Page 1

WASPADA Demi Kebenaran Dan Keadilan

Presiden Setujui Menpera Mundur JAKARTA ( Waspada): Menteri Perumahan Rakyat (Menpera) Suharso Monoarfa mengajukan surat pengunduran diri dari jabatannya kepada Presiden Susilo Bambang Yudhoyono. Dalam pernyataan pers di Kantor Kepresidenan, Jakarta, Senin (17/10), PresiAntara den Yudhoyono mengatakan ia sudah menerima surat pengunduran diri tertanggal 12 Oktober 2011 pada Minggu 16 Oktober 2011. “Kemarin saya menerima surat dari saudara Suharso Monoarfa, Menteri Negara Perumahan Rakyat, yang surat tersebut tertanggal 12 Oktober 2011 berarti lima hari yang lalu, yang berisikan permintaan beliau untuk mengundurkan diri dari jabatannya sebagai menteri,” tuturnya.

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

SELASA, Wage, 18 Oktober 2011/20 Zulqaidah 1432 H

No: 23657 Tahun Ke-65

Terbit 24 Halaman


Lanjut ke hal A2 kol. 1

Harga Eceran Rp2.500,-

Raja Arab Saudi Dilarikan Ke RS RIYADH, Arab Saudi (Waspada): Raja Arab Saudi Abdullah (foto) kembali dirawat di rumah sakit di Riyadh, untuk menjalani operasi punggung, melanjuti operasi serupa tahun lalu di Amerika Serikat. Raja berusia 87 tahun tersebut sebelumnya menjalani operasi pada bagian punggung, dimana terjadi gangguan yang menyebabkan tulang belakangnya mengalami tekanan. Operasi di AS pada November lalu itu, dilakukan untuk memperbaiki kerusakan pada tulang punggungnya. Seperti dilansir AFP, Senin (17/10), kini operasi baru yang dia jalani ditujukan untuk mengatasi berkurangnya kerja ligamen pada bagian punggungnya. Kondisi kesehatan yang disertai umur yang terus menua, menimbulkan kekhawatiran dari masa depan Kerajaan Arab Saudi. Memang sejak 1932 lalu, tampuk kepemimpinan Kerajaan Arab Saudi dipegang oleh keluara Al-Saud. Lanjut ke hal A2 kol. 2

Enam Wajah Baru Dalam KIB II

Perampok Bersenpi Jarah Sekolah YP Mayjen Sutoyo

JAKARTA (Antara): Terdapat enam wajah baru yang sudah pasti akan menduduki jabatan menteri dalam Kabinet Indonesia Bersatu (KIB) II hasil perombakan. Usai beraudiensi dengan Presiden Susilo Bambang Yudhoyono di Kantor Kepresidenan, Jakarta, Senin (17/10), enam kandidat menteri itu memberikan keterangan kepada wartawan tentang posisi yang diproyeksikan Presiden kepada mereka. Kepala Badan Koordinasi Penanaman Modal (BKPM) Gita Wirjawan diangkat menjadi Menteri Perdagangan. “Tadi dalam pertemuan saya diminta oleh Presiden dan diberikan tugas dan amanah yang baru sebagai Menteri Perdagangan dan dengan senang hati saya terima tugas, amanah baru tersebut,” tuturnya. Sedangkan Sekretaris Dewan Kehormatan Partai Demokrat Amir Syamsuddin diproyeksikan menjadi Menteri Hukum dan HAM menggantikan Patrialis Akbar. “Saya diproyeksikan akan menjadi Menteri Hukum dan HAM,” ujar praktisi hukum itu. Sedangkan anggota Komisi I Dewan Perwakilan Rakyat (DPR) Azwar Abubakar asal Partai Amanat Nasional (PAN) ditunjuk menjadi Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi menggantikan EE Mangindaan. Anggota Dewan Perwakilan Daerah (DPD) dari DKI Jakarta Djan Farid ditunjuk oleh Presiden Yudhoyono menjadi Menteri Perumahan Rakyat menggantikan Suharso Monoarfa yang mengundurkan diri karena alasan pribadi. Sedangkan Direktur PT PLN Dahlan Iskan dipercaya oleh Presiden Susilo Bambang Yudhoyono untuk menduduki posisi Menteri Badan Usaha Milik Negara (BUMN) menggantikan Mustafa Abubakar.

MEDAN (Waspada): Delapan perampok, satu di antaranya bersenjata api (senpi) beraksi di sekolah Yayasan Perguruan (YP) Mayjen Sutoyo SM Jln. Bangau No. 2, Kel. Sei SikambingB, Kec. Medan Sunggal, Senin (17/10) dinihari. Dalam aksinya, kawanan itu melumpuhkan satpam sekolah dengan mengingkat tangan dan menutup wajahnya dengan lakban, lalu disekap di kamar mandi Pos Satpam sekolah tersebut. Setelah aman, kawanan tersebut menjarah tiga komputer, tiga laptop, satu printer, satu infokus, sepedamotor, hanpdhone, dan lainnya. Informasi Waspada peroleh di lapangan, peristiwa itu terjadi sekitar pukul 04:00, ketika Satpam bernama Dedy Bangun, yang baru selesai ronda kembali ke posnya di sudut depan sebelah kanan sekolah tersebut. Sekitar tiga menit istirahat, tiba-tiba mobil Kijang Kapsul yang tidak kelihatan nomor polisinya berhenti di pinggir jalan depan sekolah tersebut. Tiga pria turun dari mobil , dan meminta Satpam membuka pintu pagar sekolah. Karena tidak dikenal, korban tidak mau membukanya. Tapi, ketiga pelaku memanjat pintu pagar besi dan masuk ke pekarangan sekolah. Salah seorang pelaku menodongkan senjata api kepada Satpam tersebut sambil Antara mengambil kunci gembok pintu pagar. Setelah pintu pagar dibuka, mobil penjahat itu masuk ke pekarangan sekolah. Lima orang lainnya turun dari mobil dan menyekap Satpam di kamar mandi. Para pelaku masuk ke ruangan sekolah setelah merusak pintu local. Mereka mengambil satu laptop dan satu infokus dari kantor Ketua Yayasan maupun kepala sekolah, dua komputer dan tiga laptop dari ruangan SMK II Medan Area, satu infokus

Lanjut ke hal A2 kol. 6


SRI SULTAN Hamengku Buwono X menerima sungkem dari putri bungsunya GKR Bendara saat prosesi tantingan di Tratag Proboyekso, Kompleks Kraton Yogyakarta, Yogyakarta, Senin (17/10) malam. Tantingan merupakan prosesi mempertanyakan kemantaban hati calon pengantin putri.

Dahlan Iskan

Gita Wirjawan

Azwar Abubakar

Amir Syamsuddin

Djan Farid

Marciano Norman

Lanjut ke hal A2 kol. 7

Pusat Masih Percaya Putra Aceh BANDA ACEH (Waspada): Penunjukan Azwar Abubakar sebagai Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Kabinet Indonesia Bersatu (KIB-II),berarti Pemerintah Pusat masih mempercayai putra provinsi itu.

Megawati: Wakil Menteri Bebani Keuangan Negara

“Saya melihat, ini sebuah kepercayaan Jakarta dan juga menunjukkan orang Aceh memiliki kemampuan memimpin sebuah kementerian,” kata ulama Aceh Tgk Imam Suja’ di Banda Aceh, Senin (17/10). Hal itu disampaikan Imam menanggapi penunjukan mantan Plt Gubernur Aceh Azwar Abubakar sebagai Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi menggantikan EE Mangindaan.

SOLO (Antara): Ketua Umum PDI Perjuangan Megawati Soekarnoputri menilai banyaknya wakil menteri yang diangkat untuk membantu para menteri Kabinet Indonesia Bersatu II bakal menambah beban keuangan negara. “Sementara ini, kalau tidak salah, ada penambahan 13 wakil menteri. Ini berarti negara juga harus menyediakan fasilitas tambahan bagi pejabat baru tersebut yang jumlahnya tidak sedikit,” kata Mega-

Dalam kaitan ini, Imam Suja’ meminta putra Aceh yang telah dipercayai memimpin kementerian itu harus serius melakukan berbagai pembenahan yang mungkin selama ini belum optimal. “Jabatan adalah sebuah amanah, dan saya meyakini Azwar Abubakar mampu memimpin kementerian itu dengan baik dan amanah. Yang tidak kalah pentingnya adalah

Lanjut ke hal A2 kol. 3

Kebakaran 8 Rumah Di Labuhan

dap keluarga korban didampingi Pengurus Cabang PKS Medan Labuhan, Senin (17/10). Politikus dari PKS itu mengatakan, pihaknya telah menghubungi Pertamina terkait masalah kebakaran tersebut. Pertamina melalui humasnya setuju membantu keluarga korban selama kebakaran itu akibat ledakan tabung gas. “Kita berjanji mengawal komitmen Pertamina itu agar benar- benar dilaksanakan,” tuturnya.

Lanjut ke hal A2 kol. 3

Waspada/ Ist

JABAL RAHMAH : Jamaah calon haji (Calhaj) kloter 3 yang sudah berada di Makkah sudah menyempatkan diri berkunjung ke Jabal Rahmah, tempat yang mempertemukan Adam dan Hawa dan dipercaya sebagai tempat makbulnya doa. Demikian disampaikan Calhaj kloter 3 bernama Sari kemarin.

Satu Calhaj P. Sidimpuan Wafat Di Makkah Sudah 82.064 Jamaah Indonesia Tiba Di Makkah JAKARTA ( Waspada ): Seorang jamaah Indonesia asal Padangsidimpuan, Sumatera Utara, Parluhutan Siagian bin Janagari, 67, wafat di rumah sakit Arab Saudi, Makkah. Parluhutan sudah dimakamkan

di Pemakaman Syaraya. Parluhutan tergabung dalam kelompok terbang (Kloter) dua Medan meninggal dunia karena menderita sakit myocard infark. Dari Siskohat (sistem ko-

Qurban Oleh Tgk H. Ameer Hamzah

Lanjut ke hal A2 kol. 6

munikasi dan informasi haji) Kementrian Agama (Kemenag) di Jakarta, diperoleh keterangan sampai Senin (17/10), tercatat calon jamaah haji Indonesia yang wafat sebanyak 16 orang.

Abdul Karim selaku penghubung PPIH ( Panitia Penyelenggara Ibadah Haji ) Indones i a d a e ra h k e r j a Je d d a h mengatakan, meninggal dunia

Lanjut ke hal A2 kol. 6

BANDA ACEH (Antara): Kota Banda Aceh dan sekitarnya kembali diguncang gempa bumi Senin (17/10) sekitar pukul 17.45. hal ini mengakibatkan sebagian warga berhamburan keluar rumah terutama mereka yang berada di gedung bertingkat. Beberapa jam sebelumnya, gempa berkekuatan 4,3 pada skala richter juga mengguncang Banda Aceh dan hanya dirasakan sebagian warga di kota itu. Menurut Badan Meteorologi, Klimatologi, dan Geofisika, kekuatan gempa kedua 5,8 pada Skala Richter, berpu-


NORMA menangis saat ditemui wartawan sehari pasca penangkapan puteranya, Iqbal Rinda oleh Maritim Malaysia. Gambar direkam, Senin (17/10).

HIDUP adalah perjuangan, sebab itu tidak boleh menyerah walau rintangan menghadang. Menjadi juru warta di Pelembang pada tahun 80-an selama 20 tahun, kemudian banting stir menjadi petani di Tapanuli Selatan, tidak membuat Burhanudin Harahap (foto), 70, Lanjut ke hal A2 kol. 6

Tiga Hari Terakhir, 23 Nelayan Ditangkap Maritim Malaysia

Lanjut ke hal A2 kol. 3

Rumah Bandar Narkoba Dijaga Buaya Mungkin bosan dengan peliharaan anjing, bandar narkoba asal Chicago, AS, memelihara buaya sebagai hewan penjaga rumah. Seperti dilansir stltoday. com pada Senin (17/10), pihak Waspada/ Rustam Effendi

NAHKODA Effendi didampingi temannya memberikan keterangan setelah tiba di Belawan, Senin (17/10).

Empat Nelayan Ditahan Malaysia Tiba Di Belawan BELAWAN (Waspada): Empat nelayan Belawan yang ditahan Malaysia selama 13 hari tiba di dermaga Lor Bahagia Lingk 26, Kel. Belawan Satu, Kec. Medan Belawan, Senin(17/10). Kepulangan mereka disambut warga dan pengurus HNSI Kota Medan dengan tepung tawar.

P. BRANDAN ( Waspada): Setelah menangkap 12 nelayan asal Sei Bilah, Kec. Sei Lepan, Langkat, Minggu (16/10), Patroli Maritim Malaysia kembali menangkap 11 nelayan tradisional. Waspada/Silfa

sat di 27 km baratdaya Sinabang, 149 km baratdaya Tapaktuan, atau 159 km baratdaya Labuhanhaji, atau 1.523 km baratlaut Jakarta. BMKG memastikan gempa tersebut tidak berpotensi menimbulkan tsunami. “Kami juga menerima laporan dari para pegawai yang berada di kantor-kantor pemerintah terkait adanya gempa pada petang hari ini,” kata Satriyo. Sementara itu, seorang karyawan swasta Nirwana berupaya turun dari lantai dua ke lantai dasar saat merasakan goyangan gempa.

Ada-ada Saja

Niat Haji Muncul Sejak Masih Muda


DHAHIYYAH atau berqurban adalah ibadah untuk mendekatkan diri (taqarrub) kepada Allah SWT. Syariat tersebut disyariatkan kepada Nabi Muhammad SAW dan ummatnya yang mampu melaksanakan. Sejarah qurban sendiri sudah ada sejak putra Adam, Habil dan Qabil, juga Nabi Ibrahim dan Ismail. Namun caranya berbedabeda. Qurban dalam Islam lebih dekat dengan bentuk yang dikerjakan Nabi Ibrahim, yakni menyembelih hewan. Berbeda dengan agama lain yang berqurban untuk dewa-dewa mereka. Qurban dalam agama Islam tidak

Lanjut ke hal A2 kol. 1

Aceh Diguncang Gempa Dua Kali

Pertamina Diminta Bertanggungjawab BELAWAN (Waspada): PT Pertamina diminta bertanggungjawab atas terjadinya kebakaran yang menghanguskan delapan rumah warga di Jalan Pancing 3, Gang Mesjid, Lingk 5, Kel. Besar, Kec. Medan Labuhan, serta menewaskan tiga penghuninya, Minggu (16/10). “Jika hasil dari lab polisi mengatakan kebakaran ini akibat ledakan tabung gas, Pertamina harus bertanggungjawab,” kata anggota Komisi D DPRD Sumut M Nasir, saat memberikan bantuan terha-

wati didampingi Sekjen PDIP Tjahjo Kumolo di Loji Gandrung Rumah Dinas Wali Kota Surakarta, Senin (17/10). Pemerintahan Susilo Bambang Yudhoyono dalam merencanakan reshuffle kabinet, katanya, semestinya melihat kebutuhan dan dilakukan selektif dengan melihat orangorang yang akan ditempatkan untuk menduduki jabatan tersebut.

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 2

Serampang - Belum ada nama dari Sumut - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)


SELASA, Wage, 18 Oktober 2011/20 Zulqaidah 1432 H z zNo: 23657 Tahun Ke-65

Terbit 24 Halaman Amir Syamsuddin

MENTERI Negara Perumahan Rakyat (Menpera) Suharso Monoarfa melambaikan tangannya usai memberi pidato dalam acara kerjasama dengan perbankan sekaligus menjadi pidato perpisahannya sebagai menteri di kantor Kementrian Perumahan Rakyat, Jakarta, Senin (17/10).

Azwar Abubakar Jadi Menpan

PPP Ajukan Sejumlah Nama Pengganti Suharso

Amir Syamsuddin Jadi Menkumham BANDAACEH (Waspada): Mantan Pj Gubernur Aceh, Ir Azwar Abubakar, MM masuk dalam Kabinet Indonesia Bersatu II, yang rencananya diumumkan Rabu, 19 Oktober, besok. Disebut-sebut,pria kelahiran Aceh Besar itu menduduki jabatan sebagai Menpan. Kepastian Azwar Abubakar menjadi menteri baru hasil reshuffle, setelah Senin (17/10) sekira pukul 11:00 – 12:00 , diterima Presiden Susilo Bambang Yudhoyono (SBY) di Istana Negara, Jakarta.

JAKARTA (Antara): Sekjen DPP PPP Romahurmuziy mengakui, PPP sudah mengajukan sejumlah nama calon pengganti Suharso Monoarfa kepada Presiden setelah pekan lalu penjabat menteri perumahan rakyat itu mengundurkan diri. Kepada pers di ruang wartawan DPR di Jakarta, Senin (17/10), Romy (panggilan akrab Romahurmuziy)

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 5

Raja Arab Saudi Dilarikan Ke RS RIYADH, Arab Saudi (Waspada): Raja Arab Saudi Abdullah kembali dirawat di rumah sakit di Riyadh, untuk menjalani operasi punggung, melanjuti operasi serupa tahun lalu di Amerika Serikat. Raja berusia 87 tahun tersebut sebelumnya menjalani operasi pada bagian punggung, dimana terjadi gangguan yang menyebabkan tulang belakangnya mengalami tekanan. Operasi di AS pada November lalu itu, dilakukan untuk memperbaiki kerusakan pada tulang punggungnya. Seperti dilansir AFP, Senin (17/10), kini operasi baru yang dia jalani ditujukan untuk mengatasi berkurangnya kerja ligamen pada bagian punggungnya. Kondisi kesehatan yang disertai umur yang terus menua, menimbulkan kekhawatiran dari masa depan Kerajaan Arab Saudi. Lanjut ke hal A2 kol 7

Azwar Abubakar

Aceh Diguncang Gempa Dua Kali

Waspada/ Ist

JABAL RAHMAH: Jamaah Calon Haji (Calhaj) Indonesia yang berada di Makkah sudah menyempatkan diri berkunjung ke Jabal Rahmah, tempat yang mempertemukan Adam dan Hawa dan dipercaya sebagai tempat makbulnya doa. Demikian disampaikan Calhaj kloter 3 asal Medan bernama Sari kemarin.

BANDA ACEH (Antara): Kota Banda Aceh dan sekitarnya kembali diguncang gempa bumi Senin (17/10) sekitar pukul 17.45. hal ini mengakibatkan sebagian warga berhamburan keluar rumah terutama mereka yang berada di gedung bertingkat. Beberapa jam sebelumnya, gempa berkekuatan 4,3 pada skala richter juga mengguncang Banda Aceh dan hanya dirasakan sebagian warga di kota itu. Menurut Badan Meteorologi, Klimatologi, dan Geofisika, kekuatan gempa kedua 5,8 pada Skala Richter, berpusat di 27 km baratdaya Sinabang, 149 km baratdaya Tapaktuan, atau 159 km baratdaya Labuhanhaji, atau 1.523 km baratlaut Jakarta. BMKG memastikan gempa tersebut tidak berpotensi menimbulkan tsunami.

