 1 BULAN DAFTAR SEKARANG DAN MENYELENGGARAKAN HAJI KHUSUS QUOTA 2011 DAFTARKAN SEGERA KE:

KANTOR PUSAT MULTAZAM

JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING TELP: (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6566.6807

Bursa

PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - 1 Set Sofa Kain/ Kulit Rp. 1 Jt-an Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Pasang Iklan

Pasang Iklan “WASPADA” Telp: 061 - 4576602

URUT RILEKSASI

Atasi gangguan, Psikosomatis, Lelah, letih, lesu, hilang asa (sakit fisik lain), bukan krn virus, bakteri & kuman Hub. 0852.7550.5381

PROPOLIS DIAMOND

JL. KLAMBIR V NO. 152 KP. LALANG MEDAN

DARI LIUR LEBAH UTK: DIABETES, REUMATIK, DARAH TINGGI, KOLESTEROL, ASAM URAT, JANTUNG, DLL Office: Jl. A.H. Nasution No. 10 Medan Fadli: 0813.7645.1862 www.geraipropolis.com

PUSAT PENGOBATAN SPESIAL ALAT VITAL DITANGANI LANGSUNG

BPK. HARYONO ASLI DARI BANTEN

Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

HUB. UD. SENANG TANI HP. 0813.9604.1710

INGIN PINTAR KOMPUTER CEPAT

TANPA KURSUS/ KULIAH

Miliki IT Pintar (Buku + CD) Terbaru Orisinil (COcok untuk segala umur) Lengkap, detail, Bahasa Indonesia, berisi 82 Judul (Teori, Penduan, Tutorial, Praktek bergambar, script & software) beserta bonus²nya: Mahir merakit comptuer dan instalasinya, trik-trik windows/ linux, trouble shooting, panduan basmi virus/ antivirus, internet, email dan setting modem adsl, corel x3, paypal, OS Windows/ Linux, jaringan Lan/ Wan, Server, pengkabelan jaringan network, cara buat blok, face book, sisco, mikrotik, teknik ubah foto jadi kartun, assembbler, VB, C++, Photoshop, autocad, 3dmax, dreamweaver, flash, Php, javascript, Mysgl & HTML, mahir membangun softwitch (Sentral Kecil), Cisco, Regedit, sistem informasi lembaga pendidikan, property, valas, warnet, system mobile, Ms. Word, Excel, Access, Power Point, dll. Hanya Rp. 150.000 (Gratis Antar) Terdiri dari Paket 150 Rb (1 buku + 1 CD) Paket 300 Rb (3 Buku + 2 CD), Paket 100 Rb (2 CD) yang asli, bergaransi hanya ada di www.chookpintar.com (Gratech Media Perkasa) Hubungi: 0813.7524.9828 - 0857.6248.2968

IKLANKAN PRODUK ANDA

BUTUH ALA TB ANTU DENGAR? ALAT BANTU TRA HEARING AID Hub. MEL MELTRA Jl. Kediri No. 36 Medan Tel. 4516161 * PONDOK NUR AGUNG * Akte Notaris No. 07/NA/2009

Anda telah minta bantuan& belajar kemanamana tetapi blm berhasil dan merasa puas !!! I. PENGOBATAN MEDIS & NON MEDIS II. Pelarisan usaha, psg susuk, gendam, pesugihan, jin, pendamping, kekebalan, dll III.PROGRAM SERTIFIKASI PENGHUSADA: Kami akan membukakan kekuatan bathin & hijab mata bathin anda secara seketika, sehingga anda memiliki kemampuan supranatural yang sangat mengagumkan dapat menembus dimensi astral, khodam dan malaikat, meminjam kesaktian, memiliki kesehatan tubuh & kelancaran usaha, dapat melakukan pengobatan medis & non medis, dsb (berijazah Sertifikat) IV. PROGRAM MASTER PENGHUSADA: Gemblengan khusus bagi anda yg ingin terjun kemasyarakat menjadi seorang supranatural yg handal dan mempunyai sertifikasi supranatural tingkat nasional, anda dijamin menguasai berbagai Ilmu Supranatural dan dapat menurunkan keilmuannya kepada orang lain secara profesional (berijazah Sertifikat) Hub. PAK RANDI (TOKOH SPRITUALIS YG BERPENGALAMAN) Serta SPRITUALIS INDONESIA AWARD 2008

Alamat: Perumahan Cendana Asri Blok AC/ 06 Tj. Morawa Telp. (061) 7778.9233 - 0813.6118.8416 0813.8811.0705 (No SMS)

* KI AGENG TAPAK JALAK * (Bukan memberi janji tapi memberi bukti)

A. PENGOBATAN MEDIS DAN NON MEDIS B. TASBIH AL KHAROMAH, BATU MERAH DELIMA, Al-Qur’an Stambul, susuk kantil, susuk rembulan, susuk nur insan, pasang susuk, pagar goib, masalah asmara, putar giling, keris semar mesem, kapsul kecantikan kekebalan, pesugihan halal, terawangan, gendam, istri cantik, khodam pendamping, suami kaya, rogosukmo, pelarisan usaha, kepangkatan, pegangan bisnis, ajimat anti tuyul, ajimat politik, ajimat atlet, pelet, putar giling, panglimunan, keartisan, sedulur papat dll problem Alamat: Perumahan Griya Mora Indah Blok C/ 105 Tanjung Morawa (masuk dari Gg. Lokasi dekat Klenteng China) Telp (061) 6962.7396 BERGARANSI 0813.6116.4240 SAMPAI 0813.9779.6600 (No SMS) BERHASIL Buka: Jam 13.00-21.00 WIB RIBUAN ORANG TELAH TERBUKTI

Bursa

SEDIA BIBIT CENGKEH

MINI & EFEKTIF

**m30/B

PENGOBATAN

ANDA BUTUH BIBIT KAKAO, KOPI ATENG YANG BERSERTIFIKAT???

JL. VETERAN PSR. X (DPN MESJID AL HIDAYAH) HELVETIA TELP. (061) 7640.1678 0813.7580.8866

07.30 I Gosip 08.00 Duaarr 09.00 Inspirasi Dorce 11.30 Redaksi Siang 12.00 I Gosip Siang 12.30 Bocah Petualang 13.00 Laptop Si Unyil 13.30 Jalan Sesama 14.00 Cita Citaku 14.30 Dunia Binatang 15.00 Koki Cilik 15.30 Asal Usul Fauna 16.30 Redaksi Sore 17.00 I Gosip News 17.30 Scary Job 18.00 On The Spot 19.00 OKB 20.00 Opera Van Java 21.00 Mariam Mikrolet 22.00 Bukan Empat Mata 00.45 Sport 7 Malam

Telp: 061 - 4576602

Bursa

PEMASANGAN DEPOT AIR MINUM ISI ULANG PALING MURAH SESUAI KEMAMPUAN ANDA 1. DEPOT RO 40 S/D 400 GALON/ HARI 2. DEPOT AIR MINERAL/ PEGUNUNGAN - TERIMA SIAP UTK JUALAN - LENGKAP SERTIFIKAT DEPKES UD. RIZKY ABADI JAYA

harus mengontrol emosi mereka di studio,” tandas Aditya menutup pembicaraan. * (AgusT)

“WASPADA”

PELUANG BISNIS

PELUANG USAHA

Aditya Herpavi

07.00 Spongebob 08.00 Dora The Explorer 09.00 Monchows 09.45 Obsesi 10.30 Bukan Sinetron 11.30 Pengakuan Terlarang 12.00 Bukan Abdel & Temon 13.00 Global Siang 13.30 Awas Ada Sule 14.30 Amel Cemal Cemil 15.00 Petualangan Panji 15.30 MTV Kutang 16.00 MTV 2 Kamera 16.30 Berita Global 17.00 Kapten Tsubasa 18.00 Naruto 19.00 3 Mas KEtir 20.00 Big Movies 22.00 Big Movies 00.00 Global Malam 00.30 Fifa World Cup

UMROH BERSAMA MULTAZAM

LOWONGAN KERJA

Kami Perusahaan Angkatan Darat, membutuhkan tenaga kerja untuk ditempatkan sebagai : 1. MANDOR LAPANGAN 2. SUPERVISOR 3. OPERATOR TELEPON Dengan syarat : 1. Laki - laki usia min 25 tahun ( 1 , 2 ) 2. Wanita usia min 23 tahun ( 3 ) 3. Berpengalaman kerja min 1 tahun ( 3 ) 4. Berpengalaman kerja min 2 tahun ( 1, 2 ) 5. Pendidikan Min SMU / Sederajat ( 1,2,3 ) 6. Teliti, loyal, jujur dan bertanggung jawab ( 1,2,3 ) 7. Dapat bekerja lembur ( 1 , 2 ) 8. Mampu bekerjasama dengan team (1,2,3) 9. Berdomisili disekitar Pulo Brayan s/d Belawan ( 1,2,3 ) 10. Mempunyai kenderaan sendiri ( 1 ,2 ) Surat Lamaran Kerja ditujukan ke: Jl. Mesjid No. 139 , Selambat-lambatnya 2 minggu setelah iklan ini terbit.

tv lain menyajikan sinetron yang dikenal memiliki penonton terbanyak. “Saya juga pemain sinetron, tapi sekarang lagi mengalami kejenuhan. Nah, lewat kuis striping berhadiah menggiurkan Rp. 2 miliar ini saya yakin program ini mampu mencuri perhatian pemirsa televisi, khususnya sinetron pada jam tayang sama,” kata ayah dua anak ini. Kendati baru pertama kali dipercaya membawakan sebuah acara kuis, Aditya tak menyianyiakan dan menjunjung tinggi kepercayaan pihak ANTV. ”Setiap hari saya harus belajar tentang banyak hal. Pasalnya, setiap episode saya kerap menghadapi keseruan 150 audiens yang berharap dapat keberuntungan 2 miliar. Jadi, saya

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

A. AMARUDIN

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG: 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6409.1777

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481 Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663 NB. MOBIL BISA MASUK/ GARASI PAKEM. B-346/DSP.5/11/2008

AHLI PENGOBATAN ALAT VITAL: PRIA/ WANITA

Yang sudah dipercaya dan Bisa bukti di tempat !! Ditangani oleh:

A. SAEPUDIN DARI PELABUHAN RATU

Jika anda cari pengobatan harus teliti dulu sebelum berobat, mana yang ahli dan mana yang asli. Sebenarnya banyak pengobatan lain juga yang memberikan bukti, tapi kenyataannya tidak ada perubahan sama sekali. Makanya kalau berobat harus serahkan kepada ahlinya. Cuma disini satu-satunya pengobatan asli dan benar-benar bukti langsung kelihatan perubahannya ditempat. Jika ada keinginan datang dan buktikan di tempat kami. Dijamin anda tidak akan kecewa, pasti berhasil. Bahkan banyak pasien dari tempat lain juga yang datang berobat kesini semua berhasil. DIJAMIN Khusus Wanita ! * Ingin kembali perawan, buka aura * Memperbesar/ Kencang payudara, Pelet * Ingin punya keturunan, Pengasihan * Penglarisan Usaha, Problem Rmh Tangga * Ingin cepat dapat jodoh, Ditinggal pacar Alamat: Jln. Amaliun Simpang Laksana No. P.33 100 M dari Yuki Simpang Raya HP: 0813 9693 8588 Izin Kejari DSP 22/-0-101-/2009

Khusus Pria ! * Lemah syahwat, Kuat, Keras, Tahan Lama * Memperbesar, Panjang, Impotensi * Mani Encer, Ejakulasi Dini, Hernia * Mati Rasa/Total, Kencing Manis. * Diabetes, Mandul


Pentas Pilkada

B6

WASPADA Selasa 25 Mei 2010

IKADI Imbau Pilih Calon Walikota Seakidah

Pilkada Siantar

8 Pasangan Calon Tandatangani Kampanye Pilkada Damai PEMATANGSIANTAR (Waspada): Delapan dari 10 pasangan calon walikota/wakil walikota Pematangsiantar menandatangani kesepakatan kampanye damai, siap kalah dan siap menang serta tidak melakukan politik uang (money politics). Penandatanganan itu dilaksanakan di depan Balaikota Jl. Merdeka, Pematangsiantar, Senin (23/5), sebelum karnaval kampanye perdana. Delapan pasangan calon yang menandatangani kesepakatan, pasangan Mahrum Sipayung-Evra Sassky Damanik, RE SiahaanBurhan Saragih, Poltak Sinaga-Jalel Saragih, Herowhin TF SinagaHj Frida Riani Damanik, Ria Novida Telaumbanua-Suriyatno. Kemudian Moh Heriza Syahputra-Horas Silitonga, Margan RP Sibarani-Rupina Aruan dan Barkat Shah-Boundeth Damanik. Sedangkan pasangan yang tidak ikut menandatangani saat itu, Hulman Sitorus-Koni Ismail Siregar dan Frans Immanuel T Saragih-Rokibah Hasibuan. Kesepakatan damai ditandatangani sesuai yang dibacakan Sekretaris KPUD Jhon Siahaan, yakni, pasangan calon akan menaati dan menepati jadwal dan waktu kampanye, menaati dan menepati tempat dan lokasi kampanye serta di luar kampanye, mematuhi dan melaksanakan ketentuan sesuai surat kepurtusan KPU tentang kampanye. Ketua KPUD Rajaingat Saragih mengatakan, sesuai tahapan pilkada, kampanye perdana dimulai Senin (23/5), diawali penyampaian visi dan misi, penandatanganan kesepakatan kampanye damai, siap kalah dan siap menang, dan diteruskan karnaval kampanye damai. Sesuai kesepakatan, sebutnya, masing-masing pasangan calon hanya menyertakan lima mobil, lima sepeda motor dan 10 becak bermotor. “Kami mengimbau media menulis apa adanya, dan kami berharap kampanye berlangsung kondusif.” Sedangkan Ketua Panwas Fetra Tumanggor mengingatkan agar PNS dan anak-anak tidak boleh terlibat kampanye. “Bila tertangkap akan dipanggil dan akan diproses sesuai ketentuan.”(a14)

Pawai Bersama Awali Kampanye Terbuka Pilkada Madina PANYABUNGAN (Waspada): Menjelang pemilihan bupati/ wakil bupati Mandailing Natal (Madina), 9 Juni 2010, KPUD menggelar pawai simpatik bersama dilaksanakan, Senin (24/5). Pawai dilepas Kapolres Madina AKBP Hirbak Wahyu Setiawan, didampingi Sekdakab Gozali Pulungan, Ketua Panwaslu Ikbal Hasibuan dan Ketua KPUD Jefri Anthoni, dengan pengguntingan pita, dengan start di Lapangan Aek Godang Panyabungan. Rute pawai mengelilingi kota Panyabungan, mulai Lapangan Aek Godang, Kel. Dalan Lidang, Pasar Baru, Pasar Lama, Gunungtua Panggorengan tembus ke jalan lingkar Timur, Galon Pasar Baru dan kembali ke Lapangan Aek Godang. Awal kampanye diikuti kendaraan hias dari masing-masing pasangan calon, yaitu, pasangan nomor 1 H Zulfarmin Lubis– H Ongku Sutan Nasution (perseorangan), pasangan nomor 2, H Aswin Parinduri-H Syarifuddin Lubis, pasangan nomor 3 Irwan H Daulay–H Samad Lubis, pasangan nomor 4 H Naharuddin Lubis-H Nuraman Ritonga, pasangan nomor 5 Arsyad Lubis– H Azwar Indra Nasution dan pasangan nomor urut 7 H Indra Porkas Lubis-H Firdaus Nasution. Ketua KPUD Madina Jefri Anthoni mengatakan, pawai akbar merupakan implementasi dari pilkada damai yang telah disepakati tujuh pasangan calon saat penetapan nomor urut pasangan beberapa waktu lalu. Sebelumnya, KPUD Madina sudah menetapkan jadwal dan tempat pelaksanaan kampanye pasangan calon bupati/wakil bupati yang dimulai 25 Mei hingga 5 Juni 2010 dengan 8 zona. Zona kampanye I meliputi Kec. Siabu dan Bukit Malintang. Zona II Kec. Hutabargot, Panyabungan Utara dan Naga Juang. Zona III Kec. Panyabungan, Panyabungan Barat dan Panyabungan Timur. Zona IV Kec. Panyabungan Selatan, Tambangan, Puncak Sorik Marapi dan Lembah Sorik Marapi. ZonaV Kec. Kotanopan, Muarasipongi, Pakantan dan Ulupungkut. Untuk zona VI meliputi kawasan Batang Natal, Ranto Baek dan Lingga Bayu. Zona VII meliputi Kec. Natal dan Muara Batanggadis dan zonaVII meliputi kawasan Sinunukan dan Batahan.(a24)

Waspada/Edoard Sinaga

KAMPANYE DAMAI: Pasangan calon walikota/wakil walikota Pematangsiantar memulai kampanye dengan karnaval kampanye damai usai 8 dari 10 pasangan calon menandatangi kesepakatan kampanye damai, siap kalah dan siap menang di depan Balaikota, Jl. Merdeka, Senin (23/5).

Calon Walikota Medan Harus Membuat Kontrak Politik MEDAN (Waspada): Dua pasang calon walikota Medan yakni, Rahudman-Eldin dan Sofyan Tan-Nelly Armayanti yang lolos pada putaran kedua, sama-sama berpeluang besar menjadi orang nomor satu memimpin kota Medan. “Peluang kedua calon walikota itu akan sama kuat jika mampu meyakinkan masyarakat dengan isu-isu yang dapat menarik minat pemilih untuk memberikan suaranya, dan kedua calon bisa membuat komitmen kepada masyarakat seperti kontrak politik,” kata pengamat politik Warjio, MA kepada Waspada, Senin (24/5). Warjio menilai, saat ini masyarakat Medan sangat menginginkan pemimpin yang pro perubahan, bersih dari sisi moralitas dan dari sisi administratif yang berkaitan dengan KKN. Ini tentu sangat diharapkan oleh masyarakat, karena berbagai persoalan yang dulu juga terjebak pada persoalan KKN tersebut. “Dalam hal ini, tidak ada pilihan lain bagi masyarakat untuk memilih kedua calon itu. Oleh karenanya, harus muncul semacam kontrak politik antara

kedua calon dan masyarakat. Karena kalau tidak ada komitmen, saya kira jumlah golputnya akan semakin besar dan tentu kurang menarik kalau partisipasi politiknya diukur dengan sedikitnya dukungan masyarakat terhadap mereka,” sebut dosen Universitas Sumatera Utara (USU) dan Universitas Medan Area (UMA) itu. Menurut dia, kedua calon walikota tersebut akan menerima dukungan masyarakat apabila mereka mampu memainkan isu-isu, seperti rasial yang berkaitan dengan ideologi atau agama dan isu berkaitan dengan perubahan terhadap perbaikan pembangunan kota Medan. “Kalau isu-isu seperti ini diangkat secara baik dan bisa memberikan keyakinan dari masyarakat atau masingmasing calon pemilih, saya kira akan memberi kesempatan lebih luas dari kedua calon, dan hal ini tergantung pada manajemen bagaimana mereka menjadikan kedua isu itu untuk meyakinkan masyarakat agar memilih mereka,” ujar Warjio, mengatakan, jika dianalisakan berdasarkan landasan ideologi dan rasialis kemungkinan besar

peluang ada pada RahudmanEldin, namun kalau isu itu dilandaskan pada perubahan kota Medan, Sofyan Tan punya kesempatan lebih luas. Kekuatan Partai Mengenai kekuatan partai untuk mencari dukungan kepada masyarakat,Wajio mengatakan, saat ini kekuatan partai masih sangat mengambang, misalnya sampai sekarang partai-partai belum bisa menentukan kemana suara dukungan mereka akan diberikan. “Jadi tergantung bagaimana misalnya pendekatan yang dilakukan kedua calon tersebut.” Misalnya Rahudman, akan mendekat ke partai-partai berbasis Islam dan memberikan keyakinan, tentunya dengan konsekuensi yang mereka dapatkan. Begitu juga sebaliknya partai-partai yang berhaluan nasionalis dan kristen akan merapat ke Sofyan Tan, karena itu merupakan kesempatan politik mereka. “Tapi di luar itu, baik di masyarakat atau partai-partai politik, semestinya ketika kedua calon tersebut datang harus bisa memberikan semacam kontrak

DPP Golkar Beri Bantuan Hukum Tim Afifi-Halomoan Di MK

KNPI Medan Berharap Tokoh Agama Beri Pencerahan

SIBOLGA (Waspada): Adanya gugatan dari tim pemenangan Afifi-Halomoan kepada Mahkamah Konsitusi (MK) yang mengadukan berbagai kecurangan pada pelaksanaan pilkada Sibolga, mendapat respon DPP Partai Golkar. DPP menyatakan, akan memberikan bantuan hukum terhadap tim Afifi-Halomoan di MK. Ketua DPD II Partai Golkar Sibolga, Syahlul Umur Situmeang kepada wartawan, Minggu (23/5) mengatakan, sesuai surat DPP Partai Golkar bernomor B-47/GOLKAR/V/2010 ditandatangani Ketua Muladi danWakil Sekretaris Octavano, akan memberi bantuan hukum kepada tim Afifi-Halomoan dalam pengajuan gugatan di MK. “Gugatan yang diajukan tim Afifi-Halomoan berupa kecurangan yang terjadi pada pilkada Sibolga disertai bukti otentik. Hal ini sesuai dengan surat DPP nomor B-47/GOLKAR/V/2010, dan kami yakin dengan bantuan hukum ini nantinya MK memenangkan gugatan tim Afifi-Halomoan,” kata Syahlul. Dijelaskannya, bentuk kecurangan yang terjadi, di antaranya, penahanan formulir C6 sebanyak 8.500 pemilih, sehingga membuat jumlah golput di Sibolga membludak. “Selain itu terdapat nomor induk kependudukan (NIK) ganda 2.600 pemilih. Bahkan ditemukan NIK masyarakat Tapteng turut memilih di Sibolga,” kata Syahlul. Bukan hanya kecurangan pada hari H pelaksanaan saja yang digugat ke MK, akan tetapi kata dia, penetapan salah satu calon yang hanya mengandalkan surat keterangan tamat belajar saat mendaftar.(a18)

MEDAN (Waspada): Para tokoh agama, dari manapun asalnya agar memberikan keteladan dan pencerahan kepada masyarakat menjelang pilkada kota Medan putaran kedua, 15 Juni 2010. Sebab putaran kedua merupakan penentuan akhir terpilihnya walikota dan wakil walikota untuk memimpin Medan lima tahun ke depan. Karena itu diharapkan kepada tokoh agama ikut membangun kesadaran umatnya untuk mensukseskan pemilu, jangan sampai tidak memilih. Harapan itu disampaikan Ketua Dewan Pengurus Daerah Komite Nasional Pemuda Indonesia (DPD KNPI) Kota Medan, Zulham Effendi Siregar kepada wartawan, Minggu (24/5) di Medan.

Katanya, Medan merupakan miniatur Indonesia karena memiliki kera-g-aman agama, suku, budaya dan etnis yang selama ini hidup rukun, saling menghormati, harmonis dalam bingkai persatuan dan kesatuan. Keberadaan ini merupakan salah satu contoh indahnya kerukunan hidup bernegara dalam bingkai Bhineka Tunggal Ika yang selalu terjaga. “Bahkan kerukunan di Medan, umumnya di Sumut sepantasnya disebut sebagai lokomotif membawa terpeliharanya persatuan di negeri ini dalam kerangka NKRI,” ucap Zulham. Karenanya, Zulham berharap kepada segenap elemen masyarakat saling menghormati, karena samasama memiliki rasa sebangsa dan setanah air Indonesia.

Ditegaskannya, isu yang bisa mengarah kepada SARA di tengah masyarakat, seharusnya tidak dijadikan senjata oleh suatu pihak mempolitisasi masyarakat untuk mencapai tujuan ataupun kepentingan kelompok tertentu. Oleh karena itu, ajakan ataupun seruan dari pemuka masyarakat, tokoh agama ataupun tokoh adat untuk mensukseskan pemilu putaran kedua akan jauh lebih berharga ketimbang saling menyalahkan. Menurut Zulham, sejatinya tokoh ag-ama maupun tokoh masyarakat memainkan peran aktifnya dengan memberikan pendidikan serta pandangan kepada masyarakat, terutama mengenai kesiapan untuk mensukseskan pilkada. Ajakan itu tetap mengendepankan

Banyak ‘Hantu’ Masuk Dalam DPT BANYAK nya jumlah pemilih yang golput pada pilkada kota Medan putaran pertama hingga 64 persen, masih menjadi pembicaraan berbagai kalangan. Sejumlah media massa dan pakar politik menyebutkan, banyaknya pemilih yang golput disebabkan karena partisipasi warga rendah dalam mengikuti pesta demokrasi itu, sehingga warga lebih memanfaatkan waktu pencoblosan 12 Mei 2010 untuk liburan. Sedangkan KPU Medan mengakui banyaknya jumlah pemilih yang golput dikarenakan kurang maksimalnya sosialisasi mereka lakukan, sehingga jumlah pemilih hanya mencapai 34 persen saja. (Waspada Rabu, 19 Mei 2010). Namun, pendapat lain dilontarkan mantan Ketua BPS (Badan Pusat Statistik) kota Medan 2001-2009 Aguslan Simanjuntak. Dia menyatakan, pada pilkada putaran pertama kemarin, banyak pemilih “hantu” yang masuk atau terdaftar dalam Daftar Pemilih Tetap (DPT). “Memang benar apa yang disebutkan politikus di media. Tapi itu hanya sedikit, yang banyak itu pemilih ‘hantu’. Pemilih ‘hantu’ maksudnya, banyak pemilih yang sudah tidak ada lagi orangnya atau meninggal atau mereka yang sudah pindah dari tempat asalnya, namun masih tercatat di Dinas Kependudukan dan Catatan Sipil. KPU hingga kini masih memakai data Dinas Kependudukan dan Catatan Sipil. “Mereka yang meninggal dan pindah biasanya tidak pernah dilaporkan oleh keluarganya ke Dinas Kependudukan, sampai data itu berakumulasi hingga 10 tahun. Orang-orang yang meninggal atau yang pindah tadi masih tercatat terus di Dinas Kependudukan itu,” kata dia kepada Waspada, Sabtu (22/5). Menurutnya, jumlah pemilih ‘hantu’ yang terdaftar dalam DPT Pilkada Medan berkisar 500 ribu lebih. Data yang tercatat di Dinas Kependudukan menyebutkan, jumlah Daftar Penduduk Potensial Pemilih Pilkada (DP4) berjumlah 2,7 juta orang lebih. Namun setelah dimutakhirkan, ditetapkan jumlah DPT pada pilkada Medan bekisar 1,9 juta pemilih dan TPS berjumlah 3.800 lebih. “Padahal yang tercatat di BPS Medan pada kondisi sekarang jumlah penduduknya berkisar 2,1 juta saja, seharusnya setelah dimutakhirkan jumlah pemilih kita sebenarnya hanya berkisar 1,4 juta. Dengan pemilih 1,4 juta tersebut

Dampak Negatif Aguslan sangat yakin yang diungkapkannya ini kebenarannya mencapai 95 persen. “Kalau tidak percaya coba tanya KPPS di Medan saat mengantar surat undangan pemilih, pasti banyak orang yang sudah meninggal atau pindah masih dapat kartu pemilih. Di setiap TPS rata-rata sekitar 125 pemilih yang tidak ada pemilihnya. Dalam membagikan kartu pemilih juga seharusnya dilakukan oleh kepling setempat, karena dia yang tahu jumlah warganya,” katanya. Dampak negatif dengan banyaknya pemilih ‘hantu’ yang mendapat kartu pemilih dikhawatirkan disalahgunakan pasangan calon yang ingin bermain curang. “Seharusnya, jika tidak ada pemilih ‘hantu’ atau orang yang meninggal maupun yang sudah pindah mendapatkan undang pemilih/terdaftar di DPT, kemungkinan bisa menghemat seperampat biaya pilkada.” TPS-TPS, kertas suara, hansip-hansip dan sebagainya bisa dikurangi seperampat, sehingga dapat menghemat biaya. Kita ketahui semua, biaya pilkada cukup besar. Banyaknya beredar pemilih ‘hantu’ tidak hanya di Medan, tetapi juga di kotakota besar lainnya saat pilkada. “Harapan saya, KPU Pusat harus mengkaji kembali sumber data dan informasi sistem pemutakhiran data,” ungkapnya. Salah seorang anggota PPS di TPS 64 Kel. Mangga Kec. Medan Tuntungan Hafiz mengakui, pada saat membagikan undangan pemilih, terdapat beberapa warga yang sudah meninggal atau yang tidak ada orangnya atau pindah, namun mendapatkan undangan untuk memilih. “Bahkan, sudah meninggal hampir sepuluh tahun lalu, contohnya atok saya dapat surat undangan untuk memilih,” ujarnya. Hal ini juga pernah diungkapkan Ketua PPS di TPS 30 Kel. Simpang Selayang, Medan Tuntungan Jhonson Tobing. Dia mengatakan, DPT mencapai 512 pemilih, namun 116 pemilih tidak ditemukan atau tidak ada orangnya, sehingga jumlah pemilih di TPS 30 Kel. Simpang Selayang, Medan Tuntungan berjumlah 396 orang. “Yang tidak ada orangnya tersebut kita kembalikan.” (Waspada Kamis, 14 Mei 2010). Banyaknya temuan seperti itu di lapangan, mantan Ketua BPS Medan itu menyarankan agar KPU kembali memakai sistem Pentarlih (Pendaftaran Pemilih) seperti zaman orde baru. Pada zaman itu, petugas datang ke rumah-rumah

politik yang disepakati, sehingga masyarakat atau parpol tidak kecewa dengan pilihan politik mereka,” sebut kandidat Doktor USM ini. Dari segi kelemahan kedua calon, Warjio menyebutkan, untuk Rahudman kelemahannya terdapat pada asalnya dari birokrasi, dimana opini birokrasi yang terbentuk sekarang ini di Medan dan Sumut bahwa orang-orang birokrasi tidak begitu baik, misalnya kasus persoalan walikota Medan terdahulu, kasus mantan bupati Langkat dan sebagainya. “Ini memberikan kontribusi negatif bagi Rahudman. Sementara sisi positifnya, Rahudman memiliki banyak pengalaman memimpin di pemerintahan,” ujarnya. Sementara, sisi negatif pada Sofyan Tan, dirinya berasal dari etnis minoritas, sehingga kemudian mereka tidak bisa referesentatif secara luas. Sedangkan positifnya, SofyanTan bukan berasal dari birokrasi, namun dari masyarakat biasa yang opininya tidak banyak terlibat dengan persoalan-persoalan KKN. “Hal ini memberi kontribusi tersendiri bagi masyarakat,” ujarnya. (m41)

