Issuu on Google+

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

SELASA, Kliwon, 1 Mei 2012/9 Jumadil Akhir 1433 H

z zNo: 23851

Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Waspada / ist

SEJUMLAH warga memperhatikan seekor bangkai gajah liar yang tergeletak di atas badan jalan yang menghubungkan Cot Punti-Krueng Ayon Kec. Sampoinet, Kab Aceh Jaya, Senin (30/4).

Pilih Mana?

Seekor Gajah Mati Diracun Di Calang

SAMPOINET, Aceh Jaya (Waspada): Warga Desa Alu Gajah menemukan bangkai gajah liar di jalan menghubungkan Desa Cot Punti-Krueng Beukah, Kec.Sampoinet, Kab. Aceh Jaya, Senin (30/4) siang. Belum diketahui pasti penyebab matinya binatang yang dilindungi ini, namun diduga akibat diracun. “Dari ciri-cirinya diracun karena mulut gajah mengeluarkan busa. Nampaknya racun dengan dosis tinggi sehingga mampu dengan cepat membunuh binatang sebesar ini,” kata Darul, pawang (Mahot) gajah anggota Conservation Respon Unit (CRU) Aceh Jaya seusai meninjau lokasi matinya gajah, kepada . Menurut Darul, gajah diduga mati 1 atau 2 jam sebelum ditemukan warga. Dikatakan tidak ada tanda-tanda luka di tubuh gajah selain busa pada mulut yang diduga akibat diracun. “Kami sudah ke lokasi dan kondisinya belum begitu membusuk. Di sekitar bangkai gajah betina juga terdapat seekor gajah muda, anak gajah yang mati. Saat kami datang, bangkainya sekitar 5 meter dari lokasi bangkai gajah yang mati,”kata Darul. Warga Cot Punti berharap gajah liar segera dikuburkan pihak terkait.

Pesta Rakyat Atau ....


REKTOR Universitas Sumatera Utara (USU) Prof. Syahril Pasaribu (keempat kanan) didampingi Wali Kota Medan Rahudman Harahap (ketiga kanan) melihat Mobil Mesin USU pada peluncuran di Medan, Senin (30/4).

MEDAN (Waspada): Kelompok buruh di Medan terpecah dua menjelang peringatan Hari Buruh atau May Day, Selasa (1/5). Kelompok pertama sepakat mengikuti pesta rakyat yang digagas Pemko Medan, kelompok lain memilih melakukan aksi unjuk rasa. Informasi itu disampaikan Direktur Intelkam Polda Sumut Kombes Pol. Bambang Soecahjo kepada wartawan, Senin (30/4) saat coffee morning bersama sejumlah wartawan di Medan. Dia mengatakan, sesuai laporan diterimanya 14 elemen buruh dan pekerja akan meramaikan pesta rakyat di Lapangan Merdeka Medan yang diprediksi dihadiri dua ribu orang. Di lokasi itu buruh akan melebur dengan pejabat Pemko Medan mengadakan acara gerak jalan. “Ada juga doorprize dan pertunjukan musik. Tapi rincian acaranya saya juga kurang tahu,” kata Bambang. Sedangkan tiga elemen buruh lainnya yang tergabung dalam Dewan Buruh Sumatera Utara (DBSU) sudah menginformasikan kepada polisi akan berunjuk rasa di sejumlah tempat strategis, di antaranya Gedung DPRD Sumut, DPRD Medan, Pemprov Sumut, Pemko Medan, BPN Sumut dan Medan serta Bandara Polonia. “Kelompok ini didukung LSM dan mahasiswa,” kata dia. Lanjut ke hal A2 kol 3

USU Luncurkan Mobil ‘Horas’ 4 Hadiah Presiden Pada Hari Buruh JAKARTA (Antara): Menteri Tenaga Kerja dan Transmigrasi Muhaimin Iskandar mengemukakan bahwa Presiden Susilo Bambang Yudhoyono telah menyiapkan hadiah bagi para buruh dalam menyambut hari buruh pada 1 Mei 2012. “Hadiah yang pertama

PTKP (pendapatan tidak kena pajak) dari sebelumnya Rp1,3 juta menjadi Rp2 juta,” kata Muhaimin seusai rapat internal di Kantor Presiden, Jakarta, Senin (30/4). Kedua, Presiden juga telah memerintahkan untuk menyiapkan pembangunan ru-

mah sakit untuk buruh. Untuk tahap awal ini akan dibangun di tiga titik yakni Tangerang, Bekasi dan Jawa Timur. “Yang ketiga hadiahnya transportasi murah untuk buruh di kawasan industri,” Lanjut ke hal A2 kol 3

MEDAN (Waspada): Fakultas Teknik Universitas Sumatera Utara (FT-USU), Senin (30/4), meluncurkan mobil hemat bahan bakar minyak (BBM). Mobil yang diberi merek ‘Horas’ itu, hasil rancangan 14 mahasiswanya. Rencananya, mobil itu diikutkan dalam kompetisi Shell Eco-Marathon (SEM) Asia 2012 di Sepang, Malaysia, Juli 2012. “Kami bangga bisa masuk dalam even SEM ini bersama 17 tim lainnya. Dari Sumatera hanya USU yang lolos,” kata Manager Tim Horas Munawir

R Siregar di sela-sela peluncuran mobil tersebut di halaman Pendopo USU. Lanjut ke hal A2 kol 3

Korban Jambret Tewas, Satu Kritis BELAWAN (Waspada): Seorang ibu rumah tangga, Delima, 35, warga Pasar 4 Lingk. 8, Kel. Terjun, tewas setelah menabrakkan sepedamotornya ke kendaraan penjambret yang baru saja merampas tasnya, di Jl. Marelan Raya, depan toko Wigo, Kel Rengas Pulau,

Kec. Medan Marelan, Senin (30/4) sore. Korban tewas dengan kondisi bagian kepala pecah setelah terhempas di aspal, kaki dan tangannya luka parah. Sedangkan temannya yang dibonceng, Nuriyati Rahma kritis dan dirujuk ke RSU Pirngadi

Medan. Sementara, anak sepupunya yang turut dibonceng Endrini, 4, hanya mengalami luka memar di kening. Menurut seorang saksi, Serka Erwin, anggota Kodam I BB, awalnya warga menduga Lanjut ke hal A2 kol 6

Polres T.Balai Tangkap 51 Orang Kasus Narkoba TANJUNGBALAI (Waspada): Polres Tanjungbalai dalam kurun waktu empat bulan sejak Januari hingga April 2012, menyita narkoba berbagai jenis, yakni sabu 336,39 gram, ganja 1.182,44 gram dan ekstasi 6 butir. Sedangkan tersangkanya berjumlah 51 orang, sebagian besar berkasnya telah dilimpahkan ke Kejaksaan Negeri Tanjungbalai, dan ditempatkan di Lembaga Pemasyarakatan Pulo Simardan. Lokasi Waspada/Abdullah Dadeh

ibu muda sedang berjalan disamping mobil Sabhara Poldasu yang parkir di depan terminal keberangkatan luar negeri Bandara Polonia Medan mengantisipasi hari buruh atau May Day.

Kadishut Tapsel Ditahan

P.SIDIMPUAN (Waspada): Majelis Hakim Pengadilan Negeri Padangsidimpuan memerintahkan Jaksa Penuntut Umum (JPU) untuk menahan Kepala Dinas Kehutanan dan Pertanahan Kab. Tapanuli Selatan Ir.SS. Perintah penahanan sesuai surat No: 200/ Pid.B/2012/PN.Psp dikeluarkan Ketua Majelis Hakim, Fasial, SH,MH, bersama anggota,

Lodewyk Ivan Simanjuntak, SH.MH dan Muhammad Shobirin,SH,MHum pada sidang pertama perkara pemalsuan surat diduga melibatkan Ir.SS, dan seorang pegusaha kayu, HJ, Senin (30/4). Dalam surat tersebut, Majelis Hakim memerintahkan JPU J Simanullang SH.MHum menahan Ir.SS di Rumah Tahanan (Rutan) Kelas IIB Pa-

dangsidimpuan selama 30 hari, mulai Senin (30/4) sampai Selasa (29/5). Sementara, JPU dalam dakwaannya menyebutkan, tindak pidana ini berawal dari PT. Panei Lika Sejahtera (PLS) mendapat Izin Pemanfaatan Kayu (IPK) seluas 4.000 Ha dengan 39.210 batang kayu

penggerebekan di kawasan Kec. Teluknibung, Seitualang Raso, Tanjungbalai Utara, dan Datukbandar. Sementara, latar belakang pelaku, bervariasi mulai dari penarik becak, nelayan, pedagang, pegawai negeri sipil (PNS) sampai pengangguran. Bahkan, seorang anggota Polres Tanjungbalai, Brigadir Bambang Purwanto turut terlibat mengonsumsi narkoba Lanjut ke hal A2 kol 1

Gempa Bisa Geser Arah Kiblat SEMARANG (Antara): Astronom Institut Teknologi Bandung (ITB) Moedji Raharto mengatakan, gempa bumi bisa menyebabkan arah kiblat bergeser sehingga perlu pengukuran ulang arah kiblat di daerah rawan gempa. “Arah kiblat shalat di masjid dan mushala di daerahdaerah yang kerap mengalami kejadian gempa bumi memang perlu diukur ulang,” katanya usai seminar “Arah Kiblat: Antara Mitos dan Sains” di Semarang, Senin (30/4). Menurut anggota Badan Hisab Rukyat Nasional Kementerian Agama itu, gempa sebenarnya tidak mengubah bentuk pola dasar bumi yang berbentuk bulat dan tidak mengubah orientasi sumbu bumi, meski gempa berskala Lanjut ke hal A2 kol 5

Lanjut ke hal A2 kol 6


KAKANWIL Depkumham Aceh Yatiman Eddy berdialog dengan sejumlah napi pasca kerusuhan di Lembaga Permasyarakatan (Lapas), Desa Gampong Bineh Blang, Kecamatan Ingin Jaya, Kab.Aceh Besar, Prop Aceh, Senin (30/4).

Lapas IIA Banda Aceh Rusuh BANDAACEH (Waspada): Lapas IIA Banda Aceh tepatnya di Kecamatan Ingin Jaya, Aceh Besar, rusuh, Senin (30/4). Keributan meluas setelah penghuni lapas ikut membantu sipir mengusir keluar anggota kepolisian yang sedang membesuk anggota polisi yang sedang mendekam di Lapas IIA itu. Awalnya, menurut penga-

kuan sejumlah napi di Lapas IIA, ada lima tahanan aparat kepolisian dibesuk 10 orang temannya yang merupakan anggota polisi. Jadwal kunjungan telah lewat sehingga sipir meminta anggota polisi itu untuk menyudahi kunjungannya. Karena tidak terima, seorang oknum polisi memukul meja sipir, sehingga terjadi cekcok antara sipir dan

AS Harus Minta Maaf

Didikan Ibu Oleh: H. Syarifuddin Elhayat SATU kali ada seorang remaja belia (kurang lebih 12 tahun) di Makkah berniat ‘musyafir’ ker negeri (negeri seribu satu malam) Baghdad untuk menuntut ilmu. Sebelum dia berangkat, anak muda ini minta ibunya memberi nasehat,” Ya Ummiii,aushinii,— ibu, beri aku bekal nasehat,” begitu katanya singkat. Tanpa ragu sang ibu memberi nasehat,”Ya waladi –berjanjilah kepadaku bahwa engkau akan tetap berlaku jujur dimanapun engkau dan kapanpun itu,” kata sang ibu dengan lembut. Sejurus kemudian sang ibu itu memberi uang

Lanjut ke hal A2 kol 6

PERBAUNGAN (Waspada): Di hari kedua pelaksanaan MTQ ke 33 tingkat Sumut, untuk cabang Khath Alquran yang dilaksanakan di Wisma Juang, Kel. Simpang Tiga Pekan, Kec. Perbaungan, Kab. Serdang Bedagai, Senin (30/4) telah menyelesaikan golongan hiasan Mushaf .

TEHERAN (Waspada): Iran mengutuk keras pembakaran kitab suci Alquran oleh seorang pendeta AS, Senin (30/4), dan menyebut aksi itu provokatif serta meminta pemerintah AS segera bertindak mencegah aksi balas dendam. Menteri Luar Negeri Iran dalam pernyataan yang dilansir kantor berita IRNA ,bahwa “Iran mengutuk keras aksi konyol, menghina dan penuh provokasi yang dilakukan oleh seorang pendeta Amerika dalam penodaan Alquran.” Kementerian Luar Negeri Iran menyebut peristiwa itu sebagai tindakan yang menghina umat Muslim dan provokatif. Teheran menuntut agar AS meminta maaf kepada

Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 6

Waspada/Edi Saputra

PARA peserta Mushaf putri tampak serius mengerjakan kaligrafi dengan pengawasan ketat dari panitia, Senin (30/4) di wisama Juang, Kel. Simpang Tiga Pekan. Kec.Perbaungan, Kab.Sergai.

Cabang Khath Alquran Selesaikan Mushaf

Lanjut ke hal A2 kol 7

Ada-ada Saja

Pembakaran Alquran

Al Bayan

oknum polisi. Aksi itu diketahui penghuni lapas yang berada di pekarangan. Kemudian, penghuni lapas emosi karena sejumlah oknum polisi dianggap telah melanggar peraturan di rumah mereka. Penghuni meluapkan kekesalannya dengan melemparkan batu ke arah polisi.

Aksi Cabut Gigi

Ayman al-Zawahri

Abu Yahia al-Libi

5 Pimpinan al-Qaeda Paling Diburu AS TANGGAL 2 Mei 2011, pasukan Navy SEAL menembak mati pimpinan al-Qaeda Osama bin Laden di rumahnya di Abbottabad, Pakistan. Osama disebut-sebut sebagai mendalangi serangan terhadap gedung kembar WTC pada 11 September 2001. Setelah kematiannya, badan intelijen anti-teror Amerika Serikat merilis daftar lima pimpanan al-Qaeda penerus Osama, yang dianggap terus memberikan ancaman terhadap negara Adidaya itu.

Lanjut ke hal A2 kol 1

GARA-gara kecewa karena hubungan asmaranya kandas, seorang wanita asal Polandia melampiaskannya dengan mencabut gigi sang mantan pacar. Saat Marek Olszewski, 45, mendatangi mantan pacarnya Anna Mackowiak yang berprofesi sebagai dokter gigi, pria ini mengira bahwa mantan kekasihnya itu telah melupakan

Lanjut ke hal A2 kol 2

Serampang - Salut buat USU - He.... he....he....

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SELASA, Kliwon, 1 Mei 2012/9 Jumadil Akhir 1433 H

z zNo: 23851 * Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Waspada / ist

SEJUMLAH warga memperhatikan seekor bangkai gajah liar yang tergeletak di atas badan jalan yang menghubungkan Cot Punti-Krueng Ayon Kec. Sampoinet, Kab Aceh Jaya, Senin (30/4).

Mobil ‘Horas’ Buatan USU Butuh Dana

Seekor Gajah Mati Diracun Di Calang

MEDAN ( Waspada): Fakultas Teknik Universitas Sumatera Utara (FT-USU), Senin (30/4), meluncurkan mobil hemat bahan bakar minyak (BBM). Mobil yang diberi merek ‘Horas’ itu, hasil rancangan 14 mahasiswanya. Rencananya, mobil itu diikutkan dalam kompetisi Shell EcoMarathon (SEM) Asia 2012 di Sepang, Malaysia, Juli 2012. “Kami bangga bisa masuk dalam even SEM ini bersama 17 tim lainnya. Dari Sumatera hanya USU yang lolos,” kata Manager Tim Horas Munawir R Siregar di sela-sela peluncuran mobil tersebut di halaman Pendopo USU. Turut hadir Wali Kota Medan Rahudman Harahap berserta jajarannya, Rektor USU Prof Syahril Pasaribu dan pembantu rektor, para undangan dari kalangan otomotif, dosen, dan puluhan mahasiswa. Menurut Siregar, mobil Horas berwarna merah hati itu dirancang berkekuatan 110 cc, panjangnya bodi 2,5 meter, tinggi 1,5 meter, dan lebar 1,2 meter. Tahun pembuatan mobil

SAMPOINET, Aceh Jaya (Waspada): Warga Desa Alu Gajah menemukan bangkai gajah liar di jalan menghubungkan Desa Cot Punti-Krueng Beukah, Kec.Sampoinet, Kab. Aceh Jaya, Senin (30/4) siang. Belum diketahui pasti penyebab matinya binatang yang dilindungi ini, namun diduga akibat diracun. “Dari ciri-cirinya diracun karena mulut gajah mengeluarkan busa. Nampaknya racun dengan dosis tinggi sehingga mampu dengan cepat membunuh binatang sebesar ini,” kata Darul, pawang (Mahot) gajah anggota Conservation Respon Unit (CRU) Aceh Jaya seusai meninjau lokasi matinya gajah, kepada Waspada. Menurut Darul, gajah diduga mati 1 atau 2 jam sebelum ditemukan warga. Dikatakan tidak ada tanda-tanda luka di tubuh gajah selain busa pada mulut yang diduga akibat diracun. “Kami sudah ke lokasi dan kondisinya belum begitu membusuk. Di sekitar bangkai gajah betina juga terdapat seekor gajah muda, anak gajah yang mati. Saat kami datang, bangkainya sekitar 5 meter dari lokasi bangkai gajah yang mati,”kata Darul.

Lanjut ke hal A2 kol 3 Mahasiswa Universitas Sumatera Utara (USU) melihat uji jalan Mobil Mesin USU ketika peluncuran di halaman pendopo kampus USU Medan, Senin (30/4).

Lanjut ke hal A2 kol 4

JANGAN ANARKIS Waspada/Surya Efendi

Kelompok Buruh Terpecah Dua 7 SSK Polisi Amankan Bandara MEDAN (Waspada): Kelompok buruh di Medan, Sumatera Utara terpecah dua menjelang peringatan Hari Buruh atau May Day, Selasa (1/5). Kelompok pertama sepakat mengikuti pesta rakyat

yang digagas Pemko Medan, kelompok lain memilih melakukan aksi unjuk rasa. Informasi itu disampaikan Direktur Intelkam Polda Sumut Kombes Pol. Bambang Soecahjo kepada wartawan,

Senin (30/4) saat coffee morning bersama sejumlah wartawan di Medan. Dia mengatakan, sesuai laporan diterimanya 14 elemen Lanjut ke hal A2 kol 1

JAKARTA (Antara): Menteri Koordinator bidang Kesejahteraan Rakyat Agung Laksono meminta agar peringatan Hari Solidaritas Buruh Internasional (May Day) pada 1 Mei tidak diwarnai dengan aksi unjuk rasa yang bersifat anarkis. “Para pekerja dipersilahkan jika ingin mewarnai peringatan hari buruh dengan melakukan aksi unjuk rasa tapi jangan bersifat anarkis,” kata Menko Kesra Agung Laksono di Jakarta, Senin (30/4).

Agung menyampaikan, penyampaian aspirasi bisa dilakukan dengan tertib dengan suasana yang kondusif. Lanjut ke hal A2 kol 6

Lapas IIA Banda Aceh Rusuh Bong Ditemukan Di Sel Anggota Polisi BANDAACEH (Waspada): Lapas IIA Banda Aceh tepatnya di Kecamatan Ingin Jaya, Aceh Besar, rusuh, Senin (30/4). Keributan meluas setelah penghuni lapas ikut membantu sipir mengusir keluar ang-

gota kepolisian yang sedang membesuk anggota polisi yang sedang mendekam di Lapas IIA itu. Awalnya, menurut pengakuan sejumlah napi di Lapas IIA, ada lima tahanan aparat

kepolisian dibesuk sepuluh orang temannya yang merupakan anggota polisi. Jadwal kunjungan telah lewat sehingga sipir meminta anggota Lanjut ke hal A2 kol 1

MTQ Ke 33 Sumut

Cabang Khath Alquran Selesaikan Mushaf PERBAUNGAN (Waspada): Di hari kedua pelaksanaan MTQ ke 33 tingkat Sumut, untuk cabang Khath Alquran yang dilaksanakan di Wisma Juang, Kel. Simpang Tiga Pekan, Kec. Perbaungan, Kab. Se rd a n g B e d a g a i , Se n i n (30/4) telah menyelesaikan golongan hiasan Mushaf . Panitera Musabaqah Khathil Quran Sumut, H. Ismail, MM mengatakan untuk cabang Khath Alquran di hari Waspada/Abdullah Dadeh

SEORANG ibu muda sedang berjalan disamping mobil Sabhara Poldasu yang parkir didepan terminal keberangkatan luar negeri Bandara Polonia Medan, mengantisipasi hari buruh atau May Day.

Gempa Bisa Menggeser Arah Kiblat SEMARANG (Antara): Astronom Institut Teknologi Bandung (ITB) Moedji Raharto mengatakan, gempa bumi bisa menyebabkan arah kiblat bergeser sehingga perlu pengukuran ulang arah kiblat di daerah rawan gempa. “Arah kiblat shalat di masjid dan mushala di daerahdaerah yang kerap mengalami kejadian gempa bumi me-

mang perlu diukur ulang,” katanya usai seminar “Arah Kiblat: Antara Mitos dan Sains” di Semarang, Senin (30/4). Menurut anggota Badan Hisab Rukyat Nasional Kementerian Agama itu, gempa sebenarnya tidak mengubah bentuk pola dasar bumi yang berbentuk bulat dan tidak mengubah orientasi sumbu bumi, meski gempa berskala

besar sekalipun. Akan tetapi, kata dia, pergerakan tanah lokal akibat kerap terkena gempa bumi memang sulit diprediksi sehingga jika ada masjid yang kebetulan berada di daerah gempa memang perlu dilakukan ulang pengukuran arah kiblatnya.

BLANGPIDIE (Waspada): 768 Lembar Kartu Tanda Penduduk (KTP) elektronik milik warga Aceh Barat Daya dikembalikan ke pusat. Pasalnya pada nomenklatur (penulisan nama) di atas bertuliskan Nanggroe Aceh Darussalam (NAD), seharusnya Aceh. Menurut Kadis Kependudukan dan Catatan Sipil) Abdya, Senin (30/4), pihaknya sempat berangkat ke Jakarta guna menandatangani pengambilan 768 e-KTP atas nama warga Abdya. Di Jakarta dirinya tidak dibenarkan membuka bungkusan e-KTP itu. “Di sana kita tidak diizinkan untuk membuka dan memeriksa e-KTP yang akan kita bawa pulang, kita hanya

Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 6


Napi memperlihatkan alat isap sabu yang diduga milik oknum polisi yang menjalani hukuman saat terjadi kerusuhan di Lembaga Permasyarakatan (Lapas), Desa Gampong Bineh Blang, Kecamatan Ingin Jaya, Kab.Aceh Besar, Prop Aceh, Senin (30/4).

Kasus Kayu, Kadishut Tapsel Ditahan P.SIDIMPUAN (Waspada): Majelis Hakim Pengadilan Negeri Padangsidimpuan memerintahkan Jaksa Penuntut Umum (JPU) untuk menahan Kepala Dinas Kehutanan dan Pertanahan Kab. Tapanuli Selatan Ir.SS. Perintah penahanan sesuai surat No: 200/ Pid.B/2012/PN.Psp. Penetapan penahanan sesuai surat No: 200/Pid.B/2012/

PN.Psp dikeluarkan Ketua Majelis Hakim, Fasial, SH.MH, bersama anggota, Lodewyk Ivan Simanjuntak, SH.MH dan Muhammad Shobirin SH. Mhum pada sidang pertama perkara pemalsuan surat diduga melibatkan Ir.SS, dan seorang pegusaha kayu, HJ, Senin (30/4). Dalam surat tersebut, Majelis Hakim memerintahkan

Oleh: H. Syarifuddin Elhayat

Waspada/Ahmad Cerem Meha

TIGA pelajar SMP swasta dijaring petugas Polres Kota Padangsiidmpuan ketika hendak pesta ganja, turut diamankan pengedarnya seorang ibu rumah tangga, NH, 56, Senin (29/4).

Beganja, Tiga Pelajar SMP Masuk Sel Bandarnya Omak-omak

P.SIDIMPUAN (Waspada): Tiga pelajar SMP swasta diduga beganja ditangkap aparat Polres Kota Padangsidimpuan, Sabtu(28/4) malam. Lanjut ke hal A2 kol 5

PANYABUNGAN ( Waspada): Polres Madina dalam operasinya di Desa Hutajulu,Kec. Hutabargot, Minggu(29/4) mengamankan 13 orang di duga terlibat penambangan liar. Informasi dihimpun Waspada, operasi yang dipimpin Wakapolres, Kompol. Rinaldi, SH mengamankan 13 orang tersangka dari 5 titik lobang tambang berbeda lokasi berikut barang bukti berupa batu diduga mengandung biji emas, pahat, dan blower.Para tersangka saat ini ditahan di Mapolres Madina. Kapolres Madina, AKBP. Fauzi Dalimunteh yang di konfirmasi melalui telepon seluler membenarkan penahanan Lanjut ke hal A2 kol 5

JPU J Simanullang SH.MHum menahan Ir.SS di Rumah Tahanan (Rutan) Kelas IIB Padangsidimpuan selama 30 hari, mulai Senin (30/4) sampai Selasa (29/5). “Un t u k k e p e n t i n g a n pemeriksaan di persidangan, hakim memandang perlu mengeluarkan penetapan Lanjut ke hal A2 kol 6

Ada-ada Saja

13 Penambang Liar Ditangkap Polres Madina

Didikan Ibu

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 1

Bertuliskan NAD,768 e-KTP Abdya Dikembalikan

Al Bayan

SATU kali ada seorang remaja belia (kurang lebih 12 tahun) di Makkah berniat ‘musyafir’ ker negeri alfu laila walaila (negeri seribu satu malam) Baghdad untuk menuntut ilmu. Sebelum dia berangkat, anak muda ini minta ibunya memberi nasehat,” Ya Ummiii,aushinii,— ibu, beri aku bekal nasehat,” begitu katanya singkat. Tanpa ragu sang ibu memberi nasehat,”Ya waladi –berjanjilah kepadaku bahwa engkau akan tetap berlaku jujur dimanapun engkau dan kapanpun itu,” kata sang ibu dengan lembut. Sejurus kemudian sang ibu itu memberi uang

kedua, panitia telah menyelesaikan golongan hiasan Mushaf sebanyak 47 peserta putra dan putri dari total jumlah peserta seluruhnya 141 orang meliputi, Mushaf, Dekorasi dan Naskah tulis. “Untuk hari ini 23 peserta putri akan menyelesaikan perlombaan hingga sore hari, sebelumnya kemarin (Minggu-red) diawali 24 peserta

Aksi Cabut Gigi


AKTRIS Meriam Bellina (kanan) bersalaman dengan pengacara Hotman Paris Hutapea (kiri) sebagai tanda damai, disaksikan mediator yang juga pengacara Meriam Bellina Dwi Ria Latifa (tengah) di Jakarta, Senin (30/4).

9 Syarat Meriam Berdamai Dengan Hotman JAKARTA (Waspada): Kasus perseteruan antara Meriam Bellina dengan Hotman Paris Hutapea, akhirnya diselesaikan dengan damai. Perdamaian itu digelar di Hotel Atlet Century, Senin (30/4). Hotman mengaku lega. Lanjut ke hal A2 kol 6

GARA-gara kecewa karena hubungan asmaranya kandas, seorang wanita asal Polandia melampiaskannya dengan mencabut gigi sang mantan pacar. Saat Marek Olszewski, 45, mendatangi mantan pacarnya Anna Mackowiak yang berprofesi sebagai dokter gigi, pria ini mengira bahwa mantan kekasihnya itu telah melupakan

Lanjut ke hal A2 kol 5

Serampang - May Day May Day peace .... - He.... he....he....

Berita Utama

A2 Gempa Bisa ....

Karena bentuk pola dasar bumi dan orientasi sumbu bumi tidak berubah, ia mengatakan bahwa rumus perhitungan arah kiblat sampai sekarang masih tetap sama, seperti menggunakan kompas masih bisa dilakukan. “Hanya saja, penentuan arah kiblat dengan kompas terkadang kurang tepat, sebab biasanya bisa saja jarum kompas terganggu oleh aliran listrik dan besi beton yang ada di sekitarnya,” katanya. Ia menjelaskan, masyarakat yang tidak memahami rumus penentuan arah kiblat sebaiknya mengonsultasikannya

Cabang Khath ....

putra dengan waktu perlombaan 8 jam,” papar H.Ismail. Diakui H.Ismail, untuk pelaksanaan MTQ ke 33 tingkat Sumut yang diselenggarakan di Sergai, khususnya cabang Khath Alquran, berjalan lebih tertib dan pengawasan ketat, baik dari pengawas maupun petugas, terlebih didukung lokasi pelaksanaan yang nyaman sehingga peserta dapat bekerja dengan tenang. Penilaian untuk katagori ini, lanjutnya, bidang kaidah khat termasuk bentuk , jarak spasi dan keserasian, kemudian keindahan khat, menyangkut orisinalitas, dan

Lapas IIA ....

polisi itu untuk menyudahi kunjungannya. Karena tidak terima, seorang oknum polisi memukul meja sipir, sehingga terjadi cekcok antara sipir dan oknum polisi. Aksi itu diketahui penghuni lapas yang berada di pekarangan. Kemudian, penghuni lapas emosi karena sejumlah oknum polisi dianggap telah melanggar peraturan di rumah mereka. Penghuni meluapkan kekesalannya dengan melemparkan batu ke arah polisi. Tidak lama kemudian penghuni Lapas IIA membakar barang-barang milik tahanan polisi di Lapas IIA. Penghuni mendapatkan satu buah bong atau alat pengisap sabu di ruangan tahanan oknum polisi. Tidak lama kemudian, aparat dari Polresta Banda Aceh dan personil Polsek Ingin

Kelompok Buruh ....

buruh dan pekerja akan meramaikan pesta rakyat di Lapangan Merdeka Medan yang diprediksi dihadiri dua ribu orang. Di lokasi itu buruh akan melebur dengan pejabat Pemko Medan mengadakan acara gerak jalan. “Ada juga doorprize dan pertunjukan musik. Tapi rincian acaranya saya juga kurang tahu,” kata Bambang. Sedangkan tiga elemen buruh lainnya yang tergabung dalam Dewan Buruh Sumatera Utara (DBSU) sudah menginformasikan kepada polisi akan berunjuk rasa di sejumlah tempat strategis, di antaranya Gedung DPRD Sumut, DPRD Medan, Pemprov Sumut, Pemko Medan, BPN Sumut dan Medan serta Bandara Polonia. “Kelompok ini didukung LSM dan mahasiswa,” kata dia. Di tempat sama, Direktur

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mg5+, Rh7. 2. Bc7+, Mf7. 3. BxM+, Rh8. 4. Mg7+mat. (Jika 1. ...., Rf7. 2. Bc7+, Rf8. 3. Md8+mat).

Jawaban TTS: TTS Topik



Politik & Hukum





Jawaban Sudoku: 5 6 7 3 8 4 9 2 1

3 9 1 5 2 7 4 6 8

4 2 8 1 6 9 7 3 5

9 3 4 6 5 2 8 1 7

1 8 6 9 7 3 2 5 4

2 7 5 4 1 8 6 9 3

7 5 9 2 4 1 3 8 6

6 4 2 8 3 5 1 7 9

8 1 3 7 9 6 5 4 2

dengan Badan Hisab Rukyat (BHR) yang ada di wilayah setempat agar penentuan arah kiblat dilakukan secara tepat. Sementara itu, astronom Institut Agama Islam negeri (IAIN) Walisongo Semarang Slamet Hambali mengakui, penentuan arah kiblat secara tepat memang harus dilakukan karena berkaitan langsung dengan acuan dalam ibadah shalat. Arah kiblat, kata dia, menunjuk langsung ke arah Ka’bah yang ada di Makkah dan menjadi acuan umat muslim dalam melaksanakan ibadah shalat sehingga pengukuran arahnya harus dilakukan secara tepat. kreatifitas, serta keindahan hiasan diantaranya unsur disain dan tata warna. Dewi Puspita Sari,21, peserta dari Perguruan Tinggi, mahasiswi semester VIII, Fakultas Syariah di IAIN Medan menuturkan baru kali pertama mengikuti MTQ cabang Khathil Alquran katagori Mushaf, tuturnya menjelang istirahat siang. Menurut mahasiswi warga Kec. Batang Serangan, Kab. Langkat ini, dirinya sudah berulang kali menjadi juara untuk tingkat kabupaten di Langkat dan berharap di MTQ ke 33 Sumut dapat meraih juara. (c03)

Umat Islam Di Singkil Protes Rumah Ibadah SINGKIL (Waspada): Ribuan umat muslim Aceh Singkil, tergabung dalam Forum Umat Islam (FUI), Senin (30/ 4), mendatangi kantor Bupati Singkil meminta ketegasan Pemkab dan Muspida setempat segera membongkar rumah ibadah non muslim yang dinilai melanggar izin dan aturan SKB 2 Menteri serta Peraturan Gubernur Aceh. “Kami beri waktu 3 x 24 jam bagi pemerintah dan Muspida Aceh Singkil untuk

KAPOLRES Aceh Singkil AKBP Bambang S dan massa berdialog terkait tuntutan pembongkaran rumah ibadah yang menyalahi izin, Senin (30/4).

Mobil ‘Horas’ ....

Jaya diterjunkan ke lokasi mengamankan suasana lapas. Kemudian Kakanwil Hukum dan HAM Aceh mengadakan rapat tertutup bersama kepala lapas dan sipir serta oknum polisi itu. Kakanwil Hukum dan HAM Aceh Yatiman kepada wartawan menjelaskan, barang bukti berupa selang yang diduga alat pengisap sabu telah diserahkan ke Polresta. “Barang bukti yang kita temukan hanya selang saja dan sudah kita serahkan ke Polresta,” katanya. Anehnya, bong pengisap sabu yang pertama kali ditemukan di kamar penghuni yang berasal dari oknum polisi hilang begitu saja. Atas kejadian itu, Yatiman mengaku akan melakukan tes urin terhadap petugas sipir di Lapas IIA Banda Aceh. Jika terlibat maka akan dikeluarkan. (cb01) Binmas Polda Sumut Kombes Pol. Heri Subiansauri mengatakan, polisi tidak akan membedakan perlakuan kedua kelompokl buruh itu. Aksi keduanya yang cukup kontras tersebut akan tetap dikawal untuk menghindari disusupi provokator. “Tak ada perbedaan, kedua kelompok itu samasama berhak memperingati hari buruh sesuai keinginan asal tidak anarki,” ujarnya. Sedangkan Kabid Humas Polda Sumut Kombes Heru Prakoso mengatakan, ada perubahan jumlah personel yang akan dikerahkan pada peringatan hari buruh menjadi 6 ribu personel. Sebelumnya dijelaskan jumlah personil 4 ribu lebih. Fokus utama yang akan dikawal ketat Bandara Polonia dengan pengawalan 7 satuan setingkat kompi (7 SSK). “Kapolda sudah menginstruksikan untuk mensterilkan bandara, jangan sampai terganggu dengan aksi demonstrasi,” kata dia. Menyikapi rencana aksi pendudukan bandar udara

oleh massa DBSU, Her u mengatakan, polisi sudah melakukan pencegahan sedini mungkin. Sejak Senin (30/4) Polda telah menyiagakan personelnya dan menutup akses bandara dari aksi dem o n s t r a n . “Ka m i s u d a h mengimbau jangan sampai melakukan aksi di bandara. Seandainya ada, kami akan cegah dengan mengalihkan demonstran ke wilayah lain,” sebut Heru. Dikatakan, bila demonstran tetap nekat menerobos blokade polisi untuk mengganggu aktivitas penerbangan, polisi akan mengambil tindakan tegas sesuai protap. Dicontohkannya, polisi akan m e n e m b a k d e m o n s t r an menggunakan peluru karet dengan sasaran pinggang ke bawah. “Tapi bukan berarti Pak Kapolda menginstruksikan anak buah menembak di tempat ya. Jangan sepotongpotong memberi informasi ke masyarakat, karena protap itu ada tahapannya,” katanya. (m27)

Al Bayan ....

mu dan memegang janji kejujuran terhadap apapun itu, sementara aku selain tidak taat kepada Allah juga khianat pada janji-janjiku pada Nya, wahai anakku teruskan perjalananmu, aku menjamin engkau akan aman dan bawalah uang bekalmu, aku juga berjanji sejak hari ini akan bertaubat nashuha kepada Allah dan akan meninggalkan seluruh pekerjaan jahatku,” katanya. Pada sore harinya, para anak buahnyapun datang membawa harta rampokan kepada ‘boss’nya. Tapi alangkah kagetnya mereka saat melihat pemimpinnya menangis dan meminta agar barang rampokan itu dikembalikan pada pemiliknya. Anak buahku sekalian, begitu kirakira kata sang lanun, sejak hari ini aku bertaubat dan Allah ta’ala memerintahkan kita agar mengembalikan amanah itu kepada pemiliknya. “Kalau tuan sebagai pemimpin kami sudah bertaubat, maka kamipun sebagai anak buah menyatakan tobat dan tidak akan melakukan pekerjaan itu lagi. Konon sejak itu mereka menjadi pemimpin muslim yang sangat baik dan memberi bantuan bagi muslim di tengah masyarakatnya. Nukilan kisah diatas, agaknya tidak perlu kita kembangtafsirkan tuan,— ceritanya cukup jelas, bahwa didikan seorang ibu sangat sangatlah berpengaruh dalam sikap dan kehidupan kita sebagai anak-anaknya.

mahasiswa adalah ketersedian dana. Biaya diperlukan untuk membuat kendaraan dan berkompetisi di SEM Asia mencapai 250 juta. “Saat ini sudah habis Rp60 juta, dan masih banyak yang harus diperbaiki agar catatan nilainya lebih baik,” jelasnya. Rektor USU Prof Syahril Pasaribu memberi apresiasi atas keberhasilan dan keseriusan mahasiswa mempersiapkan mobil rancangannya. “Mereka bekerja pagi hingga malam agar rancangannya bisa berprestasi. “ tegasnya. Dia mengatakan hasil karya mahasiswa FT ini, sebuah kebanggaan bagi USU. Disamping lagi, mobil masuk kompetisi internasional SEM Asia 2012. Di mana, tidak semua perguruan tinggi mampu lolos dalam perlombaan ini. Se m e n t a r a Wa l i Ko t a Medan Rahudman Harahap mengaku salut atas ide dan kreativitas mahasiswa menciptakan rancangan mobil hemat energi. “Kalau sudah oke, Pemko berkeinginan membeli kendaraan ini untuk dipergunakan sehari-hari,” ujarnya. (m49)

Seekor Gajah ....

Menurut Darul, warga Cot Punti berharap gajah liar segera dikuburkan pihak ter k a i t . S e l a i n k h a w a t i r serangan kawanan gajah liar lain, warga khawatir bangkai hewan itu akan menimbulkan bau tak sedap dan menjadi sumber penyakit. “Ini (jalan) juga tempat lalu lintas warga baik ke pasar maupun anak-anak ke sekolah. Jadikan cukup menggangu. Usia gajah sekitar 15 tahun,”kata Darul. Sekretaris Desa Alu Gajah, Muhtaruddin mengatakan, bangkai gajah pertama sekali ditemukan warga Desa Alu Gajah sekitar pukul 15:00 yang hendak menuju kebun. Penemuan kemudian dilaporkan warga kepadanya. “Lokasi penemuan sekira 42 km dari pusat Kota Calang. Berdekatan dengan lokasi perkebunan sawit milik perusahaan swasta,”kata Muhtaruddin. (cb06) Itulah ibu, tangannya yang mengayun buaian itu akan sanggup menggoncangkan dunia ini. Itulah ibu, pesan kejujurannya akan sanggup menggetarkan hati yang keras, hatta kalbu seorang lanun yang tak per nah lembut itu. Namun, Ncek,— ada pertanyaan yang menggelitik ati ambe,—bagaimana dengan anak-anak kita hari ini ,selain hari-hari mereka kita bekali dengan ‘dirham’,sudahkah mereka kita beri bekal janji jujur (Shiddiq) agar mereka tidak menjadi ‘perampok’ di masa datang. Antahlah mak dan umik ntahlah inang, ga taulah bundaku..…hanya kitalah yang tau semua itu. Tapi a p a p u n i t u Di d i k a n I bu sangatlah perlu ya mbuuun…

Selasa 1 Mei 2012

Kasus Kayu ....

Dalam dakwaannya JPU menyebutkan, tindak pidana ini berawal dari PT. Panei Lika Sejahtera (PLS) mendapat Izin Pemanfaatan Kayu (IPK) seluas 4.000 Ha dengan 39.210 batang kayu atau 69.413,73 M3. Lokasinya di Hak Guna Usaha (HGU) PT. Ondop Perkasa Makmur (OPM), Kec. Angkola Selatan, Kab. Tapsel. Tapi saat itu terjadi perselisihan tentang kayu antara HJ selaku Direktur PT. Dwi Putra Indo Kayu, dan Prianto selaku Direktur PT. PLS, dan Budianto (Aseng Naga-red) selaku Komisaris PT. PLS. Mereka berdamai di hadapan notaris pada 15 Desember 2009. Salah satu isi perdamaian itu, semua tunggakan Provisi Sumber Daya Hutan (PSDH),

dan Retribusi Hasil Hutan (RHH) atas IPK yang diterbitkan Bupati Tapsel, Ongku P Hasibuan, pada 3 Maret 2007, dan perpanjangannya pada 9 Desember 2008, menjadi tanggungjawab HJ dan wajib melunasinya. HJ berjanji mengurus dan menyerahkan bukti surat bebas tunggakan atas PSDH, dana reboisasi, dan RHH dari IPK selambat-lambatnya 3 bulan setelah perdamaian itu kepada Prianto. Usai mendengar pembacaan dakwaan, Majelis Hakim membacakan surat penetapan penahanan terhadap Ir. SS, dan menunda persidangan hingga Senin (7/5) dengan agenda mendengar tanggapan terdakwa atas dakwaan JPU. (a27)

Bertuliskan NAD ....

tersebut. Namun, pihaknya masih melakukan penyelidikan dan belum bisa menentukan status para penambang. Pantauan Waspada, setelah penahanan 13 penambang, aktivitas warga di lokasi tambang liar di wilayah Kec. Hutabargot mendadak sepi. Mereka takut masih ada razia susulan. Para penambang berkumpul memadati warung-warung dan duduk-duduk di halaman rumah. (c14)

wajib menandatangani berita acara serah terima saja, habis itu kita langsung pulang dengan kardus masih tertutup rapat,” katanya. Persoalan baru terungkap setelah dirinya tiba di Abdya, pihaknya bersama staf langsung membuka kardus e-KTP, namun betapa terkejutnya mereka saat melihat nomenkalatur bertuliskan NAD. “Harusnya nomenkalatur bertuliskan Aceh,,” katanya. Mendapati kesalahan penulisan nama tersebut, pihaknya langsung membuat laporan ke pusat, yang oleh pihak pusat tambahnya e-KTP se-

banyak 768 lembar itu diminta untuk dikirim kembali. “Tapi pihak pusat meminta kita untuk mengantar langsung guna pengamanan yang lebih terjamin,” katanya. Sementara biaya pengembalian e-KTP yang salah itu dibebankan pada anggaran daerah. Realisasi e-KTP Subulussalam 96,2 Persen Perekaman e-KTP dalam lima kecamatan di Kota Subulussalam, sesuai kontrak dengan pihak konsorsium tercatat 37.083 jiwa, telah terealisasi 35.688 jiwa atau 96,2 persen . Atau dari 43.401 jiwa wajib

KTP, hanya 1.395 yang belum terealisasi. Sementara dari fakta rill baru mencapai 88,22 persen. Kadis Kependudukan dan Pencatatan Sipil Kota Subulussalam Syafrianda, Senin (30/4) mengatakan, dari 43.401 jiwa wajib KTP di sana, pihak konsorsium hanya menyepakati kontrak 37.083 jiwa sehingga jika dibanding dengan realisasi per 27 April 2012, hanya 1.395 jiwa saja yang belum rekam e-KTP di Subulussalam. Sedangkan rillnya, dari 43.401 dan terealisasi 35.688, tercatat 7.713 jiwa belum melakukan perekaman e-KTP. (cb05/b28)

Ada-ada Saja ....

Jangan Anarkis ....

menyangkut nasib rakyat Indonesia termasuk para tenagakerja,” katanya. Sebelumnya, 57.000 orang dikabarkan akan berunjuk rasa dalam rangka memperingati May Day di kawasan Jakarta pada Selasa (1/5). Polda Metro Jaya mengerahkan 16.083 personel gabungan, guna mengamankan aksi unjuk rasa buruh. Presiden Siapkan Hadiah Untuk Buruh Menteri Tenaga Kerja dan Transmigrasi (Menakertrans) Muhaimin Iskandar mengatakan Presiden Susilo Bambang Yudhoyono menyiapkan hadiah untuk menyambut hari buruh pada Selasa (1/5). Usai mengikuti rapat internal di Kantor Presiden di Jakarta, Senin (30/4), Muhaimin mengatakan hadiah pertama yang disiapkan berupa peningkatan batas Pendapatan Tidak Kena Pajak (PTKP) dari Rp1,3 juta menjadi Rp2 juta. Presiden, kata dia, juga telah memerintahkan penyiapan pembangunan rumah

sakit untuk buruh yang pada tahap awal akan dibangun di Tangerang, Bekasi dan Jawa Timur. “Yang ketiga hadiahnya transportasi murah untuk buruh di kawasasn industri,” katanya. Menurut Muhaimin, pada tahap awal pemerintah dalam waktu dekat akan membeli 200 bus untuk transportasi buruh di tiga titik kawasan industri yaitu Tangerang, Bekasi, Jawa Timur dan Batam. Selain itu, kata dia, Presiden juga telah memerintahkan pembangunan rumah murah untuk buruh. “Telah dibuat skemanya, baik itu yang sifatnya rumah susun sewa maupun rumah biasa yang bantuan uang mukanya dari pemer intah.” katanya. Ia mengatakan, pembiayaan dari program-program itu akan diambil dari anggaran pemerintah pusat (APBN), anggaran pemerintah daerah (APBD) dan dana tanggung jawab sosial badan usaha milik negara (BUMN).

9 Syarat....

klien saya. Supaya semuanya aman. Karena persoalan sudah selesai, ya selesai, tanpa harus berkoar-koar masalah sendiri,” ujarnya Meriam tidak begitu saja menerima perdamaian tersebut. Artis berdarah Belanda itu mengajukan beberapa syarat kepada Hotman. Apa sajakah syarat yang diajukan Meriam, sehingga ia mau berdamai dengan Hotman? Berikut rinciannya: 1. Hotman meminta maaf atas sikapnya yang membuat Meriam merasa tidak nyaman. 2. Hotman mengakui tidak pernah sekalipun memberikan harta benda mobil Ferrari, rumah mewah, dan kapal pesiar sebagaimana diberitakan. 3. Tidak ada pernikahan di Las Vegas. 4. Hotman memohon maaf kepada Meriam dan anak-anaknya, termasuk ke-

luarga besar Meriam, yang merasa tidak nyaman dengan kasus ini. 5. Hotman mengakui Meriam sebagai perempuan terhormat, mandiri, dan bekerja sendiri untuk menghidupi anak-anaknya. 6. Meriam Bellina mutuskan hubungan dengan Hotman. 7. Hotman menegaskan perdamaian ini tercapai tanpa ada pemberian uang dan harta benda apapun. 8. Hotman berjanji tidak lagi memberikan pernyataan apapun tentang hubungannya dengan Meriam. 9. Meriam menyatakan mencabut laporan di Polda Metro Jaya. “Dengan adanya perdamaian ini, maka saling membebaskan satu sama lain dan tidak saling tuntut di kemu-dian hari,” ucap Dwi Ria. (vvn/m13)

tidak memiliki izin sudah melebihi batas waktu. Hambali selaku orator juga meminta ketegasan Pemkab Aceh Singkil mengusir lembaga donor bertopeng aksi kemanusiaan. Kapolres Aceh Singkil AKBP Bambang S meminta pemerintah setempat beserta seluruh yang terkait agar bertindak tegas sesuai tuntutan massa. Namun tetap mengedepankan aturan yang ada. Sekdakab Aceh Singkil M Yakub yang menerima massa dalam pertemuan dengan perwakilan FUI mengatakan pihaknya segera menurunkan tim untuk melakukan pendataan rumah ibadah di Aceh Singkil, dan bila ditemukan ada rumah ibadah yang menyalahi aturan akan dibongkar. (cb02)

13 Penambang .... Mansurdin/Waspada

tersebut 2012. “Kami butuh 3 bulan menyiapkan mobil ini,” jelasnya seraya menambahkan muatan mobil hanya satu orang. Kecepatan mobil ini, lanjutnya, 25 km/jam. “Ini sesuai ketentuan kompetisi SEM.” Katanya, mobil ini akan diikutsertakan dalam kompetisi internasional. Keikutsertaan USU dalam SEM Asia 2012 merupakan yang pertama selama tiga tahun kegiatan itu digelar. USU akan berkompetisi dalam kelas kendaraan Urban Concept (konsep mobil perkotaan) berbahan bakar bensin. Rekor untuk kategori ini sementara dipegang Institut Teknologi Sepuluh Nopember Surabaya dengan pencapaian 149,8 km/liter. “Target kami 200 km/liter untuk bisa juara, dan saat ini masih 90 km/liter. Kita masih terus menyempurnakan untuk mengejar hasil rekor tahun lalu,” beber Siregar. Katanya, ada satu hambatan paling berat yang dihadapi

bekal 400 dirham buat keperluan puteranya dipertantauan. Setelah pamit dan mohon doa, remaja itupun berangkat dengan menunggang kuda. Ditengah-tengah perjalanan,—begitu disebutkan dalam kisah itu,anak muda itu dicegat lanun (perampok) dan minta agar dia menjelaskan apa yang dia bawa. Sang remaja itu menceritakan apa adanya, dia berasal dari Makkah dan membawa uang 400. Konon sang lanun merasa terejek serta meminta anak muda itu memeruskan perjalanannya. Beberapa hari kemudian, dia bertemu lagi dengan sekumpulan lanun. “Berapa uang yang kau bawa,” kata bossnya lanun. “Aku bawa uang 400 dirham,” katanya lugas. Sang lanun curiga kalaukalau uang yang dia bawa tidaklah sekecil itu dan meminta agar mengeluarkan selur uh har ta bawaannya. Remaja itu mengeluarkan apa yang dia bawa termasuk uang yang hanya 400 dirham. Melihat keadaan itu lanun balik bertanya,”Mengapa engkau berlaku jujur kepadaku, padahal engkau tau aku akan merampok hartamu,” katanya. “Ibuku meminta aku berjanji agar aku tetap berlaku jujur kepada siapaun juga,” kata remaja itu dengan tulus. Rupanya hati lanun yang bengis itu tersentuh. ”Wahai anak muda, aku benar-benar haru tentang sikapmu yang taat pada ibu-

membongkar rumah ibadah yang melanggar izin, dan apabila tidak diindahkan kami sendiri yang akan bongkar,” ujar Mukaribin Pohan, Korlab FUI. Selain menuding Pemkab lepas tanggung jawab, FUI juga menuding MPU dan FKUB Aceh Singkil makan gaji buta, karena tidak bekerja sesuai tupoksinya. Padahal tenggang waktu yang disepakati untuk membongkar bangunan rumah ibadah yang


rasa kecewa setelah ia putuskan. Waktu itu, ia datang kepada mantan kekasihnya itu untuk melakukan perawatan gigi. Namun Marek salah besar, karena wanita berusia 34 tahun itu ternyata masih menyimpan rasa kecewa mendalam. Di ruang periksa, Anna membuat mantan pacarnya itu tertidur dengan memberinya obat bius dosis tinggi. Saat ‘pasiennya’ tak sadarkan diri, dokter gigi itu kemudian melampiaskan dendamnya dengan mencabuti semua gigi yang ada di mulut Marek. Setelah selesai melakukan aksinya, Anna kemudian m e m b a l u t m u l u t M arek dengan perban, dan mengatakan bahwa mantan pacarnya itu butuh perawatan dokter spesialis. Ketika tiba di rumah, pria malang ini baru menyadari bahwa ia telah kehilangan semua giginya alias ompong total. “Saya tak punya alasan untuk mencurigainya. Saya kira ia dokter yang profesional,” ujar Marek. “Kini saya harus menyiapkan biaya yang besar untuk operasi implan,” tambanya. Akibat perbuatannya, dokter gigi sadis itu diancam hukuman 3 tahun penjara, seperti dilansir Daily Mail, Senin (30/4). (rzl)

Beganja ....

‘’Penangkapan dilakukan ketika aparat Polres Kota Padangsidimpuan melakukan razia di Jl. By Pass, curiga melihat satu sepedamotor parkir tanpa pemilik. Setelah ditelusuri, didapati tiga anak menggulung ganja,’’ kata Kapolres Kota Padangsiidmpuan, AKBP Andi S Taufik didampingi Wakapolres, Kompol Maradolok Siregar, Kasat Narkoba, AKP Timbul Sihombing, orang tua pelajar, Ketua Badan Narkotika Kota (BNK) H Maragunung Harahap yang juga Wakil Wali kota diwakili staff BNK, Kualo Pardosi saat pertemuan Senin (29/4). Ketiga tersangka, RHL,14, warga Sihitang, MIP,14, warga Desa Hutaimbaru, Kec. Muara Batang Gadis, Mandailing Natal dan ARW,14, warga Kampung Jawa, Kec. Padangsidimpuan Selatan akan dikenakan UU RI Nomor 35 Tahun 2009 tentang narkotika maksimal hukuman penjara 12 tahun, minimal 4 tahun. Sedangkan seorang ibu rumah tangga NH,56, warga Palopat Pijorkoling sebagai pengedar ganja tersebut dijerat pasal tentang narkoba. ‘’Setelah pengembangan dilakukan, ganja diperoleh ketiga pelajar itu dari NH, ‘’ujar Kapolres. (c13)

penahanan terhadap terdakwa, karena dikhawatirkan melarikan diri, merusak atau menghilangkan barang bukti, atau mengulangi perbuatannya,” sebut Majleis Hakim. Alasan lain, untuk memenuhi asas persamaan di depan hukum. Karena dalam perkara yang sama dan berkas terpisah (spilit), hakim menerbitkan surat penetapan penahanan No: 201/Pid.B/2012/PN.Psp terhadap terdakwa HJ. Sementara dalam dakwaannya, JPU menyatakan kedua terdakwa, Ir. SS dan HJ, selama ini tidak dilakukan penahanan, baik selama proses penyidikan di kepolisian maupun proses penuntutan di kejaksaan.

Agung juga menyampaikan, pemerintah terus berupaya untuk menampung dan merealisasikan apa yang menjadi aspirasi para buruh salah satunya soal Badan Penyelenggara Jaminan Sosial (BPJS). Dia menjelaskan, pemerintah menargetkan BPJS Kesehatan mulai beroperasi pada 1 Januari 2014, sementara BPJS Ketenagakerjaan pada 1 Juli 2012. “Saat ini tengah dirancang peraturan pemerintah dan peraturan presiden untuk kedua BPJS tersebut,” katanya. Agung mengatakan, realisasi operasional BPJS merupakan satu bentuk komitmen pemerintah terkait tuntutan para tenaga kerja. Sementara itu, Ketua Dewan Jaminan Sosial Nasional (DJSN) Chazali H Situmorang mengatakan pihaknya optimis operasional BPJS akan terealisasi sesuai waktu yang ditargetkan. “Operasional BPJS harus terlaksana dengan baik karena

“Saya lega akhirnya. Untuk yang lain saya no comment,” kata Hotman saat ditemui di Hotel Atlet Century, Senayan, Jakarta, Senin (30/4). Ditambahkan Hotman, ia juga telah meminta maaf kepada artis lawas tersebut atas ketidaknyaman yang terjadi. Disela-sela jumpa pers, Hotman masih memberikan pujian terhadap bintang film “Catatan Si Boy” itu. “Enam tahun saya kenal Mbak Mer. Saya mengagumi sosok Meriam,” ucapnya. Mengenai dirinya yang lebih banyak diam sejak dilaporkan Meriam ke pihak berwajib, Hotman memiliki alasan tersendiri. Begitu juga dengan keinginan kuatnya untuk berdamai dengan Meriam. “Saya harus jaga perasaan Mer, keluarga saya, perasaan

Berita Utama


e-KTP Berakhir, Pemko Perkirakan Capai Target Waspada/Edi Saputra

WARGA menyaksikan rumah Sapudin, 38, warga Dusun II, Desa Bagan Kuala, Kec.Tanjung Beringin yang mengalami rusak berat dihantam puting beliung.

Puting Beliung Rusak 9 Rumah Di Sergai SEIRAMPAH (Waspada): Delapan rumah di Kab.Serdang Bedagei, rusak berat akibat dihantam puting beliung, Minggu (29/4) malam. Tidak ada korban jiwa, namun kerugian puluhan juta rupiah. Delapan rumah tersebut, masing-masing di Desa Bagan Kuala dan Desa Tebingtinggi, Kec Tanjung Beringin, satu rumah di Desa Sei Rejo, Kec.Sei Rampah. Parluhutan,51,warga Dusun II Desa Tebing Tinggi, Kec Tanjung Beringin kepada wartawan di lokasi kejadian mengatakan, peristiwa terjadi saat warga sedang berada di dalam rumah karena hujan lebat.Tiba-tiba angin bertiup cukup kencang disertai suara gemuruh, dan dalam sekejap atap rumah warga mulai terlempar dan roboh.’’ Untuk menghindari bahaya, warga yang panik langsung keluar rumah,’’ kata Parluhutan. Kepala Desa Bagan Kuala Syahroni menuturkan, untuk sementara korban mengungsi ke rumah keluarga dan tetangga. Camat Tanjung Beringin Aminuddin S.Sos kepadaWaspada mengatakan pihaknya sudah mendata korban, dari Desa Tebingtinggi terdapat empat rumah rusak masing-masing milikKhoirulSaleh47,IsmansyahPutra,33,Hj.Bumi,63,danParluhutan, 51. “ Di Desa Bagan Kuala, empat rumah rusak yakni rumah Ismail, 40, Maimunah, 70, Sapudin, 38, dan Jaitun, 60. (c03)

5 Pimpinan al-Qaeda ... Ayman al-Zawahri: Seorang ulama Mesir yang mengambil alih organisasi al-Qaeda, setelah terbunuhnya Osama bin Laden pada tahun lalu. Diduga dalam persembunyiannya di Pakistan, Zawahri merilis sejumlah video propaganda untuk menyulut semangat para pengikutnya untuk melakukan kekerasan. Abu Yahia al-Libi: Seorang militan asal Libya, yang kini diyakini sebagai orang No. 2 di jaringan al-Qaeda. Libi juga diduga merilis sejumlah propaganda dalam bentuk rekaman video. Libi berhasil meloloskan diri dari penjara AS di Bagram, Afghanistan pada tahun 2005. Mullah Mohammed Omar: Pimpinan Taliban ini berperan dalam melindungi al-Qaeda sejak Taliban masih berkuasa dan

Polres T. Balai ... dan telah divonis Pengadilan Negeri Kota Tanjungbalai satu tahun penjara dan menjalani perawatan di panti rehabilitasi. Kapolres Tanjungbalai AKBP EP Sirait melalui Kasat Narkoba AKP Novie Ardhie didampingi Kasubbag Humas AKP Y Sinulingga menyatakan komitmennya membersihkan narkoba dari kota kerang itu. (a32)

Cabang Khath Alquran ... Panitera Musabaqah Khathil Quran Sumut, H. Ismail, MM mengatakan untuk cabang Khath Alquran di hari kedua, panitia telah menyelesaikan golongan hiasan Mushaf sebanyak 47 peserta putra dan putri dari total jumlah peserta seluruhnya 141 orang meliputi, Mushaf, Dekorasi dan Naskah tulis.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mg5+, Rh7. 2. Bc7+, Mf7. 3. BxM+, Rh8. 4. Mg7+mat. (Jika 1. ...., Rf7. 2. Bc7+, Rf8. 3. Md8+mat).

Jawaban TTS: TTS Topik




Politik & Hukum




hingga saat ini. Diduga bersembunyi di Quetta, Pakistan, Omar melanjutkan kepemimpinannya memerintah pasukan militan yang bekerjasama dengan alQaeda. Omar dituding bertanggung jawab atas kematian 1.500 pasukan AS di Afghanistan sejak tahun 2001. Nasser al-Wahishi: Wahishi yang pernah menjadi pembantu Osama bin Laden, kini memegang komando gerakan alQaeda Yaman di Semenanjung Arab (AQAP). Badan anti-teror AS mengklaim gerakan ini sebagai pihak yang paling mampu untuk melancarkan serangan ke wilayah AS. AQAP telah membangun jaringan yang aman di selatan Yemen, setelah memukul mundur tentara nasionalYaman yang terpecah akibat peperangan dengan kelompokkelompok antar suku serta gejolak politik yang tengah melanda di negara tersebut. Ibrahim Hassan al-Asiri: Pimpinan pembuat bom pada jaringan al-Qaeda di Semenanjung Arab, Asiri dituduh bertanggungjawab atas perakitan bom celana dalam yang digunakan untuk membajak maskapai penerbangan Detroit pada Desember 2009. Sejumlah penjabat intelijen AS mengatakan, Asiri belum lama ini melakukan pemunculan diYaman. (yahoo/rzl) “Untuk hari ini 23 peserta putri akan menyelesaikan perlombaan hingga sore hari, sebelumnya kemarin (Minggured) diawali 24 peserta putra dengan waktu perlombaan 8 jam,” papar H.Ismail. Diakui H.Ismail, untuk pelaksanaan MTQ ke 33 tingkat Sumut yang diselenggarakan di Sergai, khususnya cabang Khath Alquran, berjalan lebih tertib dan pengawasan ketat, baik dari pengawas maupun petugas, terlebih didukung lokasi pelaksanaan yang nyaman sehingga peserta dapat bekerja dengan tenang. Penilaian untuk katagori ini, lanjutnya, bidang kaidah khat termasuk bentuk , jarak spasi dan keserasian, kemudian keindahan khat, menyangkut orisinalitas, dan kreatifitas, serta keindahan hiasan diantaranya unsur disain dan tata warna. Dewi Puspita Sari,21, peserta dari Perguruan Tinggi, mahasiswi semester VIII, Fakultas Syariah di IAIN Medan menuturkan baru kali pertama mengikuti MTQ cabang Khathil Alquran katagori Mushaf, tuturnya menjelang istirahat siang. Menurut mahasiswi warga Kec. Batang Serangan, Kab. Langkat ini, dirinya sudah berulang kali menjadi juara untuk tingkat kabupaten di Langkat dan berharap di MTQ ke 33 Sumut dapat meraih juara.(c03)

Ada-ada Saja ....

rasa kecewa setelah ia putuskan. Waktu itu, ia datang kepada mantan kekasihnya itu untuk melakukan perawatan gigi. Namun Marek salah besar, karena wanita berusia 34 tahun itu ternyata masih menyimpan rasa kecewa mendalam. Di ruang periksa, Anna O K membuat mantan pacarnya itu U tertidur dengan memberiT A nya obat bius dosis tinggi. Saat ‘pasiennya’ tak sadarkan diri, S dokter gigi itu kemudian meS A lampiaskan dendamnya dengan mencabuti semua gigi yang ada I di mulut Marek. Setelah selesai melakukan Jawaban Sudoku: aksinya, Anna kemudian membalut mulut Marek dengan per5 3 4 9 1 2 7 6 8 ban, dan mengatakan bahwa 6 9 2 3 8 7 5 4 1 mantan pacarnya itu butuh perawatan dokter spesialis. 7 1 8 4 6 5 9 2 3 Ketika tiba di rumah, pria 3 5 1 6 9 4 2 8 7 malanginibarumenyadaribahwa 8 2 6 5 7 1 4 3 9 ia telah kehilangan semua giginya alias ompong total. “Saya tak pu4 7 9 2 3 8 1 5 6 nya alasan untuk mencurigainya. 9 4 7 8 2 6 3 1 5 Saya kira ia dokter yang profesional,” ujar Marek.“Kini saya harus 2 6 3 1 5 9 8 7 4 menyiapkanbiayayangbesaruntuk 1 8 5 7 4 3 6 9 2 operasiimplan,”tambahnya. (rzl)

MEDAN (Waspada): Pelayanan Elektronik Kartu Tanda Penduduk (e-KTP) di Medan berakhir Senin (30/4) pukul 24:00. Pemerintah Kota Medan memperkirakan pendataannya mencapai target sesuai yang ditetapkan Menteri Dalam Negeri (Mendagri) Gamawan Fauzi. “Pelayanan e-KTP kita perkirakan tercapai sesuai yang ditetapkan pemerintah pusat. Pelayanan e-KTP berakhir pada akhir April. Pada 25 April, kita telah menutup pendaftaran eKTP, dan saat itu telah mencapai target yakni 113 persen,” kata Kepala Dinas Kependudukan dan Catatan Sipil (Disdukcapil) Kota Medan Darussalam Pohan kepada Waspada, Senin (30/4). Dijelaskannya, secara rinci dia belum menerima semua laporan dari camat se Kota Medan setelah berakhirnya pendataan e-KTP. Namun, dia yakin pelayanan e-KTP pasti sesuai target. “Saya belum megang data seluruhnya, namun dari

Pilih Mana ? ... Di tempat sama, Direktur Binmas Polda Sumut Kombes Pol. Heri Subiansauri mengatakan, polisi tidak akan membedakan perlakuan kedua kelompok buruh itu. Aksi keduanya yang cukup kontras tersebut akan tetap dikawal untuk menghindari disusupi provokator. Sedangkan Kabid Humas Polda Sumut Kombes Heru Prakoso mengatakan, ada perubahan jumlah personel yang akan dikerahkan pada peringatan hari buruh menjadi 6 ribu personel. Sebelumnya dijelaskan jumlah personil 4 ribu lebih. Fokus utama yang akan dikawal ketat Bandara Polonia dengan pengawalan 7 satuan setingkat kompi (7 SSK). “Kapolda sudah menginstruksikan untuk mensterilkan bandara, jangan sampai terganggu dengan aksi demonstrasi,” kata dia. Menyikapi rencana aksi pendudukan bandar udara oleh massa DBSU, Heru mengatakan, polisi sudah melakukan pencegahan sedini mungkin. Sejak Senin (30/4) Polda telah menyiagakan personelnya dan menutup akses bandara dari aksi demonstran. “Kami sudah mengimbau jangan sampai melakukan aksi di bandara. Seandainya ada, kami akan cegah dengan mengalihkan demonstran ke wilayah lain,” sebut Heru. Apel Siaga Di Bandara Ratusan aparat Polresta Medan dan Polda Sumut melakukan apel kesiagaan di halaman parkir Bandara Polonia Medan, Senin (30/4), dalam rangka antisipasi peringatan hari buruh (May Day), Selasa (1/5). Pantauan Waspada, aparat

4 Hadiah ... katanya. Menurut Muhaimin, guna menyiapkan transportasi untuk buruh tersebut, segera dibeli dalam waktu dekat 200 bus sebagai permulaan untuk tiga titik kawasan industri yaituTangerang, Bekasi, Jawa Timur dan Batam. Hadiah keempat, Presiden juga telah memerintahkan untuk

USU Luncurkan ... Turut hadir, Wali Kota Medan Rahudman Harahap berserta jajarannya, Rektor USU Prof Syahril Pasaribu, berikut pembantu rektor, para undangan dari kalangan otomotif, dosen dan puluhan mahasiswa. Lebih lanjut, kata Siregar, mobil Horas berwarna merah hati itu dirancang berkekuatan 110 CC, panjang bodinya 2,5 meter, tinggi 1,5 meter dan lebar 1,2 meter. Tahun pembuatan mobil tersebut Februari 2012. ”Kami butuh 3 bulan menyiapkan mobil ini, “ jelasnya seraya menambahkan muatan mobil hanya satu orang. Kecepatan mobil ini, lanjutnya, 25 Km/jam. ”Ini sesuai ketentuan kompetisi SEM,” katanya. Katanya, mobil ini akan diikutsertakan dalam kompetisi internasional.KeikutsertaanUSU dalam SEM Asia 2012 merupakan yang pertama selama tiga tahun kegiatan itu digelar. USU akan berkompetisi dalam kelas kendaraan Urban Concept (dirancang untuk menyerupai konsepmobilperkotaan saat ini) berbahan bakar bensin. Rekor untuk kategori ini sementara dipegang Institut Teknologi Sepuluh Nopember Surabaya dengan pencapaian 149,8 km/liter. “Target kami 200 km/ liter untuk bisa juara, dan saat ini masih 90 km/liter. Kita masih terus melakukan penyempurnaan untuk mengejar hasil rekor tahun lalu,” beber Siregar. Katanya, menyempurnakan mobil Horas ini , para mahasiswa masih butuh waktu beberapa bulan lagi. “ Salah satu hambatan paling berat adalah ketersediaan dana. Di mana, biaya dibutuhkan membuat kendaraan itu dan berkompetisi di SEM Asia mencapai Rp250 juta. Saat ini sudah habis Rp60 juta, dan masih banyak yang harus diperbaiki agar catatan nilainya lebih baik,” jelasnya. Rektor USU Prof Syahril Pa-

data yang sebelumnya kita yakin program e-KTP mencapai target,” ucapnya. Di tempat terpisah sejumlah camat ketika diwawancara mengatakan, pelayanan e-KTP hampir rampung semuanya. Walaupun masih ada yang belum melakukan e-KTP, namun tetap ditunggu sampai malam hari pukul 24:00. “Sampai malam ini (kemarin-red) kita masih melayani e-KTP di kantor camat. Kita tidak tahu apakah sudah semua masyarakat melakukan e-KTP atau belum. Tapi yang jelas pelayanan tetap kita laksanakan sampai pukul 24:00,” kata Camat Medan Kota Parlindungan. Demikian juga dikatakan Camat Medan Johor Azwarlin saat dihubungi melalui ponselnya. Menurutnya, pelayanan eKTP untuk Medan Johor sudah hampir selesai. “Sampai malam ini pukul 24:00 kita tetap melayani pendataan e-KTP. Dari data yang ada, hampir semua warga sudah melakukan e-KTP,” ucapnya.