16 Calhaj Indonesia Wafat Di Makkah Aksi Sabotase Meningkat, Freeport Lumpuh TIMIKA (Antara): Aksi sabotase meningkat di areal kerja PT Freeport Indonesia dalam beberapa hari terakhir, mengakibatkan produksi tambang terbuka Grasberg, tambang bawah tanah, pabrik pengolahan hingga pengiriman konsentrat ke Pelabuhan Portsite Amamapare lumpuh. Salah seorang karyawan PT Freeport, Nurhadi, melalui video conference dari Tembagapura Senin (17/10) menuturkan bahwa mulai pagi seluruh aktivitas produksi PT Freeport terpaksa dihentikan karena terjadi sabotase berupa pemblokiran jalan dan pemotongan pipa konsentrat di beberapa tempat.

“Semua produksi mulai hari ini dihentikan karena sudah tidak aman lagi. Tidak mungkin lagi kita mengirim konsentrat ke Porsite,” tutur Nurhadi. Direktur Eksekutif Vice President & CAO PT Freeport Sinta Sirait mengakui hingga sekarang situasi di sekitar check point 1 dekat Bandara Mozes Kilangin Timika belum terkendali bahkan semakin meningkat eskalasinya. Jalan menuju areal PT Freeport di beberapa lokasi diblokir karyawan dan massa yang sudah bergabung sejak Senin (10/10) lalu.

Satu Dari P. Sidimpuan

JAKARTA (Waspada): Seorang jamaah Indonesia asal Padangsidimpuan, Sumatera Utara, Parluhutan Siagian bin Janagari, 67, meninggal dunia di rumah sakit Arab Saudi, Makkah. Parluhutan sudah dimakamkan di Pemakaman Syaraya.

Parluhutan tergabung dalam kelompok terbang (Kloter) dua Medan meninggal dunia karena menderita sakit myocard infark. Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 6

ga akhirnya mundur, kemudian polisi mencurigai salah seorang warga setempat berinisial SP berada di belakang. Polisi melihat SP pada saat itu mempunyai senjata api jenis Short Gun yang diletakkan dipinggang belakang. Kemudian polisi berpakaian preman yang berada di lokasi langsung meringkus SP dan mengamankan senjata api yang berada di pinggangnya. Kapolsek Baitussalam AKP Ibrahim Paradis, menyebutkan ada yang memprovokasi warga hingga warga berani menghadang polisi dan Lanjut ke hal A2 kol 1

Kegagalan Aceh Terbayang Di Depan Mata BANDA ACEH (Waspada): Penolakan PA dalam Pilkada, diprediksi kondisi politik Aceh tidak konstruktif, bahkan bayang bayang kegagalan sudah di depan mata. Sebab PA merupakan kekuatan politik dominan saat ini dan menguasai DPRA. Pernyataan itu dikemukakan Sekretaris Jenderal Acehnese civil society task force (ACSTF), Juanda Djamal yang di-mintai pendapatnya oleh Waspada, Senin (17/10) terkait calon dari Partai Aceh (PA) tidak mendaftar di 17 Kab/

Penertiban Pemilik Rumah Bantuan Di Aceh Besar Diwarnai Tembakan BAITUSSAL AM, Aceh Besar (Waspada): Aparat kepolisian dan Satpol-PP menertibkan pemilik rumah bantuan di Desa Mireuk Lam Reudeup, Kecamatan Baitussalam Aceh Besar, Senin (17/10) kembali ricuh. Suasana penertiban di Desa Mireuk Lam Reudeup berubah menjadi panas. Ketika warga setempat menghadang kedatangan polisi dan Satpol PP karena warga enggan dipindahkan dari rumah bantuan Arab Saudi itu, akibatnya polisi terpaksa melepaskan tembakan peringatan ke udara. Setelah bunyi senjata war-

Prediksi ACSTF:

Kota dan calon Gubernur karena mereka nilai kegiatan Pilkada di Aceh melanggar aturan dan tidak sesuai dengan UUPA. Implikasi tidak mendaftarnya calon PA, menurut Juanda, siapapun yang terpilih menjadi gubernur maka legitimasinya menjadi sangat rendah. Bahkan komunikasi politik legislatif dan eksekutif semakin jauh daripada politik kesejahteraan. “Kita sebagai rakyat tidak lagi dapat berharap banyak untuk masa lima tahun ke

depan, karena politik kekuasaan akan mendominasi perjalanan pembangunan Aceh,” kata Sekjen Aceh Baru ini serius. Semestinya, sebut dia, pemerintahan Aceh memiliki tanggung jawab besar dalam memperkuat pembangunan demokrasi Aceh. Penguatan demokrasi tersebut, lanjut Juanda Djamal, tidak hanya dalam melaksanakan pilkada atau pemilu semata. Tetapi dalam Lanjut ke hal A2 kol 6

Niat Haji Muncul Sejak Masih Muda

Waspada/Sukri FalahHarahap

KAPOLRES Padangsidimpuan, AKBP Andi S. Taufik, Kasi Pidum Kejaksaan Negeri, Sabiin dan Kadis Kesehatan, Doria Hafni Lubis menyulut api pertama atas barang bukti perkara narkotika di lapangan voli Mapolres, Senin (17/10).

199,07 Gram Sabu Dan 365,69 Kg Ganja Dimusnahkan P. SIDIMPUAN (Waspada): Kepolisian Resort (Polres) dan Kejaksaan Negeri (Kejari) Padangsidimpuan memusnahkan barang bukti perkara tin-

dak pidana narkotika berupa sabu-sabu 199,07 gram, dan ganja 365,69 kg, di lapangan bola voli Mapolres, Senin (17/10). Pemusnahan ditandai

dengan penyulutan api pertama oleh Kapolres Padangsidimpuan, AKBP Andi Syahriful Lanjut ke hal A2 kol 3

H I D U P a d a l a h p e rjuangan, sebab itu tidak boleh menyerah walau rintangan menghadang. Menjadi juru warta di Palembang pada tahun 80-an selama 20 tahun, kemudian banting stir menjadi petani di Tapanuli Selatan, tidak membuat Burhanudin Harahap, 70, menyerah merealisasikan mimpinya menunaikan ibadah haji. Angannya menunaikan haji sudah ada ketika melakoni profesi juru warta saat masih muda, karena baginya, menunaikan haji memantapkan diri berserah kepada Allah SWT, menstabilkan hati untuk menyampaikan keluh kesah dan doa kepada Allah. Maka segala kesulitan dapat dilalui-

nya karena tekadnya yang begitu kuat. “Masa saya menjadi juru warta sangat sulit, dan tidak punya penghasilan yang bisa ditabung, Tapi karena kenyakinan, saya terus berusaha mengumpulkan uang. Meski sisa serupiah pun pasti saya tabung jika ada,” sebutnya mengenang. Dia sangat bangga dengan profesinya walau orang menganggap juru warta pekerjaan yang kecil dan tidak punya penghasilan tetap, bahkan tulisan peristiwa besar hanya dihargai dengan honor yang minim. Tapi Burhanuddin tidak putus asa dan Lanjut ke hal A2 kol 1

Ada-ada Saja

Al Bayan

Rumah Bandar Narkoba Dijaga Buaya

Qurban Oleh: Tgk. H. Ameer Hamzah

MUNGKIN bosan dengan peliharaan anjing, bandar narkoba asal Chicago, AS, memelihara buaya sebagai hewan penjaga rumah. Seperti dilansir stltoday. com pada Senin (17/10), pihak kepolisian setempat

DHAHIYYAH atau berqurban adalah ibadah untuk mendekatkan diri (taqarrub) kepada Allah SWT. Syariat tersebut disyariatkan kepada Nabi Muhammad SAW dan ummatnya yang mampu melaksanakan. Sejarah qurban sendiri sudah ada sejak putra Adam, Habil dan Qabil, juga Nabi Ibrahim dan Ismail. Namun caranya berbedabeda. Qurban dalam Islam lebih dekat dengan bentuk yang dikerjakan Nabi Ibrahim, yakni menyembelih hewan. Berbeda dengan agama lain yang berqurban untuk dewa-dewa mereka. Qurban dalam agama Islam tidak seluruhnya dipersembahkan kepada Allah. Allah hanya menerima niat ikhlas hambanya yang berqurban, sedangkan dagingnya bukan untuk Allah. Tuhan umat Islam tidak makan daging. “Tidak sampai kepada Allah

Lanjut ke hal A2 kol 5 Waspada/Asrirrais

NORMA, warga Sei Bilah, Kec. Sei Lepan, Kab. Langkat, menangis histeris saat ditemui wartawan sehari pasca penangkapan puteranya, Iqbal Rinda oleh Maritim Malaysia. Gambar direkam, Senin (17/10).

Tiga Hari Terakhir, 23 Nelayan Ditangkap Maritim Malaysia

Lanjut ke hal A2 kol 2

Ular 80 Kg Nyasar

Waspada/Muhammad Riza

Seekor ular sawah berukuran delapan meter dengan berat sekira 80 kilogram ditemukan warga Kota Sigli di kawasan Blang Peutek, Kec. Padang Tijie, Senin (17/10) sekira pukul 15.00. Kini ular raksasa ini terlihat dalam kondisi lemas terkulai dan menjadi tontonan warga di Kel. Blok Bengkel, Kota Sigli, Pidie.

P. BRANDAN (Waspada): Setelah menangkap 12 nelayan asal Sei Bilah, Kec. Sei Lepan, Langkat, Minggu (16/10), Patroli Maritim Malaysia kembali menangkap 11 nelayan tradisional. Ke sebelas nelayan yang menumpang dua perahu motor dengan nomor lambung PB 641 dan PB 016 Lanjut ke hal A2 kol 7

Serampang - Yang tak diganti mantri sunat - He.... he....he....

Berita Utama


Polres Tapteng Gagalkan Transaksi 6 Kg Ganja

MK Proses Gugatan SK KIP Aceh IDI (Waspada) : Mahkamah Konstitusi (MK) di Jakarta, Senin (17/10) menerima pendaftaran gugatan SK KIP No.1 Tahun 2011 tentang Tahapan, Program KIP dalam penyelenggaraan Pemilukada 2011 di Aceh. Pasalnya, SK itu dinilai bertentangan dengan hukum dan jika dipaksakan, hasil Pilkada cacat hukum. Demikian dikatakan kuasa hukum HTA Khaled, Safaruddin, Senin (17/10). Menurutnya, pendaftaran dilakukan secara online dengan Nomor Permohonan 2011.10.17.013/PB dengan jenis perkara Perselisihan Hasil Pemilihan Umum (PHPU). “Pemohon memberikan kuasa kepada kami (Mukhlis Mukhtar dan Safaruddin) dalam pokok perkara permohonan pembatalan SK KIP Nomor 1 Tahun 2011 jo SK No.11 Tahun 2011 jo SK No.17 Tahun 2011 tentang Tahapan, Program, dan Jadwal Penyelengaraan Pilkada Gubernur/Wakil Gubernur, Bupati/Wakil Bupati dan Walikota/Wakil Walikota di Provinsi Aceh. “Kita sudah terima tanda bukti pendaftaran online ke MK terkait gugatan SK KIP Aceh, di mana dalam pelaksanaannya kita anggap cacat hukum,” ujar Safaruddin seraya meminta KIP sudah berulangkali diingatkan baik secara lisan atau tulisan agar tidak memaksakan tahapan Pilkada tanpa dasar hukum yang jelas, namun hal tersebut tidak digubris KIP. (b24)

Niat Haji Muncul ....

terus menulis sebanyak-banyaknya untuk mendapatkan honor agar bisa menabung haji dan sangat mencintai profesinya. Masih lekat dalam ingatannya, menulis tidak sebebas dan semudah sekarang ini. Pada masa dia, menulis masih di dikte dan sangat beresiko jika menyudutkan pihak lain. “Tapi begitu pun, pengalaman dan rintangan menjadi juru warta membawa saya pada pribadi yang sabar dan pantang menyerah hingga terus menabung dan melakukan apa saja yang halal, hingga kemudian menjadi petani di usia tua sekarang pun saya jalani,” tuturnya. Dia mengungkapkan, 20 tahun bekerja di lapangan, siang malam mencari berita, tubuhnya tidak kuat lagi di makan usianya yang semakin tua. Dia pun pulang ke kampung halaman dan melakoni profesi yang sama sekali tidak pernah dilakukannya selama di Palembang. Tapi demi melanjutkan impiannya

Penertiban ....

petugas penertiban rumah. “Kami akan menertibkan siapapun warga yang tidak berhak menduduki rumah disini,”katanya. Sebelumnya, Polisi bersama satpol PP provinsi, Senin (3/10) lalu, telah menertibkan penyerobot rumah bantuan di kemukiman Mireuk lam Reudeup kec Baitussalam Aceh Besar, suasana sempat memanas saat masyarakat menutup jalan dengan tumpukan tanah dan batang kayu. Pada penertiban itu, Polsek Baitussalam Aceh Besar dibantu personil dari Polresta bersenjata lengkap juga dibantu dua truk personil satpol-PP mendatangi lokasi rumah b a n t u a n d i Mi re u k L a m Reudeup, sebelum bergerak k e l o k a s i , p a ra Mu s p i k a setempat sempat melakukan

menunaikan haji, dia pun menjamah tanah siang dan malam bersama istrinya Baiyani Pane, 68, menjadi petani. “Alhamdulillah sekarang tabungan kami telah terkumpul dan bisa berangkat haji pada kloter 15 Selasa (18/10). Rasa haru dan bahagia yang tidak terkira dari juru warta dan petani, menggeluti apa saja agar bisa menabung untuk dapat berangkat ke tanah suci,” sebutnya. Dia berkeinginan sesampainya di tanah suci bersujud ke makam Nabi, tokoh panutan yang membuatnya sangat bertekad pergi ke tempat itu, dan mendekatkan diri kepada Allah agar dijauhkan dari perbuatan maksiat dan pekerjaan yang haram. Juga agar diselamatkan dunia akhirat dan dijauhkan dari hal-hal buruk. “Dan yang utama agar Allah membersihkan hati saya dari hal-hal dan niat-niat yang buruk. Ibadah saya di usia tua tidak lain hanya untuk membersihkan diri dari kejahatan dan memantapkan diri untuk kebaikan,” tuturnya. (csf) rapat di kantor Polsek Baitussalam untuk mencari solusi terbaik. Pada saat penertiban pertama itu, masyarakat setempat dapat dikendalikan oleh kepolisian dan penertiban sebagian warga yang telah mendiami rumah bantuan di Mireuk Lam Reudeup berlangsung lancar. (cb01)

Azwar Abubakar ....

Anggota DPRRI dari Partai Amanat Nasional yang Waspada hubungi via handphone usai diterima SBY, ini menyatakan, Presiden memberikan gambaran secara umum tentang tugas masing masing calon menteri. “Selain saya, ada lima calon menteri yang dipanggil tadi oleh SBY,” kata Azwar Abubakar. Mereka masing-masing Dahlan Iskan, Amir Syamsuddin, Djan Faridz dan Letnan Jenderal TNI Marciano Norman Jawaban Problem Catur, Alumni ITB ini akan menTTS Dan Sudoku duduki posisi Menteri Pemberdayaan Aparatur Negara, Dari Halaman Sport. Reformasi Birokrasi di Kabinet Indonesia Bersatu jilid-II. Masuknya Azwar AbuJawaban Problem Catur: bakar di kabinet SBY, dibenarkan Ketua DPW PAN Aceh, 1. Me6, Ma3. Anwar Ahmad. “Saya sudah 2. GxKg6+, Rg8. dapat informasi sejak dua hari lalu dari DPP PAN di Jakarta,” 3. Me8+, Mf8. sebut Anwar yang juga Wakil Bupati Aceh Besar ini kepada 4. MxM+mat. (Jika Waspada kemarin. 1. ......., h5. Artinya, diakui Anwar, peran DPP PAN yang diga2. MxK+, Rg8. wangi Hatta Rajasa, yang tidak lain adalah besan SBY, sangat 3. Me8+mat). besar meloloskan putra terbaik Aceh ini masuk dalam Jawaban TTS: jajaran kabinet SBY. Se b e l u m n y a b e re d a r TTS Topik Politik & Hukum nama Nasir Djamil, anggota K O N S O L I D A S I P P P DPRRI asal Aceh disebut-sebut bakal masuk kabinet SBY. K E S R A Nasir masuk bursa dan menS R E K O N S T R U K S I dapat dukungan DPP PKS. A I U A O T Namun, kandas dan Azwar S P P P A T K B E R K A S Abubakar yang masuk sebagai I R O B L E T U A R I P A T






B E P A T E N Qurban .... T A N A daging dan darahnya, tetapi R T yang sampai kepada-Nya N S I F O hanya ketaqwaan-mu E R R (QS.22:37). Qurban hukumnya sunat I L I A S I muakkad (sunat yang diberatK A kan), bahkan menurut MaS L zhab Hanafi, hukumnya wajib. Mereka berdalil kepada ayat I A T I F

Jawaban Sudoku:

8 1 3 2 4 7 9 5 6

6 4 9 1 5 3 2 8 7

7 2 5 8 6 9 4 1 3

2 7 8 9 1 6 5 3 4

9 6 1 5 3 4 7 2 8

5 3 4 7 8 2 6 9 1

4 5 7 3 2 1 8 6 9

1 9 2 6 7 8 3 4 5

3 8 6 4 9 5 1 7 2

dua Surat al-Kautsar, “Maka sembahyang lah kepada Tuhanmu dan berqurbanlah”. Dalam Hadist juga disebutkan: “Barang siapa yang memiliki kelapangan (kemampuan) tetapi ia tidak berqurban, maka jangan sekali-kali ia mendekati tempat shalat kami-mushallana. (HR. Hakim dari Abu Hurairah). Menurut ahli hadist, yang idmaksud tempat sembahyang kami (mushallana) di

WASPADA Selasa 18 Oktober 2011

Waspada/Zulfan Nasution

TERSANGKA pengedar bersama barang bukti 6 kg ganja kering di ruang Sat Narkoba PolresTapteng. Foto diambil Senin (17/10).