MEDAN (Waspada): Ketua Umum Ikatan Da’i Indonesia (IKADI) Sumut Sakhira Zandi (foto) mengimbau masyarakat Medan memilih calon walikota/ wakil walikota seakidah. “Mereka itu termasuk pilihan ulama,” katanya, Senin (24/5). IKADI, kata Sakhira, perlu menyampaikan ini kepada masyarakat tentang kriteria yang perlu dikedepankan dalam memilih calon pemimpin masa depan, antara lain, memilih sosok yang sesuai dengan ketentuan yang diatur oleh agama Islam. Kemudian, melihat kepada mudhrat dan manfaatnya, mempunyai kredibilitas kepemimpinan dan sudah pernah melaksanakan tugas kepemimpinan dan telah teruji. “Ini sangat penting guna memastikan kelanjutan pembangunan kota Medan lima tahun ke depan,” kata dia. Kriteria berikutnya, agar memilih sosok yang dipilih agamawan dan para ulama. Hal ini penting menjadi pertimbangan masyarakat. “Kalangan agamawan dan ulama sudah melakukan sosialisasi bahwa orang yang dipilih hendaknya seakidah. Diharapkan masyarakat mempunyai pertimbangan khusus, meski tidak bisa dipungkiri bahwa semua orang punya pemikiran berbeda tentang karakter seseorang. Tetapi harus diingat bahwa tidak ada manusia yang sempurna, dan orang muslim yang punya kesalahan dosanya diampuni Allah,” papar Sakhira. Dia menambahkan, kriteria yang diusulkannya hendaknya mendapat tanggapan positif dari para calon walikota dan wakilnya jika nantinya terpilih. “Masyarakat pastinya akan menunggu visi dan misi yang pernah disampaikan calon itu, dan dibuktikan.”(m36)

IAFEN Ajak Warga Medan Menangkan Sofyan Tan-Nelly Armayanti MEDAN (Waspada): Ikatan Alumni Fakultas Ekonomi Universitas HKBP Nommensen (IAFEN) mengajak warga Medan mendukung, sekaligus memenangkan pasangan dr. Sofyan TanNelly Armayanti pada pilkada putaran kedua, 15 Juni 2010. “Dr Tan-Nelly merupakan pasangan terbaik yang tersisa untuk putaran kedua,” ujar Ketua Umum IAFEN James Ganda Sormin, didampingi bendahara Brilian Moktar kepada wartawan di Medan, Minggu (23/5). Dari sepuluh pasangan calon yang bertarung pada pilkada putaran pertama 12 Mei 2010, KPU Medan menetapkan pasangan Rahudman Harahap-Dzulmi Eldin dan Sofyan Tan-Nelly Armayanti maju ke putaran kedua. Dari total 678.804 suara sah yang dihitung dari 3.897 tempat pemungutan suara (TPS) di 21 kecamatan, Rahudman-Eldin memperoleh 150.671 suara pemilih atau 22,20 persen, sementara pasangan Sofyan Tan-Nelly Armayanti meraih 140.676 suara (20,72 persen). Menurut Sormin, dari dua pasangan yang tersisa untuk pilkada putaran kedua, pasangan Sofyan Tan-Nelly Armayanti merupakan yang terbaik. Pasangan ini diyakininya merupakan figur pemimpin masa depan yang akan membawa perubahan positif bagi kota Medan. Keduanya juga dipandang memiliki komitmen kuat dalam membangun pemerintahan yang bersih dan bebas dari korupsi. “Kita pegang janji dr. Tan yang menyatakan siap digantung jika melakukan korupsi. Kita meyakini kepemimpinan pasangan nomor 10 ini akan benar-benar bebas dari segala bentuk praktik korupsi,” ujarnya. Sehubungan dengan itu, Sormin mengimbau seluruh alumni Universitas HKBP Nommensen di Medan untuk tidak ragu-ragu menjatuhkan pilihan. Dia juga mengajak rekan-rekannya di seluruh kawasan Kecamatan Medan Perjuangan, Medan Timur dan juga di 19 kecamatan lainnya di Medan melakukan hal serupa. “Kita semua pasti menginginkan perubahan positif dan signifikan di kota yang kita cintai ini. Untuk itu, tegas saja dan jangan ragu-ragu, mari kita dukung dan menangkan pasangan Sofyan Tan-Nelly pada pilkada putaran kedua nanti,” katanya.(h11)

Jangan Gunakan Isu SARA nilai-nilai kearifan dalam rasa toleransi serta kebersamaan. “Landasan berpikir ini sangat penting dibangun,” kata Zulham, mengingat warga Medan hidup di alam yang majemuk dan heterogen. Dengan demikian, keragaman dapat dijadikan sebagai lokomotif agar tetap terpeliharanya persatuan dan kesatuan bangsa. “Pilkada kata dia, sematamata un-tuk masa depan dan kemajuan kota Medan. Untuk itu, KNPI Medan akan memainkan peran aktifnya guna terlaksananya pilkada putaran kedua yang demokratis, aspiratif dan lancar sampai terpilihnya pemimpin terbaik. “Pilih pemimpin sesuai hati nurani, tanpa adanya tekanan dari oknum tertentu,” ajaknya.(m11)

MEDAN (Waspada): Direktur Pusat Studi Kajian Islam, Abdurrahman, sangat kecewa dan menyesalkan tindakan oknumoknum tertentu yang menggunakan isu SARA (suku, agama, ras, adat) alam pilkada Medan putaran ke 2 yang akan dilaksanakan tidak lama lagi. “Kalau isu itu dipakai dalam pilkada, berarti tindakan itu telah merendahkan ajaran Islam dalam Alquran,” kata Abdurrahman kepada wartawan, Minggu (23/5). Ini sangat memalukan dan menunjukkan bahwa agama dimanfaatkan untuk mendapatkan nafsu kekuasan. Padahal tidak ada kaitan masalah pilkada dengan agama. “Dalam Islam, masalah tahuid dan ibadah tidak ada tawar menawar, tapi masalah muamalah, Islam tidak melarang untuk bekerjasama dengan umat apapun,” tegasnya. Karena itu, diminta kepada oknumoknum yang memanfaatkan isu agama untuk menghentikan segera tindakan itu, karena sangat memalukan. “Seharusnya semua kandidat walikota bersaing dengan sehat dan menyakikan masyarakat yang memilih dalam pilkda Medan tentang visi, misi yang akan dijalankan bila terpilih,” jelasnya. Menurut Abdurrahman, memanfaatkan isu agama dalam pilkada kota Medan sama dengan memperdagangkan ayat-ayat Alquran, hanya untuk mencapai nafsu kekuasaan. “Perlu kita ketahui, Rasul saja untuk membangun kota Madina bekerjasama dengan berbagai umat beragama, sehingga kota Madina menjadi suatu daerah yang maju. Seharusnya calon walikota yang ingin bertarung memenangkan pilkada mencontoh sikap Rasul,” jelasnya.(m39)


Selasa 25 Mei 2010

Sekdakab Samosir Sulit Dikonfirmasi Terkait Plt Bupati/Wakil Samosir SAMOSIR (Waspada) : Dua pejabat tertinggi di Pemkab Samosir (Incumbent) mengambil cuti untuk mengikuti Pemilukada Kab. Samosir tahun 2010, keduanya maju sebagai Calon Bupati Samosir 2010. Para incumbent tersebut masing-masing Ir. Mangindar Simbolon berpasangan dengan Ir Mangadap Sinaga (Nomor Urut 2/ Pas Mantap), Ober Sagala,SE, MM berpasangan dengan Tigor Simbolon,ST (Nomor Urut 7/ Obor Samosir). Izincuti Bupati Samosir Ir. Mangindar Simbolon sesuai Surat Keputusan Gubsu No.188.44/358/KPTS/2010 mulai 22 -29 Mei, dilanjutkan 31 Mei - 5 Juni. Sedangkan izin cuti Wakil Bupati Samosir Ober Sagala,SE MM sesuai SK Gubsu No. 88.44/361/KPTS/2010 mulai 23 Mei - 5 Juni 2010, sebut Anggota KPU Samosir Fernando Sitanggang, SH kepada Waspada, Senin (24/5). Dia juga mengucapkan terima kasih kepada masyarakat Samosir yang telah menjaga kekondusifan selama berlangsungnya kampanye damai, Sabtu (22/5) dan penyampaian visi misi Calon Bupati Samosir/Wakil Bupati Samosir, Minggu (23/5) di Gedung DPRD Kab. Samosir. Sekda Kab.Samosir Drs. Tigor Simbolon saat dikonfirmasi Waspada, Senin (24/5) tentang siapa Plt Bupati maupun Wakil Bupati Samosir tidak bersedia menjawab dan mendelegasi kepada ajudan Sekda. Ajudan sekda meminta agar ditanya saja langsung kepada Asisten Pemerintahan, namun telefon seluler asisten pemerintahan tidak aktif.(c10)

B7

Sumatera Utara

WASPADA

Konflik Istri Camat Dan Warga

Kondisi Makin Kritis

Bocah Penderita Tumor Harus Dirujuk Ke Medan Penegak Hukum Diminta Bijaksana KISARAN (Waspada): Bocah penderita tumor abdomen di lambungnya asal Kabupaten Batubara harus segera dirujuk keRSUDMedan,namunrujukan itu tersendat karena orang tua korban tergolong keluarga miskin dan tidak terdaftar sebagai peserta Jamkesmas. Sedangkan Dinas Kesehatan Batubara berpaling, dengan alasan tidak ada alokasi dana perawatan untuk keluarga miskin. “Anak ini harus segera dirujuk ke Medan, mengingat keadaan pasien sudah mulai parah,” ujar Dokter Spesialis Anak RSUD Kisaran, dr Alfian Nasution Sp A, ditemuiWaspada, setelah memeriksa pasien, Senin (24/5). Menurut Alfian, selain penyakit tumor itu, pasien juga menderita kekurangan gizi sehingga tubuhnya kurus dan keadaannya menjadi kronis, sehingga harus ditangani secepatnya. “Tidak ada jalan lain, selain

membawa anak itu ke rumah sakitdiMedan,bilatidaksituasinya akan bertambah parah,” ujar Alfian. Kadis Kesehatan Batubara, Surya Darma, dikonfirmasi Waspada melalui via telefon, mengatakan, mereka tidak bisa berbuat banyak, karena mereka tidak terdaftar sebagai peserta Jamkesmas, dan belum ada alokasi dana untuk perawatan mereka. “DinasKesehatanbelumadadana untuk membawa mereka ke Medan,” ungkap Surya. Ditanya solusinya, Surya belum bisa memberikan tanggapan, namun dia akan berkoordinasi dengan pihak puskesmas, untuk mengetahui kasus bocah tersebut secara jelas, selain itu katanya, pihak dinkes hanya bisa memberikan ambulans untuk membawa pasien ke Medan, selebihnya mereka belum mampu. Sebelumnya, Nanang Sudiar, 10, putra pertama pasangan

Sarwono, 34, dan Sriamia, 31, warga Dusun XI, Desa Seibalai, Kec. Seibalai, Kab.Batubara, menderita tumor abdomen di dalamlambungnya,mengakibatkan tubuh bocah kelas empat SD ini kurus. (21/5). Satu Bocah Lagi Dirawat Sementara, Senin (24/5) Abdul Rahman, 8, putra bungsu dari delapan sauadara pasangan Safaruddin, 52, dan Ramliya, 48, warga Desa Pematangrambe, Kec.Seibalai, Kab.Batubara, dirawat di RSUD Kisaran, karena bocah ini menderit panyakit yang sama, tumor abdomen, dan harus segara di rujuk ke rumah sakit di Medan, namun mereka tetaptersandungdenganmasalah biaya. (csap)

SIDIKALANG (Waspada): Ketua LSM Basis Demokrasi Indonesia Kab. Dairi, Bachatiar Sinaga meminta penegak hukum berlaku adil dan bijaksana dalam penanganan kasus konflik antara Eva Br Napitupulu (istri camat Sidikalang), dengan warga desa Blang Malum Sidikalang, Estetika Br Bintang. Tokoh pemuda Dairi itu mengatakan, kemarin, terkait telah P21-nya laporan Estetika, dimana berkas dan tersangkanya telah diserahkan ke Kejari Sidikalang 30 April 2010 lalu. “Karena kasus ini tinggal menunggu sidang di PN Sidikalang, maka kita berharap agar para penegak hukum bisa bertindak arif, bijaksana dan objektif tanpa melihat latar belakang masing-masing yang berperkara. Karena kita masih per-

caya bahwa di depan hukum, khususnya di Dairi, semua derajat manusiaituserupa,”kataBachtiar, didampingi Wakil Ketua Bidang Hukum Midian Sijabat. Sebagaimana diberitakan, konflik bermula saat Estetika dengan Camat Sidikalang Junihardi DR Siregar terlibat cekcok yang kemudian melibatkan istri camat tersebut. Dalam laporan Estetika ke polisi, dia merasa keberatan atas tindakan dan perlakuan Camat Sidikalang yang dianggap arogan dan terkesan memadang hina warganya. Dalam pengaduannya, Estetika menjelaskan, Selasa siang, 29 September 2009, dia sedang menanam jagung di tanahnya, persis di samping tembok rumah baru Camat Sidikalang itu. Saat itulah, Junihardi Siregar

bersama isterinya Eva Boru Napitupulu, datang menghampiri dengan menaiki mobil dinas BB 216Y, menanyakan kenapa Estetika mencangkuli tanah tersebut. Estetika mengaku terkejut, karena tanah itu milik orangtuanya, dan sempat terjadi perdebatan. “Saat itu Junihardi Siregar memaki-maki saya,” tutur Estetika, mengaku bahkan hendak dilempar batu oleh istri camat, Eva br Napitupulu. Namun seorang warga Blangmalum, Pesta Boru Hutauruk melerai sekaligus memegang tangan Eva Br Napitupulu. “Kami minta kasus antara saya dengan camat diproses sesuaihukum,karenaketerangan camat dan istrinya saya nilai bertolak belakang dengan kejadian sebenarnya,”sambungnya.(m11)


B8 Produktivitas Padi Alami Kenaikan, Simalungun Surplus 163.676 Ton SIMALUNGUN (Waspada): Produktivitas khususnya tanaman padi di Simalungun pada musim tanam 2010 ditargetkan antara 13 sampai 15 persen per hektare. Target ini mengalami kenaikan dari tahun sebelumnya 12,58 persen per hektare atau naik sekitar 2,5 persen dan membuat daerah itu surplus 163.676 ton. Kepala Dinas Pertanian Simalungun, Hamdan Nasution, SP, kepada Waspada, Senin (24/5), mengatakan, target tersebut untuk mendorong ketahanan pangan di Kab. Simalungun sekaligus mempertahankan daerah ini sebagai daerah surplus padi. “Kalau tahun 2009 lalu mencapai 12,58 persen per hektare, tahun ini (2010) kita targetkan mencapai 13-15 persen per hektare,� kata Hamdan. Menurutnya, dalam upaya pencapaian target tersebut, pihaknya menerapkan teknologi pertanian dengan sistem legowo. Selain itu, Dinas Pertanian juga memberikan bantuan benih sebanyak 280,5 tonyangdiberikankepada petani.“Bantuanbenihpadiitudialokasikan untuk 63 Gapoktan, 550 kelompok tani di 99 nagori dengan luasan seluruhnya mencapai 12.700 hektare,� terang Hamdan. Pupuk Sementara menghadapi Musim Tanam (MT) 2010 kebutuhan pupuk di Simalungun jauh dari yang diharapkan. Dinas Pertanian daerah ini mengusulkan 470 ribu ton, namun yang terealisasi hanya sekitar 53 ribu ton. Menurut Hamdan, usulan rencana kebutuhan pupuk bersubsidi jenis Urea, SP, ZA, NPK dan Organik yang diajukan ke Pemprovsu untuk kebutuhan MT 2010 mencapai 470 ribu ton lebih, namun yang direalisasikan hanya sekitar 53 ribu ton. Diajugamenjelaskan,sesuaiPeraturanMenteri(Permen)Pertanian nomor 10 tahun 2009 tentang perubahan harga pupuk untuk pertanian, seluruh pupuk bersubsidi mengalami kenaikan harga dari sebelumnya. Misalnya jenis pupuk Urea dari Rp 1200 menjadi Rp 1600 per kilogram, SP 36 dari Rp 1550 menjadi Rp 2000 per kilogram, ZA dari Rp 1050 menjadi Rp 1400 per kilogram, NPK Ponska dari Rp 1750 menjadi Rp 2300 per kilogram, Petrogenik dari Rp 500 menjadi Rp 700 per kilogram. (a15)

Sumatera Utara DKPPLH Pakpak Bharat Temukan Kegiatan Illegal Logging SALAK,Pakpak Bharat (Waspada): Tim Perlindungan dan RehabilitasiHutanpadaDKPPLH (Dinas Kehutanan, Perkebunan, Pertambangan dan Lingkungan Hidup) Pemkab Pakpak Bharat pada pekan lalu di wilayah kawasan Hutan Lindung Register 66 Adian Tinjoan, tepatnya bersebelahan dengan Desa Perduhapen, Kecamatan Kerajaan, Kabupaten dimaksud membuktikan adanya kegiatanillegaltersebutdikawasan tersebut. Lokasi pembalakan liar itu diketahui setelah adanya laporan dari warga desadimaksud kepada wartawan.Selanjutnya,wartawan meneruskannya ke pihak Perlindungan dan Rehabilitasi Hutan setempat di Salak. Setelah tim terbentuk, dengan dipandu dua wargaDesaPerduhapen,personil yang beranggotakan lima orang staf dari DKPPLH Kabupaten tersebut serta dua orang wartawan terjun ke lokasi itu. Di lapangan, ditemukan puluhan keping kayu olahan chain saw dengan berbagai jenis dan ukuranyangditumpukkandilima

tempat dan siap untuk diangkut. Disinyalir,berdasarkanpengakuan warga desa itu bermarga Padang, kegiatan dimaksud diduga dibekingi oknum kades, pengolahan kayu berupa broti dan papan di kawasan hutan tersebut bisa mulus. Bahkan, sebut Padang , para pelaku ketika itu pernah mengeluarkan produk illegalnya hingga beberapa truk. Tidak tanggung-tanggung, informasi yang diperoleh dari warga dan layak dipercaya menyebutkan, dalang perambahan hutan tersebut disinyalir dan didugakuatadalahoknumkepala desa (kades). Hanya saja, karena lokasinya cukup jauh dari jangkauan, kegiatan ini sepertinya berjalan mulus tanpa terpantau masyarakat. Sayangnya, karena keterbatasan personil, tim yang dipimpin Kastro Manik dan Juragan Solin berikut tiga staf lainnya, barang bukti itu urung diangkut ke lokasi yang lebih aman. Kepada wartawan, Kastro mengatakan, pihaknya akan berkoordinasi dengan perangkat desa setempat supaya

kayuolahandimaksudtetapdijaga dan tidak boleh diangkut hingga adanya penanganan lebih lanjut. Terkait permasalahan ini, salah seorang pemangku hak ulayat Sulang Silima Jamaludin Tinendung menegaskan, akan sesegera mungkin untuk menyampaikan pengaduan kepada pihak Polres Pakpak Bharat. Dikatakan, kegiatan pembalakan liar, khususnya pada kawasan hutan register seharusnya tidak boleh terjadi. Sebab, hal itu akan berdampak buruk kepada pengerusakan habitat dan ekosistem wilayah hutan tersebut. Sementara itu, bila dilihat saat ini, kepolisian dan instansi yang terkait khususnya di Kabupaten Pakpak Bharat terlihat tengah galak-galaknya dalam memberantas oknum pelaku illegal logging. (c08)

WASPADA Selasa 25 Mei 2010


Sumatera Utara

WASPADA Selasa 25 Mei 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane

Zhuhur 12:23 12:37 12:24 12:31 12:31 12:27 12:24 12:20 12:26

‘Ashar 15:47 15:59 15:47 15:54 15:54 15:51 15:47 15:43 15:50

Magrib 18:33 18:49 18:33 18:43 18:41 18:34 18:33 18:28 18:36

‘Isya

Imsak

Shubuh Syuruq

Kota

19:45 20:02 19:46 19:56 19:54 19:46 19:45 19:41 19:48

04:43 04:53 04:43 04:48 04:48 04:50 04:44 04:40 04:46

04:53 05:03 04:53 04:58 04:58 05:00 04:54 04:50 04:56

Langsa 12:26 L.Seumawe 12:29 L. Pakam 12:23 Sei Rampah12:22 Meulaboh 12:33 P.Sidimpuan12:21 P. Siantar 12:22 Balige 12:22 R. Prapat 12:19

06:12 06:23 06:13 06:17 06:18 06:19 06:13 06:09 06:15

Zhuhur ‘Ashar 15:49 15:52 15:46 15:45 15:56 15:44 15:45 15:45 15:42

C1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:36 18:41 18:32 18:31 18:43 18:27 18:30 18:29 18:26

19:49 19:54 19:44 19:44 19:56 19:39 19:43 19:42 19:38

04:44 04:46 04:42 04:41 04:52 04:44 04:42 04:43 04:40

04:54 04:56 04:52 04:51 05:02 04:54 04:52 04:53 04:50

Sabang Pandan Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan

12:36 12:23 12:23 12:24 12:34 12:27 12:24 12:31 12:19 12:29

18:49 18:30 18:29 18:32 18:46 18:34 18:33 18:41 18:27 18:38

20:02 19:42 19:42 19:45 19:59 19:47 19:46 19:54 19:40 19:51

04:52 04:45 04:45 04:45 04:50 04:48 04:43 04:48 04:39 04:49

05:02 04:55 04:55 04:55 05:00 04:58 04:53 04:58 04:49 05:59

Tarutung 12:22 T.Tinggi 12:21 Panyabungan 12:20 Teluk Dalam12:27 Salak 12:25 Limapuluh 12:20 Parapat 12:22 GunungTua 12:19 Sibuhuan 12:19 Lhoksukon 12:29

06:13 06:16 06:11 06:10 06:21 06:13 06:11 06:12 06:09

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

15:59 15:46 15:46 15:48 15:57 15:50 15:47 15:54 15:42 15:52

06:22 06:14 06:14 06:14 06:20 06:17 06:12 06:18 06:09 06:18

Zhuhur ‘Ashar 15:46 15:45 15:43 15:50 15:48 15:44 15:46 15:43 15:43 15:52

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:29 18:30 18:25 18:32 18:32 18:29 18:30 18:26 18:25 18:40

19:42 19:43 19:37 19:44 19:45 19:42 19:43 19:38 19:37 19:53

04:44 04:41 04:43 04:51 04:46 04:40 04:43 04:42 04:42 04:46

04:54 04:51 04:53 05:01 04:56 04:50 04:53 04:52 04:52 04:56

06:13 06:10 06:12 06:20 06:15 06:09 06:12 06:11 06:11 06:15

Masyarakat Blokir Lagi Jalan Perintis Kemerdekaan BINJAI (Waspada): Masyarakat Kel. Kebunlada dan Cengkeh Turi Kec. Binjai Utara kembali memblokir jalan Perintis Kemerdekaan, Senin (24/5).

Tokoh masyarakat, A.Karim menjelaskan, Senin (24/5) pemblokiran sebagian Jalan Perintis Kemerdekaan terpaksa dilaku-

kan akibat Walikota Binjai tidak menepati janji. Saat masyarakat memblokir jalan Perintis Kemerdekaan 17 April 2010, Pemko Binjai menjelaskan, perbaikan Jalan Perintis Kemerdekaan dalam proses tender. Walikota HM Ali Umri, SH, MKn saat mengadakan perpisahan dengan masyarakat Binjai Utara menjanjikan Jalan Perintis Kemerdekaan segera diperbaiki, paling lambat Mei 2010 sudah dikerjakan.

Sidang Korupsi PDAM Tirtasari Binjai

Pengacara: Terdakwa Tidak Bersalah BINJAI (Waspada): Pengacara Abdi Nusa Tarigan, SH dalam pleiodinya menyatakan, terdakwa UK yang dituduh terlibat korupsi di PDAM Tirtasari, tidak terbukti. Pledoi itu disampaiikan Abdi Nusa Tarigan dari Law Office Lubis & Rekan dalam persidangan Senin( 24/5) dengan majelis hakim dipimpin Saut M Pasaribu dan JPU JFK Sembiring. Abdi NusaTarigan menyebutkan, terdakwa UK meminjamkan perusahaan CV Mencirim Jaya kepada SP yang juga sebagai terdakwadansaksisebelumpelaksanaanlelangproyekPeningkatan Kapasitas Produksi WTP. Menurut Abdi, SP telah membujuk UK dengan imbalan uang Rp9 juta dan pernyataan bertanggungjawab sepenuhnya atas akibat yang ditimbulkan dalam pelaksanaan proyek. Abdijugamenyertakanbuktiperjanjiansewa-menyewapinjam perusahaan tertanggal 23 Mei 2006 yang dibuat UK dan SP. Serta surat pernyataan tertanggal 12 Desember 2009 yang ditandatangani SP. Pengacara juga menyebutkan, unsur dari Pasal 3 UU No. 31/1999 juncto UU No.20/2001 tidak terpenuhi, dan unsur berikutnya tidak perlu dibuktikan.Oleh karena itu terdakwa harus dibebaskan dari dakwaan subsider. SedangkanJPUJFKSembiringakanmenyampaikantanggapan dan oleh hakim ketua Saut M Pasaribu, sidang ditunda sampai Senin (31/5).(a03)

Empat Rumah Ludes Terbakar Di T. Tinggi TEBINGTINGGI (Waspada) : Empat unit rumah permanen di komplek Perumnas Bagelen di Jalan Waringin Ling VI , Kel. Bagelen, Kec. Padang Hilir, Tebingtinggi, Senin (24/5) sekira pukul 04:45 ludes dilalap sijago merah. Kendati tidak ada korban jiwa dalam insiden itu, namun kerugian diperkirakan mencapai ratus juta rupiah. Kobaran api menghanguskan empat rumah warga masingmasing milik H Sibuea (Purn. Polisi), P. Sigiro (Guru SMPN 7), Drs J Manik dan Pujo Kesumo. Sedangkan harta benda yang dapat diselamatkan beberapa kursi tamu, kasur, barang elektronik TV dan barang kecil lainnya. Menurut keterangan sejumlah warga di lokasi A Purba dan M.Siahaan kepada wartawan, kobaran begitu cepat merambat. Api diduga berasal dari adanya korsleting listrik dari salah satu rumah korban yang diduga kosong tidak berpenghuni. Purba mengaku, petugas pemadam kebakaran begitu lamban datang. Kendati setengah jam setelah kejadian, 4 unit mobil pemadam kebakaran dibantu 1 unit pemadan dari Pemkab Sergai baru datang kelokasi kejadian. Sementara itu, pasca kejadian, Walikota Tebingtinggi Ir H Abdul Hafiz Hasibuan melalui Kadis Dinas Sosial Hj Mahrani, SE didampingi Kabid Tenaga Kerja BM Tambunan menyerahkan bantuan sebesar Rp 1,5 juta terhadap masing-masing korban kebakaran. (a09/a08)

Di Binjai, Terdata Nenek Berusia 104 Tahun BINJAI (Waspada): Badan Pusat Statistik(BPS) tidak yakin ada penduduk Indonesia berusia lebih 100 tahun. Sehingga kolom pendataan sensus penduduk hanya dibuat dua kotak. Dibeberapadaerah diIndonesia,petugasSP2010menemukan warga berusia 142 tahun. Begitu juga di Kota Binjai petugas pencacah menemukan nenek berusia 104 tahun dan masih sehat. Disebabkan berkas sensus hanya menyediakan dua kotak, maka sesuai petunjuk kantor BPS, usia nenek yang 104 tahun, hanya dibuat 98 tahun. Nenek berusia 104 tahun sebagai warga di Jalan Jambu, Kel. Limau Mungkir, Kec. Binjai Barat. Nenek mengaku bernama Wagina mengaku sudah puluhan tahun tinggal di Kota Binjai. Wagina berasal dari Bengkulu, kini tinggal bersama anak dan cucu serta masih sehat. Ia hanya berucap, Allah memberikan ia usia panjang.(a03)

Nyatanya hanya janji, sampai waktu ditentukan, Jalan Perintis Kemerdekaan hanya ditimbun pasir dan batu (sirtu) tanpa ada perbaikan total. Kini Jalan Perintis Kemerdekaan kembali rusak akibat tonase truk galian C dan sawit. Masyarakat yang rumahnya di pinggiran Jalan Perntis Kemerdekaan terserang abu dan pemilik kedai nasi sulit berusaha akibat abu. Tokoh masyarakat

Abd. Karim mengingatkan masyarakat janji Walikota yang tidak ditepati, dan akan memblokir Jalan Perintis Kemerdekaan mulai Senin( 24/5). Pemblokiran jalan tidak total dan yang tidak dibenarkan melintas adalah truk, sehingga tidak menganggu masyarakat. Lobang –lobang di Jalan Perintis Kemerdekaan oleh masyarakat dibuatkan gundukan pasir dan dipasang daunan maupun

pohon. Beberapa tokoh masyarakat lainnya, ketika dihubungi, Senin (24/5) mengaku kecewa akan janji pejabat Pemko Binjai. Pihak Dinas Perhubungan ketika dikonfirmasi mengakui, urusan saranaperhubunganadalahurusan Dinas Pekerjaan Umum (PU). Kepala Dinas PU Hj. Masriani yang akan dikonfirmasi, menurut stafnya tidak berada di kantor.(a03)

Kasus Penipuan:

Tidak Kooperatif, JPU Usulkan DP Ditahan

Bupati Tinjau Gotroy Di Percut Sei Tuan

MEDAN (Waspada): Setelah beberapa kali tidak kooperatif memenuhi panggilan sidang, Jaksa Penuntut Umum (JPU) mengusulkan kepada majelis hakim agar dilakukan penahanan terhadap OK DP terdakwa kasus penipuan dan penggelapan Rp200 juta. “Ini kali ke empat terdakwa tidak memenuhi panggilan sidang di Pengadilan Negeri Medan, jadi kami sudah memiliki dasar mengusulkan penahanan ke majelis,” kata JPU, P Sinaga, Senin (24/5). Menurut informasi, lanjut Sinaga, terdakwa kembali tidak memenuhi panggilan sidang karena sakit. Namun, pihaknya belum ada menerima surat resmi dari tim medis yang menerangkan kondisi kesehatan DP. “Dia sakit apa dan berapa lama harus menjalani perawatan, kita belum tahu, sebab

PS. TUAN (Waspada) : Bupati Deliserdang H.Amri Tambunan dalam kunjungan kerjanya ke Kec.Percut Sei Tuan meninjau pelaksanaan gotong royong (Gotroy) massal dan penanaman pohon di Dusun XVIII Desa Saentis dan Desa Tanjungrejo serta peresmian kantor Kepala Desa Tanjungselamat, Minggu (23/5). Pada kesempatan itu bupati menyampaikan terimakasih kepada warga masyarakat serta berharap agar kebersamaan dan kekompakan yang diwujudkan dalam hal bergotong-royong agar tetap dipelihara sebagai warisan budaya nenek moyang sebagai apresiasi dalam memberikan kontribusi pembangunan. Kegiatan ini harus berkesinambungan, kata bupati, seraya mengingatkan melalui kegiatan gotong royong dan penanaman pohon merupakan pengembangan daya dukung alam. Sementara, Kepala Desa Saentis Racitno atas nama masyarakat mengucapkan terima kasih kepada bupati yang telah merespon kegiatan masyarakat dalam bergotong royong sehingga ini bisa menjadi pemicu bagi warga untuk tetap

kami belum ada menerima surat resmi dari dokter yang menangani kesehatannya,” papar Sinaga. Kalau terdakwa terus begini, berarti dia tidak menghormati proses hukum yang berjalan, hingga sangat beralasan kita meminta hakim untuk melakukan penahanan terhadap dirinnya, tegas Sinaga. Menurut Sinaga, seharusnya sebagai warga negara yang baik, terdakwa tidak mengabaikan panggilan sidang yang telah disampaikan secara resmi kepadanya. OK DP alias EP, 44, warga Jalan Kab. Perbaungan, Sergai, ditangkap atas pengaduan korban Safril Agus Taher, 50, warga Jalan Puri, Medan, ke Poltabes awal September 2009. Peristiwa berawal ketika DP datang ke rumah korban meminjam uang Rp200 juta dengan

alasan ada proyek Rp2,5 miliar yang mau dikerjakan. Karena kenal, korban memberikan uang yang dimintanya secara bertahap hingga mencapai Rp200 juta. Disebut-sebut uang tersebut digunakan untuk pengurusan tender proyek agar dananya segera cair. Ternyata setelah ditunggu-tunggu proyek yang dijanjikan tidak juga ada. Diduga, proyek tersebut fiktif, karena sewaktu korban menanyakan mana proyek yang dikerjakan, DP selalu mengelak dengan berbagai alasan. Karena masalah proyek tersebut tidak jelas, korban kemudian meminta uangnya dikembalikan, tapi DP selalu menghindar. Bahkan, ketika korban mau menyelesaikan secara kekeluargaan, tapi tidak ada titik temu, akhirnya korban melaporkan ke polisi. (h05)

Security Pertamina Tangkap Pembawa Pipa Test Unit PANGKALANSUSU (Waspada): Security PT Pertamina EP FieldPangkalansusumenangkap Se alias Ma, 59, warga Jalan Nurulhuda, Kel. Bukit Jengkol, Kec. Pangkalansusu, Minggu (23/ 5) malam karena kedapatan membawa 12 batang besi pipa didugahasilcuriandarilokasiTest Unit Pulau Panjang. Tersangka ditangkap di kawasan jembatan Desa Sei. Siur, Kec.Pangkalansusudanlangsung diserahkankeMapolseksetempat untuk menjalani proses hukum. Menurut Ka. Security, Kapten Nasbin, yang dikonfirmasi Waspada, Senin (24/5), Se, tercatat

sudah enam kali terlibat kasus pencurian. Meskipunsudahberulangkali tertangkap, lanjutnya, tapi pria berusia lebih setengah abad ini tidak juga jera. Beberapa waktu lalu, pihak perusahaan pernah merekrutnya sebagai penjaga keamanan di lingkungan rumah sakit milik Pertamina. Namun, upaya perekrutan gagal, sebab belum sebulan, Se, bekerja ia mengundurkan diri tanpa alasan jelas. “Kami sudah pernah mempekerjakan yang bersangkutan,akantetapikesempatan yang diberikan tidak dapat dipertahankan tersangka,” ujar

H. Azwar di hadapan Ka. Security. Sementara, pada hari yang sama, petugas security berhasil menggagalkan pencurian eks jalur pipa dari lokasi sumur HZ03 di kawasan Kampung Sawah, Kel. Bukit Kubu, Kec. Besitang. Dari lokasi, petugas mengamankan 18 meter pipa yang telah terpotong berikut pakain pelaku yang ditinggal kabur. Menurut, Nasbin, pipa yang hilang di lokasi jalur Kampung Sawah kurang lebih 200 meter. Ia menyatakan, sampai sejauh ini pelaku belum ada yang tertangkap. “Kita masih menyelidiki siapapelakudibalikaksipencurian aset perusahaan,” ujarnya.(a02)

Pulang Kunjungi Pacar, Tewas Dalam Balapan Liar BINJAI (Waspada) : Seorang remaja tewas dalam balapan liar di km 10, Kel. Cengkeh Turi Kec. Binjai Utara, Sabtu (22/ 5) malam. Korban, Ilham, 17, warga Pasar 1, Tandam, Kec. Hamparan Perak, Kab. Deliserdang. Dia tewas ketika sepeda motor yang dikendarainya menabrak pohon besar. Menurut rekan korban, Heri, 16, siswa SMA Kelas 2 di Binjai, kejadian berawal dari rencana keduanya untuk balapan liar usai menemui pacar di Kec. Kwala Begumit, Langkat. Keduanya bertukar sepeda motor.