Ditempat terpisah Camat Medan Marelan Pulungan Harahap mengatakan, pelayanan e-KTP di wilayahnya sudah hampir selesai semuanya. Namun, sampai besok (hari ini-red) masih tetap melayani e-KTP. “Sudah hampir semua warga melakukan e-KTP, tapi bila masih ada yang belum melakukan e-KTP kita tunggu sampai hari ini. Mungkin ada yang belum melakukan e-KTP karena sibuk kerja, makanya ditunggu sampai hari ini,” kata Pulungan. Hal senada dikatakan Camat Medan Sunggal Fahri Matondang. Menurutnya sesuai dengan pemutakhiran data terakhir pelayanan e-KTP di tempatnya mencapai target. Namun, sampai malam ini (tadi malam-red) pihaknya masih tetap melayani program e-KTP. “Data terakhir program eKTP di Medan Sunggal mencapai target. Namun, sampai pukul 24:00 (tadi malam-red) kita masih melayani e-KTP bagi warga yang belum melakukannya,” demikian Fahri. (m50)

keamanan terlihat apel siaga baik pagi maupun sore di depan terminal kedatangan luar negeri Bandara Polonia Medan, menyebabkan ratusan unit kendaraan roda dua dipindah ke tempat parkir di kawasan terminal keberangkatan dalam negeri. Bahkan sejumlah mobil aparat dari Sabhara Poldasu dan lainnya sudah parkir di depan terminal keberangkatan luar ne-geri terutama diseputaran Jl. Imam Bonjol Medan. Di Jln. DC Barito dipersimpangan Jl. Avros Medan, puluhanpolisidenganaparatTNI AU berjaga-jaga dari arah itu tujuan ke Bandara Poloni . Sementara itu, Kapolpos Bandara Polonia Medan Aiptu Saut Sihombing berharap unjuk rasa buruh tidakterjadi ke Bandara Polonia, karena dapat merusakcitraSumutdimatawisatawan. Libur Nasional Pengusaha yang tergabung dalam Asosiasi Pengusaha Indonesia (Apindo) Sumatera Utara meminta kepada pemerintah supaya May Day yang bertepatan dengan 1 Mei dijadikan sebagai hari libur nasional. Hal tersebut dikatakan Ketua Apindo Sumatera Utara (Sumut) Parlindungan Purba kepada Waspada,Senin (30/4), terkait May Day yang biasa dijadikan para buruh sebagai hari untuk menyampaikan hak dan tuntutan normatif mereka dengan melakukan aksi unjuk rasa di berbagai instansi pemerintahan. “Dalam aksi pada May Day ini, kita minta jangan ada sweeping kepada buruh yang lainnya. Jangan lantaran ada buruh yang nggak mau demo, dipaksa-paksa. itu tidak boleh, karena itu juga hak azasi. Saya pikir serikat

buruh bisa memahami hal itu,” ujarnya. Dia mengatakan, pengusaha tidak akan keberatan dan tidak akan mengalami kerugian, jika pada 1 Mei tersebut dijadikan sebagai libur nasional. Mengenai tuntutan-tuntutan para buruh dalam setiap aksi unjuk rasa pada 1 Mei, Parlindungan Purba mengatakan, tuntutan para buruh itu banyak dan biasanya hak-hak normatif buruh yang diminta. Begitupun harus sama-sama bisa dipahami, bahwa pengusaha juga mengalami berbagai masalah, diantaranya krisis energi gas, listrik dan sebagainya. “Saya pikir kita sepakat, pengusaha itu tidak bisa hidup tanpa buruh dan sebaliknya buruh tidak bisa hidup tanpa ada pengusaha. Jadi upaya dialogislah yang kita lakukan dan saya juga memahami masih banyak perusahaan yang tidak membayar sesuai upah minimum provinsi, tapi itukan dalam rangka menciptakan lapangan pekerjaan yang masih dalam masa percobaan,” ujarnya. Selain itu, katanya, tuntutantuntutan para buruh tersebut saat ini tidak hanya ditujukan kepada pengusaha, tetapi juga kepada pemerintah. (m27/m32/41)

Gempa Bisa ...

pembangunan rumah murah bagi buruh. “Telah dibuat skemanya, baik itu yang sifatnya rumah susun sewa maupun rumah biasa yang bantuan uang mukanya dari pemerintah,” katanya. Untuk rumah buruh murah tersebut, nantinya Kemenakerstrans akan bekerja sama dengan Kementerian Perumahan Rakyat.

besar sekalipun. Akan tetapi, kata dia, pergerakan tanah lokal akibat kerap terkena gempa bumi memang sulit diprediksi sehingga jika ada masjid yang kebetulan berada di daerah gempa memang perlu dilakukan ulang pengukuran arah kiblatnya. Karena bentuk pola dasar bumi dan orientasi sumbu bumi tidak berubah, ia mengatakan bahwa rumus perhitungan arah kiblat sampai sekarang masih tetap sama, seperti menggunakankompasmasihbisadilakukan. “Hanya saja, penentuan arah kiblat dengan kompas terkadang kurang tepat, sebab biasanya bisa saja jarum kompas terganggu oleh aliran listrik dan besi beton yang ada di sekitarnya,” katanya.

saribu memberi apresiasi atas keberhasilan dan keseriusan mahasiswa mempersiapkan mobil rancangannya. “Mereka bekerja pagi hingga malam agar rancangannya bisa berprestasi. “ tegasnya. Katanya, setiap pulang praktek, ia selalu menyempatkan diri melintas melihat anak-anak membuat mobil itu.”Mereka bekerja serius sekali menyiapkan mobil ini,” beber rektor saat di temui Waspada itu usai peluncuran mobil Horas . Dia mengatakan hasil karya mahasiswa FT ini, sebuah kebanggaan bagi USU. Disamping lagi, mobil masuk kompetisi internasional SEM Asia 2012. Di mana, tidak semua perguruan tinggi mampu lolos dalam perlombaan ini. “Horas adalah bukti bahwa semangat mahasiswa dalam menghadapi isu dan tantangan energi masa depan tidak kalah dengan perguruan tinggi lain di Indonesia, maupun Asia. USU sangat bangga akan kompetisi dan kerja keras dari mahasiswa FT,” ucapnya. Rektor mengakui menciptakan rancangan ini hambatan yang dirasakan mahasiswa ada-

lah biaya. Namun, lanjutnya, ia terus meminta mahasiswa tidak patah semangat. Sebab, rektorat akan membantu mencari donatur guna meringankan beban anak-anak. “Di ajang SEM Asia 2012, nanti bukan tentang menang atau kalah, ini persoalan kemampuan. Kita ingin buktikan bahwa kita bisa berkompetisi di level internasional,” tandas rektor Sementara Wali Kota Medan Rahudman Harahap mengaku salut atas ide dan kreativitas mahasiswa menciptakan rancangan mobil hemat energi. “Atas nama pemerintah saya bangga, apalagi USU merupakan satu-satunya dari Pulau Sumatera masuk dalam dalam kompetisi internasional itu, “ katanya. Menurutnya, pembuatan mobil ini harus terus ditingkatkan atau dikembangkan lebih baik lagi.”Kalau sudah oke, Pemko berkeinginan membeli kendaraan ini untuk dipergunakan sehari-hari. Selain sebagai upaya mendukung penghematan energi juga mempromosikan hasil karya anak Medan,” katanya.Wali Kota Medan juga sempat mencoba mobil Horas tersebut. (m49)

WASPADA Selasa 1 Mei 2012

Korban Jambret ... kejadian itu adalah kecelakaan lalulintas. Namun, setelah diketahui wanita itu adalah korban jambret, warga emosi dan memukuli kedua pelakunya. Kata Erwin, korban sempat lama terkapar di aspal, sebelum warga mengangkat dan membawanya ke rumah sakit. “Saat aku sampai ibu itu masih cengap-cengap. Namun dia meninggal saat dibawa menuju rumah sakit. Mungkin kalau cepat mendapat pertolongan, bisa selamat,” ujarnya. Sementara itu, Zulkarnaen Nasution, keluarga korban mengatakan, korban yang sehariharinya berwiraswasta itu baru pulang jalan-jalan bersama sepupu dan keponakannya. “Naas bagi dia, tewas akibat dijambret dan aku minta polisi menghukum pelaku seberat-beratnya,” sebutnya. Kedua penjambret, Er, 20, dan IN, 20, warga Ujung Banting, Kel. Bagan Deli, Kec. Belawan, dalam kondisi babak belur dihajar massa,kini ditahan Polsek Medan Labuhan. Kepada polisi, kedua tersangka mengaku menjambret tas sandang milik korban di Pasar 1, Kel. Rengas Pulau, Kec.

Kadishut Tapsel ... atau 69.413,73 M3. Lokasinya di Hak Guna Usaha (HGU) PT. Ondop Perkasa Makmur (OPM), Kec. Angkola Selatan, Kab.Tapsel. Tapi saat itu terjadi perselisihan tentang kayu antara HJ selaku direktur PT. Dwi Putra Indo Kayu, dan Prianto selaku direktur PT. PLS, dan Budianto (Aseng Naga-red) selaku komisaris PT. PLS. Namun, kemudian mereka berdamai di hadapan notaris pada 15 Desember 2009. Salah satu isi perdamaian

AS Harus Minta ... seluruh negara Islam, demikian diberitakan AFP, Senin. Hujatan itu adalah reaksi dari sebuah upacara yang berlangsung Sabtu ketika pendeta Florida Terry Jones membakar kitab suci umat Islam dan simbol Nabi Muhammad untuk memprotes pemerintah Iran karena memenjarakan seorang pendeta Kristen, Yousef Nadarkhani. Pentagon meminta Jones menahan diri dalam menyikapi insiden pendeta Iran tersebut, karena sebelumnya kasus yang sama terjadi di Afghanistan dan melibatkan para pasukan AS. Terry sebelumnya pernah melakukan aksi serupa Maret 2011, menyulut kekerasan di Afghanistan Utara menewaskan 12 orang. (bbc/afp/m10)

Waspada/ Rustam Effendi

DUA penjambret Er dan IN, dalam posisi jongkok menunggu pemeriksaan di Mapolsek Medan Labuhan. Medan Marelan. Ketika itu, korban bersama teman dan seorang anak yang masih kecil, melintas mengendarai sepedamotor Yamaha Mio dari arah Helvetia menuju Belawan. Tersangka IN yang mengemudi sepedamotor Honda Revo tanpa plat mengejar korban dan temannya Er yang berada di boncengan menjambret tas korban dari arah belakang. Selanjutnya, kedua penjambret itu kabur dengan memacu laju sepedamotornya. Namun, korban sambil berteriak minta tolong melakukan pengejaran dengan kecepatan tinggi.

Setiba di Pasar 5 depan Toko Wigo, Marelan, korban melihat penjambret itu melambatkan laju sepedamotornya karena terperangkap kemacatan lalulintas. Korban yang mengendarai sepedamotornya dengan kecepatan tinggi langsung menabrak kendaraan pelaku. Akibat tabrakan itu, korban terjatuh dan kepalanya terhempas ke aspal. Kanit Reskrim Polsek Medan Labuhan AKP Oktavianus mengatakan, pihaknya sedang melakukan pengembangan atas dugaan keterlibatan pelaku dengan aksi penjambretan lain yang terjadi sebelumnya. (h03)

itu, semua tunggakan Provisi SumberDayaHutan(PSDH),dan Retribusi Hasil Hutan (RHH) atas IPK yang diterbitkan Bupati Tapsel, Ongku P Hasibuan, pada 3 Maret 2007, dan perpanjangannya pada 9 Desember 2008, menjadi tanggungjawab HJ. HJ berjanji mengurus dan menyerahkan bukti surat bebas tunggakan atas PSDH, dana reboisasi, dan RHH dari IPK selambat-lambatnya3bulansetelah perdamaian itu kepada Prianto. Kemudian Printo membantu HJ mengurus administrasi guna mengeluarkan sisa kayu IPK yang telh distoke opname untuk HJ. Kemudian saksi HJ membayar PSDH, DR, dan RHH kayu sebanyak 5.1114,73

M3 di IPK milik PT.PLS. Selanjutnya Ir. SS selaku Kadishut menerbitkan Surat Izin Angkut untuk kayu bulat sebanyak 5.114,73 M3 11 Juni 2010, dan berakhir 11 Agustus 2010. Namun kayu tersebut tidak dapat diangkut dari PT. PLS karena belum dilengkapi Surat Keterangan Sahnya Kayu Bulat (SKSKB). “Terdakwa Ir. SS mengetahui pemilik kayu itu adalah PT. PLS dan sudah mengetahui adanya perdamaian antara HJ dan Prianto di depan notaris. Tapi masih memberikan izin pengangkutan kayu kepada HJ, kemudian HJ menggunakan surat itu sebagai dasar mengangkut kayu 16.295,09 M3 dan bukan 5.114, 73 M3 lagi,” katanya. (a27)

Lapas IIA Banda Aceh ... Tidak lama kemudian penghuni Lapas IIA membakar barang-barang milik tahanan polisi di Lapas IIA. Penghuni mendapatkan satu buah bong atau alat pengisap sabu di ruangan tahanan oknum polisi. Tidak lama kemudian, aparat dari Polresta Banda Aceh dan personil Polsek Ingin Jaya diterjunkan ke lokasi mengamankan suasana lapas. Kemudian Kakanwil Hukum dan HAM Aceh mengadakan rapat tertutup bersama kepala lapas dan sipir serta oknum polisi itu. Kakanwil Hukum dan HAM Aceh Yatiman kepada wartawan menjelaskan, barang bukti berupa selang yang diduga alat pengisap sabu telah diserahkan ke Polresta. “Barang bukti yang kita temukan hanya selang saja dan sudah kita serahkan ke Polresta,” katanya. Bong pengisap sabu yang pertama kali ditemukan di kamar penghuni yang berasal dari oknum polisi hilang begitu saja. Atas kejadian itu, Yatiman mengaku akan melakukan tes urin terhadap petugas sipir di Lapas IIA Banda Aceh. Jika terlibat maka akan dikeluarkan. (cb01)

Al Bayan ... bekal 400 dirham buat keperluan puteranya dipertantauan. Setelah pamit dan mohon doa, remaja itupun berangkat dengan menunggang kuda. Ditengahtengah perjalanan,—begitu disebutkan dalam kisah itu,anak muda itu dicegat lanun (perampok) dan minta agar dia menjelaskan apa yang dia bawa. Sang remaja itu menceritakan apa adanya, dia berasal dari Makkah dan membawa uang 400. Konon sang lanun merasa terejek serta meminta anak muda itu memeruskan perjalanannya. Beberapa hari kemudian, dia bertemu lagi dengan sekumpulan lanun.“Berapa uang yang kau bawa,” kata bossnya lanun. “Aku bawa uang 400 dirham,” katanya lugas. Sang lanun curiga kalau-kalau uang yang dia bawa tidaklah sekecil itu dan meminta agar mengeluarkan seluruh harta bawaannya. Remaja itu mengeluarkan apa yang dia bawa termasuk uang yang hanya 400 dirham. Melihat keadaan itu lanun balik bertanya, ”Mengapa engkau berlaku jujur kepadaku, padahal engkau tau aku akan merampok hartamu,” katanya. “Ibuku meminta aku berjanji agar aku tetap berlakujujurkepadasiapaunjuga,”kataremajaitudengan tulus. Rupanya hati lanun yang bengis itu tersentuh. ”Wahai anak muda, aku benar-benar haru tentang sikapmu yang taat pada ibumu dan memegang janji kejujuran terhadap apapun itu, sementara aku selain tidak taat kepada Allah juga khianat pada janji-janjiku pada Nya, wahai anakku teruskan perjalananmu, aku menjamin engkau akan aman dan bawalah uang bekalmu, aku juga berjanji sejak hari ini akan bertaubat nashuha kepa-

da Allah dan akan meninggalkan seluruh pekerjaan jahatku,” katanya. Pada sore harinya, para anak buahnyapun datang membawa harta rampokan kepada ‘boss’nya. Tapi alangkah kagetnya mereka saat melihat pemimpinnya menangis dan meminta agar barang rampokan itu dikembalikan pada pemiliknya. Anak buahku sekalian, begitu kira-kira kata sang lanun, sejak hari ini aku bertaubat dan Allah ta’ala memerintahkan kita agar mengembalikan amanah itu kepada pemiliknya. “Kalau tuan sebagai pemimpin kami sudah bertaubat, maka kamipun sebagai anak buah menyatakan tobat dan tidak akan melakukan pekerjaan itu lagi. Konon sejak itu mereka menjadi pemimpin muslim yang sangat baik dan memberi bantuan bagi muslim di tengah masyarakatnya. Nukilan kisah diatas, agaknya tidak perlu kita kembangtafsirkan tuan,—ceritanya cukup jelas, bahwa didikan seorang ibu sangat sangatlah berpengaruh dalam sikap dan kehidupan kita sebagai anak-anaknya. Itulah ibu, tangannya yang mengayun buaian itu akan sanggup menggoncangkan dunia ini. Itulah ibu, pesan kejujurannya akan sanggup menggetarkan hati yang keras, hatta kalbu seorang lanun yang tak pernah lembut itu. Namun, Ncek,— ada pertanyaan yang menggelitik ati ambe,—bagaimana dengan anak-anak kita hari ini ,selain hari-hari mereka kita bekali dengan ‘dirham’,sudahkah mereka kita beri bekal janji jujur (Shiddiq) agar mereka tidak menjadi ‘perampok’ di masa datang. Antahlah mak dan umik ntahlah inang, ga taulah bundaku..…hanya kitalah yang tau semua itu. Tapi apapun itu Didikan Ibu sangatlah perlu ya mbuuun…

WASPADA Selasa 1 Mei 2012

Medan Metropolitan


Waspada/Surya Efendi Waspada/Surya Efendi

PARKIR MASJID AGUNG: Halaman Masjid Agung dipenuhi kendaraan roda empat (30/4) sejak pagi hingga sore. Sejak menjadi sorotan publik, pengelola Masjid Agung mengeluarkan larangan penggunaan halaman tersebut untuk lokasi parkir umum, kecuali jamaah yang hendak melaksanakan shalat.

PINTU MASJID AGUNG – SUN PLAZA: Tiga PNS melintasi gerbang Masjid Agung menuju Sun Plaza, Senin (30/4) sekira pukul 14:30. Akses gerbang Masjid Agung dan Sun Plaza ini ditutup dan dibuka hanya pada waktu shalat.

Kondisi BKM Agung Kronis

Pengelola Masjid Agung Harus Diganti MEDAN (Waspada): Setelah dirundung berbagai masalah, kini pengelolaan Masjid Agung di Jln. Diponegoro Medan terus menjadi sorotan publik. Sejumlah kalangan termasuk dari lembaga legislatif mendesak agar pengelola Masjid Agung segera mengundurkan diri. Melihat begitu derasnya desakan pengunduran diri tersebut, Senin (30/4), Waspada mencoba mengkonfirmasi De-

wan Pengawas Yayasan Masjid Agung Abd. Mutholib Sembiring yang bermukim di Jakarta. Namun Abd. Mutholib tidak menjawab telefon selularnya meski terdengar nada sambung. Kemudian Waspada menghubungi Ketua Yayasan Masjid Agung Bachtiar Fanani Lubis. Namun telefon selular miliknya tidak aktif. Di gedung DPRDSU, Ketua Fraksi Partai Keadilan Sejahtera (FPKS) Hidayatullah menyatakan prihatin atas peristiwa yang terjadi di Masjid Agung seusai Shalat Jumat lalu. Dia menilai kondisi Masjid Agung sudah sangat kronis. Jalan keluar dari permasalahan

Masjid Agung adalah mengganti pengurus Badan Kenaziran Masjid (BKM) tersebut. Menurut Hidayatullah, sangat ironis ketika para jamaa Shalat Jumat meminta pengurus masjid membuka dan menghitung hasil infaq di hadapan mereka. Itu sangat nyata kalau jamaah sudah tidak percaya lagi kepada BKM. Padahal manajemen masjid merupakan manajemen paling transparan yang ada di bumi ini. Karena setap penerimaan dicatat dan dilaporkan kepada jamaah. Diberitakan sebelumnya, usai pelaksanaan Shalat Jumat (27/4), sejumlah jamaah meminta pengurus Masjid Agung

membuka kotak infaq dan menghitung jumlah uang yang ada di dalamnya. Dari penghitungan yang dilakukan di teras masjid tersebut ditemukan selisih nilai yang sangat mencolok. Hari itu terkumpul uang Rp7,8 juta ditambah 20 Ringgit Malaysia. Sedangkan pada Jumat sebelumnya, hasil uang infaq hanya Rp3,4 juta dan 11 Ringgit Malaysia. Menanggapi hal ini, Ketua FPKS Hidayatullah menyebutkan, sudah sangat sulit kalau jamaah tidak mempercayai lagi pengurus masjid. Kalau kondisi ini terus dibiarkan dia yakin suasana di Masjid Agung tidak

akan pernah kondusif. ‘’Apapun yang dilakukan pengelola Masjid Agung, terus dianggap salah,’’ katanya. Hidayatullah tidak ingin mempersoalkan siapa pengelola Masjid Agung. Dia juga tidak ingin masuk pada persoalan kemungkinan pengelola melakukan kecurangan atau tidak melakukan kecurangan keuangan. Yang pasti, jamaah sudah sangat mencurigai pengelola. Itu dibuktikan pada kejadian Jumat lalu. Jalan keluar dari masalah ini, menurut Hidayatullah, mengembalikan masalahnya pada keinginan jamaah. Pengelola Masjid Agung harus transparan

Pemprovsu, Pengusaha Dan Serikat Pekerja Diskusikan Persoalan Buruh Diupayakan 1 Mei Hari Libur Daerah MEDAN (Waspada): Pemerintah Provinsi Sumatera Utara, Asosiasi Pengusaha, dan elemen buruh Sumutm akan mengupayakan perayaan Hari Buruh Internasional yang jatuh setiap tanggal 1 Mei menjadi hari libur di Sumut. Di samping itu Pemprovsu akan menyusun peraturan daerah mengenai buruh dan mengusulkan perubahan aturan sistem pengupahan ke-

pada pemerintah pusat. Hal itu terungkap dalam acara silahturahmi dan diskusi menyambut Peringatan Hari Buruh 1 Mei antara Pemprovsu dengan pengusaha dan berbagai elemen serikat buruh di Sumut, di Gubernuran Medan, Minggu (29/4) malam. Salah satu kesepakatan dalam pertemuan itu yakni mengusulkan perubahan atas Kepu-

tusan Menteri Tenaga Kerja dan Transmigrasi nomor 17 tahun 2005 tentang Komponen dan Pelaksanaan Tahapan Pencapaian Kebutuhan Hidup Layak yang dianggap menjadi penyebab rendahnya upah buruh di tanah air. Selain itu, pertemuan juga melahirkan beberapa usulan yang perlu ditindaklanjuti untuk diterapkan antara lain peneta-

Waspada/Amir Syarifuddin

GATOT Pujo Nugroho bersama sejumlah pengusaha dan elemen buruh mengadakan pertemuan membahas dan mendiskusikan masalah buruh di Gubernuran Medan.

pan 1 Mei sebagai hari libur daerah dan menegakkan aturan perburuhan di antaranya soal penerapan UMP dan penyalahgunaan praktik outsourching. Di samping itu, baik pemerintah maupun elemen buruh juga menyepakati perlunya dilahirkan peraturan daerah yang berpihak kepada buruh sekaligus menjamin kepastian berusaha bagi investor di Sumatera Utara. Acara yang dibuka dengan jamuan makan malam bersama dan dilanjutkan diskusi tersebut dipimpin langsung Plt Gubsu Gatot Pujo Nugroho. Pertemuan yang dilaksanakan menjelang peringatan May Day ini merupakan yang keduakalinya dilaksanakan Pemprovsu di bawah kepemimpinan Gatot Pujo Nugroho. Gatot mengatakan, akan dibentuk tim kecil yang terdiri dari unsur buruh, pegusaha, dan pemerintah serta pakar untuk menyusun berbagai materi usulan perubahan Kepmen Tenakerja dan Tansmigrasi Nomor 17 tahun 2005. Tugas tim ini nantinya akan menyusun komponen apa saja yang perlu ditambahkan untuk mencapai kebutuhan layak pekerja serta berbagai usulan lainnya yang dianggap perlu. Seperti diungkapkan Minggu Saragih dari Federasi Serikat

Pekerja Metal Indonesia, Kepmen 17/2005 ini dianggap menjadi penyebab utama rendahnya upah buruh karena hanya memasukkan 44 komponen. “Jumlah komponen tersebut sudah tidak relevan dengan kebutuhan riil pekerja minimal 90-an komponen kebutuhan. Di samping itu, Permen hanya menghitung kebutuhan hidup bagi pekerja lajang sehingga upah yang selama ini ditetapkan tidak mampu menghidupi anggota keluarga kaum buruh,” ujarnya. Terkait penetapan May Day sebagai hari libur, Gatot meminta jajaran Pemprovsu dan Apindo dapat memfasilitasi usulan tersebut. Diharapkan pada peringatan tahun berikutnya May Day diperingati sebagai pestanya kaum buruh dengan menyelenggarakan berbagai kegiatan positif dan elegan di antaranya Labour Expo Party kerjasama pengusaha dan buruh. Sementara itu Ketua Apindo Sumut Parlindungan Purba mengungkapkan apresiasinya kepada Plt Gubsu atas berhasilnya Sumut dan tiga kabupaten/kota meraih penghargaan di bidang K3. Dalam kesempatan tersebut Parlindungan menyambut baik 1 Mei dijadikan hari libur daerah sebagai bentuk penghargaan kepada kaum pekerja.”May Day dijadikan hari libur kami sangat setuju dan kami sudah berkali-kali mengusulkan kepada pemerintah sehingga hari tersebut bisa dinikmati buruh bersama keluarga. Ini adalah penghargaan bagi pekerja. Kalau bisa Sumut memulai terlebih dahulu sebelum pusat, akan bagus sekali,” katanya. Parlidungan juga memuji kepekaan Gatot terhadap kebutuhan dunia usaha, di antaranya dengan memperjuangkan alokasi gas bagi kebutuhan industri Sumut. Dalam kesempatan tersebut hadir para pengurus serikat buruh dari BPW SBMI Sumut, FSB KIKES SBSI Medan, SPSI Sumut, KSBSI Sumut, F Sejati, F SPM, FNPBI, BPP KBI, SPMI Sumut, dan SBSU Sumut. Selain itu hadir Sekretaris Daerah H Nurdin Lubis, Ketua Asosiasi Pengusaha Indonesia Sumut yang juga anggota DPD RI Parlindungan Purba, pakar ekonomi Prof Ramli SE, MSi, Kepala Dinas Tenaga Kerja Provsu Botb Sihombing, unsur Forum Komunikasi Daerah, para asisten, staf ahli dan kepala SKPD di jajaran Pemerintah Provinsi Sumut.(m28)

untuk mengajak serta jamaah bermusyawarah. Dalam hal ini, pengelola Masjid Agung harus berbesar hati menyerahkan masalah ini kepada siapapun yang bisa menjaga hubungan dengan jamaah. Harus Berani Di tempat terpisah, Direktur LBH Alwashliyah Kota Medan Ibeng S. Rani, SH berpendapat, seharusnya Yayasan Masjid Agung Medan menyahuti keinginan umat untuk mengusut masalah keuangan yang bersumber dari infaq, pendapatan parkir, bantuan donator dan pemerintah. ‘’Tegasnya, kita mendukung Yayasan Masjid Agung untuk mengusut tuntas aliran dana yang diperoleh tersebut secara transparan serta mengungkap siapa saja oknumnya jika ada penyelewengan,’’kata Ibeng. Menurut Ibeng, seluruh uang yang masuk ke Yayasan Masjid Agung bisa menjadi tidak halal kalau terjadi penyimpangan dan penggelapan. ‘’Jika yayasan tegas menjalankan amanah umat, maka umat Islam akan memback-up sepenuhnya kinerja Yayasan Masjid

Agung guna kemakmuran masjid tersebut,’’ujarnya. Sebaliknya, lanjut Ibeng, jika yayasan tidak berani mengusut serta mengungkap indikasi kecurangan tersebut, maka bisa dianggap bersubahat. Jangan sampai terjadi pengrusakan terhadap nilai-nilai keagamaan sehingga menjadi sifat hedonisme, mengambil keuntungan atau manfaat dari dana bantuan umat. Memprihatinkan Menyinggung kondisi Masjid Agung saat ini, Ibeng menilai sangat memprihatinkan. Justru itu, perlu dilakukan penataan ulang dari segi kebersihan, lingkungan, keindahan, arsitektur dan halamannya sehingga terwujud kembali Masjid Agung dengan segala keagungannya. Tidak kalah pentingnya adalah bagaimana mengelola perparkiran dan pedagang-pedagang musiman. Mengenai razia yang dilakukan jamaah terhadap kotakkotak infaq, Ibeng berpendapat hal tersebut sangat wajar. Sebab, tidak ada transparansi soal uang infaq, bantuan donatur dan lainnya. ���’Kalau terjadi razia

terhadap kotak infaq di masjid, ini merupakan cerminan ketidakpercayaan umat kepada pengurus yayasan maupun kenaziran, ’’ ujarnya. Ibeng juga menyampaikan kekhawatirannya suatu saat Masjid Agung akan berpindah ke tempat lain. “Kita meminta Organisasi Kepemudaan Islam (OKI) yang beberapa tahun silam sangat berkiprah, agar peduli terhadap kondisi Masjid Agung kini,” ujarnya. Tidak Mengatur Sementara itu, Kementerian Agama Kota Medan menyatakan tidak mengatur tentang laporan keuangan masjid terutama soal infaq. Hal ini disampaikan Kepala Kantor Kementerian Agama Kota Medan Iwan Zulhami melalui Kasi Pekapontren dan Penamas Abdul Manan, Senin (30/4). “Tidak ada peraturan yang mewajibkan pengurus masjid melaporkan keuangan hasil infaq ke Kementerian Agama Kota Medan. Sebab, Kementerian Agama hanya melakukan pembinaan sesuai dengan aturan yang ada,” kata Manan. (m12/m34/h02/m37)

AS Jajaki Kerjasama Proyek MP3EI Di Sumut MEDAN (Waspada): Pihak Amerika Serikat melalui perwakilan negaranya di Indonesia, menjajaki hubungan kerjasama bidang ekonomi ke Sumatera Utara, khususnya terkait proyek Master Plan Percepatan dan Perluasan Pembangunan Indonesia (MP3EI) senilai Rp34,278 triliun. Tawaran kerja sama itu diutarakan Konselor Ekonomi Kedutaan Besar AS di Jakarta James Carauso bersama Konsulat AS di Medan Anthony Wodds dan staf ahli bidang politik dan ekonomi Konsul AS di Medan Rachma Jaurinata dalam pertemuan dengan Sekdaprovsu Nurdin Lubis didampingi Kepala Bappeda Sumut Riadil Akhir Lubis dan lainnya, di ruang kerjanya Kantor Gubernur Sumut, Senin (30/4). ”Pihak AS sangat tertarik untuk bisa berkerjasama dengan Sumut, dalam proyek MP3EI itu. Karenanya, kami datang untuk menjajaki apa-apa saja kerja sama yang bisa kami peroleh untuk lebih meningkatkan hubungan kedua belah pihak,” ujar James yang pasih berbahasa Indonesia. Mendengar hal ini Sekda Nurdin Lubis menerangkan, proyek MP3EI merupakan pro-

yek pengembangan ekonomi khusus untuk koridor Indonesia bagian barat dan di Sumatera Utara, realisasi proyek ditujukan kepada pembangunan industri hilir kelapa sawit di atas lahan seluas 3.000 hektar, milik PTPN 3 di Sei Mangkei. Proses pembangunan KEK Sei Mangkei tersebut juga melibatkan PTPN 2 dan 4 dengan total investasi Rp5,1 triliun. Menurut Sekda, selain membangun pabrik pengolahan kelapa sawit dengan kapasitas maksimal 75 ton Tandan Buah Segar (TBS) per jam, pembangunan sarana lain seperti konektivitas jalan darat dan jalur kereta api dari kawasan industri Sei Mangkei ke Pelabuhan Kuala Tanjung, Kabupaten Batubara, juga ikut dikembangkan. ”Ke depan, keberadaan industri hilir sawit Sei Mangkei itu akan menjadi tulang punggung perekonomian wilayah Barat Indonesia. Sebab, perputaran ekonomi untuk 30 tahun ke depan setelah kawasan ini rampung, diperkirakan mencapai Rp30 triliun. Karenanya kami menawarkan ke pihak investor luar termasuk AS ikut berinvestasi dalam proses pembangunan di bidang industri lainnya yang terkait dengan

kelapa sawit di kawasan ini,” ujar Sekda. Pihak Pemprov Sumut juga menawarkan kerja sama sektor pengolah karet ban pesawat sejenis Boeing dan lainnya ke pihak AS. Sebab, industri hilir proyek tersebut dalam waktu dekat akan dibangun di kawasan Sei Bamban. “Sumut yang sudah punya pengalaman 100 tahun industrialisasi sawit dan karet, masih kekurangan pabrik ban khususnya ban pesawat Boeing. Bila pihak AS berminat, mungkin kerja sama di sektor itu masih sangat membuka peluang untuk dimasuki pihak AS. Karena sampai kini belum ada peminatnya,” ujar Kepala Bappedasu Riadil Akhir Lubis. Memang, dalam proyek MP3EI di Sumut, selain pembangunan industri downstream (turunan) produk CPO (Crude Palm Oil) di Sei Mangkei, industri pengolah turunan karet juga masih sangat langka di daerah ini. ”Karenanya, prospek AS menjalin kerja sama di sektor pabrik ban di Sei Bamban, sangat baik mengingat bahan baku untuk karet di Sumut ini sangat terjamin pasokannya,” kata Riadil.(m28)

Waspada/Amir Syarifuddin

SEKDAPROV Sumut Nurdin Lubis bersama sejumlah staf menerima kunjungan Konselor Ekonomi Kedubes AS di Jakarta James Carouso didampingi Konsulat AS di Medan Anthony Wodds dan staf ahli bidang politik dan ekonomi Rachma Jaurinata.

Medan Metropolitan


WASPADA Selasa 1 Mei 2012

Remaja Perlu Wadah Pengembangan Kreativitas MEDAN (Waspada):Wadah untuk pengembangan kreativitas bagi para remaja di Sumut terutama Medan masih sangat minim. Hal ini disebabkan kurangnya perhatian pemerintah. Padahal jika talenta-talenta muda yang memiliki bakat tersebut dibangun melalui sebuah wadah kreativitas, maka kemungkinan besar akan dapat mengangkat nama suatu daerah. Inilah suatu gambaran yang dilakukan Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan. Saat ini, STIKP bekerjasama dengan Persatuan Artis Film Indonesia (PARFI) Sumut mencoba mengembangkan kreativitas remaja dengan menggelar Pemilihan Top Model dan Festival Band pada 2627 Mei mendatang. Demikian dikatakan Wakil Ketua Bidang Pendidikan di PARFI Sumut dr. Robert Valentino Tarigan, SPd, baru-baru ini. “Kegiatan ini merupakan wadah pengembangan kreativitas bagi kalangan remaja dan pelajar di Sumut, khususnya Medan. Jika hal ini sering dilakukan maka akan mengangkat nama suatu daerah,” ujarnya. Untuk membangun talenta-talenta muda berbakat, menurut Robert, perlu digelar event semacam ini sebagai bentuk pengembangan kreativitas. “Bahkan,

perekonomian suatu negara bisa berkembang karena objek wisata di negara tersebut dijadikan lokasi pembuatan sebuah film. Melalui film itu, para wisatawan akan mengetahui gambaran atau bentuk budaya suatu daerah,” tambah Pimpinan BT/BS Bima ini. Dulu, lanjut Robert, industri pariwisata di Sumut berkembang sangat pesat. Sebab, objek wisata di daerah ini sering dijadikan lokasi pembuatan film. Belakangan, objek wisata di Sumut tidak lagi dijadikan lokasi syuting film. Ketika disinggung mengenai maraknya aksi geng kereta di Medan, Robert menilai akar masalah kenakalan remaja itu adalah kurangnya wadah untuk mengembangkan kreativitas bagi mereka. Saat ini, pergaulan remaja identik dengan narkoba, nongkrong di mall, warung internet (warnet), warung kopi dan lainnya. Jika tidak diarahkan dan diawasi dengan baik oleh para orangtua, maka para remaja tersebut akan melakukan tindak kejahatan. “Karena itu, salah satu upaya pencegahan agar para remaja tersebut tidak terlibat dalam aksi kejahatan yakni menggelar berbagai event sebagai ajang pengembangan kreativitas mereka sebagaimana dilakukan STIK-P dan PARFI Sumut,” demikian Robert.(cdu)

Mahasiswa Kritik Pasal 7 Ayat 6 (a) UU APBN-P MEDAN (Waspada): Angota Komisi VII Bidang Energi dan Sumber Daya Mineral DPR RI Jhony Allen Marbun mensosialisasikan formulasi Pasal 7 ayat 6 (a) APBN Perubahan 2012 yang membolehkan pemerintah menaikkan harga bahan bakar minyak (BBM) bersubsidi. Namun penjelasannya itu mendapat kritikan dan penolakan dari sejumlah aktivis mahasiswa.

Dalam diskusi terbatas dengan sejumlah organisasi mahasiswa dan kepemudaan Sumut di Hotel Antares Medan, Senin (30/4), Jhonny menjelaskan bahwa kebijakan merevisi undang-undang untuk membolehkan pemerintah menaikkan harga BBM karena perkembangan rata-rata harga minyak Indonesian Crude Price (ICP) melonjak sampai AS$119 per barel atau melonjak jauh dari harga yang diasumsikan di APBN 2012 yakni AS$90 per barel. Akibatnya, kata Jhonny,

beban subsidi BBM yang harus ditanggung pemerintah membengkak. Bahkan, jika sampai Desember 2012 harga BBM tidak dinaikkan, maka dia memprediksi beban subsidi yang harus ditanggung APBN mencapai Rp300 triliun. Karena setiap kenaikan AS$1 per barel, maka APBN harus menanggung beban tambahan Rp900 miliar. Karena itu, tambahnya, perlu dilakukan pengendalian defisit yang salah satunya melalui penyesuaian harga BBM, yang saat itu tidak dimungkinkan karena pasal 7 ayat 6 menyebutkan bahwa harga jual eceran BBM bersubsidi tidak mengalami kenaikan. “Karena itulah perlu dilakukan penyempurnaan peraturan perundang-undangan untuk memberi kesempatan kepada pemerintah melakukan penyesuaian melalui pasal 7 ayat 6(a). Menurutnya, pasal 7 ayat 6(a) tidak bertentangan dengan putusan Mahkamah Konstitusi RI Nomor 01/2005 tentang permohonan pengujian UU No.22/ 2001 terhadap UUD 1945, yang berpendapat bahwa campur tangan pemerintah dalam kebijakan penentuan harga harus menjadi kewenangan yang di-


MENAKERTRANS H Muhaimin Iskandar (kiri) menyerahkan penghargaan Zerro Accident 2012 kepada PDAM Tirtanadi yang diterima Direktur Administrasi & Keuangan H Ahmad Thamrin, di Smesco Convention Center, Jakarta.

utamakan untuk cabang produksi penting dan menguasai hajat hidup orang banyak. Dengan demikian, pemerintah dapat mempertimbangkan banyak hal dalam menetapkan kebijakan harga tersebut, termasuk harga yang ditawarkan mekanisme pasar. Apalagi, katanya, baik UU APBN ataupun APBN-P mulai 2008-2011 juga selalu memberi kewenangan kepada pemerintah untuk melakukan penyesuaian harga BBM bersubsidi. “Karena itu agak aneh, UU APBN 2012 jadi sangat kaku karena tidak memberi kesempatan kepada pemerintah sehingga perlu

disempurnakan me-lalui pasal 7 ayat 6 (a) UU APBN P,” katanya. Lebih jauh Jhonny mengatakan, besarnya harga subsidi BBM malah membuka peluang lebih besar kepada para mafia untukmelakukanpenyalahgunaan dalam jalur distribusinya. Rasionalisasi inilah yang kemudian dibantah sejumlah aktivis mahasiswa dalam diskusi tersebut. Aktivis mahasiswa menilai pemerintah seharusnya tidak menimpakan faktor ketidakmampuan dalam mengawasi distribusi BBM bersubsidi kepada masyarakat dengan mengeluarkan kebijakan untuk menaikkan harga BBM bersub-

sidi. “Seharusnya pemerintah memperketat pengawasan terhadap tanker-tanker itu. Bukannya malah mau menaikkan harga BBM,” kata salah seorang mahasiswa. Turut hadir dalam diskusi tersebut, Ketua DPD Partai Demokrat Sumut HT Milwan, Anggota Fraksi Demokrat DPRD Sumut Tahan Manahan Panggabean, Yusuf Siregar, Meilizar Latief, Ketua KNPI Medan Zulham Effendy, Ketua Umum AMPP Amran Pulungan dan berbagai elemen mahasiswa seperti Himmah, IMM, PMII, HMI dan sejumlah Badan Eksekutif Mahasiswa di Medan.(m48)

Kamaluddin Harahap Tak Gentar Dicopot DPW PAN Tidak Mengerti Filosofi SK DPP MEDAN (Waspada): Diancam copot dari jabatannya sebagai Wakil Ketua DPRDSU, Kamaluddin Harahap mengaku tidak gentar. Malah dia menyebutkan kalau pengurus DPW Partai Amanat Nasional (PAN) Sumut tidak mengerti hakekat dan filosofi dari SK DPP yang mereka pegang. Senin (30/4), Waspada bertemu dengan Kamaluddin Harahap, di gedung dewan. Kepadanya ditanyakan seputar surat DPW PAN Sumut kepada pimpinan dewan yang minta pencopotan dirinya dari jabatan Wakil Ketua DPRDSU. Sebelumnya diberitakan, dasar surat DPW PAN meminta Kamaluddin Harahap dicopot adalah SK DPP PAN No 074 tahun 2009. Salah satu poin di SK itu menyebut tentang jabatan kader PAN di legislatif.Yakni, pimpinan fraksi dan pimpinan dewan dari PAN dijabat oleh pimpinan partai setingkatnya. Mengacu pada SK tersebut, DPW PAN Sumut memandang harus mengganti Kamaluddin Harahap, yang kini duduk sebagai Wakil Ketua DPRDSU. Karena posisi Kamaluddin di partai adalah Wakil Sekretaris DPP

PAN. Sedangkan pimpinan PAN Sumut yang menjadi anggota dewan adalah Parluhutan Siregar. Menjawab ini, Kamaluddin Harahap mengatakan, pengurus DPW PAN Sumut salah mengartikan SK No. 074 itu. Karena, bukan saja SK itu tidak berlaku surut, tapi juga kebijakan yang dilakukan DPP waktu itu untuk menghindari terjadinya tumpang tindih pemahaman tentang jabatan kader. Secara filosofi, kata Kamaluddin, keluarnya SK No. 074 itu, untuk mengatur posisi kader yang menjadi ketua fraksi atau pimpinan dewan. Saat Pemilihan Legislatif (Pileg) tahun 2009, ada penambahan jumlah pimpinan dewan di seluruh tingkatan legislatif. Untuk DPRDSU, jumlah pimpinan dewan dari empat orang menjadi lima orang, sesuai penambahan jumlah anggota dewannya. “Agar tidak terjadi tumpang tindih, DPP mengeluarkan SK 074 itu,’’ katanya. Namun demikian, menurut Kamaluddin, di DPW PAN Sumut waktu itu juga sudah diatur tentang posisi kader di DPRDSU. Lewat rapat pengurus

harian DPW, diputuskan posisi di legislatif nantinya disesuaikan dengan jabatan di partai. ‘’Kebetulan pada periode ini, PAN mendapat posisi wakil ketua. Sesuai kesepakatan, sayalah yang mendudukinya, karena waktu itu saya Ketua PAN Sumut,’’ katanya. Dengan demikian, kata Kamaluddin, seharusnya tidak perlu ada surat DPW PAN yang minta dirinya digantikan. Pada prinsipnya, penunjukan dirinya sebagai pimpinan dewan juga tidak bertentangan dengan SK No. 074 itu. Saat terpilih menjadi anggota DPRDSU, Kamaluddin masih menjabat sebagai Ketua DPW PAN Sumut. Melihat kejadian saat ini, Kamaluddin Harahap mengaku teringat saat menjadi anggota DPRDSU periode 2004-2009. Waktu itu, setelah menjadi anggota dewan beberapa saat, dirinya terpilih menjadi Ketua DPW PAN menggantikan Ibrahim Sakti Batubara. Namun, dia tidak mempersoalkan jabatan Ketua Fraksi yang dijabat Ibrahim Sakti Batubara. ‘’Saya tetap saja menjadi anggota biasa. Tidak langsung‘merebut’ jabatan pak Ibrahim,’’ katanya. (m12)

PDAM Tirtanadi Terima Penghargaan Zero Accident 2012

Rumah Diserang Puluhan OTK, Dua Pemiliknya Ditembak

MEDAN (Waspada): PDAM Tirtanadi bersama 15 Gubernur dan 21 Wali Kota/Bupati se-Indonesia serta 739 perusahaan menerima penghargaan Zerro Accident (Kecelakaan Nihil) dari Menteri Tenaga Kerja dan Transmigrasi (Menakertrans). Penghargaan itu langsung diserahkan Menakertrans Drs HA Muhaimin Iskandar Msi, sebagai Pembina Keselamatan dan Kesehatan Kerja (K-3) Tingkat nasional Tahun 2012 yang diterima Direktur Administrasi & Keuangan H Ahmad Thamrin SE, M.Psi, di Smesco Convention Center, Jakarta, Rabu (25/4) malam. Menakertrans menjelaskan, ada peningkatan jumlah perusahaan yang meraih penghargaan Zerro Accident pada tahun ini sampai 44,3 % dibandingkan tahun 2011 hanya mencapai 512 perusahaan. Kata Muhaimin, penghargaan K-3 diberikan kepada perusahaan atas evaluasi hasil audit dari lembaga audit. Menurut dia, pemerintah tidak hanya memberikan penghargaan kepada pemenang. namun bentuk insentif lainnya. “Hal ini agar jumlah perusahaan dan daerah yang peduli akan keselamatan dan kesehatan kerja dapat meningkat,” ujar Menakertrans namun tidak merinci insentif apa yang diberikan oleh pemerintah. Sementara itu, Direktur Administrasi & Keuangan PDAM TirtanadiHAhmadThamrinSE,M.Psimengakusangatsenangatasapresiasi yang diberikan oleh pemerintah dalam hal ini Menakertrans. Menurut Thamrin, seluruh jajaran direksi dan fungsionaris PDAM Tirtanadi akan lebih giat lagi dan fokus terhadap keselamatan dan kesehatan kerja di masa yang akan datang. Ini berkat kerja keras dari seluruh pegawai PDAM Tirtanadi dan dukungan stakeholder. “Kami sangat senang dan bangga menerima penghargaan ini. Betapa tidak, dari ribuan perusahaan yang ada di Kota Medan, PDAM Tirtanadi termasuk salah satu dari 20 perusahaan yang menerima penghargaan Zerro Accident,” katanya. Penganugerahan penghargaan ini merupakan program rutin yang digelar Kementerian Tenaga Kerja dan Transmigrasi. Penghargaan tersebut merupakan bentuk apresiasi pemerintah dalam mendukung upaya sosialisasi Keselamatan dan Kesehatan Kerja (K-3) tingkat nasional. (cwan)

MEDAN (Waspada): Satu rumah di Jln. Pukat V No 37, Kel. Bantan Timur, Kec. Medan Tembung, diserang puluhan orang tak dikenal. Dua pelaku bersenjata api menembak pemilik rumah Rahman Tuah Nasution, 40, dan abang kandungnya Hadi Sofyan Nasution, 43. Korban Rahman Tuah Nasution didampingi abangnya Hadi Sofyan Nasution menjelaskan, peristiwa penyerangan puluhan OTK tersebut terjadi Sabtu (28/4) sekira pukul 01:00. Awalnya Rahman Tuah ditelepon oleh abangnya, bahwa rumah mereka dikepung oleh puluhan lelaki tak dikenal. Sesampainya di rumah orangtuanya di Jln. Pukat V itu, korban langsung disambut oleh kelompok pria yang sebagian tak dikenal korban. Kemudian beberapa di antaranya menyerang Rahman Tuah dengan senjata kelewang. Seorang di antara penyerang yang diketahui berinisial Uj langsung menembak korban dari jarak 5 meter dengan menggunakan senjata api. Akibatnya, korban tertembak di bagian perut.

Sebelum menembak Rahman Tuah, para pelaku juga sempat menembak Hadi Sofyan yang berada di dalam mobilnya, namun tembakan tersebut tidak mengenai korban dan hanya menembus kaca depan mobilnya, sehingga dia luput dari tembakan. “Saya tidak tau apa motif penembakan tersebut, karena begitu saya tiba di rumah, para pelaku langsung menyerang dan menembak saya,” sebut Rahman Tuah yang juga ketua PAC Pemuda Pancasila Kecam a t a n Me d a n Te m b u n g didampingi Sekretaris Syamsul Hutasuhut kepada Waspada, Senin (1/5). Ironisnya, kata dia, dalam penyerangan tersebut ada sejumlah oknum polisi namun tidak berupaya mencegah apalagi menangkap pelaku penyerangan. Sedangkan Hadi Sofyan menyebutkan, saat dirinya baru tiba di r umah, tiba-tiba kelompok penyerang menembak dirinya yang masih berada di dalam mobil namun tidak kena dan peluru menembus

kaca depan mobil. “Satu tembakan ditujukan kepadaku namun tidak kena dan hanya menembus kaca depan,” sebutnya. Usai melakukan penyerangan, kelompok penyerang kabur dengan mengendarai beberapa mobil dan sepedamotor. Sementara itu,Syamsul Hutasuhut mendesak Polsek Percut Seituan agar mengusut kasus tersebut sekaligus menangkap para pelaku pengrusakan dan penembakan itu. “Kalau polisi tidak bisa menangkap pelaku penyerangan dan penembakan dalam tempo 2 x 24 jam, maka secara organisasi kami akan bertindak menangkap pelakunya,” tegasnya. Kapolsek Percut Seituan Kompol Maringan Simanjuntak melalui Wakapolsek AKP Azwar menyebutkan, motif penyerangan diduga karena isi pesan singkat (SMS) yang dikirim oleh Hadi Sofyan kepada seseorang, namun belum diketahui apa isi SMS tersebut. “Motif penyerangan diduga gara-gara isi SMS namuntidakdiketahuiapaisiSMS tersebut. Kasusnya masih dalam penyelidikan,” katanya. (h04)

Waspada/Amir Syarifuddin

PLT GUBSU Gatot Pujo Nugroho memberikan piagam penghargaan kepada Kepala Sekolah Burhanuddin Harahap dan Ketua Komite Sekolah MAN 1 Medan HM Yusuf Harahap.

Plt Gubsu Harapkan Alumni MAN 1 Miliki Karakter 5G MEDAN (Waspada): Plt Gubernur Sumut Gatot Pujo Nugroho mengharapkan seluruh alumni MAN 1 Medan memiliki karakter 5G. Yakni karakter yang mengutamakan Alquran dalam segala hal di kehidupan sehari-hari. “Apabila gerakan 5G ini menjadi karakter pribadi seluruh anak didik dan alumni, saya yakin ini akan menjadi batu loncatan untuk meraih masa depan yang lebih gemilang,” ucap Gatot saat memberi sambutan pada pelepasan dan perpisahan siswa kelas XII MAN 1 Medan Tahun Pelajaran 2011/2012 di Jln. Willem Iskandar/Jln. Pancing Medan, Sabtu (28/4). Karakter 5G yang dimaksud adalah gerakan membaca Alquran, gerakan menghafal Alquran, gerakan mengerti Alquran, gerakan menulis Alquran, dan gerakan mengamalkan Alquran. Di hadapan Kepala Sekolah MAN 1 Medan Burhanuddin Harahap SAg, MPD beserta dewan guru dan Kepala Badan SDM Pendidikan Menengah Kemdiknas Prof Syawal Gultom, Gatot juga berharap gerakan 5G tersebut bisa menjadi motivasi bagi seluruh siswa didik di sekolah itu dan khususnya alumni serta generasi penerus bangsa lainnya. Alasan Gatot mengutarakan harapannya tersebut, karena beberapa pertimbangan terutama Alquran sebagai sumber segala sumber ilmu yang asalnya langsung dari Allah SWT.

Sebagai sumber dari segala sumber ilmu di muka bumi, lanjut Gatot, tentunya Alquran sangat memberikan manfaat yang tiada duanya, baik di kehidupan masa kini, masa depan, dan diakhir zaman.”Sabda Rasul, sebaik-baiknya manusia adalah yang banyak memberikan manfaat bagi orang lain dan ini merupakan implementasi dari Alquran,” sebutnya. Justru karena manfaat yang tak terhingga dari Alquran itulah, Gatot sangat menganjurkan gerakan 5 G menjadi motivasi dan orientasi kehidupan di masa depan bagi seluruh alumni, siswa didik, dan umat Muslim lainnya. “Atas nama orangtua seluruh siswa, kami ucapkan terimakasih karena telah mendidik anak kami mengikuti petunjuk dan perintah Allah SWT dan Rasulnya. Mudah-mudahan, kelulusan tahun ini bisa mencapai 100 persen,” ujarnya. Gatot juga berharap kepada siswa yang sebentar lagi meninggalkan sekolah untuk menghormati orang/guru yang telah mengajarkan ilmu. Hal itu dianjurkan agar ilmu yang diperoleh menjadi berkah. “Karenanya ingat-ingatlah jasa para guru dan saya mengharapkan sekolah ini membuat website khusus untuk para alumni. Sehingga wadah tersebut bisa menjadi sarana berkomunikasi para alumni di mana pun berada,” katanya. Sebelum meninggalkan lokasi, Gatot memberikan piagam penghargaan atas nama Gubernur Sumut kepada Kepala Sekolah MAN 1 Medan Burhanuddin Harahap dan Ketua Komite Sekolah MAN 1 Medan HM Yusuf Harahap. (m28)

Sat Lantas Beri Pelayanan Prima MEDAN (Waspada): Sat Lantas Polresta Medan terus memberikan pelayanan prima kepada masyarakat yang mengajukan permohonan Surat Izin Mengemudi (SIM). Pelayanan yang dilakukan secara optimal tersebut bertujuan agar masyarakat merasa nyaman, aman dan cepat saat berurusan di Mako Sat Lantas Polresta Medan. Kasat Lantas Polresta Medan Kompol M. Risya Mustario melalui Kanit Reg Ident AKP Toni Irwansyah SH, Senin (1/5) menjelaskan, dalam rangka pelayanan prima tersebut pihaknya melakukan berbagai inovasi baru seperti menyediakan petugas pelayanan yang siapmelayanidanmemberikaninformasiterkait pengurusan SIM baru dan perpanjangan SIM hingga pelayanan Mobil SIM Keliling. “Masyarakat yang hendak mengurus SIM baru atau Perpanjangan tidak akan bingung lagi. Sebab, sudah ada petugas pelayanan dan informasi yang menuntun masyarakat, sejak awal pengurusan hingga mendapatkan SIM. Ada juga papan publikasi yang menjelaskan mekanisme pengurusan SIM di setiap ruangan di SATPAS Polresta,” jelas AKP Toni Irwansyah. Karena itu, lanjut Toni, pihaknya telah memasang spanduk tentang proses pengurusan SIM dan mekanisme pengurusan SIM di lingkungan Sat Lantas Polresta Medan serta

biaya pengurusan SIM sesuai dengan Perkap No. 9 tahun 2012 dan PP No 50 tahun 2010. Masyarakat harus langsung mengurus SIM sendiri tanpa melalui orang lain atau calo. Karena biaya pengurusan SIM A baru dan SIM B baru hanya Rp 100 ribu dan Rp120 ribu sesuai PNBP serta wajib mengikuti ujian teori dan praktik. Selain itu, loket pendaftaran pengurusan SIM baru dibagi dua loket yakni loket khusus untuk pria dan loket wanita yang sengaja dipisahkan agar parapemohonSIMmerasanyamantanpaharusantri panjang. Begitu juga saat mengikuti ujian teori, pemohon SIM pria dan wanita juga dipisahkan. “Contohnya, gelombang pertama ujian teori pesertanya semua wanita, gelombang kedua diikuti kelompok pria dan seterusnya,” terang Toni Irwansyah seraya menambahkan Satuan Penyelenggara AdministrasiSIM(SATPASPolrestaMedan)kinimasuk dalam 10 besar pelayanan SIM terbaik di Indonesia. Dijelaskan Toni, pihaknya juga menyediakan Mobil SIM Keliling yang melayani masyarakat untuk memperpanjang/memperbaharui SIM A dan SIM C yang akan habis masa berlakunya. Pelayanan Mobil SIM Keliling setiap harinya mulai pukul 09:00 hingga pukul 22:00 dan ditempatkan di lokasi yang ramai dan strategis. “Mobil SIM Keliling akan beroperasi Senin-Rabu di Komplek Perumahan Asia Mega Mas, Kamis-Jumat di Pos Polisi Belawan dan Sabtu-Minggu di Lapangan Merdeka Medan,” demikian Toni. (h04)

Jajaran PP Diminta Amankan Pembangunan Perumahan PWI MEDAN (Waspada): Ketua Majelis PimpinanWilayah (MPW) Pemuda Pancasila (PP) Sumatera Utara (Sumut) Anuar Shah, SE (Aweng) meminta seluruh jajarannya mendukung dan mengamankan proses pembangunan perumahan Persatuan Wartawan Indonesia (PWI) Cabang Sumut di Jln. PWI Dusun XVI Desa Sampali Kecamatan Percut Seituan, Kabupaten Deliserdang. Hal itu ditegaskan Aweng saat menerima kunjungan silaturahmi Ketua PWI Sumut Drs. Muhammad Syahrir bersama Sekretaris Edward Thahir, S.Sos;Wakil Ketua Drs. Khairul Muslim; Wakil Sekretaris Zul Anwar Marbun; Ketua Tim Tanah dan Pelaksana Pembangunan Graha PWI Sumut Abiyadi Siregar; Wakil Ketua Tim Drs Eddy Syahputra Sormin serta Bendahara Tim Nurhasanah, S.Sos di Swiss Belhotel Medan, Senin (30/4). Sementara unsur MPW PP Sumut yang mendampingi Aweng antara lain Wakil Ketua I Taufik, Ketua Bidang Hukum H. Danil, SH; Sekretaris H. Firdaus Nasution; Bendahara

H. Ali Madhy dan Koordinator Pokja Humas H Idrus Djunaidi. Dalam pertemuan penuh keakraban tersebut, Aweng mengatakan, pembangunan perumahan PWI Sumut merupakan langkah yang sangat positif untuk meningkatkan kesejahteraan anggota PWI. “Karena itu, saya sangat mendukung dan memerintahkan seluruh jajaran PP untuk mengamankan proses pembangunan perumahan PWI Sumut tersebut,” tegas Aweng. Pada kesempatan itu, Aweng juga menyatakan akan membantu bahan material untuk pembangunan masjid yang didirikan di lahan perumahan PWI Sumut, sekaligus PP akan bersinergi mengelola fasilitas umum dan fasilitas sosial yang terdapat di lokasi lahan seluas 14,4 hektare tersebut. Atas dukungan MPW PP Sumut itu, Ketua PWI Sumut Drs Muhammad Syahrir mengucapkan terima kasih. “Dukungan ini merupakan kebahagiaan yang sangat berharga bagi anggota PWI Sumut yang lebih 10 tahun menanti realisasi dengan mencicil secara arisan per bulan Rp150 ribu,” ujar Syahrir. (m08)


KETUA MPW PP Sumut Anuar Shah, SE (Aweng) dan Ketua PWI Sumut Drs Muhammad Syahrir diabadikan bersama sejumlah unsur pengurus MPW PP Sumut dan PWI Sumut beserta Tim Tanah dan Pelaksana Pembangunan Graha PWI Sumut usai pertemuan silaturahmi di Swiss Belhotel Medan, Senin (30/4).

Medan Metropolitan

WASPADA Selasa 1 Mei 2012


Blanko STNK Habis Pemilik Kendaraan Resah MEDAN (Waspada): Ribuan pemilik kendaraan bermotor roda dua dan empat yang ingin melakukan bea balik nama (BBN) dan perpanjangan Surat Tanda Nomor Kendaraan (STNK) resah. Pasalnya, blanko STNK di Ditlantas Poldasu habis sejak sebulan terakhir.

Akibat blanko STNK belum didistribusikan dari Korlantas Mabes Polri ke Dit lantas Poldasu, maka pihak Poldasu mengambil kebijakan dengan mengeluarkan STNK sementara kepada pemilik kendaraan. Ternyata STNK sementara yang dikeluarkan Dit Lantas Poldasu sepertinya tidak berlaku

10 Wanita Diamankan Dari Cafe Ilegal MEDAN (Waspada): Muspika Kecamatan Medan Polonia merazia sejumlah cafe illegal, Jumat malam hingga Sabtu dinihari (27-28/4), berhasil mengamankan 10 wanita tidak memiliki KTP. Razia tersebut dipimpin Kapolsek Medan Baru Kompol Dony Alexander SH, SIK, M.Hum bersama Camat Medan Polonia Drs Ody Dody Prastyo MSP, dibantu Kapten POM AU Chandra Tarigan, Kaur POM Lanud Lettu Paulus Siboro SIP, Sekcam Medan Polonia Hidayat S.Sos, MAP, Kanit Reskrim Polsek Medan Baru AKP Andik Eko Siswanto SH, dan Panit Binmas Aiptu Ganafo Sembiring, SH, dengan menurunkan 90 personel terdiri dari Polsek Medan Baru, POM, Koramil, seluruh Lurah dan Kepling. Sebelum melakukan pemeriksaan terhadap pengunjung cafe baik pria dan wanita, Camat Medan Polonia Ody Dody Prastyo mengimbau mereka agar tidak meninggalkan tempat duduknya. Selanjutnya petugas meminta para penggunjung mengeluarkan isi dalam saku, tas, dan dompetnya. Camat Ody Dody didampingi Kapolsek Medan Baru Kompol Dony Alexander disela-sela razia mengatakan, razia tersebut dilakukan secara rutin dengan sasaran narkoba, senjata tajam, senjata api, buronan, dan lainnya. Sedangkan bagi para pengunjung yang terjaring, kata Ody, pihaknya hanya melakukan pendataan saja. Selesai diberikan pengarahan, mereka dibenarkan pulang. Apabila ada yang tersandung dengan hukum antara lain, narkoba, senjata tajam, dan tindak pidana lainnya, ditangani Polsek Medan Baru untuk menjalani proses lebih lanjut. Menurut Ody Dody, cafe yang dirazia adalah cafe yang tidak memiliki izin alias ilegal. “Kita sudah berulangkali mengimbau cafe ilegal itu karena keberadaannya sangat mengganggu kenyamanan masyarakat,” sebutnya. Pantauan Waspada di lapangan, Muspika Medan Polonia melakukan razia terhadap cafe ilegal yang berada di Jln.SMA 2, Jln.Padang Golf, Jln.Perjuangan. (m36)

Wanita Bawa Heroin 5,6 Kg Diboyong Ke Jakarta MEDAN (Waspada): Petugas Badan Narkotika Nasional (BNN) memboyong seorang wanita diduga membawa narkoba jenis heroin lebih kurang 5,6 Kg, dari Medan ke Jakarta, Minggu (29/4). Tersangka Saning Sokhib Saji, 38, warga Jakarta yang lahir di Lamongan Jatim 12 Januari 1974, menumpang penerbangan Air Asia AK-1350 dari Kuala Lumpur Malaysia. Saat mendarat di Bandara Polonia Medan, petugas Bea Cukai mencurigai tersangka. Hasil pemeriksaan awal melalui X-ray, tersangka diduga membawa narkoba jenis heroin, yang disembunyikan di dinding koper warna hitam. Menurut sumber di Bandara Polonia Medan, Senin (30/4), tersangka diboyong ke Jakarta, oleh petugas BNN untuk pengembangan kasus secara intensif. Tersangka Saning Sokhib Saji beserta barang bukti didampingi sejumlah petugas BNN, diterbangkan ke Jakarta menggunakan penerbangan Lion Air JT-303, Minggu siang. Kata sumber, baru pertama kali petugas BNN memboyong tersangka pemilik heroin dari Medan ke Jakarta. “Padahal sebelumnya, setiap pelaku yang tertangkap di Medan langsung diproses dan menjalani hukuman di Medan,” ujarnya. (m32)

di daerah. Buktinya, ada pemilik kendaraan yang ditilang petugas Sat Lantas dengan alasan STNK sementara tersebut tidak berlaku. Lain lagi dialami Sugiatmo, warga Medan, yang mengurus perpanjangan STNK mobilnya melalui biro jasa. Sudah sebulan STNK nya belum selesai. Ketika ditanyakan, pihak biro jasa mengatakan blanko STNK di Dit Lantas Poldasu habis. “Blanko STNK di Dit Lantas Poldasu habis. Jadi, kami masih menunggu blanko tersebut dikirim dari Korlantas ke Medan,” jelas salah seorang biro jasa. Sedangkan Kasubag Renmin Kompol Murthada yang dikonfirmasi sejumlah wartawan, Senin (30/4) mengakui blanko STNK di Dit Lantas Poldasu sudah habis. Namun dia menyatakan blanko tersebut habis baru sekitar seminggu yang lalu. “Sudah habis sejak seming-

gu lalu. Tapi Dir Lantas Poldasu sudah menghubungi Korlantas Mabes Polri agar segera mengirimkan blanko STNK sehingga bisa melayani para pemilik kendaraan bermotor,” jelas Murthada. Rencananya, lanjut Murthada, Selasa (1/5) blanko STNK dari Korlantas Mabes Polri sudah tiba Dit Lantas Poldasu. “Rencananya besok (hari ini), sudah masuk blanko STNK yang dikirim dari Korlantas sebanyak 50 ribu blanko melalui kargo. 35 Ribu digunakan untuk Dit Lantas sisanya 15 ribu untuk Satuan Wilayah di daerah,” jelasnya. Setelah blanko STNK masuk ke Dit Lantas, mungkin keesokan harinya akan ada lagi pengiriman 12 ribu blanko STNK. “Kita mengutamakan di Dit Lantas karena pengurusan perpanjangan STNK dan BBN di sini paling banyak,” jelasnya. Ditanya berapa blanko yang

dibutuhkan Dit Lantas Poldasu, Kompol Murthada menjelaskan, Dit Lantas mengajukan 213.120 blanko STNK per triwulan 2012. Menurut Murthada, tidak hanya Dit Lantas Poldasu yang kehabisan stok blanko STNK, tetapi Polda seluruh Indonesia juga kehabisan blanko. Ditanya kenapa dari Korlantas bisa kehabisan stok blanko STNK, Murthada menjelaskan, karena masalah pengadaan blanko ini masih dalam tahap tender. “Karena masih ditender, Korlantas mencetak blankonya tidak terlalu banyak,” jelas Murthada. Disinggung tentang STNK sementara yang dikeluarkan Dit LantasPoldasutapimasihditilang oleh petugas Sat Lantas di daerah, Murthada menjelaskan, Dit Lantas sudah berkoordinasi dengan seluruh SatuanWilayah di jajaran Poldasu bahkan sudah ada surat pemberitahuannya. (m39)

Polisi Diminta Jangan Pakai Kekerasan Hadapi Buruh MEDAN (Waspada): Aparat kepolisian diminta untuk tidak lagi melakukan kekerasan saat menghadapi aksi dari ribuan buruh, Selasa (1/5) hari ini. Dalam menghadapi aksi buruh, aparat kepolisian harus konsisten dalam melaksanakan aturan tentang pengamanan massa unjukrasa, sebagaimana tertuang dalam Pedoman Umum Kepolisian Negara RI Pasal 3 Kep Kapolri No. 1 Tahun 2009. “Semua tindakan kepolisian harus sesuai dengan hukum yang berlaku. Kedua, penggunaan kekuatan dapat dilakukan bila memang diperlukan dan tidak dapat dihindarkan berdasarkan situasi yang dihadapi. Serta, penggunaan kekuatan harus dilaksanakan secara seimbang antara ancaman yang dihadapi dan tingkat kekuatan atau respon anggota Polri, sehingga tidak menimbulkan kerugian, korban, dan penderitaan yang berlebihan,” kata Ketua Ikatan Keluarga Orang Hilang Indonesia (Ikohi) Sumut Suwardi didampingi Sekretaris Astaman Hasibuan kepada Waspada, Senin (30/4).

Dia juga berharap, agar TNI tidak dilibatkan dalam aksi buruh. “Sejatinya tugas TNI adalah memberi rasa nyaman terhadap warga negara atas rasa tidak nyaman yang datangnya dari luar. Dalam hal ini melibatkan TNI dalam aksi rakyat termasuk dalam waktu dekat aksi kaum buruh adalah tindakan tidak pada porsinya,” sebutnya. Menurut Suwardi, pengamanan yang berlebihan oleh aparat dalam aksi rakyat selama ini justru merupakan bentuk tindakan provokatif negara, jika dibiarkan justru menimbulkan kekerasan. “Tuntutan buruh melalui aksi massa kerap mendapat perlakuan represif dari aparat kepolisian. Bahkan, beberapa aksi rakyat yang lalu seperti penolakan terhadap rencana kenaikan BBM, seakan aparat diberi ‘legitimasi’ untuk melakukan kekerasan dalam menghadapi aksi unjuk rasa,” ujarnya. Diterangkannya, pilihan buruh untuk turun ke jalan melakukan aksi massa adalah pilihan yang sampai dengan hari ini masih menjadi langkah dalam melakukan tuntutan peru-

bahan terhadap nasib mereka. “Sejarah peringatan May Day juga tidak terlepas dari sebuah nasib kaum buruh yang membuat buruh melakukan mogok nasional,” katanya. Setidaknya, kata Suwardi, ada dua hal pengangkangan hak buruh yang dilakukan oleh negara selama ini, yakni hak sipil politik dan hak ekonomi sosial dan budaya. “Kebebasan berserikat kaum buruh yang sering dihalangi oleh pihak perusahaan tidak mendapat perhatian dari negara melalui penegakkan hokum. Padahal menghalangi seseorang berserikat atau berorganisasi adalah perbuatan pidana,” jelasnya. Hal itu, tambah Astaman, merupakan tindakan pelanggaran terhadap hak sipil politik. “Selain itu juga upah buruh yang murah sengaja dibiarkan oleh pemerintah, seakan pemerintah saat ini lebih mementingkan investor dari pada kesejahteraan buruh. Ini semakin menunjukkan bahwa negara saat ini sedang terus melakukan penghisapan terhadap kaum buruh,” sebutnya. (h02)

Ketua Umum PPP Dukung Fadly Nurzal Jadi Cagubsu MEDAN (Waspada): Ketua Umum DPP PPP Suryadharma Ali yang juga Menteri Agama RI merestui Ketua DPW PPP Sumut Fadly Nurzal untuk maju pada Pilgubsu 2013 – 2018 nanti. Hal tersebut diungkapkan Suryadharma Ali saat mengunjungi Yayasan Pendidikan Islam Terpadu Khairul Imam Jl. STM Medan, Sabtu (28/4) sore. “Semakin banyak yang mengusulkan Fadly Nurzal untuk maju sebagai Cagubsu itukan makin bagus. Semakin banyak yang mengusulkan, semakin ketua umum yakin. Kita berharap dari berbagai komponen bisa memberikan dukungan kepada kader PPP. Siapapun yang akan ditetapkan ada mekanismenya seperti Mukerwil yang melibatkan pimpinan-pimpinan cabang,” kata dia. Menurut Suryadharma Ali, ada beberapa faktor mengapa Fadly Nurzal layak didukung. Pertama, Fadly Nurzal dekat pada semua orang. “Kalau dia sudah bisa mengambil hati semua orang, insyaallah dia bisa dipilih. Namun, siapapun yang akan ditetapkan nantinya ada mekanismenya seperti Mukerwil yang melibatkan pimpinan-pimpinan cabang,” ujarnya. Kata dia, secara pribadi, dirinya mendukung sepenuhnya Fadly Nurzal untuk menjadi Gubsu 2013– 2018. “Saya setuju, Fadly Nurzal inikan tokoh muda kita yang terbaik dari PPP,” sebutnya. Dia berharap, untuk maju menjadi calon kepala daerah di Sumut, PPP akan menggandeng semua elemen masyarakat yang ada. Meski begitu, dengan kemampuan yang ada, dia optimis kemenangan akan bisa dicapai, mengingat solidaritas kader yang kuat hingga basis paling bawah sekalipun. Sementara itu, Sekretaris DPC PPP Medan H Irsal Fikri S.Sos, juga mendukung Fadly Nurzal untuk maju sebagai Cagubsu 2013 - 2018. “Saya selaku kader mendukung sepenuhnya Fadly Nurzal untuk maju. Sampai detik ini hanya Fadly Nurzal yang masih maju sebagai cagubsu dari PPP,” tuturnya. Menurutnya, ada beberapa hal kriteria kenapa dirinya memilih Fadly Nurzal. Pertama, Fadly Nurzal merupakan salah satu kader terbaik PPP. Kedua, Fadly Nurzal tidak pernah tersandung kasus apapun. “Dan ketiga, beliau bisa diterima disemua kalangan, baik tokoh masyarakat dan agama serta seluruh kader PPP,” ujarnya sembari mengatakan siap memenangkan Fadly Nurzal. (h02)

Tewas Digilas Truk MEDAN (Waspada): Samuel Mifa Dragon Situmeang, 25, warga Desa Tarutung Bolak, Kec. Sorkam, Kab. Tapanuli Tengah, Senin (1/5) pukul 08:00, tewas digilas truk pengangkut pasir di Jln. Menteng VII, Medan. Mayat sarjana yang baru wisuda tersebut selanjutnya dievakuasi ke RSU Dr Pirngadi Medan. Informasi yang diperoleh di kepolisian, pagi itu korban mengendarai sepedamotor Mega Pro BB 2275 MG melintas dari kawasan Amplas menuju Jln. Menteng VII. Setibanya di depan Taman Kanak Kanak Future Kids, korban mendahului mobil truk Colt Diesel BK 9616 LV, tiba-tiba saja dari arah berlawanan muncul mobil Gradmax BK 1023 JH, akibatnya korban tersenggol mobil tersebut dan terjatuh. Korban yang terjatuh langsung tergilas ban truk pengangkut pasir tersebut hingga tewas di tempat, sedangkan sepedamotor rusak parah. Petugas Unit Lalulintas Polsek Percut Seituan Bripka Elvi Zakar dan Brigadir Iwan Simarmata yang turun ke TKP segera mengevakuasi mayat sarjana Unimed yang baru beberapa hari diwisuda tersebut. “Sopir mobil Grandmax dan truk pembawa pasir sudah menjalani pemeriksaan, sedangkan truk pasir dan mobil Grandmax telah disita sebagai barang bukti,” kata Iwan Simarmata. (h04)

Waspada/Mursal AI

ASISTEN Umum Pemko Medan H Cheko Wakhda Ritonga membuka Musda IV LDII Kota Medan.