Perampok Bersenpi Jarah Sekolah YP Mayjen Sutoyo

MEDAN (Waspada): Diperkirakan delapan perampok dan satu di antaranya memakai senjata api (senpi) beraksi di sekolah Yayasan Perguruan (YP) Mayjen Sutoyo SM Jln. Bangau No.2, Kelurahan Sei Sikambing-B, Kecamatan Medan Sunggal, Senin (17/10) dinihari. Para perampok itu melumpuhkan petugas satpam sekolah dengan mengingkat tangan dan menutup wajahnya dengan lakban, lalu disekap di kamar mandi pos satpam sekolah tersebut. Akibat peris-

tiwa itu, tiga komputer, tiga laptop, satu printer, satu infokus, sepedamotor, handphone, dan lainnya raib dilarikan kawanan perampok. Informasi Waspada peroleh di lapangan, peristiwa itu terjadi sekitar pukul 04:00, petugas satpam bernama Dedy Bangun yang baru selesai tugas ronda kembali ke pos satpam yang berada di sudut depan sebelah kanan sekolah tersebut. Namun, baru sekitar tiga menit istirahat di pos satpam, tiba-tiba mobil Kijang Kapsul

nomor polisi (BK) tidak kelihatan berhenti di pinggir jalan depan sekolah tersebut. Tiga pria turun dari mobil itu meminta satpam tersebut agar membuka pintu pagar besi sekolah. Karena tidak dikenal, korban tidak mau membuka pintu pagar. Kemudian ketiga pelaku itu memanjat pintu pagar besi dan masuk ke pekarangan sekolah. Salah seorang pelaku menodongkan senjata api kepada satpam tersebut sambil mengambil kunci gembok pintu pagar sekolah. (m36)

199,07 Gram Sabu ....

Taufik bersama Kasi Pidum Kejari Sabiin dan Kadis Kesehatan Pemko Padangsidimpuan, Hj. Doria Hafni Lubis. Kasat Narkoba Polres Padangsidimpuan, AKP Timbul Sihombing mengatakan, pemusnahan narkotika golongan I didasarkan pada Pasal 7 ayat (1) huruf j, Pasal 11, Pasal 38, Pasal 39, dan Pasal 45 ayat (4) KUH Pidana. Undang-undang No. 2 tahun 2002 tentang Kepolisian RI, Pasal 75 huruf k, Pasal 91 ayat 1 sampai 5 UU No. 35 tahun 2009 tentang Narkotika dan surat izin pemusnahan dari Ketua Pengadilan Negeri Padangsidimpuan No. 06, 05, dan 07/2011. Dirincikan, sabu-sabu 70,32 gram disita dari tersangka MDS, 25 Juni 2011. Sabusabu 128 ,75 gram dari tersangka MML, 28 September

2011 dan 13.881,68 gram ganja dari tersangka LB bersama SBL, 22 Agustus 2011. Sementara Kasipidum Kejari Padangsidimpuan Sabiin mengungkapkan, telah menyerahkan barang bukti narkotika ganja yang telah berk e k u a t a n h u k u m t e t a p, 351818,27 gram atau 351,81 kg. Sedangkan Kapolres Padangsidimpuan, AKBP Andi S Taufik, mengharapkan seluruh elemen masyarakat bergabung dengan kepolisian memerangi peredaran narkoba yang makin meningkat di Kota Padangsidimpuan. Bekuk Siswa SMA Pada kesempatan itu Kapolres juga mengungkapkan, baru-baru ini pihaknya menangkap dua siswa Sekolah Menengah Atas (SMA) dalam kasus ganja. Kedua pelajar SMA itu masing-masing ISH, 18, warga

menteri baru. Sementara itu, Mustafa Abubakar , kini Meneg BUMN akibat kondisi kesehatan yang tidak memungkinkan, menurut informasi, posisinya diganti oleh menteri lain. Beliau sempat koma dan dirawat di rumah sakit di Singapura akibat terserang penyakit jantung. Namun, dalam sepekan ini kondisinya dilaporkan sudah mulai membaik. Sementara itu, Presiden Susilo Bambang Yudhoyono menunjuk Direktur Utama PT Perusahaan Listrik Negara, Dahlan Iskan, yang baru menjabat setahun setengah lebih sebagai Menteri BUMN yang baru menggantikan Mustafa Abubakar. PAW Dengan masuknya Azwar Abubakar di Kabinet Indonesia Bersatu II, posisi anggota DPRRI yang selama ini diduduki Azwar bakal kosong dan akan terjadi Pergantian Antar Waktu (PAW). Soal PAW, Sekretaris DPW PAN Aceh, Tarmidinsyah Abubakar menyatakan harus dilihat aturan dan peraturan perundang undangan yang ada. Selain itu, bisa juga berdasarkan kebutuhan sesuai kapasitas calon. Azwar Abubakar menjadi anggota DPRRI dari daerah pemilihan (Dapil) I. Ada tiga Caleg di bawah Azwar, yakni, Sa y e d Mu s t a f a ( m a n t a n Gubernur GAM Wil Aceh Barat Selatan), Yusrizal Syam (Ang-

gota DPP PAN asal Abdya) dan Taf Haikal (tokoh muda berbasis LSM). Mekanisme lain, bila dua Dapil digabung, besar kemungkinan masuk nama Tarmidisnyah Abubakar, yang kini menjabat sebagai Sekretaris DPW PAN Aceh. Amir Syamsuddin Jadi Menkumham Politisi Partai Demokrat Amir Syamsuddin mendapat tugas dari Presiden Susilo Bambang Yudhoyono sebagai Menteri Hukum dan Hak Asasi Manusia. menggantikan politisi Partai Amanat Nasional, Patrialis Akbar. Kepada para wartawan di Kantor Presiden, Jakarta, Senin (17/10), Amir mengatakan, dirinya menerima kabar pengangkatan dari Menteri Sekretaris Negara Sudi Silalahi. “Kemarin malam, sekitar jam 12 malam,” kata Amir seusai bertemu Presiden. Amir mengatakan, dirinya belum pasti menjadi menteri. Pasalnya, dirinya harus menjalani pemeriksaan kesehatan di Rumah Sakit Pusat Angkatan Darat Gatot Soebroto, Jakarta, Selasa (18/10) hari ini. Sebelumnya, Presiden menunjuk seorang Wakil Menteri Hukum dan HAM, yaitu Staf Khusus Presiden Bidang Hukum, HAM, dan Pemberantasan KKN Denny Indrayana. Amir, Denny, serta calon lainnya akan dilantik Rabu (19/10) di Istana Negara, Jakarta. (b01/b05/kps)

Jalan Sidangkal, Kel. Sidangkal, Kec. Padangsidimpuan Selatan, dan AAP, 18, warga Jalan Sudirman, Kec. Padangsidimpuan Utara. “Dari mereka disita dua bungkus kertas kecil berisi ganja 3,80 gram. Kita juga mengamankan barang bukti sepedamotor Yamaha Mio tanpa nomor polisi dan satu telepon selular,” jelas Kapolres. Kedua tersangka ditangkap personil Satuan Lalulintas yang sedang menggelar razia di depan rumah dinas Wali Kota Padangsidimpuan. Saat itu, tiga siswa berseragam SMA melintas melawan arah di depan rumah dinas Wali Kota. Melihat itu personil Sat Lantas mengejar dan menghentikan kenderaan yang ditumpangi ketiganya. Begitu berhenti, seorang di antaranya langsung melarikan diri sembari membuang bungkusan kecil berisi ganja. Takut dua lainnya kabur, personil Sat Lantas langsung mengamankan barang bukti ganja yang dibuang di dekat lokasi kejadian. Atas perbuatannya, Satuan Narkoba Polres Padangsidmpuan mengenakan Pasal 111 (1) dan Pasal 127 (1) huruf a UU RI No.35 tahun 2009 tentang Narkotika terhadap kedua pelajar SMA tersebut. (a27)

sini, sembahyang itu sendiri. mereka yang enggan bergurba tak usaha sembahyang sebab meremehkan syariat yang lain. Allah akan menolak sembahyang orang-orang yang kikir mengeluarkan harta. Sebab dalam Alquran antara sembahyang dengan zakat, sembahyang dengan infaq selalu disebut berbaringan. Maka keduanya harus dilaksankan. Pelaksanaan ibadah Qurban adalah setelah shalat Id dan beberapa hari sesudahnya. Tidak sah memotong gurban di malam hari, dan daging qurban sangat diutamakan untuk konsumsi fakir miskin, tapi boleh jug sebagian kecil (sepertiga) untuk dirinya dan sepertiga lagi untuk tetangga. Daging qurban akan menjadi haram bila diperun-

tukkan kepad aorang kaya saja, sedangkan yang miskin tidak memperolehnya. Qurban itu besar sekali hikmahnya, antara lain, pelaksanaan telah melaksanakan sebuah ibadah sunat yang diisyaratkan Rasulullah, telah turut membantu fakir miskin yang hidup kekurangan, telah membantu para peternak di segi ekonomi, telah menabung pahala untuk hari akhirat, telah melepaskan dirinya dari sifat kikir dengan mengeluarkan sebagaian dari harta yang dimiliki. Bila ibadah dhahiyyah ini dapat dilaksanakan dengan niat ihklas dan sesuai dengan petunjuk, pahalanya sangat besar. di hari akhirat nanti binatang qurban itu akan menjadi kenderaan yang sangat pantas menuju surga.

PPP Ajukan ....

menuturkan ada sejumlah nama diajukan DPP PPP ke Presiden Yudhoyono, termasuk di dalamnya anggota majelis pakar PPP Djan Faridz. “Soal pengunduran diri Menpera Suharso Monoarfa itu, pada pekan lalu yang bersangkutan sudah mengajukan rencananya kepada DPP PPP dan selanjutnya DPP membicarakan masalah itu. PPP memberi keleluasaan kepada Suharso untuk mengambil sikap, mana yang terbaik menurut dia,” ujarnya. Selanjutnya kepada Presiden Yudhoyono, ujar Romy, diajukan sejumlah nama kader PPP untuk dipilih presiden sesuai hak prerogatifnya. PPP tidak ingin menyandera presiden hanya dengan mengajukan satu nama calon menteri. “Ketika surat pengunduran diri Suharso itu diterima Presiden, tentunya PPP juga mengucapkan terima kasih karena Presiden sendiri telah menyampaikan bahwa kinerja Kemenpera itu positif. Jadi dari sisi kinerja tidak ada persoalan

Ada-ada Saja ....

melakukan penggeledahan terhadap rumah tersangka yang berada di pinggiran kota Chicago pada pekan lalu. Petugas yang curiga dan sudah mendapat surat penggerebekan akhirnya menemukan apa yang mereka cari, yaitu sejumlah tanaman ganja serta ganja kering, beberapa jenis obat terlarang, dan seperangkat alat produksi barang haram tersebut. Namun yang tak disangka petugas adalah seekor buaya sepanjang 5 kaki (1,5 meter) yang menjadi penunggu rumah saat mereka melakukan penggeledahan.

gara, SH, S.Ik, M.Si didampingi Kasat Narkoba, AKP K. Nababan. Keduanya juga berhasil ditangkap. Nas diciduk dari tempat kerjanya sebagai sopir truk di salah satu pabrik Pengolahan Kelapa Sawit (PKS), sementara EML ditangkap di Jalan Sorimuda tepat di depan SDN Sibabangun. ASL dan SPM di ruang pemeriksaan Satnarkoba Polres Tapteng, Senin (17/10) kepada Waspada, mengatakan mereka sudah beberapa kali sebagai kurir ganja atas suruhan Nas. (a23)

TAPTENG (Waspada): Setelah menggagalkan transaksi ganja seberat 5 kg melibatkan oknum Polres Tapsel beberapa waktu lalu, kali ini Polres Tapteng kembali menggagalkan transaksi ganja seberat 6 kg. Ganja siap edar yang dibungkus dalam 6 bal masingmasing seberat 1 kg itu diamankan dari tangan tersangka ASL, 23, dan SPM, 26, warga Lumut dan Sibabangun, Minggu (16/10) dinihari di belakang Terminal Pandan. Kapolres Tapanuli Tengah kepada Waspada, Senin (17/ 10) menjelaskan, penangkapan bermula dari kecurigaan Unit Patroli Sabhara Polres Tapteng yang sedang patroli rutin di sekitar Terminal Pandan. Saat itu, ASL dan SPM duduk di belakang terminal. Saat didatangi petugas, salah satu dari mereka terlihat melemparkan sebuah bungkusan plastik hitam ke semak-semak di sekitar lokasi. Merasa curiga, petugas memeriksa isi bungkusan itu. Ternyata isinya 25 gram daun ganja kering. Selanjutnya kedua tersangka diamankan ke komando. Setelah diintrogasi, terungkap malam itu keduanya menunggu pembeli. Dan ganja yang akan mereka serahkan kepada calon pembeli disembunyikan di semak-semak, tak jauh dari lokasi mereka nongkrong, sebanyak 6

bal seberat 6 kg senilai Rp 7.200.000. Ganja tersebut dimasukkan dalam tas, berasal dari Penyabungan. Selanjutnya petugas mengamankan ganja itu dari lokasi, Minggu (16/10) pagi. “Jadi kedua tersangka ini adalah kurir yang sedang menunggu pembeli. Pengakuan mereka, barang itu disuruh antarkan oleh dua warga Panyabungan Kab. Madina yang sekarang tinggal di Sibabangun, Nas, 41, dan EML alias Bajing, 27,” terang Kapolres Tapteng AKBP Dicky Patriane-

Kegagalan Aceh ....

wan terjebak dalam kompetisi politik kekuasaan tanpa menghiraukan keberadaan rakyat Aceh untuk memperoleh dampak pembangunan dari anggaran yang tersedia. Lebih lanjut dia katakan, langkah PA untuk tidak mencalonkan diri untuk Cagub/ Cawagub dan Cabup/Cawabup semestinya menjadi pertimbangan semua pihak untuk mereorientasikan politik Aceh. Misalnya keadaan ini dapat menjadi momentum untuk terjadinya rekonsiliasi politik. Dalam hal ini, disebutkan, mesti ada kekuatan alternatif yang dapat memediasi kekacauan komunikasi politik yang semakin buntu. Menurut dia, ulama dapat menjadi komponen yang menyejukkan, sehingga mampu memediasi semua kekuatan

politik yang ada untuk cenderung membangun langkah strategis bersama dalam membangun Aceh kedepan. “Inilah dasar pemikiran kenapa ulama mesti menjadi kekuatan yang terpisahkan dengan umara, supaya ulama dapat menjadi kekuatan untuk mengendalikan umara di kala para kaum umara terjebak dalam politik kekuasaan ansih,” demikian mantan Juru Bicara BRR Aceh-Nias, ini. Di lain pihak, para calon Bupati/Walikota dan Gubernur dari PA yang tidak mencalonkan diri ke KIP, Sejak Minggu,dua hari lalu berkumpul di Banda Aceh membahas soal isu Pilkada. Mereka dilaporkan akan mengambil langkah hukum, diantaranya menggugat KIP yang tetap melanjutkan tahapan Pilkada di Aceh. (b01)

kit jamaah yang tengah sakit berat tetap ngotot berangkat haji. Karena di setiap masjid, jamaah selalu berebutan untuk menyalatkan jenazah, terutama para tamu-tamu Allah. “Biasanya jamaah yang menyalatkan melebihi dari empat shaft (mencapai 100 orang lebih),” ungkap Abdul Karim.Orang-orang Arab berpegang kepada Hadist Nabi Muhammad SAW yang diriwayatkan Abu Hurairah ra bahwa, menyalatkan jenazah umat muslim memiliki pahala satu qirat dan satu qirat terkecil itu sama dengan Gunung Uhud. Sudah 82.064 Calhaj Tiba Di Makkah Sementara Ketua Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan H

Syariful Mahya Bandar melalui Humas HM Sazli Nasution, Senin (17/10), menyebutkan keluarga almarhum Parluhutan bisa mengambil seluruh barang bawaan saat kepulangan Kloter 2 pada 13 November. “Pihak keluarga dapat meminta surat keterangan kematian kepada dokter kloter untuk klaim asuransi sebesar 34 juta rupiah,” kata Sazli. Dia juga mengatakan ada dua jamaah yang batal berangkat di Kloter 15 karena sakit, yakni Muhammad Jusma, 71, warga Lingkungan 8 Rengas Pulau, Medan Marelan dan Suwarti, 61. Keduanya gagal berangkat sebelum masuk asrama. “Hingga kemarin, calhaj asal Indonesia yang berada di Makkah sebanyak 82.064 orang yang tergabung dalam 204 kloter. Sedangkan di Madinah sebanyak 47.446 orang (118 kloter),” kata Sazli. Khusus jamaah asal Sumut sudah 6.344 yang tiba di tanah suci, terdiri 4.532 di Makkah dan 1.811 di Madinah, dan yang berlum berangkat sebanyak 2.155 orang. Wali Kota Medan Rahudman Harahap dan Wakil Wali Kota Dzulmi Eldin, sebelumnya melepas keberangkatan Kloter 14 Embarkasi Medan di Asrama Haji, Senin (17/10). Calhaj berjumlah 452 orang, umumnya berasal dari Kota Medan, hanya satu Calhaj dari Tanjungbalai. (j06/m32/ m37/m50/cfs)

berkehidupan, perilaku pemimpin, relasi antar elit. Menurutnya, komunikasi politik para elit sebenarnya menjadi pengetahuan yang sangat berarti bagi kokohnya fondasi demokrasi di Aceh paska konflik. Tetapi ironis sekali, ungkap dia, gubernur dan para de-

Aksi Sabotase ....

Pada Minggu (16/10), karyawan dan massa membongkar paksa pagar dan memblokir jalan di check point 1 Bandara Mozes Kilangin Timika. Aksi sabotase lainnya berupa pemotongan pipa yang mengalirkan konsentrat dari Tembagapura menuju Pelabuhan Portsite Amamapre tepatnya di Mil 45 ruas jalan menuju Tembagapura.

16 Calhaj Indonesia ....

Dari Siskohat (sistem komunikasi dan informasi haji) Kementrian Agama (Kemenag) di Jakarta, diperoleh keterangan sampai Senin (17/ 10), tercatat calon jamaah haji Indonesia yang wafat sebanyak 16 orang. Abdul Karim selaku penghubung PPIH ( Panitia Penyelenggara Ibadah Haji ) Indonesia daerah kerja Jeddah mengatakan, meninggal dunia di tanah suci bagi sebagian jamaah haji merupakan kemuliaan. Makanya tidak sedi-

sama sekali dan semua alasan hanya persoalan pribadi,” ujarnya. Romy mengatakan, selain mengapresiasi keputusan presiden atas tawaran figur yang diajukan PPP, partainya juga berharap agar tidak ada lagi perubahan atas komposisi yang bakal ditempati Djan Faridz karena dalam beberapa waktu kedepan, berbagai perubahan tetap bisa terjadi. Romy mengatakan dalam konteks perombakan kabinet kali ini, partainya memberi dukungan sepenuhnya kepada apapun putusan presiden. Namun, ia mengingatkan agar penambahan posisi wakil menteri dalam kabinet tetap harus ada pembidangan tugas yang jelas agar tidak ada tumpang tindih dengan tugas menteri. “Wamen harus bisa berbagi tugas serta bersinergi dengan menteri,` ujarnya. Saat ditanya posisi Suharso di partai, Romy menjelaskan, yang bersangkutan tetap menjabat sebagai Wakil Ketua Umum DPP PPP untuk bidang pemenangan pemilu. Pejabat kantor sheriff McHenry County mengatakan tersangka Nicholas Cosmano, 26, akhirnya dijerat dengan dakwaan berlapis atas kejahatan yang dilakukannya. Ia juga didenda karena melanggar peraturan pemerintah yang melarang kepemilikan satwa liar dengan memelihara buaya. Polisi mengatakan mereka mendapati buaya tersebut sedang berada dalam bak mandi di dalam rumah. Satwa liar itu kemudian diserahkan ke lembaga penanganan satwa Herpetological Society Chicago. (ap/rzl)

UNESCO Akan Sahkan Tari Saman Sebagai Warisan Dunia BLANGKEJEREN (Waspada): UNESCO akan mengesahkan Tarian Saman atau yang dikenal dengan Tari Tangan Seribu asal Kab. Gayo Lues menjadi warisan dunia tak benda pada 19 November 2011. Demikian Bupati Gayo Lues H Ibnu Hasim dalam pembukaan seni budaya kabupaten serumpun di Lapangan Pancasila, Senin (17/10). Dalam kesempatan itu dijelaskan, Tarian Saman adalah budaya yang hidup dalam diri masyarakat Gayo Lues. “Buktinya, kaum pria dari seluruh desa di daerah ini mampu membawakan dan memainkan Tarian Saman,” kata Ibnu Hasim. Selain itu, katanya, tarian Saman setiap umumnya dimainkan pada hari-hari besar Islam dan panen padi raya. Tujuannya, selain sebagai hiburan, juga untuk menjalin tali silaturahim antar suku Gayo di Aceh Tenggara, Aceh Tengah, Bener Merian dan Aceh Timur. “Karena itu, suku Gayo sudah sepantasnya berbangga memiliki kebudayaan yang diakui dunia internasional,” katanya. (cb04)

Raja Arab Saudi ....