Kondisi jalan licin dan akibatnya korban kehilangan kendali saat melakukan rem mendadak dan membuat sepeda motor yang dikendarai kehilangan kendali dan menabrak pohok mahoni besar di kiri jalan itu dan menghantam dadanya sehingga terpental ke sisi kanan badan jalan. Melihat kondisi demikian, rekan-rekannya yang berada dilokasi kejadian langsung memberikan pertolongan dan mengangkat korban menggunakan mobil angkot ke RSU Bidadari Binjai. Akibat pendarahan hebat pada bagian kepala

membuatnya banyak mengeluarkan darah dan tak dapat ditolong lagi oleh tenaga medis. Mulut korban korban mengeluarkan busa. Saat kejadian tidak ada satupun polisi mengetahuinya bahkan hingga jenazah korban dibawa dengan mobil ambulans ke rumah duka. Heri, rekan korban menyebutkan, hampir tiap malam dia dan kawan-kawan balapan liar di lokasi tersebut, karena tidak adanya pengawasan dari petugas kepolisian. Diakuinya, akibat balapan liar itu lebih 3 rekannya meninggal dunia. (a04)

Dengan Rp20 Ribu Per Hari Salim Bertahan Hidup LANGKAH rezeki pertemuan maut itu semuanya adalah rahasia Tuhan, tidak seorangpun yang bisa mengetahuinya. Seperti yang dialami Salim,40, warga Desa Pantai Cermin, Kec.Pantai Cermin, Kabupaten Serdang Bedagai yang sehari hariannya bekerja mencari remis di laut dengan penghasilan hanya Rp20 ribu per hari dengan anak delapan dan satu istri, tetapi masih juga bisa bertahan hidup. Salim kepada Waspada bercerita, pekerjaan itu dilakukannya karena tidak ada pekerjaan lain yang mampu dikerjakannya. Maka dengan penghasilan yang begitu sedikit, namun tetap

juga diekerjakannya. Dia sudah menggeluti pekerjaan mencari remis ini berlangsung selama empat tahun untuk menafkahi delapan orang anak dan satu orang istri. “Alhamdulillah pak, dengan rezeki yang begitu sedikit,tetapi berkah pak, masih bisa untuk memberikan kehidupan keluarga,”kata Muslim sambil menarik alat pencakar remis yang dibuat dari besi dan kawat itu. Setiap harinya Muslim mengarungi tepi pantai laut sejak mulai dari tepi pantai, Pantai Cermin hingga ke tepi pantai laut Desa Kota Pari. Bila alat pencakar remis sudah penuh berisi pasir, maka Muslim mengayakannya dengan air laut. Maka begitu diayakkan pasir turun dibawa air, sementara remis tertinggal di dalam kawat yang dianyam rapi. Setelah itu lalu remis yang ada di dalam keruntung kawat dimasukan ke tempatnya yang telah disediakan di pinggang. Setiap harinya Muslim bisa

Waspada/Husni Siregar

BERBAUR: Bupati Deliserdang Amri Tambunan berbaur dengan masyarakat, di Desa Tanjungselamat, Kec. Percut Sei Tuan, Minggu (23/5).

mendapat remis sebanyak 4 hingga 5 kilogram. Sementara harga penjualan remis yang diberikan kepada masyarakat yang ada di Pantai Cermin dengan harga Rp5 ribu per kilogram. Remis ini mirif dengan kepah, hanya saja kepah lebih besar sedangkan remis lebih kecil. Menurut masyarakat pesisir pantai, remis punya khasiat bagi manusia yang mengkonsumsinya,sebab bisa menyembuhkan penyakit rematik. Justru itu banyak warga yang memakan remis dan meminum air rebusannya yang terasa lezat dan manis. Usai mencari remis Muslim menjajakannya kepada warga yang ada di Pantai Cermin . Uang dari hasil penjualan remis itulah dibuat Muslimuntukmemberikanbiaya kehidupan bagi keluarganya. Bagaimana dengan kita yang bisa berpenghasilan Rp.50 ribu sehari, tetapi tetap juga kurang ?. Karena mungkin uang yang Rp50 ribu itu tidak ada berkah-

konsisten mendukung program GDSM. Saat melakukan peninjauan gotong royong di DesaTanjungrejo, bupati bersama rombongan disambut warga. Dan pada kesempatan tersebut bupati melakukan pengecoran planing jalan yang di kerjakan secara swadaya. Dalam peresmian kantor Kepala DesaTanjung Selamat,bupati menyerahkanpenghargaankepada para tokoh masyarakat/pengusaha pemerhati pembangunan di Desa Tanjungselamat yang dilanjutkan peninjauan stand berbagai aktivitas masyarakat antara lain pembuatan Ulos, hasil pertanian, pengelolaan susu kedelai dan lainnya. Dalam kunjungan kerja itu, bupati didampingi Asisten I M. Iqbal Nasution, Kadis Cipta Karya Donald P L Tobing, Kadis Kehutanan Arli, Kaban PMD Agus, Kadis PKD Agus Sumantri, Kabag Umum Yudi Hilmawan, Kabag Kesra Hj.Saadah, anggota DPRD DS Rahmadsyah, Ketua DPD Partai GolkarT AchmadTala’a, Ketua PMI DS H.Ismayadi serta Camat Percut SeiTuan H Syafrullah bersama Muspika dan seluruh Kades/Lurah se Kec. Percut Sei Tuan.(a05)

Polresta Binjai Ringkus Sindikat Peredaran Upal BINJAI (Waspada) : Polresta Binjai meringkus 5 anggota sindikat pengedar uang palsu dari Jawa Barat, di Kec. Binjai Selatan, Kamis, pekan lalu. Ketiga tersangka RY, 33, warga Jalan Sodiq RT,01/02, Kel. Isola, Kec. Sukasari, Bandung Barat, yang pernah tinggal di Panton Labu, Aceh, GH, 30, warga Kampung Legok, Desa Lembang, Kec. Lembang, Bandung Barat danW, 25, warga Desa Cikole, Kec. Lembang, Bandung Barat. Sementara yang diringkus di Bandung di antaranya MAF, 30, warga Kampung Babakan, Desa Sukamaju, RT 02/03, Kec. Cimaung, Kab. Bandung, adalah merupakan dalang peredaran Upal tersebut beserta AG, 38, warga Kampung Cipurut Ngora, Kab. Garut pemilik mesin cetak sekaligus mencetak upal. Keduanya diringkus petugas Polresta Binjai, Jum’at (21/5). Hal tersebut dikatakan Kapolresta Binjai AKBP Rina Sari Ginting didampingi, Kasat Reskrim AKP M. Adenan AS, dan Kanit Jahtanras Ipda Bambang Tarigan, Senin (24/5). Kelima tersangka dijerat Pasal 244 subs 245 KUH Pidana, menyimpan, memiliki, mengedarkan uang palsu dengan ancaman hukuman 15 tahun penjara. Barang bukti yang disita Polisi di antaranya uang palsu tukaran Rp 100 ribu 900 lembar, 1

unit mobil Avanza D 1303 UM, yang digunakan mereka membawa uang palsu tersebut dan alat mencetak di antaranya 1 set computer, satu unit printer, 5 spray gun, 5 blok kertas HVS warna putih, satu pengering ramkbut, 2 lampu neon/ TL, 10 kotak cutter, 3 mistar/penggaris logam. 6 botol tinta warna, satu unit air compresor, 12 buah selo tape, satu unit flash disk dan 1 buah stempel air serta 1 kaleng lem, alat cetak uang palsu. Semuanya disita dari Bandung, Provinsi Jawa Barat dibantu Unit Jahtanras Polres Bandung Barat. Upal tersebut menurut Kapolresta akan diedarkan Provinsi Aceh. Ditambahkan Kapolresta, terbongkarnya sindikat peredaran upal tersebut, ketika Polresta Binjai, menerima informasi di Jalan Sibolga, Pekan Rambung, Kec. Binjai Selatan ada satu unit mobil Avanza diduga membawa upal. RY, kepada wartawan mengaku uang palsu tersebut akan dibawa ke Panton Labu, Aceh untuk diserahkan kepada H ditukar shabu-shabu, namun belum diserakan padahal sudah diberi panjar Rp 40 juta upal katanya. Sementara, menurut AG yang pernah kuliah setahun di Atlanta, Amerika dan pernah juga berkerja di Korea dan Jepang, perbedaan upal yangdicetaknyadenganuangasli,kalaudicelupkan ke air luntur sedangkan uang asli tidak.(a04)

Kejari Sidik Dana Perparkiran T. Tinggi TEBINGTINGGI (Waspada): Kejaksaan Negeri (Kejari) Kota Tebingtinggi menyidik dana perparkiran di Kota Tebingtinggi. Penyidikan sehubungan pengaduan masyarakat tentang dugaan penyimpangan reduksi sehingga memperkaya pengelola. Kasi Pidana Khusus (Kasi Pidsus) Kejari Kota Tebingtinggi Mhd. ZulfanTanjung, SH, Senin (24/ 5), membenarkan soal itu. Dikatakannya, saat ini tahap meminta berkas-berkas terkait perparkiran di Dinas Perhubungan sebagai instansi yang bertanggungjawab. Langkah itu dilakukan, menyikapi ada pengaduan lisan dari masyarakat soal dugaan ketidakberesan pengelolaan dana perparkiran selama ini, kata dia. Terkait masalah itu, sumber di Dinas Perhubungan, mengatakan, memang ada hal yang tak wajar dalam pengelolaan perparkiran selama ini. Dikatakan, dana parkir yang masuk ke Kas Pemko Tebingtinggi dan menjadi sumber Pendapatan Asli Daerah (PAD) 2010 hanya Rp235 juta. Jumlah itu, ungkap sumber, diambil dari hari kerja selama 210 hari per tahun minus Minggu. Sehingga, hari hari libur tidak ada pemasukan dana perparkiran. Namun, faktanya di lapangan, pengutipan parkir berlangsung setiap hari tanpa ada jeda. Sehingga pemasukan dana perparkiran berlangsung setahun penuh. “Kalau begitu, yang 55 hari itu siapa yang makan duitnya,” ungkap sumber. Jadi wajar jika Kejari melakukan pemeriksaan terhadap dugaan penyimpangan dana itu, tegas

sumber. Sumberjugamenyesalkanrendahnyaretribusi parkir untuk PAD Kota Tebingtinggi selama ini. Padahal, melihat potensi yang ada, pendapatan dari retribusi parkir bisa mencapai Rp1 miliar pertahun. “Daripendapatandijalan-jalanprotokol, seperti KH.A. Dahlan, Pattimura. MT Haryono, Thamrin, Suprapto, KF Tandean, Iskandar Muda saja, bisa mencapai Rp2 juta per hari,” kata sumber. Itu artinya, ungkap dia, dari pendapatan parkir di jalan utama saja, total per tahunnya melebihi masukan PAD yang hanya Rp235 juta. Belum lagi pada jalan lainnya, tegas dia. Selain itu, sumber juga menyebutkan adanya monopoli dalam penanganan perparkiran yang berlangsung hingga belasan tahun. Ada keluarga pejabat publik yang kaya-raya dari hanya mengelola parkir. “Sudah diketahui umum, parkir itu jadi milik pribadi,” keluh sumber. Kadis Perhubungan Postel Nainggolan, SH, saat dikonfirmasi, mengatakan, pengelolaan parkir itu berat. Sehingga setiap tahun perparkiran ditenderkan kepada swasta. Dia, menampik kemampuan Pemko Tebingtinggi dalam mengelola perparkiran. Alasannya, dulu di masa Walikota Hj., Rohani Darus Daniel, SH pernah dilakukan uji coba mengelola perparkiran, tapi gagal. Sejak itu, pengelolaan perparkiran diserahkan ke pihak swasta. Namun, Postel, enggan berkomentar kenapa pendapatan parkir sangat rendah jika dibanding potensinya. Demikian pula dengan pengelola swastayangsejakbelasantahuntakpernahberubah orangnya.(a08)

Perumahan Tanpa IMB Terus Berjalan Waspada/Eddi Gultom

MENCAKAR REMIS: Muslim,40, warga Desa Pantai Cermin, Kab.Serdang Bedagai yang setiap harinya mencari remis dengan penghasilan Rp.20 ribu/hari bisa menghidupi delapan orang anaknya dan satu orang istri. Gambar ini direkam di tepi obyek Wisata Gudang Garam, Pantai Cermin, Kamis (20/5). nya. Untuk mengetahui bagai mana membuat uang itu agar berkah mari kita belajar kepada Muslim dengan pendapatan

Rp20 ribu per hari bisa menafkahi delapan orang anak dan satu orang istri. Eddi Gultom

TEBINGTINGGI (Waspada): Pembangunan perumahan di kawasan Jalan Ir. H. Juanda, Kel. Tanjung Marulak, Kec. Rambutan Tebingtinggi terus berjalan meski beklum memiliki Izin Mendirikan Bangunan (IMB). Berdasarkan pantauan, pembangunan perumahan tersebut dibangunan tembok seng dan batu di sekelilingnya. Satu unit bangunan dalam pengerjaan pembuatan dinding.Tak terlihat plang IMB di komplek perumahan tersebut. KepalaKantorPelayananPerizinanTebingtinggi ketika dikonfirmasi melalui petugas perizinan bangunan Hendro Susanto, mengatakan, izin bangunan perumahan yang terletak di Jalan Ir Juanda masih dalam proses pengurusan. Namun, katanya, seharus sebagaimana peraturan izin harus lebih dulu ada, barulah pem-

bangunan dapat dikerjakan. “Memang ada yang sudah datang mengurus izin, apakah bisa mendapatkan izin atau tidak, prosesnya masih di Dinas PU,” ujarnya . Terkait hal itu, Arya Prahasta, pegawai lainnya menambahkanterkaitpembangunanperumahan tersebut ada pengembang lain yang komplain kepadanya karena gambar konstruksi bangunan perumahan tersebut sama persis dengan perumahan yang ada di BagelenTebingtinggi. “Hanya beda tipenya saja,” ucap Arya. Kasat Pol PP Tebingtinggi, Drs. Djyardi ketika dikonfirmasi akan meninjau bangunan tersebut. Pertama, katanya, kita periksa izinnya, kalau memang sudah ada silahkan dilanjutkan, namun kalau tidak akan kita berikan tindakan, baik berupa peringatan ataupun penghentian. (a09)


C2

Sumatera Utara

WASPADA Selasa 25 Mei 2010

Polres L. Batu Tangkap 2 Perampok Dari Kandis Riau

Kesbang Politik Dan Linmas L. Batu Latih 3.216 PAM Pemilukada

RANTAUPRAPAT (Waspada): Dua perampok ditangkap di Kandis, Kab. Siak, Provinsi Riau, Sabtu (22/5) dini hari. Kedua pria berbadan kurus itu digelandang tim Reserse Uni Kejahahatan dan Kekerasan (Jahtanras) Polres Labuhanbatu ke Rantauprapat dan tiba Minggu (23/5) sore menjalang malam. “Hasil penyelidikan, setelah merampok mereka lari ke Kandis, Riau,” kata Kapolres Labuhanbtau AKBP Robert Kennedy melalui Kasar Reskrim AKP M Taufik dan Kanit Jahtanras Aiptu TR Sitompul, Minggu malam di Mapolres Labuhanbatu Jalan MH Thamrin Rantauprapat. Kedua tersangka, LTN, 28, warga Dusun Sei Tualang, Kec. Aekkuo danASaliasUcok,22,wargaPamingke,Kec.Aeknatas,Kab.Labuhanbatu Utara (Labura). Kedua tersangka melalukan pencurian dengan kekerasan bersama temannya LD (tertangkap saat kejadian) terhadap korban Dormauli br Panjaitan, 21, karyawan Kebun Aek Korsik PT Torganda, 12 Mei 2010 sekira pukul 20:30 di jalan lintas Afdeling 1 Kebun Aek Korsik PT Torganda. TR Sitompul menjelaskan, kejadian bermula dari rencana ketiga tersangka pelaku yang telah sengaja mengintai calon korban di jalan lintas kawasan perkebunan kelapa sawit PT Torganda. Malam itu, korban Daormauli br Panjaitan melintas mengendarai sepeda motor Honda Revo warna merah dan distop ketiga pelaku. Korban terus saja lewat, lalu dikejar penjahat itu kemudian dipepet. “Korban berhenti dan diancam dicampakkan ke parit. Setelah itu ketiga pelaku merampas sepeda motor korban, lalu kabur membawa sepeda motor korban. Korban pun minta tolong dan menangis,” kata TR Sitompul, menyebut korban malam itu juga melapor ke Polsek Aeknatas di Pamingke. (a26)

RANTAUPRAPAT (Waspada): Dalam rangka pengamanan Pemilu Kada Kabupaten Labuhanbatu pada 16 Juni mendatang, Badan Kesbang Politik dan Linmas L.Batu menggelar pelatihan terhadap 3.216 petugas pengamanan (PAM) untuk seluruh 9 kecamatan, mulai Senin (24/5) di Stadion Binaraga Rantauprapat. Kepala Badan Kesbang Politik dan Linmas L.Batu Nilwansyah, SH kepada wartawan, di sela-sela pelatihan menjelaskan, personil yang dilibatkan dua bagian yaitu, Pengamanan Langsung (Pam Sung) yang langsung ditugaskan di TPS-TPS dan Pengamanan Tak Langsung (Pam Tak Sung) sebagai tenaga cadangan di desa/kelurahan dan kecamatan. Jumlah personil Pam Sung yang dilibatkan 1.716 orang dan Pam Tak Sung 1.250. PAM yang dibawah kendali operasi (BKO)kan ke Polres L.Batu 150 orang dan yang di BKO-kan ke Pemkab L.Batu 100 orang. Tujuan pelatihan adalah untuk mempersiapkan tenaga-tenaga PAM di TPS secara profesional, tegas, dan tanggap terhadap permasalahan di TPS-TPS tempat personil ditugaskan. Demikian juga dengan PAM Tak Sung dengan pelatihan ini diharapkan dapat mememahami tugas-tugasnya dimana mereka di BKO-kan. Jadwal pelatihan PAM Pemilu Kada untuk 9 kecamatan di seluruh L.Batu itu dimulai Senin, 24 Mei sampai Rabu, 2 Juni 2010. Personil PAM yang dilatih pada hari itu berasal dari Kecamatan Rantau Utara dan Rantau Selatan. Nilwansyah menyampaikan, tim instruktur/pelatih langsung berasal dari dari Polres L.Batu yaitu, Kabag Bina Mitra Nainggolan dan personil dari Polres L.Batu lainnya serta dibantu seluruh staf Kesbang, Politik dan Linmas. (a27/c01)

Jangan Buat Masyarakat Batubara Terkotak-kotak LIMAPULUH (Waspada): Pemkab Batubara diminta tidak membiarkan persoalan P.APBD 2009 dan APBD 2010 berlarut larut. DemikianKetuaDPCPartaiIndonesiaSejahtera(PIS)Kab.Batubara Zainuddin kepada Waspada, Sabtu (22/5) menyikapi perkembangan persoalanAPBDBatubarayangsemakintidakjelas.“Kitamenginginkan Batubara berjalan apa adanya, tidak karna ondak copat lalu menerabas aturan. Dalam setiap pengambilan keputusan dan kebijakan tentunya sudah ada aturan mainnya, ya diikutilah,” ujarnya. Masalah APBD kini menjadi perbincangan hangat tidak saja di Batubara bahkan sampai ke berbagai daerah. Hal ini disebabkan para rekanan yang sedianya turut serta dalam proses tender khawatir dengan keberadaan anggaran yang tersedia di kas Pemkab. Apalagi anggaran Bantuan Daerah Bawahan (DBD) yang diketahui terancam tidak turun sebab APBD belum disahkan gubernur. (a31)

Ribuan Kaum Ibu Banjiri Tabligh Akbar PKS L. Batu RANTAUPRAPAT (Waspada): Ribuan kaum ibu dari berbagai kelompok perwiridan dari Kecamatan Rantau Utara, Rantau Selatan, Bilah Hulu dan Bilah Barat, Kabupaten Labuhanbatu membanjiri Tabligh Akbar DPD Partai Keadilan Sejahtera (PKS) L.Batu di Gedung Nasional Rantauprapat, Minggu (24/5). Pengamatan Waspada, kapasitas Gedung Nasional Rantauprapat yang hanya sekitar 500 orang tersebut tampak tumpah ruah karena disesaki oleh pengunjung yang jumlahnya dua kali lipat kapasitas gedung tersebut. Akibatnya, sebagian kaum ibu duduk hingga dekat podium gedung dan sebagian mengambil tempat duduk di luar gedung. Sekretaris Umum DPD PKS L.Batu Ahmad Mulkan, SPdI di sela-sela kegiatan, kepada Waspada mengatakan, tabligh akbar itu merupakan agenda rutin PKS. Pada saat yang sama, tambah Mulkan, PKS L.Batu juga melaksanakan bakti sosial berupa pembagian sembako kepada warga kurang mampu di Dusun Tebangan, Desa Janji, Kec. Bilah Barat. Sebulan lalu, PKS L.Batu juga melaksanakan bakti sosial serupa di Kec. Panai Hilir, pengobatan gratis dengan bekam di Aek Nabara, Kec. Bilah Hulu, apel siaga Pilkada PKS dan khitanan massal di Sekretariat DPD PKS L.Batu Jl Siringo-ringo, Rantauprapat. (a27)

Lonsum Kebun Sei Rumbiya Gelar Pengobatan Gratis KOTAPINANG (Waspada): Program Lonsum Peduli kesehatan di Kebun Sei.Rumbiya, kedua kalinya dilaksanakan, pengobatan gratis ini diperioritaskan untuk masyarakat di sekitar kebun, atau masyarakat di kebun Sei Rumbiya tetapi yang bukan tanggungan perusahaan. Demikian Ir HM Yusnan Effendy Hasibuan, Manajer Lonsum Kebyn Sei Rumbiya, saat berlangsung pengobatan gratis Sabtu (22/ 5) di Balai Karyawan Divisi-I Kebon Sei Rumbiya, Desa Sei Rumbiya Kec. Kotapinang Labuhanbatu Selatan. Masyarakat mendapat pengobatan yakni ibu dan anak balita, sedangkan pemeriksaan kesehatan ibu hamil dengan USG (Ultra Sanografi), HB (Haemoglobin), Vital Sign serta pemeriksaan kadar gula darah, dan setiap ibu diberi susu, vitamin. Tenaga medis yakni dr Ichwan, SpOG (spesialist kandungan), dr S.Sianipar, dr Rahim Hadriadi dan sejumlah perawat sedangkan Tim dari CSR Syamsul Bahri. (c05)

Gapeknas Labura Dukung Syamsul Matondang AEKKANOPAN (Waspada) : Musyawarah kabupaten (MuskabI) Kadin Labuhanbatu Utara yang digelar di kantor Kelurahan Gunting Saga Kecamatan Kualuh Selatan Kabupaten Labuhanbatu Utara Rabu (19/5) pekan lalu berakhir ricuh dan ditunda sampai batas waktu yang tidak ditentukan RicuhnyaMuskabItidakberhubungandengansubstansipermasalahan tata tertib Muskab-I Kadin Labuhanbatu Utara,tetapi hanya permasalahan yang bersifat pribadi antar oknum-oknum tertentu yang mencuat di Muskab. Muskab-I Kadin Labuhanbatu Utara yang berlangsung pekan laludinilaibeberapakalangansudahsepantasnyamenetapkanSyamsul Matondang sebagai Ketua Kadin Labuhanbatu Utara periode 20102015,sebab selain berfotensi beliau juga dianggap telah memenuhi persyaratan yang ditentukan bahkan tercatat sebagai calon tunggal pada Muskab yang digelar. Penilaian dikatakankan Ketua Gabungan Pengusaha Kontruksi Nasional (Gabpeknas) Labuhanbatu Utara Arly Simangunsong pada Waspada, Minggu (23/5) menanggapi kondisi Kadin Labuhanbatu Utara yang belum juga jelas. Arly Simangunsong merupakan salah seorang pimpinan sidang Muskab-I Kadin Labuhanbatu Utara, juga meminta agar Ketua Kadin Sumatera Utara bersikaf arif dan bijaksana serta mengambil sikap tegas untuk menetapkan Syamsul Matondang sebagai Ketua Kadin Labura serta menuntaskan semua permasalahan di tubuh kadin Labuhanbatu Utara yang baru terbentuk ini agar tidak menjadi preseden buruk terhadap kredibilitas Kadin. (csi)

Hentikan Tindakan PHK Sepihak LIMAPULUH (Waspada): Perusahaan perkebunan diminta tidak sewenang-wenang melakukan Pemutusan Hubungan Kerja (PHK) terhadap karyawan. Apalagi diantara mereka sudah bekerja tahunan. ‘’Negara kita negara hukum dan tidak zamannya lagi otoriter. Niat perusahaan melakukan PHK secara sewenang-wenang agar dihentikan,’’ kata Wakil Ketua DPRD Batubara Asmadinata saat menerima empat delegasi mewakili 11 pekerja permanen kelapa sawit asal Talawi yang terancam PHK di DPRD Batubara, Senin (24/5). Sedangkan Dinas Tenaga Kerja (Disnaker), pintanya, untuk mendata sekaligus mendaftarkan setiap pekerja baik di perusahaan skala besar (PT) maupun kebun pribadi agar hak mereka terasa dilindungi. Dalam pertemuan terungkap diantara buruh ada yang bekerja puluhan tahun dan tetap dibayar sistem borongan. Begitu juga memberhentikan pekerja dan mengantikan kepada yang lain.

Waspada/Armansyah Abdi

PELATIHAN: PAM Pemilu Kada L.Batu sedang mendapat pelatihan dari personil Polres L.Batu di Stadion Bina Raga Rantauprapat.

Kapal Kargo Tenggelam Di Perairan Malaysia TANJUNGBALAI (Waspada): Kapal kargo berbahan kayu, KM Camar Robinson, tenggelam di perairan Malaysia, Sabtu (22/5) dinihari. Laporan sementara, tidak ada korban jiwa dalam peristiwa itu. Akan tetapi, sampai hari ini, pihak agen pelayaran, PT Dewata Samudera Agung Perkasa, belum melaporkan kejadian itu

secara resmi kepada Administrasi Pelabuhan Teluknibung, Kota Tanjungbalai. Kejadian itu bermula ketika kapal yang membawa berbagai jenis barang untuk dikirim ke Malaysia itu, berangkat dari pelabuhan Teluknibung, Kota Tanjungbalai. Sesampainya di lokasi kejadian, tiba-tiba kapal dihantam ombak, sehingga terbawa gelombang laut sangat tinggi, dan akhirnya tenggelam bersama muatannya. Sementara, nakhoda dan

ABK, menyelamatkan diri dibantu kapal yang melintas di sekitar lokasi kejadian. Informasi sementara, para awak kapal itu masih berada di Malaysia, dan sedang menanti proses pemulangan ke tanah air. Pelaksana Kakan Adpel Teluknibung, Thamrin, semula mengaku tidak mengetahui kejadian itu, karena belum menerima laporan resmi dari agen pelayaran. “ Aku tidak tahu, belum ada laporan resminya

kemari, cari saja laporannya di luar,” ujar Thamrin melalui saluran telefon, Senin (24/5). Akan tetapi, saat ditemui di kantornya, Thamrin meralat keterangannya tersebut. “Kejadian itu memang ada, tapi laporan resminya belum sampai kemari,” ujar Thamrin. Menurut Thamrin, pihaknya baru bisa memproses kasus itu setelah ada laporan resmi. “Laporan resminya belum ada, nanti kujelaskan,” ujar Thamrin.(a37)

Isu Santet Merebak, Warga Aniaya Dan Rusak Mobil AEKKANOPAN (Waspada) : Diisukan memiliki ilmu santet, Bangun Hasibuan, 32, warga DusunKongsiEnam,DesaTerang Bulan, Kecamatan Aeknatas, Labuhanbatu Utara dianiaya warga. Sementara satu unit mobil kijang kapsul milik Mahmudin Munthe,39,yangdiparkirdidepan rumahnya ikut dirusak dan nyaris dibakar warga Minggu (23/5) sekira pukul 22:30. Atas kejadian itu Bangun HasibuandidampingiMahmudin Munthe membuat pengaduan kePolsekAeknatasataspenganiayaan dan perusakan. Keterangan dihimpun menyebutkan, kejadian berawal dari penganiayaan yang dilakukan

Suroto, warga Lingkungan Suka Maju, Aeknatas terhadap Bangun Hasibuandilokasi pertambangan galian C di Desa Terang Bulan. Diduga penganiayaan itu akibat persaingan bisnis. Tidak terima atas penganiayaanituselanjutnyaBangunHasibuan mengadukan Su ke Polsek Aeknatas, namun pengaduan yangdilakukanBangunHasibuan memancing amarah Su yang disebut-sebut karyawan pesaing bisnis korban. Selanjutnya Su bersama tiga temannya Ds,Ms, dan Ds merupakan kakak beradik adalah anak dari pesaing bisnis dari korban mempengaruhi puluhan warga yang berada di lokasi ke-

jadian menganiaya korban dengan dalih korban mempunyai ilmu santet. Puluhan warga yang terpengaruh dengan ilmu santet mendatangi rumah korban dan langsungmerusaksatuunitmobil kijangkapsulBM1514LCdidepan rumahkorbansetelahmelakukan perusakan selanjutnya Su bersama tiga temannya melarikan diri. Malam itu juga Kapolres Labuhanbatu AKBP Robert Kennedy didampingi Kapolsek Aeknatas AKP J Panjaitan Kasat Reskrim dan Kanit Jahtanras turun ke lokasi mengantisipasi agar masyarakat tidak melakukan tindakan anarkis.