LDII Diharapkan Bentuk Mental Religius Masyarakat MEDAN (Waspada): Keberadaan Lembaga Dakwah Islam Indonesia dinilai sangat penting untuk membangun mental masyarakat yang religius. Sebab, tanpa pembangunan mental yang religius, pembangunan fisik Kota Medan, tidak akan bertahan lama. “Dengan pembangunan mental yang religius, pembangunan kota Medan akan tetap terarah,” kata Wali Kota Medan Rahudman Harahap yang diwakili Asisten Umum Pemko Medan H Cheko Wakhda Ritonga saat membuka Musda IV LDII Kota Medan, di kantornya Aula Alfalah Jln. Pelajar Timur Medan, Sabtu (28/4). Dia mengharapkan, Musda LDII Medan ini dapat merumuskan program kerja yang bermanfaat bagi umat. “Musda ini tempatnya menyampaikan Ide dan pikiran, serta memilih pemimpin, sehingga tujuan bersama dari LDII dapat diraih. Untuk itu, kita berharap Musda ini dapat menyumbang pemikiran positif serta mengevaluasi kinerja sebelumnya,” ujarnya. Sementara itu, Ketua DPW LDII Sumut Agus Purwanto mengharapkan, agar kebera-

daan LDII bermanfaat bagi masyarakat Kota Medan. “Saat ini problema bangsa salah satunya adalah banyak profesional yang belum religius, dengan keberadaan LDII bisa mengarah profesional kita ke religius. Sehingga, pembangunan kota Medan seperti yang kita harapkan,” sebutnya. Purwanto juga menyampaikan pesan DPP LDII untuk warga LDII, yakni harus tunduk dan patuh kepada peraturan, serta mensukseskan programprogram pemerintah. “Beda pendapat bisa menimbulkan kekacauan. Untuk itu diminta kepada warga LDII agar mengajak masyarakat membantu Pemko Medan dalam hal kebersihan. Sehingga Medan meraih Adipura,” tuturnya. Sedangkan Ketua Panitia Hasoloan Simajuntak mengatakan, sebelum acara tersebut diselenggarakan, pihaknya sudah melakukan audiensi untuk meminta arahan kepada Wali Kota Medan, MUI Medan, LDII Sumut, dan tokoh masyarakat lainnya. Adapun tema Musda IV ini yakni ‘Meningkatkan Sumber Daya Manusia Profesional Religius Menuju Masyarakat Kota Medan yang Sejahtera, Demokratis, Berkeadilan dan Bermartabat. Hadir juga memberi tausiyah Ketua MUI Medan Mohd. Hatta, KH Zulfikar Hajar, dan seluruh warga LDII Medan. (h02)

Buruh Tuntut PT Asian Agri Bayar Kekurangan UMSK MEDAN (Waspada): Puluhan buruh yang tergabung dalam Serikat Buruh Sejahtera Indonesia (SBSI) 1992 melakukan unjukrasa di kantor PT Asian Agri Group Jalan MT Haryono Medan, Senin (30/4). Mereka menuntut kekurangan UMSK buruh tahun 2011, kekurangan pembayaran upah lembur buruh dan pemotongan upah buruh. Ketua DPD SBSI 1992 Pahala Napitupulu dalam orasinya menyebutkan, sebagaimana fakta-fakta yang ditemukan di kalangan buruh, seperti yang terjadi di PT Hari Sawit Jaya diduga terjadi tindak pidana pelanggaran pembayaran upah buruh pada tahun 2011 karena tidak sesuai dengan keputusan Gubsu no 188.44/301/KPTS/tahun 2011 tentang upah minimum sektor Labuhan Batu tahun 2011yang melanggar ketentuan keputusan Menteri Tenaga Kerja no Kep-102/Men/IV/ 2004 tentang pembayaran upah kerja lembur. “Banyak perusahaan yang telah melanggar peraturan tentang upah buruh,” sebutnya. Puluhan buruh tersebut meminta pimpinan perusahaan PT Asian Agri Group segera

membayarkan kekurangan UMSK buruh tahun 2011 diPTHariSawitJaya danmenolaksistempengupahan yang dilakukan PT Asian Agri Group selama ini.“Kami mau kekurangan upah buruh pada tahun 2011 agar segera dibayar,” ujar Pahala Napitupulu. Massa buruh juga meminta perusahaan PT Asian Agri Group segera mengangkat buruh harian lepas menjadi buruh tetap, meminta perusahaan segera menghentikan penghisapan, penindasan, dan pemotongan upah buruh selama ini. Meminta perusahaan untuk membayar upah kerja lembur buruh sesuai dengan Keputusan Menteri Tenaga Kerja dan untuk menghindari praktek manipulasi upah buruh, perusahaan agar memberikan slip penerimaan upah kepada buruh. Pihak perusahaan akhirnya meminta kepada perwakilan massa agar masuk ke dalam kantor untuk membicarakan permasalahan tuntutan mereka, namun sejumlah wartawan dilarang masuk saat ingin meliput pertemuan tersebut. PantauanWaspada, aksi demo tersebut sempat membuat arus lalulintas macat namun setelah aparat kepolisian datang mengaturnya, arus lalulintas normal kembali. (h04)

Kejatisu Tangkap Mantan Kadinkes Aceh Tamiang


SEKRETARIS Akademik Yayasan UISU Dra. Latifah Hanum MA; PR II Drs. Yanhar Jamaluddin MAP; PR.IV Drs. Syarifuddin El Hayat MA dan PD II Fakultas Kedokteran Dr H Suwarno Usman MKT meninjau peserta UMB-PTS.

UMB-PTS Di UISU Diikuti 135 Peserta MEDAN (Waspada): Ujian Masuk Bersama Perguruan Tinggi Swasta (UMB-PTS) di Universitas Islam Sumatera Utara (UISU) Kampus Jln. Karya Bakti Medan, Minggu (29/4) diikuti 135 peserta. Fakultas Kedokteran mendominasi dengan peserta sebanyak 92 orang. Kegiatan itu dilaksanakan serentak di 18 PTS seluruh Indonesia diantaranya Universitas Islam Sumatera Utara (UISU) Kampus Jln. Karya Bakti, Universitas Malahayati Lampung, Institut Teknologi Indonesia - Serpong, Universitas Pancasila Jakarta, UniversitasYarsi Jakarta, Universitas Trisakti Jakarta, Universitas Nasional Jakarta, Universitas Gunadarma Jakarta, Universitas Katolik Parahyangan Bandung, Universitas Widyama Bandung, Universitas Atmajaya Yogyakarta, Universitas Pembangunan Nasional “Veteran” Surabaya, Universitas Al-Azhar Indonesia, Universitas Paramadina, Universitas Dian Nusantara Semarang, Universitas Bung Hatta Padang, Universitas Muslim Indonesia, Universitas Swadaya Gunung Jati Cirebon. Pembantu Rektor (PR) II Drs. Yanhar Jamaluddin MAP didampingi PR IV Drs. Syarifud-

din El Hayat MA menjelaskan, UISU sebagai salah satu PTS di Sumatera Utara yang dipilih panitia Perhimpunan SPMB Nusantara (P-SPMBN) menyelenggarakan UMB-PTS tahun akademik 2012/2013 karena dinilai legal dan telah terakreditasi. “UISU Jln. Karya Bakti legal dari sisi hukum setelah keluarnya SK Mahkamah Agung (MA) No.404/K/TUN/2010 tentang penolakan gugatan Helmi Nasution. SK MA tersebut sekaligus menguatkan Putusan Mendiknas No.131 tentang pengelolaan Perguruan Tinggi UISU di bawah Ketua Umum Yayasan Prof Dr Usman Pelly dengan Rektor Dr Ir Mhd Assad MSi,” tegas Yanhar. UISU membuka 28 Program Studi S1 pada 9 Fakultas yaitu Fakultas Hukum, Agama Islam Ekonomi, Sastra, KIP, ISIP, Pertanian, Kedokteran dan Teknik. “Semua program studi tersebut mengikuti UMB-PTS yang pelaksanaannya melalui cyber test ,” tambahnya. Yanhar juga memaparkan lima manfaat UMB-PTS melalui online. Pertama, mahasiswa diberikan kesempatan untuk memilih lima Program Studi

secara lintas pada perguruan tinggi swasta lainnya diluar Medan sehingga menghemat biaya dan waktu. Kedua, ujiannya melalui cyber test, maka calon mahasiswa telah dikenalkan pada teknologi komunikasi dan informasi. Ketiga, memudahkan calon mahasiswa untuk mendaftar dengan tidak harus ke perguruan tinggi yang dituju. Keempat, karena pembayaran melalui Bank BNI, maka mahasiswa dapat mendaftar secara online, sehingga mereka terhindar dari antrian yang panjang. Dan manfaat yang kelima UMB-PTS sebagai suatu latihan bagi calon mahasiswa untuk lebih selektif dalam memilih Perguruan Tinggi Swasta. Dia juga menyebutkan UMB-PTS di UISU akan terus dipertahankan karena akan menjadi catatan akreditasi institusi dan menambah kredit. Selain itu, sangat bermanfaat bagi mahasiswa karena dari awal sudah diperkenalkan sistem masuk melalui online di perguruan tinggi. Hasil UMB-PTS akan diumumkan pada 5 Mei 2012, dapat dilihat di www. atau di UISU Jln. Karya Bakti Medan. (m49)

MEDAN (Waspada): Tim Intelijen Kejaksaan Tinggi Sumatera Utara (Kejatisu) menangkap mantan Kepala Dinas Kesehatan Aceh Tamiang Djamaluddin, 51, tersangka korupsi dana pengadaan alat kesehatan, dari Bandara Polonia Medan, Minggu (29/4). Mantan Kadinkes Aceh Tamiang itu diduga terlibat tindak pidana korupsi dana pengadaan alat kesehatan, dengan anggaran Rp9 miliar lebih bersumber APBN 2010. “Tersangka kami tangkap saat tiba di Bandara Polonia pukul 07:00 pagi tadi,” kata Plh Kasi Penkum Kejatisu Ronald H Bakara, di Gedung Kejatisu. Setelah mendapat informasi dan berkoordinasi dengan Tim Satgas Intelijen Kejagung, tim menunggu dan mengintai di Bandara Polonia. Penangkapan berjalan tenang tanpa perlawanan. “Saya tanya, bapak Djamaluddin?. Awalnya dia menyangkal, saya pegang tangannya meminta ikut ke kantor,” ujar Bakara. Menurut Bakara, Kejaksaan Tinggi Aceh menetapkan Djamaluddin sebagai tersangka sejak Desember 2011. Sejak awal pemerik-

saan, warga Jalan S. Parman Desa Sriwijaya, Kuala simpang, Kab. Aceh Tamiang itu tidak pernah memenuhi panggilan. “Dia ditetapkan dalam daftar pencarian orang sejak Desember 2011,” sebutnya. Penyidik Kejati Aceh Mukhlis saat menjemput Djamaluddin di Kejatisu mengatakan, selaku Kepala Dinas Kesehatan Aceh Tamiang, diduga tersangka terlibat korupsi pada pengadaan alat kesehatan. Dugaan, penyediaan 26 item alat kesehatan di antaranya meja operasi dan lampu operasi tidak sesuai dengan spesifikasi yang tertera dalam kontrak. “Ada barang yang tidak sesuai,” tuturnya. Kata dia, selan Djamaluddin, penyidik sudah menetapkan lima tersangka lainnya. Di antaranya, pemilik perusahaan yang menjadi rekanan berinisial R, kuasa pelaksana perusahaan berinisial R, dan Pejabat Pembuat Komitmen M, serta dua orang panitia pemeriksa barang. Sementara itu, tersangka Djamaluddin mengaku tinggal di rumah kerabatnya di Jakarta, selama dua minggu. “Rencananya, mau pulang ke Aceh Tamiang,” katanya. Setelah serah terima dengan pihak Kejatisu, tersangka Djamaluddin diboyong penyidik Kejati Aceh ke Bandara Polonia, menuju Aceh. (m38)

Ketua DPD SP PLN Dilantik MEDAN (Waspada): Raidir Galingging dilantik sebagai Ketua Dewan Pimpinan Daerah (DPD) Serikat Pekerja (SP) PT PLN (Persero) Wilayah Sumut periode 2012-2016. Pihaknya berjanji siap menjaga perusahaan terutamamendengarsetiapaspirasitenagakerja. “Kita akan menampung semua aspirasi dan perjuangkan hak anggota. Karena dengan begini kita telah menjaga perusahaan dengan mensejahterakan setiap pekerja PT PLN,” kata Raidir Galingging usai dilantik, Jumat (27/4). Raidir mengatakan, dalam 9 tahun mengurusi serikat pekerja bukan pekerjaan gampang, karena setiap anggota dapat memberikan pemikiran, tenaga dan semangat kepada pekerja serta menjaga perusahaan. “Tugas serikat pekerja menjaga perusahaan PLN. Tugas ini benar-benar pengorbanan yang diberikan pengurus kepada perusahaan,” ujarnya seraya menambahkan serikat pekerja solid di bawah komando DPP dan 9 DPC seSumut solid pada DPD Sumut. Menyinggung adanya dualisme kepe-

mimpinan pengurus DPD Serikat Pekerja, Raidir yang juga menjabat Deputi Manager Komunikasi dan Bina Lingkungan PLN Wilayah Sumut ini menyatakan,tidakadadualismekepemimpinanSPWilayah Sumut.“Kepengurusan SP hanya satu dan inilah yang diakui perusahaan serta sesuai dengan anggaran dasar dan anggaran rumah tangga kepengurusan serta undang-undang yang berlaku,” katanya. General Manager PT PLN Wilayah Sumut Krisna Simbaputra, dalam sambutannya mengatakan, kehadiran SP ini memang sangat membantu perusahaan mengatasi setiap permasalahan yang menyangkut tenaga kerja. “Ini demi kemajuan perusahaan. Karena selama ini ada sekitar 80 persen masalah yang dihadapi seputar tenaga kerja dan selebihnya masalah teknis,” katanya. Sementara pelantikan dan pengukuhan kepengurusan SP PT PLN Wilayah Sumut periode 2012 hingga 2016 ini langsung dilakukan Ketua DPP SP PT PLN (Persero) Rio Suprianto. Dia mengatakan, program kerja SP ke depan yakni menunjang kesejahteraan pekerja demi memajukan perusahaan milik negara tersebut. (m41)


WASPADA Selasa 1 Mei 2012


52 Ribu Buruh Demo Istana JAKARTA (Waspada): Kapolda Metro Jaya Irjen Pol Untung S Rajab memperkirakan 52 ribu buruh akan turun ke jalan menggelar aksi di Istana Negara memperingati hari buruh sedunia (May Day) hari ini, Selasa (1/5). “Para buruh akan terfokus pada empat titik di Jakarta menggelar aksi pawai ‘May Day’.

Kita harapkan semua berjalansesuaiprosedurdantidak melakukantindakananarkis,juga

kita minta tidak ada provokasi dan buruh tidak terprovokasi pada tindakan anarkis yang dapat merugikan kita semua,” kata Untung diha-dapan wartawan diMapoldaMetroJaya,Senin(30/ 4). 52 Ribu buruh yang turun ke jalan datang dari Jabodatabek dan kota-kota lain di pulau Jawa ini akan berunjukrasa di empat titik, yakni Istana Negara,

Bundaran Hotel Indonesia, GedungDPR-MPR,dansekitaran Gelora Bung Karno di Senayan. Untuk mengamankan jalannya unjuk rasa buruh ini, Polda Metro Jaya akan menerjunkan 16.167 anggotanya agar ‘May Day’ berjalan aman dan tertib. “Kami berharap demonstrasi tertib dan mentaati peraturan,” kata Untung. (j02)

Bantuan Ke PTS Dibayangi Penipuan JAKARTA (Waspada): Pemberian bantuan Program Hibah Pembinaan Perguruan Tinggi Swasta (PHP PTS) oleh Kementerian Pendidikan dan Kebudayaan (Kemdikbud) dibayangi aksi penipuan. Sepanjang 2011, sudah ada laporan dari 40-an PTS di sejumlah wilayah di Indonesia yang mengaku tertipu oleh pihak yang mengaku berasal dari Direktorat Kelembagaan dan Kerjasama Direktorat Jenderal Pendidikan Tinggi(Dikti).PihakPTSmengaku sudah menyetor antara Rp50 juta sampai Rp375 juta sebagai dana pendampingan. Direktur Kelembagaan dan Kerjasama Ditjen Dikti KemdikbudAchmadJazidiemengatakan, pihaknya tidak dapat menyebutkan PTS mana saja yang mengaku ditipu karena tidak diizinkan. “Rata-rata PTS itu malu kalau diekspos media bahwa lembaganya sudah tertipu. Tapi mereka berharap PTS lain berhati-hati,” kata Jazidie kepada wartawan di Gerai Informasi dan Media, Kemdikbud, Jakarta, Senin (30/4). Untuk tahun ini, Jazidie mengaku sudah menerima

aduan dari pihak Universitas Terbuka(UT).PihakUTmengaku menerima surat edaran palsu yang menyatakan pihak UT sebagai salah satu penerima bantuan hibah PTS. “Padahal kami tidak pernah menerbitkan surat edaran. Karena pengumuman penerima hibah selalu diumumkan melalui website beralamat www.dikti. Lagipula penipunya itu ceroboh. Dia tidak sadar kalau UTituPTN,manamungkindapat bantuan hibah PTS,” imbuhnya. Dikatakan Jazidie, dana PHP PTS sudah ada sejak 2008. Sejak 2008 sampai 2011 sudah terserap dana sebanyak Rp575 miliar. Khusus pada 2012, APBN sudah memastikan anggaran sebesar Rp90 miliar. Jumlah itu akan ditambah sebanyak Rp100 miliar dari APBN Perubahan. “Jadi kalau disetujui dalam APBNP, maka total bantuan PHP PTS sebanyak Rp190 miliar. Itu akan dibagikan kepada 250 PTS diseluruhIndonesia,”kataJazidie. Dana untuk masing-masing PTS berbeda. Untuk universitas yang terpilih nilai hibahnya mencapai Rp2 miliar. Untuk Institut dan Sekolah Tinggi

mencapai Rp1 miliar, sedangkan akademi sebesar Rp500 juta. Dana tersebut ditujukan sebagai upaya perbaikan mutu PTS yang jumlahnya saat ini mencapai 2900-an PTS. PTS pemohon hibah harus mengajukan proposal.Tapi yang paling penting adalah syaratsyarat mengenai kondisi di lapangan.PTSituharusdalamkondisi tidak berkonflik dengan pihak manapun, status yayasan beres sertatidakterdapatkasusplagiasi. “Jadi kalau ada universitas atau sekolah tinggi swasta yang tidak mengirim proposal lantas diberikan surat edaran tentang pengumuman pemberian bantuan, maka itu tidak masuk akal. Itu sama dengan penipuan. Dan kalau ada PTS yang mau melaporkan, kami siap melapor kepada pihak berwenang,” kata Jazidie. Menanggapi hal itu, Menteri Pendidikan dan Kebudayaan Muhammad Nuh meminta agar PTS yang tertipu segera melaporkan apa yang sudah dialaminya. JikatidakadapengaduandariPTS sebagai korban, maka kejadian serupa akan terulang kembali. “Tidak perlu malu melapor-

Waspada/Muhammad Thariq

TOKOH NU Sumut Syekh Ali Akbar Marbun didampingi Ketua PWNU Sumut H Ashari Tambunan (tengah) dan Rois Suriyah (demisioner) Prof H Pagar Hasibuan dan Wakil Rois HM Imron Hasibuan memberikan berupa sorban dan baju koko kepada Ketua KPU Pusat Husni Kamil Manik, pada acara syukuran dan silaturahmi, di aula PWNU Medan, Sabtu (28/4) malam.

Ketua KPU Pusat Dari Sumbar Orang Medan, NU Lagi APAKAH ada hubungan Gamawan Fauzi dengan Husni Kamil Manik? Pertanyaan ini muncul setelah Husni Kamil Manik terpilih menjadi Ketua Komisi Pemilihan Umum (KPU) Pusat periode 20122017. Coba kita lihat nama kedua pejabat negara ini. Mendagri tidak bermarga, sedangkan di ujung nama Ketua KPU Pusat itu melekat kata “Manik”, sebuah identitas marga di satu daerah Sumatera Utara. Mendagri sendiri dari Sumatera Barat. Dari identitas personal itu, tertepis keduanya punya hubungan keluarga. Lantas, bagaimana dengan identitassosialHusniKamilManik yang punya latar belakang cukup kental dengan masyarakat Sumbar. Apakah latar belakang karir anakMedanyanglamadiSumbar ini punya kaitan politik tertentu pada Pemilu 2014 atau benarbenar “ada tangan Tuhan” mendudukannyamenjadiKPUPusat? Sabtu (28/4) malam, Husni KamilManikmenegaskanbahwa diabisamenjadiKetuaKPUPusat berkat dari doa-doa ijabah (makbul) orang tua, ulama dan guru. Hal itu diungkapkannya pada acara syukuran dan silaturahmi Pengurus Wilayah Nahdlatul

Ulama (PWNU) Sumut dan Nahdliyin atas terpilihnya Husni Kamil Manik sebagai Ketua KPU Pusat,berlangsungdiaulaPWNU Sumut, Jalan Sei Batanghari Medan, Sabtu malam. Syukuran ditandai penyematan sorban dan penyerahan baju koko kepada Husni Kamil Manik oleh Ketua PWNU Sumut H Ashari Tambunan bersama tokoh NU Syekh H Ali Akbar Marbun, Rois Syuriyah (demisioner) Prof Pagar Hasibuan,Wakil Rois HM Imron Hasibuan dan pengurus NU lainnya. Dalam acara itu juga digelar dialog yang dipandu Wakil Ketua PWNU Sumut H Afifuddin Lubis. Di depan puluhan tokoh NU, Husni mengatakan, doa-doa ijabah membuat yang tak mungkin menjadi mungkin. Dia menunjuk contoh, seusai menamatkan pendidikan di Madrasah Aliyah Negeri (MAN) I Medan, dia semula diprediksi tidak akan lulus Ujian Masuk Perguruan Tinggi Negeri (UMPTN), tapi ternyata dia lulus dan diterima di Fakultas Pertanian Universitas Andalas Padang. Kemudian, dia yang tak mungkin menjadi anggota KPU SumateraBaratkarenakampungnya di Sumatera Utara, ternyata di usia 28 tahun, dia sudah memimpin KPU Sumbar. Dan sekarang usianya 36 tahun memimpin KPU Nasional. “Ini semua merupakan akumulasi dari doa-doa ijabah, bukan dari diri saya, tapi orang tua, guru dan ulama. Warga NU paling banyak mendoakan saya agar proses yang saya ikuti dalam

seleksi pemilihan anggota KPU Nasional bisa sukses. Sebelum penentuan anggota KPU, PWNU Sumbar juga menggelar istighosah,” kata Sekretaris PWNU Sumbar ini. Pria kelahiran Medan, 19 Juli 1975inimenambahkan,doadapat menembus ruang dan waktu. Sedangkan tasyakuran yang digelarPWNUSumut,katanya,merupakan bagian dari tautan doadoa. Ketua PWNU Sumut H Ashari Tambunan dalam sambutannya mengatakan, syukuran ini digelar sebagai ungkapan rasa kebanggaan bahwa putra Sumut yang juga pengurus NU Sumbar telah diamanahkan mengemban jabatan terhormat sebagai Ketua KPU Pusat. Namun, dia mengingatkan, jabatan pasti punya tanggung jawab berat. Adinda harus bisa memilah dan memilih mana yang tidak boleh dan boleh dilakukan. Hadir dalam acara itu, sejumlah anggota DPRD Sumut yang juga warga NU, di antaranya TDirkhansyahSubhanAli,HEnda Mora Lubis, H Marahalim Harahap, MYusuf Siregar, Tiaisyah Ritonga,IdaBudiningsih,Pasiruddin DaulaydanRahmiannaPulungan. Juga hadir mantan Ketua PWNU SumutProfAbbasPulungan,Wakil Ketua PWNU Sumut H Abdullah Nasution, Sekretaris Misran Sihaloho, Wakil Sekretaris H Khairuddin Hutasuhut, dan pimpinan badan otonom seperti Muslimat NU, Fatayat NU, IPNU, IPPNU dan Gerakan Pemuda Ansor. � Muhammad Thariq

kan. Dan bagi yang belum tertipu, sebaiknya waspada, dan tidak memberikan uang kepada pihak manapun sebelum menelusuri kebenarannya,” kata Muhammad Nuh. Untuk PHP PTS 2012 sudah ada 879 proposal masuk ke Dikti. Dari jumlah itu hanya akan terseleksi 250 PTS yang menerima hibah. Pengumumannya pada 7 Mei mendatang melalui website. (dianw)


Jangan Abaikan Nilai Pancasila MEDAN (Waspada): Bangsa Indonesia diingatkan untuk tidak meninggalkan nilai yang terkandung dalam Pancasila karena hal itu bisa memberikan efek negatif bagi jati diri bangsa. DemikianWakil Ketua MPR RI Drs Lukman Hakim Saifuddin saat membuka “Pelatihan untuk Pelatihan 4 Pilar Kehidupan Berbangsa dan Bernegara” di Hotel JW Marriott Medan, Sabtu (27/ 4) malam. Pelatihan yang diselenggarakan MPR RI bekerjasama dengan Kanwil Kemenag Sumut ini diikuti kalangan tenaga pendidik organisasi keagamaan, guru SMA/MAN/MTs, dosen, pendidik pondok pesantren serta perwakilan organisasi keagamaan berjumlah 100 orang. Hadir Kakanwil Kemenagsu Drs H Abdul Rahman, MHum, Ketua Umum MUI Sumut Prof DR H Abdullah Syah, MA. Sedangkan pemberi pencerahan terdiri dari anggota MPR RI, DPR RI dan DPD. Menurut Lukman, Indonesia memiliki empat elemen sebagai penyangga kesatuan dan persatuanbangsa.Empatelemen tersebut dikatakannya adalah, Pancasila, UUD Negara Republik Indonesia tahun 1945, NKRI dan BhinnekaTunggalIka.Empatpilar tersebut yang dikenal MPR RI sebagai Empat Pilar Kehidupan Berbangsa dan Bernegara. “Program-program ini harus

terus berlanjut agar nilai empat pilar tidak dilupakan bangsa,” katanyasambilmenyebutkansaat ini Pancasila sudah mulai dilupakan generasi bangsa. Oleh karena itu, katanya, melalui pelatihan ini jiwa generasi bangsa kita bisa mengaktualitaskan nilai-nilai empat pilar agar efek positif selalu muncul. Diharapkannya melalui pelatihan ini pengetahuan dan pemahaman peserta tentang 4 pilarkehidupanberbangsasemakinbaikdandiikutiaktualisasinilainilai yang terkandung dalam 4 pilar dalam kehidupan seharihari karena para peserta langsung bisa bersentuhan dengan masyarakat. Selain metode 4 pilar ini MPR RI juga melakukan metode melalui lomba cerdas cermat tingkat SMA, sosialisasi ke kabupaten/ kota, seminar dan lokakarya, pagelaran seni budaya, dialog interaktif diTV. Menurut Lukman penyelenggaraan pelatihan ini sudah berlangsung di 18 provinsi. Sementara Plt Gubsu Gatot Pujo Nugroho diwakili Staf Ahli Pemberdayaan Kemasyarakatan dan Pengentasan Kemiskinan Zulkifli Taufik, MHum mengharapkan kegiatan ini mampu memberikan sebuah kerangka kerja komprehensif dan berkelanjutan untuk mewujudkan para kader-kader pelatih sosialisasi 4 pilar kehidupan berbangsa dan bernegara. (m37)

Pemerintah Harus Antisipasi Fenomena Perdagangan Organ Tubuh JAKARTA (Waspada): Pemerintahharusmengantisipasifenomena perdagangan organ tubuh manusia. Pasalnya, Kementerian Tenaga Kerja dan Transmigrasi BadanNasionalPenempatandan Perlindungan Tenaga Kerja Indonesia gagal menjamin hak-hak hidup TKI terkait kasus tiga mayat TKI yang diduga korban perdagangan organ tubuh manusia. “Setelah gagal memberikan proteksi terhadap hak-hak normatif TKI, termasuk upah, libur, cuti, uang asuransi, dalam aturan kebijakan dan pelaksanaannya. Sudah sepantasnya kedua lembaga tersebut bersama Kementerian Luar Negeri segera mengambil inisiatif untuk mencari kebenaran melalui jalur hukum di Malaysia. Ini sebagai bentuk pertanggungjawaban negaraterhadaprakyatyanggagal dilindungi,” ujar anggota Komisi Hukum DPR Eva Kusuma Sundari di Jakarta, Kamis (26/4). Eva menjelaskan, hal ini sebagaimana rekomendasi DPR RI yang dibacakan oleh Timsus TKI pada 15 Desember 2011. Mengingat DPR meminta moratorium pengiriman TKI sampai ada perbaikan kebijakan di hulu, seperti rekrutmen, pelatihan dan pengiriman TKI. “Sehingga memungkinkan para TKI terhindar dari segala penipuan. Moratorium juga sepatutnya dilanjutkan hingga revisi Undang-undang PerlindunganTenaga Kerja di Luar Negeri (UUPTKLN)dirampungkanguna memastikan perbaikan mekanisme perlindungan domestik dandiluarnegeribagiTKI,”terang

mantanwakilkoordinatorTimsus TKI DPR RI ini. Sayangnya, imbuh Eva, Kemenakertrans dan BNP2TKI memilih untuk berperan sebagai penyalur TK demi pendapatan negaradaripadaberperansebagai pelindung WNI. Menurut dia, terpuruknya nasib TKI merupakan cerminan filosofi kerja 2 lembagatersebutsebagaiinstitusipencari keuntungan (profit seekers). Apalagi, semua rekomendasi DPR diabaikan. Terlebih, moratorium dicabut hanya dengan alasanMoU,sementaraperbaikan di hulu tidak dilaksanakan. “Sungguh menyesakkan, jika negara justru melakukan pembiaran aktivitas memperdagangkan orang alias TKI,” kata politisi PDIPerjuanganini.Selainitu,PDIP juga mengecam kelalaian negara yangmengirimkanTKIkenegaranegara yang tidak mempunyai sistem proteksi bagi warga negara terutama terhadap pencegahan perdagangan organ. Di Australia, lanjut dia mencontohkan, karena prosedur administrasi rumah sakit yang ketat bisa mencegahWN Filipina yang nyaris dioperasi untuk tujuanperdaganganorgantubuh. “Kita berharap pemerintah harus waspada dan serius mengantisipasi gejala bergesernya perdaganganorgantubuhmanusia yang mulai menargetkan Indonesia sebagai pasar perdagangan organ tersebut,” katanya. DPR juga diharapkan segera merespon isu ini melalui pembuatan legislasi khusus, tanpa harus menunggu jatuh korban berikutnya. (aya)

Antara Petugas Bea Cukai melakukan test barang bukti hashis di hadapan dua tersangka warga Rusia, Alexander Simonov (kiri) dan Sergei Chernykh (kedua kanan) di Kantor Bea Cukai Bandara Ngurah Rai, Bali, Senin (30/4). Kedua warga Rusia itu ditangkap pada penerbangan terpisah karena berupaya menyelundupkan 1,61 kg hashis yang dikemas dalam kapsul sebanyak 447 butir dengan cara ditelan. Alexander Simonov menelan sebanyak 88 kapsul seberat 915 gram sedangkan Sergei Chernykh menelan 359 kapsul seberat 695 gram.

BPSNT Banda Aceh Lestarikan Nilai Tradisi Lewat Rally Foto TAKENGEN (Waspada): Banyak cara memperkenalkan sekaligusmelestarikannilaitradisi budaya dan pariwisata sebuah daerah, salah satunya lewat foto. Itulah yang dilakukan Balai Pelestarian Sejarah dan Nilai Tradisi (BPSNT) Banda Aceh dengan menggelarLombaRallyFoto2012 bertema “Gayo Cultural Heritage” selama dua hari, Sabtu dan Minggu (28-29/4) di Kabupaten Aceh Tengah dan Kabupaten Bener Meriah, Provinsi Aceh. “Acara ini selain sebagai ajang silaturahmi antarfotografer juga untuk mengapresiasi nilai-nilai tradisional di dua kabupaten tersebut dan sekaligus mempromosikan potensi budaya dan pariwisata setempat,” kata Kepala BPSNT Banda Aceh Djuniat saat memberi pengarahan kepada 23 peserta rally foto di Hotel Bayu Hill, Takengen, Aceh Tengah, Sabtu (27/4). Semula acara ini akan dilaksanakan di Kota Banda Aceh dan Kabupaten Aceh Besar. Namun ketika mendengar di Kabupten Aceh Tengah ada event Festival Kopi danPacu Kuda, lokasinya dipindahkan ke AcehTengah dan BenarMeriah. “Sayangnya Pacu Kuda tidak diadakan. Sebagai penggantinya, peserta dibawa kebeberapa obyek alam dan budayauntukdifoto,”ujarDjuniat. Kasubag Tata Usaha BPSNT Banda Aceh Irini DewiWanti selaku ketua panitia rally foto menjelaskan, acara rally foto dibagi dua bagian. Pada hari pertama, peserta diharuskan mengam-

bilgambar aktivitas berkaitan dengan kopi yang menjadi komoditas utama orang Gayo antara lain pembibitan pohon kopi, pengeringan biji kopi, dan pemetikan buah kopi di Bandar Lampahanyangberlatarbelakang pemandangan BurniTelong, dalamBahasaGayo yang berarti gunung yang terbakar. Kemudian peserta rally foto diarahkan ke venue acara Festival Panen Raya Kopi Dunia pertama di Redelong untuk mengabadikan pameran kerajinan tangan masyarakat Gayo antara lain Kerawang Gayo atau kain sulaman khas Gayoyang diolah menjadi bermacam cenderamata menarik seperti bahan pakaian, baju, peci, tas, dompet, gelang, selendang dan lainnya. “Di festival tersebut, peserta juga mengabadikan beberapa seni budaya Gayo antara lainTari Saman yang begitu atraktif dan Guru Didong,” jelas Irini. Selanjutnya, peserta dibawa ke Kebayakan, tepi Danau Laut Tawar untuk memotret aktivitas warga memandikan kuda pacu. Sayangnya setibanya di sana, hujan turun. Pemotretan pun dibatalkan. Malamnya, beberapa peserta melanjutkan pemotretan pentas seni budaya Gayo di panggung acara Festival Panen Raya Kopi di Redelong. Pada hari kedua, Minggu (29/ 4).Pesertalombarallyfotodibawa ke Danau Laut Tawar untuk mengabadikan bermacam aktivitas masyarakat setempat

seperti mencari depik atau ikan penghuni asli Danau LautTawar, pemandangan alam sekitarnya serta memandikan kuda pacu yang pada hari pertama tertunda. AliAmran,salahseorangpenduduk di tepi Danau Laut Tawar menggambarkan keberadaan danau ini dulu dan sekarang yang mengalami banyak perubahan. “Dulu waktu saya masih kecil airnya benar-benar bersih, tidak ada eceng gondok dan tidak ada jalan serta rumah-rumah di tepi danau ini. Sekarang meskipun bersih tapi sudah ada sampah plastik,jugaadajalanyangdulunya adalah genangan air danau ini,” jelasnya. Kendati begitu, lingkungan danau yang menjadi nadi kehidupan bagi sejumlah warga di tiga kecamatan yakni Kecamatan Kebayakan, LutTawar, dan Kecamatan Bintang ini menjadi ikon wisataalamTakengonkhususnya, yang kerap didatangi wisatawan baik lokal, Nusantara maupun asing berkat keindahan alamnya. “Saya lihat semakin banyak orang bule ke sini, sambil motret-motret,”akuayahtigaanakdan2cucu usai mincing di tepi danau itu. Hasil lomba rally foto berhadiah total Rp16 juta ini, lanjut Irini, rencananyadipamerkandiBanda Aceh dan Jakarta sebagai bentuk publikasi pra kegiatan agar nilainilai tradisi budaya masyarakat suku Gayo dan obyek-obyek wisata di Kabupaten AcehTengah danBenerMeriahterpromosikan. (adji k)


Duta besar dari kawasan Asia, Timur Tengah, Eropa dan Afrika foto bersama Rahmat Shah saat berkunjung ke Rahmat International Wildlife Museum & Gallery, Sabtu (28/4).

21 Dubes Kagumi Rahmat Gallery MEDAN (Waspada): 21 Duta Besar negara-negara dari Kawasan Asia,TimurTengah, Eropa dan Afrika berkunjung ke Rahmat International Wildlife Museum & Gallery, Sabtu (28/4). Kedatangan ke 21 Dubes tersebut disambut langsung pemilik sekaligus pendiri Gallery satwa liar yang satu-satunya di Asia, Rahmat Shah. Adapun Duta Besar yang berkunjung Duta Besar Afganistan, Azarbaizan, Bangladesh, Brunai Darussalam. Bosnia Herzegivona, Mesir, Irak, Laos, Libia, Polandia, Seychelles, Somalia, Afrika Selatan, Srilanka, Sudan, Siria, Slovakia, Thailand, Tunisia, dan Nigeria. Dalam kesempatan tersebut Rahmat Shah langsung bertindak sebagai guide, mengingat para

tamu yang datang adalah dari kalangan diplomat, sehingga Rahmat Shah merasa perlu turun tangan melayani para tamu kehormatannya dimana Rahmat Shah juga adalah sebagai Diplomat yakni Konsul Jenderal Kehormatan Republik Turki untuk Wilayah Pulau Sumatera dan umumnya mereka telah mengenal Rahmat Shah yang selama ini aktif dalam kegiatan diplomat baik di Medan, maupun Jakarta. Diselingi cengkrama, para duta besar serius menyimak penjelasan Rahmat mengenai koleksi satwa liar yang ditata denganapiksesuaidengankondisi alamnya, sambil menawarkan kebeberapa dubes untuk berfoto dengan koleksi favoritnya. Usai berkeliling tiap ruangan,

para Duta Besar diajak ke ruangan lantai 3 atau Legend Room dan lagi Rahmat Shah menunjukkan berbagai koleksinya yang berasal dari pimpinan negaranegara seperti Brunai, Afganistan, Pakistan, dan lain-lain. Acara kunjungan Duta Besar Negara sahabat diakhiri dengan infromasi Rahmat Shah sebagai senator dari Sumatera Utara serta tugas-tugas yang diamanahkan rakyat kepada dirinya, termasuk perjuangannya membela dan menegakkan keadilan bersamasama rakyat, seperti masalah pertanahan dan hal peruntuhan beberapa rumah ibadah sebagai akibat derasnya pembangunan di Kota Medan, seperti masjid Al Ikhlas, dan Raudhatul Hasanah. (rel/m08)

Otomotif A8 Pertarungan Kemewahan Mobil Konsep SUV Mewah Dunia mobil mewah saat ini sepertinya tengah gandrung terhadap model Sport Utility Vehicle (SUV). Merek-merek mewah seperti Bentley, Maserati hingga Lamborghini berlomba membuat SUV termewah di dunia. Lalu mana yang terbaik? Ada 3 SUV baru yang dipastikan akan segera lahir ke dunia. Mobil-mobil itu antara lain Maserati Kubang, Bentley EXP 9 F dan Lamborghini Urus. Saat ini ketiganya masih dalam status mobil konsep, namun tiap pabrikan sudah menegaskan bahwa mobil mereka itu tidak hanya akan berakhir sebagai pajangan semata karena akan segera diproduksi. Berikut kupasan SUV mewah tersebut. Lamborghini Urus Lamborghini UrusMobil ini merupakan salah satu mobil yang ditunggu-tunggu dunia otomotif dan akhirnya diperlihatkan di Beijing Auto Show serta kabarnya akan segera diproduksi dan dijual ke konsumen antara tahun 2015-2017 mendatang. Lamborghini Urus memiliki tiga pintu dengan kabin yang mampu menampung 4 pe-

Lamborghini Urus (kanan) dan Bentley EXP 9 F numpang. Tingginya hanya 1,66 meter dengan roda 24 inchi. Namun, karena menyandang nama Lamborghini, hampir pasti tenaga yang dimilikinya akan sangat besar. Kabar mengatakan kalau Lamborghini akan menempatkan mesin V10 yang mampu menyemburkan tenaga hingga 600 bhp. Nama Urus sendiri diambil dari nama satu jenis leluhur banteng yang disebut Julius Caesar sebagai banteng liar di pegunungan Eropa yang sudah lama punah. Urus yang juga

dikenal sebagai Aurochs adalah banteng purba raksasa dengan tinggi hampir 1,8 meter. Tubuh Lamborghini Urus akan dibuat seringan mungkin dengan interior minimalis yang dibentuk dari karbon dan diperkuat serat polimer dan posisi duduk yang lebih rendah dari seluruh pesaingnya. Tapi, patut diingat kalau Urus bukanlah SUV pertama Lamborghini. Karena dunia mencatat Lamborghini pernah mengeluarkan model SUV pertama mereka di pertengahan

Bingkisan Simpati MSC Untuk Pasukan Melati Dalam memperingati Hari Kartini, sudah lazim terdengar jika sekolah-sekolah, instansi pemerintah, perusahaan swasta bahkan kelompok–kelompok masyarakat di Medan kerap melakukan berbagai kegiatan. Tujuannya tidak lain adalah untuk mengingat perjuangan Kartini dalam mengangkat harkat dan martabat wanita. Kegiatan yang dilakukan pun beragam dan tidak menampilkan acara seremoni saja, diantaranya melakukan bakti sosial. Adalah Medan Scoopers Community (MSC) , salah satu klub motor pemakai Honda Scoopy yang ada di Kota Medan turut juga memperingati Hari Kartini dengan memberikan ‘bingkisan simpati’ kepada petugas perempuan penyapu jalan. Kepedulian klub motor ini terhadap ‘Pasukan Melati’ karena mengingat tugas yang diemban cukup beresiko. “Bukan cuma itu, dalam

menjalankan tugasnya, kesehatan mereka pun bisa terganggu diakibatkan debu yang mereka hirup. Sayangnya, sedikit sekali masyarakat yang peduli, padahal karena mereka juga jala-nan kota Medan tampak bersih,” ujar Sofyan Siahaan, Ketua MSC, di areal komplek Stadion Teladan. Penyerahan bingkisan simpatik ini pun tidak lepas dari dukungan pihak CV. Indako Trading Co. selaku main dealer Honda di wilayah Sumatera Utara, “Meski acaranya terbilang sederhana, namun kami sangat menghargai dan mendukung apa yang sudah dilakukan salah satu klub motor binaan kami. Ke depannya, kami berharap komunitas Scoopy ini akan lebih aktif dalam melakukan kegiatankegiatan yang bermanfaat bagi anggota dan masyarakat luas,“ ucap Lie Ci Pin, Manager Promotion, yang diwakili olehYudi, SPV Promotion di sela acara.

Scoopers sendiri merupakan komunitas pengguna Honda Scoopy yang terbentuk pada 4 Desember 2011, walaupun bisa dikatakan sebagai komunitas y a n g b a r u l a h i r, n a m u n Scoopers telah menunjukkan perkembangan yang pesat. “Bagi kami, komunitas ini bukan sekedar perkumpulan untuk bersenang-senang saja, melainkan sebagai wadah dalam menyalurkan bakat dan kreatifitas, salah satunya dengan melakukan banyak kegiatan positif, salah satunya di moment Hari Kartini ini “ terang Sofyan, dari MSC. Sementara itu, Gunarko Hartoyo, Marketing Research Development Manager CV. Indako, mengungkapkan, hadirnya Scoopers pastinya menjadi jawaban bagi kebutuhan pengendara Honda Scopy untuk bisa berkumpul menunjukkan eksistensi terhadap gaya unik mereka. (adv/m47)

80an dengan nama LM002 yang bongsong, bermesin V12 yang tetap diproduksi sampai 1992. Tapi dari segi penjualan mobil ini tidak bisa dibilang sukses karena hanya mampu diproduksi Lamborghini sebanyak 300 unit saja. Maserati Kubang Mobil yang akan berbagi rahim dengan mobil popular Jeep Grand Cherokee di Chrysler Jefferson North Assembly Plant di Michigan. Namun, karena ini adalah sebuah mobil Maserati, maka

Kubang adalah“Maserati murni” dan dikatakan tidak akan berharga murah. Ketika di produksi nanti, kemungkinan nama mobil ini akan berubah dan tidak akan memakai nama Maserati Kubang lagi. Maserati mengatakan bahwa mereka sedang mencari nama yang ‘lebih Italia’ sebelum crossover ini masuk ke dalam produksi pada tahun 2013. Untuk dapur pacunya, Maserati mengatakan kalau mesin yang akan pakai adalah mesin generasi baru yang akan di desain

WASPADA Selasa 1 MEI 2012

di Modena dan akan diproduksi di Maranello yang merupakan tempat produksi Ferrari. Kekuatan mesin itu akan ditransmisikan melalui transmisi otomatis 8-speed. Bentley EXP 9 F Mobil ini adalah SUV pertama Bentley sejak berkecimpung di dunia otomotif sejak 1919 lalu. EXP 9 F diperkuat dengan mesin W12 berkekuatan 600 daya kuda yang biasa terlihat di mobil Continental GT Speed. Di dalam mobil ini terdapat fitur panoramic glass roof yang menimbulkan kesan lega. Joknya dibalut kulit halus, dengan ornamen kayu dan aluminium di mana-mana. Dashboard-nya pun canggih dengan beberapa ornamen logam. Dan penumpang di kursi belakang bakal diperlakukan bak seorang raja. Ada tempat menaruh sampanye di bawah kursi dan tempat untuk menyimpan gelas. Kemudian iPad yang dilengkapi dengan keyboard dan layar touchscreen di kursi. Masih kurang? Di bagasi belakang tersedia perlengkapan piknik dari perak yang tersimpan rapi. (mkc/m47)

Berbagai langkah evolusi sedang terjadi dalam perkembangan dunia otomotif saat ini. Ketika sebuah mobil telah menjadi kebutuhan dasar bagi setiap orang, tentunya akan semakin banyak mobil dengan fitur-fitur keselamatan dan teknologi canggih yang akan dikembangkan. Sistem keamanan tentunya harus menjadi pertimbangan yang utama dalam menciptakan sebuah mobil. Di sisi lain, faktor kenyamanan dan kemudahan berkendara juga tak boleh diabaikan begitu saja. Saat ini memang sudah banyak diterapkan teknologi canggih untuk keamanan dan kenyamanan pengendara seperti airbag, GPS, sensor kamera. Sistem seperti itu sudah menjadi bagian yang harus dimiliki oleh kendaraan-kendaraan zaman sekarang. Berikut fitur-fitur yang akan menjadi syarat dalam sebuah kendaraan di masa

depan, menurut situs otomotif Automotto. Kamera 360 Derajat Saat ini memang masih sedikit yang menggunakan sistem kamera dalam sebuah mobil. Sistem kamera yang dimaksud adalah mampu memberikan visibilitas dari berbagai arah kepada pengemudinya. Teknologi ini memiliki kemampuan berotasi 360 derajat yang mampu melihat segala sudut keadaan sekeliling mobil. Hal ini tentunya akan membantu pengemudinya untuk lebih waspada terhadap bahaya dari samping dan belakang. Cross-Traffic Warning System Cross-Traffic Warning System merupakan perangkat keamanan tertinggi untuk melindungi mobil. Misalnya ketika sedang berada di tempat parkir dan pengemudi tak dapat melihat sekitarnya ketika akan berbelok, maka sistem ini akan memberikan peringatan bahwa

Bengkel F-16 Hadir Di Medan


Klub Motor Asahan Komit Patuhi Peraturan

Lakalantas pembunuh nomor tiga di dunia, sehingga klub motor yang ada di Kab. Asahan komit mematuhi peraturan dan tidak melakukan tindakan anarkis. Komitmen itu diungkapkan para klub motor saat temu ramah dengan Kapolres Asahan AKBP Yustan Alpiani, di aula Kamtibmas Polres Asahan, Sabtu (29/4) malam. Dalam kesempatan itu para ketua klub motor menandatangani nota kesepakatan untuk mematuhi peraturan dan menjadi contoh bagi pengemudi lainnya. Kapolres Asahan AKBP Yustan Alpiani berharap klub motor yang sebagian besar kalangan pemuda bisa membangun komunikasi dengan personil polisi lalulintas, sehingga tertib di jalanan raya dapat terwujud dan

menghindarkan perbuatan anarkis seperti yang dilakukan para geng motor. “Berdasarkan data PBB, lakalantas adalah pembunuh nomor tiga di dunia, setelah serangan jantung dan depresi. Sebab itu disiplin berkendara sangat penting untuk menjaga diri dan orang lain saat berada di jalan,” ujar Yustan. Menurutnya, data Sat Lantas Polres Asahan selama Januari-Maret 2012 telah terjadi 241 lakalantas di Asahan dan Batubara, dengan korban tewas mencapai 57 jiwa, luka berat 104 jiwa dan luka ringan 409 jiwa, sedangkan total kerugian Rp394 juta lebih. Data tersebut merupakan angka yang besar dalam hitungan triwulan, dan sebagian besar diakibatkan sepeda motor yang tidak tertib berlalulintas.(a15)


KAPOLRES Asahan AKBP Yustan Alpiani didampingi Kasatlantas AKP Eko Hartanto bersama para anggota klub motor dalam pertemuan silaturrahmi.

Lalu lintas yang kian padat membuat produsen mobil dunia terus memperkecil dimensi dari setiap produk terbaru. Bodi ringkas diharapkan dapat mempermudah pemiliknya untuk bisa menerobos kemacetan. Tak cuma itu, mobil juga harus dapat mengantar si empunya hingga masuk ke dalam kantor dan berada di kursi meja kerja. Mobil listrik terkecil di dunia ini bernama Volpe. Mobil gagasan Romano Artioli dari Italia, mantan pemilik merek Bugatti dan Lotus ini, memiliki lebar 1 meter, tinggi 1,5 meter, dan berat 350 kg. Mobil itu dapat masuk di gang-gang sempit dan dijejalkan di dalam lift. Ini berarti mobil ramah lingkungan tersebut bisa diparkir di dekat meja kantor. Bahkan bisa diselipkan di celah kosong antara dua mobil yang diparkir di jalan biasa. Volpe tidak dikhususkan untuk perjalanan jauh, kecepatan maksimalnya hanya 48 km/jam dan tidak banyak ruang untuk bagasi. “Volpe menjawab kebutuhan setiap penghuni kota yang ingin bergerak sambil bergaya di sekitar kota tanpa kehilangan waktu dalam lalu lintas dan untuk mencari tempat parkir,” kata Isabella Artioli, Wakil Presiden Volpe. (dm/vvn/m47)

Fitur Serba Cerdas Untuk Mobil Masa Depan ada kendaraan atau orang di belakangnya. Built-in Refrigerator/Freezer Built-in Refrigerator merupakan bagian interior dalam sebuah mobil. Berfungsi untuk menjaga makanan atau minuman tetap dingin. Keberadaannya menjadi sangat penting jika sedang berkendara saat musim kemarau yang panas. Night Vision Fitur ini digunakan bersama kamera untuk melihat dalam cahaya yang minim pada malam hari. Alat tersebut dipasang di bagian atas mobil bersama dengan kamera. Tentunya akan sangat membantu pengendara untuk dapat mewaspadai sekitar mobil saat berkendara di waktu malam. Proximity Keys Teknologi terbaru ini adalah favorit semua orang. Dengan fitur itu, tak ada lagi yang khawatir mobilnya akan dicuri orang. Dengan Proximity Keys,

Modif Motor Terus Berkembang

Komunitas MSC bersama Pasukan Melati.

Volpe, Bisa Masuk Lift

Industri modifikasi sepeda motor di Tanah Air akan terus berkembang, seiring terus menigkatnya pasar penjualan sepeda motor. “Apalagi kini pangsa pasar motor matik juga semakin naik, yang membuat usaha bengkel dan modifikasi sepeda motor pasti tetap diminati”, demikian Willy Dreeskandar, pendiri jaringan bengkel modifikasi F-16, saat peresmian bengkel modifikasi F-16 di Medan, Sabtu (28/4). Disebutkan, F-16 IndonesianWorkshop Association, yang kini hadir di Medan, tepatnya di Jalan Djamin Ginting, merupakan distributor sparepart, grosir alat-alat bengkel, toko variasi sepeda motor, butik, Fashion, dan tentu bengkel modifikasi. Bengkel di Medan ini, adalah cabang F-16 ke 16 setelah sebelumnya ada di Jakarta, Pekan Baru, Payakumbuh, Kupang, Bogor, Tangerang, Lampung, Samarinda, Balik Papan, Surabaya, Semarang, Cikampek.

“Dan memang ini baru pertama kami hadir di Medan dengan menghadirkan konsep Butik, Fashion, dan Modification Motor, “ ucap Willy, didampingi Perhatian Fau, pemilik Bengkel F-16 Medan. Ditambahkannya, F-16 punya ciri, konsep dan‘positioning’ yang berbeda, sehingga tidak akan bersaing dengan bengkel-

bengkel lain yang ada. “Itu karena kita punya pangsa pasar yang berbeda, sehingga tidak perlu bersaing dengan bengkelbengkel servis di sekitar kita. Malah, dengan bengkel-bengkel di sekitar, kita bisa bermitra. Misalnya, kalau kita perlu sebuah spare part yang kebetulan stok kita habis atau memang kita tidak menyediakan, maka bisa membeli di bengkel sebelah,” ungkap Willy. (m47)

TI Waspada/Armansyah Th

Willy Dreeskandar (kiri) dan Perhatian Fau, pemilik bengkel F16 di Medan.


HONDA: Revo 110 Fit Revo 110 SW Revo 110 CW Absolute Revo DX Revo Techno Scoopy Supra X 125 Jari jari Supra X 125 CW Supra X 125 Injec R Vario CW Vario Techno Std Vario Techno CBS Blade 110 CW Mega Pro Jari-jari Mega Pro Racing Tiger Racing CS 1 Beat CW Spacy Spoke Spacy CW CBR 250 Std CBR C-ABS SUZUKI Hayate

12.420.000 13.020.000 14.220.000 14.860.000 16.980.000 14.810.000 15.600.000 16.750.000 17.900.000 15.560.000 16.010.000 17.070.000 14.724.000 19.510.000 20.750.000 26.690.000 18.530.000 13.540.000 12.770.000 13.570.000 43.280.000 50.150.000 15.530.000

pemilik tak perlu lagi membawa kunci mobil karena akan secara otomatis pintu mobil terbuka hanya dengan sentuhan tangan pemiliknya. Fitur ini telah dipasang pada mobil Cadillac CTS Sport Wagon terbaru. Automated Off-Road System Teknologi ini terbilang sangat keren, karena pengemudi akan bebas melaju di atas segala jenis jalanan tanpa proses yang merepotkan. Daerah berbatu, lumpur, maupun berpasir dapat dengan mudah dilewati mobil dengan fitur seperti ini. Satellite Services Fitur seperti ini sudah mulai ditemui pada beberapa mobilmobil modern, karena memungkinkan pengemudi dan juga penumpang lainnya menikmati hiburan saat berkendara. Sistem ini akan terkoneksi dengan jaringan internet sehingga dapat menayangkan siaran televisi, update lalu lintas, bermain game, musik, radio. iDriver Controller iDriver Controller adalah fitur canggih yang semakin memudahkan seseorang dalam mengendarai mobil dengan aman. Mobil nantinya akan berjalan dengan diatur oleh

Shogun Axelo FL 125 SCD 15.300.000 Shogun Axelo FL 125 RCD 16.300.000 Shogun Axelo FL 125 RMCD 16.550.000 Satria FU 150CD 20.100.000 Spin UY 125S 12.925.000 Spin UY 125SC 13.500.000 Spin UY 125 Daytona 13.850.000 Sky Drive UK 125SC 14.400.000 Thunder EN 125KS 16.800.000 Titan FW 115D 11.875.000 Titan FW 115SD 12.975.000 Titan FW 115 SCD 14.050.000 Shogun FL 125 SD 14.625.000 Shogun FL 125 RCD 15.855.000 Shogun FL 125 RCMD 16.075.000 Shogun FL 125 RCDZ 16.305.000 Sky Wave UW 125 SC 15.430.000

YAMAHA: Vega ZR-DB 13.240.500 Mio 12.965.000 Mio CW 13.763.000 Mio Soul 14.706.000 Mio CW SE 14.755.000 Xeon 16.759.000 Jupiter Z 15.136.000 Jupiter Z CW 15.901.000 Jupiter Z CW SE 16.375.000 Jupiter MX CW 17.852.000 Jupiter MX AT CW 17.127.000 V-ixion 22.397.000 V-ixion SE 24.545.000 Byson 21.611.000 Scorpio Z CW 25.051.000 Lexam 16.923.500 Mio J 13.205.000 Mio J CW 14.013.000 Fino Sport 14.641.000 (harga sewaktu-waktu dapat berubah) * Sumber main dealer di Medan



sebuah alat dengan tomboltombol kecil yang cukup responsif dan cepat. Chrysler’s uConnect Perangkat ini mampu melakukan semua perintah pengemudinya untuk melakukan banyak hal selama perjalanan. Chrysler’s uConnect adalah perintah sistem suara yang dapat berbicara dengan orang di dalam mobil dan memeringatkan pengendaranya tentang keadaaan di sekitarnya. Chrysler’s uConnect juga memungkinkan pengemudi mencapai lokasi tujuan dalam waktu cepa, karena dapat memiliki sistem navigasi yang canggih. Fitur tersebut semakin lengkap karena mampu melakukan panggilan telepon dengan orang lain. Traffic 3D Analyser Fitur mengagumkan ini akan membantu pengendara mengetahui situasi dan kondisi lalu lintas sekitar. Keuntungan lain yang didapat mobil Anda akan lebih cepat dan aman mencapai lokasi tujuan. Traffic 3D Analyser dapat menghemat biaya bahan bakar karena waktu tempuh perjalanan menjadi lebih singkat. (vvn/ m47)

Antisipasi Ngantuk Saat Berkendaraan

Salah satu penyebab kecelakaan lalu lintas yang sering terjadi pada pengendara roda dua adalah karena rasa ngantuk yang dialami ketika berkendara. Meski hal ini terlihat sepele namun ada baiknya mengetahui apa saja yang mesti dilakukan untuk mengantisipasi bila rasa ngantuk melanda. Berikut beberapa hal yang bisa dijadikan panduan agar meminimalisasi kecelakaan yang terjadi agar tidak terulang kembali. Pertama, sebelum berkendara berdoalah terlebih dahulu, meminta agar diberikan keselamatan hingga tujuan. Kedua, beristirahat atau minum secangkir kopi yang mengandung kafein guna mengurangi rasa ngantuk. Ketiga, ada baiknya sebelum berkendara melakukan ritual membasuh muka terlebih dahulu. Hal ini bisa membuat kondisi menjadi lebih segar dari pekerjaan yang melelahkan. Keempat, lakukan pemanasan sebelum berangkat. Dengan tidak lupa juga melemaskan otot-otot yang tegang agar renggang dalam berkendara. Kelima, jika mengendarai kendaraan sendirian, sebaiknya jangan terlalu banyak melamun atau memikirkan sesuatu yang tidak penting. Ada baiknya berkonsentrasi dan fokus terhadap jalan yang ditempuh. Keenam, jika perjalanan yang ditempuh sangat jauh setiap satu jam sekali beristirahatlah untuk menjaga stamina tubuh dan kendaraan. Ketujuh, jika jenuh melanda setel musik untuk menghindari kejenuhan, karena kejenuhan bisa menyebabkan ngantuk. Namun, selain hal di atas yang disampaikan masih ada hal yang penting saat berkendara yaitu safety riding, untuk pengendara motor. Safety riding merupakan kelengkapan dan kelayakan kendaraan bermotor standar. Selain rutinitas service , pastikan juga kelengkapan kendaraan seperti, kaca spion wajib ada dua buah di kiri dan kanan, lampu depan, lampu rem, lampu sign kiri-kanan, klakson yang berfungsi. Memiliki STNK dan SIM selalu siap/tidak expired, plat nomor depan belakang, dan tak lupa menggunakan helm. (bbg sumber/m47)

Luar Negeri

WASPADA Selasa 1 Mei 2012


Pemberontak NPA Bunuh 4 Tentara Di Filipina Selatan

Forum HAM Asia Kecam Kebrutalan Polisi Malaysia

MANILA (Waspada): Empat tentara Filipina dan seorang warga sipil tewas sementara dua lainnya cedera dalam serangan pemberontakTentara Rakyat Baru (NPA) di kota Labo, Provinsi Camarines Norte, kata laporan militer Senin. Jurubicara Divisi Infanteri kesembilan Angkatan Bersenjata Filipina, Mayor Angelo Guzman mengatakan sembilan prajurit dari Batalyon Infanteri ke-49 sedang melakukan dialog dari rumah ke rumah ketika mereka ditembaki oleh pemberontak di Desa Maot pada sekitar pukul 12.30 sore pada Minggu (29/4). Insiden itu terjadi empat hari setelah NPA melakukan penyergapan terhadap konvoi militer di kota Tinoc di Ifugao mengakibatkan kematian 11 tentara.“Tentara sedang mengadakan dialog dari rumah ke rumah dan mereka tidak membawa senjata api,” kata Guzman. Dia menambahkan para pemberontak mundur, dengan membawakabursenapan enamM16,sebuahsenapanmesinK3danpistol kaliber45dariparaprajurititu.“Pendudukdesasetempatmelaporkan bahwamerekatelahmelihat para pemberontak membawa tiga rekan mereka yang mati saat mereka mundur,” kata jurubicara itu. 2 Wanita NPA tewas Dua orang yang diduga anggota perempuan NPA tewas dalam bentrokan dengan pasukan pemerintah di Provinsi Quezon, Filipina Utara, kata militer. Jurubicara Komando Luzon Selatan Generoso Bolina mengatakan bahwa tentara dari Batalion Infantri ke-85 bentrok dengan 11 pemberontak di satu desa Lopez, di satu kota di Provinsi Quezon, sekitar pukul 07:50 Minggu. Dua perempuan pemberontak tewas dalam konflik itu dan tidak ada korban dari pihak pemerintah, kata Bolina. Pasukan pemerintah dikerahkan di daerah itu menyusul laporan bahwa tersangka anggota NPA terlibat dalam kegiatan pemerasan, tambahnya. NPA yang berkekuatan 4.000 pejuang adalah sayap bersenjata Partai Komunis Filipina, telah melancarkan perang melawan pemerintahFilipinadi60provinsidinegaraitusejak29Maret1969.Sebelumnya, duapemberontakkomunisdanseorangtentaratewasdalambentrokan terpisah ketika para gerilyawan meningkatkan serangan mereka di Filipina, kata para perwira militer Minggu.(bbc/ok/m10)

KUALA LUMPUR (Waspada): Forum Asia untuk Hak Asasi Manusia dan Pembangunan (FORUM-ASIA) mengecam keras kebrutalan polisi anti huru-hara Malaysia pada demonstran BERSIH 3.0 Sabtu pekan lalu. FORUM-ASIA mendesak pemerintah Malaysia untuk menghargai demokrasi dan memperbolehkan penyampaian aspirasi melalui demonstrasi. Pernyataan FORUM-ASIA, Senin (30/4), dikeluarkan menyusul bentrokan antara kepolisian Malaysia dan puluhan ribu demonstran BERSIH 3.0. Dalam insiden tersebut, demonstrasi yang berlangsung damai mendadak ricuh saat polisi membubarkan paksa massa dengan menembakkan gas air mata dan meriam air. Menurut media Malaysia, lebih dari 470 demonstran yang menuntut pemilu bersih dan bebas kecurangan ditahan dalam peristiwa tersebut, kesemuanya telah dibebaskan. Namun, FORUMASIA mencatat, sekitar 572 orang yang ditahan polisi. Sebanyak sembilan orang jurnalis juga dilaporkan menjadi korban kebrutalan Kepolisian Diraja Malaysia. “Sekalilagi,pemerintahMalaysiatelahmenunjukkanpenghinaan merekaterhadapstandarHAMinternasionalmengenaiperkumpulan damai. FORUM-ASIA mengecam keras penggunaan kekerasan yang tidak perlu, termasuk penembakan meriam air dan gas air mata, dan penangkapan massal pada demonstrasi BERSIH,” ujar Yap Swee Seng, direktur eksekutif FORUM-ASIA. Peristiwa pekan lalu ini sekaligus mengulang kembali kenangan pahit demonstrasi yang juga berlangsung ricuh sembilan bulan lalu. PM Malaysia Najib Razak justru memuji aksi polisi yang menurutnya telah berlaku dengan benar. Razak mengatakan, demonstran berusaha menerobos barikade polisi di Alun-alun Dataran Merdeka. “Tuduhan penerobosan barikade oleh beberapa demonstran bukanlah pembenaran penggunaan kekerasan oleh polisi. Polisi seharusnya tidak mencegah demonstran yang melakukan aksi duduk di Dataran Merdeka,” kata Yap. Forum HAM yang berbasis di Swiss ini mendesak pemerintah Malaysia membentuk Komisi Independen Kekerasan polisi untuk menyelidiki dugaan penyalahgunaan kekuasaan oleh polisi. Forum ini juga telah menghubungi Komisi HAM Malaysia (SUHAKAM) untuk melakukan penyelidikan terhadap kekerasan Sabtu lalu. “Kekerasan berlebihan oleh polisi pada demonstrasi Sabtu kemarin semakin menunjukkan perlunya badan independen untuk mengawasi kekerasan oleh polisi. Pelanggaran ini sangat serius dan dilakukan secara berulang-ulang,” kata Yap. (vn)

PM Yingluck Janji Damaikan Pedalaman Thailand Selatan PATTANI (Antara/TNA-OANA): PM Thailand Yingluck Shinawatra berjanji untuk membawa perdamaian ke wilayah bermasalah Thailand Selatan dan menginstruksikan instansi terkait keamanan untuk bekerja ke arah yang lebih terpadu dalam menanggulangi permasalahan. Saat bertemu dengan para pemimpin agama dari lima provinsi perbatasan selatan dan tokoh masyarakat selama kunjungannya Minggu (29/4) ke provinsi selatan Pattani, Yingluck mengatakan bahwa kunjungannya bertujuan untuk menindaklanjuti situasi di wilayah tersebut dan mengambil kebijakan untuk menyelesaikan gangguan-gangguan yang sedang berlangsung. PM Yingluck juga menegaskan bahwa pihaknya membawa perdamaian ke provinsi-provinsi perbatasan selatan lainnya. Dia menambahkan bahwa pemerintah akan meningkatkan langkahlangkah keamanan serta memberikan dukungan yang sama pentingnya kepada semua daerah. Sementaraituparapemimpinagamasetempatmemintaperdana menteri untuk mengunjungi wilayah Selatan secara berlanjut dan agar tidak mengabaikan warga perbatasan selatan. Setelahdiberipenjelasantentangsituasiyangsedangberlangsung berkaitan kekerasan yang melanda provinsi oleh badan-badan keamanan lokal, PMYingluck mengatakan pemerintah perlu kerja sama dari semua pihak terkait dan para pemimpin agama setempat. Untuk mengatasi kerusuhan wilayah, perdana menteri menekankan bahwa pemerintah akan mengikuti strategi keamanan yangdisampaikankepadaParlemenyangberfokuspadapemahaman, akses, dan pengembangan, bersama dengan prinsip-prinsip kecukupan ekonomi, serta kesetaraan. Meski ada 66 lembaga di bawah 17 kementerian yang bekerja mengenai kekerasan di selatan, namunYingluck mengakui bahwa kerja badan-badan tersebut kurang koordinasi.

Suu Kyi Mengalah Dan Hentikan Boikot Parlemen Myanmar YANGON (Waspada): Kubu oposisi pimpinan Aung San Suu Kyi akhirnya mengalah dan menghentikan boikot yang mencegah mereka bertugas di parlemen. Langkah ini menuai pujian dari Sekjen PBB Ban Ki-moon yang mengatakan bahwa Myanmar yang baru harus bersatu demi masa depan. Reuters memberitakan Senin (30/4), Suu Kyi setuju mulai duduk di bangku parlemen tanpa adanya perubahan pada redaksi sumpah jabatan. Sebelumnya, Suu Kyi dan anggota parlemen dari Partai Liga Nasional untuk Demokrasi protes pada redaksi sumpah yang mengatakan bahwa mereka “harus melindungi konstitusi.” MenurutSuuKyipekanlalu,konstitusiyangadasaatinidiMyanmar adalahbuatanjuntamiliteryangmemerintahlebihdari50tahundengan tangan besi. Suu Kyi ingin agar redaksi itu diganti dengan‘menghargai konstitusi.’ Suu Kyi mengalah dan mengakhiri boikot. Mereka akan menjabat dan membacakan sumpah yang ada. Debut pertama Suu Kyi dan simpatisan partainya akan dilakukan pada Rabu mendatang. “Sebagai bentuk penghargaan atas kehendak rakyat dan pertimbangan dari anggota parlemen partai demokrasi dan independen, kami memutuskan untuk menghadiri parlemen secepatnya dan mengambil sumpah,” kata Suu Kyi. Keputusan Suu Kyi mendapatkan pujian dari Ban yang saat ini tengah mengunjungi Myanmar. Menurutnya, oposisi dan pemerintah harus bersatu demi kemajuan Myanmar yang baru. “Kedua pemimpin harus bekerja sama menyelesaikan permasalahan. Selalu akan ada kesulitan yang dapat diatasi demi kepentingan bangsa,” kata Ban. (vn)

The Associated Press

SENTIMEN ANTI-AS MENINGKAT DI FILIPINA, Seorang pemrotes Filipina membakar satu bendera AS untuk menyatakan ketidaksenangannya atas apa yang dikatakannya campur tangan AS dan China dalam pertikaian di satu beting di Laut China Selatan. Aksi protes itu dilakukan di luar Konsulat China di kawasan perdagangan Makati, di selatan Manila, Filipina, Senin (30/4).

Kemunduran Gencatan Senjata Syria

Bom Bunuhdiri Renggut Delapan Jiwa Di Idlib BEIRUT (AP): Dua pengebom bunuhdiri meledakkan mobil yang bermuatan bahan peledak yang mereka bawa ke dekat satu kompleks militer dan satu hotel di Idlib, baratlaut Syria, Senin (30/4), yang menewaskan sekurang-kurangnya 20 orang dan jejak ledakan itu menimbulkan lobang dalam di tanah, demikian menurut media pemerintah. Ledakanitumerupakanrangkaian terakhir kemunduran bagi usaha PBB untuk mengakhiri krisisSyriayangtelahberlangsung selama13bulan.Satutimpeninjau PBB yang telah berada di Syria untuk menyelamatkan gencatan senjata yang berlaku sejak 12 April lalu, namun secara luas telah diabaikan oleh kedua belah pihak. Para pejabat PBB menyatakan rezim Syria sebagai agresor utama dalam pelanggaran gencatan senjata itu. Belum ada pihak yang mengaku bertanggungjawab atas serangan bom Senin di Idlib, satu kota di baratlaut Syria. Media pemerintah menyalahkan ‘teroris

bersenjata,’ satu sebutan untuk pemberontak yang berusaha menumbangkan pemerintah. Kantor berita pemerintah SANA mengatakan, di antara korban tewas terdapat anggota pasukan keamanan dan warga sipil. Syrian Observatory for Human RightsyangbermarkasdiLondon, satu jaringan aktivis, mengatakan lebih dari 20 orang tewas dalam ledakan tersebut. Pelaku pengeboman meledakkan bahan peledak mereka dekat satu kompleks militer dan dekat Carlton Hotel, kata SANA. Sebagian besar yang tewas adalah anggota pasukan keamanan, kata Observatorium yang

bermarkas di Inggris itu. Satu ledakan kuat, mungkin bom mobil, juga dilaporkan terjadi di dekat ibukota Damaskus, menyebabkan korban jiwa, kata Observatorium menambahkan. “Satu ledakan kuat mengguncang pinggiran kota Qudsiya dan tampaknya itu adalah bom mobil,” katanya. “Laporan awal menunjukkanadakorban.”Ledakan-ledakan terjadi meskipun gencatan senjata yang didukung PBB yang mulai berlaku sejak 12 April tetapi gagal menghentikan kekerasan. Veteran penjaga perdamaian Mayjend. Robert Mood Minggu mendesak semua pihak agar mematuhi gencatan senjata saat ia tiba di Damaskus untuk mengambil alih komando misi pengamat militer PBB guna mengawasi gencatan senjata. Sementara itu Bank Sentral SyriaMinggumalamjugadiserang dengan granat yang diluncurkan dengan roket (RPG), kata laporan televisi negara Senin. Laporan ter-

BOGOTA (Antara/XinhuaOANA): Seorang wartawan Prancis yang cedera dan tampaknya diculik di Kolombia setelah bentrokan antara pemberontak dan militer masih belum ditemukan, kata Kementerian Perta-

The Associated Press

RERUNTUHAN satu bus penumpang yang bertabrakan dengan kendaraan lainnya disingkirkan dari tempat kejadian tabrakan di Gorakhpur, 270 km timur Lucknow, India, Minggu (29/4). Menurut satu laporan berita, dua bus bertabrakan adu kambing dan jatuh ke selokan, yang menyebabkan 20 orang tewas dan mencederai 30 lainnya.

20 Tewas, 30 Cedera Dalam Kecelakaan Di Jalan Raya India di jembatan Maniram sekitar 20 kilometer dariGorakhpur.“Sementara 18 orang tewas di tempat, 30 lainnya terluka dan telah dirawat di rumah sakit setempat dengan luka serius,” kata pejabat itu tanpa menyebut nama. Pemerintah negara bagian telah mengumumkan kompensasi 50.000 rupee (kira-kira AS$1.000) untuk setiap kerabat

sebut menyalahkan serangan itu dilakukan oleh satu “kelompok teroris bersenjata.” “Satu kelompok teroris bersenjata melancarkan serangan RPGdiBankSentralSyriadiSabaa Bahrat Square di Damaskus,” kata laporan televisi. “Serangan itu hanya menyebabkan kerusakan barang-barang.” Dikatakan bahwa tiga orang bersenjata di dalam kendaraan melakukan serangan itu pada sekitar pukul 01:00 waktu setempat sebelum mereka cepat melarikan diri.Televisi itu mengatakan bahwaserangantersebutmerupakan pelanggaran jelas atas gencatan senjata yang berumur lebih dari dua pekan yang ditengahi oleh utusan perdamaian PBB-Liga Arab Kofi Annan. Dikatakanbahwa “kelompok teroris bersenjata” juga melakukan serangan RPG kedua pada patroli polisi di depan sebuah rumah sakit di daerah Damaskus, Rukn al-Din. Empat polisi terluka dalam serangan tersebut. (m10)

Wartawan Prancis Cedera Dan Hilang Di Kolombia hanan Kolombia. Menteri Pertahanan Juan Carlos Pinzon mengatakan kepada wartawan di Florencia, ibu kota Provinsi Caqueta bahwa wartawankawakanRomeoLanglois —yang menyertai tentara— “terkena peluru di lengan kirinya” selama baku-tembak kecil di Caqueta. Prajurit Angkatan Darat Kolombiayangmelancarkanoperasi kontranarkotika, yang menghancurkan lima laboratorium pemrosesan kokain, terlibat bakutembakdengananggotaAngkatan Bersenjata Revolusioner Kolom-

bia (FARC), kata Pinzon Minggu (29/4). “Di tengah ketegangan dan tekanan, yang mereka alami, (Langlois) memutuskan untuk membuka helmnya dan jaket antipelurunya untuk memperlihatkan ia adalah warga sipil saat ia bergerak menuju daerah tersebut dari tempat gerilyawan melepaskantembakan,”kataPinzon,yang mengutip keterangan tentara. Dia menambahkan itu lah yang mereka ketahui sejauh ini mengenai peristiwa tersebut, yang terjadi Sabtu di satu daerah yang dikenal dengan nama La

Irak Terima 24 Jet Tempur F-16 AS Pada Awal 2014

NEWDELHI(Antara/Xin-huaOANA):Sedikitnya20orangtewas dan30lainnyaterlukada-lamsatu kecelakaan jalan utama di kota Gorakhpur, Negara Bagian India Utara Uttar Pradesh, kata seorang perwira senior polisi. “Kecelakaanituterjadisaatbus miliknegaradanbuspenumpang swasta terjun ke selokan setelah bertabrakankepaladengankepala

Kekerasan Di Karachi, 5 Tewas

yang meninggal dan 25.000 rupee (sekitar AS$500) bagi setiap korban yang luka berat dan 10.000 rupee kepada mereka yang menderita luka ringan. Para pejabat senior negara bagian telah bergegas ke lokasi kecelakaan, kata pejabat tersebut. Dia menambahkan penyelidikan telah diperintahkan atas insiden yang menelan banyak korban itu.