Memang sejak 1932 lalu, tampuk kepemimpinan Kerajaan Arab Saudi dipegang oleh keluara Al-Saud. Adik tiri Raja Abdullah yakni Putera Mahkota Sultan Bin Abdul Aziz yang memegang jabatan sebagai Menteri Pertahanan sejak 1962 lalu, saat ini sudah berusia 83 tahun. Dirinya pun dikabarkan mengidap kanker. Sementara Pangeran Nayef yang berada diurutan ketiga tahta Kerajaan Arab, saat ini sudah berusia 77 tahun. Saat ini dirinya menjabat sebagai Deputi Perdana Menteri sejak ditunjuk Maret 2009.

Tiga Hari Terakhir ....

ditangkap kapal patroli Maritim Malaysia dengan nomor lambung 3138. Menurut salah seorang nelayan, rekan mereka ditangkap di perairan Line III berjarak sekitar 47 mil dari perairan P. Brandan. Bardasarkan data diperoleh Waspada dari KNTI, para nelayan yang ditangkap, Julpian, 41, (nakhoda), Sahrial, 30, M. Ridwan, 22, M. Ridwan, 32, Zulham, 27, Lana, 21, Iqbal Rinanda, 21, Ervan, M. Reza, 20, Mislan, 32, dan Bambang Kurniawan Safriadi. Sesaat penangkapan, salah seorang nelayan, Iqbal Rinanda sempat menghubungi temannya melalui jaringan handy talky. “Teman saya itu memberitahu dia dianiya anggota maritim, karena menolak menandatangani berita acara penangkapan,” kata Usman.

Presedium KNTI Region Sumatera, Tajrudin Hasibuan didampingi Koordinator KNTI Langkat, Iqbal, Senin (17/10) mengatakan, dalam tiga hari terakhir sudah 23 orang nelayan asal Sei Bilah yang ditangkap, sementara 6 nelayan yang ditangkap September lalu, hingga kini masih mendekam di penjara. Isteri Iqbal Rinanda, Sri Rahmadani, 20, yang mengandung anak pertama tak kuasa menahan tangis, ketika wartawan menyambangi kediamannya. Begitu juga, Norma, ibu kandung nelayan itu terus menangis histeris, mengkhawatirkan nasib putera sulungnya. “Iqbal adalah tulang pung-gung keluarga. Kalau dia di penjara tidak ada lagi tempat kami bersandar.Tolonglah kami,” ujar ibu beranak lima ini sambil menangis, minta bantuan pembebasan dari pemerintah.(a02)

Berita Utama


WASPADA Selasa 18 Oktober 2011

Nelayan T. Balai Belum Terima Minah Bersubsidi

Waspada/Muhammad Riza

SEEKOR ular sawah berukuran delapan meter dengan berat sekira 80 kilogram ditemukan warga Kota Sigli di kawasan Blang Peutek, Kec. Padang Tijie, Senin (17/10) sekira pukul 15:00. Kini ular raksasa ini terlihat dalam kondisi lemas terkulai dan menjadi tontonan warga di Kel. Blok Bengkel, Kota Sigli, Pidie.

TANJUNGBALAI (Waspada): Nelayan pukat apung tergabung dalam Asosiasi Nelayan dan Pengusaha Pukat Apung Tradisional Indonesia (ANPPATI) Kota Tanjungbalai, belum memperoleh minyak tanah (Minah) bersubsidi, kata Sekretaris ANPPATI Kota Tanjungbalai, Khairuddin Tambunan kepada Waspada, Senin (17/10). Menurut Khairuddin, dia mengetahui masuknya Minah bersubsidi yang diberikan kepada nelayan ikan teri (pukat apung), untuk merebus ikan.

Namun, selaku Sekretaris ANPPATI, dia belum mendapat laporan dari anggotanya, bahwa telah menerima Minah. “Anggota saya yang terdaftar 90 kapal, tapi belum ada laporan resmi yang menyatakan telah menerima Minah bersubsidi,” terang Khairuddin. Dikatakan, dia mensinyalir ratusan ton Minah itu disalahgunakan dengan mengoplos agar dapat dijadikan bahan bakar mesin kapal. Menurut informasi, sejumlah kapal pukat apung menerima 50 drum Minah setiap berangkat selama 10

hari. “Kalau hanya merebus ikan, 5 drum isi 200 liter cukup sekali berangkat. Tapi mengapa sampai 50 drum, itu bisa merebus ikan seluruh kota Tanjungbalai,” papar Khairuddin. Untuk itu, dia minta Pertamina, BPH Migas serta aparat terkait menyelidiki dan mengawasi penyaluran minyak tanah ke Kota Tanjungbalai. Kepala Perindustrian dan Perdagangan Kota T. Balai, Syafril Lubis dikonfirmasi Waspada melalui Kabid Perdagangan Anggiat, enggan berkomentar soal pendistribusian minyak

199,07 Gram Sabu Dan 365,69 Kg Ganja Dimusnahkan P. SIDIMPUAN (Waspada): Kepolisian Resort (Polres) dan Kejaksaan Negeri (Kejari) Padangsidimpuan memusnahkan barang bukti perkara tindak pidana narkotika berupa sabusabu 199,07 gram, dan ganja 365,69 kg, di lapangan bola voli Mapolres, Senin (17/10).

Pemusnahan ditandai dengan penyulutan api pertama oleh Kapolres Padangsidimpuan, AKBP Andi Syahriful Taufik bersama Kasi Pidum Kejari Sabiin dan Kadis Kesehatan Pemko Padangsidimpuan, Hj. Doria Hafni Lubis. Kasat Narkoba Polres Pa-

Presiden Setujui ...

Selain itu, Suharso juga dinilai berhasil melaksanakan pembangunan Rumah Susun Sewa (Rusunawa) bagi prajurit TNI dan Polri yag selama ini tidak termasuk dalam skema pembangunan rusunawa biasa. Presiden dalam pernyataannya juga memberikan apresiasi pada Kementerian Perumahan Rakyat di bawah kepemimpinan Suharso yang laporan keuangannya mendapatkan status wajar tanpa pengecualian dari Badan Pemeriksa Keuangan selama dua tahun berturut-turut pada 2009 dan 2010. Suharso: Saya Tak Ingin Ganggu Presiden SBY “Jangan sampai masalah pribadi saya mengganggu performa pemerintahan beliau (Presiden SBY),” kata Suharso Monoarfa dalam perbincangan lewat sambungan telefon, Senin (17/10). Mantan staf ahli Wakil Presiden Hamzah Haz itu memang kini tersandung persoalan rumah tangga. Sang istri, Carolina binti M Gandhi Kaluku, menggugat cerai Suharso pada Senin 12 September 2011 lalu. Suharso menegaskan bahwa pengunduran diri ini bukan untuk menunjukkan ketidaksetiaan terhadap Presiden SBY. Tapi pengunduran dirinya itu justru sebaliknya. “Saya ingin menunjukkan kalau saya loyal kepada pemerintahan SBY,” kata politisi senior PPP ini. Keputusan pengunduran diri ini sudah lama dan dipikirkan masak-masak oleh Suharso. Suharso berharap, kasus pribadi yang membelit dirinya tidak terus dibesar-besarkan media. “Ini sudah lama saya timbang-timbang. Jangan sampai, persoalan pribadi saya ini dieksploitasi sedemikian rupa dan mengganggu performa kabinet,” kata Suharso. Istri Suharso, Carolina binti M Gandhi Kaluku, mengajukan gugatan cerai pada Senin 12 September 2011 lalu. Hal itu ditegaskanjurubicaraPengadilanAgama Jakarta Selatan, Tamah. Saat mendaftarkan gugatan, Carolina datang sendiri tanpa didampingi kuasa hukum. (ant/vvn)

Atas permohonan tersebut, Presiden kemudian menyetujui pengunduran diri yang diajukan oleh Suharso dengan alasan persoalan pribadi. “Saya menerima dan menyetujui pengunduran diri saudara Suharso Monoarfa. Alasan yang disampaikan terkait dengan persoalan peribadi,” ujarnya. Presiden dalam pernyataan pers menyampaikan catatan atas kinerja Suharso selama dua tahun dalam jajaran Kabinet Indonesia Bersatu II. Menteri asal Partai Persatuan Pembangunan (PPP) tersebut dinilai cukup baik dan berprestasi. Salah satu keberhasilan Suharso, menurut Presiden, adalah perubahan sistem Kredit Perumahan Rakyat (KPR) bagi masyarakat berpenghasilan rendah yang ternyata menghasilkan efisiensi yang tinggi.

Megawati: Wakil ... “Ketika saya menjabat Presiden tidak terus mengangkat wakil menteri sebanyak itu, tetapi memilih orang-orang yang tepat dan mempunyai kemampuan untuk menduduki jabatan tertentu,” katanya. “Waktu itu saya mencari orang-orang yang mampu menduduki jabatan tertentu dan tidak memilih orang sebanyak ini. Lewat cara sekarang ini jelas akan membebani APBN, sementara anggaran tahun ini sudah berjalan. Padahal pejabat baru itu juga perlu fasilitas yang harus disediakan untuk menunjang kesuksesan bekerja,” katanya. Megawati beserta rombongan dalam kunjungannya ke Solo juga meninjau proyek bantuan rehabilitasi perumahan di Danusuman dan juga mengunjungi Taman Pintar di Gandekan, Jebres. Megawati beserta rombongan seusai melakukan peninjauan tersebut terus menuju ke Yogyakarta untuk menghadiri pesta pernikahan putri Sri Sultan Hamengku Buwono X.

Jawaban Problem Catur,

Raja Arab Saudi ...

TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Me6, Ma3. 2. GxKg6+, Rg8. 3. Me8+, Mf8. 4. MxM+mat. (Jika 1. ......., h5. 2. MxK+, Rg8.

Ada-ada Saja ...

3. Me8+mat).

Jawaban TTS: TTS Topik

Politik & Hukum




Jawaban Sudoku:

8 1 3 2 4 7 9 5 6

6 4 9 1 5 3 2 8 7

7 2 5 8 6 9 4 1 3

2 7 8 9 1 6 5 3 4

9 6 1 5 3 4 7 2 8

5 3 4 7 8 2 6 9 1

4 5 7 3 2 1 8 6 9

1 9 2 6 7 8 3 4 5

Adik tiri Raja Abdullah yakni Putera Mahkota Sultan Bin Abdul Aziz yang memegang jabatan sebagai Menteri Pertahanan sejak 1962 lalu, saat ini sudah berusia 83 tahun. Dirinya pun dikabarkan mengidap kanker. Sementara Pangeran Nayef yang berada diurutan ketiga tahta Kerajaan Arab, saat ini sudah berusia 77 tahun. Saat ini dirinya menjabat sebagai Deputi Perdana Menteri sejak ditunjuk Maret 2009.

3 8 6 4 9 5 1 7 2

kepolisian setempat melakukan penggeledahan terhadap rumah tersangka yang berada di pinggiran kota Chicago pada pekan lalu. Petugas yang curiga dan sudah mendapat surat penggerebekan akhirnya menemukan apa yang mereka cari, yaitu sejumlah tanaman ganja serta ganja kering, beberapa jenis obat terlarang, dan seperangkat alat produksi barang haram tersebut. Namun yang tak disangka petugas adalah seekor buaya sepanjang 5 kaki (1,5 meter) yang menjadi penunggu rumah saat mereka melakukan penggeledahan. Pejabat kantor sheriff McHenry County mengatakan tersangka Nicholas Cosmano, 26, akhirnya dijerat dengan dakwaan berlapis atas kejahatan yang dilakukannya. Ia juga didenda karena melanggar peraturan pemerintah yang melarang kepemilikan satwa liar dengan memelihara buaya. Polisi mengatakan mereka mendapati buaya tersebut sedang berada dalam bak mandi di dalam rumah. Satwa liar itu kemudian diserahkan ke lembaga penanganan satwa Herpetological Society Chicago. (ap/rzl)

dangsidimpuan, AKP Timbul Sihombing mengatakan, pemusnahan narkotika golongan I didasarkan pada Pasal 7 ayat (1) huruf j, Pasal 11, Pasal 38, Pasal 39, dan Pasal 45 ayat (4) KUH Pidana. Undang-undang No. 2 tahun 2002 tentang Kepolisian RI, Pasal 75 huruf k, Pasal 91 ayat 1 sampai 5 UU No. 35 tahun 2009 tentang Narkotika dan surat izin

pemusnahan dari Ketua Pengadilan Negeri Padangsidimpuan No. 06, 05, dan 07/2011. Dirincikan, sabu-sabu 70,32 gram disita dari tersangka MDS, 25 Juni 2011. Sabu-sabu 128 ,75 gram dari tersangka MML, 28 September 2011 dan 13.881,68 gram ganja dari tersangka LB bersama SBL, 22 Agustus 2011. Sementara Kasipidum Kejari Padangsidimpuan Sabiin meng-

ungkapkan, telah menyerahkan barangbuktinarkotikaganjayang telah berkekuatan hukum tetap, 351818,27 gram atau 351,81 kg. Sedangkan Kapolres Padangsidimpuan, AKBP Andi S Taufik, mengharapkan seluruh elemen masyarakat bergabung dengan kepolisian memerangi peredaran narkoba yang makin meningkat di Kota Padangsidimpuan. (a27)

Pusat Masih ...

sekira pukul 11:00 – 12:00 , diterima Presiden Susilo Bambang Yudhoyono (SBY) di Istana Negara, Jakarta. Anggota DPRRI dari Partai Amanat Nasional yang Waspada hubungi via handphone usai diterima SBY, ini menyatakan, Presiden memberikan gambaran secara umum tentang tugas masing-masing calon menteri. “Selain saya, ada lima calon menteri yang dipanggil tadi oleh SBY,” kata Azwar Abubakar. Mereka masing-masing Dahlan Iskan, Amir Syamsuddin, Djan Faridz dan Letnan Jenderal TNI Marciano Norman Masuknya Azwar Abubakar di kabinet SBY, dibenarkan Ketua DPW PAN Aceh, Anwar Ahmad. “Saya sudah dapat informasi sejak dua hari lalu dari DPP PAN di Jakarta,” sebut Anwar yang juga Wakil Bupati Aceh Besar ini kepada Waspada kemarin. Artinya, diakui Anwar, peran DPP PAN yang digawangi Hatta Rajasa, sangat besar meloloskan putra terbaik Aceh ini masuk dalam jajaran kabinet SBY. Sebelumnya beredar nama Nasir Djamil, anggota DPRRI asal Aceh disebut-sebut bakal masuk kabinet SBY. Nasir masuk bursa dan mendapat dukungan DPP PKS. Namun, kandas dan Azwar Abubakar yang masuk sebagai menteri baru. Sementara itu, Mustafa