Kapolsek Aeknatas AKP J Panjaitan ketika dikonfirmasi membenarkanadanyaperusakan mobil yang dilakukan warga. Kasusnya sudah ditangani dan barang bukti berupa satu unit mobil kijang Kapsul sudah diamankan. Sementara Camat Aeknatas HarrisTopan Hasibuan SH, Senin (24/5) mengharapkan tokoh agama dan tokoh masyarakat dapat membantu mendinginkan situasi sekaligus mengintrusikan lurah dan kepala desa agar menyampaikan kepada masyarakat supaya tidak mudah termakan isu santet atau isu lainnya yang dapat menyesatkan warga. (csi)

Usut Penyimpangan Pengadaan Sarana Dan Prasarana Pelabuhan Teluk Nibung TANJUNGBALAI (Waspada): Badan Pemeriksa Keuangan (BPK)PerwakilanSumut,diminta mengusutdugaanpenyimpangan kegiatan pengadaan sarana dan prasarana terminal penumpang Pelabuhan Teluk Nibung, Kota Tanjungbalai. Dugaan penyimpangan proyek senilai ratusan juta rupiah itu, yakni pelanggaran Keppres No. 80 Tahun 2003. Pelanggarannya, kegiatan dilaksanakan sebelum APBD 2010 disahkan DPRD setempat. “BPK harus mengusut tuntas

dugaan penyimpangan berupa pelanggaran Keppres No. 80 Tahun 2003 dalam kegiatan pengadaan sarana dan prasarana PelabuhanTelukNibung,”tegasaktivis LSM Kota Tanjungbalai, AE Sibarani kepada Waspada, Senin (24/ 5). Selainitu,lanjutSibarani,BPK, Inspektorat Kota juga perlu memeriksa kegiatan itu, dan hasilnya ditindaklanjuti ke aparat hukum, seperti Kejaksaan Negeri maupun Kejaksaan Tinggi Sumut. “Mengerjakan proyek yang anggarannya belum disahkan,

jelas pelanggaran hukum, karena sifatnya bukan darurat, apalagi wajib,” tukas Sibarani. Menurut Sibarani, jika kasus ini tidak ditindaklanjuti dengan ketegasan, sama artinya pelanggaran hukum dibiarkan terjadi di Kota Tanjungbalai, sehingga kasus serupa bakal terulang kembali. Wakil Ketua DPRD KotaTanjungbalai,SuryaDarmaARmengimbau agar Pemko Tanjungbalai tidak mencairkan dana anggaran untuk pengadaan sarana dan prasana terminal penumpang

“Sayamenimbailmudinegeri orang(Malaysia),setelah13tahun menunggu baru dapat memulai usaha mengolah ‘batako’ ini,” cerita Hasanuddin alias Karnes, warga Desa Padang Genting, Kec. Talawi Kab.Batubara, Jumat (21/ 5). Menurut Hasanuddin, selama ini dia mengaku kerja serabutandantahun1991melayarkan nasibberangkatkeMalaysiamencari pekerjaan, kebetulan ditampungbekerjadiperusahaanpembuatan ‘batu semen’ (batako) untuk bahan bangunan rumah. Sejak bekerja membuat batako disana timbul niat ingin mempelajari mengumpul ilmu lebih mendalam, bila mungkin nanti

Ilmu ditimba sudahlah penuh, tetapi bagaimana syarat utama diperlukan ‘modal’ dan sejak itu dia terus berjuang mengumpul modal tetapi tidak berhasil. Tahun 1993 dia pulang ke kampung membawa pulang sebuah alat cetak membuat batako tersebut. Ternyata usaha mencari modal cukup sulit dan dua tahun kemudian kembali ke Malaysia sampai tahun 2000, itupun tidak membawa hasil terpaksa bekerja sebagai sopir mobil rental di kampung. Namun semangat untuk membuat usaha batako dengan bahan pasir dan semen itu tidak padam, baru jadi kenyataan di awal 2006 berangsur-angsur memulai usaha tersebut. “Walaupun modal paspasan,pengolahan batako dapat beroperasi bisamerekrut 6 tenaga kerja putera kampung sendiri,” ujar Karnes, panggilan namanya sehari-hari di kampung tersebut. Untukmemulaiusahabatako minimal diperlukan modal minimal Rp 20 sampai Rp25 juta dengan produksi 2.000-2.500 batako per hari bila yang bekerja 3 orang. Produksibertambahkalaubanyak pemesan ka rena batako Karnes

MEDAN (Waspada): Imbang Tua Siregar, salah seorang wartawan media cetak terbitan Tanjungbalai, korban kekerasan karena memberitakan kasus dugaan korupsi dana MTQ korupsi di Pemko Tanjungbalai, mendatangi Pengadilan Tinggi Medan, Senin (24/5). Kedatangannya melaporkan dua majelis hakim PN Kota Tanjung Balai. “Saya melaporkan hakim Djoni Iswantoro, SH dan As’ad Rahim Lubis, SH karena menvonis bebaskan Lurah Karya Baharuddin Sinaga salah seorang terdakwa intelektual yang menyuruh menyiramkan asam sulfat ke wajahnya, hingga cacat pada muka dan sekujur tubuh korban, “ katanya usai melapor ke PT Medan. Kata Siregar, kejadian 16 Januari 2009, saat itu, dirinya melintasi kawasan Jalan Sudirman, tapi, tiba-tiba disiram oleh ketiga terdakwa Syaffi, Adil Sinaga (DPO), dan Syamsul Sinaga.” Ketiganya melakukan aksi kekerasan itu diduga disuruh terdakwa Baharudiin Sinaga,” tegasnya. Dalam proses persidangan, majelis hakim membebaskan terdakwa Baharuddin Sinaga. “Saya tidak terima dengan putusan bebas tersebut,” kata Imbang Tua Siregar. “Ini saya datang ke Pengadilan Tinggi Medan untuk melaporkan hakim yang membebaskan terdakwa itu. Tadi saya diterima Humas PT Sumatera Utara, Yohanes E Binti SH MHum,” tegas Siregar. Dijelaskannya, untuk tiga terdakwa M.Syaffi dan Syamsul Sinaga divonis masing-masing 11 tahun penjara. Sedangkan Dahniel Kabag Umum Pemko Tanjungbalai yang dinilai membiayai tindak kekerasan itu divonis 12 tahun penjara. Sementara itu, Humas PT Sumut, Yohanes mengatakan, pihaknya akan mempelajari kasus tersebut. Bila ada ditemukan ada kesalahan penindakannya diserahkan kepada Mahkamah Agung.(h05)

Waspada/Hasanuddin

BERJABAT TANGAN: Said Al-Idrus berjabat tangan dengan Imam Syahraini Siregar saat menerima SK pengurus HIPMI Labusel.

Imam Syahraini Siregar Ketua HIPMI Labusel

PelabuhanTeluk Nibung. Imbauan itu muncul karena kegiatan yang dilaksanakan Dinas Perhubungan Kota Tanjungbalai ini, diduga melanggar Keppres No. 80 Tahun 2003. Menurut Surya, Keppres No. 80Tahun 2003 tentang pedoman pengadaan barang dan jasa, kegiatan yang berasal dari dana APBD, tidak dibenarkan dikerjakan sebelum APBD disahkan, kecuali sifatnya mendesak atau wajib, seperti gaji pegawai, kesehatan dan bencana. (a37)

Pengalaman Di Malaysia Mengolah ‘Batako’ Di Batubara UNTUK mencapai cita-cita bukan mudah, harus dibarengi tekad, semangat tinggi pantang menyerah disertai kesabaran pengendalian diri. “Kalau kita tidak sabar, ingin cepat berhasil tanpa didukung persyaratan diperlukan akan menemui kegagalan.

Wartawan Korban Kekerasan Laporkan Dua Hakim PN T. Balai Ke PT Medan

KOTAPINANG(Waspada):HimpunanPengusahaMudaIndonesia (HIPMI) senantiasa siap bermitra dengan pemerintah, maupun pihak swasta, mendukung pelaksanaaan pembangunan dari segala sektor dan bekerja sama dengan perbankan untuk permodalan bagi Usaha Kecil Menengah (UKM) guna untuk mengembangkan serta meningkatkan usaha yang berpotensi di berbagai daerah terutama di Labuhanbatu Selatan. HIPMI didirikan 10 juni 1972 dan telah berdiri di 33 provinsi, memiliki 274 Badan Pengurus Cabang. Hingga saat ini jumlah anggota HIPMI di seluruh Indonesia 25.000 pengusaha mayoritas bergerak di sektor UKM. Organisasi HIPMI bukan tipe minta proyek tetapi melahirkan proyek dan menciptakan lapangan kerja di tengah masyarakat. Hal ini dikatakan Said AL Idrus, Ketua Badan Pengurus Daerah (BPD-HIPMI) Provsu saat melantik Badan Pengurus Cabang (BPC) HIPMI Labuhanbatu Selatan (Labusel) masa bhakti 2010-2013, di Restoran Jl. Bedagai Kotapinang, kemarin, dihadiri Ketua DPRD Labusel Fery Andhika Dalimunthe, Sekdakab Labusel H.Abd Rajab Pasaribu, Kapolsekta Kotapinang AKP Eduwar, Kadis Perindustrian Perdagangan H.Bahrum. Sekdakab Labusel Drs H Abd Rajab Pasaribu MM mengatakan, Labusel baru dimekarkan ini memerlukan kepemimpinan terutama di dalam sektor pembangunan perekonomian. Dengan terbentuknya HIPMI di Labusel ini, senantiasa bekerjasama dengan Pemkab untuk membangun Labusel. Pemekaran itu bukan seperti memakan cabai, saat dimakan langsung terasa pedasnya, perjuangan pemekaran ini merupakan perjuangan panjang. Tidak tertutup kemungkinan yang akan merasakan pemekaran ini adalah anak-anak cucu. Pengurus HIPMI yang dilantik Imam Syahraini Siregar sebagai Ketua, Yusuf Sekretaris, dan Muslim Nasution sebagai Bendahara dilengkapi bidang-bidang 47 orang. (c05)

Kantor Bupati L. Batu Didemo HMI Waspada/Helmy Has

PENGOLAHAN BATAKO: Bermula mencari pengalaman di Malaysia, berkat semangat tinggi serta kesabaran baru menjadi kenyataan dapat membangun usaha batako setelah 13 tahun. Hasanuddin alias Karnes dengan dua pekerja sedang menyusun batako siap cetak di halaman rumahnya di Padang Genting, Kamis (20/5). transport. Sistem upah, sebut Karnes, pekerjaan borongan dengan gaji bervariasi Rp40.000 sampai Rp75.000 per hari sesuai pekerjaannya. Bahkan gaji bertambah kalau produksi tambah banyak. Walau hanya bermodalkan semangat, bisa membantu 6 war

satunya di desa Padang Genting tersebut. “Kalau memungkinkan diharapkan bantuan modal dari Pemkab Batubara c/q Koperindag Batubara untuk pengembangan usaha sebagai salah satu tujuan mensejahterakan masyarakat sesuai slogan ‘sejahtera

RANTAUPRAPAT (Waspada): Puluhan masa kader Himpunan Mahasiswa Islam (HMI) Cabang Labuhanbatu mendatangi Kantor Bupati, Jumat (21/5) pagi menuntut Bupati Labuhanbatu segera mengaktifkan Pasar Glugur dan Terminal Padangbulan. Pasalnya menurut HMI hingga kini Terminal Padangbulan dan Pasar Glugur terkesan terkendala akibat lambatnya pengoperasian dua objek vital sarana daerah tersebut. Apalagi kesan mandeknya pembangunan selama 10 tahun tercermin dari belum beroperasinya sarana umum ini. Tidak hanya itu, masa HMI juga mendesak agar bupati segera menuntaskan persoalan sampah yang terus menghantui Kota Rantauprapat yang tak kunjung terbebas dari tumpukan sampah yang berada di pinggir jalan. “ManfaatkanTerminal Padangbulan dan Pasar Glugur secepatnya, danLabuhanbatubukankotasempah,tuntaskanlahmasalahsampah, aplikasikan tuntutan kami,” kata Said selaku orator aksi. Sementara itu, ketika aksi demo berlangsung Buapti Labuhanbatu sendiri tidak berada di kantornya, dan tidak ada satu pun pejabat Pemkab Labuhanbatu yang bersedia menemui para demonstran.


Ekonomi & Bisnis

WASPADA Selasa 25 Mei 2010

Krisis Eropa Bisa Gerogoti Kinerja Ekspor RI JAKARTA (Waspada): Men-teri Perdagangan Mari Elka Pangestu mengungkapkan hingga kini pemulihan ekonomi Eropa belum terjadi secara pe-nuh. Sehingga potensi adanya krisis Eropa terhadap kinerja ekspor Indonesia ke Eropa masih berpotensi berdampak, meski tidak akan secara signifikan. Menurut Mari, justru negara yang patut sangat waspada adalah China, terkait krisis Eropa saat ini. Mengingat ketergantungan ekspor China ke Eropa mencapai 30 persen dari total ekspor negeri tirai bambu tersebut. “Kalau kita kan 11 persen, ketergantungan kita, ke pasar Eropa tak sebesar seperti RRT (China),” kata Mari di acara raker gabungan dengan Komisi VI DPR-RI, di Gedung DPR, Senayan, Jakarta, Senin (24/5). Dikatakan Mari, meski ketergantungan ekspor Indonesia ke Eropa tidak signifikan, namun dikhawatirkan dampak

krisis Eropa bisa mempengaruhi ekonomi dunia secara keseluruhan. Hal ini tentunya jika terjadi pasti akan mempengaruhi ekspor negara-negara lain termasuk Indonesia. “Dampak apa yang terjadi di Eropa terhadap perekonomian dunia tentunya itu yang kita waspadai dan antisipasi,” jelas Mari. Negara-negara Eropa khususnya Irlandia, Yunani, Spanyol, dan Portugal saat ini mengalami krisis defisit anggaran yang besar. Dikhawatirkan krisis itu ini merembet ke negara lainnya khususnya Uni Eropa, dan dikhawatirkan mempengaruhi ekonomi dunia secara keseluruhan. Mantan Kepala Badan Kebijakan Fiskal Anggito Abimanyu tegaskan Pemerintah sebaiknya tetap waspada dan tidak boleh meremehkan ancaman dari krisis utang yang terjadi di Eropa khususnyaYunani. Anggito menilai terdapat beberapa masalah yang menjadi tantangan Kementerian Keuangan, khususnya Badan Kebijakan Fiskal dalam menjaga stabilitas makro ekonomi Indonesia ke depannya. Pertama, mengantisipasi perluasan

dampak krisis Yunani yang pengaruhnya bisa sampai ke Asia, termasuk Indonesia. “Saya kira yang pertama jangan underestimate Yunani. Krisis Yunani itu pengaruhnya bukan hanya di Eurozone tapi bisa menyebar hingga ke Jepang, China, Amerika. Itu juga bisa spread ke Asia,” ungkapnya saat ditemui di kantornya, Jalan Wahidin Raya, Jakarta, Senin (24/5). Anggito menjelaskan krisis Yunani akan berdampak beban utang dari negara-negara maju di kawasan Eropa meningkat sehingga untuk menutupinya mereka akan menyerap likuiditas dari pasar global. Dengan peringkat utang yang cukup baik yaitu AAA, investor akan lebih tertarik untuk berinvestasi di portofolio mereka sehingga berpotensi memicu pelarian modal dari negara-negara berkembang. “Banyak modal masuk ke Indonesia, karena (kondisi) Eeuro zone sedang tidak pasti. Sekarang Yunani sudah di-bailout Eurozone, IMF, dan ECB, sehingga mereka akan terbitkan surat utang lagi dengan rating yang tinggi dan itu akan diburu oleh investor. Kita harus hati-

hati meskipun kita punya fundamental ekonomi yang bagus,” jelasnya. Oleh karena itu, lanjut Anggito, yang menjadi tantangan pemerintah berikutnya adalah bagaimana mengupayakan agar modal yang masuk ke Indonesia lebih kepada investasi fisik yang sifatnya jangka panjang. Dengan demikian akan ada nilai tambah berupa penyerapan tenaga kerja sehingga turut memperkuat pertumbuhan ekonomi nasional. “Inilah tantangan terbesar. Kalau growth (pertumbuhan ekonomi) kita tinggi, tapi karena konsumsi domestik, itu tidak s u s t a i n a b l e. Ja d i b u t u h investasi,” jelasnya. Selain itu, Anggito juga menyampaikan tantangan terakhir pemerintah yaitu mengurangi berbagai risiko investasi di Indonesia. Terutama di bidang infrastruktur di mana terdapat banyak eksekusi proyek yang belum bisa jalan karena terkendala banyak hal. “Eksekusi dari proyek infrastruktur yang sudah kita siapkan selama ini harus ada langkah-langkah jelas. Mau dieksekusi atau tidak. Misal tol, listrik,” tukasnya.(dtc)

Kadin Imbau Pengusaha Taksi Lokal Siap Bersaing Dengan Blue Bird MEDAN (Waspada): Rencana masuknya taksi Blue Bird di Medan seharusnya dapat dijadikan sebagai tantangan sekaligus motivasi bagi para pengusaha maupun supir taksi lokal dalam meningkatkan pelayanan (servis) kepada konsumen. Pasalnya, pelayanan taksi lokal di Medan masih jauh dari harapan. Walau demikian, rencana masuknya taksi ini haruslah diberi jeda waktu untuk sosialisasi kepada pengusaha lokal untuk siap-siap atau segera memperbaiki servis. Ketua Kamar Dagang Indonesia (Kadin) Sumatera Utara Irvan Mutyara di Medan, Senin (24/5) menyatakan sudah saatnya kota ketiga terbesar di Indonesia tidak hanya pesat pertumbuhan industry maupun pariwisatanya melainkan pelayanannya juga. “Sepertinya pantas jika Blue Bird masuk ke Medan, hal ini untuk meningkatkan pertumbuhan pariwisata Sumatera Utara dengan Medan sebagai kota transit ke lokasi-lokasi wisata,” ujarnya. Begitupun, lanjutnya, hal ini harus diberikan jeda waktu kepada pengusaha lokal untuk bersiap diri bersaing secara bersama-sama dalam menarik simpati masyarakat lokal maupun manca negara. “Kita pun khawatir jika di-

paksakan taksi lokal bisa gulung tikar, namun hal ini harus segera berubah agar pertumbuhan pariwisata Sumatera Utara khususnya Medan dapat dijual dengan pelayanan-pelayanan yang baik pula,” lanjutnya. Pemerintah, lanjutnya, juga harus dapat menyikapi hal ini sebagai penengah antara taksi lokal dan luar agar hal ini tidak memancing kericuhan antara kedua belah pihak. “Kita melihat jumlah taksi di Medan telah memadai, namun untuk pelayanan baik dari pengusaha maupun sopirnya masih belum refresentatif,” ujarnya. Dalam hal ini Kadin siap menjembatani antara pemerintah daerah, pengusaha taksi lokal, dan luar untuk duduk bersama menjernihkan suasana agar persaingan sehat dapat diterapkan untuk menciptakan dunia usaha yang sehat pula. Hal itu juga diungkapkan Wakil Ketua Kadin Medan Putrama Alkhairi bahwa tidak ada jaminan jika Blue Bird masuk para penumpang atau pelanggan langsung naik ke taksi tersebut. “Jadi tidak ada perlu dikhawatirkan tentang hal ini, yang penting adalah bagaimana pelayanan dari masing-masing mereka untuk dapat merebut hati konsumen. Jika taksi lokal lebih baik, maka pelanggan

1 September

Produk Non-Pangan Wajib Label Bahasa Indonesia J A K A RTA ( Wa s p a d a ) : Kementerian Perdagangan (Kemendag) telah merevisi percepatan pemberlakuan wajib label berbahasa Indonesia produk non pangan dari rencana semula 1 Juli 2010 menjadi 1 September 2010. Meski mundur, jadwal pemberlakuan ini lebih cepat dari ketentuan semula yang sesuai dengan Permendag No.62/ M-DAG/12/2009 mengenai labelisasi produk non pangan yang dijadwalkan berlaku pada 21 Desember 2010 (awal 2011). “Penerapan Permendag No.62 yang tadinya berlaku 1 Januari 2011 jadi per 1 September 2010,” kata Menteri Perdagangan Mari Elka Pangestu dalam acara rapat kerja dengan Komisi VI DPR-RI, Senin (24/5). Sebelumnya Kemendag

telah merencanakan mempercepat pelaksanaan ketentuan wajib bagi produk barang nonpangan berlabel bahasa Indonesia berlaku mulai 1 Juli 2010 bagi produk impor maupun non impor. Hal ini lebih cepat dari ketentuan Permendag No.62/M-DAG/12/2009 mengenai labelisasi produk non pangan, dijadwalkan berlaku pada 21 Desember 2010. Pihak pemerintah beralasan percepatan penggunaan wajib label berbahasa Indonesia bagi produk non pangan betujuan konsumen lebih cepat mengetahui informasi produk yang dibeli, demi perlindungan. Seperti diketahui Permendag No.62/M-DAG/12/2009 mengatur wajib pencantuman label terhadap empat produk non pangan.

akan ke sana, begitupula dengan Blue Bird,” ujarnya. Bagi Medan sendiri, lanjutnya, hal ini akan sangat bermanfaat untuk meningkatkan PAD (pendapatan asli daerah). “Begitupun pemko harusnya melakukan memenej transportasi lokal dengan konsisten termasuk perbandingan antara kebutuhan taksi, becak motor (betor), dan angkutan kota,” ujarnya. “Dengan masuknya Blue Bird ini akan memberikan contoh kepada pengusaha taksi lainnya mengikuti aturan sebagaimana keputusan Menteri Perhubungan (Menhub) No. 35 tahun 2003 tentang penyelenggaraan angkutan orang di jalan dengan kenderaan umum, dalam pasal 29 dijelaskan, untuk tarif angkutan berdasarkan

argometer,” ujarnya. Kemudian, lanjutnya, dilengkapi tulisan “TAKSI” yang ditempatkan di atas atap bagian luar kendaraan dan harus menyala dengan warna putih atau kuning apabila dalam keadaan kosong dan padam apabila argometer dihidupkan, serta dilengkapi alat pendingin udara, logo dan nama perusahaan yang ditempatkan pada pintu depan bagian tengah, dengan susunan sebelah atas adalah logo perusahaan dan sebelah bawah adalah nama perusahaan, tanda jati diri pengemudi yang ditempatkan pada dashboard kendaraan. “Di Medan sendiri kan masih tidak merata, ada yang bagus dan masih banyak yang memprihatinkan,” ujarnya kembali. (m38)

Asia Pimpin Teknologi 3D JAKARTA (Waspada): Kawasan Asia menjadi pemimpin (leader) dalam perkembangan teknologi 3D sejalan dengan cepatnya percobaan penyiaran dan peluncuran 3D yang tengah gencar tahun ini. Sehingga stasiun TV dan perusahaan produksi dapat mencari teknologi penyiaran, peralatan dan aplikasi 3D di event besar pameran BroadcastAsia. Di 2009 BroadcastAsia dihadiri hampir 1.000 pengunjung dari Indonesia, menjadikan Indonesia sebagai kontingen dengan pengunjung terbesar ketiga pada pameran dan konferensi perdagangan internasional ini. Pada ajang tahun ini, jumlah pengunjung diperkirakan akan lebih besar dari tahun 2009 lalu. Demikian disampaikan Calvin Koh, Senior Project Manager, penyelenggara pameran Singapore Exhibition Services dalam keterangan persnya di Jakarta, kemarin. “Mengingat Asia merupakan rumah bagi para produsen TV dan audio elektronik terkemuka seperti Sony dan Panasonic, kawasan ini muncul sebagai pemimpin 3D,” ujarnya. BroadcastAsia2010, ajang industri multimedia digital dan hiburan terkemuka di Asia, yang akan diadakan di Singapore Expo mulai 15 – 18 Juni 2010, akan kembali menampilkan teknologi, solusi dan peralatan terbaru untuk keseluruhan rantai nilai dari kreasi konten

hingga pengiriman. Mengusung tema “Integrating Technologies, Experiencing Content”, BroadcastAsia2010 akan menampilkan pameran 3D dan Desain Digital baru, juga peralatan high definition dan digital terbaru serta solusi alur kerja terintegrasi untuk industri penyiaran, produksi dan pasca produksi. Ajang ini juga akan mengumpulkan para pemimpin bisnis dan para pemain di sektor yang sangat segmented, yang ingin membangun jaringan dan menjajaki model penghasilan baru dan kemitraan strategis. “Industri penyiaran dan media interaktif di kawasan akan menjadi saksi penawaran global terbaru di atas lahan pameran seluas 16.000 meter persegi di BroadcastAsia2010. Acara ini akan menampilkan peserta dari Brasil, Prancis, China, Jerman, Italia, Korea, Singapura, Spanyol, Inggris, Amerika Serikat dan WorldDMB,” kata Calvin. BroadcastAsia2010 akan bertepatan waktunya dengan CommunicAsia2010, ajang teknologi informasi paling komprehensif dan terbesar di Asia. Kedua ajang perdagangan yang telah mapan ini menampilkan satu-satunya platform yang secara tepat mengadopsi konvergensi telekomunikasi dan penyiaran, serta menampilkan pameran teknologi terbaru, produk dan solusi paling komprehensif di Asia bagi industri komunikasi dan informasi, media dan penyiaran. (j03)

BRI Pastikan KUR Buat TKI Cair J A K A RTA ( Wa s p a d a ) : Direktur Utama Bank Rakyat Indonesia (BRI) Tbk, Soyfan Basir memastikan memastikan bahwa program KUR untuk kalangan Tenaja Kerja Indonesia (TKI) yang bekerja di luar negeri akan cair. “Mereka kan sudah pro job. TKI jadi masuk progran KUR. Kami akan bekerja sama dengan PJTKI (pelaksana penempatan jasa TKI) untuk memfasilitasi ini,” kata usai Rapat umum Pemegang Saham (RUPS) Tahunan di Jakarta, kemarin. Menurutnya, TKI bisa masuk dalam program KUR karena kejelasan job, prosedur,

dan bisa menghasilkan dari pekerjaannya. “Mereka butuh KUR untuk membuat pasport, mengurus visa, membayar penginapan, dan mengurus administrasi lainnya, tanpa harus menjual tanah dan ternak, atau pinjam ke tengkulak dengan membayar bunga yang mahal.” BRI akan bekerja sama dengan Perusahaan Jasa Tenaga Kerja Indonesia (PJTKI) yang berperan sebagai jembatan kebutuhan itu. “Dengan begitu TKI tidak perlu bersusah-suah, bank yang nantinya masuk ke sana,” tambah Sofyan. Dalam RUPS disetujui pembagian dividen sebesar 30

persen dari laba tahun berjalan 2009 sebesar Rp7,3 triliun. Selain itu, juga menyetujui pemberian tantiem kepada direksi dan komisaris sebesar Rp84,7 miliar atau 1,16 persen dari total laba tahun lalu. Pihaknya menargetkan pertumbuhan laba 30 persen di triwulan II-2010. Pertumbuhan itu masih ditopang oleh meningkatnya kredit, khususnya Kredit Usaha Rakyat (KUR) sebesar 20 persen-25 persen. Dalam RUPS Bank BRI diperkirakan akan membagikan dividen senilai Rp2,19 triliun atau sebesar 30 persen dari total laba bersih tahun buku 2009.