BAGHDAD (Antara/Reuters): Irak menerima 24 dari 36 jet tempur F-16 yang dipesannya dari AS pada awal 2014, kata seorang pejabat tinggi kepada Reuters. Pada masa pemerintahan Presiden Saddam Hussein, Angkatan Udara Irak merupakan salah satu yang terbesar di kawasan itu dengan ratusanjetyangsebagianbesarbuataneks-UniSoviet.MiliterIrakdibubarkan setelah invasi pimpinan AS pada 2003 yang menggulingkan Saddam. Julilalu,PMNuriAl-Malikimelipatgandakanjumlahpesawattempur yang akan dibeli untuk memperkuat angkatan udara yang terabaikan selama kurun waktu panjang ketika Irak bergantung pada dukungan udaraAS. IskanderWitwit,wakilketuakomitepertahanandankeamanan parlemen, mengatakan, rombongan pertama 24 pesawat itu akan membentuk dua skwadron angkatan udara. “Irak berniat memiliki perlengkapan yang lebih canggih daripada yang dimiliki negara-negara tetangga. Negara-negara tetangga kecil seperti Kuwait bahkan memiliki lima skwadron,” kata Witwit.Irak akan mengikuti pasar untuk pesawat-pesawat lain di masa datang, kataWitwit, dengan menambahkan bahwa pilot sudah melakukan latihan untuk menerbangkan pesawat baru F-16. Sejumlah negara tetangga dan Massud Barzani, presiden wilayah otonomi Irak Kurdistan, telah mengungkapkan kekhawati-ran atas pembelian jet-jet tempur itu oleh Baghdad.Minggu (22/4), Barzani mengatakan, dia menentang penjualan pesawat tempur F-16 kepada Irak bila Maliki masih menjadi PM, karena ia khawatir pesawatpesawat itu akan digunakan untuk menyerang Kurdistan. Namun,Witwit menepis kekhawatiran itu dengan mengatakan kepada Reuters, jet-jet tempur itu dimaksudkan untuk mempertahankan Irak, tidak untuk “satu orang”. Pemimpin Kurdistan itu sebelumnya menuduh Maliki bergerak ke arah kediktatoran dan mengatakan, PM tersebut bertujuan‘membunuh proses demokrasi’ setelah ketua komisi pemilu Irak ditangkap atas tuduhan korupsi.

Montanita di Caqueta, tempat pemberontak beroperasi dan diduga memperoleh sebagian dana dari penjualan narkotika. Menteri itu tak mengkonfirmasi apakah wartawan tersebut telah diculik oleh FARC, demikian laporanXinhuaSeninpagi.“Kami tidak tahu secara pasti pada saat ini apa saja yang terjadi pada wartawan itu,” katanya. Langlois,korespondenpe-rang dengan pengalaman sedikit-nya 12 tahun meliput negara bermasalah Amerika Selatan tersebut, menjadi wartawan lepas buat salurantelevisiberitaPrancis,France 24, dan surat kabar Le Figaro. Menteri itu menyeru kelompok pemberontak tersebut agar menjadi keselamatan dan jiwa Langlois,kalaumerekamenawan dia. Sementara itu Menteri Luar Negeri Prancis Alain Juppe memberitahumediaPrancis,Ahad(29/ 4), wartawan tersebut berada di tangan pemberontak Kolombia. Langlois (35) “diculik” dan “disandera”, kata Juppe. Ditambahkannya, kementeriannya akan menjadi penengah dengan pemerintah Kolombia.

ISLAMABAD (Antara/Xinhua-OANA): Polisi di kota pelabuhan selatan Pakistan Karachi menghadapi perlawanan keras dari orangorang bersenjata berat, yang menggunakan roket dan granat tangan, menewaskan sedikitnya lima orang termasuk seorang polisi, kata polisi. Sumber-sumber kepolisian mengatakan bahwa setidaknya 20 orang termasuk empat perwira polisi tewas, sementara 55 terluka selama operasi polisi terhadap kelompok kriminal di daerah Kota Lyari, yang memasuki hari ketiga, Minggu (29/4). Inspektur senior Departemen Investigasi Kejahatan Polisi Chaudhry Aslam mengatakan bahwa operasi itu diluncurkan untuk membersihkan daerah dari unsur-unsur kejahatan, yang disalahkan atas kejahatan-kejahatan di Karachi. Namun, warga Lyari, daerah etnis Balochs, menyebut operasi itu sebagai korban politik yang diluncurkan atas “perintah” dari saingan kuat berbahasa Urdu Gerakan Muttahida Qaumi atau MQM. MQM dan pemerintah membantah tuduhan tersebut. Lyari dianggap sebagai kubu Partai Rakyat Pakistan yang berkuasa. Zafar Baloch, pemimpin komunitas Baloch, menyalahkan polisi atas kekerasan di daerah itu, dan mengatakan perwakilan dari daerah tersebut siap untuk memecahkan masalah melalui perundingan. Polisi memerangi penjahat bersenjata lengkap yang menghadapi polisi dengan peluncur roket dan granat, kata media lokal. Polisi menewaskanpuluhanpenjahatburonanselamaoperasi.Tembak-tembakan sengit terus berlangsung pada hari ketiga di berbagai belahan Lyari. Tigadariempatkendaraanlapisbajapengangkutpersonelhancur dalamserangangangstersejakoperasidimulai.Parapenjahatmenembakkanlimaroketkearahpolisidanmelepaskantembakan sembarangan, yang melukai lima orang termasuk seorang juru kamera TV Arif Ali. Korban luka segera diangkut ke rumah sakit.

Miliarder Australia Pesan Titanic Abad Ke-21 CANBERRA (Waspada): Seorang miliarder Australia, Clive Palmer, telah memesan pembuatan kapal Titanic versi baru. Proyek ini, menurut dia, demi mengenang tragedi tenggelamnya kapal pesiar mewah itu seratus tahun lampau. Menurut BBC Senin (30/4), Palmer menunjuk perusahaan galangan kapal asal China, CSC Jinling Shipyard, untuk membuat proyek ambisius ini. Desain dan kemewahan kapal itu akan dibuat mirip dengan Titanic, namun dilengkapi dengan teknologi navigasi dan komunikasi yang sangat canggih. “KapaliniakandibuatsemegahTitanicyangorisinil.Namun,tentu saja juga akan dipasang teknologi navigasi dan sistem keamanan yang terbarudiabadke-21,”kataPalmer,yangdikenalsebagaijuraganbisnis pertambangan. Menurut Canberra Times, konglomerat berusia 58 tahun ini masuk dalam daftar Orang Terkaya se-Australia 2012. Bagi Palmer, ini akan menjadi Titanic versi abad ke-21. Kapal pesiar baru itu ditargetkan mulai berlayar akhir 2016, dan akan menjalani rute perdana London - New York.Pengumuman ini muncul dua minggu setelah peringatan 100 tahun tenggelamnya Titanic. Kapal asal Inggris itu membawa 2.223 penumpang dan awak saat buang sauh dari Southampton menuju Kota New York, AS, pada 10 April 1912. Lima hari kemudian, kapal itu menabrak gunungessaatberadadiutaraSamuderaAtlantiksehinggatenggelam.

Taliban: Tidak Benar Ada Perundingan Dengan AS KABUL (Antara/AFP): Taliban Afghanistan membantah telah memulailagiperundingandenganAS,meskipemerintahAfghanistan menekankan bahwa proses perdamaian sedang berlangsung. Taliban, yang bulan lalu memutuskan kontak dengan AS di Qatar, mengatakan,merekatidakakanmemulaiperundingan‘sampaiorang Amerika mengambil langkah-langkah konstruktif dan memenuhi janji yang telah disepakati mengenai pembangunan kepercayaan.’ Langkah-langkah pembangunan kepercayaan yang diusulkan mencakup pembebasan lima pemimpin Taliban yang ditahan di penjara militer AS di Teluk Guantanamo. Pernyataan itu, yang dipasang di situs Taliban, disampaikan hanya beberapa hari setelah AS, Afghanistan dan Pakistan setuju pada pertemuan di Islamabad untuk mengkaji cara-cara memberikan jalan yang aman bagiTaliban yang bersedia bergabung dalam proses perdamaian. Langkah itu juga ditolak oleh kelompok gerilya tersebut, yang menyatakan bahwa itu bertujuan memfasilitasi militan yang tunduk pada tuntutan AS atas nama perundingan rekonsiliasi. “Karenanya Emirat Islam Afghanistan mengecam keras upaya-upaya busuk dan heboh yang menciptakan keretakan,” kataTaliban dalam sebuah pernyataan terpisah oleh juru bicara Zabihullah Mujahid.



WAN-IFRA/Michel Cambon



WASPADA Selasa 1 Mei 2012

Selebrasi Bermasalah Barca MADRID (Waspada): Pep Guardiola, entrenador Barcelona, meminta maaf atas selebrasi bermasalah Thiago Alcantara dan Dani Alves, saat El Catalan pesta gol membantai Rayo Vallecano 7-0 pada jornada 35 La Liga Primera.


EDY Reja, alenatorre Lazio, protes dan mendapat kartu merah dari wasit Mauro Bergonzi di markas Udinese, Stadion Friuli, Senin (30/4) dinihari WIB.

Peluit Hantu Memalukan Udinese Vs Lazio 2-0 UDINE, Italia (Waspada): Insiden ‘peluit hantu’ jelang bubaran laga Udinese versus Lazio pada jornada 35 Liga Seri A di Stadion Friuli, Minggu (SeninWIB), dianggap memalukan oleh kubu I Friulani. Udinese yang memenangkan laga itu 2-0, dianggap Lazio diuntungkan dengan ‘peluit hantu’ yang berbuah gol kedua tim tuan rumah menit 94. “Saya tak mendengar adanya peluit itu, sebab sedang berteriak kepada salah satu pemain saya. Namun beberapa pemain saya mengaku mendengarnya dari keramaian,” ungkap Francesco Guidolin, alenatorre Udinese. Akibat mendengar peluit yang ditiupkan pendukung La Zebrette, pemain I Biancoce-

leste jadi bengong. Keadaan itu dimanfaatkan Roberto Pereyra dengan melepaskan tendangan keras dari tengah lapangan ke gawang kosong yang telah ditinggalkan kiper Federico Marchetti. Gol tersebut kemudian disahkan wasit Maur Bergonzi. “Selanjutnya kekacauan terjadi dan itu benar-benar sangat memalukan. Bahkan, para pemain Lazio meminta saya untuk mengatakan bahwa saya mendengar peluit itu dan ingin permainan dimulai dari bola bebas,” tutur Guidolan dalam Sky Sports, Senin (30/4). Giampiero Pinzi, gelandang tuan rumah, ikut mengomentari insiden tersebut. “Saya mendengar adanya suara peluit dari keramaian,” akunya. “Kemudian pemain Lazio tiba-tiba berhenti dan berpikir

suara tersebut datang dari peluit wasit. Pereyra masih terus bermain dan sadar bila bunyi itu bukan peluit dari wasit,” tambah Pinzi kepada Football Italia. Kendati ragu apakah insiden seperti itu sudah diatur dalam buku peraturan sepakbola Italia, Pinzi menegaskan, malu atas kejadian tersebut. “Memalukan dengan adanya kejadian seperti itu malam ini, setelah laga berjalan dengan hebat,” pungkasnya. Friulani mendominasi laga dimaksud dengan penguasaan bola 62 berbanding 38 persen. Gol pembuka kemenangan Udinese dicetak kaptennya Antonio Di Natale menit 69, namun kemudian keributan terjadi setelah gol kontroversial Pereyra pada menit keempat injurytime. (m15/sky/fi)

“Atas nama klub, saya meminta maaf atas selebrasi tersebut. Karena itu jelas tidak mencerminkan sikap pemain Barca. Saya pastikan itu takkan terjadi lagi,” ucap Pep, seperti dikutip dari Goal, Senin (30/4). Usai mencetak gol kelima El Bara ke gawang kiper David Cobeno menit 77 di Teresa Rivera Stadium, Madrid, Minggu (Senin WIB), Thiago bersama rekannya Alves selebrasi dengan dansa di depan para fans Rayo. Tarian itu menyulut emosi ribuan fans tim tuan rumah. Kapten Barca Carles Puyol bahkan sampai memarahi kedua juniornya tersebut. Thiago dan Alves kemudian meminta maaf atas selebrasi bermasalah mereka. “Saya ingin meminta maaf untuk fans Rayo, yang merasa tersinggung oleh dansa kami. Kami tak bertujuan menyinggung siapapun, saya hanya ingin bersenang-senang,” dalih Alves. “Saya minta maaf jika saya telah menyinggung Rayo selama melakukan selebrasi. Emosi berlebih membuat saya melakukan kesalahan, saya harap hal itu tak terjadi lagi,” timpal Thiago. Seakan ingin melampiaskan kekesalan pasca disingkirkan

Selasa, 1 April


Getafe vs Santander 10:00 Granada vs Espanyol 16:00 Gijon vs Villarreal 18:00 *tvOne live pkl 01:00 WIB

Rabu, 2 April


Atletico vs Sociedad Barcelona vs Malaga *tvOne live pkl 01:00 WIB Mallorca vs Vallecano Zaragoza vs Levante Sevilla vs Real Betis Valencia vs Osasuna Bilbao vs Real Madrid *tvOne live pkl 03:00 WIB

16:00 18:00 18:00 18:00 18:00 20:00 20:00

Pencetak Gol Terbanyak 43 Cristiano Ronaldo (Madrid) Lionel Messi (Barcelona) 23 Radamel Falcao (Atletico) 21 Gonzalo Higuain (Madrid) 20 Karim Benzema (Madrid) 17 Fernando Llorente (Bilbao) Roberto Soldado (Valencia) Chelsea di semifinal Liga Champions, pasukan Pep langsung menekan tuan rumahVallecano begitu laga dimulai. Lionel Messi membuka pesta gol tim tamu menit 16. Alexis Sanchez menggandakan keunggulan menit 26. Seydou Keita memastikan sang juara bertahan memimpin 3-0 saat memasuki turun minum. Babak kedua baru berjalan dua menit, El Blaugrana menambahkan lagi golnya ke gawang Cobeno melalui Pedro Rodriguez. Setelah Thiago memasukkan gol kelima, Pedro menyarangkan gol keduanya menit 87. Jelang bubaran laga, Messi pun menambahkan golnya, sehingga koleksinya kini menjadi 43 gol, sama dengan superstar Real Madrid Cristiano Ronaldo. “Sepekan berlalu, kami masih sedih perihal kegagalan kami mencapai final Liga Champions dan kekalahan me-

Lecce Penentu Nyonya Tua ROMA (Waspada): Alenatorre Juventus, Antonio Conte, menyebut laga kandang melawan US Lecce besok malam pada giornata 36 Liga Seri A, menjadi penentu nasib Si Nyonya Tua, meski tim tamu 17 tingkat di bawah skuadnya. “Kami ada di depan, sehingga menjadi penguasa atas nasib kami sendiri. Rabu akan menjadi duel yang menentukan hidup kami,” tutur Conte, seperti dilansir Reuters, Senin (30/4). Setelah kehilangan gelar scudetto 2005 dan 2006 karena skandal calciopoli, Si Nyonya Selasa, 1 April (GMT) Tua dapat mengklaim gelar perdananya dalam sembilan Chievo vs AS Roma 1600 tahun terakhir. Syaratnya, The Napoli vs Palermo 1845 Old Lady memukul Lecce dan *Indosiar live pkl 01:45 WIB saat bersamaan AC Milan Rabu, 2 April (GMT) dipecundangi Atalanta di San Siro. Catania vs Bologna 1845 “Kami tahu bagaimana Cesena vs Udinese 1845 untuk menambahinya (poin),” Fiorentina vs Novara 1845 klaim Conte, yang musim ini Genoa vs Cagliari 1845 mampu membawa Nyonya Juventus vs Lecce 1845 Tua memimpin klasemen deSS Lazio vs Siena 1845 ngan catatan belum terkaParma vs Inter Milan 1845 lahkan. AC Milan vs Atalanta 1845 I Bianconeri tetap tiga *Indosiar live pkl 01:45 WIB angka di atas Milan pasca

menggunduli Novara 4-0 akhir pekan lalu. Dengan garis finish sudah berada di depan mata pada musim pertamanya sebagai pelatih di Juventus Stadium, mantan gelandang Juve dan Italia itu sempat tersinggung karena telat mendapat pengakuan. “Ketika orang-orang berbicara mengenai Juventus selalu ada seseorang yang meletakkan kunci pas pada pekerjaan. Kami belum terkalahkan, hanya saja selalu ada kata ‘tapi.’ Namun itu memberi kami dorongan ekstra untuk sukses,” pungkas Conte. Menjamu Lecce, dia kelihatannya akan tetap memberi kepercayaan pada duet Mirko Vucinic-Marco Boriello di lini depan. Duet mantan penyerang AS Roma itu telah mencetak empat gol dalam dua kemenangan terakhir, tetapi gelandang Arturo Vidal yang palling bersinar. Lecce sendiri akan datang dengan misi selamat dari degradasi. Pasca kalah kandang melawan Napoli dan Parma, Lecce kini terpuruk di peringkat 18, kalah satu angka di bawah Genoa. (m15/rtr/afp)

STRIKER Robbie Keane tak masalah menggauli istrinya Claudine pada Euro 2012.

lawan Real Madrid. Namun kemenangan ini menunjukkan tim tetap memiliki kekuatan dan antusiasme,” klaim Pedro. “Kami bermain dengan ritme dan juga kepercayaan diri. Saya senang dengan hasil yang kami raih,” tambah winger Timnas Spanyol berusia 24 tahun itu. Pedro pun menuai pujian khusus dari Pep, pelatih berusia 41 tahun yang tidak lagi memperpanjang kontraknya musim depan di Camp Nou. “Saya sangat puas dengan kinerja Pedro. Dia salah satu pemain favorit saya. Dia juga

ARTURO Vidal makin bersinar di Juventus. -AP-

Juventus 35 21 14 0 62-18 77 AC Milan 35 22 8 5 68-28 74 Napoli 35 14 13 8 62-43 55 Inter Milan 35 16 7 12 52-47 55 Lazio 35 16 7 12 50-45 55 Udinese 35 15 10 10 47-35 55 AS Roma 35 15 6 14 55-50 51 Catania 35 11 14 10 45-47 47 Parma 35 12 11 12 48-52 47 Atalanta* 35 13 13 9 40-36 46 Bologna 35 11 12 12 38-42 45 Chievo 35 11 11 13 30-41 44 Siena 35 11 10 14 43-40 43 Palermo 35 11 9 15 48-54 42 Cagliari 35 10 12 13 36-42 42 Fiorentina 35 10 11 14 34-41 41 Genoa 35 9 9 17 46-66 36 Lecce 35 8 11 16 39-53 35 Novara 35 6 10 19 29-61 28 Cesena 35 4 10 21 22-53 22 *Atalanta minus 6 poin karena judi.

Klasemen Ligue 1

beberapa elemen penting The Irish. Para WAGs pun dibebaskan mengunjungi markas tim Irlandia di Sopot, Polandia. “Tentu, pemain akan punya waktu bebas dengan pasangannya. Mereka bisa bertemu di siang hari, tapi tidak untuk malamnya. Mereka harus kembali bersama kami,” tegas mantan pelatih Juventus dan Bayen Munich tersebut. Irish masuk Grup C, gabung dengan juara bertahan Spanyol, Italia dan Kroasia. Mengawali laga melawan Kroasia pada 11 Juni 2012, Trap mengaku dalam posisi sulit saat skuadnya menjajal Gli Azzurri pada partai pamungkas penyisihan grup. “Saya tidak ingin bermain melawan Italia, karena alasan teknis dan juga karena aspek psikologis. Kami mengenal satu sama lain dengan sangat baik dan salah satu dari kami harus meninggalkan turnamen, tapi saya tidak tahu siapa,” bebernya. “Kami akan tempur dengan antusiasme, kemauan, dan identitas kami sendiri. Lalu, kita lihat apa yang akan terjadi,” tambah pelatih gaek asal Italia itu. (m15/vvn/ix)

Montpellier Paris SG Lille Rennes Lyon Etienne Toulouse Bordeaux Evian Nancy Marseille Valencs Lorient Nice Caen Dijon Ajaccio Brest Sochaux Auxerre

34 34 34 34 33 34 34 34 33 34 34 34 34 34 34 34 34 34 34 34

22 6 6 61-31 19 10 5 64-37 18 11 5 64-37 16 9 9 48-37 17 5 11 52-43 16 8 10 45-37 15 8 11 36-31 12 13 9 43-37 12 9 12 48-47 10 12 12 34-40 10 11 13 41-40 11 7 16 33-40 9 11 14 34-45 9 10 15 34-41 8 11 15 36-50 9 7 18 37-55 7 13 14 34-57 6 15 13 28-37 8 9 17 34-57 6 13 15 41-48


Montpellier vs Evian


Hasil Minggu (Senin WIB) Auxerre vs Brest Sochaux vs Bordeaux St-Etienne vs Dijon Valenciennes vs Nice Rennes vs Ajaccio AS Nancy vs Caen Lille vs Paris SG

Tekad Gol Torres

LONDON ( Wa s p a d a ) : Harry Redknapp (foto), manajer Tottenham Hotspur, yakin pasukannya bakal menggusur Arsenal dari peringkat ketiga klasemen Liga Premier League. “Kami harus terus menang dan Anda tidak tahu akan apa yang terjadi nanti. Siapa yang menyangka Wigan bisa memukul Arsenal juga Newcastle,” papar Redknapp dalam The Sun, Senin (30/4). “Kini kami mesti fokus pada diri kami sendiri dan memastikan kami akan melakukan segalanya untuk memenangi tiga pertandingan terakhir kami,” ujarnya lagi. Spurs minus empat poin di bawah The Gunners, tetapi masih menyimpan satu partai lebih banyak. Jarak kedua tim London Utara itu merapat lagi

LONDON ( Waspada): Striker Chelsea Fernando Torres (foto), bertekad untuk terus menyumbang gol pada pertandingan berikutnya yang dilakoni The London Blues. “Saya senang bisa mencetak hatrik di hadapan para pendukung dan mudah-mudahan ini menjadi awal yang baik,” tutur Torres, yang menyumbang tiga gol ketika Chelsea menggasak Queens Park Rangers 6-1 akhir pekan lalu di Stamford Bridge, London. “Sekarang yang terpenting saya berada dalam bentuk permainan terbaik demi menghadapi pertandingan penting selanjutnya,” tekad Torres, seperti dilansir Express, Senin (30/4). Si Biru akan melakoni bigmatch Liga Premier dengan Newcastle United besok malam di Stamford Bridge. Gol Torres sangat penting dalam laga itu nantinya, sebab bisa membuka

Man United Man City Arsenal Tottenham Newcastle Chelsea Everton Liverpool Fulham West Brom Sunderland Swansea Norwich Stoke City Aston Villa Wigan QPR Bolton Blackburn Wolves

35 26 5 4 86-32 83 35 25 5 5 87-27 80 36 20 6 10 68-44 66 35 18 8 9 59-39 62 35 18 8 9 53-46 62 35 17 10 8 62-39 61 35 14 9 12 46-38 51 35 13 10 12 43-37 49 35 12 10 13 45-48 46 36 13 7 16 41-47 46 36 11 12 13 44-43 45 36 11 11 14 43-49 44 36 11 10 15 47-63 43 35 11 10 14 33-49 43 36 7 16 13 36-50 37 36 9 10 17 38-60 37 36 9 7 20 40-63 34 35 10 4 21 41-69 34 36 8 7 21 47-75 31 36 5 9 22 38-79 24

akhir pekan ini, setelah London Whites mencukur Blackburn 2-0, sedangkan London Reds ditahan Stoke City 1-1.

“Saya selalu mengatakan jika semuanya bisa terjadi di dunia sepakbola. Ini bagian dari permainan. Kami punya sisa dua laga tandang melawan Bolton Wanderes dan AstonVilla,” beber Redknapp. The Lilywhites akan menyambangi markas Bolton besok malam, saat bersamaan Chelsea terlibat bigmatch dengan Newcastle United di Stamford Bridge. Hasil kedua laga itu nantinya sangat berpengaruh dalam perebutan tiket pendamping Manchester United dan Manchester City ke Liga Champions musim depan. “Saya pikir Chelsea tidak akan kehilangan banyak poin, tapi mereka masih akan bertemu Newcastle. Begitu juga dengan Newcastle, mereka masih harus melawan Everton dan Manchester City,” klaim Redknapp.


Peringkat ketiga Liga Premier bakal lolos langsung ke babak utama Liga Champions. Sedangkan peringkat empat terpaksa memulai langkahnya dari babak kualifikasi III. (m15/okz/sun)

72 67 65 57 56 56 53 49 45 42 41 40 38 37 35 34 34 33 33 31

Selasa, 1 April

Spurs Yakin Gusur Gunners Klasemen Liga Premier

membantu kami untuk sampai ke final Copa del Rey musim ini,” puji Pep. Setelah tersingkir dari Liga Champions dan hampir dipastikan gagal mempertahankan gelar La Liga, El Catalan masih berpeluang menjuarai Piala Raja Spanyol. Xavi Hernandez cs akan memainkan laga final melawan Athletic Bilbao pada 25 Mei 2012. “Kami akan mempersiapkan diri untuk mengakhiri musim ini dengan memenangi Copa del Rey untuk fans dan sebagai kado (perpisahan) bagi Guardiola,” tekad Pedro. (m15/goal/rtr/espn)

Klasemen La Liga Real Madrid Barcelona Valencia Malaga Levante Atletico Bilbao Osasuna Sevilla Mallorca Espanyol Getafe Sociedad Real Betis Vallecano Granada Villarreal Gijon Zaragoza Santander

35 29 4 2 112-30 91 35 26 6 3 104-26 84 35 15 10 10 54-43 55 35 16 7 12 51-47 55 35 15 7 13 51-48 52 35 13 10 12 49-44 49 35 12 12 11 49-46 48 35 11 15 9 39-55 48 35 12 10 13 41-42 46 35 12 10 13 39-42 46 35 12 9 14 44-49 45 35 12 9 14 39-48 45 35 11 10 14 44-50 43 35 12 7 16 42-51 43 35 12 4 19 50-67 40 35 11 6 18 32-52 39 35 8 14 13 36-49 38 35 9 7 19 38-64 34 35 9 7 19 31-60 34 35 4 14 17 24-56 26

Klasemen Liga Seri A

Irish Boleh Gauli WAGs

DUBLIN (Waspada): Tim nasional Republik Irlandia dibolehkan menggauli pasangan masing-masing selama penyelenggaraan Euro 2012 di Polandia-Ukraina, 8 Juni – 1 Juli mendatang. Namun menurut Giovanni Trapattoni, hubungan seks itu harus dilakukan sewajarnya. WAGs, sebutan bagi Istri atau kekasih sang pemain, juga tidak boleh menginap. “Saya menetapkan keputusan ini karena juga pernah menjadi pemain. Tapi, pasangan pemain tak bisa bermalam,” tutur Mr Trap melalui Irish Examiner, Senin (30/4). Kebijakan yang diberlakukan terhadap Robbie Keane dan kawan-kawan ini, beda sekali dengan beberapa konsentan Euro 2012 lainnya. Sebab bagi beberapa pelatih, hubungan seks saat kejuaraan bisa mengganggu fokus sekaligus menguras tenaga pemain. “Semuanya harus dilakukan secara proporsional, ini seperti makan. Jika Anda kebanyakan makan, Anda bisa mati juga karena kekenyangan,” tegas Trap. Bos The Green Boys itu menuturkan, kebijakan pembebasan seks itu diambil usai berdiskusi dengan


GELANDANG Barcelona Thiago Alcantara (kiri) merayakan golnya dengan menari bersama rekannya Daniel Alves di depan pendukung Rayo Vallecano di Teresa Rivera Stadium, Madrid, Minggu (30/4) dinihari WIB.

4-0 0-3 1-0 2-0 3-1 1-1 2-1


GAWANG Paris SG dibobol penyerang Lille Eden Hazard (tidak kelihatan) di Villeneuve d’Ascq Stadium, Senin (30/4) dinihari WIB.

Bukan Malam PSG PARIS (Waspada): Peluang Paris Saint Germain untuk menjuarai Ligue 1 musim ini mengalami kemunduran, Minggu (Senin WIB), setelah mereka dipecundangi LOSC Lille 2-1 di Villeneuve d’Ascq Stadium. Akibat kekalahan tandang tersebut, anak asuh Carlo Ancelotti tercecer lima angka di bawah pemimpin klasemen Montpellier, padahal Ligue 1 tinggal menyisakan tiga putaran lagi. Posisi peringkat dua pun makin rawan dipertahankan PSG, sebab juara bertahan Lille terus menempelnya dengan selisih dua angka saja. “Kini Lille dua poin di belakang kami, tapi gelar belum lepas dari kejaran kami,” dalih Ancelotti, sebagaimana diberitakan Goal, Senin (30/4). PSG sebenarnya sempat unggul lebih dahulu melalui gol Javier Pastore menit 48, namun itu bukan malam yang bagus bagi skuad Ancelotti. Kehilangan gelandang Mamadou Sakhou menit 70 akibat melakukan pelanggaran di kotak terlarang PSG, tim tamu kedodoran mengakhiri lagi. Hadiah penalti tim tuan rumah berhasil dimaksimalkan penyerang Eden Hazard untuk menyamakan kedudukan menit 71. Unggul jumlah pemain dimanfaatkan Lille untuk membalikkan skor lewat gol Nolan Roux menit 78. “Setelah kebobolan penalti dan Mamadou Sakho kena kartu merah, keadaan menjadi sulit. Saya kecewa. Kami kalah dalam laga penting yang sebenarnya kami kendalikan,” ratap Ancelotti. “Bukan malam yang bagus. Tapi kami harus melihat ke depan karena kompetisi belum selesai,” harap pelatih asal Italia berusia 52 tahun tersebut. (m15/goal/espn)

Selasa, 1 April


Liverpool vs Fulham 18:45 *MNCTV live pkl 01:45 WIB Stoke City vs Everton 18:45 *Global TV live pkl 01:45 WIB

Rabu, 2 April


Chelsea vs Newcastle 18:45 *Global TV live pkl 01:45 WIB Bolton vs Tottenham 19:00 *MNCTV live pkl 02:00 WIB


kans The Blues untuk menembus zona Liga Champions musim depan. “Di masa lalu saya merasa baik dan tajam, tapi saya tidak dapat mencetak gol. Kini saya

bisa mencetak gol, ini sangat penting bagi saya juga tim,” pungkas Torres, yang sempat mengalami kesulitan saat diboyong dari Liverpool dengan harga 50 juta pounds pada Ja-

nuari 2011. Kebangkitan striker Spanyol itu langsung mendapat pujian dari caretaker manajer Chelsea, Roberto Di Matteo. “Penyerang memang butuh untuk mencetak gol. Ini bagus, karena dia mencetak gol bagi kami,” ucap Di Matteo. “Dia (Torres) layak mendapatkan semua pujian. Dia telah bekerja keras dan gol yang ditunggu-tunggu tidak selalu datang, tetapi kami selalu senang dengan sikap dan etos kerjanya,” katanya lagi. (m15/okz/express)


WASPADA Selasa 1 Mei 2012

MEDAN (Waspada): Bekerjasama dengan jaringan main dealer di beberapa wilayah Indonesia, PT Astra Honda Motor (AHM) kembali menggelar balap motor Honda Racing Championship (HRC) sebagai salah satu upaya pembinaan pebalap berbendera Honda. Untuk kedua kalinya pula, CV Indako Trading Co, selaku main dealer Honda di Sumatera Utara, dipercayakan menggelarnya pada 6 Mei 2012. Ajang yang akan berlangsung di Sirkuit IMI Sumut Jl. Pancing Medan itu, hadir dengan konsep baru sekaligus siap menggemparkan Kota Medan. Demikian dikatakan Arifin Posmadi, General Manager CV Indako Trading Co, Senin (30/4). Arifin mengaku bangga pihaknya dipercaya lagi menggelar Honda Racing Championship, karena ajang itu akan memberikan pengaruh positif, khususnya bagi perkembangan olahraga balap di Sumut. Menurutnya, HRC 2012 berlangsung di sembilan kota besar

di Indonesia, yakni Cimahi (Jabar) sebagai seri pertama pada 25 Maret lalu, lantas Jakarta, Pati, Purwokerto, Kediri, Medan, Banjarbaru, Makassar, dan Denpasar. “Untuk Medan, ajang HRC kali ini akan mempertandingkan tujuh kelas balap, yakni MP1-Honda Bebek 125 cc Tune Up Seeded, MP2-Honda Bebek 110 cc Tune Up Seeded, MP3-Honda Bebek 125 cc Tune Up Pemula, MP4-Honda Blade 110 cc Tune Up Pemula, Honda Supra X 125 cc Standard Pemula, Honda Blade 110 cc Standard Pemula, dan Honda Matik 130 cc Standard Terbuka,” jelasnya. Tim-tim andalan Honda di Sumut dan Aceh yang bakal meramaikannya antara lain Honda Intrac, Kita-Kita Racing, Tomat Merah, Honda T7R, Honda Capella Racing Team, dan Honda Etawa. Mereka bakal menurunkan para pebalap berbakat seperti Eko ‘The Red’, Yogi Hermana, Martha Rezza, Jenius Simanjuntak, Zamet Pranata, Hambali, Fajar Fitriansyah, Safrianto Ilham, Dedi Satria, Memet T, Nova, dan masih banyak lagi.

Menurut Koordinator Timnas, Bob Hippy, pihaknya memberi batas waktu kepada pemain ISL untuk bergabung dengan timnas hingga 3 Mei 2012. Jika tidak juga segera memberi konfirmasi, para pemain ISL itu tidak akan diikutkan berlaga di Al-Nakbah International

Tournament di Palestina, 1323 Mei 2012 mendatang. “Setelah tanggal itu, kami akan fokus mempersiapkan tim dengan melakoni serangkaian ujicoba,” beber Bob di Kantor Menpora, Senin (30/4). Ditambahkan, setelah tanggal deadline yang diberikan ter-

sebut di atas, sudah ada beberapa klub akan menjadi lawan ujicoba bagi tim besutan pelatih Nil Maizar. Karena itu, kata Bob, tidak memungkinkan lagi bagi pelatih memasukkan nama baru mengingat persiapan sudah mepet. Pria yang juga anggota Komite Eksekutif (Exco) PSSI ini menjelaskan, tenggat waktu dari PSSI hanya berlaku pada turnamen di Palestina. Sedangkan untukeventlainyangakandiikuti, pemain ISL tetap bisa ikut. “Pintu bagi pemain-pemain ISL untuk membela timnas tetap terbuka. Karena itulah, kami

terus melakukan komunikasi dengan para pemain dan beberapa dari mereka sudah ada yang menyatakan keinginannya untuk bergabung,” kata Bob. Mengenai informasi yang menyebut adanya pemain ISL sudah siap membela timnas, Bob mengaku akan membeberkan sepulangnya dariYogyakarta untuk menyaksikan skuad Merah Putih senior berlatih. “Selasa saya akan bertolak keYogyakarta untuk memantau proses seleksi dan persiapan timnas senior. Siapa saja pemain ISL yang sudah bergabung akan saya sampaikan nanti sepulang

Lie Ci Pin, Promotion Manager CV Indako Trading Co, menambahkan bahwa pengunjung nantinya juga disuguhkan beragam kegiatan menarik dengan menampilkan bakat anak muda Kota Medan, seperti kompetisi One Heart Dance, cheerleaders, dan kompetisi Honda Girls Model. “Beragam games seru khas HRC juga menjadi daya tarik tersendiri bagi para pengunjung. Ini semua merupakan komitmen Honda untuk mencapai prestasi tertinggi di dunia balap, yang sudah semakin nyata,” ucap Ci Pin.

dariYogyakarta. Urusan masalah ini sepenuhnya kepada Pak Limbong (Bernhard Limbong),” beber Bob. Seperti disampaikan Manager Timnas, Ramadhan Pohan, saat bertemu wartawan beberapa hari lalu, lima pemain ISL siap bergabung di bawah asuhan Nil Maizar. Meski saat itu kelima pemain itu tidak dibeberkan identitasnya, belakangan mencuat nama-nama seperti Titus Bonai, Oktovianus Maniani dan tiga pemain Persisam Samarinda, M Roby, Fandi Mochtar, dan Djayusman Triasdi. (yuslan)

Menpora Siap Temui AFC JAKARTA (Waspada): Menteri Pemuda dan Olahraga, Andi Mallarangeng, mengaku siap menemui Task Force AFC, jika saja dirinya dimintai keterangan seputar masalah sepakbola nasional, terutama adanya dualisme kompetisi yang saat ini bergulir. Menurutnya, dengan menemui tim bentukan FIFA yang bertujuan untuk membantu menyelesaikan masalah di sepakbola Indonesia itu, dirinya berharap polemik yang terjadi segera berakhir. Karena itu, ia pun meminta agar semua pihak

mematuhi putuskan Task Force AFC. “Selaku pemerintah, saya siap melakukan apa pun demi kepentingan bangsa dan negara. Sebab imbas dari adanya ributribut seperti ini adalah timnas,” sebut Andi saat menggelar jumpa pers, Senin (30/4). Ditambahkan, pertemuan dengan Task Force AFC sudah sangat ditunggu pihaknya. Pasalnya, akan menjadi momentum untuk mendengar pendapat tim yang dipimpinWakil Presiden AFC HRH Pangeran Abdullah lbni Sultan Ahmad Shah,

Anggota Komite Eksekutif FIFA dan AFC Dato Worawi Makudi, Sekjen AFC Dato Alex Soosay serta Kepala Asosiasi Anggota dan Hubungan Internasional AFC James Johnson, terkait penyelesaian masalah sepakbola nasional. “Untuk urusan organisasi, sikap pemerintah cukup tegas. Yang diakui FIFA itulah yang juga kami akui. Karena saat ini kepengurusan Djohar Arifin Husin yang diakui, maka pemerintah pun hanya mengakui PSSI pimpinan Djohar,” sebut Andi sembari mengatakan fokus perhatian pemerintah adalah masalah dualisme kompetisi karena memengaruhi kekuatan timnas. Pada kesempatan yang sama, Djohar menegaskan Task Force AFC hanya menyelesaikan dualisme kompetisi, sedangkan urusan kepengurusan dianggap tidak ada masalah, karena cuma


SEMARAK balapan Honda Racing Championship hadir lagi di Medan, 6 Mei mendatang.

3 Mei Deadline Pemain ISL JAKARTA (Waspada): Tidak kunjung memberi konfirmasi kehadiran mengikuti proses seleksi timnas senior yang tengah berlangsung di Yogyakarta, membuat PSSI bertindak tegas dengan memberi deadline waktu kepada pemain dari kompetisi Indonesian Super League (ISL).

A11 Setelah melanjutkan penggunaan image One Heart dan Satu Hati pada tim Repsol Honda pada musim MotoGP 2012, tahun ini Honda melengkapi aktivitas balapnya dengan HRC 2012 yang dilaksanakan pertama kali pada 2003 silam. “Kami berharap gelaran akbar bertajuk ‘Where Champions Are Born’ ini dapat berjalan lancar, juga bermanfaat bagi generasi muda dan mampu melahirkan bakat-bakat baru untuk memajukan dunia balap motor,” ujar Leo Wijaya, Marketing Manager CV Indako Trading Co. (adv)

Husni Rebut Trofi Gus Irawan Kejurda Drag Race 2012 MEDAN (Waspada):Pebalap andalan tim MYB Kokomoto, RM Husni Iqbal, merebut trofi Gus Irawan setelah tampil sebagai juara umum Seri I Kejurda Drag Race 2012/Full Throttle Drag Racing 2012. Reza Fachri dari tim Caprindo merebut Piala Ketua Pengprov IMI Sumut setelah mencatat waktu 8.5 detik untuk menjuarai sekaligus memecahkan rekor kelas Best 2WD Non Turbo. Dalam balapan yang digelar klub Barspeed di lintasan Lanud Polonia Medan, akhir pekan lalu, Husni Iqbal mengoleksi total poin tertinggi 49. Husni menjuarai perlombaan di kelas 2.1.C (Sedan 1.501 s/d 1.700cc), A Karim (MYB) runnerup, ketiga J Sianipar (Nightmare), keempat Fritz Pardede (Caprindo), dan kelima Agha Novrian (Caprindo). Husni juga menyabet gelar juara kedua di kelas 3.2 (Sedan 1.501 s/d 1.700cc), mengatasi runner-up Roni S (Sebu), posisi ketiga Pontas S (70Team), keempat Iskandar M (Frontal), dan kelima Jhordy N (CWL). Persaingan di kelas FFA menempatkan Erik (18 Mobil) sebagai juara. Sebenarnya Erwin J

mencatat waktu lebih cepat di kelas ini, tapi dia hanya tampil sebagai peserta eksibisi karena tidak memakai rollbar. Runner-up Alfred dari tim Polo Mas Jakarta disusul Y Andrian (Sebu), A Karim, dan Roni S. Hasil gemilang juga ditunjukkan dragster andalan tim Sebu, Dorand, yang menyabet gelar juara di kelas 2.2, setelah mengatasi Y (runnerup), S Riyadhi, Deni WD, dan A Iryanta (Sebu). Dalam persaingan di kelas Jip Wrangler, Doran tampil sebagai juara dengan mengatasi Dwi RS (Sebu) dan Roni S. Ketua Panpel Seri I Kejurda, Edwin A Nasution didampingi Wakil Ketua Panpel Ahmad Syauqi dan Penasehat Panpel Aswin Hutajulu, menyatakan rasa gembira seri Kejurda yang didukung Chrysler Medan dan baru pertama di gelar tahun ini berjalan sukses. Turut hadir di acara penutupan, Ketua Umum KONI Medan Drs H Zulhifzi Lubis yang menyerahkan Piala Gus Irawan dan Elwin Siregar dari IMI Sumut. “Kejurda yang baru pertama digelar ini, juga mendapat sambutan antusias peserta, tercatat ada 206 starter berlomba,” sebut Edwin Nasution. (m47)

Voli Sumut Terlalu Tangguh Bagi Riau

Waspada/Yuslan Kisra

MENTERI Pemuda dan Olahraga, Andi Mallarangeng, dan Ketua Umum PSSI, Djohar Arifin Husin, memberi keterangan pers di Kantor Menpora, Senin (30/4). ada satu yang diakui AFC maupun FIFA. “Karena itulah, surat untuk pengelola breakaway league dari Task Force dikirim ke PSSI bukan kepada organisasi yang

tidak dikenal. Kita berharap masalah dualisme kompetisi segera berkahir, sehingga timnas kita bisa tampil dengan kekuatan penuh,” tutup Djohar penuh harap. (yuslan)

MEDAN (Waspada): Regu bola voli senior putra dan putri Sumatera Utara berhasil mengatasi perlawanan tim Riau dalam laga ujicoba akhir pekan lalu di GOR Lubukpakam, Kabupaten Deliserdang. Pada kategori putra, tim Sumut menang telak 3-1 atas tim Pelatda Riau yang sedang dipersiapkan menghadapi PON XVIII, September mendatang. Sumut yang dikoordinir Afituransyah, tampil menawan dan terlalu tangguh bagi tim lawan. Hasil sempurna juga diraih tim senior putri Sumut yang meraih kemenangan mencolok 31 atas tim Pelatda Riau. Kemenangan tim voli senior putra dan putri Sumut disambut gembira Kabid Binpres PBVSI Sumut, Elpian, serta pengurus lainnya. “Tim bola voli Sumut memang tidak lolos PON, tetapi kita harus menunjukkan kalau bola

voli Sumut masih salah satu terbaik di Sumatera. Hal itu akan kita buktikan di Liga Voli Sumatera di Jambi nanti,” ujar Elpian, Senin (30/4). Sayangnya, sukses tim senior tidak diikuti tim junior Sumut yang harus takluk dari regu PON Riau. Di bagian putra, Sumut takluk 1-3 dan tim putri menyerah 0-3. “Kekalahan tim junior kita lebih karena masih kurangnya pengalaman anak-anak dibanding tim Riau yang memang sudah matang dalam segala hal. Namun sebagai cikal-bakal tim Sumut di masa depan, anak-anak sudah menunjukkan perjuangan maksimal,” tambah Elpian. “Hasil ujicoba dengan tim Sumut ini akan kami jadikan bahan evaluasi untuk mempersiapkan tim lebih baik lagi sebelum tampil di PON. Kami ucapkan terima kasih kepada Sumut yang sudah menerima kami dengan baik,” ujar ofisial tim bola voli Riau, Rizal.(m42)

Munculkan Semangat Tiga Pilar PSDS Waspada/ist

TIM futsal Black Pearl FC meluapkan kegembiraan usai menjuarai turnamen futsal antarklub piala Danramil 08/Medan Johor-Amplas, Minggu (29/4) malam.

Black Pearl Juara Danramil 08 Cup MEDAN (Waspada): Tim futsal Black Pearl (BP) FC berhak memboyong trofi bergilir Danramil 08/Medan Johor-Amplas setelah menaklukkan BBM FS 3-2 di Lapangan De Futsal, Jl STM Medan, Minggu (29/4) malam. BBM FS, tampil sebagai tuan rumah, langsung menggebrak pertahanan lawan. Namun justru tim lawan lebih dulu mencetak gol lewat Braga. BBM menyamakan skor berkat gol M Rifki, namun BP FC membalik keadaan lewat gol Angga. M Rifki lalu mencetak gol penyeimbang sebelum akhirnya Braga memastikan kemenangan BP FC di penghujung laga. Turnamen yang digagas Danramil 08/Medan Johor-Amplas, Kapten Kav Azwar, itu diikuti 32 tim sejak Jumat (27/4) lalu dengan sistim gugur. Sebelumnya, partai perebutan posisi ketiga dimenangi Isori FC yang unggul atas Nejad FC 2-1. Selain trofi bergilir, BP FC juga bergak atas dana pembinaan Rp3 juta, sedangkan BBM FS memperoleh Rp2 juta dengan juara III Rp1 juta, dan juara IV Rp500 ribu. Pemain terbaik diraih Aseng (Isori FC) dan top skor disandang oleh Reza (BBM FS/7 gol). (m42)

Problem Catur


Putih melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2 8







1 A





HASIOLAN Sinaga. Nama yang lama mengental di jajaran pejabat eksekutif Deliserdang ini, saat pensiun dipercaya memimpin Persatuan Sepakbola Deliserdang Sekitarnya (PSDS). Suatu jabatan yang jelas merupakan pekerjaan tak ringan bagi mantan pejabat yang terkenal berbicara lepas dengan logat khas Tapanulinya ini. “Saya bukan muluk-muluk, namun pengapdosian tiga pilar pembangunan Pemkab Deliserdang menjadi strategi utama untuk mengembalikan masa-masa keemasan PSDS era 1960-an dan 1990-an saat Traktor Kuning bertengger di enam besar Divisi Utama, kompetisi paling bergengsi masa itu,” kenang Hasiolan baru-baru ini di Stadion Baharoeddin Siregar. Semangat Si Raja Batak -panggilan akrab Hasiolan- dengan strategi tiga pilar itu amat beralasan. Pasalnya, tim yang berdiri pada tahun 1958 ini bolak-balik mengalami prestasi pasang surut dan belum mampu merasakan gelar sekalipun. Apalagi pengurus PSDS sempat dinilai miring dengan hanya memanfaatkan PSDS untuk kepentingan pribadi dan kelompoknya. Catatan Waspada, tim yang mulai merumput di Divisi I pada 1962 ini mulai bertengger di empat besar Divisi Utama pada 1964. Namun selang setahun, mereka turun ke Divisi I. Mirisnya lagi, PSDS malah melorot ke Divisi II hingga 1984. Lalu 1985-1986




kembali naik Divisi I hingga bertahan dari 1987 hingga 2003 di pentas Divisi Utama. Nah, dalam kurun waktu 23 tahun itu, hanya pada tahun 1992, tim yang bermarkas di Stadion Baharoeddin Siregar ini mampu bertengger di enam besar Divisi Utama lewat asuhan pelatih H Nobon Kayamuddin dan Amri Tambunan selaku manajer. Lepas itu, prestasi PSDS kembali terseokseok plus alasan klasik ‘minus dana’ menjadi catatan panjang terpuruknya tim yang memiliki potensi kekayaan daerah yang berlimpah tersebut. Teranyar, tim yang terakhir berkutat di Divisi Utama musim 2005-2006 itu sempat terancam gagal mengikuti kompetisi Divisi I tahun lalu. “Saya sadar mengurus sepakbola ini pondasi utamanya harus menyingkirkan kepentingan pribadi dan kelompok. Jadi kebersamaan yang menjadikan sepakbola kita berbicara sekaligus, apalagi dengan keberadaan Bandara Internasional Kualanamu (BIK) nantinya. Intinya, PSDS harus sejajar dengan status internasionalnya Bandara Kualanamu,” pinta Hasiolan. Sadar akan penilaian miring selama ini, Hasiolan yang baru terpilih secara aklamasi menjadi Ketua Umum PSDS periode 20122016 mengingatkan semua pihak untuk kembali ke semangat kebersamaan dan keikhlasan yang merupakan ‘ruh’ PSDS. *Rizaldi Anwar



1. Paham (isme) yang membagi negara atas bagian-bagian berotonomi penuh mengenai urusan dalam negeri. 5. Singkatan Negara Sumatera Timur (terkait paham diatas). 7. Hak dan kewajiban daerah mengatur kepentingan daerahnya sendiri; Kepanjangan Otda (tulis tanpa spasi). 10. Singkatan Rancangan Undang-Undang. 11. Konglomerat (bahasa China populer). 12. Singkatan populer pemilihan umum; UU No.10 tahun 2008 dan yang baru sudah disahkan. 13. (Surat) izin. 14. Partai di Malaysia (singkatan). 16. Borgol. 17. Tempat duduk jabatan. 18. Kehormatan tertinggi yang dimiliki raja atau penguasa pada zaman pra-Islam. 20. Tidak mau bekerja sebagaimana biasanya. 22. Putusan hak Mahkamah Agung. 24. Kode signal dalam bahaya. 26. Tugas yang dirasakan orang sebagai suatu kewajiban. 27. Lapisan; Tingkat masyarakat dsb. 28. Persatuan; Ikatan. 29. Singkatan Internal Security Act. 31. Mencekoki doktrin tertentu secara mendalam hanya dari satu sisi.


KOMUNITAS pecinta sepeda onthel yang tergabung dalam Desa pose bersama usai merayakan HUT Desa ke-3, Minggu (29/4).

Olahraga Sepeda Kian Digemari Desa Rayakan HUT Ke-3 MEDAN (Waspada): Di tengah kemajuan teknologi transportasi, sepeda ternyata semakin digemari masyarakat. Meski saat ini sifatnya sekadar sarana olahraga, tidak tertutup kemungkinan ke depan sepeda kembali menjadi sarana transportasi favorit masyarakat. “Dewasa ini, olahraga sepeda semakin digemari masyarakat, utamanya sepeda antik yang kian banyak jumlahnya,” ujar Ketua Deli Sepeda Antik (Desa), Andi Syahbandi, di selasela acara HUT Desa ke-3 di Jl Bustamam Bandar Khalifah, Percut Seituan, Deliserdang, Minggu



1. Masa mengambang (Inggris populer, dua kata tanpa spasi). 2. Ilmu perbandingan politik mengenai sejarah, asal usul, perkembangan dan persebaran tata susunan politik pada masyarakat, terutama yang belum mengenal industri. 3. Usaha dan kegiatan yang meliputi penetapan tujuan dan cara-cara penyelenggaraan pemerintahan atau pembinaan organisasi. 4. Singkatan Masyarakat Ekonomi Eropa. 5. Jawaharlal ____, perdana menteri India pertama pernah datang ke Medan. 6. Penyajian data dalam bentuk tabel atau daftar untuk memudahkan pengamatan dan evaluasi. 8. Ketergantungan pada orang lain atau di bawah pengaruh negara lain. 9. Ketua; Pemimpin (dalam NU). 14. Bersifat praktis dan berguna bagi umum. 15. Negara adidaya (singkatan). 17. Perjanjian (keterikatan) untuk melakukan sesuatu. 19. Singkatan Kesatuan Aksi Mahasiswa Indonesia. 21. Wewenang. 23. Sudut pandangan. 25. Raja perempuan; Contoh. 30. Singkatan Sidang Istimewa.

(29/4). Dikatakan, meningkatnya minat masyarakat terhadap olahraga sepeda ditandai dengan makin menjamurnya komunitas pecinta olahraga sepeda di Sumut. Salah satunya, tambah Andi, adalah komunitas sepeda antik jenis onthel. “Anggota Desa sendiri setiap Minggu pagi rutin melakukan olahraga bersepeda. Selain menjadi sarana kebugaran tubuh, olahraga ini juga menjadi kegiatan rekreasi keliling kota atau pedesaan,” katanya menambahkan saat ini Desa memiliki 101 anggota. (m37)

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: mudah (**), bisa diselesaikan dalam waktu tak sampai tujuh menit. Jawabannya di halaman A2 kolom 1.

5 1 3 5 8 2 4 7 4 1

9 1 2 2 3 8 7 5 6




3 1 5 9 8 7 4 3

8 2 8 7 3 9 5 6 1 2 **230



WASPADA Selasa 1 Mei 2012

Titel Perdana Si Cantik STUTTGART, Jerman (Waspada): Petenis cantik, Maria Sharapova, akhirnya memenuhi ambisi meraih gelar juara perdana musim ini. Di final Porsche Terbuka yang digelar di Stuttgart, Senin (30/4), Sharapova mengalahkan Victoria Azarenka. AP


PETENIS Rusia, Maria Sharapova, tersenyum manis sambil memegang trofi dan hadiah mobil hasil menjuarai Porsche Terbuka di Stuttgart, Senin (30/4).

Nadal Rajanya Barcelona BARCELONA, Spanyol (Waspada): Rafael Nadal (foto) mencetak sejarah baru di pentas ATP Barcelona Terbuka. Peringkat dua dunia asal Spanyol ini mencatatkan diri sebagai petenis pertama yang mampu meraih tujuh gelar juara di era open. Nadal mentasbihkan diri menyabet titel ketujuh di panggung Barcelona Terbuka usai mengalahkan kompatriotnya, David Ferrer, Senin (30/4). Bermain di lapangan tanah liat yang juga favoritnya, Nadal meraih kemenangan 7-6 (1), 7-5. Gelar juara ini menjadikan Nadal sebagai petenis satu-satunya yang mampu meraih tujuh titel juara hanya dalam kurun delapan tahun. Gelar ini juga semakin mempertegas hegemoni The Spaniard di lapangan tanah liat. Sebelumnya, Nadal baru saja merebut gelar kedelapan secara beruntun di pentas Monte Carlo Masters. Ini merupakan gelar juara ke-34 yang direbut si kidal dari Negeri Matador dari 48 penampilannya di atas lapangan tanah liat. Berbicara soal pencapaian gemilangnya ini, Nadal merasa bangga. Meski begitu, Nadal mengakui bila gelar juara yang diraihnya kali ini didapat dengan susah payah. “Tak diragukan lagi, ini adalah salah satu pertandingan


Pelajaran Rossi JEREZ, Spanyol (Waspada): Juara dunia tujuh kali MotoGP, Valentino Rossi (foto), tidak merasa kecewa atas rapor merah yang didapatnya di MotoGP Spanyol, Minggu (29/4) malam. The Doctor menganggap hasil tersebut merupakan bekal positif untuk terus meningkatkan performa motornya. Selama sesi kualifikasi dan latihan bebas di Sirkuit Jerez, Rossi mencermati betul Ducati GP12 miliknya belum mencapai kecepatan ideal saat memasuki tikungan. Kendati masalah itu masih buntu, Rossi optimistis seri kedua kemarin member pelajaran berharga baginya dan tim. “Hal positif dalam balapan, bahwa saya berpikir itu mungkin membantu kami bisa melakukannya lebih baik lagi di seri selanjutnya, yang dimulai di MotoGP Portugal,” kata Rossi, Senin (30/4). “Dalam balapan, kami memakai settingan baru dan itu memberikan sinyal positif,” aku Rossi menyinggung upaya keras tim memperbaiki motornya mulai menemukan titik terang. “Saya harus membiasakan diri dengan gaya balapan sedikit berbeda dibanding dulu. Akibatnya, saya sering kehilangan keseimbangan di awal putaran karena pada dasarnya belum memahami saat memulainya,” lanjut The Doctor pun merasa penampilannya tidak di bawah standar pada MotoGP Spanyol tersebut. “Saya telah menemukan ritme, dalam artian saya pantas bertarung memperebutkan posisi enam melihat catatan waktunya dan saya sanggup memberikan tekanan sampai akhir,” tutupnya. (m33/auto)

tersulit sejak musim lapangan tanah liat dimulai. Saya rasa David (Ferrer) juga pantas memenangi gelar ini. Saya harap dia mendapatkan yang terbaik dalam kariernya,” tutur Nadal. Nadal mengakui dirinya sempat kerepotan menghadapi perlawanan Ferrer yang notabene rekan senegaranya. Secara jujur, petenis berusia 25 tahun ini bahkan mengatakan kemenangannya kali ini tak lepas dari

faktor keberuntungan. “David selalu memaksa Anda mengeluarkan kemampuan terbaik dan saya sedikit beruntung pada set pertama. Ketika menghadapi lima kali set point dan Anda mampu mematahkan semuanya, jelas faktor keberuntungan ada di dalamnya. Itu sama halnya seperti lotere di mana keberuntungan berada di pihak saya,” pungkas The King Of Clay itu. (m33/ap)

Dalam laga final, petenis Rusia itu terbilang lebih siap dibandingkan dengan Azarenka yang juga unggulan utama. Ditempatkan sebagai unggulan kedua, Masha menang dalam straight set 6-1, 6-4. Kemenangan ini sendiri menjadi gelar WTA pertama pada tahun ini yang diraih si cantik asal Negeri Beruang Merah itu. Terlebih, dirinya mampu membalaskan dendam kepada Azarenka usai dikalahkan di final Australia Terbuka dan Indian Wells. Dengan menyabet gelar Porsche Terbuka, Sharapova mengungkapkan kesenangannya. Pasalnya, ia mengaku bila dirinya telah menghadapi lawan-lawan yang cukup hebat di babak sebelumnya. AP

“Saya benar-benar sangat senang dapat memenangkan turnamen yang sangat sulit, karena harus berhadapan dengan lawan-lawan hebat. Saya juga menyayangkan Victoria (Azarenka) tidak bermain maksimal karena sedang cedera,” ungkapnya. Sharapova menuturkan bila ajang ini sendiri adalah pemanasan untuknya sebelum mengikuti Turnamen Prancis Terbuka di Roland Garros, 27 Mei mendatang. Tak hanya itu, gelar jawara ini juga menambahkan uang saku Masha senilai 115 ribu dolar AS dan sebuah mobil Porsche 911 Carrera berwarna putih. Sebaliknya, Azarenka sendiri benar-benar kecewa dengan kekalahan yang didapatnya dari Sharapova. Terlebih ini merupakan kekalahan kedua baginya tahun ini. Kendati begitu, ratu tenis dunia asal Belarus itu sendiri sadar kegagalannya dikarenakan cedera. “Sudah pasti saya tidak senang dengan raihan ini, namun saya ucapkan selamat untuk Maria (Sharapova). Ini akan tetap menjadi minggu yang baik bagi saya,” pungkas Azarenka yang selalu masuk final di setiap turnamen yang diikutinya tahun ini. (m33/ap)

CENTER LA Lakers, Andrew Bynum (kanan), berhasil memblok usaha Kenneth Faried bagi Denver Nuggets dalam game 1 NBA Playoff Wilayah Barat di Staples Center, Senin (30/4).

Prestasi Bynum Hadiah Lakers LOS ANGELES, AS (Waspada): Didukung dua bintangnya, LA Lakers meraih kemenangan 103-88 atas Denver Nuggets dalam game pembuka NBA playoff Wilayah Barat di Staples Center, Senin (30/4). Secara fantastis, Andrew Bynum tampil memukau dan memimpin timnya dengan cetakan 10 angka 13 rebound, dan 10 blok untuk mencatat triple-double pertama bagi Lakers di babak playoff dalam 21 tahun terakhir. Bintang Lakers terakhir yang mencetak triple-double adalah guard legendaris Magic Johnson pada Final NBA 1991. Bertanding di kandang, Bynum memang tampil nyaris tanpa catat. Bahkan sepanjang 38 menit bermain, center muda Lakers ini hanya melakukan satu foul. Namun, Kobe Bryant tetap menjadi pencetak angka terbanyak dengan raihan 31 poin di musim playoff ke-15 dari 16 tahun karier profesionalnya. Selain itu, koleksi 10 blok milik Bynum membuatnya mampu menyamai rekor milik pemain Utah Jazz, Mark Heaton (26 April 1985), dan

Hakeem Olajuwon (29 April 1990), sekaligus melewati rekor klub (9 blok) milik Kareem AbdulJabar. Di Memphis, LA Clippers membalikkan ketertinggalan 21 angka untuk meraih salah satu kemenangan terhebat sepanjang sejarah NBA Playoff. Dengan perjuangan gigih, Clippers menang 99-98 atas Grizzlies. Clippers sepertinya akan kalah telak saat tertinggal 64-85 di awal kuarter keempat. Namun, semangat Chris Paul cs berhasil membawa mereka mencetak 26 poin untuk berbalik unggul 97-96 sebelum akhirnya menang. Clippers pun menyamai rekor Boston Celtics saat membalikkan ketinggalan 21 poin saat melawan New Jersey Nets, 25 Mei 2002. Di Atlanta, kekalahan menjadi hasil akhir bagi Boston Celtics. Dijamu Hawks, Celtics terpaksa menelan kekalahan 74-83. Di partai lainnya, San Antonio Spurs terlalu tangguh bagi Utah Jazz yang tumbang 106-91. Kemenangan Spurs ditentukan oleh Tony Parker yang membukukan 28 angka dan delapan assist. (m33/ap)

Sumatera Utara

WASPADA Selasa 1 Mei 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:24 12:37 12:25 12:32 12:31 12:28 12:25 12:20 12:27 12:27

‘Ashar 15:43 15:55 15:44 15:50 15:50 15:48 15:44 15:40 15:46 15:45

Magrib 18:32 18:48 18:33 18:42 18:41 18:34 18:32 18:28 18:35 18:36



Shubuh Syuruq


19:43 19:59 19:44 19:53 19:52 19:44 19:43 19:39 19:46 19:47

04:46 05:57 04:47 04:52 04:52 04:53 04:48 04:43 04:50 04:48

04:56 05:07 04:57 05:02 05:02 05:03 04:58 04:53 05:00 04:58

L.Seumawe 12:30 L. Pakam 12:23 Sei Rampah12:22 Meulaboh 12:34 P.Sidimpuan12:22 P. Siantar 12:22 Balige 12:22 R. Prapat 12:19 Sabang 12:37 Pandan 12:24

06:14 06:25 06:14 06:20 06:20 06:20 06:15 06:11 06:17 06:15

Zhuhur ‘Ashar 15:48 15:42 15:41 15:53 15:42 15:42 15:42 15:39 15:55 15:44




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:40 18:31 18:31 18:43 18:27 18:30 18:29 18:26 18:48 18:30

19:51 19:42 19:42 19:54 19:38 19:41 19:40 19:36 19:59 19:40

04:50 04:46 04:44 04:56 04:47 04:46 04:46 04:43 04:56 04:48

05:00 04:56 04:54 05:06 04:57 04:56 04:56 04:53 05:06 04:58

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:24 12:26 12:35 12:28 12:25 12:32 12:20 12:31 12:24 12:23

18:30 18:33 18:45 18:35 18:33 18:41 18:27 18:38 18:30 18:30

19:40 19:43 19:56 19:45 19:43 19:51 19:38 19:48 19:40 19:41

04:50 04:50 04:57 04:53 04:48 04:54 04:44 04:54 04:49 04:46

05:00 05:00 05:07 05:03 04:58 05:04 04:54 05:04 04:59 04:56

Panyabungan 12:21 Teluk Dalam12:28 Salak 12:26 Limapuluh 12:22 Parapat 12:24 GunungTua 12:21 Sibuhuan 12:20 Lhoksukon 12:30 D.Sanggul 12:24 Kotapinang 12:19 AekKanopan 12:21

06:18 06:13 06:12 06:23 06:14 06:13 06:14 06:11 06:24 06:15

15:43 15:43 15:51 15:46 15:42 15:48 15:38 15:48 15:42 15:40

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Masyarakat Selayang Kejar Pelaku Curanmor BINJAI (Waspada): Puluhan warga Desa Selayang Baru, Kec. Selesai,Kab.Langkat,Minggu(29/4)malammengejardanmengepung pelaku pencurian sepedamotor Scorpion Z milik Sutris, warga Desa Situngkit, Kec.Wampu, ketika menghadiri undangan di Dusun Pulo I Desa Selayang Baru. Menurut Sutris, sepedamotornya BK 2421 SU, diparkir tak jauh dari tempat pesta. Ketika mau pulang ternyata sepedamotornya raib. Sutris menghubugi warga untuk membantu mencari sepedamotornya. Puluhan warga sampai Senin (30/4) dinihari berusaha mencari sampai ke tengah kebun sawit yang gelap dan becek, bersenjatakan golok dan batu menyisir pinggiran Sungai Wampu. Tapi tersangka tak juga ditemukan.(a04)

Ratusan VCD Bajakan Diamankan Polres Binjai BINJAI (Waspada): Sat Reskrim Polres Binjai, Senin (30/4), menyita ratusan kaset VCD bajakan dari Jalan Sudirman Kec. Binjai Kota, tepatnya di bawah Sky Cross Binjai. Petugas juga mengamankan pedagang VCD berinitial MM, 24, warga Jalan Setia Budi Kec. Binjai Utara. MM kepada wartawan menyebutkan, dia baru beberapa bulan menjual VCD bajakan, dan tidak tahu asal-usulnya. “Saya hanya pekerja, tidak tahu di mana toke mendapat kaset-kaset ini,” akunya. Pantauan wartawan di Polres Binjai, dari ratusan keping VCD yang disita polisi itu, terdapat kaset bergambar semi porno, dan film asal Jepang, Eropa. Kasat Reskrim Polres Binjai AKP Aris Fianto membenarkan diamankannya ratusan kaset tersebut bersama seorang pedagang. “Kita masih menyelidiki kasus ini. Diduga kaset tersebut sengaja digandakan,” ujar Aris.(a05)

Terima Telepon, Desi Tak Pulang BINJAI (Waspada): Rukiah, 50, warga Jalan Pradana, perumahan Berngam, Kec. Binjai Kota kehilangan putrinya Desi Trisna Sari, 17, yang sudah beberapa hari tak pulang setelah menerima telepon dari orang yang baru dikenalnya. “Apalagi yang harus saya buat,” tutur Rukiah dengan mata berkaca-kaca kepada wartawan, Minggu (29/4) siang di kediamannya. Menurut Rukiah, sebelum menghilangputrinyaitumenerima telepon dari seseorang.“Anak saya pernahcerita,iamenerima telepon dari pria yang ingin bertemu,” sebutnya. Setelah itu, Desi (foto) mengatakan akan menemui pria itu di dekat SMP. Malamnya dia pergi tanpa memberitahu keluarganya, dan sejak itu dia tak pulang. “Kami mencari sampai ke rumah temannya. Tapi tak satu pun temannya tahu keberadaan Desi, hingga akhirnya Tika, salah satu temannya mengatakan melihat dua laki-laki. Yang satu mengenakan helm, jaket coklat membawa sepedamotor Mio dan seorang lagi berbadan tinggi kurus menemui Desi,” katanya. “Tikamelihatlangsungdansempatberpapasandengankeduanya,” ujarnya sambil menambahkan, Desi memakai kaos putih, celana pendek coklat, sandal biru, kulit putih dan mata sipit. Rambut pirang sebahu. “Pulanglah anakku, ibu sangat rindu.”(a05)

Truk Cold Diesel Raib Dari Tempat Parkir P. BRANDAN (Waspada):Truk Cold Disel BK 8553 G milik Adinur, 33, warga lingkungan Pematang Panjang, Kel. Tangkahan Durian, Kec. Brandan Barat, raib dibawa maling dari lokasi parkir tak jauh dari rumahnya, Minggu (29/4). Hilangnya truk angkutan barang ini baru diketahui korban sekira pukul 07:00. Menurut keterangan, truk tidak ada lagi di lokasi doorsmeer milik Agus Susanto, 40 meter dari rumahnya. Kapolsek P. Brandan, AKP HM Kosim Sihombing dikonfirmasi Waspada, Senin (30/4), membenarkan pihaknya menerima pengaduan terkait pencurian truk. Menurut dia, kasus ini dalam proses penyelidikan.(a02)

Pengurus Ikadi Langkat Gelar Pelatihan Khatib STABAT (Waspada): Menyongsong Musda pertama Ikatan Dai Indonesia (Ikadi) Kab. Langkat, digelar pelatihan para khatib Shalat Jumat di Kec. Hinai, Salapian dan di Bahorok, bertempat di aula Kantor Camat masing-masing wilayah, Minggu (29/4). Menurut pengurus Ikadi Langkat, Salamuddin, jumlah peserta mencapai85orangdarikalangankhatibyangselamainimenghidupkan masjid. Sementara narasumber meliputi pengurus MUI Langkat, pengurus BKPRMI dan Kepala Kua. Kegiatan bertujuan agar para khatib mendapat pembekalan wawasan, lebih memahami ajaran Islam sesungguhnya, sekaligus membendung dan mencegah munculnya kembali ajaran sesat seperti berkembang di Kec. Kuala, belum lama ini.(a03)

Jangan Percaya Calo TKI STABAT (Waspada): JumlahTKI asal Kab. Langkat yang mengadu nasib di Malaysia pada 2011 menurun dibanding sebelumnya. Tahun 2011 hanya 633 orang sementara 2010 mencapai 1.144 orang. Penurunan tersebut menurut pihak Disnakertrans, pengaruh krisis ekonomi Eropa hingga berdampak berkurangnya permintaan tenaga kerja. Kadis Nakertrans Langkat, Saiful Abdi melalui Kasi Penempatan Dan Informasi Pasar Kerja, Ismail, mengatakan tahun ini jumlah TKI akan ditingkatkan mengingat informasi yang diperoleh kuota Sumut ke Malaysia sekitar 17.000 orang. ‘’Jumlah dari Langkat tidak akan dibatasi jika calon TKI bersangkutan memenuhi syarat,’’ kata Ismail, kemarin. Dikatakan, dilema saat ini masih ada calon TKI yang percaya kepada oknum calo dengan alasan proses administrasi hingga proses keberangkatan tidak sulit, padahal mereka tidak menyadari itu akan merugikan jika sewaktu-waktu terjadi kecelakaan kerja atau PHK di negara tempat mereka bekerja. Mengacu Peraturan KementerianTenaga Kerja DanTransmigrasi no. 23 tahun 2008, klaim asuransi TKI hanya berlaku di daerah asal pencari kerja. Bagi mereka yang memproses perjanjian penempatan dan rekomendasi paspor bukan dari daerah asal (Disnakertrans), akan mempersulit proses asuransi. Kerugian lain menggunakan jasa calo, lanjut Ismail, TKI yang legal berpeluang menjadi ilegal akibat tidak adanya pembekalan wawasan. Sebagai contoh jika TKI bekerja di negara tetangga dan berjumpa orang lain yang menawarkan gaji lebih besar, kemudian pindah tempat kerja, berpeluang menjadi TKI ilegal. Peluang itu tentu didasari sang majikan melapor kepada aparat penegak hukum atas dasar melanggar perjanjian, sementara paspor pencari kerja bersangkutan masih dipegang majikan pertama.(a03)


06:16 06:17 06:24 06:20 06:15 06:21 06:11 06:21 06:15 06:13

Zhuhur ‘Ashar 15:40 15:47 15:44 15:39 15:41 15:39 15:39 15:46 15:42 15:37 15:39




Shubuh Syuruq

18:26 18:33 18:33 18:29 18:30 18:26 18:26 18:39 18:31 18:25 18:27

19:36 19:43 19:43 19:39 19:41 19:37 19:36 19:50 19:41 19:35 19:38

04:47 04:55 04:51 04:45 04:48 04:46 04:47 04:52 04:49 04:44 04:45

04:57 05:05 05:01 04:55 04:58 04:56 04:57 05:02 04:59 04:54 04:55

06:14 06:21 06:17 06:12 06:15 06:13 06:13 06:19 06:16 06:11 06:12

Bagasi Lion Air Tak Aman PATUMBAK (Waspada): Bagasi perusahaan penerbangan Lion Air tak aman dan barang para penumpang angkutan udara itu rawan kehilangan. Ernila Puspa Sari, salah seorang penumpang pesawat Lion Air yang berangkat, Sabtu (28/ 4) dari Bali tujuan Medan, kepada Waspada, Senin (30/4) mengaku, pesawatyangditumpanginyadari Bali transit Jakarta dan tiba di Bandara Polonia Medan sekira pukul 17:45. Saat itu dia tidak menemukan tasnya. Menurut korban, tas miliknya bernomor seri bagasi 375 681 berisi pakaian dan beberapa

dokumen penting, hilang. Dia sempat menunggu beberapa jam, tapi barang tersebut tak juga muncul. Kejadian itu dilaporkannya kepihakLionAir,danjawabannya hanya, ‘akan dicek’. Bahkan setelah hampir 2 x 24 jam, dan sudah bolak-balik ditanya ke pihak Lion Air, namun kopernya tak juga ditemukan. “Mereka hanyamengatakansedangdicari,” kata warga Bali yang berkunjung

ke Patumbak, Deliserdang ini. Dia sangat berharap pihak Lion Air menemukan kopernya, karena sejumlah dokumen penting di dalamnya segera dibawa kembalikeBali,Selasa(1/5).“Pihak Lion Air harus bertanggungjawab,” tegasnya. Untuk menghindari kejadian sama yang memperburuk citra Lion Air, seharusnya pimpinan perusahaan jasa penerbangan itu menindaklanjuti masalah ini hinggatuntas.Bukanhanyamengganti kerugian kepada penumpang,sebabbilayanghilangadalah surat-surat penting seperti ini, pertanggungjawabannya bagaimana,tanyaErnilaPuspaSari.(c02)

Jelang May Day, Aliansi Buruh DS Galang Massa TANJUNGMORAWA (Waspada): Menjelang peringatan hari buruh 1 Mei, ratusan orang tergabung dalam aliansi buruh se Deliserdang menggalang massa guna memperingati hari buruh, Senin (30/4). Massa mengendarai sepedamotor dan pengeras suara men-

datangi perusahaan (pabrik) di Kawasan Industri Medan (KIM) StarTanjungmorawa di Jalinsum Medan-Lubukpakam, Km 19, Tanjungmorawa, Deliserdang. Sementara puluhan personel Samapta Polres Deliserdang dan Satpol PP,siagadilingkunganKIM Star.