Abubakar , kini Meneg BUMN akibat kondisi kesehatan yang tidak memungkinkan, posisinya diganti oleh Dahlan Iskan. Mustafa sempat koma dan dirawat di rumah sakit di Singapura akibat terserang penyakit jantung. Namun, dalam sepekan ini kondisinya dilaporkan sudah mulai membaik. PAW Dengan masuknya Azwar Abubakar di Kabinet Indonesia Bersatu II, posisi anggota DPRRI yang selama ini diduduki Azwar bakal kosong dan akan terjadi Pergantian Antar Waktu (PAW). Soal PAW, Sekretaris DPW PAN Aceh, Tarmidinsyah Abubakar menyatakan harus dilihat aturan dan peraturan perundang undangan yang ada. Selain itu, bisa juga berdasarkan kebutuhan sesuai kapasitas calon. Azwar Abubakar menjadi anggota DPRRI dari daerah pemilihan (Dapil) I. Ada tiga Caleg di bawah Azwar, yakni, Sayed Mustafa (mantan Gubernur GAM Wil Aceh Barat Selatan), Yusrizal Syam (Anggota DPP PAN asal Abdya) dan Taf Haikal ( tokoh muda berbasis LSM). Mekanisme lain, bila dua Dapil digabung, besar kemungkinan masuk nama Tarmidisnyah Abubakar, yang kini menjabat sebagai Sekretaris DPW PAN Aceh. (ant/b01/b05)

ikan. Namun TLDM tidak perduli dan tetap membawa mereka ke Malaysia. “Aku bersikeras kalau kami masih di perairan Indonesia, namun mereka tidak perduli,” ujarnya. S e d a n g k a n M Yu n a n mengatakan, saat mereka akan pulang ke Indonesia, hanya dibekali dengan mi instan dan air mineral. “Kami bebas Jumat dan tidak ada diberi uang. Sehingga kami pulang menggunakan uang sisa,” katanya. Ketua HNSI Kota Medan Zulfahri Sigaian berterimakasih kepada Pemerintah Indonesia dan Malaysia yang telah mampu bernegosiasi dengan baik untuk melepas ke empat nelayan Belawan tersebut. “Ini bentuk ker-

ukunan antara negara, yang terbina dan semoga ke depan hal ini bisa dipertahankan,” sebutnya didampingi wakil ketua Alfian MY. Sebelumnya, empat nelayan Belawan yakni tekong kapal Efendi, bersama tiga anak buah kapalnya (ABK) M Yunan, Rahmad danWirya ditangkapTLDM No: 137 saat mencari ikan dengan menggunakan kapal pancing tradisional atau tunda di perairan Selat Malaka pada koordinat 05.07.200. utara dan 99.03.180 timur.Diduga wilayah itu masih di Indonesia. Selanjutnya keempat nelayan itu diserahkan TLDM ke polisi maritim Penang, untuk diproses sesuai hukum setempat. (h03)

lin, pihaknya berusaha mengajak PN Gas dan Dinas Kebakaran melatih masyarakat cara mengatasi jika terjadi kebakaran. “Selama ini masyarakat tidak tahu cara menghadapi kebakaran. Untuk itu sosialisasi menanggulanginya perlu dilakukan,” sebutnya. Masih Kritis Satu hari setelah kebakaran, Rohana br Manurung, istri Rudi Sinaga, masih dirawat intensif di ruang ICU RSU Martha Priska Medan, dengan kondisi kritis. “Dia telah bisa bicara tapi matanya masih tertutup karena seluruh kulitnya terbakar,” kata Ramlan Manurung, abang korban, saat ditemui di rumah sakit, Selasa (17/10). ”Mau operasi, mereka minta uang Rp10 juta, padahal Pemko setuju menanggung biaya perobatan adikku saat Pak Wali datang kemari, kemarin,” ujar Ramlan. Tabung Gas Kasat Reskrim Polres Pela-

buhan Belawan AKB Hamam mengatakan, berdasarkan keterangan saksi dan alat bukti di lapangan, penyebab kebakaran lebih besar mengarah kepada tabung gas tiga kg. “Namun untuk lebih pastinya kita tunggu hasil labfor Poldasu,” katanya. Sementara itu, tiga korban tewas akibat kebakaran itu yakni Rudi Sinaga, 40, bersama anaknya Riska Sinaga, 4, telah dikebumikan di desanya di Siborong Borong, Taput. Rosa Pasaribu, keponakan J Sinaga, 9, dikebumikan di TPA Martubung. Seperti diberitakan sebelumnya, delapan unit rumah warga Jalan Pancing Tiga Gang Mesjid Lingk 5, Kel. Besar, Kec. Medan Labuhan, terbakar mengakibatkan tiga orang penghuninya teweas terpanggang, Minggu (16/10) siang sekitar pukul 12:30. Selain itu, seorang kritis akibat sekujur terbakar dan dirawat di RSU Martha Friska. (h03)

da, 21, Ervan, M. Reza, 20, Mislan, 32, dan Bambang Kurniawan Safriadi. Sesaat penangkapan, salah seorang nelayan, Iqbal Rinanda sempat menghubungi temannya melalui jaringan handy talky. “Teman saya itu memberitahu dia dianiya anggota maritim, karena menolak menandatangani berita acara penangkapan,” kata Usman. Presedium KNTI Region Sumatera, Tajrudin Hasibuan didampingi Koordinator KNTI Langkat,Iqbal,Senin(17/10)mengatakan, dalam tiga hari terakhir sudah 23 orang nelayan asal Sei Bilah yang ditangkap, sementa-

ra 6 nelayan yang ditangkap September lalu, hingga kini masih mendekam di penjara. Isteri Iqbal Rinanda, Sri Rahmadani, 20, yang mengandung anak pertama tak kuasa menahan tangis, ketika wartawan menyambangi kediamannya. Begitu juga, Norma, ibu kandung nelayan itu terus menangis histeris, mengkhawatirkan nasib putera sulungnya. “Iqbal adalah tulang punggung keluarga. Kalau dia di penjara tidak ada lagi tempat kami bersandar. Tolonglah kami,” ujar ibu beranak lima ini sambil menangis, minta bantuan pembebasan dari pemerintah. (a02)

mewujudkan aparatur pemerintahan yang bersih dan berwibawa,” kata mantan anggota DPR RI periode 2004-2009 itu. Selain itu, ia menyarankan agar Azwar Abubakar memperbaiki sikap mental para pegawai negeri sipil yang hingga kini dinilai masih diperlukan perbaikan, khususnya terkait PNS yang sering bolos kerja. Tokoh Aceh lainnya Prof DR Yusni Saby menilai penunjukkan Azwar Abubakar sebagai menteri dalam KIB-II oleh Presiden Susilo BambangYudhoyono sebuah penghargaan bagi masyarakat provinsi ujung paling barat Indonesia ini. “Paling tidak, Aceh sudah bertambah deretan ‘orang kuat’ ditingkat pusat yang tentunya juga akan mengabdi bagi kepentingan bangsa dan Negara Kesatuan Republik Indonesia (NKRI),” kata dia menjelaskan. Oleh karenanya, mantan Rektor IAIN Ar-Raniry Darussalam Banda Aceh itu mengajak seluruh elemen masyarakat untuk mendukung dan mendoakan agar putra Aceh terbaik tersebut terus berkarya dan mengabdi bagi kepentingan umum dan NKRI. Kepastian Azwar Abubakar menjadi menteri baru hasil reshuffle, setelah Senin (17/10)

Empat Nelayan ... Nakhoda kapal Effendi kepada Waspada mengatakan, selama ditahan di penjara atau lokap Malaysia, dia bersama tiga anak buah kapalnya (ABK) M Yunan, Rahmad dan Wirya diberi makan serta diperlakukan dengan baik. “Kami tidak ada dipukul,” katanya. Ditanya tentang proses penangkapan, Effendi menyebutkan, sebelumnya dia bersama temannya tidak sadar kalau lokasi mereka menangkap ikan adalah wilayah perairan Ma laysia. Saat ditangkap, mereka sempatmembantahtudinganTentara Laut Diraja Malaysia (TLDM) No: 137, kalau mereka telah mencuri

Pertamina Diminta ... Kedepan, kata Nasir, untuk mengurangi tingkat ledakan tabung gas 3 kg, pihaknya meminta Pertamina kembali melakukan sosialisasi cara menggunakan tabung bersubsidi itu dengan baik. “Sosialisasi memang sudah pernah. Namun perlu dimantapkan,” ujarnya. Hal yang sama dikatakan anggota DPD RI asal Sumut Parlindungan Purba. Parlindungan meminta pemerintah kembali mensosialisasikan cara penggunaan tabung gas 3 kg kepada masyarakat. Sosialisasi ulang itu perlu mengingat saat ini hanya sekitar 30 persen masyarakat yang mengerti cara menggunakan tabung gas 3 kg dengan baik. “Ternyata temuan kita sebanyak 70 persen lagi masyarakat Indonesia masih gamang menggunakan tabung gas,” katanya. Selain Pertamina, kata Par-

Tiga Hari Terakhir, ... Ke sebelas nelayan yang menumpang dua perahu motor dengan nomor lambung PB 641 dan PB 016 ditangkap kapal patroli Maritim Malaysia dengan nomor lambung 3138. Menurut salah seorang nelayan, rekan mereka ditangkap di perairan Line III berjarak sekitar 47 mil dari perairan P. Brandan. Bardasarkan data diperoleh Waspada dari KNTI, para nelayan yang ditangkap, Julpian, 41, (nakhoda), Sahrial, 30, M. Ridwan, 22, M. Ridwan, 32, Zulham, 27, Lana, 21, Iqbal Rinan-

tanah bersubsidi. Di tempat terpisah, pemilik pukat apung di Kota Tanjungbalai, Akiat, menyatakan nelayan mendapat minyak tanah bersubsidi untuk bahan bakar merebus ikan teri hasil tangkapan, berkat upaya DPC HNSI Kota Tanjungbalai. Menurut Akiat, penyaluran minyak tanah bersubsidi oleh DPC HNSI Kota Tanjungbalai melalui mitra kerjanya UD Nelayan Sejahtera, sudah sesuai keinginan para nelayan dengan harga Rp3.250 per liter atau Rp650 ribu per drum. Disebutkan, kebutuhan Akiat sekali melaut 50 drum atau 10 ribu liter minyak tanah untuk 8 unit kapal ikan teri, atau pukat apung selama 10 hari. Jika dikalkulasi dengan harga minyak tanah bersubsidi, biaya untuk 8 kapalnya Rp32.500.000. Sebelum ada minyak tanah bersubsidi, mereka harus mengeluarkan biaya Rp80 juta. “Minyak tanah bersubsidi bukan untuk bahan bakar mesin, melainkan hanya untuk bahan bakar merebus ikan hasil tangkapan di laut saja. Lagipula saya pikir, tak seorang pun pemilik kapal yang mau merusak mesin kapalnya sendiri,” tutur Akiat. Sebelumnya Waspada memperoleh informasi, dalam sebulan ini Pertamina telah menyalurkan Minah bersubsidi ke Tanjungbalai, 365 kiloliter (KL). Sasarannya adalah para nelayan pukat apung. Sementara External Rela-

Satu Calhaj P. Sidimpuan ... di tanah suci bagi sebagian jamaah haji merupakan kemuliaan. Makanya tidak sedikit jamaah yang tengah sakit berat tetap ngotot berangkat haji. Karena di setiap masjid, jamaah selalu berebutan untuk menyalatkan jenazah, terutama para tamutamu Allah. “Biasanya jamaah yang menyalatkan melebihi dari empat shaft (mencapai 100 orang lebih),” ungkap Abdul Karim. Orang-orang Arab berpegang kepada Hadist Nabi Muhammad SAW yang diriwayatkan Abu Hurairah ra bahwa, menyalatkan jenazah umat muslim memiliki pahala satu qirat dan satu qirat terkecil itu sama dengan Gunung Uhud.

Enam Wajah Baru ... Dahlan yang memberikan keterangan paling terakhir sempat menangis di hadapan wartawan karena sebenarnya ia tidak ingin meninggalkan PLN. “Karena sekarang ini temanteman PLN sedang semangatsemangatnya bertugas, tetapi Presiden menugaskan sebagai Menteri BUMN,” ujarnya. Sedangkan Komandan Diklat TNI AD Letjen Marciano Norman ditunjuk oleh Presiden Yudhoyono untuk menjabat Kepala Badan Intelijen Negara (BIN) menggantikan mantan Kapolri Jenderal Pol (Pur) Sutanto. Seluruh calon menteri itu menjalani tes kesehatan pada Selasa (18/10) di Rumah Sakit

tions PT Pertamina Unit Pemasaran (UPms) Regional I Sumatera Bagian Utara, Sonny Mirath, ketika dikonfirmasi mengatakan Pertamina merupa-

kan penerima mandat untuk menyalurkan BBM subsidi di Indonesia dan regulator, atau pemberi mandat Badan Pengatur Hilir Migas (BPH Migas). (a14/a32)

Waspada/Ismanto Ismail

KTU Yayasan Perguruan Mayjen Sutoyo SM Cici Desliantika, 21, sedang menunjukkan rak yang diobrak-abrik pelaku perampokan bersenjata api, Senin (17/10).

Perampok Bersenpi ... dari ruangan STM Medan Area. Selain itu, kawanan rampok juga mengambil sepedamotor, handphone milik satpam, dan mengondol beberapa set kunci sekolah, kemudian kawanan itu kabur. Setelah bersusahpayah, korban Dedy Bangun berhasil ke luar dari kamar mandi dan menuju kediaman Suwarni, 59, pemilik kantin sekolah dan putrinya Siti Rahmawati Spd, 36, kepala sekolah SD YP Mayjen Sutoyo, di lokasi sekolah tersebut. Ketua Yayasan Perguruan Mayjen Sutoyo SM, M Waris mengatakan, pihaknya sudah melapor ke Polsek Sunggal. Sementara itu, Kapolsek Sunggal AKP M Budi Hendrawan, SH,SIK didampingi Kanit Reskrim AKP Victor Ziliwu, SH,SIK ketika dikonfirmasi mengatakan, pihaknya sudah turun ke Tempat Kejadian Perkara (TKP) pukul 06:00, ketika para siswa belum datang ke sekolah. “Kita telah mengumpulkan bukti-bukti dan melakukan pemeriksaan sejumlah saksi,” kata Budi. (m36) Sementara Ketua Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan H Syariful Mahya Bandar melalui Humas HM Sazli Nasution, Senin (17/10), menyebutkan, keluarga almarhum Parluhutan bisa mengambil seluruh barang bawaan saat kepulangan Kloter 2 pada 13 November. “Pihak keluarga dapat meminta surat keterangan kematian kepada dokter kloter untuk klaim asuransi sebesar 34 juta rupiah,” kata Sazli. Dia juga mengatakan ada dua jamaah yang batal berangkat di Kloter 15 karena sakit, yakni Muhammad Jusma, 71, warga Lingkungan 8 Rengas Pulau, Medan Marelan dan Suwarti, 61. Keduanya gagal berangkat sebelum masuk asrama.

“Hingga kemarin, calhaj asal Indonesia yang berada di Makkah sebanyak 82.064 orang yang tergabung dalam 204 kloter. Sedangkan di Madinah sebanyak 47.446 orang (118 kloter),” kata Sazli. Khusus jamaah asal Sumut sudah 6.344 yang tiba di tanah suci, terdiri 4.532 di Makkah dan 1.811 di Madinah, dan yang berlum berangkat sebanyak 2.155 orang. Wali Kota Medan Rahudman Harahap dan Wakil Wali Kota Dzulmi Eldin, sebelumnya melepas keberangkatan Kloter 14 Embarkasi Medan di Asrama Haji, Senin (17/10). Calhaj berjumlah 452 orang, umumnya berasal dari Kota Medan, hanya satu Calhaj dari Tanjungbalai. (j06/m32/m37/m50/cfs)

Gatot Subroto Jakarta. Dahlan Iskan yang pernah menjalani pencangkokan hati di China dalam pernyataan persnya mengatakan, ia pun tidak tahu apakah bisa melewati tes kesehatan tersebut. “Seperti yang orang-orang ketahui, saya ini orang sakit,” ujar pria yang gemar mengenakan sepatu kets bahkan untuk bertemu Presiden di lingkungan Istana itu. Juru Bicara Kepresidenan Julian Aldrin Pasha menyatakan sampai saat ini ia tidak dapat memberikan konfirmasi terhadap nasib para menteri yang posisinya akan digantikan itu apakah nantinya dicopot atau digeser dalam Kabinet Indonesia Bersatu II.

Pada Senin, audiensi Presiden dengan para calon menteri telah berakhir karena Kepala Negara didampingi oleh AniYudhoyono bertolak menuju Daerah Istimewa Yogyakarta pada pukul 14:00WIB, guna menghadiri pernikahan putri Sultan Hamengkubuwono X. Presiden melanjutkan audiensi Selasa sepulang dari Yogyakarta. Presiden Yudhoyono dijadwalkan tiba kembali di Jakarta pada Selasa siang 18 Oktober 2011, dan mengumumkan perombakan kabinet pada Selasa malam pukul 20:00 WIB di Istana Kepresidenan. Sedangkan pada Rabu 19 Oktober 2011 akan dilaksanakan pelantikan terhadap anggota baru Kabinet Indonesia Bersatu II.

Niat Haji Muncul ... menyerah merealisasikan mimpinya menunaikan ibadah haji. Angannya menunaikan haji sudah ada ketika melakoni profesi juru warta saat masih muda, karena baginya, menunaikan haji memantapkan diri berserah kepada Allah SWT, menstabilkan hati untuk menyampaikan keluh kesah dan doa kepada Allah. Maka segala kesulitan dapat dilaluinya karena tekadnya yang begitu kuat. “Masa saya menjadi juru warta sangat sulit, dan tidak punya penghasilan yang bisa ditabung, Tapi karena kenyakinan, saya terus berusaha mengumpulkan uang. Meski sisa serupiah pun pasti saya tabung jika ada,” sebutnya mengenang. Dia sangat bangga dengan profesinya walau orang menganggap juru warta pekerjaan yang kecil dan tidak punya penghasilan tetap, bahkan tulisan peristiwa besar hanya dihargai dengan honor yang minim. Tapi Burhanuddin tidak putus asa dan terus menulis sebanyak-banyaknya untuk mendapatkan honor agar bisa menabung haji dan sangat mencintai profesinya. Masih lekat dalam ingatannya, menulis tidak sebebas dan semudah sekarang ini. Pada masa dia, menulis masih di dikte dan sangat beresiko jika menyudutkan pihak lain. “Tapi begitu pun, pengalaman dan rintangan menjadi juru warta membawa saya pada pribadi yang sabar

LENTERA ... seluruhnya dipersembahkan kepada Allah. Allah hanya menerima niat ikhlas hambanya yang berqurban, sedangkan dagingnya bukan untuk Allah. Tuhan umat Islam tidak makan daging. “Tidak sampai kepada Allah daging dan darahnya, tetapi yang sampai kepada-Nya hanya ketaqwaan-mu (QS.22:37). Qurban hukumnya sunat muakkad (sunat yang diberatkan), bahkan menurut Mazhab Hanafi, hukumnya wajib. Mereka berdalil kepada ayat dua Surat al-Kautsar, “Maka sembahyang lah kepada Tuhanmu dan berqurbanlah”. Dalam Hadist juga disebutkan: “Barang siapa yang memiliki kelapangan (kemampuan) tetapi ia tidak berqurban, maka jangan sekali-kali ia mendekati tempat shalat kami-mushallana. (HR. Hakim dari Abu Hurairah). Menurut ahli hadist, yang idmaksud tempat sembahyang kami (mushallana) di sini, sembahyang itu sendiri. mereka yang enggan bergurba tak usaha sembahyang sebab meremehkan syariat yang lain. Allah akan menolak sembahyang orang-orang yang kikir mengeluarkan harta.

dan pantang menyerah hingga terus menabung dan melakukan apa saja yang halal, hingga kemudian menjadi petani di usia tua sekarang pun saya jalani,” tuturnya. Dia mengungkapkan, 20 tahun bekerja di lapangan, siang malam mencari berita, tubuhnya tidak kuat lagi di makan usianya yang semakin tua. Dia pun pulang ke kampung halaman dan melakoni profesi yang sama sekali tidak pernah dilakukannya selama di Palembang. Tapi demi melanjutkan impiannya menunaikan haji, dia pun menjamah tanah siang dan malam bersama istrinya Baiyani Pane, 68, menjadi petani. “Alhamdulillah sekarang tabungan kami telah terkumpul dan bisa berangkat haji pada kloter 15 Selasa (18/10). Rasa haru dan bahagia yang tidak terkira dari juru warta dan petani, menggeluti apa saja agar bisa menabung untuk dapat berangkat ke tanah suci,” sebutnya. Dia berkeinginan sesampainya di Madinah bersujud ke makam Nabi, tokoh panutan yang membuatnya sangat bertekad pergi haji, dan mendekatkan diri kepada Allah agar dijauhkan dari perbuatan maksiat dan pekerjaan yang haram. Juga agar diselamatkan dunia akhirat dan dijauhkan dari hal-hal buruk. “Dan yang utama agar Allah membersihkan hati saya dari hal-hal dan niat-niat yang buruk. Ibadah saya di usia tua tidak lain hanya untuk membersihkan diri dari kejahatan dan memantapkan diri untuk kebaikan,” tuturnya. (csf) Sebab dalam Alquran antara sembahyang dengan zakat, sembahyang dengan infaq selalu disebut berbaringan. Maka keduanya harus dilaksankan. Pelaksanaan ibadah Qurban adalah setelah shalat Id dan beberapa hari sesudahnya. Tidak sah memotong gurban di malam hari, dan daging qurban sangat diutamakan untuk konsumsi fakir miskin, tapi boleh jug sebagian kecil (sepertiga) untuk dirinya dan sepertiga lagi untuk tetangga. Daging qurban akan menjadi haram bila diperuntukkan kepad aorang kaya saja, sedangkan yang miskin tidak memperolehnya. Qurban itu besar sekali hikmahnya, antara lain, pelaksanaan telah melaksanakan sebuah ibadah sunat yang diisyaratkan Rasulullah, telah turut membantu fakir miskin yang hidup kekurangan, telah membantu para peternak di segi ekonomi, telah menabung pahala untuk hari akhirat, telah melepaskan dirinya dari sifat kikir dengan mengeluarkan sebagaian dari harta yang dimiliki. Bila ibadah dhahiyyah ini dapat dilaksanakan dengan niat ihklas dan sesuai dengan petunjuk, pahalanya sangat besar. di hari akhirat nanti binatang qurban itu akan menjadi kenderaan yang sangat pantas menuju surga.