Jumlah tersebut, menurut dia, termasuk dividen interim yang dibayarkan pada 6 Desember 2009, sehingga dividen tunai sebesar Rp132,07 per saham.. Sementara itu, sebesar 13 persen dari laba bersih akan digunakan sebagai dana cadangan dan 54 persen untuk laba ditahan. “Dividen akan dibagikan pada 15 Juli,” ujar Sofyan. Bank BRI mencatat laba bersih sebesar Rp7,31 triliun sepanjang 2009, dimana perolehan laba itu naik 22,66 persen dibanding 2008. “Sedangkan di triwulan II-2010 ini diperkirakan akan naik 30 persen,” tutur Sofyan.(j03)

C3

Anggito :

Saya Dianggap Melakukan Perselingkuhan Politik JAKARTA (Waspada): Mantan Kepala Badan Kebijakan Fiskal Anggito Abimanyu buka suara soal tudingan ‘makelar’ APBN 2010 sebesar Rp2 triliun. Anggito merasa banyak hal yang tidak benar soal tudingan itu. Anggito menyatakan keberatan dengan pemberitaan baru-baru ini yang menyudutkannya. Ia menegaskan kedekatannya dengan dewan adalah hal wajar dan murni profesional kerjaan. “Itu adalah masukan dan bergaul, tanpa kita lupakan asas-asas kepantasan. Rasanya saya pantas sih saya sekarang bisa membuat testimony atas tuduhan, alegasi ataupun yang dimunculkan media massa,” ungkap Anggito di kantornya, Jakarta, Senin (24/5). Anggito melanjutkan keluhannya atas tuduhan media bahwa dirinya telah menyetujui anggaran senilai Rp2 triliun yang dimintakan dewan ke daerah konstituen mereka dalam APBN-P 2010. “Yang dulu saya dianggap melakukan perselingkuhan politik sekarang, lewat belakang, dan yang kedua masalah Rp2 triliun, kok gak ngecek gitu lho. Kalau prosesnya memang bumpy (bergejolak) seperti itu ya. Di DPR itu banyak keinginan dan usulan, baik pribadi, tapi proses itu kan berjalan dalam proses pengambilan keputusan, dan yang perlu diperhatikan kan keputsan akhir seperti apa,” ujarnya. Dengan banyaknya pengalaman yang dia telah dapatkan sebagai kepala BKF selama tahunan, ia pun berniat untuk mengungkapkannya dalam bentuk tulisan. “Jadi mudah-mudahan pengalaman ini bisa saya tuliskan, saya sedang berusaha menuliskan tulisan ke beberapa media, pesan-pesan moral, keteguhan sikap, vote matters, dan keyakinan kebenaran saya berani mengatakan itu sekarang karena tidak ada lagi hal-hal yang saya khawatirkan, itu nanti adalah untold story. Tapi jangan semuanya,nanti saya gak diwawancarai lagi,” ujarnya diiringi tawa. Anggito Abimanyu sempat disebut-sebut ‘menjembatani’ tambahan anggaran Rp2 triliun agar DPR memuluskan APBNP2010. Namun akhirnya Badan

Anggaran tidak menyetujui usulan tersebut karena tambahan Rp2 trilun sebagaimana diusulkan Komisi XI DPR RI tidak ada dasar hukumnya. Anggito sendiri kini telah mengajukan pengunduran diri sebagai Kepala BKF, sesaat setelah Presiden SBY mengumumkan penunjukan Anny Ratnawati sebagai wakil menkeu. Anggito merasa kecewa karena sudah menandatangani pakta integritas untuk menjadi wamenkeu sebelum akhirnya namanya malah dihapus oleh presiden SBY. Anggito Abimanyu yang sudah mengundurkan diri merasa gamang meninggalkan tugas-tugas yang belum selesai di Badan Kebijakan Fiskal Kementerian Keuangan.“Sudah habis air mata saya,” ujarnya saat ditanya mengenai kesan selama menjabat Kepala BKF. Anggito mengaku masih banyak agenda BKF yang belum diselesaikan. Namun, apa mau dikata, dia harus tetap pergi untuk mengabdi ke kampusnya. “BKF saya yang lahirkan, masih banyak unfinished agenda,itu yang membuat saya gamang meninggalkan, karena bertugas tapi belum selesai. But I have to go,” tegasnya. Anggito merasa yakin teman-temannya pasti akan mampu menyelesaikan agenda yang belum selesai tersebut. “Teman-teman saya yang akan menyelesaikan,” jelasnya. Pada kesempatan itu, Anggito menyatakan sudah saatnya untuk saling memaafkan dan merelakan atas keputusannya itu. “Pembicaraan terakhir dengan Pak Agus, beliau ikhlas dan memahami alasanya tujuan, silakan di charge batere dulu. Saya akan bantu dari luar. Forget and forgive. Itu sudah jalan, kalau ada kesalahan ya mohon dimaafkan,” tuturnya. Anggito Abimanyu secara resmi akan mundur dari BKF per 24 Mei, setelah nasibnya sebagai Wakil Menteri Keuangan diombang-ambingkan selama 6 bulan. Anggito Abimanyu sebelumnya mengungkapkan kekecewaannya kepada lingkungan istana karena tidak ada konfirmasi dan pemberitahuan kepada dirinya soal pembatalan dirinya menjadi Wakil Menteri Keuangan. (dtc)

XL Nelpon Gila Makin Gila SEBAGAI salah satu Perusahaan Telekomunikasi terkemuka di Indonesia yg mulai beroperasi secara Komersial sejak 8 Oktober 1996, saat ini XL adalah penyedia layanan selular dengan jaringan yang luas dan berkualitas di seluruh Indonesia bagi pelanggan ritel (cosumer solutions ) dan solusi bagi pelanggan korporat (business solutions ). Demi menjawab kebutuhan konsumen akan komunikasi suara, SMS dan data, kembali XL memberikan layanan, program dan tarif yang menguntungkan bagi pelanggan. Dan kali ini XL meluncurkan promo terbaru yaitu paket super nelpon gila untuk para calon pelanggan yang belum pernah mencoba layanan murah dengan jaringan yang super handal dari XL. Peluncuran paket super gila ini ditandai dengan Penyerahan secara simbolis bola bertuliskan tarif nelpon & tarif SMS dari Ayu Tantri selaku Regional Marketing Manager kepada wartawan pada press conference di Terminal Futsal, Jumat (21/5). Sebagai paket baru, paket nelpon gila makin gila merupakan paket super nelpon gratis segalanya dan super murahnya ke semua operator, tanpa harus daftar. Tarif SMS nya Rp1 per SMS ke semua operator dan tarif nelpon cuma Rp5 per detik ke operator lain. Paket ini sudah bisa dinikmati sejak 21 Mei di wilayah Sumut dan Aceh. Nikmatnya lagi menggunakan paket ini, pelanggan baru XL juga mendapatkan Bonus tambahan gratis 1000 SMS berlaku selama tiga hari pada saat pengaktifan kartu perdana plus cuma pemakaian akumulasi Rp1.500 langsung mendapatkan bonus nelpon gila gratis 1.000 SMS ke semua operator, 100 menit nelpon dan 1 MB. Dan yang ingin menikmati beragam paket dan layanan menarik lainnya dapat mengakses * 123 #.


Aceh

C4

WASPADA Selasa 25 Mei 2010

Gadis Curanmor Ditangkap

800 Pedagang Pasar Keudah Tak Jadi Digusur BANDA ACEH (Waspada): Ternyata sekira 800 Pedagang di Pasar Keudah, Kota Banda Aceh yang sebelumnya kebingungan karena bakal digusur, Kamis (20/5), dengan berbagai pertimbangan untuk sementara tak jadi digusur. Penundaan penggusuran sehubungan turunnya revisi surat pemberitahuan II, Walikota Banda Aceh yang membatalkan pemberitahuan sebelumnya. Dalam pemberitahuan II Walikota Ir. Mawardy Nurdin, M. Eng. Sc memperbolehkan kembali para pedagang berjualan hingga 31 Juli 2010. Pantauan di lokasi, hingga Senin (24/5) ratusan pedagang masih melakukan aktivitas berjualan berbagai jenis sayuran, buah-buahan, bahkan sembako di komplek pasar tersebut yang merupakan tanah Dephum dan HAM, yakni eks Lembaga Pemasyarakatan (Lapas) alias penjara Keudah.(b21)

Ratusan Hektar Padi Diserang Hama PANTONLABU, Aceh Utara (Waspada): Ratusan hektar padi di sejumlah desa Kec. Tanah Jambo Aye, Aceh Utara, dilaporkan terkena hama wereng. Daun padi yang masih muda menguning, sementara pangkal batang membusuk. Kondisi ini meresahkan petani. Mereka khawatir gagal panen. “Kami sudah berupaya sekuat tenaga mengantisipasi, termasuk menyemprotkan racun anti hama secara berkala. Tapi hanya sebagian kecil bisa pulih. Selebihnya terus menguning dan mati muda,” kata Muharram Jafar, 35, petani asal Teupin Bayu, Kec. Tanah Jambo Aye, Minggu (23/5). Keluhan serupa disampaikan petani lainnya, Muhammad Saman, warga Desa Alue Pa peun. “Kami kewalahan. Berbagai merk racun telah kami coba, namun hasilnya tetap tidak memuaskan. Kami berharap Dinas Pertanian Aceh Utara turun ke lapangan membantu mengatasi hama wereng ini,” harap Muhammad Saman. Dia menambahkan, dalam kondisi normal hasil panen gabah mencapai 5-7 ton per ha. Tapi jika melihat kondisi padi saat ini, target itu dipastikan sulit tercapai. Bahkan tidak tertutup kemungkinan, sebagian petani gagal panen. “Jika kena penyakit seperti ini, jangankan 5 ton per ha, tiga ton saja susah,” tandas Saman.(cmus)

Tahun 2010, Lhokseumawe Stop Terima CPNS Formasi Umum KOTA LHOKSEUMAWE (Waspada): Munir Usman, Walikota Lhokseumawe, Senin (24/5) usai menyerahkan 202 SK CPNS formasi umum tahun anggaran 2009, di halaman kantor Walikota kepada wartawan mengatakan, untuk tahun 2010 pihaknya akan menyetop penerimaan CPNS formasi umum. Hal ini disebabkan kwantitas PNS di lingkungan Pemkot Lhokseumawe telah 3.900 orang, termasuk yang baru di SK kan. Sementara jumlah pegawai honorer dan bakti murni mencapai 1200 orang. “Karena jumlahnya cukup banyak, maka kita hentikan dulu penerimaan CPNS formasi umum tahun 2010. Agar dapat memperjuangkan nasib para honorer untuk menjadi CPNS,” sebut Munir Usman. Bukan hanya itu, semua instansi pemerintah di Pemkot Lhokseumawe dilarang menerima tenaga honorer dan bakti murni, kecuali telah terjalin hubungan koordinasi dengan Badan Kepegawaian Daerah (BKD). Karena tanggungjawab ini berada di bawah pihaknya. Sebutnya, jumlah CPNS yang baru menerima SK pengangkatan 202 orang, dengan rincian tenaga guru 141 orang, kesehatan 5 orang, dan tenaga teknis 56 orang. Untuk tahun anggaran 2008 dan 2009 pihaknya sengaja menitikberatkan penerimaan CPNS pada formasi tenaga guru, guna mendukung program pemerintah pusat dalam meningkatkan mutu pendidikan nasional. “Pada 2008 ada puluhan guru Bahasa Inggris, strata satu, yang kita tempatkan di Sekolah Dasar. Pada 2009 guru Bahasa Inggris kita rekrut kembali puluhan orang, beserta tenaga guru bidang studi lainnya,” jelas Munir Usman didampingi Sabaruddin, Kepala BKD. Kepada para CPNS yang baru menerima SK diminta bekerja sebaik-baiknya guna melayani masyarakat. Kepada mereka juga diingatkan untuk tidak melakukan pekerjaan yang bukan tanggungjawabnya. “Kepada saudara-saudara yang baru menerima SK CPNS saya ucapkan selamat bekerja, sesuai bidang masing-masing,” ucapnya.(cmun)

Waspada / H. Rusli Ismail

TETAP BERJUALAN: Pedagang di Pasar Keudah eks Lapas Keudah kembali bisa berlega hati atas dispensasi yang diberikan Pemerintah Kota (Pemko) Banda Aceh, dengan memberi kesempatan kepada mereka untuk tetap bisa berjualan hingga 31 Juli 2010.

Tiga Bangunan Paket Proyek Dana Otsus Diterlantarkan BIREUEN (Waspada): Pembangunan tiga paket proyek fisik yaitu gedung pustaka, ruang pameran dan pagar komplek areal UPT SKB Bireuen seluas 2,5 ha dengan sumber dana otonomi khusus (Otsus) Provinsi Aceh 2008 tak juga rampung hingga 2010, bahkan diterlantarkan. Kepala UPT SKB Bireuen, Drs. H. Suherman Amin, Minggu (23/5) membenarkan, tiga proyek yang dibangun di lingkungan kawasan kantor yang dipimpinnya diterlantarkan. Namun dia mengaku tidak mengetahui, karena tidak diberitahu. “Tidak jelas berapa anggarannya karena saya tidak pernah dikonfirmasi oleh rekanan dan Pejabat Pelaksana Tehnis

Kegiatan (PPTK). Saya ketahui dari Darwis dari Dinas Pendidikan Aceh, katanya dari dana Otsus provinsi,” jelasnya. Menurut Suherman Amin, awalnya dia tidak protes karena menurut informasi semua koordinasi hanya melalui Dinas Pendidikan Provinsi Aceh. Namun sebagai Kepala UPTSKB merasa seperti kurang dihargai. Bahkan, beberapa waktu lalu pernah dimintai keterangan oleh tim pemeriksa dari Inspektorat Provinsi (Bawasda ). Saat itu Suherman Amin secara jujur mengaku tidak mengetahui prihal anggaran proyek tersebut karena tidak pernah mendapat konfirmasi dari pihak rekanan, kenapa harus bertanggungjawab. “Maret dan April 2009 lalu, Bawasdaprov Aceh turun mengecek ke tiga proyek. Saya tidak tahu kelanjutannya,

yang pasti ini temuan mereka, bahkan ketika itu PPTK yang dikonfirmasinya mengatakan akan mengusulkan kembali pada 2010 sebab pada 2009 telah diusulkan tidak ada realisasi. Namun itu pun tak pernah ada bahkan belum ada tanda-tanda dilanjutkan,” terangnya. Sebelumnya, Pejabat Pelaksana Teknis Kegiatan (PPTK) Dinas Pendidikan Provinsi Aceh, Darwis, S.Sos yang dikonfirmasi wartawan melalui telepon mengatakan, proyek tersebut belum rampung karena berbagai kendala. Bahkan, katanya saat itu, bukan hanya di UPT-SKB Bireuen, tapi sangat banyak proyek bangunan fisik bersumber dari dana Otsus 2008 tidak selesai dikerjakan karena waktu. Namun pihaknya akan mengajukan untuk 2009, tetapi tidak tercover, 2010 ini akan mereka rampungkan.(amh)

RAT Ke-33 Puskud Aceh Alot, Ketua Diminta Mundur BANDA ACEH (Waspada): Rapat Anggota Tahunan (RAT) ke 33 Pusat Koperasi Unit Desa (PUSKUD) Aceh yang dilaksanakan di Asrama Haji Banda Aceh, Sabtu (22/5), sehari penuh berlangsung alot. Pasalnya, dalam laporan Badan Pengawas Puskud Aceh menyebutkan Ketua Puskud Aceh dalam melaksanakan amanah tidak sesuai AD dan ART sehingga Puskud Aceh mengalami kerugian Rp220 juta lebih. Ketua Badan Pengawas M. Natsir Ilyas bersama dua anggota lainnya menyorot Ketua Puskud Aceh Muhammad Hanafiah dalam melaksanakan tugasnya tanpa restu dari unsur pengurus lainnya. Dia menyontohkan soal pabrik pengolahan kopi di Bener Meriah yang telah diputuskan kontrak dengan penyewa sebelumnya tidak dilengkapi dokomen. Atas kesepakatan internal pengurus memberi kesempatan kepada ketua Puskud MH atas nama pribadi menyewa pabrik kopi itu senilai Rp220 juta/tahun. Anehnya, surat perjanjian itu ditandatangani sekretaris dan bendahara Puskud Aceh selaku penyewa, sedangkan Ketua Puskud Aceh atas nama pribadi bertindak atas nama penyewa. Pengawas

menilai surat kontrak sewa menyewa itu cacat hukum dan harus ditinjau ulang. Sebab pengurus secara lengkap tidak membuat surat kuasa kepada bendahara dan sekretaris Puskud Aceh bertindak atas nama pengurus Puskud Aceh. Pengawas juga menyorot, setelah menandatangani surat kontrak sewa menyewa pabrik pengolahan kopi, lalu pengurus Puskud Aceh menyewakan lagi pabrik kopi itu kepada PT. Gayo Nusantara Agrobisnis atas nama MH Ketua Puskud Aceh senilai Rp220 juta dibayar lunas. “Tapi uang itu tidak disetorkan ke kas pengurus Puskud Aceh,” sebut Pengawas dalam laporannya. Sementara Ketua Puskud Aceh Muhammad Hanafiah mengakui dana itu sudah dimanfaatkan untuk kepentingan pembayaran fee tender proyek pemerintah akhir 2009 senilai Rp102 juta, sementara proyeknya tidak terealisasi. Dia mengaku dana segar sebesar itu menjadi tanggungjawabnya dan akan dibayar cicil. Padahal Sekretaris Puskud Aceh, Anwar Yusuf telah mengingatkan Ketua Pus-

kud Aceh agar tidak main-main dengan proyek di samping tidak ada dalam program kerja tahun 2009. Proyek itu juga sudah dipenghujung tahun tidak mungkin lagi bisa dikerjakan dalam waktu relatif singkat, karena menyangkut anggaran. “Tapi saudara ketua tetap bersikeras bermain proyek yang tidak jelas itu,” sebut Anwar kesal. Mayoritas anggota Puskud Aceh dengan alot membahas kebijakan Ketua Puskud Aceh yang terkesan tidak harmonis di antara pengurus dan telah menyalahi amanah anggota. Bahkan Muhammad Hanafiah diminta mundur dengan hormat dari jabatan ketua sebelum diturunkan secara paksa. Pimpinan Rapat M. Hanafiah, SE, MM berhasil meredam suasana panas itu dan atas kesepakatan anggota menyimpulkan, diberi waktu mengembalikan pinjaman dana di Puskud senilai Rp220 juta hingga 17 Agustus 2010. RAT juga menyetujui laporan pertanggungjawaban pengurus Puskud, program kerja tahun 2010 dan laporan neraca tahun 2009.(b29)

Bantuan Anak Yatim Diselewengkan

Waspada/Maimun Asnawi, SH.I

SERAHKAN SK: Munir Usman,Walikota Lhokseumawe, Senin (24/5) di halaman kantor Walikota menyerahkan SK pengangkatan CPNS secara simbolis kepada tiga penerima. Jumlah total CPNS yang di SK kan 202 orang.

BANDA ACEH ( Waspada): Para pengurus Yayasan Panti Asuhan ‘Aneuk Atjeh’ (YPA3) yang selama ini menampung puluhan anak yatim korban tsunami di Desa Lam Hasan Kec. Peukan Bada, Aceh Besar mempertanyakan bantuan yang telah disalurkan sejumlah pihak, karena dua tahun terakhir panti asuhan Aneuk Atjeh belum menerima apa pun. Padahal, bantuan tersebut sangat dibutuhkan pihak yayasan guna memenuhi berbagai kebutuhan puluhan anak yatim, seperti biaya kebutuhan hidup maupun biaya pendidikan mereka yang bersekolah mulai dari jenjang Sekolah Dasar (SD) hingga SMA. Ketua Yayasan Panti Asuhan Aneuk Atjeh (YPA3), Tgk. H. Asnawi, kepada wartawan kemarin mengatakan, setelah melakukan pengecekan oleh pihak yayasan, sejumlah bantuan berasal dari Dinas

Sosial Provinsi dari tahun 2009/2010 sebesar Rp106 juta, sedangkan dari Kantor Gubernur Aceh Rp45 juta, dan kantor HAM Rp10 juta, dan banyak lainnya ternyata tak disalurkan. Mereka menuding pembina yayasan menggelapkan bantuan, karena tidak pernah sampai. Padahal menurut informasi dari sejumlah instansi pemerintah, bantuan tersebut telah disalurkan melalui yang bersangkutan. “Kami dengar banyak bantuan disalurkan kepada yayasan melalui pembina, tapi dua tahun terakhir tidak pernah kami terima seperti dari Kantor Gubernur Aceh dan Dinas Sosial. Ini sudah termasuk dugaan penggelapan bantuan untuk anak yatim,” ujar Ketua YPA3, Tgk H. Asnawi. Menurut Asnawi didampingi sejumlah pengurus yayasan, akibat tidak

Soal Pemotongan Dana BOS Dan Fee Buku:

Ka. UPTD Merasa Difitnah Ketibaan (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 398 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *

FireFly

Keberangkatan (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta

16:30

11:15 JT 397 Medan/Jakarta 16:00 JT 307 Jakarta 19:50 JT 399 Medan/Jakarta

07:20 11:55 16:35

12:50 SJ011 Medan/Jakarta

13:20

12:20 AK 306 Kuala Lumpur *

12:45

PANTONLABU, Aceh Utara (Waspada): Kepala Unit Petugas Teknis Dinas (Ka. UPTD) Pendidikan Jambo Aye/Langkahan, Aceh Utara, Drs. M. Insya merasa difitnah, terkait pemotongan dana BOS dan fee bisnis buku pelajaran. “Bagaimana saya potong, sedang dana Biaya Operasional Sekolah (BOS) tahun 2010 itu langsung masuk rekening para kepala sekolah (Kasek) masingmasing Sekolah Dasar Negeri (SDN), yaitu Kec. Tanah Jambo Aye dan Langkahan,” kata M. Insya menjawab Waspada, Minggu (23/5). Kata dia, prahara fitnah ditiup oknum-oknum tertentu, sehubungan aktivitas pembangunan pagar pekarangan kantor UPTD pendidikan, Jl. Pendidikan Pantonlabu. “Tiga sisi pagar sudah saya bangun, namun sisi depan terbengkalai karena dana. Melihat bangunan ini terbengkalai, 32 Kasek SDN menempuh alternatif secara tanggung renteng dengan dana Rp24 juta,” ujarnya seraya menambahkan. “Bangunan pagar semua ditangani para Kasek. Saya hanya memberi izin dan menunjukkan lokasi, tanpa campur tangan masalah biaya,” tandas M. Insya. Terkait keterlibatannya dalam bisnis buku yang disebut-sebut bekerjasama dengan penerbit Airlangga, sekaligus menerima fee 30 persen, ini pun fitnah.

diterimanya bantuan, kondisi kehidupan anak yatim di panti asuhan sangat memprihatinkan. Banyak kebutuhan tak terpenuhi, sehingga pengurus harus berusaha mencari jalan ke luar lain untuk membantu mereka. Bantuan yang rutin diterima selama ini hanya berasal dari Leon Burger, seorang donatur dari Belanda senilai Rp13 juta/bulan. Sementara bantuan lain, pada 2008 ada bantuan dari Kantor Gubernur Aceh Rp45 juta. Dari Dinas Sosial Provinsi Aceh juga ada bantuan rutin sejak 2008 hingga sekarang mencapai Rp43 juta/tahun. “Anehnya, uang bantuan yang masuk dari Dinas Sosial, bukan ke rekening yayasan yang sudah kami serahkan sebelumnya. Tapi justru masuk ke rekening pembina yayasan. Namun kami dari pengurus yayasan justru tidak pernah diberi tahu ada uang masuk. Entah dibawa kemana uang itu,” ungkap Asnawi. H. Asnawi menyebutkan, di panti asuhan yang dipimpinnya itu, saat ini menampung 33 anak yatim korban tsunami dari sejumlah daerah di Aceh. Panti asuhan tersebut berdiri 15 April 2007, dibangun seorang donatur dari Belanda. Sementara pembina yayasan, ketika dikonformasi terkait tudingan pengurus panti asuhan dengan tegas membantah. Menurutnya, bantuan tersebut tidak pernah digelapkan untuk kepentingan pribadi. “Tidak benar tudingan seperti itu. Itu fitnah. Saya siap duduk dengan pengurus Panti Asuhan Aneuk Atjeh mempertanggungjawabkan semua bantuan yang masuk melalui saya, karena ini menyangkut kehidupan

SIGLI (Waspada): Pelaku pencurian sepeda motor (Curanmor-red) tidak selamanya pria. Di Kabupaten Pidie, seorang gadis berinisial F, 19, warga Desa Aron, Kecamatan Glumpang Tiga terlibat Curanmor. Kini tersangka F meringkuk di Sel Mapolres Pidie, setelah ditangkap tim Reserse Kriminal (Reskrim) Polres Pidie bersama barang bukti satu sepeda motor jenis metik warna biru milik Rika Safira, 12, warga Desa Sira, Kecamatan Bandar Baru, Pidie Jaya, Senin (24/5) sekira pukul 11:00. Dalam beraksi, F mengincar anak-anak di bawah umur yang kebetulan melintas di jalan dengan sepeda motor. Lalu F berusaha mengkelabui korban dengan cara berpura-pura minta tolong dengan alasan handphonenya tertinggal. Kapolres Pidie AKBP Dumadi, SS, Tmk melalui Kasat Reskrim AKP Erlin Tangjaya, menduga tersangka F melakukan aksinya sudah lebih dari dua kali. Sebab, sebelumnya F juga pernah coba membawa kabur motor orang lain di kawasan Mesjid Abu Daud Beureueh, Kota Beureunuen, Kecamatan Mutiara, namun berhasil digagalkan. Dalam mencuri sepeda motor Rika Safira, tersangka F berpura-pura minta tolong dengan alasan handphonenya tertinggal di salah satu toko ponsel di Tringgadeng, Kab. Pidie Jaya. Selanjutnya tersangka minta diantar ke toko tersebut dengan jarak tempuh sangat jauh. Sekira 300 meter berjalan, F minta korban yang merupakan gadis di bawah umur itu turun dari sepedamotor dengan lasan gantian mengemudi. Setelah itu tersangka membawa kabur sepeda motor tersebut dan meninggalkan korban, seraya meminta handphone korban. Di lain tempat, keluarga korban gelisah, karena Rika Safira belum sampai di rumah. Lalu abang korban mencoba mencari. Setelah ditemukan, Rika Safira bercerita pada abangnya dilanjutkan kepada polisi. “Tersangka dan barang bukti telah kita amankan,” tegas Erlin.(b20)

Waduk Paya Aboe 15 Tahun Tersumbat BIREUEN (Waspada): Petani sawah empat desa di Kec. Peusangan Kab. Bireuen telah 15 tahun menunggu air hujan bila ingin menggarap sawahnya yang luasnya sekitar 300 ha. Pasalnya, waduk di Desa Paya Aboe, telah dangkal dan tersumbat sehingga tak bisa dimanfaatkan. Pantauan Minggu (23/5), kondisi waduk di Desa Paya bersisian dengan perbukitan tak jauh dari areal persawahan tadah hujan terlihat berair, tapi sudah dangkal dan ditumbuhi belukar. Bahkan salah satu dari tiga pintu air kondisinya rusak. Geuchik Desa Paya Aboe, Zulkarnaini didampinggi sejumlah tokoh masyarakat dan petani, kepada Waspada, Minggu (23/5), ketika berkunjung ke desa itu mengatakan, sekitar 15 tahun terakhir 300 ha sawah di empat desa terkendala pengairan, sehingga tak hanya padi, bila ditanam palawija juga selalu gagal panen. “Kondisi waduk selama ini sudah sangat dangkal dan ditumbuhi semak belukar, meski ada air tapi tidak bisa dialirkan lantaran tiga unit pintu air, baik untuk menyuplai air ke persawahan di Desa Paya Aboe maupun tiga desa lain sudah rusak dan tersumbat lumpur,” kata Zulkarnaini. Menurutnya, kondisi waduk seperti itu, setahun hanya bisa sekali tanam itu pun selalu gagal panen karena tanaman padi saat mulai berbuah mati, tak cukup air. Begitu juga jika petani tanam palawija, meski tanaman subur tapi gagal panen karena tingginya curah hujan. “Untuk memberdayakan kembali kesejahteraan ekonomi masyarakat, kami berharap pemerintah memperbaiki waduk ini,” harapnya.(amh)

Dua Siswa Bireuen Ke Turki BIREUEN (Waspada): Dua siswa Bireuen yang baru menamatkan sekolah di Fatih Bilingual School (FBS) Lamlagang Banda Aceh, mendapat kesempatan kuliah ke Turki. Keduanya adalah Moch. Yusuf Isalamakova dan Al Haris. Mereka akan bertolak ke Turki dari Bandara Sultan Iskandar Muda Banda Aceh via Bandara Sukarno-Hatta Jakarta 28 Mei, bersama siswa lain. Ibrahim, orang tua Moch. Yusuf Islamakova kepada Waspada, Minggu (23/5) mengatakan, keberangkatan anaknya bersama sejumlah anak Aceh lainnya, merupakan kebanggaan sebegai orang tua. Karena, anaknya itu ikut mengharumkan nama Bireuen dan Aceh sampai ke Eropa. “Kami para wali murid sangat mengharapkan mereka dapat merekatkan kembali hubungan yang pernah dibentuk nenek moyang orang Aceh dengan masyarakat Turki pada dulu kala, serta demi kemajuan Aceh di masa datang,” sebut warga Peudada itu, seraya berterimaksih kepada pimpinan dan seluruh elemen Fatih Bilingual School yang mendidik anaknya.(amh)

Korban Gizi Buruk Tidak Mendapat Pelayanan Medis LHOKSEUMAWE (Waspada): Kemal Sani,18, dari keluarga miskin di pesisir Pusong Lama, Kecamatan Banda Sakti, Pemko Lhokseumawe sulit menggerakkan tubuhnya akibat gizi buruk. Menurut keluarganya, ketika masih bayi menderita panas namun tidak mendapat penanganan medis secara baik, sehingga sampai sekarang tidak mampu mengkonsumsi makanan secara normal. Yusnidar, 35, janda miskin yang hidup di rumah kontrakan di pinggiran Kota Lhokseumawe, Senin (24/5), mengaku pasrah dengan kondisi putra sulungnya. Dengan keadaan ekonomi keluarga yang serba kekurangan, perempuan yang sehari-hari bekerja di kios sederhana di depan rumahnya tidak mampu membiayai pengobatan Kemal Sari. “Dulu pernah saya bawa diakerumahsakitdiBuketRata,tapihanyadiberiobatturunpanas,”kataYusnidar. Setelah Yusnidar berpisah dengan suaminya yang saat ini menetap di Kec. Meureudu, Aceh Pidie beberapa tahun lalu, Kemal Sani tinggal bersama ibunya di rumah tidak layah huni. Bangunan kumuh berdinding tenda lusuh hanya beberapa meter dari garis pantai Pusong. Sehingga ketika bertiup angin laut, penderita gizi buruk ini kerap kedinginan karena angin masuk melalui ratusan lubang dinding. Menurut Yusnidar, ketika melahirkan Kemal dia masih tinggal bersama suaminya di Aceh Pidie. Ketika itu, anaknya menderita demam hebat. Meski akhirnya demam bisa diatasi, namun korban tidak mampu mengkonsumsi makanan secara normal. Sampai sekarang dia hanya bisa makan nasi bubur dan air, sedangkan makanan lain tidak mampu dimakan. Upaya lain untuk mengurangi penderitaan Kemal, juga pernah dilakukan dengan minta bantuan ke Bagian Kesra Pemko Lhokseumawe. Melalui kepala desa data kondisi korban telah dikirim ke pemerintah daerah setempat. Sementara Kabag Kesra Pemko Lhokseumawe, Syafruddin mengaku belum menerima informasi tentang korban kurang gizi di Pusong Lama. Oleh sebab itu dia sangat mengharapkan aparat desa segera menyampaikan data, agar pihaknya bisa mengarahkan bantuan sesuai kebutuhan. “Kalau memang butuh pengobatan kita bisa mengarahkan ke dinas kesehatan agar bisa diobati,” jelas Syafruddin.(b17)

Waspada/Zainal Abidin

GIZI BURUK: Kemal Sani,18, korban gizi buruk dari keluarga miskin di pesisir Pusong Lama, Kecamatan Banda Sakti, Pemko Lhokseumawe sedang


Aceh

WASPADA Selasa 25 Mei 2010

C5 Idi Cut Butuh SPBU

5 Km Jalan Peunaroen Baru Butuh Pengaspalan PEUNAROEN, Aceh Timur (Waspada): Lima kilometer jalan di Desa Peunaroen Baru, Kecamatan Peunaroen, Kabupaten Aceh Timur, butuh pengaspalan. Pasalnya, sejak merdeka jalan tersebut belum tersentuh pembangunan. “Jalan pedesaan ini belum pernah di aspal, karena itu kita desak instansi terkait segera menurunkan tim untuk mengukur dan melakukan pengaspalan jalan,” ujar Geuchik Peunaroen Lama, Suratmansyah, kepada Waspada, Minggu (23/5). Kata dia, ratusan Kepala Keluarga (KK) dalam setiap rapat bulanan selalu mendesak aparatur desa mengusulkan pengaspalan jalan di desa itu, namun setiap tahun diusulkan selalu ditolak oleh Pemkab Aceh Timur. “Padalah ke tingkat kecamatan selalu kita usulkan,” sebutnya. Suratmansyah mengatakan, selain desa tersebut butuh pengaspalan jalan, sejumlah gorong-gorong juga perlu dibangun jembatan penghubung, sehingga lintasan dusun ke dusun dapat ditempuh tanpa harus melalui kubangan kerbau dan jalan yang penuh lumpur.