Kordinator Bambang Hermanto menyebutkan, sosialisasi itu bertujuan untuk menggalang massa guna menggelar aksi peringatan hari buruh (May Day) pada Selasa (1/5), dengan titik kumpul di Lapangan Garuda, Tanjungmorawa.(c02)

Wali Kota Binjai Tinjau Gotong-royong BINJAI (Waspada):Wali Kota Binjai H. M. Idaham, SH, M.Si meninjau gotong-royong di Jalan Randu II Kel. Jati Utomo, Binjai Utara, baru-baru ini, diprakarsai Karang Taruna dan masyarakat. Wali Kota Binjai mengharapkan masyarakat mengadakan gotong-royong secara rutin, agar lingkunganterjagakebersihannya. Juga mengimbau untuk membuat tempat penampungan sampah, sehingga bisa diangkat petugas Dinas Kebersihan. Idaham menyebutkan, sampah tersebut menjadi sumber energi setelah Pemko Binjai menjalin kerjasama dengan investor dari Korea Selatan untuk pengelolaannya. Pada gotong-royong dihadiri tokoh masyarakat Pardio, Ketua Karang Taruna Kota Binjai Agus Supriantono,Wali Kota menjelaskan, Jalan Randu II akan diaspal dengan hotmix pada 2013. Jalan tersebut mempunyai fungsi

strategis sebagai jalan alternatif bagi masyarakat Kec. Binjai Utara menuju Medan. Wali Kota Binjai juga memerintahkan Camat Binjai Utara mengecekulangtandabataswilayah

Kec. Binjai Utara dengan Kab. Langkat dan Deliserdang, sesuai KeputusanMenteriDalamNegeri No.114tahun1992,berkoordinasi denganBagianTataPemerintahan Setda Kota Binjai.(a04)

Waspada/Riswan Rika

WALI KOTA HM Idaham meninjau gotong-royong di Jati Utomo.


TINGGINYA minat baca dibutuhkan tambahan dukungan sarana armada bus keliling untuk menjangkau masyarakat di kelurahan dan sekolah.

Perpustakaan Umum T. Tinggi Kekurangan Bus Keliling TEBINGTINGGI (Waspada): Minat membaca buku masyarakat melalui jasa bus keliling yang disediakan Kantor Badan Arsip dan Perpustakaan Pemko Tebingtinggi, belakangan ini meningkat. Duaunitbusyangada,nyaristakmampumelayani masyarakat di tiap kelurahan dan sekolah. Tingginya antusias masyarakat membaca hampir tak sebanding dengan sarana bus keliling yang ada. “Kita masih kekurangan sarana bus perpustakaankeliling,untukmenjangkaumasyarakat pembaca di kelurahan di pinggiran kota,” kata Kasi Pelayanan dan Kerjasama Perpustakaan Umum, Safaruddin, S.Sos saat ditemui, kemarin. Menurutnya, untuk menjangkau masyarakat pembacadikelurahandi5kecamatanKotaTebingtinggi, sudah seharusnya ada 5 bus perpustakaan keliling. Karena itu memerlukan perhatian khusus pemerintah guna menunjang tujuan pendidikan dalam mencerdaskan anak bangsa. Mobil perpustakaan keliling yang memiliki koleksi buku 4.293 eksemplar, hanya mampu menjangkau beberapa lokasi seperti kawasan

Kel. Pinang Mancung, Tanjung Marulak, Bulian, Karya Jaya di Kec. Bajenis, Padang Hulu dan Kec. Rambutan. Sebelumnya, Kakan Perpustakaan Umum, Hj. Nina Zahara menyampaikan, setiap hari tidak kurang dari 300 pengunjung baik dari dalam dan luar daerah yang gemar membaca berbagai jenis judul buku study di ruang perpustakaan lantai II. Dengandidukungfasilitassuasanayangnyaman, ruang berpendingin. Untuk konsumsi baca buku bagi masyarakat yangtinggaldipelosokkelurahan,sudahadabeberapa tempat taman bacaan (rumah baca), di antaranya diKel.BandarUtama,Persiakan,dantamanbacaan di Kel. Bagelen dengan koleksi buku baru atau best sealer yang akan dipajang di sana. Perpustakaan Umum Tebingtinggi telah memperoleh penghargaan pengelola Taman Bacaan Terbaik Tingkat Sumut di Kel. Bandar Utama tahun 2011. Awal 2012 kembali memperoleh penghargaan serta bantuan dari perusahaan Coca Cola Foundation (CCF). (a11)

Bermanasik Di Lokasi Pembangunan Masjid Dan Ponpes Tahfizul Quran DELISERDANG (Waspada): Kegiatan bimbingan manasik haji bagi jamaah calon haji (Calhaj) Majlis Ta’lim Jabal Noor Medan, Minggu (29/4), berbeda dengan sebelumnya. Pada manasik haji kali ini, seratusan jamaah Calhajmengikutibimbingandilokasipembanguan Masjid dan Pondok Pesantren (Ponpes) Tahfizul Quran Jabal Noor Jalan Sei Mencirim Gang Abadi, Desa Medan Krio, Kec. Sunggal, Deliserdang. Pimpinan Majlis Ta’lim Jabal Noor Medan Al-Ustadz KH Zulfiqar Hajar Lc sengaja mengajak jamaahCalhajnyamelihatlangsungkondisiterakhir pembangunan masjid dan Ponpes yang masih sekitar 40 persen. Hadir Al-Ustadz Drs H Nasrun Zakaria Ketua dan Sekretaris DPW LDII Sumut Ir H. Agus Purwanto dan M. Sofyan, ST serta Ketua LDII Medan, H. Hasoloan Simanjuntak, SH bersama unsur pengurus, H. Abdullah Mubarak. Acara diawali pembacaan ayat-ayat suci Al Quran oleh Qari Muhammad Syafi’I, S.Sos dengan pentausyiah Drs H. Amhar Nasution, MA dan

kata sambutan H. Agus Purwanto. Ditutup doa oleh Al-Ustadz H. Asfil Lc yang baru kembali dari Universitas Al-Azhar Kairo, Mesir. Acara diwarnai penyerahan Sembako kepada warga sekitar pembangunan masjid dan Ponpes. Walau duduk di kursi berlantaikan tanah timbun, namun tidak mengurangi rasa kebersamaan,ukhuwahdansilaturahmisesamajamaah Jabal Noor. Dalam acara itu terkumpul infak Rp95 juta, termasuk infak istri Wali Kota Medan, Hj. Yusra Siregar Rp20 juta dan dari hamba Allah, Rp50 juta. Milad Tazkira Sumut Al-Ustadz KH Zulfiqar Hajar berharap jamaah Jabal Noor beramai-ramai menghadiri Milad (HUT) ke-8 Majelis Zikir Tazkira Sumut pimpinan KH Amiruddin MS pada Minggu, 13 Mei di Masjid Agung Medan pukul 08.00. Dalam Milad akan hadir pentausyiah mantan Menteri Agama RI, Prof Dr H. Said Agil Al-Munawwar, MA dengan Qari Internasional Dr H. YusnarYusuf Rangkuti, MA, MS asal Sumut.(irh)

TEBINGTINGGI (Waspada): Parkir kenderaan yang aman dari pencurian dan perusakan, salah satu standard pelayanan minimum di satuan kerja perangkat daerah (SKPD) yang melayani urusan publik. Kondisi demikian merupakan citra pemerintah di hadapan publik. Karena jika kenderaan yang diparkir di halaman SKPD tidak aman, berakibat terjadinya keluhan terhadap instansi pengelola layanan publik. Hal itu ditegaskan Wali Kota Tebingtinggi Ir. H. Umar Zunaidi Hasibuan, MM, Selasa (24/4), saat memberi pengarahan di acara ‘Bimbingan TeknisStandardPelayananMinimaldiLingkungan Pemko Tebingtinggi,’ di aula TC Sosial. Dikatakan, selain parkir aman, staf di front terdepan kantor pemerintahan, merupakan ujung tombak pelayanan. PNS yang pertama kali menerima warga mengurus sesuatu, merupakan citra pemerintah. “Jika PNS itu bermuka masam, suka marah-marah atau bertele-tele, maka akan ter-

bentuk citra buruk dipikiran warga,” ujarWali Kota. Karena itu, Umar Z. Hasibuan, minta seluruh anakbuahnyalangsungmelayanimasyarakat,membuat standard pelayanan minimal terhadap warga denganskemaalurpengurusanyangharusditempuh warga dalam mengurus suatu keperluan di SKPD. Prosedur yang harus ditempuh, yakni persyaratan harus tertulis, tegas dan jelas. Petugas harus menguasai apa yang ditanyakan warga. Disiplin dan tanggungjawab petugas harus dijalankan. Memiliki kompetensi dalam melayani, adil terhadap warga dan mendahulukan yang lebih duluan. Cepat dan sopan dalam melayani serta memiliki jangka waktu yang pasti kapan urusan bisa selesai. “Yang paling penting biaya pengurusan harus jelas agar warga tidak merasa ditipu,” himbau Wali Kota. Bimtek SPM Pemko Tebingtinggi, diikuti 40 peserta dari seluruh SKPD yang ada. Berlangsung 24-26April2012,dilaksanakanBadanKepegawaian, Pendidikan dan Pelatihan (BKPP).(a09)

Komitmen Ditpolair Poldasu Tekan Kejahatan Dan Pelanggaran Hukum Parkir Aman, Standard Pelayanan Minimum SKPD

TANJUNGBERINGIN (Waspada):Dalamupayamenciptakan keamanan dan rasa nyaman, Direktorat Kepolisian Perairan Kepolisian Daerah Sumatera Utara (Dirpolair Poldasu) tetap berkomitmen meningkatkan penekanan berbagai tindak kejahatan serta pelanggaran hukum lainnyadiwilayahperairanSumut. Demikian ditegaskan Dirpolair Poldasu, Kombes Ario Gatut Kristianto didampingi Kasi Patwal, Kompol GM Sihombing, Kasi Sar Binmas, Kompol Rivolkhair, Wakapolres Sergai KompolZahrie,KasatpolairPolres Sergai Iptu Bakharuddin, saat kunjungan kerja ke Mapolair Polres Sergai, Selasa (24/4) di

Dusun I, DesaTebingTinggi, Kec. Tanjung Beringin, Kab. Sergai, “Seperti dalam upaya penekanantindakperompakandilaut, Dirpolair Poldasu terus meningkatkan patroli dengan metode patroli mobile di daerah rawan, termasuk menempatkan personel di kapal-kapal nelayan yang akan melaut. Kemudian mengingat kejahatan di laut berawal dari darat dan berakhir di darat, pihak kita juga meningkatkan jumlah personel Intel di darat dengan membentuk anggota penyelidikan di bawah komando Kasi Lidik berpangkat Kompol,” ungkap Ario Gatut. Diakui Ario Gatut, kesulitan pengungkapan perampokan di

laut sering terkendala, karena korban baru melapor setelah beberapa hari kejadian, diperparah minimnya saksi. Terkait pelarangan alat tangkap nelayan, lanjut Ario Gatut, ada delapan alat tangkap salah satunya pukat trawl. Berdasarkan Permen no. 5 tahun 2012, merujuk Permen no. 02 tentang pelarangan,pelaksanaanyaditundasatu tahun sampai 2013, hingga ada pemberitahuan. KunkerDirpolairPoldasudan rombonganmenggunakanKapal Pol II.2001 dengan Komandan Kapal, Bripka Asep, diakhiri pertemuan masyarakat pesisir dannelayanKec.TanjungBeringin di Mako Polair Polres Sergai.(c03)

Mendagri RI Gamawan Fauzi:

Dengan Otda, Pelayanan Masyarakat Lebih Baik, Mudah, Cepat, Murah

Waspada/Edi Saputra

DIRPOLAIR Poldasu, Kombes Ario Gatut Kristianto (dua dari kanan) didampingi Kasi Patwal, Kompol GM Sihombing, Kasi Sar Binmas, Kompol Rivolkhair, Wakapolres Sergai, Kompol Zahrie, Kasatpolair Polres Sergai, Iptu Bakharuddin kunker ke Mako Polair Polres Sergai.

SEI RAMPAH (Waspada): Dalam upaya mewujudkan kualitas kinerja penyelenggaraan pemerintahan daerah (pemda) yang profesional secara efektif dan efisien dalam kerangka otonomi daerah, diminta seluruh jajaran pemerintahan pusat maupun daerah merefleksikan dan memperkokoh tanggungjawab serta kesadaran bersama atas amanah mau pun tugas untuk menjadikan daerah lebih mandiri, maju dan sejahtera dalam kerangka Negara Kesatuan Republik Indonesia (NKRI). Hal ini diungkapkan Menteri Dalam Negeri (Mendagri) Gamawan Fauzi, dalam sambutan tertulis dibacakan Bupati Serdang Bedagai (Sergai), Ir. HT. Erry Nuradi, M.Si pada peringatan Hari Otonomi Daerah (Otda) XVI tingkat Kab. Sergai di halaman kantor Bupati di Sei Rampah. Peringatan Hari Otda XVI dihadiri unsur

Forum Koordinasi Pimpinan Daerah (FKPD) Sergai, Wabup Ir. H. Soekirman, Sekdakab Drs. H. Haris Fadillah M.Si, para Staf Ahli Bupati dan Asisten, para Kepala SKPD, Camat se Sergai dan ratusan PNS Pemkab Sergai. Dengan dilaksanakannya otonomi daerah, menempatkan Pemda sebagai ujung tombak pembangunannasionalsehinggauntukmenghasilkan dampak positif dalam pertumbuhan ekonomi daerahyangmakinmeratasertatingkatkemiskinan mau pun angka pengangguran yang makin menurun, jelas Gamawan Fauzi. Mengakhiri sambutannya, Mendagri menegaskan otonomi daerah agar selalu diisi kegiatan dalam peningkatan kinerja penyelenggaraan pemda, berorientasi pada pelayanan masyarakat guna mewujudkan kemajuan daerah dan kesejahteraan rakyat.(a08)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Kajari Kisaran Naikkan Semua Kasus Batubara LIMAPULUH (Waspada): Kepala Kejaksaan Negeri (Kajari) Kisaran, A Tarigan menegaskan, semua kasus yang telah masuk dari Kab. Batubara segera dinaikkan. Kasus itu berkisar pada pembangunan RSUD, Badan Pemberdayaan Perempuan Anak dan KB (BP2KB), Sekretariat Dewan dan Pengangkatan tenaga honorer. Saat ditemui di ruang kerjanya, Senin (30/4), A Tarigan, yang didampingi Kasi Intel R. Parhusip, Juru Bicara LEM-BB Arsyad Nainggolan dan Kordinator Formitrasu Kamaluddin HR menjelaskan, dalam mengajukan kasus tindak pidana korupsi, pihaknya mendalami betul laporan yang diterima. Sehingga, saat diajukan ke pengadilan tidak ada lagi yang meragukan. “Sampai saat ini kami memeriksa sejumlah pejabat dan pegawai yang bertugas di Dinas Kesehatan, Sekretarian DPRD Batubara, BP2AKB dan PNS yang terkait dengan pengangkatan honorer menjadi PNS,” kata Parhusip. Namun Parhusip mengatakan, selain kasus RSUD ditangani oleh seksi Pidsus, dia tidak dapat memberikan informasi berapa orang yang telah diperiksa. Kasus yang ditangani pidsus adalah, BP2AKBterkaitdugaanpemotonganhonorPetugasPenyuluhKeluarga Berencana Desa (PPKBD), Sekretariat Dewan dan tenaga honorer yang diangkat menjadi PNS. Sementarakasus pembangunan RSUD, menurut Parhusip, panitia pelaksana tender di Dinkes Batubara sudah diperiksa, yang jumlahnya enam orang. Namun pejabat yang dipanggil itu statusnya masih belum ditetapkan karena kasus ini masih pengumpulan bahan keterangan. Kordinator Formitrasu dan Juru bicara LEM-BB menyatakan, kasus RSUD dan BP2AKB ini benar - benar merugikan masyarakat. “Kasus dugaan pemotongan honor PPKBD itu adalah kebiadaban, begitu juga pembangunan RSUD yang menelan biaya besar namun meragukan, khususnya pengadaan alkes,” kata Arsyad.(c05)

WASPADA Selasa 1 Mei 2012

Kebakaran Di T. Tiram Satu Tewas, Dua Luka TANJUNGTIRAM (Waspada): Saat listrik padam dua rumah ludes terbakar dan dua lainnya dirusak. Kebakaran yang menimpa rumah penduduk di Dusun IV Desa Bagandalam. Tanjungtiram. Batubara, Minggu (29/4) malam itu, menelan korban jiwa satu orang terpanggang, satu kritis, dan dua luka bakar saat terjadi kebakaran. Korban tewas Rafika Suri, siswa MTs kelas II, kakak korban Puput siswa Madrasah Aliyah mengalami luka bakar kritis, dan abangnya Zaki dibawa ke RSU Kisaran.Ibukorban,Dewijugamenderita luka bakar bagian tangan. Kebakaran terjadi ketka hujan turun sekira pukul 20:00 saat listrik padam, diduga akibat kelalaian korban menyimpan

bensin di dalam rumah. Korbaran api dengan cepat menjilat rumah jiran melalap rumah Rusli, IlahdanAbdullah.Usaikebakaran baru ditemui korban Rafika Suri tewas terpanggang, sedangkan Puput,Zaki,IbuDewidapatdiselamatkandandibawakeRSUKisaran. Ribuan warga datang menjenguk sekaligus mengantar korbanRafikakepekuburankeluarga

di Limalaras. Tampak hadir Sekdakab Batubara Erwin, Ketua TP-PKK Hj. Chodijah Arya Zulkarnain, Kadissos Aladin, Camat Tanjungtiram Nasir Yuhanan, CamatTalawiA.L.Luhftisekaligus memberi bantuan berupa 45 kepingsenguntukrumahkorban, korban meninggal Rp1 juta, dan tiga korban lain Rp500 ribu/ rumah. Camat Tanjungtiram Nasir Yuhanan, Senin (30/4) mengatakan, selain bantuan, Pemkab diberikan Sekdakab Erwin, juga Ketua TP-PKK Hj. Chodijah Arya memberikan sejumlah uang, dan pihak kecamatan memberikan bantuan 1 goni beras dan 1 kotak mie instan kepada ke empat korban yang rumahnya terbakar. (a12/a13)

Bupati Asahan Lantik 19 Pejabat Eselon II Dan III KISARAN (Waspada): Bupati Asahan Drs. H. Taufan Gama Simatupang MAP kembali mengadakan mutasi 19 pejabat struktural lingkungan Pemerintahan Kabupaten Asahan, Senin (30/4) di Aula Melatim, kantor Bupati Asahan. Adapun pejabat yang dimutasi yakni Drs. Ismail menjabat Kepala Dinas Pendidikan menggantikanDrs.ZainalAripinSinaga, MH yang menduduki posisi baru sebagai Kepala Dinas Pemuda, Olahraga, Kebudayaan dan Pariwisata, HM. Syafei, S.Sos yang sebelum Kadisporabudpar menjadi Staf Ahli Bupati bidang Kemasyarakatan dan SDM. Kemudian pejabat eselon III yangdilantikRuslan,SHmenjabat Camat Air Joman, Drs. Ahmad

NasirSiregarmenjadiCamatSilau Laut.Mahmudiyangsebelumnya SekcamAirbatupromosimenjadi Pj Camat Rahuning. Darwinsyah Lubis, S.STP menduduki posisi Pj Camat Airbatu, Sofyan Manulang menjabat Pj Camat Sei Dadap, Sunardi, S.Sos menjadi Camat Pulo Bandring. Sedangkan Drs. Armansyah dilantik menjadi Pj Camat Setia Janji, Syahputra, SE yang sebelumnya menjabat Sekcam Pulau Rakyat promosi menjadi Pj Camat Teluk Dalam mengganti M. Ajim, SE yang menduduki jabatan baru sebagai Camat Kota Kisaran Barat. Sri Humiatsih, SE yang sebelumnya Camat Kota Kisaran Barat dan satu-satunya camat perempuan Kab. Asahan dilantik

menjadi Kabid Pemberdayaan Perempuan dan Perlindungan Anak pada BPP dan KB Kab. Asahan. Drs. Budi Anshari, M.Si menjabat Sekretaris pada Dinas Perikanan dan Kelautan, serta drg. Leli Mughaini menduduki jabatan Sekretaris pada Diskes Kab. Asahan. Taufan dalam sambutannya berharap kepada pejabat yang baru dilantik dapat mengguasai dengan sungguh-sungguh fungsi dan tugas karena jabatan tersebut merupakan ujung tombak keberhasilanPemkabAsahansesuai tuntutan masyarakat. Hadir dalam acara tersebutWabup H. Surya, BSc, Sekda, para asisten, staf ahli,parakadis,kaban,kakan,camat dan undangan lainnya. (a31)

Lima Balon Direktur Poltan Sampaikan Visi Misi TANJUNGBALAI (Waspada): Sebanyaklimabakalcalon(Balon) Direktur PoliteknikTanjungbalai menyampaikan visi dan misi dalam Sidang Senat Terbuka di aula I kantor Wali Kota, Kel. Sijambi, Kec. Datukbandar, Senin (30/4). Kelima bakal calon itu, Abdurrahman, ST, MT dari PoliteknikNegeriMedan,Ir.AlfianHamsi, MScdariUSU,Ir.HasbullahPanggabean, MT dari Pendidikan Teknologi Kimia Industri Medan (PTKI), Nuraswara Putra, ST, MT dari Politeknik Negeri Medan dan

Ir. Syahrul, MS dari Universitas Riau. Penyampaian visi misi dan program kerja bakal calon itu, menghadirkan empat panelis, yaitu pengurus Yayasan Poltan, DPRD, mantan Direktur Politeknik Negeri Medan Ir. Zilkifli Lubis, MIKom danDirekturPDAMTirta Kualo Zaharuddin. “Inipertamakalidilaksanakan penjaringan dan pemilihan Direktur PoliteknikTanjungbalai periode 2012-2016 lewat mekanisme pemilihan Senat Politeknik Tanjungbalai,” terang Ketua

Komisi Penjaringan dan Pemilihan Direktur PoliteknikTanjungbalai periode 2012-2016 M. Fajrin Pane, didampingi Sekretaris M. Fuad Parinduri. Menurut Fajrin, penjaringan dan pemilihan itu dilakukan melalui mekanisme pemilihan Senat Politeknik Tanjungbalai. “Masa jabatan Ir. Tengku Tibri, MT akan berakhir pada Mei 2012, maka akan dilaksanakan pemilihan sesuai dengan Statuta bahwa masa jabatan Direktur Politeknik Tanjungbalaiadalah4tahun,”jelas Fajrin. (a14)

Pemkab L.Batu Rencanakan Penambahan Lahan TPA RANTAUPRAPAT (Waspada): Dinas Pasar Dan Kebersihan Kab. Labuhanbatu merencanakan pembelian lahan seluas 4,5 hektar untuk penambahan tempat pembuangan akhir (TPA) sampah di Desa Pulo Padang, Kec. Bilah Barat. Sekretaris Dinas Pasar Dan Kebersihan, Kamal Ilham menyampaikan itu kepada wartawan, Jumat (27/4) di ruang kerjanya. “Kami telah meninjau lahan seluas 4,5 hektar yang akan direncanakanuntukdibelipemkabsebagaiTPA sampah milik warga yang ditawarkan seharga Rp750 juta. HarapankamiDPRDbisamenyetujuipembelianlahanitu,”katanya. Dia menjelaskan, rencana penggunaan lahan masyarakat yang bakal dibeli pemkab untuk dijadikanTPA tersebut juga sudah mendapat restu dari warga sekitar. Sebab, setelah peninjauan

dilakukan,pihakDispaskebL.Batu sudahterlebihdahulumelakukan pendekatan kepada masyarakat setempat. “Sekarang tinggal menunggurestuanggotaDPRD.Kalau merekasetujulokasiitusudahsangat strategis dijadikan sebagai TPA,” tutur mantan Kepala Puskesmas Kec. Pangkatan tersebut. Dia menambahkan, meski rencana pembelian lahan itu berlangsung, pihaknya tetap berharap PTPN3 dapat memperpanjang izin penggunaan TPA sampah yang berada di lahan PTPN3 di Lingkungan Perlayuan yang selama ini masih digunakan sebagai tempat pembuangan sampah Pemkab L.Batu. “Kami juga sudah mengajukan surat permohonan perpanjangan izin penggunaan lahan PTPN3 sebagai lokasi TPA. Surat itu ditandangani langsung oleh Bupati dr H Tigor Panusunan

Siregar SpPD dan ditembuskan ke kantor direksi di Medan. Sementara anggota DPRD L.Batu H Irwasyah Ritonga S Pd I, M Hum mengatakan, pihaknya setujudenganpenambahanlahan TPA tersebut, asalkan digunakan untuk kemaslahatan masyarakat di L.Batu.“Kami dukung rencana itu dan bisa mereka ajukan anggarannya di Perubahan–APBD 2012 untuk dibahas digedung dewan,” ungkapnya. Namun dia berharap, sebelum penetapan lahan yang direncanakan untuk dibeli pemerintah daerah itu, harus terlebih dahulu dilakukan kajianagarnantitidakberdampak buruk kepada masyarakat sekitar TPA yang bakal dibeli itu. “Harapan kita nanti kalau ada TPA yang baru dibeli, persoalan sampah bisa diselesaikan dan tidak berserakan lagi di ruas jalan,” tandasnya. (a18)

Penderita Gizi Buruk Ditemukan Di Asahan KISARAN (Waspada): Balita penderita gizi buruk ditemukan lagi di Asahan, dan kini masih menjalani perawatan intensif di RSUD Kisaran. Informasi dihimpun, korban Indra,1,4 bulan, putra pertama pasangan Asna, 25, dan Juli, 27, warga Titi Payug, Bangan Asahan, Kec. Tanjungbalai, menderita demam, batuk serta diare selama

kurang lebih delapan bulan, sehingga berat badannya hanya 5,1 kg. Kini anak malang tersebut dirawat di RSUD Kisaran dengan menghandalkansuratketerangan tak mampu untuk mendapat perawatan. “Anak saya sudah sakit delapan bulan lalu, dua minggu terakhir bertambah parah mengakibatkan tubuhnya lemah, se-


INDRA terbaring lemah mendapat mendapat perawatan intensif di RSUD Kisaran karena menderita gizi buruk.

hingga dirujuk ke RSUD Kisaran untuk menjalani perawatan medis,” ujar ibu korban, Asna, ditemui Waspada, Sabtu (28/4). Menurutnya sewaktu anaknya lahir dalam keadaan normal dengan berattigakilogram,diberiASIselama tiga bulan serta imunisasi, namun selanjutnya diberi susu dan makanan kemasan untuk bayi. “Saya tidak tahu apa penyebab anak saya menjadi sakit, padahal saya selalu membawanya ke bidan desa untuk berobat,” ujar Asna, yang mengaku telah pisah dengan suaminya. Bupati AsahanTaufan Gama Simatupang, melalui Kadis Kesehatan dr. Herwanto. Sp.B dikonfirmasi, Minggu (29/4), menuturkan pihaknya masih mendalami masalah itu. Gizi buruk yang menyerang balita, menurutnya sebagian besar pada kalangan keluarga prasejahtera dan minim pengetahuan kesehatan dalam perawatan bayi. “Kita telah menyebar posyandu dan bidan desa di wilayah Asahan. Diharapkan masyarakat selaluberkonsultasiterkaitkesehatananaknyakepadapetugaskesehatan yang ada di desa, sehingga gizi buruk bisa dihindarkan sedini mungkin,” ujar Herwanto.(a15)

Waspada/ Syahri Ilham Siahaan

BUPATI Labura H Kharuddin Syah, mencoba kendaraan hasil karya siswa SMK AW Marbau, pada acara pameran Pendidikan dan Porseni.

Bupati Labura Buka Pameran Dan Porseni AEKKANOPAN (Waspada): Bupati Labuhanbatu Utara (Labura) H. Kharuddin Syah, SE membuka pameran Pendidikan dan Porseni di lapangan sepakbola Aekkota Batu, Kec. Na IX X, Senin (30/4). Kegiatan tiga hari itu memamerkan hasil karya dari berbagai sekolah. Hadir pada kegiatan itu, Kadisdik Labura H. Ridwan Rambe, MPd, Kadis Pendapatan Ahmad Fuad,KadisSosialdanTenagaKerjaAsrilManurung, S.Sos,Kadis Dukcapil H Bahman, Camat Na IX - X S Sormin, Kabag Humas Syahrul Adnan Hasibuan, SE serta beberapa SKPD yang lain. H. Kharuddin Syah mengatakan, kegiatan Porseni dan Pameran Pendidikan dapat dijadikan sarana pencarian bakat anak di bidang seni, olah raga maupun prestasi akademik. Karena bakat yang ada pada anak tidak akan berkembang kalau tidakdiberikansaranuntukmengaktualisasikannya. Menurut pria yang akrab disapa H. Buyung itu, kegiatan seperti ini harus dilaksanakan secara

kontinyu dikelola dengan baik dalam rekrutmen, seleksi maupun penilaiannya, jangan sampai ada kecurangan kecurangan yang dapat mencederai prestasi yang ditorehkan”. “Saya yakin suatu kelak akan muncul atlit atlit Labura di Even Regional, Nasional bahkan Internasional. Semua itu bisa kita capai dan pasti kita raih, kalau kita bina dengan sungguh sungguh terus menerus dengan kejujuran dan kebersamaan,” kata H Buyung. Kepala Dinas Pendidikan H Ridwan Rambe menjelaskan, kegiatan pameran Pendidikan dan Porseni berlangsung 30 April sampai 2 Mei 2012, mempunyai dua sasaran pokok yakni sasaran eksternalkepadamasyarakatdansasarankedalam tubuh Dinas Pendidikan sendiri. Kegiatan tersebut diikuti semua sekolah yang ada di Labura, serta menampilkan 11 stand pameran, tujuh cabang olah raga serta 10 jenis seni yang diperlombakan. (c08)

Mabuk Tuak, Tiga Pelajar Keroyok Ibrahim TANJUNGBALAI (Waspada): Tiga pelajar diduga mabuk tuak, melakukan pengeroyokan terhadap teman satu meja Ibrahim Nasution mengakibatkan daun telinga nyaris putus disayat pisau, Senin (30/1) sekira pukul 01.00. Kasus penganiayaan secara bersama-sama itu kini ditangani Polsek Datukbandar, Polres Tanjungbalai. Sementara ketiga pelaku masih lidik berinisial HS, 14, pelajar Sekolah Dasar (SD), dan Ri, 17, murid salah satu SMA, keduanya penduduk JalanArteri,Gg.Jati,Kel.Sirantau,Kec.Datukbandar, Kota Tanjungbalai. Kemudian pelaku lainnya Le, 16, juga siswa salah satu SMA, warga Kel. Pasarbaru, Kec. Seitualang Raso, Kota Tanjungbalai. Informasi dihimpun Waspada, kejadian berawal saat korban bersama ketiga tersangka minum tuak di salah satu pakter (warung) di Jalan Arteri. Mereka diduga telah banyak menenggak minuman mengandung alkohol dengan diiringi gelak tawa dan nyanyian. Disaatkondisimabukitu,satudariketigapelaku, yakni Le merasa tersinggung atas nyanyian dan tarian korban dan langsung terjadi perang mulut. Tidak cukup sampai di situ, terjadilah perkelahian tigalawansatuyangtidakseimbangmengakibatkan daun telinga korban nyaris putus disayat pisau. “Pas kejadian, HS memeluk Ibrahim dari belakang, terus kedua temannya leluasa memukul dan melukai telinga sebelah kanan pakai pisau

hingga nyaris putus,” ungkap seorang saksi mata sembari menyebutkan pelaku yang memegang pisau adalah Ri. Diterangkan, belum sempat perkelahian usai, seorang pengendara sepeda motor datang dan menyelamatkan korban dari amukan ketiga anak bawah umur itu. “Ada orang membantu Ibrahim dengan menyuruh naik kereta terus dilarikan ke rumah sakit,” tutur lelaki yang enggan disebut identitasnya itu. Kapolres Tanjungbalai AKBP EP Sirait dikonfirmasi melalui Kapolsek Datukbandar AKP H Sihite, Kanit Reskrim Aiptu S Sirait didampingi KasubbagHumasAKPYSinulinggamembenarkan penganiayaan itu. Dikatakan, pihaknya masih melakukan pengejaran terhadap ketiga pelaku. Di tempat terpisah, Ketua Front Pembela Islam (FPI) Kota Tanjungbalai Surya Abdi Lubis alias Osama mengecam keras keberadaan warung penyedia minuman beralkohol yang ada di sepanjang Jalan Arteri dan Jati. Sebab sering sekali terjadi tindak kriminal terutama malam Kamis dan Minggu akibat minuman keras. “Sungguh memalukan, kita sangat prihatin, masihpelajarsudahmenenggakalkohol,berkelahi lagi, mau dijadikan apa Kota Tanjungbalai,” kata Osama, sembari meminta agar pihak terkait menertibkan warung penyedia minuman beralkohol. (a32)

Media Dibutuhkan Untuk Keberhasilan PNPM-MP RANTAUPRAPAT (Waspada): Keberadaan media sangat dibutuhkan untuk lebih memberhasilkan program pembangunan pemerintah khususnya Program Nasional Pemberdayaan Masyarakat- Mandiri Perdesaan (PNPM-MP) di tengah-tengah masyarakat. Demikian disampaikanWartawan Waspada Rantauprapat, Armansyah Abdi, S. Sos selaku nara sumber pada kegiatan Pelatihan Pengembangan Media Informasi Ruang Belajar Masyarakat (RBM) PNPM-MP, Kab. Labuhanbatu yang diselenggarakan Kantor Camat Bilah Barat, Kamis (26/4) di Wisma Darma Melati Rantauprapat. Armansyah menyampaikan, kegiatan pengembangan media informasi terhadap para

pelaku PNPM-MP merupakan bagian dari pengembangan Ruang Belajar Masyarakat, guna peningkatan kapasitas pelaku PNPM-Mandiri Perdesaan dalam penyampaian pesan PNPM itu sendiri di tengah-tengah masyarakat. Koordinator Kelompok Kerja Bidang Pengembangan Media Informasi M Yusuf, selaku Setrawan Kec. Bilah Barat PNPM-MP yang juga Sekretaris Camat Bilah Barat menyampaikan, peserta pelatihan terdiri dari pengurus BKAD, UPK dan BPUPK PNPM-MP yang terdiri dari enamkecamatan.Sebelumnyatampilnarasumber Wartawan Harian Analisa, Roni Afrizal, SE yang menyampaikan materi UU Pers No. 40/1999 dan Kode Etik Jurnalistik Indonesia. (a18)

Tertibkan Hotel Tanpa Izin KOTAPINANG (Waspada): Pemkab Labusel didesak menertibkan dan menutup sementara Hotel Grand Permata Cikampak di Kec.Torgamba, Kab. Labusel, karena merugikan pemerintah daerah dan dikhawatirkan mengancam keselamatan pengunjung. DesakanitudiungkapkanKetuaGerakLabusel, Nanang Azhari Harahap kepada Waspada, Minggu (29/4). Menurutnya, sebelum segala perizinan dan sistem keamanan hotel dibenahi, sebaiknya Pemkab melarang hotel berlantai empat itu beroperasi. “Bagaimana pengawasan Pemkab terhadap ini. Bagaimana hotel dapat beroperasi tanpa izin apa pun,” kata Nanang. Dia juga menyayangkan sikap manajemen hotel yang terkesan mengabaikan keselamatan pengunjung dengan tidak dilengkapinya peralatan pengaman sepertipendeteksi asap, tangga darurat dan alarm kebakaran. Padahal, kata dia, beberapa kasus yang terjadi seperti terbakarnya kasus MCT Karaoke, Hotel dan Pub menewaskan puluhan pengunjung dan terbakarnya Karaoke Zet Plane belum lama ini. “Jangan sampai kejadian itu terjadi di Hotel Permata. Jadi sebaiknya hotel ini ditutup dulu sambil membenahi segala izinnya. Kalau pihak

hotel tidak menghiraukan, sebaiknya diambil langkah hukum yang tegas,” katanya. Diberitakan sebelumnya, meski belum memiliki izin resmi dari Pemkab Labusel, namun Hotel Permata Cikampak di Kec. Torgamba telah beroperasi. Parahnya, hotel tersebut juga tidak memiliki sistem pengamanan yang memenuhi standar. Namun pihak manajemen hotel membantah tudingan tersebut. “Ini lagi dalam pengurusan, enggak mungkin kita buka usaha tanpa izin, dari dulu sudah ada, namun ada perombakan kembali,” kata Grand Manajer Hotel Permata, Muhammad Indah. Bentuk Pansus Perizinan Sementara itu, banyaknya perusahaan perkebunan yang tidak mentaati aturan agar memilikiizingangguan(HO)harusdiresponDPRD Labusel.DPRDdimintamembentukPanitiaKhusus melakukanpenelitiansekaligusrekomendasisolusi terhadap masalah tersebut. Desakan itu disampaikan Ketua Jaringan IntelektualMudaIndonesia(JIMI)Labusel,Saiman Siregar. Menurutnya, Pansus tersebut dibentuk untukmenelitiperusahaanyangdidugamelanggar aturan-aturan dan perizinan di daerah maupun pusat.(c18)

Sumatera Utara

WASPADA Selasa 1 Mei 2012


Banyak Hotel Di Parapat Diduga Tak Miliki IPAL Kualitas Air Danau Toba Terancam


PIMPINAN Wilayah BRI Medan, Donswan Simatupang menggunting pita peresmian KCP BRI P. Brandan di Jalan Tahrim, Kec. Babalan.

Pimpinan Wilayah BRI Medan Resmikan KCP BRI P. Brandan P. BRANDAN (Waspada): Bank BRI terus mengembangkan sayap usahanya hingga pelosok daerah. Senin (30/4), Pimpinan Wilayah BRI Medan meresmikan pembukaan Kantor Cabang Pembantu (KCP) BRI di Jalan Thamrin, Kec. Babalan. Peresmian KCP ini dihadiri tokoh agama, pengusaha, H. Syahrun Hakim, Camat Babalan, Faisal Rizal Matondang, tokoh masyarakat, Asnani Daud, tokoh Eksponen ’66, Ahmad Zar, serta unsur aparat TNI/Polri. Pimpinan Wilayah BRI Medan, Donsuwan Simatupang mengatakan, BRI termasuk salah satu bank yang terdaftar penghasil laba tertinggi urutan ke 349 untuk tingkat dunia. Reputasi ini, menurutnya, sangat membanggakan. Banyak manfaat yang bisa didapat nasbah menabung di BRI. Terhitung Januari s/d Desember tahun ini, lanjut Simatupang, BRI membagi sukacita melalui berbagai hadiah. “BRI berkomitmen membantu masyarakat,” ujar Simatupang seraya menambahkan, dana yang telah dihimpun dari nasabah akan dilepas kembali, membantu meningkatkan prekonomian masyarakat P. Brandan. Sementara Pimpinan Cabang BRI Stabat, Gatot menyatakan, KCP P. Brandan diharapkan dapat melayani masyarakat secara maksimal, khususnya di sekitar Telukaru. Saat ini, katanya, unit BRI sudah tersebar luas di sejumlah kecamatan di kab. Langkat. BRI juga membuka Teras di Stabat dan Batangserangan. Dalam waktu dekat dibuka dua teras lagi di P. Brandan dan Sawitseberang. BRI membuka layanan ATM dengan harapan masyarakat dapat memanfaatkan pelayanan online. Camat Babalan, Faisal Rizal Matondang mengatakan, KCP BRI diharap dapat menggerakkan gairah roda prekonomian masyarakat. “Saya berharap, kemajuan yang dicapai BRI dapat membawa berkah untuk menstimulasi kemajuan ekonomi masyarakat,” ujarnya.(a02)

Peletakan Batu Pertama Masjid Manarul Huda SIDIKALANG (Waspada): Pembangunan Masjid Manarul Huda di Komplek Perumahan Puri Asri Laembulan, Kecamatan Sitinjo, Kabupaten Dairi, Minggu (29/4) ditandai dengan peletakan batu pertama oleh Kapolres Dairi AKBP H. Enggar Pareanom, S.Sos yang diwakili H. Asmui Nasution. Ketua Pengadilan Agama Sidikalang H. Abd. Musa, SH, MH mengatakan, orang yang memberikan infak untuk pembangunan masjid adalah merupakan investasi di akhirat nanti. Ketua Panitai Pembangunan Masjid Ustad Erlan Noval, S.Ag, M.Ag menyebutkan, jumlah biaya pembangunan diperkirakan mencapai Rp250 juta. (ckm)

SIMALUNGUN (Waspada): Sebagian besar hotel dan penginapan di Parapat, Kec. Girsang Sipanganbolon, Simalungun, diduga keras membuang limbahnya langsung ke Danau Toba. Tentu saja, ini membuat kualitas air Danau Toba terganggu. Dari ratusan hotel dan penginapan yang ada di kota turis tersebut, diperkirakan hanya lima hotel yang telah memiliki IPAL (Instalasi Pengolahan Limbah). Kepada Waspada, Senin (30/ 4), Kepala Badan Lingkungan Hidup (BLH) Pemkab Simalungun, Ir. Raja Sianipar menyatakan, pihaknya saat ini sedang melakukan pendataan dan meneliti jumlah pasti hotel serta penginapan yang tidak memiliki IPAL untuk selanjutnya melakukan penertiban. “Sebagian besar hotel, penginapan dan restoran di Parapat kita curigai membuang limbahnyalangsungkeDanauTobatanpa melalui proses pengolahan sebelumnya. Dan untuk membuktikannya, kami saat ini sedang melakukanpendataandanpenelitian

di lapangan,” tegas Sianipar. Menurutnya, data awal yang diperoleh BLH Simalungun, hanya lima hotel yang memiliki IPAL, dan umumnya adalah hotel-hotelberbintang,sedangkan selebihnya belum dapat dipastikan pembuangan limbahnya. Dia menambahkan, sesuai Undang-undang Nomor 32 tahun 2009 tentang Perlindungan dan Pengelolaan Lingkungan, setiapperusahaantermasukhotel, penginapan dan restoran yang terbukti melakukan pencemaran lingkungandapatdikenakansanksi pidana. “Kita akan surati pihak hotel,penginapanmaupunrestoran yang terbukti membuang limbahnya ke danau. Kita juga tidak serta-merta menjerat para pengusahanya dengan sanksi

pidana, tetapi menyurati meminta supaya limbah yang akan dibuang diproses melalui IPAL, sehingga limbah yang dihasilkan dan dibuang ke danau tidak mencemari dan membahayakan kualitas air danau atau masyarakat di sekitarnya,” tandasnya. Anggota DPRD Simalungun, Mansur Purba mengharapkan Pemkab Simalungun mensosialisasikan kepada para pengusaha hotel, penginapan dan restoran di Parapat betapa pentingnya melengkapi IPAL untuk mendukung pelestarian Danau Toba, sebagai sumber penghidupan bagi masyarakat di sekitarnya. “Kita berharap seluruh pengusaha hotel, penginapan dan restoran di Parapat menyadari pentingnya melengkapi IPAL dalam proses pengolahan limbah yang dihasilkan, sehingga jika dibuang ke danau tidak mencemari dan membahayakan kualitas air danau serta ekosistem yang ada di sekitarnya,” ujar Purba. (a29)

Dekranasda DS Terima Kunjungan Pimpinan Pusat Muslimat NU LUBUKPAKAM (Waspada): Ketua Dekranasda Deliserdang Ny. Hj. Ir. Anita Amri Tambunan menerima peserta studi banding Pimpinan Pusat Muslimat Nahdlatul Ulama (NU) melalui Ketua Induk Koperasi (Inko) “Annisa” dipimpin Hj. Darwani Pasaribu didampingi Ketua PW Muslimat NU Sumut Hj. Alina Hanum Nasution, Ketua PC Muslimat NU Deliserdang Dra. Wastiana Harahap bersama 35 pengurus Muslimat NU seSumut, di Gedung Dekranasda Deliserdang Jalan Negara Lubuk Pakam,baru-baru ini. Studi banding dalam rangkaian pelatihan perkoperasian yang dilakukan pihak Kementerian Koperasi dan UKM bekerjasama dengan PP Muslimat NU

digelar tiga hari di Medan. Ny. Hj. Ir. Anita Amri Tambunan yang juga penasehat PC Muslimat NU Deliserdang ketika menerima kunjungan peserta studi banding menyam-paikan terimakasih dipilihnya Dekranasda Deliserdang sebagai objek lapangan studi banding dalam rangkaian pelatihan perkoperasian. Hal ini, lanjut dia, tentunya menjadi pendorong bagi pengurus Dekranasda Deliserdang untuk terus membina kaum perempuan yang memiliki kreativitas untuk mampu meningkatkan perekonomian keluarga yang tentunya sebagai upaya kita memperjuangkan hak-hak mereka. Menurut Ketua TP PKK

Deliserdangini,kaumperempuan di Deliserdang telah mampu memproduksi Batik gorga khas Deliserdang yang cukup diminati pengunjung. Demikian juga ulos tenunan motif khas Deliserdang, kramik dan gerabah yang unik, makanan ringan dan souvenir lainnya yang tentunya dapat dikembangkan di daerah lain. Ketua Induk Koperasi “Annisa”PPMuslimat NUHjDarwani Pasaribu menyatakan kagum dengan sambutan hangat serta tampilan Dekranasda Deliserdang. Ini tentu sangat sejalan dengan cita-cita muslimat yang senantiasa bertekad memberdayakan perempuan sebagai pendongkrakpeningkatanperekonomian keluarga yang bermuara untuk kesejahteraan. (a06)

BUPATI Singkil Ir. Rajali,M.Si dan istri menerima Oles Polang-polang dari KadisperindagkopUMKM Kab. Phakpak Barat Mangaraja Maha,SH di Stand Pemkab Pakpak Bharat.

Hubungan Pakpak Bharat Dan Singkil Terjalin Sejak Dulu MEDAN (Waspada): Hubungan historis masyarakat Kab. Pakpak Bharat dengan masyarakat Kab. Singkil sudah sejak zaman dulu terjalin, bahkan hingga saat ini hubungan genersi berikutnya tetap kuat dan terpelihara. Kadis Perindagkop dan UMKM Kab. Pakpak Bharat Mangaraja Maha,SH mengatakan di Medan, Minggu (28/4), usai menyerahkan Oles Phakpak Polang-polang kepada Bupati Singkil Ir.Rajali,M.Si dan isteri pada pameran harijadi ke-13Kab.Singkil,diStandPemkabPakpakBharat, Jumat (27/4). “Kehadiran saya di pameran tersebut merupakan undangan dari Pj. Bupati Singkil Ir. Rajali,M.Si,” kata Maha yang mantan staf Kantor Koperasi Provsu. Pemkab Pakpak Bharat melalui Disperindagkop-UMKM memamerkan berbagai produk pertanian antara lain buah gambir, nenas, nilam, madu, kopi dan jeruk super. Selain itu Dewan Kerajinan Nasional Daerah (Dekranasda) Pakpak Bharat juga ikut memamer-

kan kerajinan masyarakat seperti tenunan oles polang-polang, sori-sori, anyaman tas, kembal (tikar), topi dan sandal. “Sudah menjadi tekad Pemkab Pakpak Bharat akan terus mengejar segala ketertinggalannya selama ini di bawah kepemimpinan Bupati Phakpak Barat Remigo Yolanda Berutu,” t egas Mangaraja Maha. Kunjungan Pj.Bupati Singkil Ir. Rajali,M.Si di Stand Pemkab Pakpak Bharat disambut penuh kekeluargaan dengan pakaian adat Pakpak Bharat. Pada kesempatan itu Mangaraja Maha,SH dan J.Manik yang juga staf ahli memberikan oles polang-polang kepada Bupati Singkil dan isteri sebagai oleh-oleh dari Pakpak Bharat, juga sebagai tanda persaudaraan kedua kabupaten tersebut. Bupati Singkil mengucapkan terimakasi dan Njuah-Njuah. “Pamkab Pakpak Bharat dan masyarakat harus membangun budaya, adat-istiadat danpemerintahansesuaidengansemangatNKRI,” ujar Mangaraja Maha. (m24)

Pick Up Terbakar Tabrak Pohon PEMATANGSIANTAR (Waspada): Satu unit mobil Daihatsu pick up bermuatan kasur dan ambalmilikRediManandoPardede,32,pedagang, warga Desa Resah Pagar Jati, Warung Seri, Lubukpakam, Kab. Deliserdang menabrak batang pohon dan terbakar. Pengemudi mengalami luka retak kaki kanan. MobilpickupDaihatsuBG9929KMmenabrak batang pohon yang ditanam di pulau jalan dan terbakar, terjadi di Jalan Sisingamangaraja, Kelurahan Bane, Kota Pematangsiantar pada Sabtu (28/4) pukul 04:30. Peristiwa itu terjadi ketika mobil sarat muatan kasur dan ambal yang dikemudikan korban melajudengankecepatantinggidariarahParluasan menuju Simpang Dua.

Ketika tiba di tempat kejadian, persisnya di depanbekaskantorDinasKehutananSimalungun, tiba-tiba mobil menabrak pulau jalan dan pohon, langsung terbakar. Warga yang mendengar suara benturan segera berdatangandanmemberikanpertolongandengan mengeluarkan korban yang terjepit di dalam mobilnya serta membaringkan di halaman teras rumah warga. Kapolres Pematangsiantar AKBP Alberd TB Sianipar,S.Ik,MHsaatdikonfirmasimelaluiKasubbag Humas AKP Altur Pasaribu, Kasat Lantas AKP Hendrik Situmorang, MM dan Kanit Laka Iptu SugengWahyudi S, SH menyebutkan kejadian itu masih dalam penyelidikan dan mobil Daihatsu pick up milik korban sudah diamankan. (a30)


Alquran Solusi Berbagai Persoalan Bangsa PEGAJAHAN (Waspada): Di tengahbergulirnyaarusmodernisasi dengan berbagai tantangan, pelaksanaan MTQ diharap mampu menjawab persoalan, terutama tentang pembinaan akhlak dan moral bangsa. DemikiansambutanMenteri Agama RI, H. Surya Dharma Ali pada pembukaan MTQ ke-33, Tingkat Sumut, Sabtu (28/4) malam di kompleks replika Istana Sultan Serdang di Kel. Melati, Kec. Pegajahan,Kab.SerdangBedagai. “Selain itu pelaksanaan MTQ juga diharap semakin menumbuhkan kecintaan masyarakat terhadap Alquran, jika dibaca, dipelajari,diresapisertadiamalkan dalam kehidupan sehari-hari. Banyaknya persoalan yang kita hadapi Al Quran adalah solusinya,” ucap H. Surya Dharma Ali. Semakin banyak kita membaca, lanjut Menag, semakin dalam kita memahami maknanya. Alquran bisa menjadi sumber inspirasi, bisa memotivasi kita untuk menyelesaikan berbagai

persoalan yang dihadapi bangsa. Menag mengharapkan MTQ inisekaligusdapatmenjadiperisai ummat,dariinfiltrasibudayayang merusak dan yang menyesatkan

bangsa. Saat ini kita hidup di tengah suasana totalitas yang tidak menentu akibat ekses dunia maya yang tidak bisa dibatasi. Sementara menurutnya, kita

Waspada/Edi Saputra

MENTERI Agama RI, H. Surya Dharma Ali.

kurang memiliki kemampuan melakukan proses blacklist terhadap yang baik dan yang buruk. “Karena itu saya memiliki alasan yang kuat untuk bisa meluncurkanprogramgerakanmasyarakat maghrib mengaji, yakni membiasakan masyarakat kita untuk mengaji setelah shalat maghrib, dimulai dari satuan-satuan kecil hingga gerakan masyarakat luas,” papar H. Surya Dharma Ali. Dengan mengalokasikan waktuprogrammaghribmengaji, harapnya, kita menyemai kecintaan terhadap Alquran kepada masyarakat serta anakanak yang hari-harinya dirampas oleh kegiatan yang tidak berguna khususnya diwaktu maghrib. Untuk menyemai kebajikan diperlukan pembiasaan hingga padaakhirnyamenjadikebutuhan yang dirasakan bersama. “Saya berharap jajaran Kementerian Agama di mana pun, wajib di lini terdepan dalam merealisasi program maghrib mengaji,” imbau H. Surya Dharma Ali.(c03)

Kafilah MTQ Pakpak Bharat PAKPAK BHARAT (Waspada): Pimpinan kafilah Pakpak Bharat pada MTQ ke-33 tingkat Sumut di Kab. Serdang Bedagai, Makner Banurea, SP yang sekaligusKa.BP4KPakpakBharat, kepada Waspada menjelaskan, Senin (30/4), Kab. Pakpak Bharat diwakiliqaridanqariah,Hidayatul Fahmi Capah (Tartil Putra), Putri Aulia Padang (Tartil Putri), Walimansyah Bancin (Tilawah Anakanak), Siti Rahma Pasaribu (TilawahAnak-anakPutri),Fitriadi (Tilawah Remaja Putra). Kemudian Nurhayati Boangmanalu (Tilawah Remaja Putri), Suherman ( Tilawah DewasaPutra),IdaSuryaniBerutu (Tilawah Dewasa Putri), Al Amin (MK2Q Putra) dan Ismahanul Aflah Siregar (MK2Q Putri). Selain itu Pakpak Bharat juga memberangkatkan 10 orang official dipimpin Makner Banurea, SP dengan anggota Jalil Angkat, SH, Drs. H. Saidup Kudadiri, MM, Irwan Sidebang, S.Ag, MM, Drs. Malindung

Capah, Syarifuddin Manik, M.Ak, M. NasipYusuf Tumangger, S.Ag, Riswan Gajah, S.Ag, S.Pd, MM, Remsina Tumangger, S.Pd dan

Zulkarnaen Padang. “Kami mohon do’a restu seluruh masyarakat demi kesuksesan kafilah Kabupaten Pakpak

Bharat mengikuti MTQ ini,” ungkap Makner Banurea, saat melepas kafilah dilakukan Sekda Drs. Holler Sinamo, MM.(csb)

Waspada/Saut Boangmanalu

SEKDA Pakpak Bharat Drs. Holler Sinamo, MM (tengah) bersama kafilah dan official MTQ Ke-33 Sumut di Serdang Bedagai.

Waspada/Edi Saputra

LAYAR screen di sisi barat mimbar utama dan baliho raksasa tumbang akibat diterpa angin kencang dan hujan lebat.

Cuaca Ekstrim Terpa Lokasi MTQ Ke-33 Sumut PEGAJAHAN (Waspada): Hari pertama pelaksanaan MTQ ke-33 tingkat Provinsi Sumatra Utara di kompleks replika Istana Sultan Serdang, di Kel. Melati Kebun, Kec. Perbaungan, Kab. Serdang Bedagai diterpa angin

Kontingen Medan Siap Hadapi Saingan Terberat SERGAI (Waspada): Kasi Pekapontren dan Penamas Kementerian Agama Kota Medan, Abdul Manan yang ikut dalam kontingen MTQ Tingkat Provinsi di Serdang Bedagai, Senin (30/ 4) menyebutkan, kontingen asal Medan siap menghadapi lawan terberat. “Saya melihat tim peserta yang terberat berasal dari Sergai sebagai tuan rumah dan dari Madina,” kata Abdul Manan. Disebutkannya, peserta lomba antara lain Mahmud Kholil Shofa Siagian 1 juz dan Tilawah putra. Dia berlomba di arena7Sulaimaniyah.Sedangkan NolaYunita Panjaitan 10 juz putri berlomba di arena 4 Aula SMK. Dahlia Hiasan peserta Mushaf putra 4 berlomba diWisma Juang. Nur Misbah Sinaga di cabang Qiraat Saba’ putri berlomba di arena utama. Sedangkan Fajar Sani Nasution ikut lomba tafsir bahasa Arab putra di arena 7 Sulaimaniyah.(m37)

kencang dan hujan lebat, Minggu (29/4) sekira pukul 18:15. Akibatnya satu layar monitor (screen) di sisi barat mimbar utama yang terbuat dari rangka besi tumbang. Selain itu baliho berukuran raksasa bertuliskan bendera negara-negara sahabat, juga tumbang. Puluhan papan bunga yang berjajar di sepanjang lingkar jalan lokasi MTQ, juga tak pelak dari sasaran angin kencang. Bahkan derasnyaguyuranhujanmenggenangi jalan masuk menuju stand

UKM, sehingga merepotkan pedagang. Namunberuntung,saathujan dan angin kencang berlangsung seluruh cabang yang diperlombakan telah selesai dilaksanakan, sehingga tidak mengganggu. Sementara Ketua Pelaksana MTQ ke-33 Sumut, Drs. H. Haris Fadillah didampingi Kapolres Sergai, AKBP Arif Budiman serta sejumlah panitia ketika dikonfirmasi, Senin (30/4), di arena MTQ mengatakan,“kitaberharapkepada Allah SWT dan doa seluruh

masyarakatkhususnyaSergai,agar cuacatetapbaikhinggaselesainya pelaksanaan MTQ. Selain itu masyarakatdapatdatangberbondongbondong ke lokasi MTQ.” Bagipengunjung,lanjutHaris Fadillah, diharap berhati-hati saat melintasi rel kereta api yang tidak diawasi petugas keamanan, sebelum menyeberang agar terhindar dari kecelakaan. “Namun sejauh ini cuaca ekstrim tidak menghalangi pelaksanaan MTQ ke33Sumutyangsedangberlangsung,” tegas Haris Fadillah.(c03)

Kafilah Binjai Menempati Enam Rumah Penduduk SERDANG BEDAGAI (Waspada): 34 Qari dan qariah ditambah official serta pelatih menempati enam rumah penduduk di Dusun IV Desa Bengkel Kec. Perbaungan, Kab. Serdang Bedagai, berjarak sekitar 1 km ke arena MTQN Tk. Prov. Sumatera Utara. “Alhamdulillah, lokasi kafilah Binjai tak jauh dari arena MTQN ke-33,”ujarUstadDrs.Mhd.Nasir, Senin (30/4). Kafilah Kota Binjai terkesan akan keramahtamahan warga. “Mereka menyambut kami seperti keluarga,” aku anggota kafilah. Ketua LPTQ Binjai Drs. H. Amir Hamzah, MAP dan ketua kafilah H. Wahyudi, SH minta kafilah Binjai menghormati tata krama dan etika masyarakat. Selama berada di pemondokan

bisa menyatu dan menambah persaudaraan. Kondisi anggota kafilah juga diakui Nasir cukup baik. “Insya Allah anggota kafilah tak ada yang mengeluh, ini berkat kordinasi kafilah dan peran LPTQ Binjai sertaWaliKotaHMIdahamcukup baik.” Menurut official/pelatih Drs. Mhd.NasirdanUstadHasanTajir, Senin(30/4),qaridanqariahBinjai sudahtampilmaksimal.Menurut Nasir, sebelum mereka naik ke mimbar, qari dan qariah dilatih di pemondokan. Begitu juga duta Binjai lain tetap dimotivasi oleh ketua LPTQ Binjai, Drs. H. Amir Hamzah, MAP. Pada hari ke tiga pelaksanaan MTQN ke-33 Prov. Sumatera Utara, sesuai jadwal, Binjai akan

tampil dengan qari dan qariah 10 jus putra, Danu Ardianto dan 10 jus putri, Ayu Syahfitri. 5 Jus putra, Ahmad Zaki. Kemudian Tartil putra, Nizar Mashuril, Tartil Putri, Nurul Hafizah Siregar. Khot Mushaf putri Winda Martini. Fahmil Quran terdiri dari Muhammad Iskandar, MuhammadErwinsyahdanMuhammad Khaidir. Kemudian Tafsir Al Quran Bahasa Indonesia Taqiyuddin Ahmad Hamzah. Ustad Mhd. Nasir menyebutkan, hujan lebat di lokasi MTQN Serdang Bedagai Minggu malam (29/4), tidak menghalangi pelaksanaan musabaqah. “Hanya pengunjung agak berkurang, mungkin akibat hujan dan faktor jalan yang macet,” jelasnya.(a04)

Sumatera Utara


WASPADA Selasa 1 Mei 2012

DBD Merebak Di Gunungtua Penyuluhan Dan Fogging Dari Pintu Ke Pintu GUNUNGTUA (Waspada): Penyakit Demam Berdarah Dengue (DBD) cenderung merebak di Gunungtua, Kab. Padanglawas Utara (Paluta). Pada 2012 ini, sejumlah warga dan balita meninggal dunia setelah menderita penyakit yang ditularkan nyamuk aedes aegypti. “Kita tidak ingin ada korban lagi,makakitasiagadenganmelakukan pemberantasan dan penyuluhan3MPlusagarmasyarakat mengerti betapa bahayanya penyakit DBD ini,” kata Plt Kadiskes Paluta, H. Darwin Harahap kepada Waspada, Senin (30/4). Dijelaskannya, untuk mengantisipasimerebaknyapenyakit DBD khususnya di wilayah Gunungtua, Kec. Padangbolak, Kab.

Paluta, puluhan staf Dinas Kesehatan (Dinkes) Paluta bekerjasama dengan personel Konfi Senapan C 123 Rajawali Gunungtua menggelar penyuluhan DBD door to door sekaligus pengasapan (fogging) di wilayah Lingkungan I, Kel. Pasar Gunungtua hingga Tobat, Kec. Padangbolak. Sebelum melakukan pengasapan, pihak Dinkes bersama

Kesadaran Warga Paluta Mengurus IMB Rendah GUNUNGTUA (Waspada): Tingkat kepatuhan pengusaha dan warga di wilayah Kab. Padanglawas Utara (Paluta) untuk mengurus perizinan, khususnya Izin Mendirikan Bangunan (IMB), masih tergolong rendah. Pengembang dan pemilik bangunan masih terhitung yang mau mengurus IMB. HalitudibenarkanKepalaBadanPerizinandanPelayananTerpadu Paluta, H. Mara Lobi Siregar, S.Sos, MSi kepada Waspada, barubaru ini. Dikatakannya, sebagian besar masyarakat dan pengusaha yang mendirikanbangunandiwilayahPalutabelummengurusdanmemiliki IMB. “Tingkat kesadaran pengusaha dan warga di Paluta untuk memperhatikan dan mengurus IMB memang belum tinggi. Bahkan, belum ada satupun warga dan pengusaha datang ke kantor untuk mengurus izin itu,” katanya. Ia menambahkan, sosialisasi tentang IMB maupun izin lainnya sudah disebarluaskan ke masyarakat, namun hingga kini belum ada yang melakukan proses pengurusan IMB ke kantor. “Tidak dibenarkan mendirikan bangunan jika tidak mengantongi IMB. Itu diatur dalam Perda Paluta. Jika tidak memiliki IMB, kami akan melakukan tindakan tegas. Bangunan yang sudah berdiri, akan dirazia dan diberikan sanksi sesuai Perda,” ujarnya. Mara Lobi mengimbau, agar seluruh lapisan masyarakat mengindahkan Perda tentang IMB. Peran serta pemerintah dan masyarakat akan membuat pembangunan di Paluta terlaksana dengan baik. “Saya imbau dan tekankan kepada warga atau pengusaha, semua kegiatan harus berpedoman pada prosedur yang ada. IMB merupakan hal penting. Jadi, harus ditaati,” pintanya. (a35)

Polres Ajak Masyarakat Berantas Judi, Narkoba Dan Prostitusi KABANJAHE (Waspada): Dalam Rapat Koordinasi, Polres Tanah Karo mengambil sikap dengan mengajak masyarakat, tokoh masyarakat, lintas agama untuk bersama sama ambil bagian dalam memberantas judi, narkoba dan prostitusi yang terjadi di Kabu. Karo. Hal ini terungkap, Jumat (27/4) di aula Pupur Sage yang dihadiri Bupati Karo DR HC Kena Ukur Karo Jambi Surbakti, unsur Muspida Plus, tokoh tokoh agama, dan juga dihadiri ketua PWI Kab. Karo DairidanPhakpakBaratDicksonPelawidanpuluhantokohmasyarakat yang hadir. Dalam paparannya, Kapolres Tanah Karo AKBP Marcelino Sampouw, SH, Sik, MT mengatakan, dari tahun 2011 Polres Tanah Karo telah mengungkap 292 kasus, dengan jumlah tersangka 457 dan uang Rp35.736.000. Sedangkan pada Januari-April 2012 pihaknya telah mengungkap 95 kasus dengan tersangka 156 orang dan uang sebesar Rp17.349.500, dengan total kasus judi tahun 2011 hingga Kamis (26/4), pihaknya telah mengungkap 387 kasus, 613 tersangka dan barang bukti uang Rp53.085.800. Sedangkan penyelesaian kasus judi pada 2011 sebanyak 235 kasus dan telah mendapat vonis hanya 2,4 sampai 6 bulan. Selanjutnya, pada 2012 penyelesaian kasus judi sebanyak 23 kasus, dan 10 kasus di antaranya telah mendapat vonis. Kapolres juga mengatakan, dalam memerangi judi, narkoba dan prostitusi di Kab. Karo, kiranya perlu bekerja sama, dimulai dari diri dan rumah tangga masing masing. Untuk menyelamatkan masa depan generasi muda Tanah Karo, Kapolres dan elemen masyarakat sepakat untuk membuat nota kesepakatan. Sementara ormas dan beberapa tokoh agama, tokoh pemuda menyepakati untuk segera ditindaklanjuti guna menekan peredaran judi narkoba dan prostitusi secepatnya di Kab. Karo. (c10/a36)

personel Konfi senapan C 123 Rajawali memberikan penyuluhan serta pemahaman kepada warga tentang bahaya dan penanggulangan DBD, yang dilakukan langsung dari pintu ke pintu rumah warga. “Kegiatan serupa akan digilir ke desa-desa lain di seluruh wilayah Padanglawas Utara. Tujuannya untuk memberikan pencerahan kepada warga desa tentang bahaya serangan nyamuk DBD. Mudah-mudahan kegiatan ini dapat membantu warga sebagai pencerahan. Dan ini merupakan cara jitu untuk menghindari serangan DBD,” terangnya. SenadajugadiungkapkanKasi P2PDinkesPalutaArdiSyahbana.

Pihaknya telah menyampaikan imbauan agar warga menjaga kebersihan dan kesehatan lingkungan sebagai upaya menekan penyebaran penyakit DBD, antara lain dengan menerapkan Program 3M Plus (menguras tempat penampungan air, membersihkan kotoran dan lingkungan yang potensial menjadi habitat nyamuk penyebab DBD, dan menimbun barang-barang yang dapat menjadi tempat genangan air di lingkungan sekitar warga). Selain itu, petugas Dinkes Paluta dibantu personel Konfi Senapan C 123 Rajawali Gunungtua juga membagikan bubuk abate kepada masyarakat dan

para pedagang di sepanjang Jalan Sisingamangaraja, Kel. Pasar Gunungtua, Kec. Padangbolak. Turut dalam penyuluhan sekaligus pengasapan tersebut yakni, Kabid PMK dr Arnalom Sitorus Pane dan Kasi P2P Ardisyahbana Harahap, bersama Camat Padangbolak Tunggul P Harahap, S.Sos, Lurah Pasar Gunungtua H. Abdul Rahman Harahap, Komandan Regu (Danru) Konfi Senapan C 123 Rajawali Serda Ardiansyah Siregar, Kepala Lingkungan I Pasar Gunungtua Khairul Saleh Harahap dan Sekretaris Umum Majelis Daerah KAHMI Paluta Ganti Paruntungan Pulungan. (a35)

Warga Madina Harapkan Damkar Standby Di Kecamatan PANYABUNGAN (Waspada) : Masyarakat Kab. Mandailing Natal (Madina) sangat mengharapkan mobil pemadam kebakaran (Damkar) standby di kecamatan.HarapantersebutdisampaikantokohmasyarakatKec.Kotanopan Sangkot Syukur Nasution, 56, di Panyabungan, Senin (30/4). “Mengingat seringnya terjadi kebakaran yang tidak dapat segera ditangani pihak pemadam kebakaran, sehingga akibat dari lambannya penanganan yang disebabkan jarak tempuh yang sangat jauh dari ibukota, mengakibatkan kerugian yang tidak sedikit dialami masyarakat,” ujarnya. Seperti salah satu contoh kebakaran yang terjadi di Kelurahan Simangambat beberapa waktu lalu, yang menghanguskan beberapaunitrumah.Masyarakat menilai, jika mobil pemadam kebakaranstandbydikecamatan, maka tidak akan terjadi hal separah ini. “Untuk itu, pemerintah sangat diharapkan untuk memikir-

kan mobil pemadam kebakaran di setiap kecamatan paling tidak per dapil yang ada di Kabupaten MandailingNatalini,sehinggajika terjadi kebakaran bisa cepat teratasi dan tidak akan menimbulkan kerugian yang sangat besar,” harapnya. “Sudah sering saya dengar terjadimobilpemadamdilempari masyarakat akibat lambannya sampai ke lokasi kebakaran, namun ini saya yakin bukan kelalaian dari petugas namun akibat dari jarak tempuh yang sangat jauh dari ibu kota ke lokasi, karena selama ini mobilpemadamkebakaran tersebut hanya dipusatkan di ibukota saja,” jelasnya lagi. KepalaBadanPenanggulangan Bencana Daerah (BPBD) Rizfan Juliardy, yang dimintai keterangannya baru-baru ini terkait keluhan masyarakat tersebut mengatakan, setiap kali ada bencana kebakaran yang disalahkan adalah petugas, akibat terlambatnya mobil pemadam sampai ke lokasi. Diakuinya, mengingat Kab.