WASPADA Selasa 18 Oktober 2011

Medan Metropolitan

Masjid Al Ikhlas Harus Dibangun Di Tempat Semula MEDAN ( Waspada): Ulama Drs H Fachrrurozy Pulungan, SEI, mengharapkan bila Masjid Al Ikhlas dibangun kembali harus sesuai dengan luas dan besarnya bangunan semula, di lokasi yang sama dan besar bangunannya seperti semula. Begitu pun, umat Islam masih menunggu putusan dari majelis hakim Pengadilan Tata Usaha Negara (PTUN) Medan karena kasus perubuhan masjid tersebut masih dalam proses di persidangan. “Secara pribadi, saya mengharapkan Masjid Al Ikhlas dibangun kembali di tempat semula. Kalau harus dibangun di tempat lain, namun lokasinya tidak

terlalu jauh dari lokasi masjid sebelumnya. Karena setiap harinya banyak jamaah yang melaksanakan shalat di masjid tersebut,” kata Ustadz Fachrrurozy Pulungan kepada Waspada, Senin (17/10) sore. Menurut Fachrrurozy, jamaah masjid masih menunggu putusan dari PTUN Medan untuk pembangunan kembali Masjid Al Ikhlas. Pembangunan kembali Masjid Al Ikhlas merupakan sesuatu yang sangat diharapkan oleh seluruh jamaah dan umat Islam umumnya. “Mari kita do’akan agar Masjid Al Ikhlas yang telah dirobohkan itu segera dibangun kembali di tempat semula,” sebutnya. Mengenai adanya oknum yang menerbitkan sertifikat di

atas lahan masjid tersebut dan menyalahgunakannya, dia meminta agar aparat penegak hukum untuk mengusutnya. Selain itu, tambah Fachrrurozy, jamaah Masjid Al Ikhlas cukup banyak sehingga pembangunan kembali masjid secara permanen dan besarnya seperti semula akan bisa menampung jamaah yang datang, terlebih lagi pada Shalat Jumat. Hal ini dibuktikan, jamaah Shalat Jumat selalu ramai meskipun pelaksanaannya di badan Jalan Timor, persis di areal bangunan lama. Begitu juga ulama lainnya yakni Ustadz Indra Suheiri bersikap sama. Masjid Al Ikhlas harus dibangun kembali, apalagi perubuhan masjid tersebut dinilai menyalahi peraturan dan

menyakiti perasaan umat Islam. “Masjid Al Ikhlas harus dibangun kembali ditempat yang sama dan tidak ada pilihan lain karena sesuai dengan tuntutan sejumlah ormas Islam dan jamaah masjid,” katanya. Menurut Suheiri, aliansi ormas Islam menyambut baik pemikiran dari Pangdam I/BB Mayjen Lodewijk F Paulus sebagai langkah konkrit untuk rencana pembangunan kembali Masjid Al Jihad. Sebagai tahap awal di lapangan, kata Suheiri, pihaknya akan melibatkan 35 ormas Islam Sumut yang tergabung dalam Aliansi Ormas Islam Sumut Pembela Masjid Al Ikhlas. Terkait tentang sertifikat yang dikeluarkan BPN tahun

Medan Terancam Tidak Dapat Adipura Kebersihan Pasar Tradisional Masih Buruk MEDAN (Waspada): Kota Medan terancam tidak mendapat Adipura. Pasalnya, kebersihan sejumlah pasar tradisional masih buruk. Seperti di kawasan Pasar Petisah yang masih ditemukan tumpukan sampah. Saat melakukan inspeksi mendadak (sidak), Senin (17/ 10),Wali Kota Medan Rahudman Harahap menemukan tumpukan sampah yang belum diangkut oleh petugas kebersihan. Seharusnya sampah tersebut sudah diangkut sebelum pukul 10:00. Tumpukan sampah ini terlihat di Tempat Penampungan Sementara (TPS) Pasar Petisah di Jln. Rotan. Selain tumpukan sampah, wali kota juga mendapati sejumlah gerobak sampah teronggok di tepi jalan tidak beraturan sehingga mengganggu arus lalu lintas. Menanggapi masalah ini, Wali Kota Medan Rahudman Harahap meminta seluruh

jajaran Satuan Kerja Perangkat Daerah (SKPD) terkait menjaga kebersihan lingkungannya agar Pemko Medan meraih Adipura pada tahun ini. “Saya minta kepada Kadis Kebersihan segera mengangkut sampah di TPS ini dan menata letak sejumlah gerobak agar tidak mengganggu lalu lintas,” tegas Rahudman. “Tahun ini, kita harus dapat Adipura. Makanya, sebelum saya bentuk tim kecil, terlebih dahulu saya turun ke lapangan. Ternyata masih banyak sampah dan batu-batu kecil dibiarkan di jalan, itu tentu menurunkan nilai. Pasar harus bersih, bobot nilai pasar itu 9. Pasar inilah kuncinya jika mau menda-

patkan Adipura. Kalau pasar tidak bersih, dipastikan tidak mendapat Adipura,” jelasnya. Dengan melakukan sidak, lanjut Rahudman, pihaknya dapat mempersiapkan segala sesuatu sehingga Adipura bisa menjadi milik masyarakat Kota Medan pada tahun ini. “Kita mau mempersembahkan Adipura untuk masyarakat,” tegasnya. Saat ditanya apakah Pemko Medan akan mengeluarkan anggaran khusus untuk meraih penghargaan Adipura, Rahudman mengatakan, semua SKPD sudah memiliki anggarannya masing-masing. “Jadi, tidak usah ditunggutunggu. Soal penataan taman di Pasar Petisah ini, Camat sudah bisa melakukannya. Kalau tidak ada cat, bisa diminta sama toko cat. Kalau cuma lima kaleng untuk keindahan, tidak mungkin mereka tidak memberikan. Asal jangan minta yang lain-lain,” tambahnya.

Rahudman juga meminta Dinas Pertamanan menata pohon-pohon yang ada di sekitar Pasar Petisah Medan. Dinas Bina Marga segera memperbaiki ruas jalan menuju pasar Petisah yang kondisinya sudah rusak. “Kita minta besok jalan yang berlobang ini sudah mulus. Ini sangat membahayakan pengendara. Kita lihat saja, kepala seksi perparkiran yang hingga sekarang masih koma, tidak sadarkan diri hanya karena terjatuh dari sepedamotor di jalan berlobang di Jln. Gajah Mada,” tegasnya. Rahudman menambahkan, peninjauan ini sebagai upaya menumbuhkan kepedulian semua instansi terkait, sehubungan dengan penilaian Adipura tahun ini. Karena itu, diharapkan semua SKPD dapat memahami lebih luas apa saja yang harus dipersiapkan sehingga harus ada kebersamaan untuk meraih Adipura.(m50)

Poldasu Periksa Kesehatan 78 Tahanan MEDAN (Waspada): Setelah kematian mendadak mantan Kepala Dinas Bina Marga Medan Gindo Maraganti Hasibuan di dalam sel Mapolda Sumut, petugas Bid. Dokkes (dokter dan kesehatan) Poldasu memeriksa kesehatan 78 tahanan yang berada dalam sel. Pemeriksaan itu, kata Kasubbid Pengelola Informasi dan Data (PID) Humas Poldasu AKBP MP Nainggolan, Senin (17/10), dimulai sejak pagi hingga sore hari. Namun dia tidak menjelaskan penyakit apa saja yang dialami para tahanan selama dalam sel, dan berapa jumlah tahanan yang dinyatakan sehat serta kurang sehat. Menurut Nainggolan, pemeriksaan kesehatan tahanan dilakukan secara rutin satu bulan sekali. “Setiap bulan dilakukan pemeriksaan secara rutin, bukan karena kematian Gindo Maraganti Hasibuan,” sebutnya membantah pemeriksaan kesehatan karena kematian mendadak Gindo di dalam sel. Kata Nainggolan, pemeriksaan kesehatan tahanan itu dila-

kukan Bid. Dokes, bukan urusan Direktorat Tahanan dan Barang Bukti. “Apa yang diperiksa Dokkes yang tahu,” ujarnya. Selain pemeriksaan kesehatan rutin, prosedur pemeriksaan tahanan yakni ketika tersangka dimasukkan ke dalam sel dan saat akan dikirim ke jaksa. “Kalau ada yang sakit langsung diberi pengobatan, dan jika sakitnya memerlukan opname, akan direkomendasikan untuk opname, tentunya bisa dibantarkan,” katanya. Harus bertanggungjawab Terkait kamatian Gindo, praktisi hukum Muslim Muis, SH kepada wartawan, Senin (17/10) mengatakan, perlu dipertanyakan dan diusut. Dia juga mengatakan, Kapoldasu orang paling bertanggungjawab atas kematian Gindo, karena ada unsur pembiaran terhadap anggotanya menahan tersangka yang menderita sakit. Polisi, sebutnya, memiliki kewenangan melakukan penahanan dan menolak pembantaran tersangka yang sakit. “Tetapi untuk menolak permohonan

itu harusnya polisi mengeceknya dengan memeriksa kesehatan tersangka kepada dokter kehakiman, dan harus ada hasil medis dari dokter kehakiman untuk memastikan penyakit tersangka,” sebut Muis. Tentang alasan penolakan juga perlu dipertanyakan, kenapa tersangka sakit serius tidak dibantarkan ataupun ditangguhkan penahanannya. “Sesuai pasal 31 KUHP disebutkan, tersangka berhak meminta untuk dibantarkan dan ditangguhkan penahanannya. Hal itu juga diatur dalam undang-undang,” katanya. Apakah pihak keluarga bisa mengambil langkah hukum, Wakil Direktur Lembaga Bantuan Hukum (LBH) Medan itu menyebutkan, tentu bisa. “Pihak keluarga bisa menggugat Kapoldasu,” sebutnya. Kabid Humas Poldasu KombesPol.HeruPrakosodikonfirmasi terpisah mengatakan, pihaknya siap digugat pihak keluarga. “Penahanan dilakukan sudah sesuai prosedur, itu demi kepentingan penyidik. Langkah hukum apa-

pun dilakukan keluarga, baik melalui gugatan ataupun tuntutan dugaan tindak pidana, Poldasu siap menghadapinya,” tutur dia. Mengenai hasil visum dari RSU Pirngadi Medan untuk mengetahui penyebab kematian Gindo, Heru mengatakan akan diketahui dua hingga tiga minggu ke depan. Gindo Maraganti Hasibuan, mantan Kadis Bina Marga Medan ditemukan petugas piket tahanan meninggal dunia di kamar mandi sel tahanan Poldasu dengan posisi telungkup pada Jumat (14/10) sekitar pukul 16:30. Gindo masuk ke kamar mandi pukul 15:35 untuk mengambil air wudhu shalat Ashar. Namun satu jam lamanya dia tidak keluar, dan ditemukan sudah tidak bernyawa lagi. Gindo ditahan terkait kasus dugaan korupsi proyek pengadaan alat berat di Dinas Bina Marga Medan yaitu, tiga unit backhoe loader, satu unit motor grader dan satu unit asphalt mixing plat bersumber dari APBD dan P-APBD Pemko Medan TA 2009. (m27)

2006 atas Hak Pakai tanah Hubdam di Jalan Timor, Suheiri menilai cacat hukum. Bahkan, oknum-oknum yang menyalahgunakan sertifikat tersebut harus diusut oleh aparat penegak hukum. “Oleh karena itu, semua pihak harus mentaati prosedur hukum yang berlaku dan tidak boleh adanya diskriminasi dalam penegakan hukum dan keadilan,” ujarnya. Disebutkan Suheiri, perubuhan Masjid Al Ikhlas pada 5 Mei 2011 itu, selain bertentangan kaidah hukum agama, seharusnya tidak terjadi, apalagi terus diprotes seluruh jamaah. Jamaah tetap melaksanakan Shalat Jumat di tengah jalan raya, persis di depan lokasi masjid yang telah rata dengan tanah. (h04)


ICMI Dukung Pangdam I/BB MEDAN (Waspada): Ketua Ikatan Cendikiawan Muslim Indonesia (ICMI) kota Medan Indra Sakti Harahap, ST. MSi memberikan apresiasi sekaligus mendukung Pangdam I/ Bukit Barisan Mayjen TNI Lodewijk Paulus yang akan membangun kembali Masjid Al Ikhlas di Jalan Timor Medan. Menurut Indra Sakti (foto) kepada wartawan, Senin (17/10), niat Pangdam I/BB yang akan membangun kembali Masjid Al Ikhlas di Jalan Timor Medan, harus didukung dan diberikan apresiasi. Kata dia, langkah tersebut merupakan wujud nyata kepedulian pemerintah khususnya TNI AD dalam menjaga kerukunan umat beragama sekaligus memelihara suasana kondusif di Sumut khususnya di Medan. “Saya menyatakan dukungan dan apresiasi yang besar kepada Pandam I/BB yang begitu besar kepeduliannya terhadap umat

Islam,” tutur Indra. Disebutkan Indra, pihaknya yakin langkah tersebut dilakukan panglima untuk tetap menjaga keutuhan bangsa dalam bingkai Bhineka Tunggal Ika, sehingga pembangunan kota Medan tetap dapat berjalan dengan nuansa persaudaraan yang tinggi antara sesama umat beragama. Sebelumnya Pangdam I/BB mengatakan, mempelajari kemungkinan untuk membangun kembali Masjid Al Ikhlas di Jalan Timor Medan yang pernah direlokasi ke Namorambe, Kabupaten Deliserdang. Hal itu disampaikan Pangdam I/BB Mayjen TNI Lodewijk Paulus saat meresmikan pembangunan Masjid ArRahman di Kompleks Kompi Bantuan Batalyon Zipur I/Dhira Dharma di Medan, Jumat (14/10). (m40)

Tim Pembangunan Griya PWI Aktifkan Posko MEDAN (Waspada): Terhitung Minggu (16/10), Tim Tanah dan Pelaksana Pembangunan Griya Persatuan Wartawan Indonesia (PWI) Cabang Sumatera Utara (Sumut) mengaktifkan Posko di atas lahan 14,4 hektare Dusun XVI Desa Sampali Kecamatan Percut Sei Tuan Kabupaten Deliserdang. Pengaktifan Posko dilakukan bersamaan pemancangan nama Jln. PWI yang sebelumnya Gang Tawon dilakukan Kepala Desa Sampali Ir. Sri Astuti didampingi Ketua Tim Tanah dan Pelaksana Pembangunan Griya PWI Sumut Abyadi Siregar;Wakil Ketua Tim Edward Thahir, S.Sos; Drs. Eddy Syahputra Sormin;Wakil Sekretaris Zul Anwar Ali Marbun dan Abdul Hakim Harahap. Turut hadir di lokasi, Kepala LKBN Antara Biro Medan Drs. Simon Pramono; Wakil Ketua Bidang Pembelaan Wartawan PWI Cabang Sumut Martohap Simarsoit, SH; Kepala Dusun XVI Sampali P Tanjung dan warga sekitar yang sedang melakukan gotong-royong pembersihan parit dan semak di sisi jalan. Menurut Ketua Tim Abyadi Siregar, pihaknya akan berjuang secara maksimal untuk mewujudkan berdirinya perumahan Anggota PWI Sumut di atas lahan seluas 14,4 hektare yang telah dirintis sejak 2001 ketika PWI Sumut dipimpin H.A. Muchyan AA, serta dilanjutkan Ketua PWI

Sumut masa bakti 2010-2015 Drs. Muhammad Syahrir. “Melalui komitmen sumbangan dana Rp100 juta yang diberikan Bapak H.M. Fauzi Lubis selaku anggota PWI Sumut yang juga Pemimpin Umum/Pemimpin Redaksi Harian Mimbar Umum pada acara sambung rasa PWI Sumut dengan para Pemimpin Redaksi, anggota DPRD Sumut dan stakeholder di Exchange Club Gedung Uniland Medan, Sabtu (15/10), menjadi langkah awal yang sangat berharga,” ujar Abyadi. Dia berharap, dukungan dana tersebut menjadi spirit dan motivasi bagi anggota PWI Sumut lainnya yang memiliki kavling di atas lahan untuk terpanggil dalam upaya merealisasikan percepatan pembangunan perumahan PWI Sumut di Dusun XVI Desa Sampali. Dijelaskan Abyadi, mandat yang diterima dari para pemilik lahan sesuai kesepakatan rapat pada 8 Oktober 2011, disusul penyerahan Surat Keputusan (SK) PWI Cabang Sumut No.26/SK/ PWI-SU/X/2011 tertanggal 11 Oktober 2011, merupakan amanah yang sangat berat. ”Namun, dengan kebersamaan dan kekompakan seluruh pemilik kavling, insya Allah cita-cita kita bersama akan terwujud,” ujarnya. Susunan personel Tim Tanah dan Pelaksana Pembangunan Griya PWI Sumut sesuai SK

PWI Cabang Sumut No.26/SK/ PWI-SU/X/2011 tertanggal 11 Oktober 2011 terdiri dari Ketua Abyadi Siregar, Wakil Ketua Edward Thahir, S.Sos dan Drs. Eddy Syahputra Sor min, Sekretaris Tohap P Simamora dengan Wakil Zul Anwar Ali Marbun dan Abdul Hakim Harahap, Bendahara Nurhasanah, S.Sos dengan Wakil Ristiawati dan Drs. Ahmad Ali. Sembari membenahi kelengkapan administrasi, kata

Abyadi, Tim Tanah dan Pelaksana Pembangunan Griya PWI Sumut dalam waktu dekat akan mengundang 241 pemilik kavling untuk membahas secara lebih mendalam terkait perangkat peraturan sistem arisan rumah tumbuh, besaran biaya, sistem pengamanan lahan dan pembentukan koordinator blok. “Mudah-mudahan segala sesuatunya dapat berjalan lancar,” pungkasnya. (m08)


KEPALA Desa Sampali Ir. Sri Astuti memancangkan nama Jln. PWI sebelumnya Gang Tawon bersamaan pemancangan nama jalan di sekitarnya secara permanen.