Suratmansyah menuturkan, Desa Peunaroen Baru adalah desa hasil pemekaran dari Peunaroen Lama. Sebelumnya, desa itu hanya sebuah dusun yang jarak tempuhnya mencapai beberapa kilometer ke pusat kecamatan. Namun pasca pemekaran, desa yang dipimpinnya dipecahkan dalam beberapa dusun, diantaranya dusun Rawa Pakes. “Meski desa ini hasil pemekaran, namun sudah selayaknya dibangun jembatan dan jalan, sehingga perekonomian masyarakat lancar dan pelajar tidak harus lagi menjinjing sepatu,” kata Geuchik Suratmansyah seraya mengharapkan, pemerintah membangun jalan dan jembatan di sana. Camat Peunaroen, Jaman, S.Pd, ketika dikonfirmasi Waspada secara terpisah kemarin mengaku, pihaknya selalu mengusulkan setiap usulan desa ke tingkat kabupaten, namun untuk tahun ini APBK Aceh Timur, sangat terbatas. “Sehingga untuk pembangunan jalan desa butuh waktu, namun Pemkab tetap membangunnya secara menyeluruh,” tandasnya. (cmad)

Waspada/Muhammad H. Ishak

Togel Marak Di Langsa

BERLUMPUR: Lintasan pedesaan di Desa Peunaroen Baru, Kecamatan Peunaroen, Kab. Aceh Timur, mayoritas rusak parah. Bahkan, beberapa titik terlihat berlumpur. Foto diambil baru-baru ini.

LANGSA (Waspada): Peredaran judi toto gelap (togel) di Kota Langsa sejak sebulan terakhir kian marak dan mulai meresahkan masyarakat. Padahal Provinsi Aceh sebelumnya telah membuat Qanun nomor 12, 13, 14 tahun 2003 tentang syariat Islam, yang melarang seluruh bentuk maksiat. Anehnya, Wilayatul Hisbah (WH) Langsa yang merupakan aparat penegak Syariat Islam justru ‘tidak berkutik’. Berdasarkan pantauan Waspada, aksi jual beli togel di Langsa dilakukan dengan berbagai modus yang rapi dan tersembunyi. Bahkan para pecandu togel adalah kalangan kelas menengah ke bawah. Meski aparat kepolisian dan WH Langsa sebelumnya telah mewanti-wanti keberadaan judi togel, namun tetap berjalan lancar. “Ya judi togel memang banyak beredar di Langsa. Mereka beroperasi secara sembunyisembunyi dan sangat hati-hati. Bahkan transaksi beli nomor togel bisa dengan SMS saja,” kata salah seorang warga Kota Langsa yang minta namanya dirahasiakan. Menyikapi maraknya togel di Langsa,Wakil Ketua Majelis Permusyawaratan Ulama (MPU) Kota Langsa Alamsyah Abubakardin kepada wartawan, Minggu (23/5) mengatakan, dengan maraknya peredaran togel hingga masuk ke desa-desa menunjukkan lemahnya kinerja

Ratusan PNS Aceh Singkil Mangkir

Wilayatul Hisbah (WH) selaku aparat penegak Syariat Islam. Apalagi dengan status diberlakukannya Syariat Islam di Aceh, seharusnya keberadaan judi togel tidak boleh ada dan harus segera diberantas. “Kami sebelumnya selalu mendapat teguran dari beberapa masyarakat Kota Langsa melalui SMS handphone mereka, bahwa judi togel di Langsa sudah berkembang biak dan leluasa, sampai-sampai para ibu rumah tangga setiap harinya membahas tentang togel,” ucap Alamsyah Abubakardin. Alamsyah Abubakardin menambahkan, kalau pihak Wilayatul Hisbah (WH) Pemko Langsa, tidak segera mengambil tindakan dan membiarkan mereka melakukan maisir (judi), tentu masyarakat akan semakin tersesat. Karena itu Alamsyah mengatakan pihaknya MPU Kota Langsa meminta kepada pihak Wilayatul Hisbah (WH) Kota Langsa, agar melakukan penangkapan serta memberi himbauan terhadap pelaku maisir (judi) togel yang belum sempat berlarut untuk perbuatan dosadosa mereka, katanya. Sementara Kepala Satpol PP dan WH Kota Langsa Syahbainur yang dikonfirmasi, Minggu (23/5), tidak berhasil ditemui. Bahkan ponsel yang bersangkutan saat dihubungi juga tidak aktif. (ts)

2.325 Honorer Belum Diangkat CPNSD Di Aceh Tamiang KUALASIMPANG (Waspada): Sebanyak 2.325 orang tenaga honorer yang bertugas di berbagai Satuan Kerja Perangkat Daerah (SKPD) di lingkungan Pemkab Aceh Tamiang belum ada ‘sinyal’ diangkat langsung sebagai Calon Pegawai Negeri Sipil Daerah (CPNSD) dari formasi honorer di Kabupaten Aceh Tamiang. “Sampai saat ini belum ada tanda-tanda atau sinyal dari Pemerintah Pusat untuk mengangkat langsung tenaga honorer tersebut menjadi CPNSD di daerah ini,” terang Sekretaris Badan Kepegawaian Pendidikan dan Pelatihan ( BKPP) Kabupaten Aceh Tamiang, Zulkarnain,SE menjawab pertanyaan Waspada di ruang kerjanya, pekan lalu. “Jumlah tenaga honorer sebanyak 2.325 orang itu namanya tidak tercantum dalam data base atau buku putih,” ungkap Zulkarnain. Sedangkan tenaga honorer yang namanya masuk dalam data base semuanya sudah diangkat menjadi CPNS/PNS. Sekretaris BKPP Aceh Tamiang itu juga merincikan jumlah tenaga honorer yang masuk buku data base tercatat 1.746 orang, tetapi jumlah sebenarnya tidak sebanyak itu karena ada

nama ganda (double), berhenti dan ada yang sudah meninggal dunia. “Tetapi tidak bisa dilakukan penyisipan,” kata Zulkarnain. Menurut Zulkarnain, tenaga honorer yang namanya masuk data base sudah diangkat menjadi CPNS/PNS di Aceh Tamiang, rincinya tenaga penyuluh 13 orang, tenaga kesehatan 256 orang, guru 700 orang dan tenaga teknis 772 orang. “Mereka adalah yang mengantongi SK Honorer 2005 ke bawah terhitung Januari 2005. Tenaga honorer yang namanya masuk data base semuanya sudah diangkat langsung menjadi CPNS/PNS dari formasi honorer,” sebut Zulkarnain. Sedangkan jumlah honorer sekarang 2.325 orang yang SK-nya terhitung Juni 2005 hingga yang diperpanjang Januari 2010. Jadi total semuanya 2.325 orang, tambahnya. Zulkarnaen juga tak menampik berdasarkan PP Nomor 46 Tahun 2005, Pemerintah Pusat sudah melarang atau tidak dibenarkan lagi menerima tenaga hohonrer. “Tetapi karena kebutuhan, maka ada pengangkatan tenaga honorer di Aceh Tamiang,” kata Zulkarnain.(b24)

Pertamina Lakukan Penajakan Sumur RK 2010 KUALASIMPANG (Waspada): PT Pertamina EP Field Rantau, Jumat (21/5) melakukan penajakan Sumur RNT-SZ9 di Desa Kebun Rantau, Kecamatan Rantau, Kabupaten Aceh Tamiang, sekitar 10 km arah Timur kota Kuala Simpang. Kegiatan tersebut merupakan penajakan RK (Rencana Kerja) 2010. Menurut pihak Pertamina Rantau, lokasi RNT-SZ9 ditajak menggunakan Rig. CWKT 210B / 2A milik PDSI (Pertamina Drilling Service) berkapasitas 400 HP hingga mencapai kedalaman akhir ± 1000 mTVD (meter True Vertical Deep) dari lantai bor, dengan jangka waktu pelaksanaan 27 hari kerja operasional. Tujuan pengeboran untuk menghasilkan

GAMBA TANYO

> Kirim foto dari kamera handphone ke 08192

PLAFON SD NEGERI AMBRUK

hidrokarbon di struktur Rantau, khususnya lapisan Z-420. Struktur Rantau yang sudah lama tidak aktif untuk beroperasi, dan sekarang mulai aktif lagi setelah keberhasilan sumur P-399 yang berproduksi dari Z-770 ( 744 – 746 m ). Kemudian Sumur RNT-SZ9 ini setelah berproduksi menjadi sumur P-400. Field Manager Rantau, Toto Suhartono mengimbau pekerja dan pekarya mematuhi serta mentaati aturan-aturan perminyakan dalam menjalankan tugas untuk menghindari hal-hal yang dapat menghambat atau merugikan perusahaan, menerapkan manajemen lingkungan yang baik serta mengutamakan keselamatan dan kesehatan kerja.(b24)

11 01 47

Siswa SD Negeri Pucok Alue Dua, Kecamatan Simpang Ulim, Kabupaten Aceh Timur, sedang belajar mengajar di ruang kelas yang plafon dan sebagian atapnya sudah ambruk. Kondisi ini sudah dilaporkan ke Dinas Pendidikan Aceh Timur. namun sampai sekarang diperbaiki. Kiriman Sazli, Simpang Ulim, Aceh Timur. 0813970987xx

SINGKIL ( Waspada): Sedikitnya seratusan PNS di jajaran Pemkab Aceh Singkil tidak melaksanakan tugas alias mangkir, demikian Kepala Badan Kepegawaian Pendidikan dan Pelatihan Kab. Aceh Singkil H. Mukmin Saraan SH.MA melalui Kepala Bidang Pembinaan dan Pengembangan Sumber daya Aparatur Muzakir SH kepada Waspada, Senin (24/5) di ruang kerjanya. Mangkirnya PNS yang bertugas di kantor, badan, dinas, dan Setcam dalam wilayah Kerja Pemerintah Aceh Singkil menurut Muzakir, sudah melampau

batas toleransi kerja PNS dan melanggar Disiplin PNS PP No. 30 Tahun 1980. Dari laporan yang diterima kata Jakir, kebanyakan PNS tidak melaksanakan tugas mencapai tiga bulan berturut–turut. Bahkan ada di antara mereka yang masih berstatus CPNS yang sudah mendapat dua kali teguran dari pimpinan unit kerja karena dalam satu bulan hanya bertugas 10 hari dalam satu bulan. Untuk itu kepada PNS yang mangkir diharapkan agar kembali melaksanakan tugas seperti biasa. “Jika teguran yang telah disampaikan tidak diindahkan,

kita tidak akan segan-segan mengambil tindakan tegas. Status kepegawaiannya akan terancam,“ sebut Jakir. Adapun PNS dan CPNS yang telah mendapat teguran satu dan dua dari pimpinan SKPD di antaranya staf Sekcam Simpang Kanan, Suro, Kantor Satpol PP dan Sekretaris KPU Aceh Singkil. Rendah Selain banyaknya PNS dan CPNS yang mangkir dalam melaksanakan tugas, disiplin PNS di jajaran Pemkab Aceh Singkil juga tergolong rendah. Kepala Bagian Humas dan Protokol Set-

dakab Aceh Singkil H. Khaldum BK.SE kepada Waspada di tempat terpisah mengaku banyak PNS yang absen pada upacara peringatan 102 tahun Hari Kebangkitan Nasional yang dirangkaikan dengan apel bersama setiap tanggal 17, bulan berjalan yang belangsung di halaman kantor Bupati Aceh Singkil belum lama ini. “Dari rekap absen yang kita terima banyak PNS, pejabat eselon yang absen dan sudah kita laporkan kepada Bupati Aceh Singkil agar diambil tindakan tegas,“ sebut Khaldum.(cb02)

IDI CUT, Aceh Timur (Waspada): Belasan ribu warga dalam 45 desa di Kecamatan Darul Aman—Idi Cut, Kab. Aceh Timur, butuh Stasiun Pompa Bensin Umum (SPBU). Pasalnya, selama ini warga harus menempuh perjalanan ke luar kecamatan untuk mendapatkan Bahan bakar Minyak (BBM). “Masyarakat mengeluh, terutama ratusan nelayan di Kuala Idi Cut, dimana selama ini warga harus menempuh 12 Kilometer ke timur dan ke barat untuk memenuhi BBM,” sebut Camat Darul Aman, Muhammad Ikbal, S.Pd, kepada Waspada, Minggu (23/5). Menurutnya, Idi Cut sudah selayaknya dibangun SPBU. Alasannya, selain makin bertambahnya banyak kendaraan yang memakai BBM, di sana juga telah dicanangkan akan dibangun jalan elak yang tembus ke Kec. Peudawa. “Jika dibangun secepatnya, maka peluang percepatan ekonomi lebih meningkat,” kata Ikbal seraya mengatakan, hal itu diungkapkannya menyusul banyaknya permintaan animo yang meminta agar di Idi Cut dibangun SPBU. Dia mengaku, sejak merdeka hingga kini masyarakat dalam 45 desa disana untuk memdapatkan BBM harus keluar ke Kec. Julok dan Ke Idi Rayeuk ataupun ke Peudawa, “karena di Idi Cut tidak ada SPBU, tapi jika SPBU tersedia di sana, maka masyarakat dapat hemat biaya transportasi,” katanya. Ketika disinggung lokasi yang cocok untuk dibangunnya SPBU? Ikbal tidak mengintervensi titik yang harus dibangun SPBU di Kecamatan Darul Aman, namun dia menyerahkannya sepenuhnya kepada investor yang akan membangunnya. “Titik lokasi yang akan dibangun terserah pengusaha, namun intinya di Idi Cut butuh SPBU,” tandas putra pertama Alm. H. Ishak, itu.(cmad)

Listrik Sering Padam, Masyarakat Kutuk PLN KUALASIMPANG (Waspada): Masyarakat Kecamatan Bendahara Kabupaten Aceh Tamiang mengutuk PT. PLN ( Persero) yang sering melakukan pemadam aliran listrik dan merugikan pelanggan. “Setiap malam aliran listrik dipadamkan dan ini sangat merugikan masyarakat,” ungkap tokoh masyarakat SungaiYu, Kecamatan Bendahara, Tgk Saiful melalui telepon selularnya, Kamis (20/5) malam. Saiful menerangkan, pemadaman listrik biasanya dilakukan menjelang maghrib sampai tengah malam. “ Seperti Kamis malam akibat pemadaman anak-anak tidak bisa belajar dan mengaji. Selain itu aktivitas masyarakat juga terganggu akibat listrik dipadamkan tanpa ada penjelasan,” kata Saiful.

Saiful menambahkan, masyarakat tidak tahu mau mengadu ke mana karena pihak PLN menerapkan manajemen sepihak, yaitu jika pelanggan telat bayar rekening dikenakan denda dan jika sampai tiga bulan menunggak aliran listrik pelanggan langsung diputus. “Tapi jika mereka memadamkan aliran listrik , mereka tidak pernah memberikan kompensasi kepada masyarakat atau pelanggan yang telah dirugikan,” kata Saiful. Manager PT. PLN ( Persero) Wil-NAD Cabang Langsa, Ranting Kualasimpang, Irwan Pakeh ketika dikonfirmasi, Jum’at (21/ 5) sedang tidak ada di kantornya. Menurut sekuriti PLN, Irwan Pakeh sedang ke Rantau ada tugas di Sub Ranting PLN.(b24)

Waspada/Tarmizi Ripan

DIPERTANYAKAN: Puluhan konsumen pengguna bahan bakar minyak (BBM) antre berjam-jam di sentral pengisian bahan bakar umum (SPBU) Subulussalam. Mereka kecewa karena SPBU yang lebih dikenal galon bernomor 14. 237. 452 itu tidak bisa melayani konsumen dengan alasan petugas ‘listrik mati’. Sementara SPBU di Penanggalan, Kota Subulussalam bisa melayani konsumen dengan cara menggunakan mesin genset listrik. Foto direkam belum lama ini.

Punahnya Hutan Peunaroen… TERIKNYA matahari melengkapi panasnya alam. Sedetik teringat, hari itu cuaca sangat tidak bersahabat dengan beberapa insan pers bersama tim KSDA Aceh yang masuk ke pedalaman Aceh Timur, Provinsi Aceh, persisnya di Desa Peunaroen Baroe, Kecamatan Peunaroen. Setelah menempuh perjalanan hampir 75 Kilometer menelusuri Simpang Gampong Beusa-Lokop, menggunakan kendaraan roda empat jenis Doble Cabin, akhirnya tiba di sebuah lokasi persis di Dusun Rawa Pakes, Desa Peunaroen Baroe. Di sana bersama aparatur desa dan masyarakat tim terlihat perbincangan serius seputar kondisi amukan gajah yang belakangan kerap terjadi. Ternyata dari beberapa pertanyaan yang dilemparkan, sejumlah jawaban dapat disimpulkan bahwa, mengamuknya satwa liar berbadan jumbo itu akibat perambahan hutan dan pembukaan lahan baru hingga membuat hutan Peunaroen, itu, punah. Ketika dibandingkan sebelum tahun 2005, hutan itu masih tergolong baik. Kondisi hutan yang terlihat alami sangat memikat dan bersahabat satwa liar di sana dengan penduduk. “Dulu jangankan terjadi amukan gajah, tapak (bekas perjalanan) gajah sekalipun tidak pernah kita lihat,” ujar Bukhari, warga setempat kepada Waspada pekan lalu. Usai makan siang dan shalat bersama, tim bersama Waspada kembali melanjutkan perjalanan menelusuri jalan setapak. Di Dusun Rawa Pakes, desa setempat terlihat sejauh mata memandang hutan telah gundul dijadikan lahan perkebu-

nan. Sebagian warga yang ikut bersama tim mengatakan lahan yang digarap tersebut telah disertifikatkan. Melihat kondisi tersebut, sangat tidak layak disana harus ada pembukaan lahan dengan alasan perkebunan dan pertanian warga. Pasalnya, daerah yang itu masuk dalam Kawasan Ekosistem Lauser (KEL). “Ini dulunya hutan, tapi sekarang telah menjadi lahan perkebunan warga,” ujar Sudarmansyah, Geuchik Peunaroen Baroe. Beberapa gubuk (pondok— red) yang terbuat dari kayu itu kini tinggal kerangka. Tidak ada lagi dinding atau atapnya. Lantai gubuk pun hanya tinggal potongan-potongan batang kayu berdiameter kecil berjejer tanpa papan di atasnya, bahkan lokasi di sekeliling gubuk sudah terang benderang. Beberapa warga mengatakan, kondisi spontan berubah setelah terjadi amukan gajah belum lama ini. Lelah rasanya, air miniral dalam botol terus diteguk. Muhammad H.Ishak wartawan Waspada yang ikut menelusuri hutan Peunaroen, melihat kondisi hutan di kawasan yang terpaut beberapa kilometer dari pemukiman penduduk itu telah punah. Buktinya, selain banyak lokasi yang telah digarap dan hutannya ditebang, beberapa lokasi juga terdengar suara sinsaw (mesin pemotong kayu— red). “Itu suara chainsaw, dan ini membuktikan bahwa aksi penebangan hutan masih terjadi disini,” ujar seorang personel KSDA Aceh menyahuti pertanyaan Waspada yang berjalan di belakangnya. Hutan dengan pohon-pohon besar yang dahulu memenuhi halaman gubuk sudah tidak kelihatan lagi dan

berganti dengan pohon-pohon kelapa sawit kecil yang baru ditanam. Hutan Peunaroen, dahulunya sangat bagus dan indah, bahkan hutan yang dipenuhi pepohonan alam, tinggi menjulang nan asri itu luasnya hingga ke Lokop, Kecamatan Serbajadi dan Simpang Jernih. Namun,saatWaspada mendatangi kawasan itu pada akhir pekan lalu, nyaris tidak ada lagi sisa keasrian hutan yang notabenya tercatat sebagai hutan alam dan masuk dalam KEL. Pemandangan di sana kini tidak ubahnya seperti lokasi perusahaan perkebunan kelapa sawit. Di mana-mana yang terlihat hanya kelapa sawit dan kelapa sawit. Kalaupun ada pemandangan berbeda, sesekali terlihat pepohonan karet yang tidak terawat. Tidak tampak lagi pepohonan besar, kecuali satu

dua yang masih dibiarkan hidup tinggi menjulang di hamparan pepohonan lainnya. Kondisi hutan Peunaroen sudah hilang kealamiannya. Sekarang ini yang terlihat hanya hamparan kebun kelapa sawit milik sejumalah perusahaan, seperti milik PT Puti Hijau. Hutan Peunaroen memang nyaris tinggal nama saja. Padahal, pada tahun 2004 ke bawah, hutan itu cukup alami, namun kini telah tercemar dan punah dengan sejumlah aksi manusia, baik melalui pembukaan lahan baru maupun dengan penebangan liar yang luasnya mencapai ribuan hektar. Bupati Aceh Timur, Tgk. Muslim Hasballah telah berulangkali menerima laporan terkait punahnya hutan Peunaroen. Namun hingga kini belum ada upaya yang dapat menghentikan aksi pembukaan

lahan baru disana. Berawal dari perambahan hutan, secara otomatis menjadi masalah baru di wilayah pantai timur Aceh, itu. Setelah aksi harimau di Kecamatan Julok,kini ditambah dengan masalah aksi kawanan gajah liar yang kian mengganas hingga merubuhkan ratusan pondok dan puluhan rumah. Kendati masyarakat banyak yang mengungsi akibat amukan gajah, namun lokasi mengganasnya gajah kini terus dijadikan lokasi penggarapan lahan baru oleh masyarakat. tidak diketahui siapa yang salah dibalik punahnya hutan Peunaroen? Namun pemerintah satu-satu pihak yang harus membatasi dan menurunkan tim ke lapangan mengecek areal lauser yang telah punah akibat penebangan liar dan pembukaan lahan baru… Muhammad H. Ishak

Waspada/Muhammad H. Ishak

PUNAH: Gumpulan asap mewarnai aktivitas warga di kawasan hutan Peunaroen, Kab. Aceh Timur. Foto diambil pekan lalu.


Opini

C6

WASPADA Selasa 25 Mei 2010

Kerjasama Ekonomi Indonesia Singapura Oleh Bachtiar Hassan Miraza Kerjasama Kawasan Batam, Bintan dan Karimun ini menyangkut masalah hidup matinya Singapura masa depan. Jadi Indonesia harus mendapat manfaat yang setimpal, jangan “dijual murah”

TAJUK RENCANA

Anas Calon Presiden Pengganti SBY 2014

P

emerintahan Presiden Susilo Bambang Yudhoyono (SBY) dan Wapres Boediono baru setahun, namun Partai Demokrat kelihatannya sudah mulai ‘’menggadang-gadang’’ nama Anas Urbaningrum, pasca terpilih sebagai Ketua Umum DPP Partai Demokrat periode 2010-2015 di Bandung kemarin. Pujian dan harapan banyak dialamatkan pada sosok tokoh muda yang 15 Juli 2010 nanti baru genap berusia 41 tahun. Dialah ketua umum partai termuda saat ini, dan memimpin partai terbesar (Demokrat) pula pemenang pemilu 2009 dengan lebih 20 persen suara. Lompatan suara Demokrat lebih 200 persen pada pemilu lalu memang bukan semata-mata kerja Anas karena posisinya di partai belum sampai di level atas. Dalam tim sukses Pilpres SBY – Boediono pun posisi Anas hanya anggota. Namun ia (Anas) mampu menjiwai kerjanya dan bekerja tanpa pamrih. Dan satu lagi kelebihannya, Anas memiliki kesantunan dalam berpolitik sehingga ciri khas SBY yang santun melekat kuat pada sosoknya yang kalem ketimbang banyak tokoh kader Demokrat lainnya. Luar biasa hasil yang diperoleh Anas dalam Munas-II Partai Demokrat yang berlangsung demokratis dan terbuka itu. Dalam putaran kedua pemilihan ketua umum, Anas menyingkirkan Marzuki Alie dengan meraih suara 280 melampaui raihan Marzuki 248 suara. Padahal, Andi Mallarangeng yang gagal di putaran pertama — hanya memperoleh 80-an suara— sudah memberi isyarat ‘’berkoalisi’’ dengan Marzuki Alie, namun berkat kecerdasan peserta Munas akhirnya terpilihlah tokoh muda sebagai ketua umum, sehingga wajar saja kalau Anas disebut-sebut bakal ditampilkan dalam Pilpres 2014 nanti menggantikan SBY yang sudah dua periode. Pada Pilpres 2014 nanti usia Anas memasuki 45 tahun menjadi sangat fenomenal kalau melihat selama masa Orde Baru hingga saat ini belum ada tokoh di bawah usia 50 tahun tampil dalam Pilpres. Lawan-lawan Anas nanti diperkirakan masih tokoh tua seangkatan dengan orang tuanya, kalau saja Megawati, Amien Rais, Wiranto, Surya Paloh, Aburizal Bakrie, Prabowo masih nekat mencalonkan diri. Hemat kita, persaingan dalam Pilpres 2014 lebih berpeluang memajukan tokoh Intisari muda. Besar kemungkinan Anas akan bersaing dengan Puan Maharani (putri MegaAnas sosok politisi san- wati),YennyWahid (putri Gus Dur), maupun muda dari PKS, Golkar, PAN dll. Detun,identik dengan SBY. tokoh ngan demikian kepemimpinan Anas akan Usianya relatif muda, kaya diuji dalam kiprahnya sebagai ketua umum setidaknya dalam empat tahun ini. gagasan dan visi; pantas partai, Jika perolehan suara Demokrat pada pemilu jadi pemimpin masa depan dan Pilpres 2014 lebih baik, apalagi kalau target yang dicanangkan Anas tercapai (30 persen), tidak akan ada yang bisa menahan Anas untuk maju sebagai Capres dan berpeluang besar menggantikan SBY sebagai orang nomor satu di republik ini. Tak pelak lagi terpilihnya Anas sebagai ketua umum merupakan cerminan dari kader yang bekerja keras, mau turun ke bawah dan membawakan politik santun yang selalu didengung-dengungkan oleh Ketua Dewan Pembina Partai Demokrat Susilo BambangYudhoyono. Karakter Anas memang identik dengan SBY, tidak meledakledak dan memiliki visi memajukan partai ke depan. Memang kualitas kinerja Anas pantas diberi apresiasi. Anas maju dalam MunasII berkat dukungan kader militan dari kalangan arus bawah yang menolak politik uang dalam suksesi, semata-mata ingin membesarkan partai. Walaupun dari segi finansial Anas kalah dari Andi Mallarangeng yang menjabat Menpora dan Marzuki Alie yang menjabat Ketua DPR, namun pendukung Anas tetap kokoh dan bergeming mencalonkannya. Hasilnya sungguh luar biasa. Anas menang dengan mengalahkan seniornya di partai. Banyak faktor yang menjadi barometer kemenangan Anas, namun faktor kenetralan SBY sebagaimana ditekankan Ketua Dewan Pembina sekaligus Pencetus dan Pendiri Partai Demokrat itu menjadi ‘’faktor utama’’ karena banyak peserta Munas-II yang semula mendukung Andi karena didukung Ibas, putranya SBY, akhirnya balik memilih Anas. Sebab, SBY menekankan tidak ada putra mahkota, tidak boleh menggunakan ‘’money politics’’ dan harus menggunakan hati nurani. Sejumlah faktor pendukung kemenangan atau nilai lebih Anas yang tidak dimililiki kandidat lain (Andi dan Marzuki) adalah Anas lebih dekat dengan pengurus dan kader Demokrat di berbagai daerah selama lima tahun ini. Karena keunggulan itu pulalah Anas dapat memenangi pertarungan tanpa membeli suara. Berkat kedekatan yang sudah lama terbangun itu dan menjaganya terus sampai Munas-II berlangsung membuat upaya Andi dan Marzuki yang terbilang baru menjelang Munas-II baru berupaya menarik simpati arus bawah menjadi gagal. Kemenangan Anas merupakan kemenangan pesta demokrasi tanpa ‘’money politics’’ dan semata-mata berdasarkan kualitas calonnya. Kalaupun ada pihak yang menggunakan politik uang nyatanya kalah dibuat keinginan besar para kader yang menginginkan Demokrat semakin besar setelah melewati masa transisi ketergantungannya dengan SBY.+

Hubungi kami KANTOR PUSAT

Penerbit: PT Penerbitan Harian Waspada

Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002

KANTOR PERWAKILAN  Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817.  Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385  Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109  Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan hitam-putih Rp. 33.000,Halaman depan berwarna Rp. 90.000,Ukuran kolom: 40,5 mm E-mail Iklan: iklan@waspadamedan.com