Madina sangat luas sehingga sangat sulit untuk menjangkau seluruhnya, untuk itu memang sudah sangat wajar jika ada mobil pemadam kebakaran di setiap kecamatan paling tidak di setiap Dapil yang ada di Madina. “Sekarang ini masih terbatas mobil pemadam, sehingga untuk menempatkannya di setiap kecamatan masih sangat sulit kita lakukan, karena mobil pemadam kita hanya enam unit, sedangkan yang bisa difungsikan hanya lima unit ,” katanya. Ditambahkannya, untuk menempatkan mobil pemadam di setiap Dapil yang ada di Kabupaten Mandailing Natal, diperlukan empat unit mobil pemadam lagi, karena supaya efektif penggunaannya harus ada minimal dua unit per Dapil. “Saya kira, kalau keinginan masyarakatuntuksetiapkecamatan belum memungkinkan, terlebihdahuluperDapilkitabuat.Itupun kalau ada dukungan dari pemerintahdanDPRDKab.Mandailing Natal,” terang Risfan. (c15)

Balon Wali Kota Sidimpuan Dari Departemen Keuangan P. SIDIMPUAN (Waspada): Seorang bakal calon (balon)Wali Kota Padangsidimpuan akan maju dalam pemilukada Oktober mendatang. Dia PNS di Departemen Keuangan (Depkeu) Pusat yang menyatakan kesiapannya dan dikabarkan sudah melobi partai-partai besar. H.SaroEdiHasibuan,SE,SPd, MM, MSE kepada wartawan, Kamis (26/4) malam di Hotel Natama, Kota Padangsidimpuan mengatakan, dia maju mencalon menjadiWali Kota Padangsidimpuan karena ingin memajukan Kota Sidimpuan sebagai kota moderndenganmenitikberatkan pada potensi perdagangan, jasa, kesehatan serta pendidikan. Saro mengatakan, dia PNS

aktif dan sekarang menjabat Kasubdit di Depkeu Jakarta. Saat inisedangmengambilgelardoctor dan berdomisili di Depok. Katanya, sebagai bagian dari masyarakat Tapsel, dia lahir di Simangambat, Kab. Madina 43 tahun lalu, menamatkan SD hingga SMP-nya di Desa Simangambat, Kec. Siabu, Tapsel lama, saat ini mekar menjadi Mandailing Natal (Madina). Dari SMAN 4 Kota Padangsidimpuan dilanjutkan kuliah ke FE Universitas Jambi. Sebagai putra daerah Sumut dia merasa terpanggil untuk mendarmabaktikan sebagian usianya berjuang melawan kemiskinan dan kebodohan yang membelenggu sebagian besar rakyat Kota Sidimpuan dan

berjuang untuk mencerdaskan serta mensejahterakannya. Awal Mei ini dia akan membentuk tim dan membentuk posko sekaligus menyampaikan kepadapublikkesiapannyauntuk bersaing menuju Salak-1. Soal wakil, kata Saro, dia sudah mengantongi sejumlah nama, namunbelumbisadisampaikannya hingga nanti ditetapkan siapa nama yang akan menjadi pendampingnya. “Soalwakilsudahada,tapinanti akan kita sampaikan. Kalau partai ada empat partai besar yang kita sudahberkomunikasinamunsaat inikitafokusuntukmengikutiproses di Partai Demokrat, karena Partai Demokrat bisa mengusung langsung kandidat,” ungkapnya. (c13)

Perkebunan Merangir Perbaiki 3 Km Jalan Rusak Di Serbelawan SERBALAWAN (Waspada): Tiga dari delapan kilometer jalan Pemkab Simalungun di jajaran Kecamatan Dolok Batu Nanggar yaitu dari Simpang Pabrik Pengolahan kebun Dolok Merangir sampai dekat pintu gerbang Telkom Serbelawan yang rusak parah, memperoleh bantuan perawatan dari perkebunan PT. Bridgestone sejak 24 – 28 April 2012. Menurut Asisten HRD (Personalia) PT. Bridgestone Dolok Merangir H. Syofyan, ketika dikonfirmasi, Sabtu (28/4) membenarkan, kalau pihaknya mengerahkan alat-alat berat di lintaskan jalan Dolok Merangir menuju Serbelawan dari Perkebunan PT. Bridgestone Dolok Merangir. Jalan berlubang ditimbun pasir dan 30 meter kubik batu pecah, tanpa aspal. “Sekarang, badan jalan Dolok Merangir ke Serbelawan sudah rata dan bisa dilintasi kendaraan. Tapi kalau di hari panas seperti sekarang, jalan penuh dengan debu yang berterbangan, di kala musim hujan jalan becek karena lumpur tanah bram jalan yang menutup badan jalan,” ujarnya. Namun pada lintasan jalan lainya mulai jalan kompleks PTPN IV Kebun Dolok Ilir menuju ke jembatan Sei Bahapal 2 km ruas badan jalan juga rusak berat dipenuhi lubang besar dan kecil. Para pengendara harus berhati-hati ketika melintasi jalan karena lubang ada di mana-mana. Upaya pihak PU Pemkab belum ada terlihat untuk merawat ruas badan jalan yang rusak parah, paling para warga sebisanya menutup badan jalan berlubang sangat dalam. (c17)

Waspada/Ali Bey

ALAT berat yang sedang bekerja di lintaskan jalan Dolok Merangir menuju Serbelawan dari Perkebunan PT. Bridgestone Dolok Merangir pada pasar yang berlubang besar dan kecil sedang melakukan pengikisan ruas badan jalan untuk seterusnya menutup jalan berlubang.

Waspada/Sukri Falah Harahap

ANGGOTA DPD RI, Parlindungan Purba (empat kanan) dan rombongan diabadikan bersama Bupati Tapsel, Syahrul M Pasaribu (tiga kanan), Wakil Bupati, Aldinz Rapolo Siregar dan para pimpinan SKPD, saat reses di Tabagsel.

DPD Mendukung Perpindahan Kantor Bupati Tapsel Ke Sipirok P. SIDIMPUAN (Waspada): Anggota Dewan Perwakilan Rakyat Daerah (DPD) RI asal Sumatera Utara, Parlindungan Purba, mendukung percepatan pemindahan kantor Bupati Tapanuli Selatan beserta sarana prasarana lainnya dari Kota Padangsidimpuan ke Desa Kilang Papan Dano Situmba, Kec. Sipirok. “Pembangunan kantor BupatidanDPRDyangdimulaitahun ini, merupakan satu langkah baik yang ditempuh Pemkab Tapsel. Saya dukung itu dan akan turut mengusahakan bantuan anggaran dari pemerintah pusat untuk pembangunan kantor lainnya di pertapakan tersebut,” kata Parlindungan Purba ketika menjalani reses di Tapanuli Bagian Selatan, Rabu (25/4). Pada reses ini, Parlindungan Purba turut didampingi Kepala Satuan Kerja (Kasatker) Pelaksanan Jalan Nasional Wilayah II Balai Besar Pelaksanan Jalan Nasional I (BBPJN), Bambang

Pardede. Kemudian ada juga Kepala PT (Persero) PLN Cabang Padangsidimpuan, Sudirman. Anggota Komite II DPD RI yang membidangi perekonomian dan ESDM ini lebih lanjut mengatakan, kalaupun ada yang berkomentar sinis tentang perkantoran tersebut, dia berharap agar dijadikan sebagai bahan penyempurnabagiprosesperpindahan pusat pemerintahan Tapsel. Di hadapan Bupati Tapsel, Syahrul M Pasaribu,Wakil Bupati, Aldinz Rapolo Siregar, dan sejumlah pimpinan SKPD. Parlindungan Purba mengaku sebelum ke kantor bupati di Padangsidimpuan, dia terlebih dulu meninjau lokasi pertapakan perkantoran itu. Juga ke lokasi pembangunanjaluralternatifAek Latong yang ditarget harus selesai tahun ini. “Pembangunan kantor bupati dan DPRD tersebut cukup bagus dan pemandangan sekitar

lokasinya juga sangat indah. Saya akan turut membantu mengupayakan bantuan anggaran pembangunan dari pusat,” jelasnya sembari menegaskan bahwa dia akan serius merealisasikan janji tersebut. Bupati Tapsel, Syahrul M Pasaribu, mengatakan dia dan empat kepala daerah lainnya di Tabagsel telah sepakat untuk membangun daerah ini secara bersama-sama.Salahsatubentuk perwujudannya, telah membuat satu surat yang diteken bersama kePTWingsAiragarmembukarute penerbangan ke bandara Aek GodangdiKab.PadanglawasUtara. “Limakepaladaerahdanlima ketua DPRD di Tabagsel telah sama-sama menandatangani satu surat bersama ke Menteri PU, meminta pembangunan run way bandara Aek Godang.Tahun ini pemerintah pusat mengucurkan sekitar Rp5 miliar untuk kelengkapan bandara tersebut,” katanya. (a27)

Waspada/Sori Parlah Harahap

PERSONEL Konfi Senapan C 123 Rajawali Gunungtua sedang melakukan fogging di salah satu rumah warga di lingkungan satu, Kel. Pasar Gunungtua, Kec. Padangbolak, Kab. Padanglawas Utara.

‘Menari-nari’ Di Atas Jalinsum Rusak Parah P. SIDIMPUAN ( Waspada): Parahnya kerusakan jalan lintas Sumatera (Jalinsum) mulai dari wilayah Kab. Tapanuli Tengah sampai ke Kota Padangsidimpuan, membuat anggota DPR RI yang juga Ketua DPP Partai Demokrat, Drs. H. SutanBathoeganaSiregarMMbesertarombongan terpaksa ‘menari-nari’ di dalam mobil. “Akibatrusaknyajalanitu,kamiyangadadalam mobil seperti menari. Kalau ada orang hamil yang ikut dalam mobil, mungkin sudah melahirkan dan jadilah barang tuh, “ katanya pada silaturahmi bersama pengurus dan kader Demokrat Padangsidimpuan dan Tapsel. Untuk mengatasi kondisi infrastruktur yang rusak berat ini, sebutnya, sangat dibutuhkan pemimpin yang benar-benar peduli dan cinta kepada daerah. Pada kesempatan itu dia melontarkan penilaian tentang Provinsi Sumatera Utara yang menurutnya saat ini seperti orang yang tidur lelap dan harus dibangunkan. “Yakinlah jika seorang pemimpin peduli dengan daerah, maka jarang terlihat lobang menganga di badan jalan. Ingat, Sumut adalah provinsi terbesar nomor dua di Indonesia, tapi infrastrukturnya memperihantinkan, “ ujarnya. Sutan Bathoegana menilai ini sebagai akibat dari kurangnya kordinasi, komunikasi, dan kemampuan lobi para pemimpin daerah di Sumut ke pusat. Sehingga banyak anggaran pembangunan yang beralih ke kawasan Timur atau tepatnya Sulawesi Selatan (Makassar). “Jika pemimpin Provsu jeli dan peduli dengan rakyatnya. Saya pikir tidak sulit mengarahkan anggaran pembangunan dari pusat ke Sumut. Lobi anggaran ke pusat, maka jadilah barang tuh,” ulangnya kembali. Disisi lain, Sutan yang pernah mengecap pendidikan di SDN 12 Kota Padangsidimpuan itu mengimbau masyarakat, agar jangan sekali-

kali memilih pemimpin hanya karena uang. Karena jika itu yang terjadi, maka pembangunan tidak akan pernah terealisasi dengan baik. “Jika seorang pemimpin terpilih karena saweran-nya. Maka tahun pertama bukan membangun daerah yang ia pikirkan, tapi bagaimana melunasi utangnya. Tahun kedua berpikir uang masuk, tahun ketiga pikirannya terporsir memenuhi panggilan KPK karena korupsi. Sehingga tidak ada lagi waktu untuk membangun daerah,” sebutnya. Sutan Bathoegana mengaku dirinya sebagai orang yang sangat anti money politic dan mengemis jabatan. Karena jika dia mau, jabatan Menteri bisa saja didapatnya karena faktor kedekatandenganPresiden.“Sayaseringberdebat berjam-jam dengan Pak SBY dalam membahas sebuah masalah. Saya ini orang yang komit, jika tidak tetap tidak, meski kepada komandan,” tegasnya. Terkait rencana maju pada Pilgubsu 2013 mendatang, Sutan Bhatoegana menegaskan jika dirinya sangat serius untuk maju dan telah minta restu kepada Ketua Umum DPP Demokrat. Saat itu Anas Urbaningrum agak berat hati dan memintanya menjadi Menteri saja. Tapi ditolaknya, dan akhirnya Anas merestui. “Rencana maju di Pilgubsu murni karena panggilan hati nurani untuk membangun Sumut ke arah lebih baik. Saya terenyuh melihat Sumut saat ini, dan sebagai putra asli daerah saya memutuskan untuk maju pada Pilgubsu. Jujur, kalau hanya untuk cari uang dan jabatan, saya sudah cukup,” jelasnya. Hadir dalam silaturahmi itu, Ketua DPC Partai Demokrat Kota Padangsidimpuan, H. Khoiruddin Nasution, Ketua DPC PD Tapsel, H. Sutor Siregar, Ketua DPC PD Paluta, pengurus bersama ratusan kader dan simpatisan. (a27)

Kepala SDN Diduga Cabuli Siswi GUNUNGSITOLI (Waspada): Oknum Kepala salah satu SD Negeri di Sisarahili Gamo, Kec. Gunungsitoli berinisial ET alias Ama Nota dilaporkankepolisiterkaitkasusdugaanperbuatan cabul terhadap anak di bawah umur yang merupakan siswinya sendiri. Oknum ET alias Ama Nota, 45, warga Desa Sisarahili Gamo, Kec.Gunungsitoli dilaporkan karena diduga telah melakukan perbuatan cabul terhadap Juwita, 12, (nama samaran) siswi kelas 6 salah satu SDN di Sisarahili Gamo dengan cara memeluk dan menggerayangi tubuh korban. Korban, yang ditemui di Kantor Pusat Kajian Perlindungan Anak (PKPA) Kota Gunungsitoli, Jln. Makam Pahlawan, Desa Mudik, Kec. Gunungsitoli, Kamis (26/4) mengatakan pencabulan terhadap dirinya dilakukan oknum ET alias Ama Nota di Ruang Perpustakaan salah satu SDN Sisarahili Gamo, Jumat (13/4) lalu sekira pukul 8:30 sebelum Ujian Akhir Sekolah (UAS) berlangsung. Pada saat kejadian, Juwita menemui oknum kepala sekolah, ET di ruang perpustakaan sekolahnya karena sebelumnya telah diperintahkan oleh kepala sekolah untuk menemui dirinya apabila pengawas ujian telah datang. Namun saat Juwita menemui kepala sekolah di ruanganya, ternyata tidak ada, langsung korban mencari dan menemui oknum ET sedang berada di ruang perpustakaan sekolah. “Ketika saya menemuinya di ruang perpustakaan, dia menyodorkan sebuah pensil kepada saya dan langsung memeluk saya sambil kedua tangannya memegang megang buah dada saya serta meminta saya untuk menciumnya. Karena ketakutan saya pun berontak dan menolaknya

sambil berlari masuk ke dalam kelas”, tutur Juwita dengan lugunya. Di tempat yang sama, orangtua Juwita, Bazatulo Telaumbanua alias Ama Opiter, 45, mengatakan sangat menyesali perbuatan kepala sekolah terhadap anaknya, sehingga kini anaknya dilarang ke sekolah, karena takut keselamatan anaknya tidak terjamin saat pergi ke sekolah yang jaraknya 1 km dari rumahnya. Menurut Bazatulo, kejadian tersebut baru diberitahu oleh Juwita kepadanya, Selasa (17/ 4/) sehingga dengan pertimbangan bersama keluargakasusyangmenimpaanaknyadilaporkan ke Polres Nias sesuai bukti laporan No. STPLP/ 181/IV/2012/NS, atas dugaan pencabulan terhadap anak di bawah umur. Mengenai kedatangan mereka di Kantor PKPA bersama Juwita, Bazatulo mengatakan tujuannya adalah untuk meminta PKPA memberikan pendampingan terkait kasus yang dialami anaknya. Koordinator PKPA Gunungsitoli, Dani di tempatyangsamamembenarkanbahwaorangtua Juwita datang ke PKPA untuk meminta pendampingan atas kasus yang dialami anaknya yang telah dilaporkan ke Polres Nias. Dani menambahkan selain kasus yang menimpa Juwita, PKPA Gunungsitoli sehari sebelumnya juga telah menerima laporan kasus yang sama, terkait pencabulan terhadap anak umur 12 tahun yang terjadi di Desa Dahana, Kec. Namohalu Esiwa, Kab. Nias Utara. Pada kasus tersebut, Dani memberitahu bahwa korban diduga telah di perkosa dua kali oleh pelaku berinisial FZ dan kasus tersebut juga sudah dilaporkan ke Polres Nias. (a25)

Seorang Ibu Butuh Ketelatenan Dan Kesabaran PEMATANGSIANTAR (Waspada): Seorang ibu butuh ketelatenan dan kesabaran saat menjalankan peran sebagai orangtua. Karena, peran serta seorang ibu sangat dibutuhkan dalam membimbing dan membentuk karakter pendidikan dasar anak di keluarga. “Kaum perempuan, khususnya kaum ibu mempunyai peran penting dalam mendidik anak sejak dini,” sebut Wali Kota Pematangsiantar, Hulman Sitorus, SE melalui Sekda Drs. Donver Panggabean, M.Si saat peringatan Hari Kartini ke-133 yang dilaksanakan dengan sederhana dan berlangsung hikmat, serta dihadiri ratusan kaum ibu terdiri anggota dan pengurus Tim Penggerak PKK, Dharma Wanita Persatuan, Bhayangkari, kepala SKPD dan camat di gedung DharmaWanita Persatuan, Jalan Porsea, Kamis (26/4). Selain itu, menurut Wali Kota, kaum perempuan khususnya para ibu mempunyai peran penting dalam mendidik anak sejak dini. “Sosok seorang ibu turut menentukan nasib para generasi penerus bangsa ke depan. Karena itu, seorangibuharusmemperhatikanperkembangan

dan pertumbuhan anak-anaknya, membimbing serta memberikan pendidikan dasar yang memadai agar tetap berkarakter,” ujarnya. KetuaPenasehatGabunganOrganisasiWanita (GOW) Pematangsiantar Ny Rusmiati R Hulman Sitorus menyebutkan, peringatan Hari Kartini mengingatkan kaum perempuan sebagai insan mulia dalam sejarah dan menempatkan sebagai standar untuk memperbaiki diri. Sebelumnya, Ketua Pelaksana Peringatan Hari Kartini ke-133 Drg. Rumondang Sinaga, MARS melaporkan, peringatan Hari Kartini itu dilaksanakan sebagai wujud penghargaan atas cita-cita perjuangan seorang perempuan Indonesia bernama RA Ajeng Kartini. Di akhir peringatan Hari Kartini itu, Ketua Penasehat GOW, Sekda, Ketua Dharma Wanita Ny. Silvy Donver Panggabean, Wakil Ketua Tim Penggerak PKK Ny. Rini Koni Ismail Siregar, mewakili Kejaksaan Negeri, Dirut PDAM Tirtauli H. Badri Kalimantan, SE, MM menyerahkan hadiah kepada para pemenang lomba busana Kartini. (a30)

1 CM 2 CM

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower




Selasa, 1 Mei 2012

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

CRV Th. 2004. Hitam, pajak 4. 2013. Matic, mbl cukup sehat, tinggal pakai, luar dalam pokoknya puas pakai, tdk kecewa. Harga. 146Jt. Nego. HP. 0852 6175 2131

DAIHATSU Taruna FGX Thn. 2004 Lengkap, W. Hijau, TV, DVD, Hrg. Nego. Peminat Hub. HP. 0813 6212 2339 SUPER PROMO DAIHATSU BARU

All New Xenia, Terios, Pick Up, Luxio, Sirion, Full Disc, Ready Stock, Data dijemput. Hub: IRNANDA 0813 75802895 / 0821 6761 2659

DAIHATSU Taruna CSX Thn. 2000 Dijual. Warna Biru, BK Medan, kondisi mulus, mesin sehat. Hub. HP. 0812 600 500 39 DAIHATSU ESPASS 97 AC, Tape, VR, Wr. Biru, BK Mdn Asli. Hub. 0812 6569 3737 DAIHATSU Taft 1994. 4x4 Hitam BK Medan, Asli, Siap pakai. Harga 74 Nego. Hub. 0821 6363 4282 DAIHATSU Xenia Th. 2006. Wrn Hitam. 1000cc. Lengkap. BU 1 tgn. Hrg. 97Jt. Peminat Hub. HP. 0813 6223 4109

DAIHATSU Xenia DLX P 1.3, Tahun 2010 Hitam. Hrg. 123Jt. TP. 0812 6097 8761 DAIHATSU Xenia Thn. 2010 Akhir. Xi, Sporty, warna hitam, BK Medan cantik, 1 pilihan. Harga 135Jt. Hub. 0831 9853 5403 DAIHATSU Xenia Th. ‘05, 1000cc. Wrn silver, pajak pjg, mls, Rp. 97Jt/ BU. Jl. SM. Raja sebelah ILP No. 200. 0812 6038 5555 / 7851402 HONDA CRV manual Th. ‘07, 2000cc, wrn abu2 metalik, pakai TV, power mbl mulus, 1 tgn dari baru, Rp. 248Jt. Depan Kampus UISU No. 200. 0815 337 33688 / 7851402

HYUNDAI Thn. 96 Wrn hitam dijual Met, VR, BR, AC, PS, PW, Miror, pajak br diurus, mobil siap pakai, nggak kecewa. Hrg. 38Jt Nego. Hub. 0813 7030 1442 HYUNDAI Elantra Thn. 96. AC, Tape, V. Racing, PS, PW, W. Silver. Kondisi mulus, orisinil Hrg. 30Jt (damai). Hub. 0853 7177 8166 ISUZU Panther Sporty 2,5 Merah met Th. 97, mulus, a/n. Sendiri. Asli Medan, siap pakai, Hrg. 66 Jt Nego. Hub. 0812 6949 9450

5 CM 6 CM

Rp. 65.000 Rp. 78.000

TOYOTA Kijang Capsul Th. 97 W. Biru metalic, AC, Tape, VR, BR, PS, PW, CL, BK Medan Body asli kaleng, mulus, tdk kecewa. Hub. 0813 6233 0595

TOYOTA Kijang Capsul 1.8 Th. 2003 Dijual. Silver, Bensin, BK Medan. Hub. 0813 9671 6520 dan 0813 6200 4295. Jl. Tuasan No. 77 A Medan.

7 CM 8 CM

Rp. 91.000 Rp. 104.000



ELEKTRONIK REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757 Siap Ketempat


TOYOTA Kijang Super G, Th. 97 W. Hijau metalic, AC, Tape, VR, BR, PS, PW, CL, BK Medan, body kaleng jamin mulus Hub. 0852 7599 6758


TOYOTA Kijang Super Commando Long Th. 95. W. Hitam metalic. AC, Tape, VR, BR, BK Medan, body lempang, jamin mulus. Hub. 0813 7582 3555

Surat Tanah Sertifikat No. 2188 A/n. Ramli Sitanggang. Terletak : Gang Abdul Majid Harahap Tanah 600. Luas: 219M2. Disepanjang Jalan: Yos Sudarso KIM II Jl. P. Batam No. 1. Sampai Dengan Tanah 600

TOYOTA Kijang Kencana Thn. 91 Dijual. W. Hijau met, 6 Speed, long, mobil sangat sehat. H. 39Jt. Nego. dan Sedan Starlet 1000cc. Thn. 86. W. Biru met. H. 27Jt. Nego. Hub. HP. 0813 7031 0953

TOYOTA Kijang Innova 2005 Dijual. Type G / Biru - Bensin, Rp. 150Jt/ Nego. TP. Hub. 0821 6768 6363



PURBA : 0813 9789 4633 TOYOTA Kijang Capsul Model LGX New Solar Th. 2004 mulus, orisinil, VR, BR, PS, PW, CL, Rmt, E. Miror, AC DB, Full sound Pake TV, Wrn silver met, Hrg. 146 Jt. Nego. Hub. 0821 6440 6043


TERCECER Surat Tanah An. Hanafi. Terletak di Jl. Sei Seluas 489m2. Bagi yang menemukan Hub: 082113489812 akan diberi hadiah.



TOYOTA Avanza Type G Dijual. Thn. 2006 warna hitam, mobil mulus, cantik, siap pakai. Hub. 0853 7178 3999

BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807



WC WC WC 0813 7035 7291 TUMPAT/ SAL. AIR

845.8996 0812.631.6631 Bergaransi/ Setia Luhur 160 F

Pelanggan Yang Terhormat HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA.

Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602

MITSUBISHI 100% BARU - T120SS PU DP 14 Jt-an, Angs. 2,6 Jt-an - L300 PU DP 24 Jt-an, Ang. 3,8Jt-an - Colt Diesel Hub. 0813 9799 0818

NISSAN READY STOCK Dapatkan Nissan Xtrail, DP Murah 50 Jt-an atau Angsuran 7 Jt-an + Kredit s/d 5 thn. Hub. 081361726293

SUZUKI Escudo Th. 2005 W. Hitam metalic. AC, Tape, VR, BR, PS, PW, CL, Body kaleng. Mulus seperti baru. Hub. 0852 6129 5788

SUZUKI Carry Th. 2001 BK Mdn. W. Biru. Hrg. Nego. Jual Cepat. HP. 0852 7650 6242 TOYOTA Kijang Super G BK Mdn Th. 1994. AC DB Jual Cepat Siap pakai. Hrg. Nego. HP. 0821 6021 0957




KOMPUTER CUCI GUDANG LAPTOP SPESIAL MEI - Toshiba 14” Inch: 1,9Jt - Toshiba 12” Inch: 1,7Jt - HP. 12 Inch: 1,6Jt - Dell 12 Inch: 1,5 Jt - Dell 14 Inch: 1,7Jt - Fujitsu 14 Inchi: 1,7 Jt - Fujitsu 13 Inch: 2,3Jt - IBM 11 Inch: 1,5Jt - IBM 14 Inch: 1,3Jt.

- Merk Terkenal - Kwalitas Diakui - Bergaransi - Siap pakai Hub: Pondok Kelapa No. 9 B Medan Ringroad

TOYOTA Avanza G Th. 2009 BK Mdn Warna hitam. Cat dan mesin mulus, siap pakai. Hrg. Nego. Jual Cepat HP. 0811 652506


DAFTARKAN SEGERA KE: KANTORPUSATMULTAZAMMEDAN Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6495.8456

Kantor: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4/18 Medan

Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488 Website:




Kami group perusahaan yang berkembang dengan pesat, sedang melakukan ekspansi divisi baru, serta membuka kesempatan berkarir untuk posisi sbb: 1. Staf Stock Controller (C.S.C) 2. Staf Sales Marketing (S.S.M) 3. Staf Administrasi dan Operasional (S.A.O) 4. Staf Office Boy (S.O.B) Adapun syarat dan kondisi sbb: - Pria, usia 18 = 30 tahun (S.S.C dan S.S.M) - Pria/ wantia, usia 18 - 35 tahun (S.A.O dan S.O.B) - Pendidikan SMA dan sederajat (semua posisi) - Pengalaman kerja min. 1 tahun (S.S.C, S.S.M dan S.A.O) - Memiliki kendaraan sendiri (S.S.C, S.S.M, dan S.O.B) - Jujur, ulet, berdedikasi tinggi dan bertanggung jawab (semua posisi) Fasilitas: Jenjang karir, gaji menarik, medical claim, insurance, dll Surat lamaran lengkap dalam amplop tertutup disertai “KODE: FMCO-2012” di sudut atas amplop dan pasphoto 4x6 (satu Lembar) ditujukan ke: Kantor harian “WASPADA” selambatlambatnya 2 (dua) minggu sejak diterbitkannya iklan ini

SERVICE LAPTOP LCD gelap, Rusak, Engsel patah, Keyboard, Battery, HDD, Hank, Virus dan Lain TERIMA LAPTOP & KOMPUTER Mau JUAL, BELI, Tukar Tambah, Keadaan RUSAK PARAH pun kami TAMPUNG jg luar kota. KAMI SOLUSINYA CV.RBC Boleh Tes! Jujur & Di Percaya Jl. Sena No. 47/4 Tel. 4553359, 77700887






BMJ = Jl. Serdang Gg. Belimbing No. 2D Mdn, butuh karyawan Tamatan SMA (Baru Tamat), SKU/ Ijazah Boleh menyusul C.P: 0852.9711.9056 - 7784.1353 / 0812.6094.2580

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun


Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Pasang Iklan Mini

“WASPADA” Telp: 061 - 4576602

HANYA 185 JT Krakatau Rumah Baru Khusus Muslim, 2 KT, 2 KM Jl. Purwosari Krakatau Hub. 0813.9627.9192 0821.6603.3261

TANAH TANAH Dijual di Pondok Surya Jl. Sinumba II (dkt Jl. Karya Sei Agul), Uk. 15x29mtr, Harga 1,1 Jt/mtr, Hub. 0813.7695.5180 - 0813.9627.9192

TANAH Dijual Uk. 25c31m, di Jl. Psr 3 Gg. Melati Krakatau Rp. 700 Rb/mtr Hub. 0853.7308.6785 - 0821.6603.3261

Menerima Lowongan Kerja Tamatan SMA Sekretaris Muslim, Belum kawin, Cewek 20 - 26 Hubungi 0813.7508.7688


Lowongan kerja, Dibutuhkan wanita tamatan SD, SMP, SMA, Akper, Akbid utk dididik diperkajakan sbb: Baby Sitter, P. Jompo, K. Asuh, Honor 900 Rb s/d 1,6 Jt. Hub: Yayasan Sinar Bunda, Jl. Ngumban Surbakti No. 23 Simp. Pos Pd. Bulan Medan HP. 0821.6064.4428



Di Perumahan Villa Asri Permai No. 11, Jl. Stasiun (±1 km dari Villa Gading Mas Mariendal), Ls. Bgn T. 80, Tnh 8x17m, SHM, 3 KT, 2 KM + Jerjak, Siap huni, Hrg 400 Jt/nego Hub. 0813.7533.4051



Anda perlu rantangan U/ dikantor & dirumah menu berganti setiap hari (masakan Muslim) dapat dilayani utk kec. Medan Denai, Medan Tembung, Percut Sei Tuan & Bag. Kuis Hub. Bu Dina HP. 0821.6062.3002


Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.3334 HP. 0813.7580.8866


Di Jl. Klambir V depan Sekolah PAB, 2 Tingkat, 2 KM, SHM Strategis utk usaha Bebas banjir, Harga nego Hub. 0813.9680.3777 (TP)



2 Tkt Uk. 5x15m, SHM, Jl. Karya Jaya, Titi Kuning Medan Johor, Pinggir Jalan HP. 0852.8221.8222


RUKO 2 Lt 385 Jt/ nego JL. Besar Denai (samping Mesjid Al Quba), Cocok buka usaha apa saja Hub. 0813.9627.9192 / 0821.6603.3261


Uki. Tanah 9,20x21,50m, Uk. Tanah 7x12m, Jl. Tembung Pasr 8/9 Gg. Al-Ridho Desa Bdr. Klipa, ±150m dari Jln besar Tembung, Harga 190 Jt/nego Hub. 0852.7301.1715 - 0878.6839.1096

Dapat Profit Jutaan Rupiah/ Hari Hub. 0878.6942.9700


Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik



2 Kamar Tidur & 3 Unit Kiosnya Kondisi masih dalam sewa/ usaha (sisa 3 bulan lagi), Lokasi pinggir jalan besar & sangat strategis, sangat cocok utk investasi, SHM Peminat serius hub pemilik langsung 0852.6157.3181 0813.9685.5487 / 7685.5267


TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

MELAYANI GROSIR & ECERAN Lagu² Indonesia - Daerah - Dll. Kaset, CD, VCD original Jl. Sutomo 118A (simp. Yose Rizal) Mdn Telp. 7334.825 HP. 0852.7772.2021

Penerbangan Via Singapore *Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis

Manasik Haji Multazam: Setiap hr Sabtu Pkl. 14.00-16.00 Wib hr Minggu pkl. 09.00-11.00 WIb Tempat manasik Mesjid Agung Medan Jl. P. Diponegoro


0852 6076 2430 0852 1090 7422 (Minggu tutup)




Jamaah luar kota dapat penginapan/ Hotel, makan dan transportasi ke Bandara Gratis !!!





PO. BOX 1480

Jl. P. Brayan Medan




Ada Garansi

MITSUBISHI Colt Diesel Truck Dijual 120 HD Thn. 2004. 1 tgn dari baru, mobil cantik, bak tinggi, siap pakai. Hub. 0853 6123 9899





0812 631 6631


1. 2. 3. 4. 5. 6.



FORD ESCAPE 2004, Warna silver metalic, Manual 4x2, Plat B, Tangan pertama, Mulus Hub: 0819 854531 - 06175092645

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput




TOYOTA Rush 1,5 G T h . ‘ 0 7 . Wr n h i t a m metalik, Rp. 158Jt. Hub. 0813 6089 4043


IKLAN KHUSUS 6x1,5 kolom Rp. 120.000


TOYOTA Kijang LGX 2002 Rp. 112Jt/ Nego. Biru tua, Bensin, mulus, plat BL. 0812 6056 6356 / 80021050

SEDAN GEMINI SOLAR Th. 1992. BK Medan (Rwt) Hub. 0813 9633 5982 Rp. 18 Jt. Nego.

11 CM Rp. 165.000 12 CM Rp. 180.000


TOYOTA Kijang Super G Commando Dijual. Thn. 94. BK Mdn AC DB, 6 Spd. Tape, Dashboard sedan, 5 pintu, Cantik. Hrg. 60Jt/Nego. Hub. 0812 639 3235 - 0812 8621 4177

TOYOTA Innova E Plus. Bensin Th. ‘08. Abu2 metalik, Mbl ctk sekali, 1 tangan dr baru, Rp. 160Jt. Depan Sekolah Eria No. 200. 0821 6767 7000 / 7851402

9 CM Rp. 126.000 10 CM Rp. 140.000


1 Unit Ruko Usaha Air Minum Isi Ulang Jl. Setia Budi 51A (Dpn Mie Aceh Baru) Lokasi Strategis Lengkap Siap pakai Hrg 35 Jt/thn Minimal 3 thn Hub. 0831.9797.1599














Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.7194 Fax. (061) 415.7504 SUMUT - INDONESIA


1 Jam tuntaskan lemas BERGARANSI syahwat 100% ALAMI - Cepat keluar - Impotensi, diabetes - Tambah ukuran - Ramuan vagina perawan, kembali, hasil bisa cek dr metode : Biotheraphy dan Ramuan Herbal Office: Mesjid Raya Mdn 600m lurus di Jl. Amaliun No. 125 Bpk. Kosim S. Ag HP. 0812.63700.234 Izin Dinkes: 448/347/2004

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda


Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR


Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333



Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.1222


A6 07.00 Doraemon 09.00 Dahsyat 11:00 Infotainment : INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14.30 Cek & Ricek 15.30 Tom & Jerry 16.00 Silet 17.00 Seputar Indonesia 17.30 Target Operasi 18.00 Mega Sinetron : Yusra Dan Yumna 20.00 Mega Sinetron : Karunia 22.30 Box Office Movie


07:00 Inbox 09:00 Liputan 6 Terkini 09:03 Halo Selebriti 10.00 SCTV FTV 11:00 SL Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12.30 SCTV FTV 14:30 Status Selebriti 15.00 Cinta Dan Uya Sama Sama Kuya 16.30 Liputan 6 Petang 17.00 Sinetron 19.00 SCTV SInetron Putih Abu Abu 20.30 SCTV SInetron : Cinta Salsabilla 22.30 Liputan 6 Terkini 22.33 FTV Utama

07:20 - Animasi Spesial : Oscar Oasis 07:30 - Kisah Unggulan 10:30 - Diantara Kita 11:00 - Sidik 11:30 - Lintas Siang 12:00 - Layar Kemilau 13:30 - I Drama 15:00 - Starlite 15:30 - Lintas Petang 16:00 - Zona Juara : Tv Champion 17:00 - Animasi Spesial 18:00 - Animasi Spesial : Shaun The Sheep 19:00 - Fathiyah 20:00 - Tendangan Si Madun 21:00 - Putri Nabila 23:00 - Dewi Dewi Show 23:30 - Fa Cup Highlights 24:30 - Sport Mania 00:00 - Lintas Malam

07:30 - Fenomania 08:00 - Friends (Live) 09:00 - Fresh & Fun 09:30 - Gowes Dunia 11:30 - Topik Siang (Live) 12:00 - Klik ! 13:00 - Tom & Jerry 13:30 - Tom & Jerry 14:00 - Woody Wood Pecker (New-Season 1) 14:30 - Woody Wood Pecker (New-Season 1) 15:00 - Indonesia Super League 17:30 - Topik Petang (Live) 18:00 - Pesbukers (Live) 19:00 - Siapa Takut 20:00 - Full House 21:00 - Realiti Selebriti 22:00 - Sinema Spesial

07:00 - KISS Pagi 08:00 - FTV Pagi 10:00 - Hitzteria 11:30 - Patroli 12:00 - Drama Asia (Korea) : Twinkle Twinkle 13:30 - Drama Asia (Korea): A Thousand Day\’s Promise 15:00 - Kiss Sore 16:00 - Fokus 16:30 - Drama Asia (Korea) : Lie To Me 18:00 - Drama Asia (Mandarin): To Liong To (Golok Pembunuh Naga) 19:00 - Sinetron Unggulan 20:00 - Tutur Tinular 22:00 - Buaya Show 2 3 : 3 0 - Me g a A s i a Bottom of Form

07.05 Bedah Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.05 Eleven Show 11.30 Metro Siang 13.05 Wideshot 13.30 Wideshot 14.30 Wideshot 15.05 Bisnis Hari Ini 16.05 Wideshot 16.30 Wideshot 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.05 Suara Anda 20.30 Bicara Konstitusi 21.05 Top Nine News 21.30 Today’s Dialogue 22:30 Open Mic 23.05 Genta Demokrasi 23.30 Metro Sports

WASPADA Selasa 1 Mei 2012

07:30 Ranking 1 08:30 Semangat Pagi 10:00 Wisata Terapi 10.30 Insert 11.30 Jelang Siang 12:00 Reportase Siang 12:30 Jika Aku Menjadi 13:15 Bukan Prime Time 14.00 Magic Comedy 14:30 Digital Clip 15:00 Sketsa 16:00 Show Imah 17:00 Reportase Sore 17:30 Inside 18:15 Comedy Project 19.15 Tahan Tawa 20:15 Bioskop TransTV 22.15 Bioskop Trans TV 01:15 Reportase Malam

09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News 12:00 Live News Kabar Siang 13:30 Apa Kabar Indonesia Siang 15:00 Live News Kabar Pasar 16:30 Live News Kabar Petang 19:00 Apa Kabar Indonesia Malam 19:30 Indonesia Lawyers Club 22:30 Live News Kabar Malam 23:30 Radio Show

08:00 Naruto Shippuden III 09:00 Doo Bee Doo 10:00 Obsesi 11:00 Dapur Cobek 11:30 Hot Spot 12:00 Global Siang 12:30 Awas Ada Sule 13:30 Sketsa Tawa 14:00 Petualangan Panji 14:30 Profesor X 15:00 OB (Office Boy) 15:30 Fokus Selebriti 16:00 100% Ampuh 17:30 Spongebob Squarepants 19:00 Untung Ada Sule 20:00 Sketsa Tawa 20:30 Big Movies 22:30 Movies

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Think Like A Man Masih Duduki Puncak Box Office FILM Think Like A Man kembali menduduki puncak box office Amerika Utara pada pekan kedua dengan pendapatan 18 juta dolar AS. Dengan demikian film komedi romantis produksi Sony/Screen Gem itu telah meraup 60,9 juta dolar AS sejak diluncurkan akhir pekan lalu dan menjadi salah satu film Afrika-Amerika tersukses sepanjang sejarah, demikian menurut laporan Kantor Berita Xinhua. Sejumlah bintang Amerika-Afrika membintangifilmdiadaptasidariceritakarya komedian televisi dan radio, Steve Harvey, berjudul Act Like a Lady, Think Like a Man tersebut yakni Michael Ealy, Jerry Ferrara, Think Like A Man/ Meagan Good, dan Regina Hall. Film itu bercerita tentang empat perempuan sudah menyerah berusaha membuat kawan laki-laki mereka melakukan apa yang mereka minta sampai menemukan buku Steve Harvey dan menggunakan nasehat dalam buku itu untuk membalikkan keadaan. Setelah Think Like A Man, posisi tangga box office ditempati film animasi 3D buatan Sony, The Pirates! Band of Misfits dengan pendapatan 11,4 juta dolar AS selama tiga hari pemutaraannya, dua juta dolar AS lebih tinggi dari proyeksi. Drama milik Warner Bros The Lucky One dibintangi Zac Effron dan Taylor Schilling, tergeser ke posisi tiga dalam pekan keduanya di box office dengan pendapatan 11,32 juta dolar AS pada akhir pekan ini dan pendapatan keseluruhan 39,9 juta dolar sejak diluncurkan. Meskipun telah enam pekan bertahan di box office, The Hunger Games tetap mantap di posisi keempat sedang film komedi romantis The Five Year Engagement buatan Universal menempati posisi kelima dalam debutnya di box office. Lima film lain melengkapi daftar film paling populer di Amerika Utara akhir pekan ini adalah Safe (7,7 juta dolar AS), The Raven (7,3 juta dolar AS), Chimpanzee (5,5 juta dolar AS), The Three Stooges (5,4 juta dolar AS), dan The Cabin in The Woods (4,5 juta dolar AS).(ant)

Lindsay Lohan Perankan Elizabeth Taylor AKTRIS dan penyanyi Lindsay Lohan baru saja menandatangani kontrak untuk peran sebagai Elizabeth Taylor dalam film ‘Lifetime’, sebagaimana diberitakan People. Ditambah Lohan merasakan kedekatan secara personal dengan legenda Hollywood itu sebelumnya. Sebab pada 2006 silam saat usia Lohan baru menginjak 19 tahun, Lohan berpose sebagai Taylor untuk sebuah majalah. Fotografernya adalah perancang busana papan atas, Karl Lagerfeld, hasil jepretannya juga digunakan sebagai sampul majalah tersebut. Dalam foto tersebut Lohan benar-benar bertransformasi sebagai Taylor. Kecantikan dan keagungan mereka benar-benar serupa, sehingga akhirnya Lohan pun mendapatkan kesempatan untuk memerankan Taylor dalam film ‘Lifetime’. Sampai sekarang belum jelas siapa aktor yang akan menjadi lawan main Lohan untuk memerankan karakter Richard Burton dalam ‘Liz and Dick’. Aktor Russell Crowe dan Clive Owen disebut-sebut akan memerankan karakter tersebut berdasarkan voting dilakukan People pada pekan ini.(ant)

07:30 Selebrita Pagi 08:00 Ups Salah 08:30 Mendadak Jutawan 09:00 Pelangi 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-Citaku 14:00 Dunia Air 14:30 Koki Cilik 15:00 Brownies 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Indonesiaku 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Jam Malam 00:30 Sport7 Malam **m31/G

Anggun Tetap Indonesia, Meski wakili Perancis Di Eurovision PENYANYI Indonesia Anggun C Sasmi mewakili negara bangga bisa mewakili Perancis di ajang unik Eurovision Song Perancis dalam acara final kontes lagu Eurovision 2012 akan Contest. Diakuinya lagu Echo (Kau Dan Aku) tentang esensi kehidupan diadakan di Ibu Kota Azerbaidjan, Baku 26 Mei mendatang. “Harapan saya di Eurovision hanya satu ya bisa menjadi - cinta antara dua orang. Meskipun gaya hidup kita ingar-bingar pemenang,” ujar Anggun C Sasmi usai melantumkan lagu You modern dan obsesi consumist kita, apa benar-benar penting dan and I dalam acara London Eurovision Party berlangsung di The memberi makna hidup kita adalah “Anda dan saya”, ujar Anggun. Dalam rangka mengikuti kontes itu, Anggun Shadow Lounge, Soho, Minggu malam. telah berkeliling negara-negara di Eropa untuk Dalam kontes diikuti penyanyi seluruh wilayah mempromosikan lagunya tersebut. Dalam Eropa itu Anggun akan mempromosikan lagu baru video klip, Anggun tampil seksi dalam berjudul Echo (You and I).“Saya akan membawakan balutan busana rancangan desainer lagu dari album terbaru saya,” ujar Anggun yang kondang Jean-Paul Gaultier. menjadi duta Goodwill Ambassador untuk Perempuan memulai karir di IndoOrganisasi Pangan dan Pertanian Perserikatan nesia dengan lagu Dunia Aku Punya dan Bangsa-Bangsa dalam memerangi kelaparan Mimpi tersebut memilih untuk medunia. ngejar karir internasional dengan Anggun yang tampil bersama finalis ajang meninggalkan Indonesia pada tahun kontes lagu di Eropa mengakui bahwa 1996. meskipun ia menjadi wakil untuk Perancis Album pertamanya sejak berkarir tetapi dirinya masih tetap orang Indonesia. di luar negeri La neige au Sahara alias “Tubuh saya masih orang Indonesia,” Snow on the Sahara menembus ujar Anggun lagi yang tampil dengan anggun tangga lagu Eropa, bahkan dunia mengunakan busana rancangan disainer internasional pada tahun 1997. terkemuka saat melantumkan lagu Echo Anggun bisa mewakili Perancis liriknya ditulis Anggun bersama William karena saat ini memang sudah berRousseau serta composer Jean Pierre Pilot kewarganegaraan Perancis. Meski dan William Rousseau. demikian, Anggun mengaku tak meAnggun mewakili Perancis di Eurovision ninggalkan ke-Indonesia-annya. Anggun Song Contest 2012 adalah bintang intertetap merasa dirinya sebagai orang nasional yang telah berhasil menjual lebih Indonesia. dari dua juta copy album di seluruh Eropa. Dalam London EuroAnggun sebelumnya sukses dengan vision Party berlangsung Album pertamanya sejak berkarir di luar di club terkemuka di negeri La neige au Sahara alias Snow on Soho, hingga pukul the Sahara menembus tangga lagu Anggun/ tiga pagi para peEropa, bahkan dunia internasional pada ngunjung dengan tahun 1997. Anggun hijrah ke Eropa untuk memulai karir internasionalnya. antusias ikut berjoget bersama Anggun. Dari lebih 200 pengunjung hanya ada segelintir penonton London, Amsterdam dan akhirnya Paris, dimana dia bertemu produser telah berhasil membuat lagu Celine Dion menjadi sukses. asal Indonesia diantaranya Yunita Anggraini, telah menetap di Bersama-sama mereka menciptakan Salju memukau On The London lebih dari tujuh tahun. “Saya sangat terkesan bisa menyaksikan penampilan Anggun,” Sahara memetakan di 33 negara di seluruh dunia dan membuat 5 besar di Eropa dan AS Top 20, Anggun memutuskan menjadi ujar Yunita bercita cita bisa melanjutkan pendidikan di Inggris. “Mbak Anggun itu orangnya friendly banget, cantik dan keren, warganegara Perancis. Anggun pernah bernyanyi bersama artis besar seperti Peter nggak cuma bahasa Indonesia nya, Anggun dengan lagu Perancis Gabriel, Pras (The Fugees), Julio Iglesias dan Michael Bolton sangat nya juga keren,” ujar Yunita tinggal di daerah Picadilly.(ant)

Sidikalang Musik Blender #5 Lindsay Lohan

Cara Unik William-Kate Rayakan Ultah Pernikahan SETAHUN lalu pernikahan agung putra mahkota kerajaan Inggris, William dengan Kate Middleton di Westminster Abbey berlangsung dengan agung. Namun William-Kate merayakannya dengan cara sederhana, sebagaimana diberitakan People. Pada hari ulang tahun pernikahannya, William-Kate justru menghadiri pernikahan salah satu teman dekat Kate, di sebuah gereja kecil setempat. “Tamu yang hadir dalam pernikahan kerabat Kate itu, membuat suasana terasa seperti kembali ke pernikahan agung William-Kate. Karena kehadiran mereka dirasa sangat penting para undangan,” ujar fotografer istana, Mark Stewart, saat itu juga berada di sana. Turut hadir pula adik perempuan Kate, Pippa Middleton, serta temanteman dekat pasangan Duke dan Duchess of Cambridge, seperti Emilia d’Erlanger, Nicholas dan Alice van Custem, Harry Aubrey-Fletcher beserta istrinya Louise, serta Tom van Straubenzee. William-Kate tiba di lokasi saat cuaca mendung dan gerimis, sehingga pasangan itu datang dan berlari menyusuri jalan setapak gereja di bawah perlindungan payung, ujar Stewart. Namun pada akhirnya pasangan kerajaan ini merayakan ulang tahun Pangeran William dan Kate Middleton pernikahan mereka di sebuah rumah pedesaan di Anglesey,Wales Utara.(ant)

CLASMILD bekerjasama dengan Sidikalang Underground Community (SUC) menggelar acara pagelaran musik bertema Sidikalang Musik Blender#5. Gebyar musik berlangsung Sabtu (28/4) di Gedung Olah Raga (GOR) menghadirkan bandband ternama asal kota Sidikalang dan Medan. Pagelaran tersebut juga sudah menjadi agenda tahunan Komunitas pemuda Sidikalang agar dapat mengekspresikan hobby juga menjadi media penyaluran bakat Generasi Muda melalui seni. Sidikalang Musik Blender #5 jugadimaksudkansebagaiwadah menampung kreativitas generasi muda dalam bidang seni. Mempersatukan dan mempererat tali persaudaraan generasi muda. Menumbuhkan semangat Patriotisme dan Nasionalisme melalui seni juga mengekspresikan semangat kepahlawanan melalui seni, tutur Pardomuan simbolon selaku ketua panitia. Sesuai dengan slogan Clasmild Talk less do more (sedikit

Pentas Sidikalang Musik Blender #5 berlangsung meriah bicara banyak bekerja) inilah dilakukan komunitas anak-anak Dairi ini. ”Clas Mild tidak akan

pernah berhenti memberikan hiburan kepada pecinta musik”, ujar Sulianto selaku Branch

Manager didampingi Edi Agustin selaku Sales Supervisor PT NTI Indonesia (Clas Mild). (m19)

Ekonomi & Bisnis

WASPADA Selasa 1 Mei 2012


2012, Harga BBM Tak Naik



Menko Perekonomian Hatta Rajasa (kiri) membubuhkan tanda tangan disaksikan Menteri Perumahan Rakyat Djan Faridz (kanan) dan Menteri ESDM Jero Wacik saat acara penandatanganan kerjasama Kemenpera dan Kementerian ESDM di Jakarta, Senin (30/4). Kesepakatan tersebut mengenai dukungan penyediaan tenaga listrik, gas rumah tangga dan pengeboran air tanah bagi masyarakat berpenghasilan rendah.

Kualitas BBM Bersubsidi RI Paling Rendah JAKARTA (Waspada): Kualitas bahan bakar minyak (BBM) bersubsidi, khususnya premium, masih di bawah standar BBM bersubsidi di negara-negara lain. Untuk itu, pemerintah lebih baik memperbaiki kualitas premium sebelum menaikkan harga. Koordinator Komite Penghapusan Bensin Bertimbal, Ahmad Safrudin, menjelaskan, kualitas premium Indonesia tidak memenuhi standar negara-negara Eropa, bahkan, standar Euro 1 sekalipun. Selain

kadar oktan hanya 88, olefin content premium masih di atas 35 persen dan kadar aromatic serta benzene lebih dari 5 persen dan 2,5 persen. Sementara itu, spesifikasi Euro 2 memiliki persyaratan kadar belerang maksimal 500 ppm, kadar olefin maksimal 35 persen, kadar aromatic maksimal 5 persen, dan kadar benzene maksimal 2,5 persen. Safrudin mengatakan, mahalnya harga BBM di luar negeri lebih karena spesifikasi telah tinggi. Ia mencontohkan, bensin reguler di Malaysia dipatok Rp7.000 per liter dengan oktan 91 dan telah memenuhi standar Euro 4. Bahkan, harga BBM di Amerika Serikat setara dengan Rp5.000 per liter dan telah memenuhi standar Euro 5. Harga BBM di Vietnam

Rp9.000 per liter dengan standar Euro 2, India Rp12.000 per liter (Euro 4), dan Jepang Rp17.000 per liter (Euro 5). “Adalah sangat wajar pula premium di Indonesia dipasarkan dengan harga Rp4.500 per liter, karena kualitasnya yang lebih rendah,” kata Safrudin di Jakarta, Senin (30/4). Vietnam telah mengadopsi teknologi kendaraan bermotor Euro 2 sejak 2006, sehingga mengubah spesifikasi BBM dengan standar Euro 2. Langkah ini diikuti India yang mengadopsi Euro 4 sejak 2010. Pemerintah sejak 1 Januari 2007 telah menetapkan standar Euro 2. Namun, langkah itu tidak diikuti dengan penyesuaian kualitas BBM yang dipasarkan di Indonesia dengan syarat berstandar Euro 2.


Head of Telkomsel Branch Banda Aceh Departement Ihsan memberi keterangan mengenai program “Rezeki Aceh” kepada wartawan, saat peluncuran program loyalti bagi pelanggan Telkomsel di Aceh tersebut, Senin (30/4).

Telkomsel Luncurkan Program “Aceh Rezeki” BANDAACEH (Waspada): Telkomsel kembali memberikan apresiasi kepada pelanggan simPATI, Kartu As dan Kartu Facebook khusus nomor HLR Aceh melalui program “Rezeki Aceh”. Periode program berlaku 1 Mei-31 Juli 2012. Selain menyediakan hadiah utama berupa satu Xenia tipe M Deluxe 1000 cc, pada program ini pelanggan berkesempatan mendapatkan hadiah bulanan dan mingguan yang menarik. “Program Rezeki Aceh merupakan salah satu apresiasi Telkomsel kepada pelanggan setia agar mereka terus menggunakan produk Telkomsel,” ujar Ihsan, Head of Telkomsel Branch Banda Aceh Department pada peluncuran program “Rezeki Aceh” di Banda Aceh, Senin (30/4)

Untuk mengikuti program Rezeki Aceh ini, kata dia, pelanggan tidak perlu melakukan registrasi khusus, tapi cukup mengumpulkan poin melalui dua cara, yaitu pelanggan kartuAs langsung mendapat 15 poin dari setiap aktivasi paket Jagoan Serbu Siang atau Malam. Sedangkan pelanggan simPATI, akan langsung mendapat 25 poin setiap kali mengaktifkan Paket Talkmania Siang atau Malam. “Selain itu, bagi pelanggan simPATI, kartu As dan Kartu Facebook yang melakukan panggilan percakapan di luar paket Jagoan Serbu dan Talkmania akan mendapat tambahan dua poin dari setiap kelipatan Rp.200 selama panggilan percakapan berlangsung,” kata I h s a n d i d a m p i n g i He n i Purweni, Corporate Commu-

nication Sumatera Division. Ditambahkan, untuk hadiah mingguan diberikan pulsa Rp10 ribu bagi 100 pelanggan yang memiliki poin tertinggi pada periode minggu tersebut. Untuk hadiah bulanan berupa lima unit HP Android, tiga unit Samsung Galaxy Tab 8.9 inch, dan 1 paket emas seberat 3 mayam, diberikan kepada pelanggan yang memiliki poin tertinggi pada periode bulan tersebut. Untuk mengetahui jumlah poin yang dimiliki atau informasi lainnya tentang program ini, pelanggan dapat mengecek melalui SMS ke 3966 dengan mengetik ACEH#POIN, tanpa dikutip bayaran alias gratis. Selain itu pelanggan juga dapat menghubungi Call Center Telkomsel 155 (gratis) atau Contact Center 188 (berbayar). (b04)

Pemerintah, dia melanjutkan, cenderung memanipulasi jika membandingkan hargaharga BBM di berbagai negara di Asia. Padahal, kualitas premium lebih rendah dibandingkan BBM di negara lain. “Apabila hendak menaikkan harga premium, seyogyanya pemerintah meningkatkan kualitasnya terlebih dahulu. Sebab, apabila tidak, maka konsumen harus membayar lebih mahal atas per liter bensin yang diperoleh,” katanya.

Dengan memperbaiki kualitas premium, lalu menaikkan harganya, pemerintah dianggap tidak bertentangan dengan undang-undang. Langkah itu juga berpotensi dapat disinergikan dalam konteks penghapusan subsidi BBM. “Akan rasional apabila pemerintah melakukan penyesuaian terhadap harga jual premium, mengingat adanya peningkatan biaya produksi akibat penyesuaian kualitas,” katanya. (vvn)

BANGKALAN (Waspada): Menteri Koordinator Bidang Perekonomian Hatta Rajasa memprediksi hingga akhir 2012 harga bahan bakar minyak (BBM) bersubsidi tidak akan mengalami kenaikan. Alasannya, harga minyak mentah dunia saat ini masih berada jauh di bawah harga 120,75 dolar AS per barel. “Sekarang masih jauh di bawah itu, jadi tidak mungkin (naik). Hingga akhir 2012, kita sulit menaikkan harga BBM, hanya konsumsi BBM sekarang ini perlu dikendalikan,” ujar Hatta Rajasa saat menghadiri resepsi pernikahan putra Bupati Bangkalan, Madura, kemarin. Hatta menjelaskan saat ini masih dikaji pemerintah adalah kebijakan penghematan BBM bersubsidi, salah satunya dengan melakukan pembatasan. Namun rencana tersebut hingga kini belum bisa diputuskan karena masih harus dipikirkan lebih luas dan diteliti dengan baik. “Beberapa alternatif sedang dipikirkan dan dikerjakan oleh Menteri ESDM. Pada saat yang tepat di bulan Mei nanti akan disampaikan. Intinya harus bisa tersosialisasi dengan baik dan

perlu pengendalian, bukan pembatasan,” ungkapnya. Hatta menambahkan, ke depan harus dipikirkan jika BBM tidak naik hingga akhir tahun, APBN tetap sehat dan pertumbuhan bisa maksimal. Bentuk pengendalian agar APBN tetap sehat minimal tidak ada penyelundupan dan penyalahgunaan BBM. Misalnya, perkebunan dan pertambangan besar tidak boleh menggunakan BBM bersubsidi. “Caranya pemerintah daerah harus ikut mengawasi, yakni dengan membentuk tim pengendali,”jelasnya. Sementara itu, anggota Komisi VII DPR Satya W Yudha mengatakan, pemerintah harus konsisten melaksanakan pembatasan BBM bersubsidi meski sebenarnya kebijakan tersebut tidak menghasilkan dana penghematan subsidi secara signifikan. Menurutnya, pemerintah juga harus mengambil langkah penting lain dalam pengendalian penggunaan BBM,yakni memerangi praktik penyelundupan ke negara tetangga. “Pemerintah kali ini harus konsisten, tidak boleh maju mundur lagi dalam menerap-

kan kebijakan pembatasan penggunaan BBM bersubsidi. Masyarakat jangan lagi dibuat bingung. Konsistensi pemerintah menjadi taruhan kepercayaan seluruh rakyat,” tuturnya. Direktur Eksekutif ReforMiner Institute Pri Agung Rakhmanto menilai sistem kartu kupon dengan nama dan alamat yang jelas cukup ideal untuk diterapkan guna mengamankan program pembatasan BBM bersubsidi. Namun, pemerintah harus bisa menjamin identitas tunggal dari orang yang namanya tertera dalam kupon. Kepala Badan Pengatur Hilir Minyak dan Gas Bumi (BPH Migas) Andy Sommeng menuturkan sampai saat ini pihaknya masih menunggu keputusan pemerintah menyiapkan pengawasan pembatasan konsumsi BBM bersubsidi. Dia mengaku belum mendapat informasi mengenai alat kendali konsumsi yang dipilih pemerintah. “Sekarang masih berada di pihak Kementerian Koordinator Bidang Perekonomian, saya masih menunggu belum ada informasi,” jelasnya.(okz)

DP Murah Dilarang, Penjualan Mobil Anjlok J A K A RTA ( Wa s p a d a ) : Perusahaan otomotif PT Astra International Tbk memprediksi penjualan kendaraan bermotor terutama mobil, akan terganggu pada semester II tahun ini. Hal itu disebabkan adanya rencana pemerintah untuk menerapkan pembatasan bahan bakar minyak (BBM) bersubsidi maksimal untuk kendaraan 1.500 cc dan pemberlakuan uang muka kredit (DP) bagi kendaraan bermotor. “Motor akan stagnan jangka pendek, terutama repeat order, pembelian ke sekian. Kalau mobil ada, tapi jangka pendek,” kata Kepala Divisi Public Relations Astra, Yulian Warman, di Jakarta, Senin (30/4). Menurut dia, sebagai sebuah kesatuan unit bisnis, Astra tetap mengacu ke Gabungan

Industri Kendaraan Bermotor Indonesia (Gaikindo). Dia mengatakan, Gaikindo sudah melakukan pembicaraan dengan pemerintah terhadap rencana penerapan aturanaturan itu. “Kalau sudah jelas arah pemerintah ke mana, kami ikut. Sekarang belum ada detailnya,” katanya. Dia menjelaskan, penjualan mobil per Maret 2012 sebanyak 255 ribu unit untuk semua merek di Indonesia. Astra yang memiliki lima merek mobil telah berhasil menjual sekitar 55 persen dari total penjualan itu. “Kalau itu dikalikan empat, bisa sejuta unit pada tahun ini. Kalau semester II belum ada masalah. Tapi, kalau DP dan BBM berlaku, maka itu akan menjadi tantangan,” ujarnya. Kendati demikian, Yulian

mengaku optimistis dampak yang ditimbulkan terkait aturan baru itu tidak akan terlampau besar. Sebab, dalam jangka panjang, masyarakat tetap memerlukan kendaraan, karena belum tersedianya transportasi massal yang dianggap nyaman. Dia mengaku, dari sisi perusahaan pembiayaan, Astra memiliki beberapa anak usaha, di antaranya Toyota Astra Finance, Federal International Finance, dan Astra Credit Company. Yulian mengatakan, kredit macet di perusahaan pembiayaan milik Astra terhitung masih kecil. “Itu nggak ada masalah. Tapi, kalau dari sisi global akan semakin sehat, DP untuk perusahaan pembiayaan semakin sehat,” katanya.(okz)

Izin Bank Asing Di Indonesia Terlalu Mudah JAKARTA (Waspada): Bank Indonesia (BI) dan Otoritas Jasa Keuangan (OJK) diminta untuk terus memperjuangkan asas resiprokal mengingat begitu mudahnya bank asing berekspansi di Indonesia. Asas kesetaraan ini harus diterapkan karena kemampuan industri perbankan Indonesia setara dengan perbankan di luar negeri dalam mengelola keuangan. “Bank-bank Indonesia kalau ingin buka cabang di luar negeri diperlakukan tidak adil, ada sejumlah persyaratan yang mengganjal,” ujar Direktur Utama Bank BJB Bien Subiantoro, di Hotel Four Season, Jakarta, Senin (30/4). Menurut Bien, pembahasan soal asas kesetaraan harus dimulai dengan Singapura, karena bank Singapura banyak beroperasi di Indonesia. “Setelah Singapura, baru negara lain,” tegasnya. Sebenarnya, menurut Bien, pembatasan izin usaha bank nasional di luar negeri oleh beberapa negara sangat tidak relevan, karena menurut Bien kemam-

puan perbankan nasional dalam mengelola keuangan tidak perlu diragukan lagi. Menurutnya, perbankan nasional sangat tangguh dalam menghadapi krisis global. “Jadi, sangat tidak masuk akal jika otoritas bank di luar negeri selalu menganggap risiko perbankan Indonesia sangat besar, kita dianggap warga kelas dua dan negara dengan perbankan yang berisiko, padahal kita sangat bagus mengelola bank,” jelasBien. Bien pun meminta BI untuk berani menerapkan one on one agreement dengan bank asing. Artinya, apabila ada satu cabang bank Singapura buka di India maka India juga membuka satu cabang di Singapura, termasuk mesin ATM-nya. “Kita bisa lihat di Bandara Changi Singapura, ATM State Bank of India sangat banyak, sementara bank nasional kita tidak satu pun ada disana. Padahal mereka punya cabang di Indonesia banyak sekali, dan mestinya kita bisa menerapkan ini dengan mereka,” pungkas Bien.(okz)

Harga Jual Emas Antam Turun Sampai Rp50 Ribu JAKARTA (Waspada): Harga emas lokal dijual PT Aneka Tambang Tbk (ANTAM) mengalami penurunan harga. Tapi di sisi lain, harga beli kembali emas (buy back price) masih di Rp489.000 per gram. Seperti dikutip dari, Senin (30/4), emas ukuran 1 gram berada di posisi Rp545.000, atau selisih Rp500 dari harga Jumat lalu yaitu Rp545.500. Emas dua gram turun Rp1.000, dari harga Rp1.050.000 menjadi Rp1.051.000. Emas 2,5 gram, berada di Rp1.302.500, berselisih Rp1.250 dari harga Rp1.303.750. Harga emas tiga gram Rp1.555.000, berselisih Rp1.500 dari harga Rp1.556.500. Harga emas empat gram Rp2.060.000, atau selisih Rp2.000 dari harga hari Jumat Rp2.062.000. Sedangkan harga emas lima gram Rp2.575.500, selisih Rp2.500 dari harga Jumat Rp2.578.000. Harga emas 10 gram Rp5.110.000 berselisih Rp5.000 dari harga Jumat

Rp5.115.000. Lalu harga emas 25 gram berselisih Rp12.500, dari harga Rp12.712.500 menjadi Rp12.700.000. Emas 50 gram juga mengalami penurunan dari Rp25.360.000 menjadi 25.335.000, selisihnya Rp25.000. Harga emas 100 gram Rp50.620. 000 berselisih Rp50.000 dari harga Jumat lalu Rp50.670.000. Dan emas 250 gram juga mengalami penurunan harga yaitu Rp126.450.000 dari harga sebelumnya Rp126.575.000. Sementara itu, seperti dilansir dari Reuters, prospek membeli emas lebih aman dengan dolar di bawah tekanan yang lebih rendah dari perkiraan ekonomi AS. Data dan spekulasi Federal Reserve memudahkan kebijakan untuk mendorong pertumbuhan. Harga emas spot tidak berubah, masih di 1.663,04 dolar AS per ounce. Sementara harga emas pada Jumat lalu ada di posisi 1.667,11 dolar AS per ounce. (okz)


SAYUR PETAI : Seorang pedagang tampak menunjukkan sayur petai di pasar Berastagi, Kabupaten Karo Sumatera Utara, beberapa waktu lalu. Sayur petai asal Sumut banyak diminati para wisatawan yang berkunjung ke Tanah Karo tersebut. Harga sayur petai yang sudah dikupas Rp 50.000 perikat, sementara harga sayur petai yang belum dikupas Rp 35.000 perikat.

PTKP Naik, Penerimaan Pajak Turun Rp30 T J A K A RTA ( Wa s p a d a ) : Pengamat Perpajakan Universitas Indonesia Gunadi menilai rencana pemerintah menaikkan besaran Penghasilan Tidak Kena Pajak (PTKP) dari Rp15,8 juta menjadi Rp24 juta per tahun dapat menurunkan potensi penerimaan pajak 2-3 persen atau Rp16-30 triliun per tahun. Namun, turunnya potensi penerimaan negara tersebut dapat diimbangi dengan peningkatan daya beli masyarakat sekitar 30 tahun. “Terdapat potensi penurunan penerimaan sekitar Rp16-30 triliun atau 23 persen dari total penerimaan pajak di luar bea cukai sebesar Rp850 triliun,” kata Gunadi di Jakarta, Senin (30/4). Dari perhitungan Gunadi, batas minimal PTKP menjadi Rp24 juta per tahun setara dengan kenaikkan sebesar 40 persen. Dengan kenaikan tersebut, potensi penurunan penerimaan negara dari pajak bisa mencapai Rp16 triliun hingga Rp30 triliun.

Gunadi menyatakan, meski terdapat penurunan setoran pajak, kenaikan batas minimal PTKP juga bisa mengurangi beban masyarakat dari rencana pemerintah menaikkan harga bahan bakar minyak dan inflasi. Menurut dia, rencana pemerintah untuk menaikkan PTKP menjadi Rp24 juta per tahun sudah ideal, karena sesuai dengan upah minimum regional (UMR) dan pengeluaran orang miskin. “Turunnya PPh akan diringankan oleh naiknya PPN belanja wajib pajak dan PPN dari kenaikan BBM serta inflasi umum,” paparnya. Sebelumnya, Menteri Keuangan Agus Martowardojo mengatakan, kenaikan PTKP menjadi Rp24 juta per tahun dapat menghilangkan penerimaan pajak dari PPh sebesar Rp12 triliun per tahun. “Kalau dilaksanakan per 1 Juli, maka kita akan kehilangan Rp6 triliun,” katanya. Seperti diketahui, wacana mengenai besaran PTKP telah

muncul sejak lama. Dirjen Pajak Kementerian Keuangan saat itu, Darmin Nasution, (kini Gubernur Bank Indonesia) pernah mengungkapkan revisi PTKP bisa dilakukan pemerintah setiap saat. Kenaikan PTKP ini biasanya ada kaitannya dengan penyesuaian tingkat inflasi. Untuk mengubah PTKP, pemerintah terlebih dahulu harus melihat kondisi perekonomian. Selanjutnya, Menteri Keuangan cukup berkonsultasi dengan DPR lalu menerbitkan Peraturan Menteri Keuangan (PMK). Darmin menjelaskan, PTKP hadir untuk menjawab laju inflasi di tanah air. Maksudnya, jika inflasi yang terjadi dalam beberapa tahun terakhir cukup tinggi, dalam satu tahun pasti akan dipertimbangkan kembali. Terakhir kali, pemerintah telah menaikkan batas minimal PTKP menjadi Rp15 juta. Sebelumnya, PTKP yang ditetapkan pemerintah adalah Rp13 juta per tahun. (vvn)

Ekonomi & Bisnis


WASPADA Selasa 1 Mei 2012

Harga Elpiji Di Medan Naik Lagi MEDAN (Antara): Harga gas elpiji ukuran 12 kg di pasar Medan naik lagi atau sudah Rp78.000 per tabung meski Pertamina sudah menegaskan belum menaikkan harga tebus ke distributor. “Harga gas elpiji memang naik lagi jadi Rp78.000 per tabung kalau diantar sampai rumah dan Rp77.000 per tabung kalau tidak diantar.Sebelumnya masih Rp75.000-Rp76.000 per tabung,” kata pedagang gas di kawasan Marindal Medan J Purba, Minggu (29/4) malam. Harga elpiji itu naik sejak akhir Maret dan semakin mahal pada awal April hingga pekan ini. Purba akui, harga tebus dari

agen memang belum naik. Tetapi, kata dia, pasokan ketat sehingga untuk tetap untung dan mengantisipasi adanya kenaikan harga tebus menyusul rencana pembatasan bahan bakar minyak bersubsidi, pedagang memang menaikkan harga. Apa boleh buat, harga terpaksa dinaikkan karena hampir semua pedagang juga menaikkan harga jual elpiji itu, katanya. Harga elpiji 12 kg di awal Maret masih Rp72.000 -75.000 per tabung. Assistant Customer Relation Fuel Retail Marketing Region I Marketing and Trading Directorate PT Pertamina, Sonny Mirath ketika dikonfirmasi

menegaskan Pertamina belum ada menaikkan harga jual dan pasokan juga tetap lancar ke distributor. Dia mengakui ada kenaikan permintaan gas itu hingga menjadi 1.100 metrik ton per hari tetapi permintaan yang naik itu bisa dipenuhi karena kapasitas tangki penyimpanan elpiji di Pangkalan Brandan Langkat sudah 6.000 metrik ton dimana pasokannya dari Tanjung Uban. “Pertamina akan mempertanyakan distributor termasuk minta pengusahanya meninjau soal harga kenaikan elpiji itu ke agen.Kalau penjualan di pedagang bukan lagi tugas Pertamina,” katanya.

Juli, Disperindag Gelar Pasar Murah Di 140 Titik



Suasana pekerja menjahit tekstil menjelang Hari Buruh Internasional di PT Yeon Heung Mega Sari di Kawasan Berikat Nasional, Jakarta Utara, Senin (30/4). Pada peringatan Hari Buruh Internasional 1 Mei 2012, kaum buruh Indonesia menuntut pemerintah untuk menjalankan program jaminan sosial, upah layak bagi buruh, serta menghapus sistem perekrutan kerja secara alih daya.