Medan Metropolitan


WASPADA Selasa 18 Oktober 2011

Komitmen Pemerintah Lindungi Produk Lokal Lemah Tidak Pro Rakyat, Menteri Perdagangan Harus Diganti MEDAN (Waspada): Kalangan DPRDSU menilai, komitmen pemerintah untuk melindungi pengusaha dan produk lokal sangat lemah. Buktinya, barang-barang dari luar negeri sangat bebas masuk ke daerah ini, baik secara resmi maupun ilegal. Sementara, DPW Lumbung Informasi Rakyat (Lira) Sumut menegaskan, Menteri Perdagangan Marie Pangestu harus dikeluarkan dari Kabinet Indonesia Bersatu Jilid II. Pasalnya, sejumlah regulasi (kebijakan) yang dikeluarkan Marie selama ini, terlihat tidak pro terhadap pemberdayaan ekonomi kerakyatan. Berbicara kepada Waspada di gedung dewan, Senin (17/10), anggota Komisi C DPRDSU Muslim Simbolon mengaku sangat khawatir dengan banyaknya produk impor masuk ke Sumut, terutama Medan. Sampaisampai barang bekas pun diimpor, sehingga menjadikan Sumut ibarat tong sampah raksasa. Bendahara Fraksi Partai Amanat Nasional (FPAN) ini menilai, Pemprovsu sepertinya belum menjalankan fungsi untuk melindungi pengusaha dan hasil produksi lokal. Buktinya, di pasaran sangat ‘banjir’ produk impor masuk seperti produk makanan/minuman, obat-obatan, buah-buahan, garmen dan furniture. ‘’Bahkan barang bekaspun ada masuk,’’ kata Muslim. Kondisi seperti ini, menurut Muslim, tidak boleh dibiarkan pemerintah. Harusnya, pemerintah melalui dinas terkait sudah mendengarkan keluhan

petani dan pengusaha kecil tentang produk impor ini. ‘’Bohong, kalau pemerintah tidak tahu keluhan masyarakat. Karena secara kasat mata, barang impor sudah menggeser produk lokal di pasaran,’’ katanya. Menurut Muslim, sudah selayaknya Pemprovsu mengeluarkan peraturan tentang jenis produk impor yang diperbolehkan masuk ke daerah ini. Disamping itu, aparat penegak hukum harus meningkatkan pengawasannya terhadap produk impor ilegal. “Kita akui bahwa saat ini eranya pasar bebas. Namun, bukan berarti pemerintah membiarkan saja seluruh produk asing masuk. Pemerintah juga berkewajiban memproteksi agar produksi lokal juga dapat hidup. Karena itu, harus ada peraturan yang menyebutkan produk apa saja yang boleh masuk ke Sumut. Tentunya komoditas yang tidak ada atau diproduksi terbatas di sini,” tambahnya. Melihat volume dan jenis produk impor di pasaran, Muslim curiga terhadap kinerja instansi terkait selama ini yang menyatakan sudah melakukan pengawasan dengan baik. Sebab, produk-produk ilegal tampak dijual bebas di pasaran. Di sejumlah supermarket

UDA Wisuda 718 Sarjana Dan Pascasarjana MEDAN (Waspada): Universitas Darma Agung (UDA) mewisuda 718 lulusan periode 2011-2012, di Hermina Hall, Sabtu (15/ 10). Dari jumlah itu, 672 Sarjana Strata 1 dan Ahli Madya, serta 48 Pascasarjana. “12 sarjana di antaranya lulusan terbaik atau memperoleh prestasi yang baik,” kata Rektor UDA Prof Binsar Panjaitan, dihadapan para wisudawan. Dalam acara itu, hadir Plt Gubsu Gatot Pudjo Nugroho diwakili Kepala Dinas Pendidikan Sumut Syaiful Syafrii, Koordinator Kopertis Wilayah I Sumut-NAD Muhammad Nawawiy Lubis, Ketua UmumYayasan Pendidikan Dharma Agung/ Institut Sain Teknologi TD Pardede/Akademi Pariwisata dan Perhotelan Dharma Agung Sariaty PR Siregar. Rektor UDA Binsar Panjaitan menyatakan, lulusan UDA telah berhasil berkpirah diberbagai profesi dan institusi pemerintahan, maupun swasta. Mulai dari menduduki jabatan posisi wali kota, bupati, anggota DPRD, hingga kepala satuan kerja perangkat daerah (SKPD). “Sampai dengan hari ini UDA telah menghasilkan lulusan sebanyak 32.522 orang yang tersebar di Sumut, seluruh nusantara bahkan luar negeri. Selain itu, hubungan UDA dengan alumni juga tetap terjaga dengan baik. Hal ini dibuktikan dengan masih intensnya komunikasi dan silahturahmi dalam setiap kegiatan UDA,’ sebut Panjaitan. Panjaitan menambahkan, UDA melalui rapat senat akademik telah sepakat menetapkan visi bermutu, mandiri dan berkarakter. Artinya, selain berorientasi pada mutu yang membentuk kemandirian juga harus menjadi lulusan yang berkarakter. Sementara KetuaYayasan UDA Sariaty PR Siregar menyebutkan, prosesi wisuda kali ini berbeda dengan sebelumnya. Sebab, pada wisuda ini bertepatan dengan perayaan Dies Natalis UDA ke 52. “Saya ucapkan selamat kepada UDA, semoga UDA makin jaya dalam mencerdaskan kehidupan bangsa,” katanya. Sementara Kepala Dinas Pendidikan Sumut Syaiful Syafrii menuturkan, pengalaman ilmu yang telah didapat selama bangku perkuliahan hendaknya dimanfaatkan dalam dunia sehari-hari dan dunia kerja. (m49)

Besok Pemadaman Listrik Wilayah Medan Kota MEDAN (Waspada): Sejalan upaya PLN Cabang Medan untuk mempertahankan dan meningkatkan mutu serta keandalan pasokan listrik ke pelanggan, maka akan dilaksanakan Pemeliharaan Jamperan SUTM & Perampalan Pohon (Gerakan Bersih Penyulang). Selama berlangsungnya pekerjaan pemeliharaan tersebut, akan dilakukan Pemutusan Aliran Listrik (Pemadaman) untuk sementara waktu di wilayah kerja PT PLN (Persero) Rayon Medan Kota, pada Rabu (19/10) besok mulai pukul 08:30-16:00WIB. Daerah yang mengalami pemadaman yaitu, Jln Juanda – Samanhudi – Mongonsidi – Polonia – Starban – Suwondo – Hotel Pardede – Haji Misbah – Masdulhak – Dr Cipto – Wali Kota sebahagian – Multatuli sebahagian – Sekolah SMP / SMA Angkasa. Berkenaandenganpemadamanaliranlistriktersebut,PLNCabang Medan menyampaikan permintaan maaf kepada seluruh pelanggan. “Kami mengupayakan semaksimal mungkin agar pekerjaan pemeliharaan dapat diselesaikan dalam waktu yang sesingkatnya, sehingga pasokan aliran listrik secepatnya dapat dipulihkan kembali,” ujar Humas PLN Cabang Medan Ade Budhi F. (m41)

dan swalayan, kata Muslim, beredar produk impor ilegal. Indikasinya terlihat dari tidak adanya registrasi dari pemerintah Indonesia. Apakah registrasi dari Departeman Perindustrian dan Perdagangan maupun dari Departemen Kesehatan. Komitmen dari tiga instansi (Bea Cukai, Disperindag, Kepolisian), menurut Muslim, harus kuat guna melindungi produk lokal. Koordinasi tiga instansi ini harus baik guna mencegah masuknya barang impor ilegal. Tidak Pro Rakyat Di tempat terpisah, DPW Lira Sumut menegaskan, Menteri Perdagangan Marie Pengestu harus diganti karena sejumlah kebijakan yang dikeluarkannya tidak berpihak kepada pemberdayaan ekonomi kerakyatan. Marie membuka seluas-luasnya impor sejumlah bahan-bahan pokok yang sebetulnya masih bisa diatasi dengan peningkatan

produktifitas produk lokal. “Bahkan, Marie Pangestu tidak mampu bersinergi dengan kementerian terkait seperti pertanian dan pariwisata,” tegas Sekjen DPW Lira Sumut Oscar Siagian, SKM di dampingi Gubernur Lira Sumut H.Rizaldi Mavi, MBA; Wakil Gubernur Rizal Sihombing, SH; Wakil Sekretaris Ir. Togi Siagian; Bendahara Ir. M. Saleh Pane; Direktur Lembaga Hukum CP Siregar, SH dan badan intelijen Darwin Sinaga. Menurut Siagian, reshuffle kabinet pemerintahan Presiden SBY sangat penting dan mendesak dilakukan. Sesuai pengamatan Lira, banyak kinerja para menteri tidak memuaskan. Hal itu terlihat dari target yang menjadi ukuran keberhasilan, ternyata tidak mampu dipenuhi. Selain Menteri Perdagangan, Lira juga menyoroti kinerja Menteri Pemberdayaan Apara-

tur Negara (Menpan) yang tidak mampu melakukan reformasi birokrasi sehingga persoalan korupsi makin menggurita di sejumlah instansi. Kemudian, kinerja Menteri Pertanian Ir. Suswono yang kurang memuaskan dalam memberdayakan petani untuk meningkatkan daya saing. Menteri Perhubungan Freddy Numberi tidak mampu mengantisipasi tragedi kecelakaan transportasi. Dengan momentum reshuffle ini, kata Siagian, perlu dibuat target kualitatif dan kuantitatif terhadap seluruh menteri sebagai indikator keberhasilan. Dengan demikian, masa tiga tahun kepemimpinan SBY, semakin dirasakan oleh masyarakat. “Jika tidak, maka masyarakat akan dirugikan dan bukan tidak mungkin akan menjadi apatis bahkan akan melakukan pembangkangan sosial,” demikian Siagian.(m12/m24)

Ratusan Guru Agama Demo Tuntut Tunjangan Sertifikasi MEDAN (Waspada): Ratusan guru agama yang tergabung dalam Forum Komunikasi Guru Sumut (FKGS) nelakukan unjuk rasa sambil berorasi di depan Kantor Wilayah Departemen Agama Sumut Jalan Gatot Subroto Medan, Senin (17/10). Dalam orasinya guru agama yang bertugas di sekolah umum itu, menuntut agar Kakanwil Depag Sumut segera mengeluarkan dana sertifikasi guru yang belum mereka dapatkan dari Juli hingga Desember 2010 dan Januari hingga Juni 2011. Marudut Siringo-ringo dan Pangihutan Siregar, koordinasi aksi,mengatakan,sertifikasiuntuk satu orang dalam setiap semesternyaRp15juta,jadiperorangnya mendapatkan Rp30 juta. Kepala Kantor Kementerian Agama Wilayah Sumut Syariful Mahya Bandar, MAP mengata-

kan, uang tersebut belum ada diterima di Kanwil Sumut dan kalau pun dana tersebut telah dikeluarkan pusat maka yang memegang dana tersebut adalah Departemen Keuangan. “Yang mengatakan uangnya sudah di Kanwil maka kami adalah orang dzholim, karena uang itubelumditerimadaripusat,dan kalau pun uang tersebut dikeluarkan maka uang berada di KPPN,” kata Syariful didampingi Kabid Mapenda Drs Yulizar Lubis. Menurutnya, syarat untuk menerima tunjangan sertifikasi itu, harusnya guru tersebut memiliki Nomor Regestrasi Guru (NRG), sesuai dengan Keputusan Menteri Agama No 73 tahun 2011 dan seharusnya penjelasan ituadadiKemenagMedan.”Pihak Kemenag Kota Medan juga tidak bisa melanggar aturan Dirjen masalah aturan NRG bagi yang

tidak keluar NRGnya dan yang mengeluarkannya Diknas. Maka kalau tidak keluar NRG, Kanwil tidak berani mendorong untuk mengeluarkan dana tersebut karena bisa menyalahi aturan pemerintah yang nantinya bisaditudingkorupsi,”ujarSyaiful. Sebelumnya, Ketua Asosiasi Guru Agama Islam Sumatera Utara(AGPAI)AliNurdinbersama Sekretaris Drs Romen Purba meminta pemerintah agar segera memenuhi hak guru agama ini. Selama ini, kata Nurdin, yang lancar programnya hanya pelaksanaan diklatnya saja.Tetapi saat pembayaran hak para guru bisa tertunda hingga lama sekali. “Kenapapemerintahtidakmerespon, kalau alasan NRG itu, seharusnya diselesaikan juga dengan cepat, sejak Juli dan Desember 2010bahkan2011sudahakanberakhir,” sebutnya. (m37)

LAPK: Hentikan Sementara Operasi P2TL MEDAN (Waspada): Operasi Penertiban Pemakaian Tenaga Listrik (P2TL) dinilai mengandung cacat hukum dan bertentangan dengan norma yang berlaku sehingga perlu dilakukan moratorium terhadap operasi tersebut. Operasi tersebut harus dihentikan untuk sementara waktu sembil membenahi semua permasalahan dari hulu sampai hilir terkait P2TL tersebut. “Begitu banyak masalah yang membelit operasi P2TL selama ini dan kalau dilanjutkan berpotensi memunculkan letupan sosial,” kata Direktur Lembaga Advokasi dan Perlindungan Konsumen (LAPK) Farid Wajdi kepadaWaspada, Minggu (16/10). Polemik pelaksanaan P2TL yang dilaksankan petugas PT PLN Sumatera Utara kian hari terus meruncing dan wacana pembubaran tim P2TL bahkan bergema dari gedung DPRD Sumatera Utara. Resistensi program P2TL memang patut terjadi karena begitu banyak masalah yang membelit ‘tim pemburu pencuri arus listrik’ ini. Dekan Fakultas Hukum UMSU ini mengatakan, pada intinya pelanggan merasa proses penertiban kurang manusiawi, banyak melanggar hukum dan menyalahi prosedur tetap seperti diatur UU No. 30 Tahun 2009 tentang Ketenagalistrikan, serta petunjuk teknis dan PP yang dikeluarkan Kementerian ESDM dan Ditjen LPE, SK Direksi Nomor 234/Dir/2008 yang dikukuhkan Dirjen LPE sebagai

regulator, melalui Keputusan Dirjen LPE Nomor 318-12/20/ 600.I/2008. Masalah yang muncul ke permukaan terkait dengan P2TL yaitu soal pelanggaran asas praduga tidak bersalah yang dianut dalam sistem hukum Indonesia. “Betapa tidak, tanpa proses hukum pelanggan langsung divonis sebagai terdakwa ‘pencuri’ dan dapat pula didenda sekehendak hati petugas? Seorang terdakwa teroris sekalipun berhak atas pendampingan hukum mulai dari kepolisian, kejaksaan, sampai di depan pengadilan,” ujarnya. Lalu, apakah saat memutus sambungan atau mencopot meteran, petugas P2TL ada didampingi pihak kepolisian dan apakah juga disaksikan Penyidik Pegawai Negeri Sipil (PPNS) dari Metrologi Legal. Kalau tidak maka petugas P2TL telah melakukan tindak pidana sebab mereka bukan penyidik, tapi telah berani melakukan tugas yang seharusnya dilakukan penyidik? Masalahnya kalau merupakan tindak pidana, mengapa tidak ada proses hukum sampai ke pengadilan? Atau, justru memutus sambungan listrik, tetapi malah melibatkan oknum petugas negara non-penyidik kepolisian-PPNS, misalnya pelibatan polisi militer atau oknumTNI? Termasuk pula soal penyitaan meteran milik pelanggan. Apakah memang ada izin pengadilan. Lalu, bagaimana pula proses dan mekanisme uji forensik pembuktian atas tuduhan pencurian, yang dilakukan

secarasepihakolehpetugasP2TL? Apalagi permasalahan masyarakat saat ini, pehamaman masyarakat mengenai P2TL masih minim karena kurangnya sosialisasi. Misalnya menyangkut kerusakan segel pengaman meteran. Bagaimana mungkin segel pengaman divonis sengaja dirusak atau dikloning pelanggan, padahal memang segel telah ausataudaluarsadimakanwaktu. Pada kesempatan itu, Farid mengatakan, atas dasar monitoring dan evaluasi sederhana diperlukan pembenahan yang signifikan baik pada tataran konsep, regulasi, maupun implementasi di lapangan. Tak kalah penting perlu adanya sosialiasi menyeluruh agar masyarakat tidak mencuri dan mengerti haknya sebagai konsumen. Sampai kini tidak ada sosisalisasi memadai bagi masyarakat terkait standar operasional prosedur dalam melaksanakan P2TL. Selain itu, katanya, tidak ada mekanisme hak menyatakan keberatan terhadap operasi P2TL bagi terduga pelanggar. Tindakan‘main tebas’ memutus sambungan atau mencopot meteran tanpa melihat kasus per kasus jelas tidak adil. “Bagaimana mungkin operasi P2TL dilaksanakan secara fair kalau operasi itu mengandung cacat hukumdanbertentangandengan norma berlaku. Jalan terbaik cuma melakukan penghentian sementara operasi P2TL, sambil membenahi semua hal dari hulu sampai ke hilir terkait dengan P2TL dimaksud,” ujarnya. (m41)


PEMBINA Yayasan Imelda dr Rosa Dalima Ritonga diabadikan bersama para alumni Akper Imelda ketika akan diberangkatkan ke Jekarta untuk mengikuti pelatihan bahasa Jepang.