K

unjungan Presiden Susilo Bambang Yudhoyono beserta para menteri ke negara Singapura dan Malaysia tanggal 16-19 Mei lalu mungkin lebih baik jika dibandingkan dengan kunjungan ke negara lain untuk menciptakan kerjasama ekonomi. Ketiga negara ini merupakan negara yang berada dalam satu kawasan ASEAN yang memiliki kepentingan ekonomi yang sama dan lebih nyata. Kerja sama ekonomi berdasarkan kawasan, jauh lebih penting dari kerjasama ekonomi internasional lainnya karena dapat menciptakan sinergi ekonomi yang lebih kuat bagi masing masing negara yang bekerjasama. Saat ini di kala persaingan ekonomi semakin ketat dan kemajuan teknologi yang semakin tinggi tapi di tengah sumberdaya alam yang semakin terbatas, tidak ada lagi negara yang tidak membutuhkan kerjasama, khususnya kerjasama ekonomi. Berdasarkan itulah mengapa kunjungan Presiden ke Singapura dan Malaysia dikatakan penting bagi memperkuat kerjasama ekonomi Indonesia dengan kedua negara. Dalam pertemuan di Singapura dihasilkan enam kesepakatan dengan membentuk enam kelompok kerja bagi menciptakan suatu kerjasama ekonomi kedua negara. Keenam kelompok kerja itu menyangkut bidang Kerjasama Kawasan Batam, Bintan dan Karimun, bidang investasi, bidang transportasi udara, bidang pariwisata, bidang tenaga kerja, bidang bisnis pertanian. Yang menarik dari keenam bidang ini adalah bidang Kerjasama Kawasan Batam, Bintan dan Karimun. Pasti dari keenam bidang yang dibahas, yang paling penting bagi Singapura adalah bidang ini. Sementara bidang lainnya kurang penting karena tanpa Indonesia pun Singapura bisa melakukan kerjasama ekonomi. Apalagi struktur perekonomian Singapura tidak sama dengan

struktur perekonomian Indonesia. Tapi bukan berarti lima bidang lainnya tidak perlu. Ia tetap diperlukan sebagai aktifitas ekonomi biasa. Mengapa demikian? Singapura mungkin tidak memiliki masalah ekonomi secara khusus sehingga Singapura bisa santai menghadapi masalah ekonomi sebagaimana lumrahnya. Tidak seperti Indonesia yang tidak pernah mampu menyelesaikan masalah ekonominya. Yang sangat penting dari keenam kerjasam a i t u bagi Singapura adalah masalah Kerjasama Kawasan Batam, Bintan dan Karimun. Ini menyangkut masalah hidup matinya Singapura masa depan. Kita maklumi Singapura adalah negara yang perekonomiannya sangat maju, yang terus berkembang tapi dihadapkan dengan luas negara yang terbatas. Bagaimana mungkin Singapura bisa mempertahankan dan mendorong perkembangan perekonomiannya jika sumberdaya alamnya terbatas. Ini suatu masalah pokok dan penting bagi Singapura. Singapura menyadari akan kekurangannya. Oleh sebab itu Kerjasama Kawasan Batam, Bintan dan Karimun sangat penting baginya. Tak ada suatu negara yang dapat mempertahankan kekuatan ekonominya tanpa ada sumberdaya alam (kawasan) karena tidak ada kegiatan

ekonomi tanpa ada sumberdaya alam. Jadi Singapura menghadapi suatu masalah pelik jika ia tidak bisa memperluas daerah kerjanya seperti yang dilakukan oleh Jepang saat ini. Singapura dan Jepang memiliki masalah yang sama yaitu keterbatasan sumberdaya alam. Jepang telah berhasil memperluas kawasan kerja ekonominya dengan menciptakan kerjasama dengan hampir seluruh negara di dunia dalam memanfaatkan potensi ekonomi negara mitranya di bidang industri dan perdagangan. Sesuai dengan kondisi saat ini, kepemilikian atas sebuah kawasan tidaklah penting. Mungkin pun tidak efisien jika dikaitkan dengan biaya manajemen pemerintahan yang dikeluarkan negara. Yang penting adalah bagaimana dapat memanfaatkan kawasan tersebut bagi keperluan ekonomi. Bukan kepemilikannya yang penting tapi kesempatan memanfaatkannya. Itulah kira kira prinsip kerjasama yang dilakukan Singapura maupun Jepang. Hal ini hendaknya menj a d i perhat i a n pemerintah Indonesia dalam setiap pembahasan Kerjas a m a Kawasan Batam, Bintan dan Karimun. Indonesia harus menyadari betapa pentingnya arti kawasan tersebut bagi Singapura dan Indonesia harus mengambil manfaat maksimal dari kepentingan Singapura ini. Jangan mudah memberi pemanfaatan sumberdaya alam ke negara manapun dengan mendapatkan manfaat yang tidak setimpal. Sumberdaya alam adalah pemberian dariYang Maha Kuasa dan tak suatu negara pun yang mampu menciptakannya bagi perluasan negaranya. Ketersediaan sumberdaya alam memiliki kecenderungan semakin menurun

sementara kebutuhannya memiliki kecenderungan yang semakin meningkat. Ini memberi isyarat bahwa pada masa mendatang negara yang memiliki sumberdya alam yang melimpah akan jauh lebih kuat dari negara yang menguasai teknologi. Mungkin banyak yang terperanjat. Tapi harus disadari bahwa tak ada gunanya teknologi jika tidak ada sumberdaya alam. Garapan teknologi adalah sumberdaya alam, baik dilihat sebagai sumber bahan baku ataupun tempat beraktifitas. Oleh sebab itu kita sedikit kecewa dengan pernyataan Presiden di dalam konferensi pers di Singapura yang memuji dan mengatakan Singapura akan mengembangkan Kawasan Batam, Bintan dan Karimun yang akan berpengaruh bagi pembangunan daerah setempat. Seolah-olah Indonesia berterima kasih pada Singapura. Padahal tidak demikian. Singapuralah yang seharusnya berterima kasih kepada Indonesia karena tanpa kawasan ini pembangunan ekonomi Singapura akan stagnan. Yang dikhawatirkan dari pemikiran Presiden adalah Indonesia akan menjual murah pemanfaatan sumberdaya alamnya (kawasan) kepada Singapura seperti yang terjadi pada masa lalu. Di samping itu Indonesia juga harus mengkaji apa manfaat yang telah diperoleh masyarakat daerah terhadap kerjasama yang lalu. Seperti dimaklumi kerjasama kawasan ini sudah berlangsung lama. Saat ini hanya untuk perluasan dan penguatannya saja untuk memperkuat makna kerjasama itu. Kawasan ini telah berkembang tapi dinikmati oleh Singapura dan kaum pendatang. Penduduk asli setempat (pribumi) tetap saja miskin. Hal seperti ini hendaknya juga dikaji oleh pemerintah Indonesia. Pada dasarnya kita sepakat untuk melanjutkan dan memperkuat kerjasama kawasan ini dengan Singapura. Tapi tentu dengan perolehan manfaat yang setimpal dan dengan memperhatikan kepentingan masyarakat pribumi setempat. Jangan jual sumberdaya alam sebagai barang rongsokan dan jangan biarkan masyarakat pribumi melarat ditengah kemakmuran Singapura dan kaum pendatang. Penulis adalah pemerhati ekonomi

Keperkasaan Rupiah Perlu Dicermati Oleh Edismar C. Nainggolan Penguatan rupiah melemahkan daya saing ekspor Indonesia dan pergerakan rupiah dapat terjadi sewaktuwaktu dikarenakan kepanikan pelaku dan terjadinya anomali pasar

N

ilai tukar rupiah terhadap dolar Amerika Serikat (US$) belakangan ini terus menunjukkan penguatan (apresiasi) dan menunjukkan ketangguhan, dari Rp. 9.335.- (05 Januari) menjadi Rp. 9.030.- per US$ (04 Mei 2010). Ada beberapa hal penting yang dapat dikemukakan penyebab terjadinya penguatan rupiah tersebut, dan langkah antisipasi yang perlu dilakukan untuk menghadapi dampaknya di hari esok. Dalam World Economic Outlook (WEO) edisi April 2010 oleh Dana Moneter Internasional (International Monetary of Fund/IMF) disebutkan adanya koreksi atas proyeksi pertumbuhan ekonomi global yang disampaikan IMF pada awal tahun 2010, yaitu dari 3,25% menjadi 4,2%. Perbaikan tersebut juga merupakan salah satu faktor pemicu menguatnya rupiah terhadap dolar Amerika Serikat (AS). Di lain pihak, harus diakui bahwa tata ekonomi global telah berubah-dolar AS yang dahulu sangat perkasa dan sangat dominan serta dapat mendikte perekonomian dunia kini makin ditinggalkan oleh para pelaku ekonomi. Banyak juga negara mulai menghindari untuk menyimpan dolar AS dan mengalihkan asetnya dalam bentuk surat berharga, logam mulia, atau mata uang lain yang lebih kuat. Artinya, bahwa tingkat kepercayaan publik terhadap dolar terutama kalangan pengusaha semakin merosot terutama sejak lembaga finansial Amerika Serikat yang telah menyebabkan perekonomian global masuk ke dalam jurang krisis ditambah adanya pembengkakan defisit anggaran pemerintah Presiden Barack Obama, telah semakin membuat dolar AS semakin tidak kompetitif. Dalam pada itu, perekonomian Indonesia pada 2010 diperkirakan tumbuh 6,0 – 6,7%, lebih besar dibanding perkiraan semula 5,0% hingga 5,5%, sedangkan pertumbuhan ekonomi triwulan I-2010 yang semula diperkirakan 4,8%, oleh akibat kondisi ekonomi domestik dan global yang kondusif maka tingkat pertumbuhannya menjadi 5,7% atau jauh lebih besar dibanding pertumbuhan ekonomi triwulan I – 2009, 4,4%. Otoritas moneter juga akan melaku-

kan upaya untuk mengelola risiko dengan mempertahankan stabilitas moneter dan stabilitas sistim keuangan. Sejumlah langkah yang ditempuh, antara lain mengelola ekses likuditas di pasar uang dan perbankan agar kondusif bagi upaya memelihara stabilitas moneter dan stabilitas sistim keuangan sambil tetap mempertahankan suku bunga acuan (BI Rate) pada tingkat 6,5 persen. BI Rate dalam level itu diyakini masih kondusif bagi upaya memperkuat proses pemulihan perekonomian, menjaga stabilitas keuangan, serta mendorong intermediasi perbankan dan sekaligus juga akan dapat menahan perkiraan laju inflasi tahun 2010 sebesar 5 %. Sementara itu, lembaga pemeringkat utang internasional, Standard & Poors (S&P) telah menaikkan peringkat kredit Republik Indonesia dari BB- menjadi BB dengan outlook positif. Sehingga posisi peringkat utang Indonesia ada pada satu notches atau tingkatan lagi ke peringkat utang tertinggi dan yang didam-idamkan oleh semuan negara, yakni investment grade. Peningkatan peringkat kredit tersebut mencerminkan adanya perbaikan didalam pengelolaan fiskal melalui upaya untuk menurunkan rasio utang terhadap Produk Domestik Bruto (PDB) – dari 32 % (2008) menjadi 29 % (2009), termasuk peningkatan cadangan devisa Indonesia secara terus menerus (Januari 69,56 miliar USD, Februari 69,73 miliar USD, dan Maret 71, 40 miliar USD). Dalam pada itu, menguatnya IHSG sebesar 10,2% selama triwulan I-2010 merupakan dukungan dari pertumbuhan ekonomi yang cukup tinggi, 5,4% pada triwulan IV-2009 serta disertai dengan perbaikan sovereign bond rating oleh S&P dan Fitch yang menyebabkan IHSG mampu mencetak pertumbuhan tertinggi dibandingkan dengan 3 negara kawasan. Aspek pendukung lainnya adalah, kemampuan sebagian besar perusahaan yang telah melakukan rilis laporan keuangan dan membukukan laba operasional - bahkan di antaranya mampu meningkatkan laba operasional. Ratarata peningkatan laba operasional pada tahun 2009 sebesar 23% (yoy). Dan sejalan dengan membaiknya indikator

profitabilitas, terdapat juga kecenderungan Debt to Equity Ratio (DER) yang menurun. Posisi DER rata-rata emiten turun dari 3,7% pada tahun 2008 menjadi 3,1% pada tahun 2009. Sementara itu, membaiknya risiko di pasar keuangan global pada gilirannya mendorong aliran modal asing ke pasar Surat Berharga Negara (SBN). Dimana pada triwulan I-2010 net beli asing di pasar SBN mencapai sekitar Rp 24 triliun ke pasar SBN atau naik dibandingkan dengan net beli asing pada triwulan IV2009, yang hanya berkisar Rp14 triliun. Implikasi apresiasi rupiah Penguatan rupiah memiliki dampak tertentu terhadap perekonomian. Pertama, penguatan rupiah telah menjadikan pertahanan ekonomi nasional semakin tangguh, dan oleh karenanya inflasipun terus mengalami penurunan ; dari 0,84% pada bulan Januari, 0,30% pada bulan Februari, dan terjadi deflasi (0,14) pada bulan Maret 2010. Sehingga inflasi kalender (Januari-Maret) sebesar 0,99 persen. Kedua, apresiasi rupiah terhadap dolar diperkirakan telah menjadi salah satu penyebab berkurangnya tekanan terhadap inflasi (imported inflation) dan meningkatkan daya beli, serta yang menjadi salah satu penyebab meningkatnya nilai impor beberapa produk tertentu asal China dimana selama bulan Maret 2010 naik hingga 67,3% dari US$100,56 juta dibanding dengan US$ 60,11 juta pada periode yang sama tahun lalu. Ketiga, penguatan rupiah juga akan dapat ; mengurangi tekanan neraca pembayaran atas impor 65 persen bahan baku, 22 persen barang modal, dan sisanya barang konsumsi, memperkecil jumlah rupiah atas pembayaran kewajiban bunga utang luar negeri yang jumlahnya sekitar US $ 65 juta. Satu lagi yang tidak dapat diabaikan adalah menurunnya biaya rupiah dan berkurangnya biaya impor dari; minyak mentah sekitar 70 juta barel per tahun, Premium sekitar 50 juta barel per tahun, dan Elpiji sekitar 500 ribu ton per tahun. Meski demikian, pergerakan kurs rupiah memiliki tingkat sensitivitas yang tinggi terhadap kejadian-kejadian eksternal maupun internal dan oleh karena itu terdapat beberapa hal yang sangat perlu diperhatikan disaat terjadinya apresiasi rupiah. Pertama, penguatan rupiah disatu sisi akan melemahkan daya saing ekspor Indonesia, karena harga komoditas kita relatif lebih mahal bagi negara konsumen pengimpor produk yang kita hasilkan, dan dampak lanjutannya adalah bahwa industri dalam ne-

geri akan terpukul dengan kondisi tersebut - akibatnya produk dalam negeri kurang kompetitif yang ujung-ujungnya akan dapat menurunkan tingkat aktivitas industri, memungkinkan terjadinya pemutusan hubungan kerja (PHK), serta penyebab meningkatnya tingkat pengangguran. Kedua, pergerakan rupiah dapat terjadi sewaktu-waktu dikarenakan kepanikan pelaku dan terjadinya anomali pasar sebagaimana hal tersebut telah kita rasakan pada waktu terjadinya krisis keuangan global – dan yang kemudian mengakibatkan penarikan dana hot money oleh investor asing – dampaknya adalah Indeks Harga Saham Gabungan (IHSG) Bursa Efek Indonesia (BEI) menurun 50% selama paruh kedua tahun 2008, padahal perdagangan saham beberapa periode sebelumnya mengalami pertumbuhan yang dinamis, naik 53% selama tahun 2006, serta naik 52%

(Berlanjut ke hal C 7)

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca dengan disertai CD. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Transfortasi Medan mengarah ke massal - Takutnya awak mengarah ke macat total * Dirut PLN: Asahan III untuk masyarakat Sumut - Nanti janji tinggal janji * Gedung baru DPRDSU sarat penyimpangan - Kok baru sekarang tercium aromanya?

oel

D Wak

WASPADA

Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Plt. Redaktur Opini: Dedi Sahputra. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba, H. Halim Hasan, Diurna Wantana (Sumatera Utara), T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Handaya Wirayuga, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

 Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 


Opini

WASPADA Selasa 25 Mei 2010

Masyarakat Bertanya KPIDSU Menjawab Pengantar: Komisi Penyiaran Indonesia Daerah Sumatera Utara (KPIDSU) merupakan lembaga negara independen yang dibentuk melalui UU No 32/2002 tentang Penyiaran, dengan tujuan untuk mengatur segala hal mengenai penyiaran di Indonesia. KPIDSU berfungsi sebagai lembaga perwujudan pertisipasi masyarakat dalam penyiaran, menampung aspirasi dan menjembatani kepentingan masyarakat akan isi penyiaran di Indonesia (Radio dan TV— baik swasta, publik, komunitas, maupun berlangganan). Untuk itu, KPIDSU bekerjasama dengan Waspada membuka rubrik tanyajawab guna menampung aspirasi, keluhan, saran dari masyarakat mengenai apa saja tentang penyiaran radio dan televisi. Pertanyaan Anda dapat dikirim melalui surat dengan mencantumkan kupon (MBKM) dan fotokopi identitas diri yang masih berlaku ke alamat: Harian Waspada Jl. Brigjen Katamso 1 Medan 2015. 2. Sekretariat KPIDSU Jl. Adinegoro 7 Medan 20235, Telp. (62-61) 4520924 (sentral). Fax. (62-61) 4520962. Email: Info@kpid-sumutprov.go.id dan ukmedan@yahoo.com serta Website: kpidsumutprov.go.id (T) : Setelah digemparkan oleh kasus “Markus Palsu” yang ditampilkan TV-One. TV berita itu kembali ceroboh dalam menyampaikan berita. Pada Kabar Petang tgl 18 Mei menjelang penutupan acara sekitar pukul 19:28. Wib, presenter berita TV One menyampaikan berita meninggalnya Gesang sebagai berita penutup. Presenter berita acara dengan yakin menyampaikan berita sampai ucapan belasungkawa. Sebagai muslim, kami cukup kaget dan langsung menyampaikan doa untuk almarhum. Tidak lama kemudian muncul running text yang menyatakan “Gesang masih dalam keadaan stabil”. TV-One yang mengaku TV berita nomor satu telah sembrono menyampaikan berita duka, tanpa cek and ricek. Bisa dibayangkan kabar duka ini bagi keluarga yang mendengarnya. Boleh saja ngaku TV yang paling dulu mendapatkan berita terkini, tapi sekaligus paling pertama menyampaikan berita ngawur! (Arif Setiawan, Jl Sutrisno Medan) (J): Kami sependapat dengan Anda bahwa benar berdasarkan pengamatan kami pada saat itu presenter TV One dalam Kabar Petang (18/5) ceroboh dengan menyampaikan berita duka cita Gesang di penutupan acara. Padahal sebagaimana kita ketahui maestro keroncong itu baru meninggal dunia pada Kamis (20/5). Pihak TV One pastinya sudah menyadari kesilapan itu. KPID juga berharap agar TV One jangan sembrono dan yang penting heboh dalam menyampaikan informasi demi mendongkrak rating. Yakinlah semakin lama pemirsa kita akan semakin dewasa dalam menila tayangan yang bermutu. (T) Kami mohon, Pihak TPI menyetop atau membatasi secara ketat, tayangan film anak-anak di jam-jam belajar (terutama TV TPI dan Global). Sudah gitu tayangan diulang-ulang alias gak ada yang baru ! Mohon dipikirkan bahwa Indonesia terbagi dalam tiga wilayah jam, sehingga misalkan di Jayapura, waktu Indonesia bagian timur (WIT) jam 21.00 bukan jam belajar, tapi di Medan masih jam 19.00 wib merupakan jam belajar, mohon dipikirkan untuk kelangsungan belajar-mengajar anak-anak Indonesia. (Hary Suhendar, Sei Mencirim, Deli Serdang) (J): Kami juga menerima keluhan yang sama dengan Anda tentang tayangan anak-anak seperti Ipin Upin di TPI pada saat jam belajar. KPID akan mengimbau TPI untuk memerhatikan jam tayang anak-anak itu. KPID juga terus mendesak agar pelaksanaan siaran berjaringan segera direalisasikan oleh televisi Jakarta agar dari sisi isi siaran antara satu daerah dengan daerah lainnya berbeda atau terjadi keragaman isi siaran, di samping itu kebutuhan masyarakat lokal atas tayangan berkualitas sesuai dengan budaya lokal juga terpenuhi. (Mumtaz Yahya, Jl Japaris, Medan) (T): Trans TV Selasa 19/5/10 menanyangkan acara (bingkai berita) mengenai bocah perokok di mana ditayangkan gambar proses bocah tersebut merokok. Menurut saya hal ini akan memberikan stimulus yang buruk bagi anak-anak yang menonton. (Fajar, Sutomo Ujung, Medan). (J): Setiap televisi memang harus hati-hati dalam menyajikan tayangan. Informasi dari Anda akan kami sampaikan ke pihak Trans TV untuk tetap mematuhi kode etik penyiaran Kupon MBKM sebagaimana tercantum dalam Pedoman Prilaku Penyiaran dan Standar Program Siaran (P3SPS). KPIDSU - WASPADA Terima kasih.***

Promosi Kesehatan Masyarakat RS Oleh dr Candra Syafei, SpOG Di beberapa rumah sakit promosi kesehatan sudah sejak lama. Hanya saja tidak sistimatis dan tidak terorganisir secara terarah

D

i masa lampau sistimkesehatan lebih banyak berorientasi pada penyakit, yaitu hanya menunggu sampai ada yang sakit, barulah kemudian diberi pengobatan. Dalam keadaan yang memerlukan si sakit dirawat di rumah sakit, sesudah sembuh, dipulangkan kembalipadakeluarganya.Seringkalimereka sakit kembali, ditimpa penyakit yang sama sehingga dirawat kembali di rumah sakit. Demikianlah siklus ini berlangsung terus, sampai kemudian disadari, bahwa sebenarnyauntukmemeliharakesehatanmasyarakat diperlukan suatu rangkaian usaha yang lebih luas. Di mana perawatan dan pengobatan di rumah sakit ini hanyalah satu bagaian kecil saja dari pada rangkaian usaha tersebut. Efektifitas suatu pengobatan, selain dipengaruhi oleh pola pelayanan kesehatan yang ada serta oleh sikap dan ketrampilan para pelaksananya, juga sangat dipengaruhi lingkungan, sikap, pola hidup dan kerja sama yang positip dengan pasien dan keluarganya. Kalau pasien dan keluarganya mempunyai pengetahuantentangcara-carapenyembuhan dan pencegahannya, serta keluarga pasien mampudanmauberpartisipasisecarapositip, maka jelas bahwa hal ini akan sangat membantu penyembuhan. Ini juga membantu pula peningkatan kualitas kesehatan masyarakat pada umumnya. Promosi kesehatan di rumah sakit berusaha mengembangkan pengertian pasien dan keluarganya tentang penyakit yang diderita si pasien, tentang hal-hal yang perlu diketahui dan dikerjakan oleh pasien dan keluarganya untuk membantu penyembuhan dan pencegahannya. Jadi promosi kesehatan di rumah sakit berusaha menggu-gah kesadarandanminatpasiendankeluar-ganya untuk berperan serta secara positip dalam usaha penyembuhan dan pencegahan penyakit.Karenaitupromosikesehatanharuslah merupakan bagian yang tak terpisahkan dari programpelayanankesehatandirumahsakit. Perhatianparapimpinankesehatan,baik di negara maju maupun di negara berkembang terhadap promosi kesehatan semakin meningkat. Komponen promosi kesehatan daripadaprogram-programkesehatanmakin diperkuat. Di Indonesia, promosi kesehatan yang ditujukan kepada masyarakat umum mendapat perhatian yang makin mening-

kat.Tetapi sekelompok masyarakat tertentu yang sebenarnya mempunyai kesiapan psikologis untuk dimotivasi, nampaknya terlupakan. Mereka ini adalah para pasien di rumah sakit,sertakeluargadanteman-temanmereka yang berkunjung kepadanya. Di beberapa rumah sakit memang promosi kesehatan sudah dilaksanakan sejak lama. Hanya saja tidak sistematis dan tidak terorganisir secara terarah, melainkan hanya berdasarkan minat dan kesempatan yang dimiliki oleh beberapa petugas tertentu saja. Berbagai reaksi dan pendapat muncul terhadap pemikiran promosikesehatandirumah sakit ini. Banyak yang berpendapat bahwa kegiatan pelayanan kesehatan di rumah sakit sudah sedemikian padatnya dijejali oleh beraneka kegiatan teknismedissehingga tidak adawaktuluang untuk kegiatan edukatif. Alasan lain mengemukakan kekurangan tenaga terlatih dan terbatas fasilitas sebagai hambatan. Namun demikian, masih banyak pula suara-suara patriotik yang mengumandang danmenyatakanbahwakemungkinanuntuk melaksanakan promosi kesehatan di rumah sakit masih tetap ada asal ada pengertian dan kemauan pengelola dan penyelenggaraannya. Perbedaan pendapat seperti ini muncul terutama akibat dari perbedaan pengertian mereka tentang apa yang dimaksud dengan promosi kesehatan. Pengertian PKMRS Pengertian Promosi Kesehatan Masyarakat Rumah Sakit (PKMRS) merupakan suatu proses belajar untuk mengembangkan

Membaca harian Waspada Jum’at tgl 21 Mei 2010 halaman A2 : Berita utama judul: Anggota DPRD Paluta pukul wartawan Waspada saat meliput unjuk rasa, saya sangat menyesalkannya. Tergerak hati ini untuk menulis dan menyampaikan tulisan singkat kepada harian Waspada. Pertama dan utama sekali saya ingin menyampaikan rasa keprihatinan saya terhadap terjadinya peristiwa yang menimpa saudara Sori Parla Harahap wartawan harian Waspada yang sedang meliput berita di Paluta. Kedua saya ingin menyampaikan penyesalan dan keprihatinan saya atas insiden yang terjadi dan menimpa wartawan Waspada sekaligus mohon maaf saya kepada pimpinan harian Waspada dan jajarannya, khususnya kepada saudara H.Prabudi Said yang selama 30 tahun sejak tahun 1978 telah menjalin kerjasama organisasi olahraga Catur di SUMUT hingga saat sekarang ini. Untuk selanjutnya sungguh ironis bahwa anggota DPRD Kabupaten Palas yang terlibat dalam insiden yang memalukan tersebut justru anggota dewan asal partai Patriot yang kehadirannya sebagai Parpol di Indonesia dibidani oleh Organisasi Pemuda Pancasila suatu organisasi perjuangan yang dikenal konsisten melaksanakan sosial kontrol terhadap segala bentuk penyelewengan dan penyalahgunaan kekuasaan. Sejak era tahun ‘80-an Pemuda Pancasila SUMUT telah bertekad untuk mengalihkan perjuangan yang mempergunakan otot menjadi perjuangan yang mengandalkan otak/Politik.Maka terkesan sungguh aneh apabila pada tahun 2010 ini ada politisi dari partai Patriot yang menggunakan otot dalam komunikasi dengan wartawan yang justru mitra kerjanya dalam melaksanakan fungsi kontrol terhadap penguasa. Sejak Pemuda Pancasila Sumut dipimpin oleh Alm.H.Effendi Nst tahun 1965, Dastagor Lubis, Ahmad Safii Siregar, Amran YS, H.M Marzuki, Ajibsyah dan Donal Sidabalok, wartawan adalah mitra kerja Pemuda Pancasila dalam melaksanakan sosial kontrol. Maka sudah seharusnya bila melalui harian Waspada hari ini kami sampaikan penyesalan/keprihatinan dan mohon maaf kami kepada PWI Sumut dan jajarannya. Hormat saya H.M Marzuki SE, MSi mantan Ketua DPW Pemuda Pancasila Sumut Periode 1984-1996.Dan saat ini anggota MPN Pemuda Pancasila.

Was-Was Dewasa ini berbagai judul muncul di layar media televisi yang menjadi tontonan berbagai lapisan masyarakat mulai anak-anak keci, TK/SD, Mahasiswa bahkan orang tua dan lanjut usia. Berbagai penampilan di layar kaca dengan kisah-kisah manusia dan adanya sifat atau perasaan was-was itu sendiri. Kita melihat gambaran kehidupan manusia yang saling berhura-hura punya penampilan pakaian ala west. Ada cerita keluarga yang berantakan, kemewahan dan harta yang melimpah ruah tapi tidak berbahagia atau keluarga yang sakinah, mewaddah, warohmah dan barokah tidak tercapai lagi, yang tercapai adalah kemewahan, harta, intan berlian, gemerlapan, penampilan yang glamour dan lain sebagainya. Tapi apabila kita merujuk pada Surah An-Naas ayat 4: kalimat was-was berarti kejahatan, bisikan syaitan, maka penulis heran mengapa manusia selalu was-was padahal jelas sifat itu bisikan dari syaitan yang jahat. Manusia saat ini banyak yang was-was, baik itu mengenai Kasus Markus dan masalah lainnya yang menimpa jabatan harta (tahta-harta dan wanita). Maka melalui pembaca menulis, kami ajak para sahabat jangan was-was. Semoga kita tetap waspada. H.Ichsan Nasution Labuhanbatu

pengertian yang benar dan sikap yang positip dari individu atau sekelompok terhadap kesehatan agar yang bersangkutan melakukan cara hidup sehat sebagai bagian dari cara hidupnya sehari-hari atas kesadaran dan kemauan sendiri. Jadi tujuan promosi kesehatan masyarakat rumah sakit adalah perubahan perilaku. Dalam kehidupannya kita sehari-hari banyak contoh-contoh dimana perubahan perilaku terjadi secara kekerasan, atau karena takut, karena adanya imbalan dan sebagainya. Memang ada waktu-waktu tertentu dimana kita harus mempergunakan cara-cara kekerasan untuk mencapai suatu perobahan perilaku tertentu. Misal dalam situasi wabahdansemacamnya.Tetapi ini tidak akan kita bicarakandisini.Yangakankita bicarakan di sini ialah bagaimana mencapai perubahan perilaku melalui promosi kesehatan yaitu melalui proses belajar dan pemberdayaan, karena perubahan semacam itu lebih lestari. Karena promosi kesehatan masyarakat rumah sakit pada dasarnya adalah suatu proses belajaruntukmeningkatkan kemampuan , maka keberhasilan promosi tergantung pada seberapa jauh kita memahami dan terampilmenerapkan prinsip-prinsip belajar dan berdaya. Ciri-ciri PKMRS Berikut ini diuraikan ciri-ciri promosi kesehatan masyarakat dikembangkan di rumah sakit ; 1) Untuk individu yang sedang memerlukan pengobatan dan atau perawatan di instansi kesehatan, terutama di rumah sakit, dan untuk pengunjung. 2) Ditujukan pada pengembangan pengertian pasien tentang penyakit yang sedang dideritanya, untuk membantu dan mencegah penularan. 3) Ditujukan membantu pasien dan keluarganya agar mampu dan mau berperan seta secara aktip dalam usaha-usaha preventip, promotip, kuratip dan rehabilitatip. 4) Untuk menerapkan prinsip-prinsip belajar dalam melaksanakan kegiatannya. Jadi singkatnya, promosi kesehatan ditujukan untuk

pasien-pasien yang sedang dalam pengobatan dan perawatan dan juga untuk para pengunjung terutama keluarga. Bagaimana tindak lanjut promosi kesehatan di rumah sakit agar bisa lestari? Siapa yang akan mengadakan tindak lanjutnya dirumah pasien? Hal ini harus memanfaatkan sistim rujukan yang ada, yaitu bahwasanya tanggung jawab pasien sesudah pulang dari rumah sakit diserahkan kepada Puskesmas untuk meneruskan tindak lanjutnya, baik tindak lanjut medis maupun tindak lanjut promosi kesehatannya. Selanjutnya tanggung jawab terbesar dan terpenting tentunya ada di tangan keluarga dan pasien itu sendiri. Pelatihan petugas Kira-kira beberapa hari lalu telah dilaksanakan pelatihan pembuatan media promosi kesehatan di rumah sakit se Sumatera UtaraolehDinasKesehatanProvinsiSumatera Utara yang berpraktek lapangan di Rumah SakitKumpulanPaneTebingTinggi.Pelatihan diikuti 33 rumah sakit, pelatihan ini bertujuan untukmemberikanpeningkatanketrampilan dan kemauan bagi petugas promosi kesehatan di rumah sakit dalam rangka mendesain dan merencanakan media promosi kesehatan di rumah sakit. Rumah sakit yang setiap hari dikunjungi pasien dan keluarga pasien, merupakan tempat yang strategis untuk dijadikan kawasan media promosi kesehatan. Karena disaat di rumah sakit, masyarakat biasanya baru sadar bahwasanya sakit itu menderita, padahal penderitaan itu dapat dihindari atau diperkecil kemungkinannya jika kita mau mengikuti apa-apa yang disampaikan dalam promosi kesehatan. Maka keberhasilan promosi kesehatan di rumah sakit relatif lebih efektif jika dibandingkan dengan promosi kesehatan di luar rumahsakit.Namunpadakenyataannyapromosikesehatandirumahsakitkurangbanyak dilakukan.Mengapademikian?Salahsatunya, selain dukungan pimpinan yang kurang, juga keterampilan dan kemauan petugas masih jauh dari harapan. Maka dengan adanya pelatihan pembuatan media promosi kesehatan di rumah sakit. Diharapkan dapat memberi daya ungkit yang signifikan terhadap gerakan pemberdayaan promosi kesehatan di rumah sakit. Karena promosi kesehatan rumah termasuk bagian dari mutu yang dapat meningkatkan citra dan pemasaran rumah sakit tersebut. Penulis adalah Kepala Dinas Kesehatan Provinsi Sumatera Utara

Perawat, Dulu Hingga Sekarang (Refleksi Hari Perawat Sedunia) Oleh Rosanti Muchsin, SST, M.Kes

Tokoh PP Sumut Sesalkan Pemukulan Wartawan Waspada

C7

Perawat adalah tenaga terdidik yang bekerja 24 jam, tapi banyak yang menerima salary tidak pantas