MEDAN (Waspada) : Sebagai upaya untuk menjaga gejolak harga menjelang perayaan hari besar, pihak Dinas Perindustrian dan Perdagangan (Disperindag) Medan akan mengadakan pasar murah di 140 titik di 21 Kecamatan, dan 151 Kelurahan. Hal tersebut dikatakan Kepala Dinas Perindustrian dan Perdagangan Medan Syahrizal Arif kepada Waspada, Senin (30/4). “Tahun ini kita akan menggelar pasar murah di 140 titik, jumlah ini sedikit lebih meningkat dari sebelumnya yang hanya terdapat 134 titik saja. Penambahan ini dilakukan karena kita melihat pada tahun sebelumnya ada daerah yang belum

dilakukan pasar murah padahal daerah tersebut memang layak untuk digelar pasar murah,” ujarnya. Syahrizal menambahkan nantinya pasar murah ini akan digelar selama sebulan lebih. Saat ini pihak Disperindag Medan terus berupaya dan bekerjasama dengan camat dan kelurahan masing-masing daerah untuk menentukan daerah mana yang memang pantas digelar pasar murah nantinya. Sebab pasar murah ini digelar memang untuk daerah masyarakat yang kurang mampu. Dia mengaku, dalam satu kelurahan saja nantinya ada 5 sampai 7 pasar murah yang didirikan seperti yang dilakukan

untuk daerah belawan pada tahun lalu, sebab menurutnya mayoritas warga belawan tergolong kurang mampu. Sedangkan barang yang dijual di pasar murah itu nantinya seperti beras, minyak, gula, tepung, sirup, kacang, dan lainnya. Menurutnya, pasar murah sudah digelar sejak tahun 2002. Hal ini dilakukan sebagai upaya menjaga gejolak harga barang menjelang perayaan hari besar, sebab biasanya menjelang hari itu seluruh harga akan naik. Syahrizal mengatakan, dalam hal ini pihak Disperindag Medan hanya bertugas untuk memfasilitasi kekurangan barang yang terjadi nantinya di pasar murah. (cdu)

JAKARTA (Waspada): Bertempat di RS Dhuafa, Musirawas, Jumat lalu, PT Sidomuncul dengan produk unggulan Tolak Angin dan Kuku Bima Energi bersama Perdami Sumatera Selatan & Kementerian PDT memberikan bantuan kepada 200 warga miskin penderita buta katarak. Acara berbarengan dengan kunjungan kerja Menteri PDT itu realisasi dari pelaksanaan MoU (memorandum of understanding) yang dilakukan sebelumnya diikuti juga Menteri KKP dan Menakertrans RI beserta rombongan dan perwakilan dari PT Sidomuncul juga Perdami yang meninjau langsung pelaksanaan operasi katarak. Sebelumnya SidoMuncul bersama Perdami telah melakukan penandatanganan perjanjian kerjasama dengan Menteri Pembangunan Daerah Tertinggal (PDT) dan PBNU kerjasama bakti sosial operasi

katarak di daerah tertinggal dan dengan RSCM Kirana untuk wilayah Jakarta dan sekitarnya. Adapun daerah yang telah dibantu sampai 2012 ini 21 propinsi yaitu Aceh, Sumatera Utara, Sumatera Selatan, Sumatera Barat, Batam (Kepulauan Riau), Lampung, Jabodetabek, Banten, Jawa Barat, Jawa Tengah, DIY, Jawa Timur, Bali, NTT, NTB, Gorontalo, Maluku, Sulawesi Selatan, Sulawesi Utara, Kalimantan Selatan, Kalimantan Timur dan Kalimantan Barat. Jumlah warga kurang mampu yang telah dioperasi pada 2012 ada 3.408 pasien. Sementara yang telah terjadwal untuk operasi katarak sejauh ini 9.527 orang. Sehingga total pasien katarak yang telah di operasi kerjasama PT Sidomuncul bersama Perdami sejak 2011 sampai

sekarang sebanyak 9.408. Dirut PT Sidomuncul Irwan Hidayat mengatakan: “Kami senang bisa melakukan kerjasama dengan berbagai pihak dalam baksos katarak ini. Tanpa bantuan dari pihak lain tentunya program ini tidak dapat berjalan dengan baik. Sekali lagi kami mengucapkan terima kasih kepada semua pihak yang telah membantu selama ini. Semoga kedepannya akan semakin banyak pihak yang peduli terhadap masalah buta katarak di Indonesia”. Program bantuan operasi katarak bagi masyarakat tidak mampu pada tahun 2011 telah mendapatkan penghargaan “Asia Responsible Entrepreneurship Award 2011” dari Enterprise Asia melalui program corporate social responsibility (CSR) operasi katarak gratis.(rel)

Pemerintah Tak Memihak Petani Sidomuncul Salurkan Bantuan Di Musirawas MEDAN (Waspada):

Pemerintah hingga saat ini dinilai belum memihak petani, kata Ketua Himpunan Kerukunan Tani Indonesia (HKTI) pusat Martin Hutabarat kepada wartawan, Senin (30/4). Dia berbicara pada acara rapat kerja daerah HKTI Sumut dan HUT ke-39 organisasi itu, di Hotel Dharma Deli, Medan. “Keberpihakan pemerintah kepada petani belum nyata. Impor bahan pangan yang nilainya Rp125 triliun tiap tahun bukti tidak adanya perhatian pemerintah meningkatkan kesejahteraan petani,” katanya. “Itulah nilai belanja bahan pangan yang kita pasok (impor) dari luar negeri untuk 2011,” jelasnya. Hadir juga di acara itu Wakil Sekjen HKTI Pusat Pangihutan Siagian, Ketua HKTI Sumut Zaman Gomo Mendrofa, Wakil Ketua HKTI Sumut Tosin Gurning, ME Girsang dan Dartati Damanik.

Waspada/Armin Nasution

DARI kiri ke kanan Ketua HKTI Sumut Zaman Gomo Mendrofa, Ketua HKTI Pusat Martin Hutabarat , Bendahara HKTI Sumut Nova Juli Rosana, Wakil Ketua HKTI Sumut Dartati Damanik, dan pengurus HKTI Sumut lainnya saat HUT ke-39 organisasi itu di Hotel Dharma Deli Medan, Senin (30/4). Kemudian Bendahara Nova Juli Rosana, Wakil Bendahara Eka Wahyu, Wakil Sekretaris Parlin Doni Sipayung, Ketua HKTI Medan Rinaldi Amri, dan pengurus HKTI lain. Kemudian tokoh lain yang datang Ketua Partai Gerindra Sumut Ramses Simbolon, Dirut Bank Sumut Gus Irawan Pasaribu, dll. Menurut Martin, besarnya belanja bahan pangan itu, antara lain untuk impor beras

sebanyak tiga juta ton, kedelai, jagung, buah-buahan dan gula. “Padahal, pemerintah selalu mengatakan kalau kita sudah swasembada beras, tapi nyatanya impor tetap dibiarkan bahkan jumlahnya makin besar,” katanya. Begitu juga gula, Indonesia memiliki kebun tebu cukup luas tapi sampai sekarang impor gula masih dilakukan. Padahal, dari segi potensi, kebun tebu yang ada bisa

dimanfaatkan menggenjot produksi bahkan bila perlu membuka lahan pertanian yang baru, tuturnya. Karena itu, dalam HUT kali ini, kata Martin, Ketua Umum HKTI Prabowo Subianto berkomitmen memperjuangkan agar impor bahan pangan dipangkas hingga akhirnya dihentikan. Bila pemerintah serius memperjuangkan nasib petani menuju kesejahteraan, biaya impor bahan pangan bisa dikurangi dan selebihnya digunakan memperbaiki sistem pertanian, tuturnya. “Sehingga swasembada pangan terutama beras sebagaimana yang didengung-dengungkan presiden terealisasi. Begitu juga persaingan dengan produk luar negeri, petani Indonesia mampu mengatasinya,” ungkap dia. Martin mengatakan untuk melindungi petani dari serangan impor, pihaknya masih terus menggodok UU Perlindungan Petani, dan diharapkan UU tersebut bisa terealisasi tahun ini. Dalam UU tersebut, kata Martin yang juga anggota legislasi ini, antara lain memuat kepemilikan lahan bagi petani.


HARGA SAWIT : Seorang warga mencoba memindahkan buah sawit miliknya di perkebunan sawit Kota Tebing Sumatera Utara, foto Minggu (29/4). Harga tandan buah segar kelapa sawit pada tingkat petani pekan ini naik, dari Rp1.400 per kilogram menjadi Rp1.450 perkilogramnya.

Pertamina Tingkatkan Penyaluran, Premiun Di SPBU Tetap Kosong LHOKSEUMAWE ( Waspada): Kendati Pertamina mengaku telah meningkatkan penyaluran premium ke SPBU, namun stok di stasiun pengisian (SPBU) di Lhokseumawe dan Aceh Utara tetap kosong. Pantauan Waspada sejumlah SPBU di Lhokseumawe terpaksa tutup akibat premium habis. SPBU Cunda dan SPBU Simpang Kuta Blang, dari pagi sampai siang hari tidak menjual premium. “Dari pagi tadi bensin habis, jadi kami terpaksa tutup,” jelas Azhar,32, pengawas SPBU

Cunda, Lhokseumawe, Senin (30/4). Kondisi serupa juga terjadi di SPBU Simpang Kuta Blang. Pompa premium terlihat sepi, hanya pompa solar yang masih aktif. Sementara itu, sepeda motor dan kendaraan roda empat terlihat antri di SPBU pusat Kota Lhokseumawe. Mereka terpaksa menunggu giliran mengisi premium. Menurut pekerja di sana, kondisi tersebut sudah terjadi sejak seminggu lalu. Informasi diterima Waspada, kondisi sama juga terjadi

di SPBU sepanjang jalan Medan-Banda Aceh mulai dari Sigli sampai Aceh Utara. “Anehnya, pedagang eceran tetap menjual bensin dengan harga lebih tinggi di sekitar SPBU,” jelas Muhammad, 30, seorang warga setempat. Sementara itu Sales Representative Pertamina Wilayah VII Raka Pradipta mengaku penyaluran subsidi ke SPBU pada hari Jumat dan Sabtu jumlahnya di atas normal. “Permintaan seper-tinya tinggi,” kata Raka Pradipta seraya mengharapkan untuk

kebutuhan premium di pusat Kota Lhokseumawe bisa diantisipasi dengan pertamax sambil menunggu penambahan premium dari Pertamina. Untuk mengantisipasi kelangkaan premiun bersubsidi, pihaknya megharapkan informasi dari masyarakat bila terdapat penyaluran SPBU tidak wajar. “Penyaluran tidak wajar, semisal mengisi ke drum atau jerigen dalam jumlah banyak. Masyarakat bisa melaporkan ke Per tamina,” tambahnya kembali.(b15)

Pemerintah telah berjanji membagikan lahan kepada petani sejak delapan tahun lalu. “Ada sembilan juta hektare lahan yang akan dibagikan tetapi sampai sekarang belum terealisasi. Nah, itu yang akan kita tuntut,” ujar Martin. Sementara Ketua HKTI Sumut Zaman Gomo Mendrofa mengatakan rakerda ini membahas bagaimana pemerintah Indonesia khususnya Pemprovsu bisa menekan impor bahan pangan. Seperti jagung yang jum-lahnya sangat banyak sehingga membuat petani merugi, ungkapnya. Apalagi, baru-baru ini petani jagung melakukan demo ke kantor Gubsu namun hingga sekarang belum ada hasilnya. “Nah, dalam rakerda ini kami mau membahas bagaimana agar pemerintah kita bisa mendengarkan keluhan petani dengan menghentikan impor terutama saat panen raya berlangsung,” kata Gomo.(m06)

Taspen Naikkan Tunjangan Pensiunan PNS 7 Persen JAKARTA (Waspada): PT Taspen (Persero) berencana menaikkan tunjangan para pegawai pensiunan pemerintahan sebanyak tujuh persen dari 2011. Kenaikan tunjangan tersebut hanya berlaku bagi Pegawai Negeri Sipil (PNS), Purnawirawan, dan Warakawuri. Sekretaris Perusahaan TaspenWiharto menjelaskan selain tunjangan adapula kenaikan tunjangan anak yatim/piatu dan tunjangan orang tua Polri. “Selain itu ada juga pemberian tunjangan kehormatan bekas anggota Komite Nasional Indonesia Pusat (KNIP) dan tunjangan Veteran RI,” ungkapnya dalam siaran pers, Jakarta, Senin (30/4). Wihar to melanjutkan kenaikan tunjangan pensiun

pokok baru mulai berlaku sejak pembayaran 1 Januari 2012 dan dibayarkan pada Mei 2012. Menurutnya, pembayaran rapel dari Januari-April 2012 akan dilaksanakan bersamaan dengan jadwal pembayaran pensiun pada Mei. Di sisi lain, besarnya pokok tunjangan bekas anggota KNIP dan PKRI (Perintis Kemerdekaan Republik Indonesia) yakni sebesar Rp1.988.000 dan untuk janda/duda senilai Rp1.481.000. Sekadar informasi, kenaikan pensiun pokok dan tunjangan pelaku pemerintahan ini dilaksanakan berdasarkan Peraturan Pemerintah (PP) No.18/2012, PP No.19/2012, PP No.20/2012, PP No.21/2012, PP No.22/2012, dan PP No.23/2012. (okz)

BICT Terima Penghargaan Kecelakaan Nihil M E D A N ( Wa s p a d a ) : Belawan International Container Terminal (BICT ) PT Pelabuhan Indonesia I (Persero) menerima penghargaan karena keberhasilannya menekan angka kecelakaan kerja menjadi nihil atau zero accident. Atas keberhasilan itu Menteri Tenaga Kerja dan Transmigrasi Muhaimin Iskandar di Gedung Smesco Convention Center Jakarta Selatan memberikan penghargaan kepada General Manajer BICT Capt Hidayat Alcaff disaksikan Walikota Medan Rahudman Harahap dan kepala daerah lainnya di Sumut. Menteri Tenaga Kerja dan Transmigrasi dalam kata sambutannya menyebutkan 2012 jumlah yang menerima anugrah penghargaan Keselamatan Kesehatan Kerja (K-3) ini meningkat dibanding tahun sebelumnya. Pada 2012 jumlahnya menjadi 1.000 perusahaan terdiri dari zero accident dan

Sistem Manajemen Keselamatan dan Kesehatan Kerja (SMK3). Menteri menegaskan keberhasilan ini tidak lepas dari peran pemerintah daerah mulai dari gubernur hingga bupati dan walikota yang melakukan pembinaan tiada henti kepada seluruh perusahaan di daerahnya karena K-3 ini sangat penting. Menurut Asisten Hukum dan Humas BICT PT Pelabuhan Indonesia I Suratman, Senin (30/4), peran di daerah melakukan penilaian terhadap SMK3 dan K-3 dari setiap perusahaan dilaksanakan dinas tenaga kerja dan dinas sosial di daerah selanjutnya memberikan kepada pusat. Suratman menjelaskan, BICT yang merupakan pelabuhan peti kemas terbesar ke 3 di Indonesia ini, dalam operasionalnya menggunakan waktu 24 jam tiada henti menangani bongkar muat peti kemas dari kapal ke dermaga dan pelayanan kapal.(m35)

Presidan Direktur XL Hasnul Suhaimi (kanan) menerima penghargaan Selular Award 2012 kategori Best CEO of The Year 2011 dari Head of Media Grup Global selular media Penerbit Majalah Selular Nana J Rahmat.

XLRaihTigaPenghargaan Selular Award PT XL Axiata Tbk (XL) berhasil meraih tiga kategori penghargaan di ajang Selular Award 2012, yang diselenggarakan Majalah Selular di Jakarta (25/4). Ketiga jenis penghargaan yang berhasil diraih oleh XL tersebut adalah kategori Best CEO of The Year 2011 untuk Presiden Direktur XL Hasnul Suhaimi, Best Customer Care Service, dan Most Innovative Product. President Direktur XL Hasnul Suhaimi menyatakan: “Keberhasilan XL meraih tiga penghargaan di Selular Award tahun ini merupakan buah dari kerja keras seluruh tim XL untuk terus tanpa henti melahirkan inovasi dan meningkatan manfaat berbagai layanan XL bagi pelanggan, termasuk customer service. Kami berharap apresiasi ini juga bisa semakin memacu kinerja XL sekaligus berkreasi memberikan layanan yang terbaik bagi pelanggan dan masyarakat.” Ajang Selular Award 2012 merupakan penyelenggaraan yang ke-9, yang secara rutin memberikan apresiasi kepada para operator, vendor, dan pelaku industri telekomunikasi lainnya. Mekanisme penilaian berdasarkan polling SMS pembaca majalah Selular dan tabloid Handphone yang melibatkan 1.512 responden, dengan jumlah total SMS mencapai 6.218.

Ekonomi 2012: Memenuhi Harapan ? (2)



WASPADA Selasa 1 Mei 2012


Apresiasi Hari Buruh Tapi Jangan Anarkis


umlah buruh di Indonesia cukup besar, mencapai 3,5 juta orang. Jika satu orang memiliki tiga anak maka jumlah keluarga buruh mencapai 17,5 juta jiwa. Wajarlah kalau pemerintah dalam hal ini Menakertrans merasa khawatir jika kaum buruh melakukan demo (unjuk rasa). Imbauan Menakertrans agar buruh merayakan May Day (Hari Buruh) 1 Mei 2012 dengan kegiatan positif, misalnya bakti sosial, seminar, lokakarya, dan olahraga pastilah menggelikan, mengapa? Kegiatan sebagaimana disebut Menakertrans Muhaimin Iskandar itu sulit terwujud atau hanya sekadar wacana dan harapan belaka. Bagaimana mungkin buruh dapat melakukan semua hal yang disebutkan Muhaimin jika kesejahteraan buruh masih dipandang sebelah mata. Mayoritas buruh Indonesia masih menerima upah di bawah standar minimum sehingga hidup dan kehidupan kaum buruh amat mengenaskan. Cukup untuk makan saja, itu pun dalam porsi sekadar tidak mati karena tak lagi memperhatikan asupan gizi. Ya, sekadar untuk menyambung hidup. Bagaimana dengan pendidikan anak, tempat tinggal, kesehatan? Masih jauh dari harapan. Justru itu, apa yang diimbau Menteri Tenaga Kerja dan Transmigrasi Muhaimin Iskandar agar pelaksanaan peringatan Hari Solidaritas Buruh Internasional (May Day) pada 1 Mei 2012 berlangsung dalam suasana tertib, aman, dan damai perlu diantisipasi oleh aparat keamanan. Berbagai aksi buruh dapat saja menyulut hal-hal yang tak diingini, apalagi kaum buruh berupaya menduduki sejumlah objek vital, seperti simbol negara, jalan tol, bandara, pelabuhan, kantor pemerintah, gedung dewan dll, maka diperlukan antisipasi yang akurat dari aparat keamanan. Akurat dalam mendeteksi kemungkinan anarkis dengan menebar intelijen, melakukan tahapan demi tahapan yang sesuai dengan prosedur pengamanan sipil. Artinya, pengamanan harus ketat tapi juga mempertimbangkan aspek sosiologi dan psikologi kaum buruh di Indonesia, termasuk kota Medan (Sumut) yang selama ini menjadi barometer pergerakan buruh sejak zamannya Mochtar Pakpahan. Hemat kita, melakukan perayaan Hari Buruh oleh Serikat Buruh (SBSI) atau Serikat Pekerja (SPSI) dan serikat-serikat buruh/pekerja lainnya Intisari merupakan haknya kaum buruh. Sewajarnya kita memberi apresiasi, termasuk sikap negara Dalam negara demokrasi terhadap buruh saat melakukan aksi unjuk rasa. Sepanjang dalam karidor hukum, tidak anarkis, aksi unjuk rasa dilindungi kita perlu memberi apresiasi tinggi karena aksi rasa untuk menyampaikan sikap, pendaundang-undang tapi ja- unjuk pat, kritik, tuntutan dll merupakan hak setiap ngan sampai melakukan warga negara yang dilindungi undang-undang. sini aparat keamanan terutama jajaran keaksi kekerasan dan perusakan Di polisian perlu mewaspadai pihak ketiga yang ingin mengacau agar aksi damai kaum buruh tidak menjadi anarkis. Aparat keamanan perlu tanggap dan melakukan tindakan persuasif terhadap aksi buruh di mana saja, termasuk di Medan. Selama memenuhi ketentuan hukum jangan diganggu dengan aksi-aksi represif. Tapi, jika sudah mulai melihat situasi memanas, kepentingan umum sampai terganggu, maka diperlukan langkah berani dan tegas terhadap aksi anarkisme. Sebab, memperjuangkan demokrasi tidak harus dengan cara-cara kekerasan, termasuk merugikan kepentingan masyarakat luas (umum). Kita sependapat jika perayaan May Day (hari ini) dijadikan sebagai momentum peningkatan kesejahteraan pekerja dan produktivitas kerja sehingga kedua belah pihak sama-sama beruntung. Jika buruh dan pengusaha dapat bersinergi, saling mendukung, dipastikan omset meningkat. Dan jika penjualan bertambah maka keuntungan perusahaan semakin besar. Konsekuensi logisnya buruh ikut menikmati sebagian dari keuntungan itu dalam bentuk peningkatan upah, bonus, fasilitas kesehatan dll. Menakertrans perlu menjembatani setiap permasalahan buruh dengan pengusaha industri dan perkebunan, seperti kasus di Jakarta, Tangerang dll sehingga aksi-aksi buruh disahuti dengan benar. Tentunya dengan melihat fakta (kasus) di lapangan. Sebab, kalau kenaikan upah dipaksakan sementara perusahaan dalam kondisi sulit pada akhirnya kedua-duanya bakalan rugi jika terjadi kebangkrutan. Di sinilah perlunya kesamaan pandangan sekaligus keterbukaan. Buruh di satu pihak dengan pengusaha di pihak lain. Harus bisa duduk bermusyawarah jika terjadi perselisihan dengan mengedepankan ‘’win win solution’’. Hal itu hanya mungkin terjadi jika kedua belah pihak tidak mengedepankan mementingkan diri sendiri. Dan posisi pemerintah harus jelas, di mana semangat Hari Buruh perlu diapresiasi untuk meningkatkan kesejahteraan kaum buruh. Andai spirit ini dapat dijadikan acuan kita yakin kaum buruh pun dapat menikmati masa tuanya dengan optimis (sejahtera). Jangan hanya pegawai negeri saja yang setiap tahun diapresiasi dalam bentuk kenaikan gaji, tapi pegawai swasta khususnya kaum buruh pun berhak mendapatkan upah yang wajar dengan sentuhan pemerintah. Apalagi melihat harga barang (sembako) semakin mahal, kenaikan angka inflasi membuat biaya hidup semakin tinggi, sangat memberatkan bagi kaum buruh. Kiranya praktik upah murah harus dipinggirkan, tak zamannya lagi diterapkan. Investor pun pasti menjauh kalau upah ditekan murah sementara aksi unjuk rasa semakin marak di mana-mana. Tak ada rasa aman salah satu parameter investor menolak menanamkan modalnya di Indonesia. Selamat Hari Buruh 2012. Ingat, boleh unjuk rasa tapi jangan anarkis.+


Faks 061 4510025

Facebook Smswaspada

Beras Yang Menyandera Bangsa Oleh Toto Subandriyo Profesor ToruYano dari Tokyo University pernah mengingatkan, ancaman riil bangsa Indonesia bukanlah ancaman eksternal berupa invasi negara asing.Ancaman riil justru datang dari internal bangsa ini, menyangkut masalah kebutuhan pokok


alam sebuah kuliah umum sekitar tiga puluh tahun lalu, guru besar teknologi pangan Institut Pertanian Bogor (IPB) Profesor FG Winarno mengkritik keras kebijakan “berasisasi” yang ditempuh pemerintah Orde Baru. Kebijakan itu disebutnya sebagai sebuah kesalahan fatal, karena selain akan menggusur kearifan pangan lokal, kebijakan “berasisasi” akan menjadi bumerang bagi pemerintah di kemudian hari. Hingga akhir era 1970-an, semua siswa Sekolah Dasar akan menjawab dengan tepat jika ditanya tentang makanan pokok penduduk beberapa daerah di tanah air. Mereka akan menjawab jagung saat ditanya apa makanan pokok masyarakat Madura, menjawab sagu saat ditanya apa makanan pokok masyarakat Papua, dan menjawab thiwul atau singkong saat ditanya apa makanan pokok masyarakat Wonogiri. Kebijakan “berasisasi” membuat semua kearifan pangan lokal tersebut tercerabut bahkan menjadi bumerang bagi pemerintah. Beras selalu menjadi komoditas penyumbang inflasi terbesar dan selalu menyandera bangsa ini. Mengingat saat ini beras telah menjadi makanan pokok seluruh masyarakat Indonesia, maka laju inflasi yang diakibatkan oleh naiknya harga beras ini tentu sangat mengimpit beban hidup

+628576333XXXX Dengan hormat,ada bandar sabu di Jl.langgar dekat simpang Gg.mamiai, bandar sabu ini berinisial Az alias Lg, dia terbilang licik, transaksi kerap didalam rumahnya, ia selalu memegang barangbuktinya.perlu strategi penangkapan penjebakan sebab terbilang licin dan licik,tangkap segera. +6285362238178 “Slamat untk pemenang....rakyat berbahagia atas kemenanganmu,semoga aja tdk sia-sia menuju Aceh kembali ke masa Sultan Iskandar muda tempo doeloe.tak ada lagi wanita pamer paha ketat di Tanoeh Aceh. +6285296521522 Bupati tanah Kar0 dan Gubsu tolong lihat Jln Kabanjahe Lau Pakam sudah puluhan tahun rusak berat.kpd Gubernur baru Aceh jln Kutacane Bahorok hendak nya program mualim pertama.telah mualim kemana lagi kami mengadu karena pemerintah karo tdk pernah memperhatikan jln ini kalaupun di perbaiki berapa bulan udah rusak lagi tolong dato zaini jl Kutacane Bahorok jadi program pertama dato dan mualim +6281375308945 Selamat sukses kepada bapak M.Thaib/M.Jamil menjadi bupati dan wk.bupati kab.Aceh Utara semoga dpt men jalankan ama nah rakyat. Salam dari keluarga besar asahan-sumut +6285276926560 Entah hp yg salah beli .entah tangan yg gatal2 hendak mengetik .entah telinga yg salah dengar .kalau nggak salah lihat elbe ada pak Wali kota Medan diatas motor penerangan pegang mik yg di kawal pamong praja nya menyiarkan sejuta pohon hrs di jaga.kini satu tak nampak lagi apa habis ditelan bumi atau tangan2 jahil ? Memang banyak polisi disitu dekat sekolah Annizam tapi polisi tidur dekat sekolah tu pak Jln Perjuangan bangunkan aja pak .dari elbe katorong di podoknyo nan langang tmbg +6281264100513 Terlepas dari sisi kekurangannya namun fakta membuktikan bahwa sepanjang sejarah perjuangan kemerdekaan Indonesia hanya tiga Ibu Negara yg benar-benar menjunjung tinggi nilai-ninali keislaman (BERKERUDUNG) masing-masing : Ibu Negara Fatmawati Soekarno , Ibu Negara Shinta Abdurrahman Wahid dan Isteri Mantan Wapres H Hamzah Haz semoga Allah SWT meninggikan derajat mereka. Amiin +6285260103051 Tanyalah pada dirimu, apa yg telah engkau berikan untuk agamamu. cobalah tanya dirimu, apa yg telah engkau persembahkan kepada tanahairmu. tanyakan juga pada dirimu, apa yg telah engkau dapatkan dari keadaan dirimu selama ini. engkau berkata bahwa kamu mencari kebahagiaan dalam kehidupan ini. atas dasar dan karena itu engkau melakukan apa saja yg kamu bisa. tidak jarang pula engkau mengatasnamakannya demi menjustifikasikan segala kegiatanmu. demi mendapatkan kesenangan. demi menemukan kebahagiaan. Tuhan memerintahkannya. begitu kamu sering berkata. tapi, apakah benar engkau sekarang tengah mencari kebahagiaan. dan adakah kebahagiaan itu telah engkau dapatkan. atau sebenarnya kamu tidak mendapatkan apa2 dari segala bentuk pengusahaanmu itu. tapi cuma pura2 bahagia. pura2 senang. padahal “di sana”, di dalam dirimu, seperti tidak ada apa2nya. aku berkata begini kepada dirimu. karena aku merasa seperti demikian. tidak mendapatkan apa2 dari segala usaha untuk menemukan kesenangan. beruntunglah engkau sekiranya tidak seperti diriku...tapi kini aku juga tak lagi seperti itu, hampa dari “sesuatu”. aku telah mulai merasakan mendapatkan yg sesuatu banget. semenjak aku terhidayahkan BERKENALAN AKRAB

mereka. Analisis yang dilakukan BPS memperoleh kesimpulan bahwa setiap kenaikan laju inflasi 1 persen akan menambah jumlah penduduk miskin 0,8 persen. Orang awam mungkin mengira bahwa harga beras yang melonjak tinggi beberapa bulan lalu sangat menguntungkan petani. Namun sejatinya harga beras yang tinggi pada musim paceklik tidak dinikmati oleh petani kita yang sebagian besar termasuk petani gurem (menggarap sawah kurang dari 0,5 hektar). Pada musim paceklik beras hasil panen telah habis dikonsumsi keluarga, mereka telah menjadi net consumer beras. Pihak-pihak yang diuntungkan adalah para tengkulak, pedagang, dan Perum Bulog. Diversifikasi Pemerintah harus menempuh berbagai upaya serius agar beras tidak semakin menyandera kehidupan bangsa. Upaya pertama yang harus ditempuh adalah menggenjot peningkatan produksi. Selama ini sistem produksi pangan Indonesia menganut pola peasent-based and family-based food production yang berbasis pada jutaan petani kecil dengan luas lahan yang sangat kecil. Nasib pangan bangsa selama ini ditumpukan pada sistem produksi pertanian tradisional dengan pelaku

petani kecil tersebut. Para pakar meyakini bahwa sistem ini tidak akan mampu menjawab tantangan kebutuhan pangan yang meningkat, baik dari segi kualitas maupun kuantitas. Apalagi jika melihat kondisi pangan dunia beberapa tahun terakhir yang kecenderungannya sangat mengkhawatirkan. Oleh karena itu pemerintah harus memadukan sistem ini dengan sistem produksi pangan berbasis korporasi dan food estate. Kedua, menekan kehilangan hasil pascapanen. Saat ini angka kehilangan hasil gabah/beras nasional sekitar 12 persen. Apabila kita dapat menekan angka kehilangan hasil menjadi 6 persen dengan cara mekanisasi, maka akan dapat diselamatkan tidak kurang dari 2 juta ton beras per tahun. Volume sebesar ini dapat menutupi kekurangan kebutuhan beras domestik yang selalu diimpor. Ketiga, mengurangi konsumsi beras melalui program diversifikasi pangan. Konsumsi beras masyarakat kita mencapai 139,15 kilogram/kapita/ tahun (Data Kementerian Pertanian) atau 113,48 kilogram/kapita/tahun (data BPS). Jika angka tersebut dapat diturunkan menjadi 100 kilogram/kapita/tahun, maka kita dapat menghemat jutaan ton beras dan menjadi negara eksportir beras. Satu hal yang perlu diingat, upaya diversifikasi pangan ini harus menghindari beralihnya konsumsi beras ke terigu. Jika hal ini yang terjadi, permasalahan baru yang lebih pelik akan muncul. Tanaman gandum yang menghasilkan terigu adalah tanaman subtropis yang sulit dibudidayakan di Indonesia sehingga ketergantungan impor terigu makin besar. Program diversifikasi pangan tidak dapat berjalan cepat dan berkesinam-

bungan jika tidak berbasis pada tepung-tepungan (flour based food). Untuk percepatan diversifikasi sumber pangan, mau tidak mau pemerintah harus menggalakkan konsumsi umbiumbian. Negeri ini sangat kaya varian bahan pangan sumber karbohidrat. Kampanye sehari tanpa nasi (one day no rice) perlu dilakukan secara konsisten dan berkesinambungan. Produksi umbi-umbian seperti ketela pohon, ketela rambat, ubi, dan kentang, harus digalakkan untuk kemudian diolah dan dipasarkan dalam bentuk tepung. Saat ini komoditas yang telah banyak diusahakan adalah ketela pohon dalam bentuk modified cassava flour (mocaf) untuk substitusi terigu dalam pembuatan mi dan roti. Berbagai upaya tersebut harus diikuti dengan upaya pengendalian laju pertumbuhan penduduk. Saat ini laju pertumbuhan jumlah penduduk dan peningkatan produksi pangan masih sangat timpang. Laju pertumbuhan jumlah penduduk saat ini sebesar 1,49%/tahun, sedangkan angka peningkatan produksi beras hanya 0,95%/tahun. Untuk itu revitalisasi program keluarga berencana (KB) perlu dilakukan dengan serius. Profesor Toru Yano dari Tokyo University pernah mengingatkan bahwa ancaman riil yang dihadapi bangsa Indonesia saat ini bukanlah ancaman eksternal berupa invasi negara asing. Ancaman riil justru datang dari internal bangsa ini, cukup disulut dengan isuisu yang menyangkut masalah kebutuhan pokok seperti kelangkaan dan melambungnya harga beras, maka konflik sosial mudah sekali marak. Penulis adalah Alumni IPB Dan Magister Manajemen UNSOED.

APEKSI Dan Kota Medan Oleh Drs. Rivai Nasution, MM Sebagai konsekuensi Otda,semua daerah punya tanggung jawab yang sama yaitu meningkatkan daya saing daerah, pelayanan publik serta peningkatan kesejahteraan masyarakat.


usyawarah Komisariat Wilayah (Muskomwil) I Asosiasi Pemerintahan Kota Seluruh Indonesia (APEKSI) ke-5 baru saja digelar dengan kota Medan sebagai tuan rumah. Dihadiri 24 wali kota serta narasumber dari Komisi Pemberantasan Korupsi (KPK) M.Busyro Muqoddas dan Dirjen Kementerian Dalam Negeri Edi Sugiharto, Muskomwil sepakat memilih Wali Kota Medan Drs H.Rahudman Harahap, MM sebagai ketua APEKSI periode 2012-2015. Ada alasan signifikan kenapa pimpinan komisariat wilayah I dipercayakan kepada Rahudman Harahap. Antara lain, Wali Kota Medan ini dinilai memiliki kemampuan membangun kerjasama dengan sesama kota anggota APEKSI. Terlebih dalam membangun kota Medan untuk serta melaksanakan Undang-Undang Otonomi Daerah (Otda). Ini sesuai tema Muskomwil I yakni meningkatkan daya saing daerah, pelayanan publik untuk kesejahteraan rakyat. Mengamati even tahunan yang sarat nuansa kultural dan heroik tersebut dapat membangkitkan semangat para peserta Muskomwil I APEKSI ke-5 untuk membangun wilayahnya masingmasing. Keberadaan APEKSI di wilayah I itu sendiri dinilai sangat potensial sehingga dapat member dorongan bagi meningkatkan pembangunan kota Medan. Muskomwil tersebut, digelar sebagai salah satu upaya bersama untuk

mendalam terhadap berbagai isu strategis yang berkembang. Terutama dalam rangka memantapkan pelaksanaan Otda. Karena itu kepengurusan APEKSI bukanlah wadah mencari popularitas tapi sebagai bentuk kesediaan memikul tanggung jawab besar untuk mengembangkan fungsi dan peranan APEKSI dalam kerangka membangun kapasitas daerah, guna melaksanakan Otda yang semakin efektif. Untuk menjalankan roda organisasi ini, ketua APEKSI dibantu dua wakil ketua yakni Wali Kota Padang Fauzi Bahar dan Wali Kota Pekanbaru, Firdaus. Ditambah sekretaris bukan anggota yakni Asisten Pemerintahan (Aspem) I Kota Medan Drs Daudta P.Sinurat, MM serta Bendahara dipercayakan kepada Kepala Badan Pengelolaan Keuangan Daerah Kota Medan Irwan Ritonga. Sebagai kota industri, kota Medan membangun hubungan antar kota yang ada di tanah air. Misalnya, ke depan perlu dilakukan kerjasama antarkota di bidang industri ataupun bidang kerajinan tangan. Di sini kita harus dapat melihat kota mana yang bisa menonjolkan suatu produk untuk dibuat studi banding sehingga dapat meningkatkan kesejahteraan masyarakat. Terjalinnya kerjasama antarkota ini lebih diutamakan, tidak hanya dalam forum diskusi, tapi banyak hal yang akan kita lakukan dalam memprioritaskan berbagai hal. Misalnya

an ekonomi, pembangunan sosial budaya. Sementara itu, sebagai konsekuensi Otda, semua daerah punya tanggung jawab yang sama yaitu meningkatkan daya saing daerah, pelayanan publik serta peningkatan kesejahteraan masyarakat. Karenanya, diharap APEKSI dapat mengembangkan berbagai program kerja yang mampu meningkatkan kapasitas daerah, sekaligus merekomendasikan berbagai strategi dan kebijakan yang diperlukan bagi daerah. Sehingga dapat melaksanakan tugastugas Otda secara lebih berdaya guna dan berhasil guna. Terkait rencana pemerintah untuk melakukan revisi terhadap UU No.32 Tahun 2004 tentang pemerintah daerah, ada beberapa harapan nyata bagi daerah, khususnya anggota APEKSI. Daerah otonom diharapkan semakin mampu melaksanakan tugas-tugas otonomi, sehingga revisi diharapkan akan semakin mampu mengembangkan demokratisasi lokal yang sangat diperlukan dalam pembangunan daerah. Dengan demikian daerah diharapkan semakin mampu pula mengembangkan kapasitas fiskal daerah untuk mendorong kemandirian dalam pembiayaan pembangunan daerah. Pimpinan KPK Busyro dalam makalahnya menyampaikan judul “Membangun Zona Integritas Membangun Bangsa, Pencegahan Tindak Pidana Korupsi di Lingkungan Pemerintah Kota (Pemko) Medan”. Sedangkan Edi Sugiharto menyampaikan makalah berjudul “Penyelenggaraan Pelayanan Publik Yang Akuntabel Dan Transparan”. Mencermati tajuk makalah yang disampaikan kedua narasumber tersebut menunjukkan keinginan kuat agar APEKSI untuk sinergitas pembangunan masyarakat, khususnya untuk ma-

berharap, semoga Komwil I APEKSI tetap eksis untuk menjawab berbagai tantangan bagi pembangunan kota Medan. Penulis adalah Kabag Hubungan Kerjasama Setda Kota Medan.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Bupati Batubara, Rp3,8 M benahi P. Salah Nama - Tapi jangan pula salah penggunaan * Sutan Bhatoegana, Sumut sudah lama tertidur - Tidur-tidur ayamlah, he...he...he * Simalungun akan bangun Cable Car di Danau Toba - Perkara ‘angan-angan’!



WASPADA Selasa 1 Mei 2012

Kesehatan Masyarakat Pesisir

Mimpi Jadi Kenyataan Kado Buat Meneg BUMN Dengan KEP 236/MBU/2011 Terobosan Yang Diterobos Bapak Menteri Yang Terhormat, Beberapa waktu lalu saya sedang tidur-tiduran disiang hari, tiba-tiba saya bermimpi. Pada mimpi disiang bolong itu saya melihat sosok Bhatara Muda Nasution (BMN) Dirut PTPN2 T.Morawa datang menjumpai Bapak Megananda Daryono (MD) Deputi Bidang Industri Primer Kemeneg.BUMN di Jakarta. Sebagai dua orang sahabat kental yang telah lama akrab itu terjadilah dialog sebagai berikut : BMN : Pak Dar-Pak Dar kita dapat durian runtuh dan kesempatan emas yang tak akan pernah kita dapatkan sampai kiamat. MD : Opo opo. Kek bersemangat banget ketok-e BMN : Ala mukjizat jatuh kepangkuan kok tidak tahu MD : Yo yo opo jelaskan dong ben aku ngerti BMN : Kan Pak Dahlan Iskan telah terbitkan keputusan Meneg BUMN No.KEP 236/MBU/2011 yang membolehkan Menteri BUMN menunjuk langsung Direksi perusahaan pemerintah tanpa Rapat Umum Pemegang Saham (RUPS) atau Tim Penilai Akhir (TPA). MD : Yo jadi ono opo BMN : Kok bodoh kali. Menteri boleh menunjuk langsung tanpa RUPS/TPA. Jadi tinggal kita berdua yang menentukan, bukankah anda adalah eselon satu dalam Kementerian ini yang dapat wewenang Menteri karena telah dilegasikan sedang aku adalah Direksi/Dirut yang mendapat pendelegasian wewenang Menteri tingkat dua sedang orang yang mendapat pendelegasian tingkat tiga dan empat yaitu Komisaris dan Pengawas BUMN kecillah itu. Bukankah selama ini Komisaris kita itu pihak yang mengaminkan saja sama dengan Pengawas BUMN seperti Pa Pam tingkat direksi saja. MD : Jadi kepiye ? BMN : Kepiye, kepiye apa laghi. Andakan beberapa minggu lagi akan memasuki usia pension masih sempat jadi Direktur Holding sekaligus jadi Dirut PTPN III dan Dirut PTP IV juga kita bisa atur karena ala macam tidak tahu saja Ise Do Simangataur Nagaraon. MD : Lho Dirut PTPN III dan IV yang paten itu mau dikemanakan, apa bisa disingkirkan dan apa Pak Menteri nanti mau. BMN : Ala sudahlah kan dia tidak tahu. Dia kan orang baru dating dari bidang kontak-kontak (listrik) dan bukan lulusan IPB mana tahu dia tentang PTPN yang semi aristokrat feodal ini. MD : Tapi…… BMN : Tak usah tapi tapi, mau nggak ini kesempatan hanya sekali dalam seumur hidup. MD : Yo uwis aku melu, aturlah. BMN : Nah, begitu dong lalu salaman dan berpelukan mesra. Begitulah mimpiku itu Pak Menteri dan pada esok harinya tepat tgl 20 Desember 2011 mataku terbelalak membaca Harian Waspada yang memuat berita judul : PTPN2 Tandatangani Perjanjian Usaha Patungan. Disitu katanya PTPN2 akan membuat perumahyan rakyat dengan areal 800 hektar melalui kerjasamanya dengan Perumnas. Untuk lebih meyakinkan public maka penandatanganan MoU itu digelar di kantgor Meneg BUMN tgl 15 Desember 2011. Dengan Dapenbun bekerjasama untuk melola rumah sakit Tembakau Deli sebagai solusi utang PTPN2 sebanyak (tak disebut berapa jumlahnya) kepada Dapenbun karena selama ini kiranya uang dana pension yang dikutip dari setiap karyawan setiap bulannya itu tidak disetorkan ke Dapenbun. Kemudian disebutkan juga akan mengoptimalkan lahan bekas gedung dan kangtor Perkebunan Helvetia seluas 7,5 hektar. Tidak jelas disebutkan mau dijual, hanya dioptimalkan saja. Sedang tanah itu diluar HGU PTPN2 dan kena Rencana tata Ruang Wilayah. Pokoknya bagi siapa saja yang membaca berita itu membayangkan bahwa PTPN2 sekarang sedang bangkit. Kemudian di salah satu media terbitan Medan edisi 9 Januari 2012 judul Perusahaan Properti PTPN2 Harus Terbentuk. Nah bagi siapa yang mengikuti beritanya akan terkesan seolah-olah PTPN2 betul-betul sedang bangkit, apalagi dalam berita itu dilengkapi keterangan yang meyakinkan. Keterangan Deputi bidang Industri Primer Kemen BUMN Bpk Megananda Daryono telah menerima pendelegasian wewenang Menteri dan harus tampil meyakinkan sebagai seorang menteri layaknya, lalu berucap, Tahun 2012 ini adalah tahun keemasan bagi PTPN2, beliau meyakinkan orang seolah-olah PTPN2 saat ini sedang dalam tahun perak yang sebentar lagi segera memasuki tahun emas. Padahal tahun perunggu pun tidak, karena utangnya sekeliling pinggang, utang kepada Dapenbun yang Rp 800 M itu tidak disebut mengakibatkan rumah sakit Tembakau Deli yang megah itu disendera. PTPN2 telah menyediakan lahan seluas 8.200 hektar dipinggir kota Medan nanti disitu akan dibangun perumahan menjadi Kota Metropolitan. Dimana lokasinya tidak disebutkan. Kenyataannya lahan untuk tempat mendirikan Poliklinik saja tidak punya maka dikelurknalah Surat Perintah Pengosongan rumah kepada 5 orang pensiunan disekitar Masjid Jl.Merak Jingga itu dengan alas an untuk mendirikan Poliklinik disitu, karena sejak 1 Januari 2012 Rumah Sakit Tembakau Deli akan ditutup. Mendapat protes dari para penghuninya maka gagal. Kita bangga atas terobosan Dirut PTPN2 bekerjasama dengan investor luar, Malaysia melalui PT. Langkat Nusantara Kepong (PT.LNK) dan akan dilanjutklan lagi kerjasamanya juga dengan Malaysia melalui PT. AAR Nusantara mengenai bibit sawit unggul yang akan menghasilkan laba yang fantastis katanya. Sangat aneh, kebon-kebon yang bagus dijual oleh Dirut PTPN2 kepada pengusaha Malaysia dengan dalih KSO melalui PT. LNK kemudian pengusaha Malaysia itu ekspansi usahanya untuk menghasilkan laba fantastis. Kok dibangga-banggakan seharusnya malu orang asing menjadi tuan rumah dinegeri kita. Sedang laba yang katanya fantastis itu kan akan mengalir keluar negeri. Bahwa dari 141 BUMN diseluruh Indonesia hanya PTPN2 saja yang memiliki komoditas packing lengkap, ada sawit, tembakau dan tebu yang produksinya diatas target. Luar biasa Bpk Megananda ini menyanjung PTPN2 dibawah kepemimpinan Bhatara Muda Nasution itu setinggi langit. Padahal kenyataannya apa yang dapat dibanggakan selain utang yang berjibun. Apa yang dibanggakan mengenai tembakau kalau tempat pelelangannya saja di Bremen Jerman sudah lama tutup karena tidak ada Tembakau Deli yang akan dilelang. Begitu juga tebu, nyatanya kedua pabriknya saja tidak dapat beroperasi serentak karena ketiadaan bahan baku tebu. Ooi, dikatakan produksi tebu diatas target yang benar target diatas, produksinya dibawah. Ketika Meng BUMN berkunjung ke PTPN2, berkali-kali memuji terobosan Bhatara Muda Nasution Dirut PTPN2 terhadap kerjasama dengan Malaysia dan terutama mendirikan usaha properti di PTPN2. Katanya lagi Meneg BUMN sangat berkeinginan agar usaha properti di PTPN, hebat bukan, buat usaha property. Tidak perlu beli lahan, panggil investor, bagi hasil dapat uang banyak. Nenek lampir pun bisa jadi Direktur. Selanjutnya muncullah orang menerima pendelegasian wewenang Menteri yang ketiga yaitu Bpk Komisaris Utama PTPN2 yaitu Ato Suprapto (diwakili T.Yose Rizal) memberikan statemen yang berisi, kami bangga PTPN2 teleh membentuk pasukan relawan Nusantara Peduli sebagai SAR nya BUMN. Hanya satu-satunua di BUMN diseluruh Indonesia. (Padahal yang dibentuk itu adalah PAM Swakarsa yang membuat heboh dalam kasus Mesuji di Lampung). Ini akan menjadikan sengketa tanah di PTPN2 berdarah-darah nanti kalau dipaksa mengusir pensiunan dan petani demi kepentingan usaha property PTPN2 itu. Bngga karena PTPN2 telah memiliki penangkaran rusa di emplasmen Kandir T.Morawa (begitu makmurna zaman ke emasan itu nanti sampai direksi perlu hiburan dengan rusa-rusa berkeliaran disekeliling Istananya). Bangga PTPN memperoleh laba sebesar Rp 47,7 M tahun 2011 (utangnya dua Trilyun per 31 Desember 2011 tidak diungkapkan. Oh begitulah Komisaris Utama. Penerima pendelegasian wewenang Menteri keempat pengawas BUMN tidak ditampilkan karena dianggap seperti Papam tingkat Direksi saja. Tidak perlu. Selesailah sudah praktek lapangan kemudian tinggal menyusun laporan. Dibuatlah laporan dan hasil pengkajian dan disusun personalia Direksi disodorkan ke Menteri, kemudian keluarlah penetapan Bhatara Muda Nasution dipertahankan menjadi Dirut PTPN2 sedang Megananda Daryono turun gunung jadi Dirut PTPN III merangkap Direktur Holding, Dirut PTPN III dan IV. Yang paten itu terlempar entah kemana. Inilah hasil keputusan KEP 236/MBU/2011 itu. Pertanyaannya, kalaulah benar KEP 236/MBU/2011 telah dicabut karena dianggap keliru dan diganti dengan Kepmen No.164.165 dan 166 tgl 13 April 2012 apakah produk dari KEP 236/MBU/2011 yang dianggap keliru itu juga tidak perlu dicabut. Tolong jawab Pak Menteri. Demikianlah mimpi disiang bolong ini saya sampaikan kepada Bapak Menteri, semoga Bapak senyum pahit menerimanya.Terimakasih. Hormat saya, Ketua FSPP Ex PTP Medan H.M.Yusuf Sembiring


Oleh dr Candra Syafei, Sp.OG Wilayah pesisir memiliki nilai ekonomi tinggi, namun terancam keberlanjutannya.


erbicara laut, tentu tidak dapat terlepas dengan daerah pantai atau pesisir. Sebenarnya ada lima masalah yang perlu segera ditangani dalam pembangunan wilayah pesisir dan pulau-pulau kecil di daerah itu. Kelima masalah ini cukup penting dan strategissehinggaperlukitatanganidengan serius agar pembangunan wilayah pesisir dan pulau-pulau kecil bisa dioptimalkan. Kelima masalah itu adalah a). Masih tingginya jumlah penduduk miskin di wilayahpesisirdanmasihterbatasnyaakses masyarakatataskebutuhandasarterutama pendidikan, kesehatan dan infrastruktur dasar. b). Belum tersusunnya sistem perlindungan sosial yang memadai dan mempengaruhi tingkat kesejahteraan masyarakat pesisir. c). Tingginya angka pengangguran yang dipengaruhi rendahnya perluasan kesempatan kerja serta kulturbudayamasyarakatpesisiritusendiri. d). Dukungan infrastruktur juga masih belum memadai, seperti transportasi, penyediaan air bersih, energi kelistrikan. e).Kualitas lingkungan permukiman di wilayah pesisir. Untuk menghadapi semua permasalahan itu diperlukan dukungan dan kerjasamasemuapihak.Dengandemikian secara bertahap dan berkelanjutan berbagai permasalahan pembangunan wilayah pesisir dan pulau-pulau kecil dapat ditanggulangi bersama. Malaria Di Pesisir Dinas Kesehatan Provinsi Sumatera Utara telah mencatat ada sebanyak 17 daerah kabupaten/kota masuk dalam wilayah endemis atau penyebaran penyakit malaria yang disebabkan nyamuk Anopheles, sebagian besar di daerah pesisir. Beberapa kabupaten/kota endemis malaria itu di antaranya adalah Kabupaten Mandailingnatal (Madina), Padanglawas Selatan (Palas),Tapanuli Selatan (Tapsel), Padanglawas Utara (Paluta), Sibolga, Labuhanbatu, Asahan, Serdangbedagai, Deliserdang, Tapanuli Tengah (Tapteng), Langkat, Samosir, Kepulauan Nias. Penyakit malaria termasuk penyakit menular langsung dan prioritas untuk penanggulangannya. Jenis penyakit menular langsung itu cukup banyak dan menjadi prioritas. Penyakit menular yang menimbulkan banyak kematian seperti DBD, rabies, filariasis (menimbulkan kecacatan danbisatinggiangkakasusnya).Yangdinilai berbahaya adalah jenis Plasmodium Falciparum disebabkan oleh protozoa parasit yang dibawa masuk pada tubuh manusia melalui nyamuk betina anopheles. Ini memiliki infeksi yang paling berbahayadanmemilikitingkatkomplikasi yang tinggi. Semua ada di Sumatera Utara kecuali

Plasmodium Malariae. Penyakit malaria ditularkan oleh nyamuk anopheles. Pencegahan penyakit ini bisa dilakukan dengan memberantas nyamuk anopheles. Pengobatan penderita serta mendiagnosa penderitamalariasecaradini.Sedangkanmasa inkubasinya satu hingga tiga minggu. Dan lamanya masa inkubasi tergantung daya tahan tubuh seseorang. Secara umum, wilayah pesisir dapat didefenisikan sebagai wilayah pertemuan antara ekosistem darat, ekosistem laut dan ekosistem udara yang saling bertemu dalam suatu keseimbangan yang rentan. Pesisir adalah wilayah yang unik, karena dalam konteks bentang alam, wilayah pesisir merupakan tempat bertemunya daratan dan lautan. Lebih jauh lagi, wilayah pesisir merupakan wilayah yang penting ditinjau dari berbagai sudut pandang perencanaan dan pengelolaan. Maka perlu Perda (peraturan daerah) tentang pengelolaan wilayah pesisir dan pulau-pulaukecil,agarseluruhkabupaten/ kota se Sumatera Utara dapat melakukan perencanaan dan pengelolaan wilayah pesisir dan pulau-pulau kecil di daerah masing-masing. Kementrian Kelautan dan Perikanan dalam rancangan Undang-undang PengelolaanWilayah PesisirTerpadu mendefenisikan bahwasanya wilayah pesisirsebagaikawasanperalihanyangmenghubungkanekosistemdaratdanekosistem laut yang terletak antara batas sempadan kearah darat sejauh pasang tertinggi dan ke arah laut sejauh pengaruh aktivitas dari daratan. Wilayah pesisir memiliki nilai ekonomi tinggi,namunterancamkeberlanjutannya. Denganpotensiyangunikdanbernilaiekonomitadimakawilayahpesisirdihadapkan padaancamanyangtinggipula,makahendaknya wilayah pesisir ditangani secara khusus agar wilayah ini dapat dikelola secara berkelanjutan. Selain itu, wilayah pesisir juga merupakan daerah penghambat masuknya gelombang besar air laut ke darat jika diwilayah pesisir terdapat kawasan hutan mangrove. Ekosistem Mangrove Hutan mangrove merupakan lahan basah yang paling produktif, karena tumbuh di daerah pasang surut pantai. Tentu kita belum lupa kerusakan fatal dan menewaskan ratusan ribu orang di Aceh dan Sumatera Utara akibat gelombang Tsunami. Andai saja masyarakat serta pemerintah memahami dan menyadari arti penting mangrove untuk meminimalisasi dahsyatnya hantaman gelombang lautan yang menerjang daratan, tentunya ekosistem mangrove tidak akan dibiarkan punah seperti saat ini. Secara ekologis hutan mangrove dapat menjadi penahan abrasi atau erosi,

pengendali interusi air laut dan tempat habitat berbagai jenis fauna. Sedangkan manfaat lainnya baik bagi lingkungan ekosistemdaratandanlautan,diantaranya sebagai habitat berbagai jenis fauna, tempatmencarimakandanberkembangbiak berbagai jenis ikan dan udang. Besarnya nilai produksi primer tersebut cukup berarti bagi penggerak rantai makanan kehidupan berbagai jenis organisme akuatik di pesisir dan kehidupan masyarakat pesisir. Tujuan dari kegiatan penanaman mangrove adalah untuk memberi stimulasi bagaimana melakukan pengelolaan wilayah pesisir secara terpadu dan berkelanjutan yang berbasis masyarakat. Di samping itu dengan melakukan kunjungan langsung ke daerah pesisir diharapkan dapat mengetahui permasalahan dan konsep pembuatan kebijakan pengelolaan wilayah pesisir itu sendiri. Yakni a).Laut merupakan sumber dari common property resources (sumber daya milik bersama), sehingga kawasan memiliki fungsipublic/kepentinganumum.b).Laut merupakan open access regime, memungkinkan siapa pun untuk memanfaatkan ruang untuk berbagai kepentingan. c).Laut bersifat fluida, dimana sumber daya (biota laut) dan dinamika hydrooceanographytidakdapatdisekat/dikapling. d).Pesisir merupakan kawasan yang strategis karena memiliki topografi relatif mudah dikembangkan dan memiliki akses sangat baik (dengan memanfaatkan laut sebagai “prasarana” pergerakan. e).Pesisir merupakan kawasan kaya sumber daya alam, baik yang di ruang daratan maupun ruang lautan, yang dibutuhkan untuk memenuhi kebutuhan manusia. f).Wilayahlautdanpesisirbesertasumberdaya alamnya memiliki makna strategis bagi pengembangan ekonomi Sumut, karenanyadapatdiandalkansebagaisalah satu pilar ekonomi. Pengelolaan Pesisir Terpadu Pengelolaan Pesisir Terpadu (P2T) adalah proses yang dinamis yang berjalan secara terus menerus, dalam membuat keputusantentangpemanfaatan,pembangunan dan perlindungan wilayah dan sumberdaya pesisir dan lautan. Suatu kegiatan dikatakan keberlanjutan, apabila kegiatanpembangunansecaraekonomis, ekologisdansosialpolitikbersifatberkelanjutan. Berkelanjutan secara ekonomi berarti bahwa suatu kegiatan pembangunan harusdapatmembuahkanpertumbuhan ekonomi,pemeliharaanmodal,danpenggunaan sumberdaya serta investasi secara efisien. Berkelanjutan secara ekologis mengandung arti, bahwa kegiatan dimaksud harus dapat mempertahankan integritas ekosistem, memelihara daya dukung lingkungan, dan konservasi sumber daya alam termasuk keanekaragaman hayati. Sehingga diharapkan pemanfaatan sumberdaya alam daerah pesisir dapat berkelanjutan.

Pengelolaan berbasis masyarakat dapat diartikan sebagai suatu sistem pengelolaan sumber daya alam di suatu tempat dimana masyarakat lokal ditempat tersebut terlibat secara aktif dalam proses pengelolaan sumber daya alam yang terkandung di dalamnya. Di Sumatera Utara pengelolaansumberdayaberbasismasyarakatsebenarnyatelahadadasarnya,yakni dalamPasal33UUD1945yangmenyebutkan bumi dan air dan kekayaan alam yang terkandung di dalamnya dikuasai negara dan dipergunakan sebesar-besarnya bagi kemakmuran rakyat. Ketentuan tersebut secara tegas menginginkan agar pelaksanaan penguasaan pemerintah atas sumber daya alam khususnya sumber daya pesisir dan lautandiarahkankepadatercapainya manfaat yang sebesar-besarnya bagi kemakmuran rakyat banyak. Juga harus mampu mewujudkan keadilan dan pemerataan sekaligus memperbaiki kehidupan masyarakat pesisir serta memajukan desa-desa pantai. Kegiatan Di Pesisir Sumut Baru-baru ini diselenggarakan acara kepedulian sosial di daerah pesisir Sumatera Utara. Acara“Menoleh Kelaut” adalah salahsatutemadalamacarakegiatanHUT Provinsi Sumatera Utara ke 64 dan Dies NatalisUSUyangke60tahun2012,dengan leadingsektorDinasKelautandanPerikananProvinsiSumateraUtarauntukmelakukan pengabdian masyarakat di wilayah pesisir secara terpadu. Tepatnya, tanggal 19 April 2012, rombongan Pemerintah Daerah Provinsi Sumatera Utara dan CivitasAkademikaUniversitasSumateraUtara dipimpin Sekretaris Daerah Provinsi Sumatera Utara didampingi Rektor USU beserta Sekda Kabupaten Langkat dan jajarannya bergerak meluncur ke Langkat— tepatnya kecamatan Pangkalansusu di Pulau Sembilan. Di sana dilakukan berbagai kegiatan. Antara lain: melakukan tatap muka dengan warga pesisir pantai, melakukan gerakanterpadumembersihkanpantai,menanam pohon mangrove, melakukan pemeriksaan & pengobatan gratis, membagikan stimulan makanan tambahan anak sekolah (PMT-AS), penyuluhan kesehatan dengan membagikan media penyuluhan berupa buku-buku modul dan buku saku, leaflet, poster, kaset-kaset/CD film penyuluhan kesehatan masyarakat. Gerakan ini direncanakan terus dilakukan pada lima lokasi pesisir di Kabupaten Langkat, Deliserdang, Serdangbedagai dan Batubara. Tentunya sifatnya simultan sehingga ke depan diharapkan dapat dilanjutkan secara bergulir dan bergilir dilakukan ke seluruh lokasi pesisir di Sumatera Utara— olehsemuakomponendanelemenpenggiat pembangunan—untuk menjadikan daerah pesisir menjadi sentra yang produktif, setara dengan kemajuan daerahdaerah lainnya. Semoga! Penulis adalah Kepala Dinas Kesehatan Provinsi Sumatera Utara.

Mewujudkan Indonesia Bebas Aki Oleh Lia Marina, SS Target penurunan AKI tak lebih hanya lips service untuk mencapai target MDGs 2015, tanpa benar-benar menghilangkan faktor-faktor penyebab tingginya AKI.


ata SDKI (Survey Demografi dan Kesehatan Indonesia) 2007 menunjukkan Angka Kematian Ibu (AKI) di Indonesia tertinggi seASEAN. Jumlahnya mencapai 228 per 100.000 kelahiran hidup. Pemerintah masih dituntut bekerja keras menurunkannya hingga tercapai target Millenium DevelopmentGoal(MDG)5,menurunkan AKImenjadi102/100.000padatahun2015. Bahkanangkakematianibumencapai 307 per 100.000 kelahiran sedangkan AKB (AngkaKematianBayi)diIndonesiasebesar 35/1000 kelahiran hidup. Penyebab kematian ibu di Indonesia cukup beragam. Beberapa faktor penyebab langsung kematian ibu di Indonesia masih didominasi perdarahan 28%, eklampsia 24%, dan infeksi 11%. Penyebab kematian bayi yaitu BBLR 38,94%, asfiksia lahir 27,97%. Hal ini menunjukkan bahwa 66,91% kematian perinatal dipengaruhi kondisi ibu saat melahirkan. Faktor tidak langsung penyebab kematian ibu karena faktor “terlambat” dan “terlalu”. Ini semua terkait dengan faktor akses, sosial budaya, pendidikan, dan ekonomi. Menurut anggota Komisi IX DPR RI Herlini Amran, yang dimaksud faktor “terlambat” adalah terlambat mengenal tanda bahaya persalinan dan mengambil keputusan, terlambat dirujuk, dan terlambat ditangani tenaga kesehatan di fasilitas kesehatan. Berdasarkan Riskesdas (Riset Kesehatan Dasar) 2010, masih cukup banyak ibu hamil dengan faktor resiko “terlalu” yaituterlalutuahamil(diatasusia35tahun) sebanyak 27%, terlalu muda untuk hamil (di bawah usia 20 tahun) sebanyak 2,6% dan terlalu banyak (jumlah anak lebih dari 4) sebanyak 11,8% dan terlalu dekat (jarak kelahiran kurang dari 2 tahun). Menurut Direktur Jenderal Gizi Kesehatan Ibu dan Anak Kementerian Kesehatan Slamet RiyadiYuwono saat ini terdapat 10provinsidengantingkatangkakematian ibu melahirkan tinggi. Sepuluh daerah tersebut adalah Jawa Timur, Jawa Barat, JawaTengah, Sumatera Utara, NusaTenggara Timur, Banten, Sulawesi Utara, Sumatera Barat, Lampung dan Sulawesi Tengah. Untuk mengatasi permasalahan tersebut, pemerintah saat ini terus melakukan upaya menurunkan AKI di antaranya dengan memberikan Jaminan Persalinan atau Jampersal yang mulai berlaku tahun ini.

Menurut Slamet, masyarakat akan mendapatkan jaminan pembiayaan pelayananpersalinanyangmeliputipemeriksaan kehamilan, pertolongan persalinan, pelayanan nifas termasuk pelayanan Keluarga Berencana (KB) pasca persalinan dan pelayanan bayi baru lahir. Selain itu pemerintah juga akan memperbanyak tenaga-tenaga medis dan juga Puskesmas keliling di daerah yang angka kematian ibu melahirkannya tinggi. Slamet juga menjelaskan untuk mengatasi AKI yang tinggi di Indonesia, pemerintah mulai tahun ini juga melaksanakan program Emas atau Expanding Maternal and Newborn Survival bekerjasama denganpemerintahAmerika Serikat. Dalam program ini, Amerika Serikat memberikanbantuansebesar 55 juta dolar Amerika. Program tersebut akan dilakukan secara bertahap. Pemerintah Indonesiaakanmeluncurkan program emas untuk menurunkan AKI melahirkan. Pada tahun ini program tersebut dilakukan di enam provinsi yang memiliki 70 persen kasus kematian ibu. Daerah tersebut adalah Banten, Jawa Tengah, Jawa Timur, Sumatera Utara, Sulawesi Selatan, dan Jawa Barat. Program Emas intinya satu, memperkuat pelayanan di tingkat Puskesmas, pelayanan di tingkat rumah sakit dengan 24 jam. Para bidan, para dokter di wilayah tersebut ditingkatkan kemampuannya bagaimana menolong persalinan, dan bagamana cara pengiriman ibu yang mau melahirkan, mendiagnosis dengan tepat (\\t“_blank” Program Jampersal Program Jaminan Persalinan (Jampersal)diluncurkanKementrianKesehatan RI sejak awal tahun 2011. Jampersal adalah program baru pemerintah yang bertujuan

menolong kaum ibu agar mendapatkan pelayanan persalinan oleh tenaga medis. Jampersal dimaksudkan menghilangkan hambatan finansial bagi ibu hamil untuk mendapatkan jaminan persalinan, yang di dalamnya termasuk pemeriksaan kehamilan, pelayanan nifas termasuk KB pasca persalinan, dan pelayanan bayi baru lahir. Terobosan pemerintah ini diharapkan mengurangi hambatan finansial (financial barrier) masyarakat yang selama ini tidak memiliki jaminan biaya persalinan—agar mampu mengakses persalinan ibu berkualitas sehingga AKI menurun. Apabila kita sekilas menelaah program Jampersal memang terlihat bagus karena toh bertujuan menurunkan AKI. Namun ada beberapa hal yang perlu dikritisi. Pertama, benarkah Jampersal bisa menekan AKI yang 90% dipicu oleh faktor terlambat mengakseslayananpersalinan oleh tenaga medis? Karena minimnya biaya yang disiapkan pemerintah, sangat diragukan program ini efektif menekan AKI. Pemerintah menganggarkanbiaya persalinan normal Rp500 ribu dengan rincian untuk pemeriksaan kehamilan selama empat kali kunjungan Rp40 ribu, persalinan normal Rp350 ribu dan pelayanan nifas setelah melahirkan Rp30 ribu untuk tiga kali kunjungan. Anggaran dana tersebut sedikit jumlahnya, walhasil banyak bidan yang tidak mau bekerjasama ikut program ini karena biaya persalinan saat ini minimal 800 ribu. Lantas bagaimana dengan ibu yang harus melakukan operasi saat persalinan? Apakah dijamin ditanggung pemerintah? Belumlagiterlambatnyadanayangdicairkan sering menghambat proses masyarakat memperoleh Jampersal. Ditambah mahalnya harga obat, juga sarana dan prasarana semisal transportasi terutama karena kondisi geografis yang sulit. Belum lagi rendahnya penghargaan terhadap jasa tenaga medis, seringkali besarnya jaminan pemerintah ini tidak realistis untuk

memberikan pelayanan persalinan layak. Perlu diketahui program jampersal hanya menanggung hingga kelahiran anak kedua saja, kelahiran anak berikutnya ditanggung masyarakat sendiri. Hal ini sejalan dengan program KB yang dicanangkan pemerintah. Masyarakat patut mempertanyakan mengapa program pemerintah terkait kesehatan tidak kunjung menekan angka kematian? Selama hampir 20 tahun AKI hanya turun dari 390 (1991) menjadi 228 (2007). Jawabannya karena pemerintah telah menjadikan pelayanan publik termasuk kesehatan berbasis‘jasa yang diperdagangkan’. Karenanya tidak nampak keseriusan kebijakan melayani rakyat. Pemerintah meratifikasi GATS (General Agreement Trade and Services), menjadikan ranah kesehatan sebagai jasa yang diperdagangkan. Semestinya paradigma kebijakan pelayanan adalah tanggung jawab untuk memenuhi semua hajat hidup rakyat, sebagaimana diperintahkan syariat Islam. Jampersal adalah kebijakan setengah hati pemerintah dalam pelayanan publik. Seolah memahami persoalan masyarakat, namun justru memberikan pelayanan menyengsarakan kaum ibu. Target penurunan AKI tak lebih hanya lips service untuk mencapai target MDGs 2015, tanpa benar-benar meng-hilangkan faktorfaktor penyebab tingginya AKI. Lebih jauh, program ini juga rawan ditunggangi agenda kontrol populasi melalui program KB. Pemerintah dituntut memberikan pelayanan persalinan yang layak dan bermartabat. Negara akan mampu melakukan itu dan dengan menyediakan dana yang mencukupi jika menjadikan tanggung jawab pelayanan sebagai paradigma, bukan menjadikan kesehatan sebagai jasa yang diperdagangkan. Juga negara seharusnya mengambil sistem ekonomi Islam menggantikan system ekonomi kapitalisme. Hanya dengan sistem Islam pelayanan persalinan yang layak dan bermartabat bias diperoleh masingmasing individu umat. Ingatlah bahwa sejak 13 abad lalu khalifah kaum Muslimin telah menyediakan rumah sakit, tenaga medis, logistik dan pembiayaan yang memadai. Khalifah Harun Ar Rasyid telah memerintahkan kas Baitul Mal untuk mendirikan RS, RS bersalin, sekolah kebidanan dan bahkan industri farmasi. Wallâhua’lambish-shawâb. Penulis adalah Aktivis Muslimah Hizbut Tahrir Indonesia.


B10 LHOKSEUMAWE (Waspada): Untuk audisi Putri Kopi Regional Aceh Tengah, pendaftaran bisa melalui Putri Kopi Aceh 2010 Vivi Anggraini yang berdomisili di Lhokseumawe. Pendaftaran dari 20 April lalu hingga 5 Mei mendatang. Vivi Anggraini kepada Waspada, Senin (30/4) mengatakan, bagi remaja yang berminat mendaftarkan diri silahkan menghubungi dirinya melalui nomor kontak pendaftaran 085763737090. Remaja itu tentunya berasal dari Kota Lhokseumawe, Langsa, Kabupaten Aceh Utara, Bireuen, Aceh Timur dan Aceh Tamiang. Disebutkan, batas usia mulai 17-23 tahun, belum menikah dan tidak mempunyai anak, tinggi minimum 165 cm, berpengetahuan umum dan wawasan luas, berpenampilan menarik, cerdas, serta berkepribadian, menguasai Bahasa Inggris atau bahasa asing lainnya, berbakat atau keahlian khusus, sehat jasmani dan rohani dan terakhir kandidat yang datang di kota audisi berdasarkan seleksi awal panitia.(cmk)

LHOKSEUMAWE (Waspada): Tim peneliti dari Central Information for Samudra Pasai Heritage (CISAH) melakukan survei sepajang daerah aliran sungai Keureutoe dan Krueng Pirak, Kecamatan Paya Bakong, pedalaman Aceh Utara. Mereka akan menguatkan keberadaan Kerajaan Buluh Telang yang disebutkan dalam Hikayat Raja-raja Pasai. Kegiatan ini disebut ekspedisi Meugat Seukandar, nama dari raja yang memimpin Kerajaan Buluh Telang di Aceh Utara. Menurut peneliti sejarah dan kebudayaan Islam, Taqiyuddin Muhammad ekspedisi Meugat Seukandar III ini diperkirakan membutuhkan waktu selama 60 hari. Karena itu, selama proses survei tim peneliti memilih bermukim di Paya Bakong.

BIREUEN (Waspada): Aksi balap liar malam hari mulai marak lagi di Bireuen. Bahkan terkesan para ABG semakin nekad melakukan aksi maut di jalan raya yang menggunakan sepedamotor. Pantauan Waspada, Sabtu (28/4) menjelang dini hari sejumlah ABG melakukan aksinya di jalan nasional mulai kawasan Cot Gapu hingga Desa Geulanggang Teungoh. Sebagian lainnya kumpul di pinggir jalan di kawasan Cot Gapu. “Kami sudah bosan melihat aksi balap liar ini, dan dalam hal ini kami tidak menyalahkan lagi polisi, karena polisi selama ini sangat getol memberantasnya, namun dasar anak itu serta orang tuanya yang tidak mengawasi, makanya aksi balap liar ini timbul tenggelam, “ kata sejumlah warga Geulanggang Baroe. Aksi mereka tersebut, sambung warga lain, dikhawatirkan selain akan mengalami kecelakaan juga dikhawatirkan kesabaran warga habis dan akan terjadi hal-hal yang tidak inginkan. Kapolres Bireuen AKBP Yuri Karsono melalui Kasat Lantas AKP Suharmadi menegaskan, pihaknya tidak mentoleril lagi para aksi balap liar dan bila kedapatan mereka akan ditangkap. (cb02)

Anggota Pramuka 17 Kecamatan Ikut Persami BIREUEN (Waspada): Ratusan anggota Pramuka dari 17 kecamatan, di Bireuen binaan Kodim 0111 Bireuen, mengikuti perkemahan Sabtu-Minggu (Persami) di kawasan perbukitan Gle Mata Ie, Desa Meunasah Tgk Digadong, Kota Juang, Bireuen, Sabtu (28/4)-Minggu (29/4). Acara yang dibuka langsung Dandim 0111/Bireuen, Letkol Inf Muhammad Arfah diisi dengan berbagai kegiatan sosial di antaranya menyantuni yatim serta melakukan penghijauan dengan menanam seribu pohon di lokasi dan di komplek asrama Kodim di Desa Blangbladeh. Dandim dalam acara pembukaan mengatakan, kegiatan tersebut untuk pembinaan remaja supaya mengenal dan mencintai sesama serta memberi pengetahuan tentang wawasan nusantara tentang bahaya narkoba dan tentang perannya dalam pembangunan.(cb02)

Mantan Anggota DPRK Bireuen Diduga Keracunan Tongkol Panggang BIREUEN (Waspada) : Safli,36, mantan anggota DPRK Bireuen dari PKS warga Desa Geudong-Geudong, Bireuen, tumbang diduga keracunan setelah menyantap “sure panggang” (tongkol panggang) terpaksa dilarikan ke RSUD Dr Fauziah, Sabtu (28/ 4). Cut Marhamah,32, istri Safli yang ditemui Waspada di ruang rawat UGD RSUD Bireuen suaminya tumbang setelah menyantap ikan sure panggang (ikan tongkol) saat sarapan pagi di rumahnya Desa Geudong Geudong, Bireuen. Menurut Cut Marhamah setelah menyantap “ikan sure panggang,” suaminya langsung muntah-muntah, kepala pusing berat dan mual-mual. Akibat kondisinya mengkhawatirkan, suaminya langsung dilarikan ke UGD RSUD Dr Fauziah. Dr Mahyal yang menangani korban di UGD menyebutkan, korban muntah-muntah dan pusing karena keracunan, namun belum bisa dipastikan apakah akibat keracunan ikan tongkol atau penyebab lainnya.(b12)

Intelektual Muda Aceh Di Jakarta Dukung Zaini-Muzakkir BANDA ACEH (Waspada): Gerakan Intelektual Muda (GIM) Aceh Jakarta mendukung dr Zaini Abdullah-Muzakkir Manaf sebagai Gubernur dan Wakil Gubernur Aceh terpilih periode 2012-2017. “Bahkan, kami menilai Pemilukada Aceh adalah sebuah laboratorium politik dan demokrasi lokal terbesar di Indonesia,” ungkap jurubicara GIM Aceh-Jakarta, Fuad HadiWoyla, melalui siaran pers yang diterima, Minggu (29/4). Menurut Fuad, sebagai daerah post conflict dan post disaster, damai Aceh patut diapresiasi. Dan sekaranglah saatnya bagi semua pihak di Aeh untuk mengisi damai dan pembangunan Aceh. “Karena itu, semua stakeholder harus peduli dan berkontribusi positif untuk Aceh lebih baik, dengan mengawal agenda perdamaian dan pembangunan demi mewujudkan kesejahteraan masyarakat Aceh,” ucapnya. (b04)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


“Sasaran dari survei potensi kepurbakalaan di sekitar DAS Keureutoe dan Krueng Pirak ini antara lain artefak-artefak dalam bentuk makam, nisan, keramik dan tembikar yang menjadi tanda bekas hunian Samudera Pasai,” katanya, Senin (30/4). Taqiyuddin Muhammad yang ikut bersama tim ekspedisi menambahkan, kegiatan ini kelanjutan survei awal tim CISAH beberapa waktu lalu di kawasan Paya Bakong. Tim telah menemukan bekas-bekas peninggalan Samudera Pasai. Sebelumnya, tim peneliti tersebut memperoleh informasi dari warga setempat tentang adanya potensi kepurbakalaan di pedalaman Aceh Utara itu. (b15)

Ribut Dengan Ical, Muntasir Diminta Jangan Bawa-bawa Nama Aceh

14 Gudep Pramuka Bireuen Ikuti Raimuna Dan Lomba LT-3

Balap Liar Marak Di Bireuen

Selasa 1 Mei 2012

Tim Survei Telusuri Kerajaan Buluh Telang Di Pedalaman Aceh Utara

Audisi Putri Kopi Bisa Daftar Di Lhokseumawe

BIREUEN (Waspada) :Wakil Bupati Bireuen Drs H Busmadar Ismail selaku Ketua Kwarcab Pramuka Kabupaten Bireuen yang bertindak sebagai inspektur upacara membuka Raimuna Cabang penegak dan Lomba Tingkat-3 penggalang di komplek SMPN-5 Bireuen Senin (30/4). Pembukaan Raimuna dan LT-3 penegak ditandai dengan penyematan tanda peserta putra-putri dan penyerahan bendera kepada Marzuki Hs selaku Ketua panitia penyelenggara Raimuna dan LT-3. Hadir dalam acara pembukaan Raimuna dan LT-3, unsur Muspika, para calon Bupati, para Ketua Mabigus, para Kepala Sekolah serta sejumlah undangan lainnya. (b12)


Waspada/Maimun Asnawi

RATUSAN pengguna kendaraan bermotor di Lhokseumawe, Selasa (30/4) siang antri mengisi bahan bakar minyak (BBM) di SPBU di Pusat Kota Lhokseumawe. Antrian panjang ini terjadi karena di tiga SPBU lainnya mengalami kekosongan bensin.