B

erpakaian putih-putih dilengkapi kap yang terpasang di kepalanya, bekerja di rumah sakit selama 24 jam dengan memberikan pelayanan kepada pasien. Itulah lambang perawat yang selama ini dikenal masyarakat. Perawat bekerja siang dan malam untuk melayani pasien dirumah sakit/klinik. Mereka selalu melayani pasiennya dengan senyum dan ramah. Bukan hanya orang sakit yang menerima pelayanan perawat di rumah sakit/ klinik tapi juga keluarganya. Sering kali keluarga pasien dalam keadaan cemas menghadapi keluarganya yang sakit, sehingga mereka selalu banyak bertanya kepada perawat ,dan perawatlah yang selalu menjawab pertanyaan serta menghilangkan kecemasan dan kegundahan mereka. Perawat menjadi tulang punggung berdirinya suatu rumah sakit. Bisa dipastikan, tanpa perawat rumah sakit tidak akan bisa beroperasi. Sungguh merupakan suatu profesi yang sangat mulia. Tapi bagaimana pemerintah, pengusaha kesehatan dan masyarakat memandang profesi ini? Sudah menjadi rahasia umum, perawat menerima salary yang rendah, hanya sebatas UMR. Bahkan perawat yang bekerja di klinik atau praktik dokter masih ada yang menerima salary Rp.300.000 sampai Rp. 400.000. Selain itu, belakangan ini di Indonesia, perawat selalu diidentikkan dengan seksi. Hal seperti ini dapat kita lihat pada film yang telah dibuat oleh para sutradara, tentang perawat yang dikaitkan dengan horor dan seksi, seperti pada film suster ngesot, suster keramas, dll. Ada pula sebuah grup band baru (Charlie’s Angle) yang manggung dengan menggunakan simbol seragam “perawat” lengkap dengan kap di kepalanya tetapi berpakaian sangat seksi. Bukan hanya itu, banyak pula tayangan-tayangan lain di televisi yang sering mengidentikkan perawat sebagai wanita yang seksi, penggoda pria, selingkuh dan

Keperkasaan... (Lanjutan dari hal C6) selama tahun 2007. Ketiga, para pelaku bursa juga menyimpulkan bahwa situasi politik yang terkait dengan Bank Century telah membuat mereka tidak mau berspekulasi, dan telah membuat investor wait and see sehingga nilai transaksi saham mengalami penurunan dalam satu pekan, pada awal bulan Maret - di kala Pansus Bank Century melakukan kesimpulan hasil kerja pansus. Di hari Senin, 1 Maret transaksi sebesar Rp 2,79 triliun, Selasa 2 Maret Rp 3,2 triliun, Rabu, 3 Maret Rp 3,26

berpakaian dengan memamerkan organ tubuh yang tak pantas untuk dipamerkan. Sungguh merupakan suatu penghinaan terhadap profesi perawat. Seperti inikah masyarakat Indonesia memandang sebuah profesi yang sangat mulia dan berkompetensi? Berkaitan Hari Perawat Sedunia yang berlangsung 12 Mei kemarin, penulis ingin memaparkan lebih jauh tentang profesi perawat, yang seyogianya merupakan profesi yang mulia sehingga tidak lagi di pandang sebelah mata di Negara kita Indonesia .

wa lampu sentir. Ia berjuang agar perawat mendapatkan kedudukan yang layak di mata masyarakat/pemerintah, mendapat imbalan sebagai perawat, memiliki jam kerja yang sesuai dan memiliki pendidikan formal. Perjuangan Florence Nightingale tidak sia-sia, pada tahun 1950 perawat diakui sebagai profesi. (Pengantar Konsep Dasar Keperawatan, oleh A.Azis Alimul Hidayat)

Sejarah perawat di dunia Perawat mulai berkembang sebelum perang dunia kedua tepatnya pada permulaan Masehi. Di mana pada masa itu mulai berkembang agama Islam dan Kristen. Berkembangnya agama, diiringi dengan perkembangan keperawatan. Seperti saat berkembangnya agama Kristen, di bawah kepemimpinan Lord Constantin dibangun rumah sakit yang bernama Monastic Hospital di Roma untuk merawat orang-orang sakit, cacat, miskin dan yatim piatu. Tetapi pada masa itu yang menjadi perawat belum memiliki pendidikan formal perawat. Dan saat berkembangnya agama Islam (pertengahan abad ke VI M), mulai dikenal ilmu kimia, hygiene dan obat-obatan dengan tokohnya yang terkenal “Rafidah”. Begitu juga pada permulaan abad ke XVI, dimana banyak korban perang tetapi masih belum ada perawat dengan pendidikan formal. Masa itu yang menjadi perawat adalah para tentara dan wanita yang memang ikhlas membantu para korban perang. Saat inilah keberadaan perawat mulai dibutuhkan. Pada masa sebelum perang dunia II mulailah perjuangan seorang wanita yang dikenal sebagai tokoh pembaharu dunia keperawatan Florence Nightingale. Ia merawat para korban perang siang dan malam dengan hanya memba-

Perkembangan perawat di Indonesia Di Indonesia sendiri, ilmu keperawatan dibawa oleh penjajah, yaitu Belanda dan Inggris. Pada masa penjajahan Belanda, yang menjadi perawat adalah rakyat Indonesia , namun mereka hanya diizinkan merawat para awak kapal dan orang-orang VOC. Berbeda dengan zaman penjajahan Inggris, mereka mengenalkan keperawatan kepada penduduk Indonesia dengan memberi pencacaran, memperhatikan kesehatan para tawanan perang, mengobati penyakit selsual, mengenalkan cara perawatan yang baik terhadap pasien dengan gangguan jiwa. Lambat laun keperawatan di Indonesia semakin berkembang dengan berdirinya RS. Stadverband di Glodok-Jawa Barat (saat ini bernama RSCM) pada tahun 1906 dan berdirinya sekolah perawat pertama kali pada tahun 1960. Perawat diakui sebagai profesi di Indonesia pada tahun 1983. (Pengantar Konsep Dasar Keperawatan, oleh A.Azis Alimul Hidayat) Sesuai dengan syarat agar diakui sebagai profesi, perawat harus berada di bawah pendidikan tinggi. Pendidikan minimal untuk menjadi perawat adalah Diploma 3. Saat ini di Indonesia bukan hanya memiliki pendidikan Strata S1, tetapi sudah sampai ke tahap pendidikan S2 Keperawatan. Di Thailand sudah memiliki pendidikan S3 Keperawatan. Sejak diakui sebagai profesi, sekolah pendidikan perawat pun menjamur dimana- mana dan lulusan perawat mencapai ribuan setiap tahunnya. Kemana para lulusan ini bekerja? Mereka tersebar ke rumah sakit baik negeri maupun swasta, klinik, praktik dokter, praktik bidan, bahkan ada yang sampai ke luar negeri. Selain itu perawat juga berperan sebagai dosen dan peneliti.

triliun, Kamis, 4 Maret, nilai transksi Rp 2,87 triliun, dan pada Jumat, 5 Maret nilai transaksi yang tercatat di bursa hanya sebesar Rp 2,1 triliun. Padahal di saat normal transaksi berkisar antara Rp 3,5-4 triliun. Penurunan transaksi perdagangan saham ataupun pelarian modal (flight for safety) dapat terjadi karena kepanikan politik serta yang dapat menjadi faktor pemicu (trigger point) terjadinya pelemahan kurs rupiah dan yang dalam kenyataaannyapun, praktis lebih dahsyat daripada guncangan pasar bursa ataupun pelarian modal yang dipicu oleh pertimbangan ekonomi semata (flight for quality).

Penutup Penguatan rupiah yang terjadi sekarang merupakan dampak dari positifnya kepercayaan pasar terhadap prospek moneter dan makro ekonomi Indonesia. Kendati demikian, sebaiknya kita jangan langsung terlena dalam euforia. Bahwa variabel kurs rupiah sebagai salah satu indikator perekonomian mengalami penguatan - memang tak terbantahkan, akan tetapi hal-hal lain yang harus senantiasa diwaspadai dan dicermati dari fenomena ini adalah: pertama, kinerja perekonomian Indonesia yang tidak cukup hanya didasarkan pada variabel kurs rupiah, inflasi dan suku bunga semata, Oleh sebab itu, sejumlah indikator

Apa sebenarnya tanggung jawab perawat? Perawat bertanggung jawab untuk memberikan perawatan kepada klien baik sehat maupun sakit secara holistic (keseluruhan), mencakup bio, psiko, sosio dan spiritual. Artinya, perawat memberikan pelayanan keperawatan bagi pasien, mengatasi keluhan-keluhan pasien secara mandiri dengan menggunakan asuhan keperawatan, dan berkolaborasi dengan dokter dalam hal pemberian obat-obatan. Hal ini disebut dengan tindakan kuratif. Selain melakukan tindakan kuratif, perawat juga berperan dalam melakukan tindakan preventif (pencegahan penyakit), dengan melakukan penyuluhan-penyuluhan kepada masyarakat, menjalankan kegiatan posyandu dan lain sebagainya. Tindakan rehabilitatif juga melibatkan keperawatan. Hal yang dilakukan perawat dalam melakukan tindakan rehabilitatif adalah dengan melatih kembali kemampuan pasien agar dapat berfungsi kembali seperti sediakala. Dalam melaksanakan tugas-tugas tersebut (melakukan tindakan kuratif, preventif dan rehabilitatif), perawat memperhatikan psikologis pasien, keterlibatan pasien dalam bersosialisasi dan yang pa ling utama tidak bertentangan dengan keyakinan yang dianut oleh pasien. Oleh sebab itulah perawat dapat memahami jika mendapati keluarga pasien atau pasien yang marahmarah, suka menyendiri atau mempunyai pantangan ini dan itu saat menjalani perawatan. Jika pasien/keluarga bertanya, berkeluhkesahtentangpenyakitataukeadaan yangdialaminya,perawatselalumemberikan solusiatausupportkepadakepasien/keluarga berdasarkan latar belakang dan keyakinan pasien. Begitulah tugas-tugas dan kewajiban yang dijalani oleh perawat dalam kesehariannya. Dapat kita bayangkan begitu mulianya dan betapa letihnya, namun perawat selalu menjalaninya dengan senyum dan ikhlas. Begitupun masih banyak masyarakat/pengusaha bidang kesehatan yang memandang rendah, memberikan salary yang sangat minim bahkan “menghina” profesi yang memiliki kompetensi ini. Penulis adalah Dosen Akademi Perawat ColumbiaAsia Medan

data makro ekonomi lainnya seperti investasi, ekspor-impor, pertumbuhan PDB dan kinerja perbankan masih sangat sulit untuk diabaikan. Kedua, seberapa lama keperkasaan rupiah dapat bertahan? Apakah hanya bersifat temporer, dan berapa sebenarnya nilai wajar kurs rupiah terhadap dolar AS untuk tetap dapat memelihara aktivitas ekonomi, dan seberapa besar intervensi yang tepat akan dilakukan oleh Bank Indonesia? Penulis adalah Alumni Pasca Sarjana UNKRIS Jakarta dan The IOP, University of Texas at Dallas (UTD), USA


C8

Otomotif Performa Hebat Khas Mobil Eropa

WASPADA Selasa 25 Mei 2010

MB E 63 AMG Mercedes Benz E 63 AMG terbaru hadir di tanah air Mei ini, yang bisa menjadi pelepas dahaga penikmat sedan sport dengan performa tinggi, ciri khas mobil sport Eropa.

Sedan sporty terbaru yang cocok sebagai mobil harian ini merupakan model E-Class yang menawarkan sebuah kombinasi impresif antara performa yang luar biasa, kesan berkendara dinamis yang sempurna, dan sebuah

teknologi yang ditransfer dari model performa tinggi SL 63 AMG Roadster. E 63 AMG terbaru yang mengusung mesin bertenaga besar AMG 6.3-liter V8, berbeda dengan model-model E-Class regular. E 63

Mercedes Benz E 63 AMG

AMG bahkan telah mengaplikasi teknologi terbaru AMG Ride Control yang merupakan sistem suspensi sport dengan kontrol peredam elektronik. Selain itu, E 63 AMG juga telah dilengkapi dengan axel depan baru, dan tentunya desain eksterior dan interior yang semakin berkelas. Mobil ini juga telah mempersenjatai E 63 AMG dengan rem komposit, dimana pada model EClass tertinggi fitur ini hanya diberikan dalam paket opsional. Konsumsi BBM Mercedes-AMG secara ekstrim juga telah berhasil memangkas konsumsi bahan bakar E 63 AMG terbaru hingga 12%, di tengah performanya yang semakin meningkat. Dengan kombinasi sistem asistensi pengendaraan yang unik, E 63 AMG bahkan telah menjadi merek terdepan di bidang keselamatan berkendara. Mesin berkapasitas 6.3-liter V8 AMG yang dibenamkan pada E 63 AMG terbaru mampu memproduksi tenaga maksimum 386kW/ 525 hp dan torsi puncak 630 newton meter. Performa ini sebanding dengan kehebatan yang dimiliki

SL 63 AMG. Di samping itu, Roadster peforma tinggi ini juga telah menyumbangkan model sistem transmisi sport terbaru AMG SPEEDSHIFT MCT 7-Speed ke dalam tubuh E 63 AMG bahkan perpindahan gigi lebih cepat dibandingkan dengan SL 63 AMG. Teknologi ini tak lain merupakan mekanisme kopling basah siap pakai yang diaplikasi dari converter torsi konvensional dan berukuran padat. Bersama empat mode pengendalian individual, pengoplingan ganda dan fungsi Race Start, system transmisi ini mampu mengoneksikan performa ekstrim dari mesin secara sempurna dengan reaksi perpindahan halus dan cepat. Hal ini telah menjadikan kesan berkendara yang dihadirkan E 63 AMG menjadi sepenuhnya baru dan sangat dinamis. E 63 AMG hanya membutuhkan waktu 4,5 detik untuk melesat dari diam ke kecepatan 100 km per jam. Sementara kecepatan tertinggi dapat diraih hingga 250 km per jam, yang dibatasi sistem kecepatan elektronik. (inc/h09)

Sukses Besar Ford Berkat Inspirasi Toyota Motor Corp bisa menduduki puncak industri otomotif dunai sejak beberapa tahun terakhir. Ternyata kuncinya sederhana. Toyota selalu menjaga kesederhanaan model yang dijual di seluruh dunia. Model seperti Corolla, Camry, dan Yaris yang dijual di Asia hanya dimodifikasi kecil untuk memenuhi selera lokal di Eropa dan Amerika Utara. Begitu strateginya. Sistem produksi seperti ini sangat menguntungkan bagi Toyota. Dia bisa memproduksi mobil dalam volume besar dengan biaya pengembangan lebih murah. Memang, sistem produksi seperti ini sangat fatal saat terjadi masalah, terutama yang meFord Focus, tempati posisi kedua penjualan tertinggi. nyangkut kualitas. Kepercayaan

Punya Mobil Jadi Lebih Mudah Dengan Kredit Impian Daihatsu PT Astra Daihatsu Motor (ADM) selaku ATPM Daihatsu di tanah air, beserta PT Astra InternationalDaihatsu Sales Operation Tbk (AI-DSO) memperkenalkan program Kredit Impian bagi calon konsumen yang berada di Medan, dengan digelarnya acara peluncuran, bersama wartawan di hotel JW Marriot, Medan, Jumat (22/5) malam. Hadir dalam acara peluncuran program, Marketing Direktur PT ADM Amelia Tjandra, Head Domestic Marketing Division ADM Elvina Afni, Kepala PT AI-DSO Wilayah Sumatera Tunjung Pramusinto, serta Reny FY selaku Branc Manager ACC Daihatsu. Kredit Impian adalah sistem kredit yang memberikan berbagai kemudahan bagi masyarakat untuk memiliki mobil impian Daihatsu baru. “Kredit Impian menawarkan cara mengangsur 50% dari harga mobil selama tiga tahun, sedangkan sisanya dapat dilunasi atau dicicil kembali selama maksimal empat tahun, atau memilih opsi lain, seperti tukar tambah dengan Daihatsu baru,” ungkap Elvina Afni, dalam awal paparannya. Disebutkan, program Kredit Impian ini merupakan hasil kerjasama antara Daihatsu dengan Asrtra Credit Company (ACC) dengan Asuransi Astra Buana (Garda Oto). Program Kredit Impian diluncurkan bagi masyarakat yang ingin memiliki mobil impian namun memiliki down payment terbatas, serta cuma punya memiliki alokasi dana Rp3 jutaan per bulannya. Dengan program ini, mereka bisa memiliki mobil baru tanpa harus mengorbankan kebutuhan bulanan lainnya. Khusus untuk Daihatsu Xenia Li, jumlah uang muka (DP) sebesar 15% dari harga on the road (OTR), sementara Daihatsu lainnya seperti Xenia tipe selain Li, Terios, Luxio, Sirion dan Gran Max DP 20%. Menurut Elvina Afny, program ini bukan ditujukan bagi yang tak mampu membeli mobil baru, melainkan untuk yang ingin membeli mobil namun keberatan dengan cicilan bulanannya dan memilih alternatif mobil bekas. “Jadi menyasar kepada konsumen baru, sehingga kita bisa menjangkau target pasar yang lebih luas lagi, sekaligus meningkatkan value dari pada Daihatsu,” ungkap Elvina.

Lewat program Kredit Impian ini, lanjut Elvina, kon-sumen hanya mencicil 50% dari harga, selama tiga tahun, sementara sisanya, Daihatsu memberikan berbagai alternatif kemudahan, dengan pilihan pertama adalah melakukan tukar tambah (trade in) dengan mobil Daihatsu baru. “Xenia yang diumpamakan memiliki harga OTR Rp100 juta yang pada tahun ketiga akan mengalami penurunan nilai sekitar 80% jika dijual kembali atau Rp80 juta. Dengan uang Rp80 juta hasil penjualan Xenia tadi, konsumen bisa menggunakan untuk melunasi 50% sisa cicilan dan sisanya yang Rp30 juta bisa dimanfaatkan untuk membayar DP mobil Daihatsu baru,” papar wanita ramah ini. Sementara alternatif kedua, dengan mencicil sisanya dengan menjalankan paket spesial tenor maksimal 4 tahun. Bisa dengan atau tanpa DP, diskon 50% untuk biaya administrasi dan asuransi sesuai standar mobil baru, dan alternatif terakhir adalah melunasinya dengan tunai. Amelia Tjandra juga tak menampik kalau program Kredit Impian sebagai bagian dari strategi Daihatsu dalam meningkatkan penjualan. “Memang, semuanya untuk mendukung penjualan Daihatsu, karena 70 persen pembeli Daihatsu adalah via kredit,” tandas Amelia. (h09)

Daihatsu Xenia, kini bisa dibawa pulang dengan DP hanya 15 persen.

global langsung turun, dan penjualan pun akan terkikis cepat. Forbes dalam artikelnya, pakan lalu, menyatakan, Toyota Corolla kompak adalah mobil yang paling populer di dunia dengan penjualan tahun 2009 mencapai 908.661 unit. Sekitar sepertiga laku terjual di Amerika Serikat. Corolla adalah salah satu kendaraan Toyota yang sempat mengalami masalah pada pedal gas yang lengket. Tentu saja, setelah masalah ini, penjualan Corolla bakal terkoreksi dan sepertinya juga akan tergeser dari mobil paling laris. Demikian juga dengan Camry dan Yaris. Kedua mobil global Toyota ini juga laku keras. Mereka masih menempati posisi 10 besar penjualan tertinggi. Strategi Toyota itu sepertinya menjadi inspirasi bagi Ford. Dan Ford sukses besar. Ford mengembangkan Focus dari nol untuk dijual di setiap negara. Hasilnya, penjualan Focus tahun lalu mencapai 781.139 unit dan berhasil menempati posisi kedua penjualan tertinggi. Penjualan tertinggi ketiga, adalah Ford Fiesta. Fiesta yang diproduksi massal di seluruh

dunia mampu mengantongi penjualan pada tahun lalu sebanyak 724.502 unit. Lagi-lagi, dengan strategi barunya itu Ford telah berhasil menjadikan Fiesta sebagai mobil global milik AS. Tapi perkembangan industri otomotif berubah sangat cepat. Pengamat otomotif dari JD Power & Associates mengatakan bahwa China dan negara-negara berkembang akan dominan dalam industri otomotif. “Sepuluh tahun ke depan industri otomotif akan sangat berbeda dari saat ini,” kata John Humphrey, wakil presiden senior operasi otomotif global JD Power. Volume penjualan di seluruh dunia akan pulih setelah resesi dan tumbuh sekitar 72 juta kendaraan pada 2011. Ini meningkat dari sekitar 64 juta pada tahun 2009. “Tapi pertumbuhan yang akan datang dari daerah baru dengan kebutuhan konsumen yang berbeda,” katanya. Dulu pasar industri otomotif yang paling penting adalah AS, Jepang, dan Eropa Barat. Ke depan, negara-negara itu masih penting, tapi mereka tidak berkembang, sehingga pasar otomotif akan beralih ke negara berkembang. (vvn/h09)

Arai Helm Terbaik

Produsen helm internasional, Arai terpilih sebagai helm terbaik 2010 versi JD Power dan Associates. Arai mengalahkan produsen helm terkenal lain seperti Shoei, Icon, Harley-Davidson dan Scorpion. Dengan hasil ini, Arai pun berhasil mempertahankan predikat sebagai helm terbaik yang telah mereka pegang selama 12 tahun terakhir. Study yang dilakukan dengan mewawancarai 4.800 orang konsumen ini menilai tiga faktor utama seperti keamanan melindungi wajah, ventilasi dan gaya dari helm itu sendiri. Setiap faktor tersebut dibagi lagi ke-11 faktor turunan yang berbeda dan kemudian diakumulasi dalam skala 1.000 poin. Dan dalam hasil penelitian tersebut Arai mendapat angka kepuasan tertinggi dengan meraih nilai 836 poin lebih tinggi dari nilai Shoei yang hanya 827 poin dan Icon 826 poin. “Penjualan motor baru turun jauh selama beberapa tahun

Arai, pertahankan predikat 12 tahun.

Donaldsha , juga di atas Mitsubishi Lancer Evolution. Tiga tahun lalu, juga dalam ajang kejurnas reli di Sumsel, Eddy dan Adil juga sudah mengukir prestasi serupa, yakni menempati posisi keenam overall. Dalam balapan yang diikuti 23 kompetitor bersaing di kawasan Penajam Paser Utara, Kaltim, Eddy/Adil memilih bertarung di Grup GR 2, yakni mobil berpenggerak dua roda dengan kapasitas mesin 2.000 cc yang boleh dimodifikasi. Menurut Eddy yang dijumpai di bengkel Monster, Jl. Sei Batang Hari Medan kemarin (24/5), pilihan bermain di kelas yang lebih tinggi karena mereka ingin tantangan baru. “Dan ternyata hasil kami dapat sangat maksimal mampu menjuarai Grup GR 2, meski hanya mengandalkan mobil dengan

prestasi dengan dua kali menyabet gelar juara nasional di grup N15. “Jadi, kami membutuhkan tantangan baru,” tambahnya. Meski menghadapi lawan yang lebih berat, namun kami tidak gentar. “Dalam reli, faktor kemampuan mobil, skill pembalap, pengalaman , dan kru pendukung serta nasib, samasama menentukan posisi akhir. Tentu juga berkat doa dan restu masyarakat Sumut,” tambah, Adil. Di Kaltim kemarin, sebut Adil, tim tetap percaya diri dengan peforma Suzuki SX 4, yang dari basisnya memang hanya perlu polesan sedikit supaya bisa ikut berlomba di ajang reli. Apalagi kaki-kaki mobil cross over ini terkenal tangguh. “Jadi tidak heran, ratarata peserta yang ikut grup N15 di kejurnas putaran I memakai

Pabrikan mobil asal China Geely tidak menutup kemungkinan akan memasukkan mobil super murah mereka Intelligent Geely (IG) ke Indonesia. Mobil ini akan segera di produksi pada 2012 dan akan dipasarkan di China pada 2013 mendatang dengan harga 10.000 RMB atau sekitar Rp 13 jutaan saja. Dan bila benar akan masuk, harga IG dipastikan tidak akan sampai Rp 25 juta. “Harga IG disana sekitar Rp 13 jutaan, dengan kondisi Bea Masuk sekarang paling mahal harganya Rp 25 juta,” ujar Presiden Direktur PT Geely Mobil Indonesia (GMI) A Budi Pramono. Harga tersebut menurut Budi adalah harga termahal, bisa jadi harganya tidak akan sebesar itu, terlebih saat ini sudah ada perjanjian perdagangan bebas antara ASEAN dan China. “Ditambah sedikit lagi, kita bisa memasukkan IG dengan fitur-fitur terkini,” pungkas Budi. IG sendiri beberapa waktu lalu tampil di ajang otomotif bergengsi Beijing Auto Show. Bila benar diproduksi mobil ini akan mematahkan predikat mobil termurah sejagat yang selama ini dipegang oleh Tata Nano yang saat ini sudah naik harga menjadi antara US$ 2.800-3.800 (Rp 26-35,2 juta). Di Beijing IG hadir dengan disain dan teknologi terkini. Pada model konsepnya, IG mengaplikasi pintu model sayap camar alias gullwing dengan lekuk tubuh yang futuristik. Sementara untuk dapur pacunya, Geely IG konsep tersebut sudah mengaplikasi teknologi hibrid dengan memadukan sebuah mesin konvensional berkapasitas 998 cc dan sebuah motor listrik. Dengan perpaduan dua kekuatan itu, Geely IG mampu melaju hingga ke kecepatan 150 km/jam. Kemampuan tersebut didapatnya berkat sumbangan tenaga dari mesin konvensional yang mampu mengeluarkan tenaga hingga 52 kW pada 6.000 RPM dengan torsi mencapai 93 Nm pada 3.400-3.800 RPM. Sementara motor listrik yang digerakan oleh Iron Phosphate lithiumnya mampu menyemburkan tenaga hingga 60 kW pada putaran mesin 6.000 RPM dengan torsi mencapai 180 Nm pada 6.000 RPM. “Tapi di versi produksinya kemungkinan IG akan dibuat dengan mesin bensin berkapasitas 800-900 cc, bisa juga kita minta mesin yang lebih besar,” pungkas Direktur GMI Richard Yang. (dt0/h09)

Grand Cherokee Baru Yang Bikin Off Road Menyenangkan Ketenaran Grand Cherokee sebagai salah satu Sport Utility Vehicle (SUV ) paling tangguh sepertinya akan diteruskan melalui model terbarunya. Grand Cherokee model 2011 baru saja dilepas kepasaran. Ada tiga varian yang coba ditawarkan Jeep, yakni Laredo, Limited, serta Overland. Demikian dikutip dari Autoevolution, pada akhir pekan. Untuk tipe Laredo, Jeep menawarkan dengan harga mulai Rp300 juta, sementara varian Limited 4x4 harga dibuka mulai Rp363 juta, dan terakhir tipe Overland yang ditawarkan dengan harga mulai Rp391 juta. Grand Cherokee generasi terbaru ini menjadi kendaraan pertama yang dilengkapi mesin Chrysler Pentastar-6 berkapasitas 3.600 cc. Sokongan sumber tenaga ini memungkinkan keluaran daya mencapai 290 dk namun dengan tingkat efisiensi bahan bakar 11 persen lebih baik dibanding sebelumnya. Selain sektor mesin yang dibenahi, Jeep juga menggunakan suspensi udara baru yang memungkinkan kendaraan bisa diturunkan maupun dinaikkan sesuai kondisi jalan baik on road maupun off road. Ada pula sistem Selec-Terrain yang merupakan sistem kontrol traksi dengan berbagai pengaturan kondisi jalan, baik pasir, salju hingga jalan berbatu. Dengan begini, maka medan off road diklaim makin nyaman dan menyenangkan jika menggunakan Grand Cherokee. (uky)

New Grand Cherokee.

Tips

Waspada/ist

Eddy WS (kiri) dan Syariful Adil (kanan) di atas podium kejurnas Borneo Rally 2010. yang selalu setia mendukung keikutsertaan tim Suzuki yang

Mobil Murah Geely Hanya Rp 25 Juta

terakhir. Beitu juga helm. Jadi lebih penting bagi produsen helm motor untuk memastikan pelanggan mereka saat ini bisa terpuaskan karena hal itu meningkatkan kemungkinan mereka akan kembali membeli merek yang sama pada saat ingin membeli helm baru,” ungkap Senior Director of the Powersports Practice at J.D. Power and Associates, Todd Markusic, seperti kutip dari situs JD.Power, Senin (24/5). “Karena pemilik biasanya mengganti helm mereka setiap tiga sampai empat tahun sekali, menciptakan loyalitas pelanggan dapat memberikan manfaat yang besar untuk produsen,” tutupnya. (dto/h09)

Prestasi Fenomenal Pereli Suzuki Di Borneo Rally Pereli senior Sumut dari tim Suzuki, Eddy WS membukukan raihan prestasi fenomenal ketiga berlangsung putaran I kejurnas Borneo Rally 2010 di Kaltim, medio Mei lalu. Andalan tim Suzuki Spectra Indocafe Rally itu, yang ditemani navigator berpengalaman Syariful Adil berhasil menduduki posisi Lima Besar klasemen overall kejurnas, meski hanya mengandalkan tunggangan standar Suzuki SX 4 berspesifikasi grup N15. Eddy/Adil finish ke lima di belakang empat peserta yang semuanya memakai mobil spesifikasi N-4, yakni mobil berpenggerak empat roda dengan mesin 2.000 cc bebas, dengan tenaga mesin mencapai 310 horse power. Pembalap Sumut ini berada di urutan ke lima di belakang Subhan Aksa (Sulsel/Mitsubishi Evo X), Akbar

Intelligent Geely.

Spectra, ban radial khusus rally yang diproduksi Swallow. “Sukses

Alarm Mobil Tidak Rewel

Fungsi alarm pada mobil untuk menangkal pencuri, tentu efektif. Tapi bagaimana kalau fungsi tersebut jadi berlebihan, sehingga sedikit-sedikit bunyi. Bisa dimaki tetangga jadinya. Head Service Auto2000 Bekasi Barat, Adi Suryono, memberikan tips agar alarm mobil tidak rewel. Bisa dilakukan sendiri dirumah lho! Alarm rewel, menurutnya, bisa disebabkan karena memang bermasalah, atau bisa juga hanya karena setingan Potensio Meter nya yang diset terlalu sensitif. Potensiometer adalah fitur untuk menyetel sensitifitas alarm mobil. “Kalau terlalu sensitif, sedikit-sedikit bunyi, tinggal setel saja potensiometernya,” ujarnya. Caranya mudah kok, terdapat modul alarm yang letaknya di konsol tengah sebelah kanan, tepat di bawah dashboard stir. Untuk menyetelnya, tinggal buka penutupnya menggunakan kunci 10. “Nah, nanti terlihat modul alarmnya, setelah itu, ada switch yang tinggal diputar saja untuk menyetel sensitifitas alarm,” paparnya. Bila diputar searah jarum jam, alarm nya akan semakin sensitif, begitu juga sebaliknya, berlawanan arah jarum jam, sensitifitasnya akan berkurang. Nah, mumpung sekalian dibuka, tidak ada salahnya untuk membersihkan soket-soket yang terdapat pada mobul alarm tersebut, tentunya agar aliran listrik tetap optimal, sehingga bisa mengurangi gejala alarm abnormal. “Bagusnya sih pakai cairan pembersih semacam WD40, kalau bisa tidak hanya di modul saja, tapi juga semua swicth alarm yang terdapat pada setiap pintu mobil,” ujarnya. Nah, mudah bukan? bila semuanya sudah dilakukan, dijamin


Waspada, Selasa 25 Mei 2010