BBM Langka Lagi, Depot Pertamina Terkejut LHOKSEUMAWE (Waspada) : Kelangkaan BBM kali ini di Kota Lhokseumawe ternyata bukan hanya membuat panik warga. Pihak Depot Pertamina Wilayah Regional Satu terkejut dengan kondisi SPBU yang begitu cepat kehabisan stok. Dalam satu pekan ini, kelangkaan BBM telah terjadi berulangkali di SPBU Kota Lhokseumawe, Batuphat dan sekitarnya khusus padahari Jumat, Sabtu dan Minggu. Padahal pihak Pertamina sudah menyuplai stok ke SPBU yang diperkirakan cukup untuk setiap harinya. Akan tetapi yang terjadi dilapangan, Senin (30/4) ternyata SPBU begitu cepat kehabisan stok dalam melayani konsumen karena meningkatnya permintaan BBM. Kondisi itu mengakibatkan

terjadinya kelangkaan BBM beberapa jam sejak pukul 08:34 di sejumlah SPBU Kota Lhokseumawe. Sehingga sebagian SPBU langsung tutup usaha dan memasangkan papan bertuliskan ‘BBM habis, menunggu kiriman pasokan baru dari Deppot Pertamina. Sales Representatif Wilayah VII NAD Raka Pradigta kepada Waspada mengaku terkejut dan merasa aneh dengan SPBU yang begitu cepat kehabisan stok BBM yang sejak awal diperkirakan cukup. Raka membenarkan kondisi yang menyebabkan terputusnya sementara pasokan BBM mengingat secaras pontanitas permintaan konsumen meningkat tinggi. “Saya merasa aneh juga dengan SPBU yang kehabisan stok terlalu cepat dan tidak wajar. Tapi tugas kami hanya mengantarkan pasokan BBM ke SPBU, setelah itu bukan lagi ke-

wenangan kami,” tutur Raka. Mengingat kebutuhan masyarakat yang tinggi, sambung Raka, akhirnya pihak Depot Pertamina setempat kembali mengirimkan pasokan baru sebanyak 24 ton ke 28 SPBU yang sedang alami kehabisan stok sekira pukul 14:22. Agar tidak kembali terulang peristiwa kelangkaan BBM, Raka mengimbau warga tidak mengambil BBM di SPBU dengan jerigen dan drum. Raka juga meminta pihak terkait yang lainnya agar tidak diam menutup mata dan segera melaporkan ke Pertamina bila ada konsumen nakal atau SPBU yang tidak menaati aturan yang berlaku. Seorang warga Kota Lhokseumawe Faisal mengatakan kelangkaan BBM ini diduga kuat akibat ulah para mafia minyak yang memborong BBM di SPBU dengan tempat berkapasitas besar. (b16)

192 Peserta Ikut MTQ Muara Batu Nanti Malam MUARA BATU (Waspada): 192 Peserta dari sembilan kemasjidan akan menguji kemampuan pada Musabaqah Tilawatil Quran (MTQ) tingkat kecamatan. MTQ ke-31 tingkat Kecamatan Muara Batu, Aceh Utara itu akan dilaksanakan di Gampong Reuleut Timu, Selasa (1/5) malam ba’da Isya. Ketua Pantia MTQ, Tgk Fajri M Yunus kepada Waspada, Senin (30/4) menyebutkan, sam-

pai menjelang pelaksanaan MTQ, di meja panitia sudah terdapat 192 peserta yang mendaftar. Mereka berasal dari sembilan kemasjidan, yaitu Kemasjidan Syuhada Reuleut, Darussamin Cot Usi. Selanjutnya Kemasjidan Babul Imarah Pinto Makmur, Baitannur Mane Tunong, Al Aziziyah Krueng Mane, Alhamra Meunasah Baro, Blang Panyang Meunasah Drang, Al Akmal Cot

Trueng dan Nurul Falah Bungkaih. Disebutkan, MTQ ke-31 ini diperlombakan enam cabang bagi putra dan putri. Keenam cabang itu Tilawatil Quran, Fahmil, Syarhil, Hifdzil 1-30 Juz, Khattil dan Tafsir Quran. “Insya Allah, sesuai rencana, pembukaan akan dibuka oleh bapak Pj Bupati Aceh Utara HM Alibasyah,” tutur Geuchik Reuluet Timu M Jafar. (cmk)

Perhelatan Akbar Di Dayah Ulama Kharismatik Aceh

Puluhan Ribu Tamu Bersimbah Air Mata LANGKAHAN (Waspada): Perhelatan akbar di Pondok pesantren ulama kharismatik Provinsi Aceh, Tgk H M Daud Ahmady alias Abu Lueng Angen di Gampong Krueng Lingka Lueng Angen, Kec Langkahan, Aceh Utara, diwarnai simbahan air mata. Tidak kurang dari 25.000 tamu dari berbagai penjuru Aceh, Pj Gubernur Aceh, Ir H Tarmizi A Karim. Dari beberapa daerah di Indonesia, berikut dari negara tetangga, seperti Kuala Lumpur Malaysia, Brunei Darussalam, Singapura dan di belahan penjuru daerah lainnya, Minggu (29/4), tumplek di dayah yang kini terdaftar sekitar 1.700 santri tersebut. Tamu dari berbagai latar belakang dan status sosial itu, menangis haru karena lama tidak ketemu dan bersilaturahmi dengan Abu Lueng Angen, akibat berbagai kesibukan. Ulama kharismatik ini yang kondisi fisiknya tidak lagi setegar dulu, dengan ramah menyambut para tamu, termasuk sekitar 10.000 mantan santrinya yang kini merupakan pimpinan dayah pula di daerahnya masingmasing. Semua tamu yang datang hasratnya sama, yaitu ingin memeluk dan mencium gurunya itu, namun kondisi fisik Abu Lueng Angen yang dalam keadaan uzur itu tidak memungkinkan, sehingga para pendatang harus mengurungkan niatnya. Yang terlihat dari para tamu hanya buliran air mata, sembari memberi isyarat dengan anggukan hormat. Wajahnya Abu Lueng Angen yang penuh gurat ke-

LHOKSEUMAWE (Waspada): Terkait ribut masalah internal antara Ketua Umum Partai Golkar Aburizal Bakrie alias Ical dengan Ketua DPD Partai Golkar Banda Aceh Muntasir, diminta agar tidak membawa-bawa nama Aceh. Sebagaimana yang dilansir berbagai media masa, Senin (30/4), Muntasir tidak terima atas sindiran Ical yang menyebutnya “seperti orang habis minum” yang dianggap berkonotasi dengan pemabuk. Lantas Muntasir mengatakan, “Saya ini orang Aceh, penganut Syariat Islam. Masa dikatakan pemabuk? Itu sama saja menghina orang Aceh.” Ucapan itu ternyata mengusik sejumlah orang Aceh yang tidak suka identitas diri mereka

dilibatkan dalam masalah internal partai. “Saya minta, Muntasir jangan bawa-bawa nama Aceh dalam perkara dia. Dia harus menyelesaikan masalah pribadinya dengan Ical itu secara sportif,tidakperlumembawa-bawanamaAcehsegala,” tegas Ketua Pusat Kebudayaan Aceh-Turki (PuKAT), Thayeb Sulaiman kepada Waspada. Dia tidak setuju nama Aceh dibawa-bawa dalam masalah partai, karena Aceh punya masalah tersendiri yang lebih besar. Lagi pula, katanya, Golkar tidak popular di Aceh. Pemenang Pilkada atas Wali Kota Banda Aceh adalah dukungan dari Demokrat dan PPP. Sedangkan Gubernur Aceh sendiri menang atas usuangan Partai Aceh.(b14)

Mobil Tim Pemenangan Balon Bupati Bireuen Dirusak OTK BIREUEN (Waspada): Satu unit mobil Toyota Avanza BL 813 ZA yang disebut-sebut digunakan tim pemenangan bakal calon (Balon) Bupati Bireuen periode 2012-2017, Nurdin Abddul Rahman yang berpasangan dengan Zakwan Usman, dirusak Orang Tak Dikenal (OTK), Senin (30/4) dini hari. Menurut informasi yang dihimpun dari berbagai sumber melaporkan, perusakan mobil saat diparkir di rumah ketua tim pemenangan balon incumbent itu di Kecamatan Gandapura, Yusrizal. Diduga pelaku berjumlah dua orang merusak kaca jendela mobil sebelah kanan hingga

hancur dan kaca depan mobil hingga hancur dengan menggunakan parang. Setelah pemilik rumah terbangun dan pelaku melarikan diri. Kapolres Bireuen, AKBP Yuri Karsono, SIK melalui Kapolsek Gandapura, Iptu Aji Wisa Prayogo ditemui wartawan Mapolsek setempat mengatakan, setelah menerima laporan kejadian itu polis segera merapat ke lokasi kejadian. “Mobil yang menjadi sasaran diamankan ke polsek, polisi sedang melakukan penyelidikan kasus pengrusakan tersebut, kita fokus pada tindak kriminal saja yaitu pengrusakan mobil,” katanya. (b17/b12)

Bupati Dan Wali Kota Terpilih Diminta Terbuka Dengan Rakyat SAMUDERA (Waspada): Bupati terpilih Kabupaten Aceh Utara Muhammad Thaib dan Wali Kota terpilih Suadi Yahya, diminta harus terbuka dengan rakyat dalam semua hal, serta patuh pada garis perjuangan dan memprioritaskan program pengentasan kemiskinan. Hal tersebut disampaikan Tgk Zulkarnaini Hamzah, Ketua Komite Peralihan Aceh (KPA) yang akrapdisapaTgkNidalamacaraMaulidNabiBesar Muhammad, SAW di komplek Makam Sultan Malikussaleh di Gampong Beringen, Kecamatan Samudera, Aceh Utara, Senin (30/4) pagi. “Penurunan angka kemiskinan harus menjadi program skala prioritas pada masa pemerintahan yang baru. Jika program ini berhasil dilaksanakan dengan baik, maka tidak mustahil kita akan mampu mewujudkan kesejahteran ma-

syarakat. Partai Aceh akan terus melakukan pengawasan terhadap model kerja kerja ke depan. Ini demi kemaslahatan kita semua,” kata Tgk Zukarnaini. Peringatan Maulid Nabi Muhammad di Gampong Beuringen dihadiri Muzakir Manaf, Wakil Gubernur Aceh terpilih, para petinggi PA, Muspika dan Muspida, serta para tokoh masyarakat se-Aceh Utara. Jangan ada lagi yang ditutup pada kemimpinan ke depan, semua pihak pemimpin harus siap untuk membuka diri serta mau menerima berbagai kritikan, karena kritikan adalah bahan masukan untuk memperbaiki kinerja. “Sebagai rasa syukur kita atas terpilihnya pemimpin yang diusung PA, kita santuni 3.000-an anak yatim,’’ katanya. (b18)

Polisi Tangguhkan Penahanan Tersangka Kasus Pupuk Subsidi LHOKSUKON (Waspada): Polres Aceh Utara mengabulkan permintaan penangguhan penahanan T Zulkifli Abdullah, 56 dan Chairi Ramli, 54, dua tersangka kasus dugaan penggelapan 10 ton pupuk bersubsidi di Kec. Cot Girek, Aceh Utara. “Mereka keluar sel sejak Sabtu (28/4). Meski demikian, kasusnya tetap lanjut dan mereka kita kenakan wajib melapor tiap Senin-Kamis,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kasat Reskrim, AKP Marzuki, Senin (30/4). Chairi Ramli, Ketua KUD Bukit Makmur, Kec. Cot Girek dan T Zulkifli, 56, pemilik kios pengecer pupuk bersubsidi, UD Sejahtera Tani, di Desa Kilometer XII, Cot Girek, ditetapkan sebagai tersangka dalam kasus itu 16 April 2012. Keduanya sempat ditahan di Mapolres Aceh Utara selama tiga hari, sejak Rabu, 25 April 2012.

Seiring penahanan itu, pihak pengacara kedua tersangka mengajukan permintaan penangguhan penahanan dengan alasan berbeda. Pengacara T Zulkifli beralasan kliennya punya riwayat sakit jantung. Sedangkan pengacara Chairi menyatakan kliennya tak akan melarikan diri atau merusak serta menghilangkan barang bukti. “Chairi juga mengaku hendak menikahkan anaknya pekan ini,” tutur AKP Marzuki. Kasus ini berawal dari ditemukannya 10 ton pupuk bersubsidi oleh aparat Polres Aceh Utara, di gudang KUD Bukit Makmur, Cot Girek, 26 Maret 2012. Pupuk itu dibeli dari UD Sejahtera Tani, Rp125.000 per sak, lalu dijual ke petani Rp 140.000 per sak. Padahal Harga Eceran Tertinggi atau HET-nya hanya Rp 115.000 per sak.(b19)

Korban Mati Tergantung Masih Tanda Tanya Waspada/ M Jakfar Achmad

ULAMA kharismatik Provinsi Aceh,Tgk H M Daud Ahmady alias Abu Lueng Angen, pimpinan dayah Darul Huda Lueng Angen, Kec. langkahan,Aceh Utara,saat dipapah bangkit untuk menyambut tamu yangdatangmemenuhiundanganacaraperkawinanputribungsunya, Siti Raihanah alias Nyak Nah, Minggu (29/4). tuaan, hari itu nampak ceria. Betapa, perhelatan akbar yang diselenggarakan keluarganya bersama masyarakat itu, yaitu acara perkawinan putri bungsunya yakni Siti Raihanah alias Nyak Nah (panggilan akrab). Salah satu tamu dari negara tetangga, Abdul Azizi, 35, asal Kampung Baru Kuala Lumpur Malaysia. Ia mengaku, kedekatannya dengan Abu Lueng Angen, sudah terjalin begitu lama. “Kita pengurus Masjid Kampung Baru Kuala Lumpur Malaysia, kita terikat hubungan silaturahmi ilmu agama,” katanya ringkas. Pernikahan Siti Raihanah dengan pemuda pemuka aga-

ma, Tgk Kamarullah pertengahan April ini, peresmiannya, Minggu kemarin. Menantu ulama kharismatik ini, berasal dari dayah MUDI Mesra Samalanga, Kabupaten Bireuen, punya benang merah dengan latar belakang Abu Lueng Angen yang dulu menimba ilmu di Samalanga. “Kondisi Abu Lueng Angen bertambah parah, sejak pertengahan 2011 lalu paska jatuh terleset yang menyebabkan tulang paha kirinya patah,” jelas juru bicara dayah Darul Huda Lueng Angen, Tgk M Jafar di tengah-tengah kesibukannya, pada hari perhetan akbar penikahan putri bungsu ulama ini.(b13)

LHOKSEUMAWE (Waspada): Alimuddin,60, penjaga malam yang tewas dengan tubuh tergantung masih menjadi tanda tanya. Sampai saat ini pihak kepolisian Banda Sakti Lhokseumawe yang menangani kasus ini belum menerima hasil visum dari RS, Senin (30/4). “Kita masih menunggu hasil visum. Berdasarkan hasil visumlah kami mengambil tindakan, apakah perlu pengusutan atau memang korban bunuh diri. Jika bukan bunuh diri, barulah kami memeriksa saksi-saksi,” ungkap Kapolsek Banda Sakti, melalui Kanit Reskrim, Bripka Zamzami kepada wartawan. Sejauh ini warga masih bertanya-tanya terhadap kematian penjaga malam ini yang

dianggap tidak lazim. Kematian yang terungkap, Minggu, (29/4) menjelang siang itu masih menyimpan misteri. Zamzami memperkirakan, setidaknya besok mereka sudah mendapatkan hasil pemeriksaan medis terhadap korban. Penemuan mayat korban yang tergantung di rumah kontrakannya ini sempat membuat gempat masyarakat di Gang Keluarga, Tumpok Teungeh ini. Tidak seseorang pun menyangka jika Alimuddin tewas dalam keadaan begitu menggenaskan. Seseorang yang curiga lantas mengintintip lewat rengangan papan, dan melihat sesosok tubuh setengah tergantung di tiang ruangan utama rumah itu. (b14)

Masalah Pengupahan Buruh Isu Utama May Day 2012 LANGSA (Waspada) : Masalah pengupahan masih menjadi isu utama peringatan May Day tahun 2012 ini. “Banyak kesewenangan para pemegang kekuasaan tidak mempedulikan nasib dan tidak berpihak pada kepentingan kaum buruh itu sendiri,”ujar Yusbi Yusuf, Advokasi Konfederasi Serikat Buruh Sejahtera Indonesia (KSBSI) Provinsi Aceh, Senin (30/4). Dia menambahkan, momentum May Day tahun 2012 ini, pemerintah harus segera menyi-

kapi empat hal mendasar permasalahan buruh. Dia mengakatan demi kesejahteraan buruh, maka pemerintah harus segera mencabut pasal dimaksud atau melakukan amandemen UU No.13 tahun 2003 ini. Sementara menyangkut masalah pengupahan buruh, khususnya di Aceh, Gubernur Aceh telah menetapkan Upah Minimum Provinsi (UMP) Aceh tahun 2012 adalah Rp1,4 (b22)


WASPADA Selasa 1 Mei 2012

Tujuh Personil Pos Lanal PPI Peudada Ditarik

Hari Terakhir e- KTP Di Nagan Warga Berdesakan NAGAN RAYA (Waspada) : Meskipun e- KTP yang berjalan empat bulan di wilayah Kabupaten Nagan Raya namun masih banyak warga yang belum mendapatkan untuk berfoto salah satunya di Kecamatan Seunagan Timur, warga menjadi berdesakan di pintu masuk berfoto. ‘’Kita sudah berjam- jam di sini sampai sekarang belum mendapatkan giliran foto, seharusnya para panitia itu membuat satu lagi ruang supaya tidak terjadi desakan begini,’’tegas warga yang di dalam ruangan foto,kemarin. Sementara di luar ruangan masyarakat yang menunggu untuk mendapatkan giliran foto yang berdesak- desakan karena panitia penyelenggara lamban dan tidak fair.(cb07)

Warga Pulo Seunong Mohon Pembangunan SIGLI (Waspada): Masyarakat Tangse, Kabupaten Pidie yang bermukim di Desa Pulo Seunong dan Pulo Mesjid, memohon perhatian pemerintah setempat segera membangun jalan desa mereka yang sudah lama mengalami rusak parah. Amatan Waspada, Minggu (29/4) saat ini ruas jalan desa tersebut dipenuhi lubang-lubang dan bebatauan. Bila tiba musim hujan kondisi jalan tersebut mirip kubangan kerbau, dan pada musim kemarau lintas itu penuh terpaan debu. Jufri, 36, warga Desa Pulo Seunong bersama beberapa warga desa setempat mengungkapkan ribuan masyarakat Tangse, khususnya masyarakat Desa Pulo Seunong dan warga Desa Pulo Mesjid sangat membutuhkan perhatian Pemkab Pidie untuk memperbaiki jalan yang menghubungkan Desa Pulo Mesjid dan Desa Pulo Sunong tembus kota Kecamatan Tangse. (b10)

PEMA Unsyiah Bantu Korban Banjir Agara KUTACANE (Waspada) : Pemerintahan Mahasiswa (PEMA) Universitas Syiah Kuala, Banda Aceh, Sabtu (28/4) Sore, menyerahkan bantuan, beras dan pakaian senilai Rp13 juta pada korban banjir bandang di Kecamatan Bukit Tusam, Aceh Tenggara. Ketua PEMA Unsyiah, Azmi, kepada Waspada, Sabtu (28/ 4) didamping Ketua KAMMI Agara Mahali menyebutkan, bantuan senilai RP 13 juta itu, digalang PEMA Unsyiah dari masyarakat dijalanan Kota Banda Aceh serta dibantu juga dari beberapa instansi pemerintahan di Aceh yang peduli atas aksi itu. Bantuan diberikan berupa, beras sejumlah 81 sak, telur 60 papan, minyak goreng 60 Kg, selain ini juga diberikan kepada korban banjir itu sarung sebayak 3 kardus, baju wanita 50 lembar, baju pria 50 lembar, serta jilbab sebanyak 93 buah. Disebutkan semua yang disumbangkan tersebut dibeli di Kutacane untuk dibagikan kepada korban di tiga desa masing-masing, Desa Sebudi Jaya, Kerukunan dan Rikit Bur. Ketua KAMMI Agara Mahali, mengatakan, atas partisipasi rekan mahasiswa dari luar Agara atas musibah yang meninpa warga Agara ini, selaku ketua KAMMI Agara, mereka mengucapkan terimakasih. (b25)

Nelayan Pidie Belum Terima Dana Rehab Rumah SIGLI (Waspada): Beberapa nelayan di Kabupaten Pidie mengaku hingga April 2012 belum menerima dana rehab rumah berkisar Rp 5 juta sampai Rp 6 juta. Padahal Dinas Kelautan dan Perikanan (DKP) Pidie yang menangani proses pencairan dana tersebut telah selesai melakukan pendataan Januari 2012. “ Kami sampai sekarang ini belum menerima dana tersebut, bahkan kami tidak tahu lagi kelanjutan dari hasil pendataan DKP Pidie. Karena tidak ada kabar lagi, kami menduga itu hanya data-data saja sebab dananya tidak kunjung turun” kata Abu Bakar, 45 salah seorang nelayan di Kecamatan Batee, kepada Waspada, Minggu (29/4). Menurut Abu Bakar, beberapa bulan lalu Pemkab Pidie melalui DKP mendata nelayan untuk rehab rumah. Kepada warga nelayan dijanjikan diberikan dana berkisar Rp 5 juta hingga Rp 6 juta. Dana itu akan dicairkan dalam dua tahap. Keluhan yang sama juga disampaikan warga nelayan, Kecamatan Simpang Tiga, Kembang Tanjong dan Muara Tiga. Kepala Bidang Kelautan, Dinas Kelautan dan Perikanan (DKP) Kabupaten Pidie, Sarwati. SPi meminta supaya masyarakat bersabar, karena sekarang ini sedang dalam tahap verifikasi oleh pusat.(b10)

SMA 1 Seunagan Gelar Perpisahan NAGAN RAYA (Waspada) : SMA 1 Seunagan Kabupaten Nagan Raya Sabtu (28/4), menggelar acara perpisahan yang berlangsung di SMA setempat. Kegiatan dihadiri Pj Bupati Nagan Raya Azwir, S.Sos, Dinas Pendidikan yang diwakili Dikdas Bukhari, SPd dan KUA serta wali murid. Dari amatan Waspada di SMA 1 Seunagan selain melakukan perpisahan, dalam acara tersebut para siswa mengadakan berbagai aneka acara seperti tari ranup lampuan, tari Keunebah Endatu dan drama yang di ambil dari kisah penjajahan belanda kepada rakyat Aceh yang di pimpin Teuku Umar serta istrinya Cut Nyak Dhien. Kepala Sekolah M Taher, SPd kepada Waspada mengatakan, acara ini adalah sebagai wujud pada siswa dalam bentuk perspisahan dengan adik sekelasnya serta guru. (cb07)

Bersihkan Makam Tokoh Penyebar Dakwah Islam Di Gayo TAKENGEN (Waspada): Makam seorang tokoh penyebar siar dakwah Islam di massa penjajahan Belanda dibersihkan sejumlah petugas kepolisian dan warga di Belang Bebangka, Pegasing, Aceh Tengah. Kegiatan amal dilakukan aparat gabungan Polda Aceh bersama Polres Aceh Tengah dan warga Pegasing, selain bakti sosial, juga mengenang perjalanan seorang ulama kharismatik asal Pulau Jawa di Gayo. MakaminimerupakantempatwafatnyaReje(Raja)SultanRaden asal Pulau Jawa. Menurut cerita para tokoh adat, beliau (alm. Reje Raden) bersama istrinya meninggal di Gayo ini setelah melakukan misi dahwah Islam pada zaman penjajahan kolonial Belanda. Demikian sebut Kapolres Aceh Tengah, AKBP Dicky Sandoni melalui Polsek Pegasing, Lettu Suprihadi, didampingi Sabara Polda Aceh, AKP, Asmadi kepada Waspada, Minggu (29/4) di sela-sela kerja bakti membersihkan makam Reje Sultan Raden di Belang Bebangka, Aceh Tengah. Sementara, Ali Husin AZ, 75, merupakan Mukim Pegasing, dalam kesempatan itu mengatakan, meski tidak diketahui secara pasti tahun berapa Reje Raden melakukan siar Islam di Gayo. Namun dari cerita turun menurun, ulama asal Pulau Jawa ini telah memberi ‘penerangan’ bagi rakyat pada masa itu. (cb09)

Waspada/Irwandi MN

PETUGAS kepolisian didampingi camat pihak warga melakukan pembersihan makam Reje Sultan Raden di Belang Bebangka, Aceh Tengah, Minggu (29/4).


Waspada/Gito Rolies

PANGDAM IM Mayjen Adi Mulyono salam komando dengan Dandim 0101/BS yang baru Letkol Inf Triadi Murwanto dan Dandim lama Letkol CZI Saptono Syiwarudi, serta Letkol Inf Dian Hardiana, mantan Deninteldam IM pada sertijab Dandim 0101 BS di Makodam IM, Senin (30/4).

BBM Ilegal Asal Medan Ditemukan Di Aceh Tengah TAKENGEN (Waspada) : Polres Aceh Tengah mengamankan BBM solar non subsidi tanpa izin (ilegal) yang dipasok dari Medan, Sumatera Utara. Petugas yang melakukan kroscek bersama staf BP Migas, Minggu (29/4) mengamankan 3.400 liter solar tanpa izin milik CV Mahara yang dipasok untuk kebutuhan PT Hae Chang (PLTA Peusangan Aceh Tengah). Menurut Kapolres Aceh Te-

ngah AKBP Dicky Sandoni melalui Kasat Reskrim AKP Wendi Oktariansyah, Senin (30/4) di Mapolres setempat, pihaknya telah mengamankan seorang tersangka, Ag bin Sabaruddin, 45, pemilik CV Mahara sebagai pemasok minyak ke PT Hae Chang. Sementara dari pengembangan kasus dan keterangan tersangka, diketahui BBM tersebut berasal dari PT Indah Deli Jaya Lestari, Medan,” tutur Wendi. Kecurigaan polisi berawal dari adanya satu tangki minyak berwarna merah putih berka-

pasitas 16.000 liter yang ditemukan di Kampung Remesen, Silih Nara. Tangki ditemukan di lokasi pembuatan terowongan PLTA yang sedang dibangun. Menurutnya, akibat belum adanya izin niaga yang dimiliki CV Mahara sebagai pemasok minyak ke PT Hae Chang, tersangka dapat dijerat dengan pasal 23 jo 53 tentang tindak pidana ilegal BBM. “Dari keterangan tersangka dan seorang saksi, kegiatan ilegal memasok BBM dari Medan initelahberlangsung4kalikeAceh Tengah,��� jelasnya. (cb09/b32)

13 Anggota DPRK Gayo Lues Layangkan Mosi Tak Percaya BLANGKEJEREN (Waspada) : Tiga belas anggota DPRK Gayo Lues menyatakan sikap mosi tidak percaya terhadap Ketua dan dua Wakil Ketua DPRK Gayo Lues. Pasalnya, mereka menuding ketua DPRK mengeluarkan surat ilegal yang ditujukan kepada KIP dan Panwaslih agar tahapan Pilkada Bupati/ Wakil Bupati Gayo Lues dihentikan. Karena dianggap telah melanggar tata tertib DPRK Gayo Lues No. 01 tahun 2009 Pasal 14 ayat 1-9 tentang mekanisme hak menyatakan pendapat, dan melanggar kode etik DPRK pasal 98 ayat 1-2 tentang kewajiban menaati kode etik. Selain itu, tiga belas anggota ini menuding substansi dari isi surat Ketua DPRK tidak mencerminkan kenetralan selaku pimpinan lembaga terhormat, karena hanya surat-surat dari kontestan Pilkada nomor urut 2 saja yang menjadi referensinya. Padahal begitu banyak kasus dan masalah yang dihadapi kontestan pilkada No. 3 di lapangan yang dilakukan peserta No. 2, seperti intimidasi, penculikan, pemaksaan, dan ancaman kepada tim dan pendukung No. 3. Hal ini kata mereka, terbukti makar yang direncanakan sebelum 9 April, akan terjadi keka-

cauan dan kerusuhan apabila tidak menang no. 2. “Ternyata makar tersebut terlaksana 10 April setelah diketahui perolehan suara No. 2 kalah. Terjadi demo anarkis, pembakaran kotak dan surat – surat suara serta kantor penyelenggara pilkada,” ujar M Yusuf HS, salah satu anggota DPRK Gayo Lues itu, Senin (30/4). Tambahnya, dengan demikian permintaan pilkada ulang dari Tim Sukses No. 2 direspon oleh ketiga pimpinan DPRK dengan surat pendapat gelap agar tapan pilkada dihentikan sementara. Menurut anggota dewan yang lain, M Saleh, tiga pimpinan DPRK telah sewenang-wenang memperalat lembaga DPRK untuk kepentingan politik dan kelompoknya dengan melayangkan surat No. 170/51/ DPRK/2012, tanggal 17 April 2012, dengan sifat rahasia yang ditandatangani ketua DPRK HM Amru, wakil ketua Selamat dan Sudirman yakni, ketua tim sukses No. 2 Irmawan – Yudi. Ali Husin, dari Fraksi Golkar menyesalkan sikap ketuanya yang juga ketua DPD II Partai Golkar Gayo Lues telah mengintervensi KIP/KPU dan Panwaslih untuk menghentikan tahapan-trahapan Pilkada. Mosi tidak percaya tersebut,

bermula dari berita acara rapat komisi A Bidang Pemerintahan, Kamis (26/4) dihadiri ketua komisi A Wahab, Wakil Ketua Jafar dan Sekretaris Alfahsyam. Selanjutnya komisi A mengundang komisi lain melalui Sekretaris Dewan agar secepatnya melakukan rapat gabungan. Rajab Marwan, Sekwan DPRK Gayo Lues menyikapi, secara administrasi surat keluar masuk tentang pendapat pimpinan DPRK Gayo Lues hanya ada dua surat dari Tim Sukses No. 1 dan No. 2 yang masuk ke sekretariat DPRK, namun itu hanya tembusannya saja, artinya bukan langsung ditujukan kepada DPRK, melainkan kepada KIP dan Panwaslih. 13 Anggota DPRK yang menyatakan mosi tidak percaya terhadap Ketua dan Wakil Ketua, yakni Jafar (wakil ketua komisi A), Ibrahim (ketua komisi B), A Wahab (ketua komisi A), A Azis (wakil ketua komisi B), A Murtada (anggota komisi D), Kasim Syehsaman (ketua komisi D), M Yusuf HS (wakil ketua komisi C), Ali Husin (ketua komisi C), Rajudin ( anggota komisi B), Alfahsyam (sekretaris komisi A), M Saleh (sekretaris komisi B), Ismail Muse (sekretaris komisi C), Said Sani (anggota komisi C). (cjs)

Pertemuan Mahasiswa AMIK Ricuh Perwakilan Yayasan Diusir SIGLI (Waspada) : Pertemuan ratusan mahasiswa Akademi Manajemen Informatika dan Komputer (AMIK) dengan pihak yayasan Jabal Gafur Sigli, Senin (30/4) siang sempat ricuh. Mahasiswa mengusir perwakilan yayasan dan nyaris membakar meubiler kampus itu karena kecewa tidak mendapat kepastian dari pihak yayasan. Pantauan Waspada, pertemuan di kampus itu berlangsung sekira pukul 10:00. Ratusan mahasiswa berkumpul di salah satu ruangan kampus guna mendengar penjelasan pihak yayasan. Namun belum sempat menemui kesepakatan, 2 perwakilan Yayasan Jabal Ghafur yang menghadiri pertemuan mewakili yayasan diusir mahasiswa. Keduanya yakni Rektor Universitas Jabal Ghafur Prof Dr Bansu Irianto Ansari dan Ketua PengawasYayasan Jabal Ghafur M Nasir Ahmad. Ketua Umum Forum Komisaris AMIK Jabal Ghafur Sigli, Erlizar mengatakan, pertemuan tersebut merupakan tindaklanjut dari undangan mahasiswa terhadapYayasan Jabal Ghafur. Sedianya pertemuan diadakan Minggu (29/4), namun tidak ada pihak yayasan yang hadir. Menurut Erlizar, pengusiran karena kedua perwakilan yayasan itu tidak membawa surat mandat dariYayasan Jabal Ghafur sehingga menyalahi admi-

Waspada/Arman Konadi

“Sebenarnya tuntutan mahasiswa sudah direspon yayasan, makanya saya yang ditunjuk sebagai Pjs untuk datang. Tapi karena buru-buru surat mandat itu belum dibuat,” kata Bansu yang juga rektor di Unigha Sigli. Pertemuan yang berlangsung hanya sekitar 30 menit itu sempat diwarnai sorakan mahasiswa terhadap kedua perwakilan. Mahasiswa juga terlibat perdebatan hebat saat mempertanyakan surat mandat. Karena tak mampu menunjukkan surat keduanya akhirnya dikeluarkan dari ruang pertemuan. (cb06)

oknum marinir Kopka AS dan Praka AD, atas nama Lanal Lhokseumawe meminta maaf terkait insiden itu. Tindakan kedua oknum bukan institusi akan diambil tindakan tegas. Menurut Tjatur Sunarto, kejadian itu hanya salah pengertian bukan masalah permintaan ikan. Saat itu kedua oknum marinir sedang melakukan patroli mencurigai seorang nelayan melaju sangat cepat, lalu dikejar. Kedua oknum marinir Kopka AS dan Praka AD tak mengerti bahasa Aceh, kemungkinan salah pengertian saat nelayan memberi penjelasan dalam bahasa Aceh sehingga terjadi insiden yang tidak diinginkan. Panglima Laot Bireuen Baharuddin Yunus mengatakan, pasca insiden itu kebanyakan boat nelayan tidak melaut karena masih khawatir terhadap imbas insiden Sabtu (28/4). (b12)

Kebocoran UN, Kobar-GB Dilobi Agar Cabut Laporan BANDAACEH (Waspada) : Sejumlah pihak berupaya melobi Koalisi Barisan Guru Bersatu (Kobar-GB) Aceh agar mencabut laporan mereka ke Polda Aceh terhadap dua oknum guru yang diduga telah membocorkan kunci jawaban UN SMP dan SMA. “Ada beberapa pihak yang sudah berusaha melobi kita agar mencabut laporan tersebut, tapi kita bersikeras tetap akan melanjutkan kasus ini,” ungkap Ketua Kobar-GB Aceh Sayuthi Aulia Yusuf didampingi Sekretaris Kobar-GB Aceh, Husniati Bantasyam, Senin (30/4). Menurut Sayuthi, laporan yang mereka buat ke Polda Aceh ini bukan bermaksud untuk menyakiti siapa pun, tetapi untuk menjadikan kasus ini sebagai upaya untuk mengungkapkan siapa sebenarnyayangmenjadipelakuutamaterjadinya kebocoran UN setiap tahunnya di Aceh. Selain itu, kata dia, hal ini mereka lakukan semata-mata untuk menyahuti anjuran Dinas Pendidikan Aceh untuk melaporkan kepada pihak berwajib jika mendapati oknum-oknum

yang melakukan kecurangan pada saat UN. “Kami berharap para guru yang dilaporkan tersebut mau membeberkan kepada pihak berwajib dari mana asal-usul jawaban tersebut,” papar Sayuthi. Sebagaimana diberitakan, Jumat (27/4) lalu, Kobar-GB Aceh melaporkan dua guru ke Polda Aceh karena diduga membocorkan UN tahun 2012 di Aceh. Kedua guru ini, yakni AR (guru SMPN 18 Banda Aceh) dan RF (guru SMPN 2 Ulim, Pidie Jaya) diduga mengirim kunci jawaban yang dikirim guru lain ke handphone mereka untuk para siswa peserta UN dan guru-guru lain di Aceh untuk diteruskan kepada siswa. Pengaduan tertulis ke Polda Aceh dilakukan Kobar-GB berdasarkan hasil investigasi kepada AR dan hasil pembicaraan yang direkam antara AR dengan RF di kantor Kobar-GB. Bahkan, dalam pembicaraan tersebut diperoleh informasi bahwa pembocoran UN ini melibatkan oknum kepala sekolah dan guru yang terlibat dalam kepanitiaan di sekolah tersebut. (b04)

DPP PPRN PAW-kan Anggota DPRK Aceh Selatan TAPAKTUAN (Waspada) : DPP Partai Peduli Rakyat Nasional (PPRN) secara resmi mengusulkan penggantian antar waktu (PAW) anggotanya di DPRK Aceh Selatan, Sulaiman dan penggantinya Hanafiah. Usulan tertuang dalam SK DPP PPRN No.0070/SK/DPP-PPRN/IV/2012, tertanggal 14 April 2012 dan Surat Keputusan No 176/SP/ DPP-PPRN/IV/2012, tertanggal 14 April 2012. “Terhitung sejak 14 April 2012, DPP PPRN resmi mengusulkan PAW dan pemberhentikan Sulaiman dari keanggotaan PPRN dan sekaligus mencabut kartu tanda anggotanya dan menetapkan Hanafiah, No.KTA : BL.01.A03.0001. 2008.0326,” kata Ketua DPW PPRN Aceh, Nazier A Ganie, kepada wartawan, Senin (30/4) di Tapaktuan. Usulan PAW Sulaiman, menurut Nazier, dilakukan demi kepentingan partai. “Siapa pun yang melanggar AD/ART dan peraturan partai, tetap diberi sanksi dan kader yang menduduki anggota legislator harus di-PAW,” papar Nazier

seraya menyebutkan DPP PPRN telah mengirim surat ke DPRK Aceh Selatan tentang usulan PAW. Anggota DPRK Aceh dari Partai PPRN, Suliaman yang dikonfirmasi mengakui pihaknya telah diusulkan pemberhentian dari anggota dewan. Dia berharap DPP PPRN dapat mempertimbangkan kembali usulan PAW dan pemberhentian dirinya dari keanggotaan PPRN. Alasannya, karena dirinya tidak pernah melakukan pelanggaran dan mengkhianati partai. Sulaiman mengatakan, jika usulan PAW dan pemberhentian dirinya dari PPRN terus dipaksakan, maka pihaknya akan menempuh upaya hukum melalui PTUN sampai ke MK. Sebab, usulan PAW itu baru bisa dilakukan ketika yang bersangkutantelahmelakukanpelanggaranberat. Syarat mem-PAW-kan seorang anggota dewan, kata Sulaiman, di antaranya karena melanggar AD/ART partai dengan bukti otentik, kena hukuman selama lima tahun, melanggar etika/moral, mengundurkan diri dan meninggal dunia. (b30)

5 Km Jaringan PLN Sigli Rusak SIGLI (Waspada) : Puluhan desa di tiga kecamatan di Pidie, Minggu (29/4) gelap gulita akibat padamnya aliran listrik. Pemadaman disesalkan warga karena dilakukan sepihak tanpa pemberitahuan. Amir, 36, warga Kalee, Kec.Muara Tiga, Pidie, menuturkan, padamnya listrik terjadi sejak pukul 18:30. Padamnya listrik menimbulkan tanda tanya di masyarakat karena Minggu malam cuaca di Pidie cukup bersahabat. Manajer PLN Cabang Sigli, Taufiq Hidayat

yang dihubungi terpisah mengaku pemadaman karena rusaknya jaringan PLN bawah tanah di wilayahnya. Kondisi ini membuat pasokan listrik ke tiga kecamatan yakni Pidie, GrongGrong dan Muara Tiga terganggu. “Ada korsleting yang diakibatkan karena ada kebocoran pada jaringan bawah tanah. Namun dua wilayah yakni Grong-Grong dan Padang Tiji sejak pukul 22:00, listrik sudah menyala,” kata Taufik Hidayat. (cb06)

Polisi Bekuk Pembunuh Mahasiswa UTU MEULABOH (Waspada) : Tersangka pembunuh Mahasiswa Universitas Teuku Umar (UTU), Samsuri,24, ditangkap jajaran Polres Aceh Barat yang bekerja sama dengan Polres Abdya di Desa Keude Siblah, Kecamatan Blangpidie, Kabupaten Abdya, Jumat (27/4) sekira 22.30. Kalpores Aceh Barat AKBP Artanto, melalui Petugas Reskrim, Jhon Aswin, Minggu (29/4) wartawan mengatakan, kronologis penangkapan terhadap tersangka MM . Berdasarkan informasi dari salah seorang teman dekat tersangka. Ternyata MM memiliki hubungan sesama jenis dengan seorang waria yang berprofesi peñata rias di salah satu salon kecantikan yang beralamat di Desa Gampa, Kecamatan Johan Pahlawan. Pihak kepolisian meminta bantuan kepada teman dekat MM untuk memberitahukan keberadaan tersangka lalu polisipun segara

SEJUMLAH mahasiswa berdebat dengan para pihak yang mewakili Yayasan Jabal Ghafur Sigli, Senin (30/4). nistrasi.“Harusnya jika memang utusan yayasan dia membawa surat resmi dari yayasan. Ini agar apapun keputusan pertemuan berkekuatan hukum,” kata Erlizar. Selain mengusir perwakilan yayasan, mahasiswa juga mengusir Pembantu Direktur III AMIK, Zakaria Abbas karena dinilai tak mampu membawa aspirasi mereka. Prof Bansu Irianto mengaku dirinya ditunjuk yayasan untuk menjadi Pjs AMIK menggantikan direktur sebelumnya Mustafa Alibasyah. Kehadirannya untuk menjaringa aspirasi mahasiswa AMIK.

PEUDADA ( Waspada) : Komandan Pangkalan Angkatan Laut (Lanal) Lhokseumawe Letkol Laut (P) Tjatur Sunarto menegaskan, pihaknya sudah menarik tujuh anggota yang bertugas di Pos AL PPI Peudada Bireuen dan diganti dengan personil lain. “Dua di antara tujuh anggota yang melakukan pemukulan terhadap nelayan, Kopka AS dan Praka AD sudah diamankan ke Detasemen Polisi Militer AL Lhokseumawe untuk ditindak tegas sesuai dengan hukum militer,” ujar Dan Lanal kepada wartawan saat turun ke Pos Lanal PPI Peudada, Minggu (29/4). Pihaknya sudah berkunjung ke rumah korban bersama Panglima Laot, unsure Muspika setempat untuk menjenguk Jafaruddin, warga Desa Pulo Peudada yang dipukul kedua anggotanya dan menyerahkan santunan. Atas tindakan main hakim sendiri, dua

bergerak ke lokasi lalu membekuknya. Artanto juga menceritakan kronologis kejadian pembunuhan. “ pada hari itu mereka sedang menikmati minuman keras bermerek Scoth, lalu korban mengatakan“ minuman yang lebih ini aku bawa pulang ke rumah. “ Tersangka tidak mengizinkan, kemudian beradu mulut dan tersangka mengambil sebuah batu giling cabai untuk memukul bagian leher. Setelah itu korban jatuh ke lantai lalu tersangka merasa kurang puas, sehingga kembali menusukkan pisau ke leher korban hingga tewas. Barang bukti pembunuhan sudah diamankan di Kapolres Aceh Barat berupa batu giling cabai, pisau, 1 botol minuman keras merk Scoth dan 2 bungkus rokok. Tersangka MM dijerat pasal 340 dan 388 KUHP dengan ganjaran hukuman 20 Tahun penjara. (cb07)

Penegakkan Perda Pijay Terkendala Jumlah Personil Pol PP/WH MEUREUDU (Waspada) :Upaya menciptakan kondisi kabupaten Pidie Jaya menjadi daerah yang tertib, tentram dan teratur belum berjalan optimal. Hingga kini keberadaan personil satpol PP- selaku lembaga yang memiliki tugas dan fungsi menegakkan peraturan daerah-di kabupaten tersebut dinilai masih kurang. Akibatnya sejumlah personil yang telah direkrut harus bekerja ekstra dengan penghasilan terbatas. “Dengan 8 kecamatan di Pidie Jaya, idealnya ada penambahan 48 personil untuk memperlancar tugas-tugas kita,”kata Kasatpol PP dan WH, Pidie Jaya, Drs Asiah MM, kepada Waspada, Minggu (29/4). Menurut Asiah, terbatasnya personil satpol PP dan Wh di Pidie Jaya membuat pihaknya harus bekerja ekstra keras siang maupun malam hari. Hal itu karena sebaran 8 kecamatan di Ka-

bupaten pemekaran Pidie itu dinilai relatief luas. “Kalau personil sudah sesuai jumlah penduduk maka di tiap Kecamatan bisa kita tempatkan 10 orang petugas satpol PP dan WH. Jadi kalau ada pelajar yang lari ke kecamatan Bandar Baru kita bisa kordinasi dengan petugas di sana,”kata Asiah mencontohkan. Sementara sebanyak 40 orang petugas satpol PP dan WH Pidie Jaya, Senin (30/4) akan mengikuti pelatihan pendidikan tugas. Pelatihan yang dipusatkan di Asrama Yon Armed Kodam Iskandarmuda Kecamatan Paru, Pidie Jaya akan berlangsung selama sepekan dan direncanakan dibuka Bupati Pidie Jaya Drs HM Gade Salam. “Kita berharap pelatihan ini dapat menambah wawasan serta mampu meningkatkan kualitas personil Pol PP danWH kedepan,”pungkas Asiah. (cb06)



Truk Colt Tubruk Pohon, Kernet Tewas IDI (Waspada) : Akibat diserang kantuk berat, truk jenis colt diesel BK 8210 ZE mengalami kecelakaan tunggal di Jalan MedanBanda Aceh km 359-360 di Desa Gampong Keude, Kec.Darul Aman, Kab. Aceh Timur, Senin (30/4) sekira pukul 04:30. Akibatnya, kernet truk tewas dan sopir mengalami luka kritis. Kejadian berawal ketika truk melaju dari arah Medan menuju Banda Aceh. Tiba-tiba mobil barang itu dengan kecepatan tinggi disopiri Eriyanto, 30, asal Perbaungan, Serdang Bedagai, Sumatera Utara kehilangan kendali akibat diserang kantuk. Truk kemudian menghantam pohon di kanan kanan jalan. Akibat kejadian itu, sopir mengalami luka patah pada tangan sebelah kiri. Sementara kernet bernama Anto, 40, warga yang sama tewas setelah sempat dirawat. Kasat Lantas Aceh Timur Iptu Hangga Utama Dermawan didampingi Kanit Laka Lantas Pos Idi Aiptu Bustamam membenarkan kejadian itu. (b24)

LHOKSUKON (Waspada): Ujian Nasional (UN) susulan untuk tingkat SMP di Aceh Utara, yang digelar di SMPN 1 Syamtalira Bayu, Senin (30/4), hanya diikuti empat siswa dari 11 orang yang mendaftar. “Kita sudah berusaha semaksimal mungkin. Bahkan ada yang dijemput langsung ke rumah. Tapi tetap saja banyak yang tidak hadir,” ungkap Sekretaris Panitia UN Aceh Utara, A Rahman TB, kemarin.

PETUGAS Lantas Pos Idi melihat truk colt diesel BK 8210 ZE yang ringsek berat setelah menghantam pohon di pinggir jalan negara Idi Cut, Kec.Darul Aman, Kab. Aceh Timur, Senin (30/4).

Kesadaran Bayar Pajak Kendaraan Meningkat IDI (Waspada): Kesadaran masyarakat di Kab. Aceh Timur dalam membayar pajak kendaraan roda dua maupun roda empat terus mengalami peningkatan. Hal itu terjadi sejak Januari 2012. “Kesadaran masyarakat dalam membayar pajak kendaraan sudah meningkat dibandingkan tahun-tahun sebelumnya, “ kata Kapolres Aceh Timur AKBP Iwan Eka Putra, SIK melalui Kanit Regident Samsat Aceh Timur Iptu T. Yani. F di Idi, Senin (30/4). Dia mengatakan, tahun 2011 setiap bulannya hanya 700 unit kendaraan roda yang melakukan pembayaran pajak. “Pada awal Januari hingga bulan April tahun 2012 ini sedikitnya ada 900 kendaraan roda dua yang membayar pajak setiap bulanya. Hal itu mengalami kenaikan sekira 35 persen dibandingkan tahun lalu,” kata Iptu T Yani. Dia mengatakan, kenaikan itu karena kesadaran masyarakat pemilik kendaraan bermotor selama ini untuk membayar kendaraannya telihat sangat tinggi. Sementara itu, kesadaran masyarakat pemilik kendaraan roda empat untuk membayar pajak juga mengalami peningkatan dibandingkan tahun sebelumnya. “Juga Mutasi kendaraan roda dua serta roda empat mengalami kenaikan, pada bulan April sebanyak 10 kendaraan roda empat dan roda dua sebanyak 2 unit yang mutasi dari luar daerah ke Aceh Timur,” sebutnya. (b24)

Jalan Menuju PPP Idi Berlubang IDI (Waspada) : Sepanjang 500 meter jalan menuju Pelabuhan Perikanan Pantai (PPP) Idi, Kab. Aceh Timur kondisinya sangat memprihatinkan. Selain berlubang bagaikan kubangan kerbau, saat musim penghujan digenangi air. Sementara saat musim pengering menyebabkan debu tebal ketika dilintasi kendaraan. Kondisi jalan sepanjang lebih kurang 500 meter itu kini tergolong rusak parah. Padahal jalan merupakan urat nadi para nelayan di sana sebagai sarana transportasi dalam mengangkut hasil perikanan di PPP Idi ke luar daerah, termasuk ke Sumatera Utara. Warga mengeluhkan kerusakan jalan tersebut, sebab sering terjadi kecelakaan saat mengelak lubang dan kubangan kerbau yang terjadi di tengah badan jalan. Warga meminta, Dinas Pekerjaan Umum Aceh Timur kini sudah saatnya memperbaiki jalan tersebut sehingga akses menuju PPP Idi lancar. (b24)

Waspada/Muhammad H Ishak

WARGA menghindari genangan air di kawasan jalan rusak di jalan utama menuju PPP Idi, Kec.Idi Rayeuk, Aceh Timur, Senin (30/4).

Ironisnya lagi, sambung Rahman, para orangtuajugaterkesantidakmendukunganaknya mengikuti ujian ulang itu. Padahal, jika tidak memanfaatkan peluang tersebut, siswa yang bersangkutan otomatis gagal total. Rahman juga menyebut, jumlah total siswa yang tidak ikut UN tingkat SMP di Aceh Utara tahun ini, 190 orang. Dua diantaranya meninggal dunia. Sisanya sakit, sudah menikah dan kebanyakan tanpa keterangan.(b19)

8 Pelajar SMP Di Bireuen Ikuti UN Susulan

Waspada/Muhammad H. Ishak

MESKI tak layak huni, satu dari lima kelas ruang belajar tetap dimanfaatkan para siswa MTsN Idi Cut dalam mengikuti belajar mengajar. Foto direkam, Senin (30/4).

Siswa MTsN Idi Cut Belajar Di Ruang Lapuk IDICUT (Waspada) : Sedikitnya lima kelas pelajar Madrasah Tsanawiyah (MTs) Negeri Idi Cut, Kab. Aceh Timur sejak penegerian tahun 1999 belajar di ruang lapuk. Meski sudah ditinjau staf Kementerian Agama RI dari Jakarta, namun hingga kini ratusan pelajar sekolah menengah itu masih menimba ilmu pengetahuan agama dan umum di ruang yang tidak layak huni.

Jumlah Ruang Kelas Belajar (RKB) di MTsN Idi Cut sebanyak

Waspada/Muhammad H Ishak

Selasa 1 Mei 2012

UN SMP Susulan Di Aceh Utara Hanya Diikuti 4 Siswa

Pelayanan Kesehatan Warga Mon Geudong Memprihatinkan PEUREULAK BARAT (Waspada): Warga Mon Geudong, Kecamatan Peureulak Barat, Kabupaten Aceh Timur mengeluhkan pelayanan kesehatan yang dirasakan sangat minim. Kendati di gampong itu telah ada Pos Pelayanan Kesehatan Desa (Polides) namun sampai saat ini belum ada petugas kesehatan yang menempati rumah tersebut, sehingga ketika warga membutuhkan bantuan kesehatan, mereka harus pergi ke ibukota kecamatan. “Akibat minimnya pelayanan kesehatan banyak penyakit yang dialami warga tidak dapat dideteksi dengan cepat oleh petugas kesehatan setempat,” ujar Shaleh, salah seorang mahasiswa Sekolah Tinggi Agama Islam Negeri (STAIN) Cot Kala Langsa yang sedang melaksanakan Kuliah Pengabdian Masyarakat (PKM) di gampong itu, Senin (30/4). Ditambahkan beberapa waktu lalu anak M.Jailani kepala dusun Mon Geudong meninggal dunia akibat terserang malaria pada jumat lalu setelah sempat dibawa berobat ke RSUD Langsa. “Petugas kesehatan baru datang pada hari sabtu untuk melakukan penyemprotan, namun setelah itu tidak ada tindak lanjut, belum ada petugas kesehatan yang datang lagi,” katanya. Dia mengharapkan agar pemerintah setempat lebih memperhatikan kondisi gampong yang berada agak jauh dari pusat ibukota kecamatan dan jumlah penduduk yang hanya 82 kepala keluarga sehingga tingkat kesehatan masyarakat setempat jadi lebih baik. (b22)


18 unit. Namun lima di antaranya para siswa harus belajar di ruang seperti kandang ayam. Tidak hanya kursi dan meja yang tidak mencukupi, para siswa kelas 1 itu juga berdesak-desakan di ruangan itu. Bahkan dalam satu meja yang normal 2 siswa kini ditempati 3-4 siswa. Pihak madrasah terpaksa memanfaatkan gedung yang terbuat dari papan beratap rumbia karena RKB yang ada tidak mencukupi. Kondisi itu terjadi sejak MTsN Idi Cut dinegerikan tahun 1999. Para siswa mengeluhkan kondisi kelas seperti itu, karena saat musim penghujan para siswa terpaksa mengungsi ke kelas lain dan menghentikan proses belajar mengajar. Muhammad Riza, siswa

Kelas I MTsN Idi Cut mengatakan, dia bersama rekan-rekan sekelas kerap mengungsi ke kelas lain ketika hujan tiba, sebab atap yang terbuat dari daun rumbia bocor dan di dalam kelas juga digenangi air hujan. “Jumlah kelas permanen yang tersedia saat ini ada 19 kelas, tapi tidak mampu menampung 600 lebih siswa kelas 1 hingga kelas 3,” kata Kepala MTsN Idi Cut Nawawi, Senin (30/4). Kepala Kemenag Aceh Timur Faisal Hasan melalui Kepala TU Adnan mengatakan, pihaknya akan terus berupaya untuk meningkatkan fasilitas dan ruang belajar sesuai kebutuhan di MTsN Darul Aman secara bertahap. (b24)

Mantan Kadis Kesehatan Tamiang Jadi Penghuni Lapas IIA BANDAACEH (Waspada) : Kejaksaan Tinggi Aceh telah menahan mantan Kepala Dinas Kesehatan Aceh Tamiang Djamaluddin, 51, yang menjadi Daftar Pencarian Orang (DPO) selama empat bulan. Djamaluddin kini mendekam di sel tahanan Lapas IIA Banda Aceh yang terletak di Kecamatan Ingin Jaya, Aceh Besar, setelah ditangkap oleh tim Intelijen Kejagung RI dan Kejati Sumut di Bandara Polonia, Medan, Sumatera Utara, Minggu (29/4). Menurut Kajati Aceh MYusni, Djamaluddin ditetapkan sebagai tersangka karena terlibat dalam dugaan kasus korupsi mark-up (penggelembungan) harga dalam proyek pengadaan alat-alat kesehatan (Alkes) senilai Rp8.842.263.000 untuk RSUD Aceh Tamiang tahun anggaran 2010. Karena tidak pernah memenuhi panggilan Kejati Aceh untuk diperiksa, maka Kejati Aceh menetapkan Djamaluddin sebagai tersangka dan statusnya sebagai DPO. Dari pengembangan kasus tersebut, Kejati Aceh juga telah

Waspada/Gito Rolies

PETUGAS keamanan Bandara SIM memboyong mantan Kadis Kesehatan Aceh Tamiang Djamaluddin. Djamaluddin menjadi DPO selama 4 bulan dan ditangkap di Bandara Polonia Medan, Minggu (29/4). menetapkan lima tersangka yang terlibat dalam proyek pengadaan Alkes AcehTamiang di antaranya berinisial M sebagai PPK, HF dan Z sebagai panitia penerima barang, R dan EP sebagai rekanan. Kelima tersangka lainnya itu, menurut Kajati Aceh, belum ditahan karena dianggap selalu memenuhi pemanggilan yang

dilakukan Kejati Aceh untuk pemeriksaan. Ia menambahkan, Jamaluddin akan diperiksa dalam batas waktu 20 hari sesuai ketentuan. Setelah pemeriksaan nantinya, kemungkinan besar tersangka dalam kasus Alkes Aceh Tamiang akan bertambah. (cb01)

BIREUEN (Waspada) : Kendati 52 peserta UN SMA, MA dan SMK di Kabupaten Bireuen absen tidak mengikuti Ujian Nasioal (UN) 16 April baru lalu, tidak ada seorang pesertapun yang melapor untuk mengikuti UN susulan. Kecuali peserta UN SMP, MTs dari 83 peserta yang absen delapan peserta di antaranya sudah mulai mengikuti UN susulan, sedangkan 75 peserta lainnya tanpa keterangan. Demikian Kadis Dikbudpora Bireuen Drs Asnawi, MPd melalui Kabid Dikmenjur Drs M Nasir, MPd menjelaskan hal itu menjawab pertanyaan Waspada di kantornya, Senin (30/ 4). Dikatakan, kedelapan peserta UN SMP yang

mengikuti UN susulan, SMPN 4 Bireuen satu peserta, SMPN 3 Bireuen satu peserta, SMPN 1 Juli satu peserta dan SMPN 1 Jeumpa satu peserta akan mengikuti UN susulan di Sub Rayon 03 SMPN 2 Bireuen. Satu peserta SMPN 2 Simpang Mamplam mengikuti UN susulan di Sub Rayon 01 SMPN1 Samalanga, SMPN 2 dan SMPN 3 Peudada masing-masing satu peserta mengikuti UN susulan di Sub Rayon 02 SMPN 2 Peudada dan SMPN 3 Jeunieb satu peserta mengikuti UN susulan I Sub Rayon 04 SMPN 3 Jeunieb. Ujian susulan berlangsung 30 April hingga 3 Mei, ujarnya. (b12)

1.110 Siswa MTs Ikut Porseni LHOKSUKON (Waspada): Sebanyak 1.110 siswa dari 40 Madrasah Tsanawiyah (MTs) mengikuti Pekan Olahraga dan Seni (Porseni) ke- XIII, se-Kabupaten Aceh Utara, di Kompleks Dayah Terpadu Al Muslimun, di Desa Meunje, Kec. Lhoksukon, Aceh Utara. “Acara ini kita gelar dua hari, 30 April-1 Mei 2012. Cabang yang kita perlombakan ada 17 kategori, termasuk fashion show busana muslim, kaligrafi, MTQ dan atletik,”kata Ketua Panitia, Hamdani A Jalil didampingi Sekretarisnya, Muhammad Hanafiah, kemarin. Menurut Hamdani, pekan olahraga dan seni ini didanai secara patungan karena tidak ada dana khusus dari pemerintah. “Kedepan, kita berharap Kanwil Kemenag Aceh mengalokasikan dana untuk Porseni, sehingga kegiatannya bisa berlangsung lebih sukses dan meriah lagi,” harap Hamdani.(b19)


DUA siswi peserta lomba Busana Muslim dari MTsN Matangkuli, Khairunnisa dan Safrida, diabadikan di lokasi Porseni XII Aceh Utara, di KompleksDayahTerpaduAlMuslimun,DesaMeunje, Kec. Lhoksukon, Aceh Utara, Senin (30/4).

Si Yatim Jago Matematika Ingin Kuliah Kalau Dapat Beasiswa TIPIKAL malu-malu kucing sudah menjadi bawaanya, saat didekati Waspada langsung memperkenalkan namanya. “Nama saya Erna Mulia,” ucapnya pelan-pelan. Kemudian ia duduk dengan sopan, dan tak banyak berkata sebelum ada yang memancingnya berbicara. Datang bersama pengasuh Baitulmal Muamalat Aceh Utara Syibran Malasi dari desa pedalaman Aceh Utara (Gampong Blang Dalam Tunong, Kecamatan Nisam) ke Krueng Geukueh, dengan menempuh jarak sekitar 10 km. Perjalanan membuatnya lelah, selain jauh, jalan menuju ke sana tak semulus yang kita bayangkan. Dek Nong, begitulah dipanggil ibunya di rumah. Dek Nong kecil, tak berbeda jauh dengan Dek Nong saat ini, kecuali postur tubuh dan wajanya. Mulai duduk di bangku SD, Dek Nong selalu mendapatkan rangking prestisius, rangking satu selalu digenggamnya mulai kelas satu hingga tamat. Begitu juga saat duduk di bangku SMP, walaupun menurun sedikit pada permulaan sekolah. Rangking empat dan tiga saat kelas satu, kemudian pelan-pelan naik menjadi rangking dua pada dua semester sekaligus saat kelas dua. Sedangkan kelas tiga, kedua semester dia raih rangking satu, tak hanya itu juara umum menjadi miliknya. Ketika disinggung nilai rata-rata. “Nilai saya waktu SMA lumayan bagus, tapi waktu kelas satu sempat dapat 70, kemudian kelas naik jadi 80. Terus kelas tiga naik lagi menjadi 90. Nilai tertinggi, pada mata pelajaran Matematika, lebih dari 90,” akui anak yatim korban konflik itu. Meski jago bidang Matematika, siswa SMA 1 Nisam ini sempat meraih juara empat Olimpiade Mata Pelajaran Ekonomi se-Kabupaten Aceh Utara saat duduk di kelas dua SMA. Kesempatan tersebut difasilitasi Baitulmal Muamalat (BMM) Aceh Utara, maka ia wajar mengucap-

kan terima kasih kepada pengasuh, serta pihak sekolah. Saat mengikuti Ujian Nasional (UN) kemarin, 75 persen soal mampu dijawabnya dengan benar. Kemampuan itu juga yang dia membuatnya bertekad melanjutkan kuliah ke Universitas Syiah Kuala (Unsyiah) Banda Aceh di FKIP atau FMIPA Matematika. Catatan penting, anak buruh petani ini mampu kuliah kalau diberi kemudahan biaya kuliah. Sementara kini, melalui kepala sekolah setempat, undangan program Bidikmisi ke Unsyiah telah didapatkan, tapi harapan itu masih membuat dara suka berbusana muslimah itu ragu, dengan kebenaran itu. “Mudahan saya benar-benar mendapatkan beasiswa Bidikmisi ke Unsyiah sampai selesai,” urainya berharap. Muntasir, guru mata pelajaran Matematika sekolah setempat saat dihubungi Waspada mengakui Erna Mulia merupakan salah satu siswa berprestasi di SMAN 1 Nisam, dan berasal dari keluarga miskin. “Saya lihat Erna punya kemauan tinggi melanjutkan kuliah, tapi kemauan itu tentu dibarengi bantuan beasiswa,” ucap Muntasir. Menurut Muntasir, sosok Dek Nong adalah putri yang komplit, mulai rajin menuntut ilmu agama ketika pulang ke rumah dan beprestasi saat di sekolah. Hal itulah yang membuat banyak guru di sekolah itu menggeleng-geleng kepala dan terharu ketika mendengar nama Erna Mulia itu disebutkan orang. Kepala sekolah Drs Ahmad, MPd, menyebutkan, SMAN 1 Nisam mendapat jatah 30 persen jalur undangan Program Bidik Misi, karena sekolah itu terakreditasi B. Untuk Erna Mulia telah terdaftar di situs Bidik Misi dengan nomor identitas 9923170405. Mustafa Kamal

SMP Matahari Itupun Lahir Di Simpang Jernih SULIT untuk mencapai puncak. Namun jika kemauan jika dibaringi dengan kesungguhan yang ikhlas semua pekerjaan sukses sebagaimana diharapkan. Meski empat tahun yang silam wajah pendidikan di wilayah Kabupaten Aceh Timur tergolong ‘gelap’, tapi berkat usaha dan kegigihan serta petuangan hingga malam hari jajaran Dinas Pendidikan Aceh Timur kini jauh lebih ceria dibandingkan sebelumnya. Tidak hanya dari segi kuantitas yang didongkraknya, mutu ataupun kualitas jauh lebih meningkat. Bahkan, demi terwujudnya pendidikan yang handal hingga ke pedalaman, gagasan baru di bawah kepemimpinan Kadisdik Aceh Timur H Agussalim, SH.MH (foto) tergolong berbeda dari sebelumnya. Tidak hanya sebatas itu, kekompakan yang dibangun antar guru dan kepala sekolah juga terlihat jauh lebih harmonis selama kepemimpinan. Simpang Jernih dan Serbajadi (Lokop) dua dari 24 kecamatan di Kab. Aceh Timur. Meski ke Lokop bisa ditempuh lima jam perjalanan darat, namun untuk menembus ke Simpang jernih harus melalui Daerah Aliran Sungai (DAS) Kuala Simpang (Aceh Tamiang). Aneh, tapi nyata bahwa wilayah Aceh

Timur berbatasan dengan Aceh Tamiang, bahkan berbatasan dengan Sumatera Utara. Awal November 2011 yang lalu Kadisdik Aceh Timur bersama jajarannya melakukan kunjungan kerja ke SDN Ranto Panjang, Kecamatan Simpang Jernih. Satelah menembus 7 jam perjalanan perahu mesin melalui DAS Kuala Simpang. Setiba di sana, rombongan disambut para bines dan ditepungtawari (Peusijuek—red) ala Gayo, karena mayoritas masyarakat di Simpang Jernih bersuku Gayo. Awalnya, sambutan tokoh masyarakat dalam meminta agar di Desa Ranto Panjang itu dibangun SMP, meski tidak harus di tahun 2011, tetapi harapannya di tahun 2012/2013 di sana sudah ada SMP, karena lebih dari 10 tahun lulusan SD para siswa tidak melanjutkan lagi ke SMP. Alasannya satusatunya SMP di Simpang jernih adalah SMPN 1 Simpang Jernih yang membutuhkan waktu 2,5 jam perjalanan dengan menggunakan perahu mesin. Dinilai mendesak, spontan H Agussalim dalam sambutan kala itu langsung membuka pendaftaran siswa SMP di Ranto Panjang. “Kala itu saya berhenti sejenak dan berfikir, apa nama SMP itu. Lalu spontan karena Ranto Panjang (Kecamatan

Simpang Jernih sangat jauh dari Idi (Pusat Pemkab Aceh Timur) maka teringat ke matahari yang sangat jauh. Sehingga detik pula namanya SMP Matahari. Saat itulah lahir SMP Swasta Matahari di Ranto Panjang,” kata H Agussalim kepada Waspada Senin (30/4) di Idi. Tak hanya sebatas itu, keesokan harinya SMP Swasta Matahari menerima pendaftaran siswa baru tahun pembelajaran 2011/2012. Sebanyak 32 siswa terdaftar saat itu sebagai siswa angkatan pertama SMP Swasta Ranto Panjang. Lain dari yang lain, SMP Swasta itupun menerima siswa yang lulus 6 tahun yang silam. “Ada juga yang meminta para ibu yang sudah punya anak ingin melanjutkan ke SMP, tapi itu tidak dibolehkan secara aturan,” sebut H Agussalim lagi seraya menambahkan, kini, SMP Swasta Ranto Panjang sedang aktif melaksanakan Proses Balajar Mengajar (PBM) di SDN Ranto Panjang. SMP Wajib Lulus Sekolah Menangah Pertama (SMP) adalah tingkatan yang dikejar untuk pemerataan diseluruh pelosok di Aceh Timur. Selain menyelenggarakan wajib belajar 9 tahun, pihaknya menilai masyarakat harus menikmati minimal hingga ke jenjang

SMP. Namun setelah Mendiknas merintis wajib belajar 12 tahun maka Disdik Aceh Timur lebih fokus SMK. Sebab SDM lulusan SMK lebih terampil dan siap pakai dibandingkan lulusan SMA. Dalam setiap kunjungan kerja, H Agussalim terus menerus berpesan agar guru dan Kepala Sekolah (Kepsek) membangun kerjasama yang baik untuk menciptakan suasana yang lebih baik, sehingga pada akhirnya mampu menjalankan tugas dan fungsinya sebagai abdi negara. “Alhamdulillah, melalui gagasan dan terobosan ini sudah banyak perubahan di dunia pendidikan, khususnya di Aceh Timur,” kata H Agussalim. Untuk menjalankan citacita bangsa sebagaimana yang telah diamanahkan dalam undang-undang, Disdik Aceh Timur selama empat tahun telah mampun membangun gedung sekolah mulai dari Pendidikan Anak Usia Dini (PAUD), Taman Kanak-Kanan (TK), Sekolah Dasar (SD), Sekolah Menengah Pertama (SMP) dan Sekolah Menengah Atas (SMA) ataupun Sekolah Menengah Kejuruan (SMK). Selama H Agussalim menjabat sebagai Kepala Dinas Pendidikan Aceh Timur secara rinci telah mampu mengembang

Waspada/Muhammad Ishak

KEPALA Dinas Pendidikan Aceh Timur H Agussalim, SH. MH pendidikan, seperti PAUD yang sebelumnya 42 unit kini menjadi 121 unit yang tersebar hingga ke pedalaman Aceh Timur seperti Simpang Jernih dan Lokop. Begitu juga dengan Taman Kanak-kanak dan Raudhatul Amal (RA) yang sebelumnya berjumlah 48 titik kini sudah menjadi 64 TK/RA dan TK Pembina sebelumnya hanya 1 titik di Idi Rayeuk kini sudah menjadi 8 TK Pembina yang tersebar di seluruh Aceh Timur. Selain itu juga, jumlah Seko-

lah Menengah Pertama (SMP) yang sebelumnya hanya berjumlah 34 kini sudah menjadi 63 titik. Sekolah Menangah Atas (SMA) yang sebelumnya 16 titik kini menjadi 22 titik. Sedangkan SMK yang sebelumnya hanya 3 titik yakni SMKN 1 Idi Rayeuk, SMKN Peureulak dan SMKN Peureulak Barat kini menjadi 10 SMKN yang tersebar hingga ke Simpang Jernih dan Serbajadi (Lokop). Muhammad H. Ishak

Waspada, Selasa 1 Mei 2012