Yayasan Imelda Lepas 16 Alumni Akper ke Jepang MEDAN (Waspada): Sebanyak 16 perawat alumni Akademi Perawat (Akper) Imelda dinyatakan lulus seleksi dan akan bekerja di Jepang. Ke-16 orang alumni tersebut terdiri dari delapan tenaga kerja kangosi (perawat) dan delapan untuk careworkers (perawat jompo). KetuaYayasan Imelda dr. H. RI Ritonga MSc, didampingi Pembina dr. Rosa Dalima Ritonga, Direktur Pelaksana RSU Imelda Pekerja Indonesia dr Imelda Liana Ritonga, SKp, MPd, MN mengatakan, sangat bangga atas keberhasilan para alumninya dalam ujian yang diselenggarakan oleh BNP2TKI di Jakarta. “Para alumni Akper Imelda itu berhasil masuk di antara 200 perawat yang terbaik di Indonesia. Ini suatu prestasi yang sangat kita syukuri,” ujar Ritonga. Saat ini ke-16 alumni Akper Imelda tersebut sedang mengikuti pelatihan bahasa Jepang di Jakarta. Selama pelatihan, peserta akan bergabung dengan alumni Akper-Akper lain se Indonesia. “Selama masa pelatihan tersebut, para peserta sudah mendapat uang saku sebesar AS$10 per hari dan kebutuhan akomodasi (ma-

kan dan pondokan) juga ditanggung. Fasilitas yang mereka dapatkan ini sudah sangat layak,” katanya. Menurut Ritonga, keberhasilan itu tidak terlepas dari dukungan BP3TKI Medan. “Ini adalah keberhasilan kita semua terutama kami sangat berterima kasih atas dukungan dan perhatian Bapak Drs Harris Nainggolan, MM selaku Kepala BP3TKI Medan beserta seluruh jajarannya,” tutur Ritonga. Sementara itu, dr Rosa Dalima Ritonga menjelaskan pada awal 2012 akan ada seleksi perawat untuk penempatan ke Jepang. “Kepada para alumni Akper Imelda maupun perawatperawat alumni Akper lain yang berminat silakan mendaftar ke Yayasan Imelda untuk mengikuti seleksi awal tahun nanti atau silahkan menghubungi ke 0811635719 (dr Rosa Dalima),” katanya. Menurut dr Rosa Dalima, selama bekerja sebagai perawat di Jepang, para perawat (kangosi) akan menerima gaji sebesar Rp18 juta per bulan dan untuk careworkers sekira Rp15 juta per bulan.(m25)

Terkait Gagal Berangkatkan 120 Calhaj

PT AWK Akan Dikonfrontir Dengan Kementerian Agama MEDAN (Waspada): Terkait pengaduan 120 jamaah calon haji (calhaj) yang gagal berangkat ke Tanah Suci Mekkah, pada 11 November 2010 silam, pemilik usaha PT Azizi Wisata Kencana (AWK) Nazlah Lubis akan dikonfrontir dengan saksi ahli dari Kementerian Agama. Nazlah diperiksa kembali oleh penyidik Polsek Medan Timur, kemarin. “Dalam waktu dekat, penyidik akan memintai keterangan saksi ahli dari Kementerian Agama sekaligus mengkonfrontir pihak biro perjalanan haji dengan pihak Kementerian Agama. Selanjutnya, akan dilakukan gelar perkaranya di Mapolsekta Medan Timur,” ujar Kapolsek Medan Timur Kompol Patar Silalahi, Senin (16/10). Ketika diperiksa, Nazlah Lubis yang masih berstatus sebagai saksi tersebut mengaku belum menyetorkan uang dari jamaah calon haji ke Departemen Agama. “Kita memeriksa Nazla sebagai saksi dan belum sebagai tersangka. Dari keterangannya, Nazla tidak menyetorkan uang jamaah calon haji ke Departeman Agama sehingga gagal berangkat ke tanah suci,” kata

Patar. Patar menjelaskan, pihaknya masih terus melakukan penyelidikan. Dua minggu kedepan akan lakukan konfrontir terhadap Nazla dengan Kementerian Agama. Dalam kasus itu, Nazla berjanji akan mengembalikan uang para jamaah calon haji dan terus berupaya memberangkatkan mereka pada tahun ini, namun hingga proses hukum berlangsung, pemilik PT Azizi Kencana Wisata tak kunjung memberangkatkan jamaah calon haji yang menggunakan jasanya. Diberitakan sebelumnya, para jamaah calon haji tak jadi berangkat ke tanah suci dikarenakan oleh pihak PT Azizi Kencana Wisata menelantarkannya di Hotel Sri Deli, Medan. Sebanyak 120 calon haji non reguler yang menggunakan fasilitas (ONH) plus ditipu oleh PT Azizi Kencana Wisata Jalan Sutomo Medan, yang hendak memberangkatkan mereka. Para jamaah calon haji telah menyetorkan dana tidak kurang dari Rp65 juta per orang, agar bisa menunaikan ibadah haji ke Mekkah, namun hingga saat ini belum terlaksana. (h04)

Sidang Lanjutan Korupsi Master Plan

Hakim Ancam Pidanakan Saksi Mantan Ketua Panitia Proyek MEDAN (Waspada) : Sidang lanjutan perkara dugaan penyelewengan dana proyek pembuatan Master Plan Kota Medan 2016, yang mengakibatkankerugiannegarahinggaRp1.526.062.238 kembali digelar di Pengadilan Tindak Pidana Korupsi (Tipikor) yang bersidang di Pengadilan Negeri (PN) Medan, Senin (17/10). Pada persidangan dengan terdakwa mantan Kepala Bappeda Ir Hermes Joni, tim JPU dari Kejatisu diketuai Rehulina Purba SH, menghadirkan sejumlah saksi, di antaranya, Edi Dharma Tarigan, mantan Ketua Panitia Pengadaan Barang dan Jasa pada Proyek Master Plan Kota Medan 2016, untuk didengarkan kesaksiannya. Edi Dharma dalam kesaksiannya dihadapan majelis hakim diketuai Jonny Sitohang SH, mengaku banyak tidak tau terkait pekerjaan penyusunan Master Plan yang bersumber dari APBD tahun 2006 senilai Rp4,76 miliar tersebut. Hal itu terungkap ketika majelis hakim maupun jaksa bertanya kepada Edi Dharma, dan hanya dijawabnya dengan perkataan tidak ingat dan lupa. Dihadapan persidangan, Dharma mengaku hanya mengikuti 3 kali rapat yang digelar panitia dan seluruh laporan BAP yang dibuat merupakan hasil dari laporan anggota panitia lainnya. “Saya hanya mengikuti 3 kali rapat dan laporan yang ada di BAP merupakan

hasil laporan anggota panitia lainnya,” sebut Dharma yang terkesan berbelit-belit. Mendengar keterangan itu, majelis hakim sempat berang dan mengancam akan mempidanakan Edi Dharma jika memberikan kesaksian palsu atau menutup-nutupi kebenaran. “Saudara saksi, anda cukup menjawab apa yang ditanya. Apabila anda memberi keterangan yang berbelit-belit, maka anda dapat diancam memberi kesaksian palsu dan dapat dipidana dan diancam tujuh tahun penjara,” kata majelis hakim. Anehnya, Dharma selaku ketua panitia mengaku tidak menguasai tugas pokok dan fungsinya (tupoksi) dalam pengadaan barang dan jasa Master Plan Kota Medan 2016. “Saya lupa, saya tidak ingat pak hakim. Saya tidak menguasai soal pengerjaan Master Plan. Yang lebih menguasainya adalah Husni selaku sekretaris,” ujarnya menjawab pertanyaan majelis hakim seraya mengaku tidak aktif dalam kepanitian. Pada persidangan ketiga itu, tak hanya majelis hakim yang terlihat emosi. Jaksa dan kuasa hukum terdakwa sempat tegang-tegangan. Pasalnya, jaksa dan kuasa hukum terdakwa terlihat memperdebatkan jawaban yang dilontarkan saksi. Akhirnya, majelis hakim juga menegur kedua belah pihak karena dianggap tidak sopan dan tidak menghargai persidangan. (m38)

Haji 1432 H A6 PPIH Harus Selektif Terhadap Jamaah Sakit MEDAN (Waspada): Ketua Majelis Ulama Indonesia (MUI) Medan mengingatkan panitia keberangkatan haji lebih selektif memberangkatkan jamaah calon haji yang sakit, apalagi tidak di dampingi keluarga. “Bukan melarang beribadah haji, tetapi kalau calon jamaah haji yang sakit tidak di dampingi keluarga, tentu akan merepotkan saat mereka melaksanakan rangkaian ibadah di tanah suci,” kata Ketua MUI Medan, Prof. HM Hatta kepada Waspada saat melepas 452 jamaah Kloter 14 asal Medan bersama Ketua PPIH Medan H Syariful Mahya

Bandar di Embarkasi Medan, Senin (17/10). Hatta menyebutkan, jamaah asal Sumut pada musim haji 2011 ini 60 persen di antaranya beresiko tinggi (Risti). Mereka mengindap berbagai penyakit, terutama jamaah berusia lanjut. Dalam Kloter 14 ada dua Calhaj harus cuci darah dua kali seminggu. “Kami berharap semuanya

dapat menjalankan ibadah dengan baik, dan pulang kembali ke tanah air dalam keadaan sehat,” kata Hatta menyebutkan, selama di tanah suci para jamaah mendapat pengawasan tim kesehatan haji Indonesia. Bagi jamaah yang harus cuci darah, tidak bayar atau gratis. Namun petugas kesehatan haji di Klinik Asrama Haji Medan, dr Indah Maya Sari yang ikut memantau jamaah ke Bandara Polonia menyatakan, dibandingkan jamaah Kloter lain yang sudah berangkat ke tanah suci, jamaah Kloter 14 sedikit yang mengalami masalah kesehatan. “Hanya 10

Waspada/Abdullah Dadeh

PETUGAS haji Medan membopong Rusni binti Abd. Latief Marpaung saat akan naik ke pesawat haji Pullmantur Air yang di cater Garuda Indonesia, Senin.

persen jamaah yang mengalami gangguan kesehatan atau risti, itu juga karena gangguan tekanan darah tinggi,” kata dia. Sementara Rusni binti Abd. Latief Marpaung, 37, asal Kloter 10 Tanjungbalai sudah dinyatakan dapat berangkat ke tanah suci, meski dia harus di bopong saat naik ke pesawat haji Pullmantur Air oleh beberapa petugas. Warga Tanjungbalai itu sempat dirawat di RS Haji Medan akibat tekanan darah (HB) nya turun. “Nanti saat mendarat di Jeddah sudah ada tim dokter yang membantu merawatnya,” kata Syariful Mahya Bandar, berharap Rusni dalam keadaan sehat hingga kembali ke tanah air. (m32/m37/m50/cfs)

WASPADA Selasa 18 Oktober 2011

Waspada/Surya Efendi

DIOBSERVASI: Dokter Aryanti melakukan pemeriksaan terhadap 3 jamaah calon haji Kloter 14 di ruang observasi Asrama Haji Medan, Minggu (16/10). Tiga jamaah calon haji ini mengalami tensi darah yang tinggi hingga lebih dari 200 derejat celcius. Namun tidak sampai menggagalkan jamaah tersebut menunaikan ibadah haji.

Penglepasan Jamaah Almukaromah

Siap Mengemban Amanah

MEDAN (Waspada): Penglepasan 140 jamaah KBIH Almukaromah berlangsung haru di antara keluarga jamaah calon haji yang akan berangkat haji pada kloter 14, Sabtu (15/10). Sangkot Saragih, pengurus KBIH Almukaromah mengatakan, jamaah calon haji yang akan berangkat ke tanah suci dalam keadaan sehat, bahkan jamaah tertua terlihat bersemangat dan segar menjelang keberangkatan. Kata dia, suasana penglepasan sangat mengharu-biru karena banyak keluarga memadati jalan dan gedung KBIH. “Para keluarga masih enggan berpisah dan melepas keberangkatan keluarganya, tapi dengan arahan dan imbauan bahwa ikhlas dan tulus melepas keberangkatan menunaikan haji adalah keberkahan bagi keluarga, maka suasana menjadi kebahagiaan,” kata dia. Semua jamaah berkumpul di KBIH Almuakaromah di Jln. Prajurit sejak pukul 07:00, dan menaiki bus pada pukul 08:00 diselingi adzan yang dikumandangkan panitia. Sangkot mengatakan, setiap hari Minggu pukul 09:00 para keluarga jamaah dapat mengikuti pengajian di KBIH untuk mendoakan keselamatan dan kesehatan keluarga yang berada di tanah suci. “Pengajian diisi ceramah bagaimana etika dan adab keluarga ketika di tinggal salah satu keluarga yang menunaikan haji, bagaimana harus menjaga sikap dan sopan santun kepada tetangga dan lingkungan. Juga menyampaikan doa-doa untuk keluarga agar lancar menunaikan haji,” kata dia.(csf)

MENJADI petugas haji membuat H Abdul Haris (foto) merasa bahagia. Hal ini dikatakannya, Senin (17/10), saat mendampingi jamaah Kloter 15 yang akan berangkat Selasa (18/10) hari ini. Kata dia, jamaah dalam Kloter (kelompok terbang) berasal dari berbagai daerah, sehingga dia harus pandaipandai berkomunikasi untuk menerima aspirasi terhadap persoalan yang mungkin muncul saat berada di tanah suci. “Insayallah saya akan berusaha memberikan yang terbaik sesuai amanah yang diberikan kepada saya. Apalagi dalam kloter sudah ada kepala regu dan kepala rombongan. Sebagai tim pemandu haji (TPHI), saya akan bekerja sesuai kemampuan saya,” kata Haris yang menjabat Ka.KUA Medan Denai itu. Calhaj yang bergabung di Kloter 15 ini di antaranya berasal dari Padang Lawas Utara (Paluta), sedangkan Haris mempunyai latar belakang dari daerah yang tidak jauh dari kawasan itu.

Dengan begitu dia dapat memahami karakter masyarakat Paluta, sebanyak 290 orang. Demikian juga daerah lainnya, yakni Karo sebanyak 25 orang dan Medan 135 orang.“Sebagai petugas tentu saja saya berharap mampu menjalankan tugas dengan baik,” ucapnya. Sebelumnya pada 2009 Abdul Haris sudah melaksanakan ibadah haji bersama isterinya. Hal ini kata dia, salah satu kemudahan baginya untuk mengerti tentang perjalanan ibadah haji, meskipun secara geografis wilayah Makkah maupun Madinah mungkin mengalami perubahan. “Namun dengan pengalaman yang lalu, mudah-mudahan saya bisa menjalankan tugas dengan baik. Saya berharap perjalanan kedua sebagai petugas haji, semakin mengantarkan saya menjadi sosok yang lebih dekat kepada Allah dan selalu mensyukuri nikmat yang diberi Allah. Sebab, sayapun tak menyangka bisa terpilih sebagai petugas haji di tahun ini,” kata dia. (m37)

Nama-nama Jamaah Calon Haji Kloter 17 Asal Kabupaten Asahan, Medan Dan Perorangan Masuk Asrama Haji Rabu (19/10), Berangkat Kamis (20/10) Melalui Bandara Polonia Embarkasi Medan 01 Imran Muhammad Tahir Bin Muhammad Tahir 02 Zainal Arifin Zakaria Bin Zakaria Jahja 03 Sudartik Suparmin Ahmad Binti Suparmin 04 Ahmad Syafii Manurung Bin Nuryaman Manurung 05 Junita Lestari Sanjaya Binti Pairun Sanjaya 06 Pansuri Jasoritua Ritonga Bin H Hasan Ritonga 07 Ubaedah Muhammad Darsim Binti M Darsim 08 Mahmuddin Nurdin Sipahutar Bin Nurdin 09 Arlinawati Idham Sitorus Binti Idham 10 Nurhasanah Parta Harahap Binti H. Parta Harahap 11 Tiamah Kasim Abdullah Binti Kasim 12 Chairani Muhammad Jamil Binti H.Mhd.Jamil Nst 13 Jamilah Basar Abdullah Binti Bahsar 14 Amir Husin Pane Bin B. Pane 15 Asyiah Muhammad Said Binti Muhammad Said 16 Ernawati Keman Abdullah Binti Keman 17 Rukijah Uteh Meneng Binti Uteh Meneng 18 Komis Tohar Simanjuntak Bin Tohar Simanjuntak 19 Muhammad Idris Nuteh Bin M.Nuteh 20 Fatimah Syam Sitorus Binti M.Yusuf Sitorus 21 Nurmiah Kuong Simanjuntak Binti Kuong Simanjunta 22 Chairuddin Rukmanudin Sawaludin Bin Rukmanudin 23 Yusniar Adenan Tahir Nasution Binti Adenan Tahir 24 Masri Hidayani Siagian Binti H Hidayat Siagian 25 Sri Panatari Siagian Binti H Hidayat Siagian 26 Mardiana Hidayat Siagian Binti H Hidayat Siagian 27 Hidayat Aminullah Siagian Bin Aminullah Siagian 28 Mariati Yusuf Lubis Binti Yusuf Lubis 29 Nahruddin Faqih Batubara Bin H.Faqih Zainuddin 30 Asliyati Djaudin Abdullah Binti Djaudin 31 Faridah Raja Anwar Binti Anwar 32 Hafsah Muhammad Thahir Binti Mhd Thahir 33 Syarifah Sohor Tanjung Binti Sohor Tanjung 34 Darmawan Raja Anwar Binti Anwar 35 Taing Nurbaidah Karim Binti Abd.Karim 36 Siswati San Nursad Binti San Nursad 37 Rubama Koto Ibrahim Binti Ibrahim 38 Riswanda Prawira Negara Bin Muhammad Isya 39 Farida Hanum Mansyur Binti Mansyur 40 Syamsul Zuhdy Simatupang Bin H.Mhd.Syarif Simatu 41 Khainur Abdul Muhid Lubis Binti H.Abd.Muhid Lubi 42 Rosdiana Siantono Abdullah Binti Siantono 43 Kamisah Yuda Tirta Binti Yudatirta 44 Wiji Setro Winangun Binti Setro Winangun 45 Sikem Sanwardi Abdullah Binti Sanwardi 46 Amir Hamzah Hasibuan Bin Mhd.Said Hasibuan 47 Hamdani Ingah Bidin Bin Ingah Bidin 48 Ramli Syafii Hasibuan Bin Syafii Hasibuan 49 Ahmad Syahlan Abdul Manan Bin Abdul Manan 50 Syamsiah Nurdin Abdullah Binti Nurdin 51 Ibrahim Ahmad Dahlan Marpaung Bin Ahmad Dahlan 52 Zuraida Abdullah Amal Binti Abdullah 53 Hasan Basri Udin Bin Udin 54 Ramlan Abdul Gani Bin Muhammad Zain 55 Lismawati Nur Effendi Binti Nur Effendi 56 Ponirin Parman Mustorjo Bin Parman 57 Irian Nani Hanawi Hamid Binti Hanawi Hamid 58 Siti Aminah Binti Abdul Halim Binti H.Abdul Hali 59 Rabiah Abdul Madjid Binti H.Abd.Majid Falahiyah 60 Kardiana Mahat Sinaga Binti Mahat Sinaga 61 Erhani Datuk Muda Tongah Binti Datuk Muda Tongah 62 Nurmala Hendrik Sianipar Binti Hendrik Sianipar 63 7 Ansoruddin Mustafa Harahap Bin Mustafa Harahap 64 Petti Megawati Ceno Binti Ceno Daulay 65 Aisyah Lim Abdullah Binti Lim 66 Murni Asmuni Sabran Binti H.Asmuni 67 Ummisyah Abu Bakar Binti Abu Bakar 68 Rahmadsyah Yusuf Rangkuti Bin H.M. Yusuf Rangkut 69 Gabena Ahmad Lufti Siregar Binti H. Ahmad Lutfi 70 Mariyani Abdul Karim Binti Abdul Karim 71 Nurjanah Nukman Abdullah Binti Nukman 72 Ahaddinsyah Ali Marpaung Bin Syaifuddin Ali Marp 73 Ramadiah Chotip Panjaitan Binti H Chotip Panjait 074 Ahmad Najib Amron Bin Ok Amron 075 0200056932 Muhammad Irwan Nasution Bin Taat Nst 76 Fatimah Awaluddin Rasid Binti Awaluddin A

77 Henri Syamsuddin Siregar Bin H Syamsuddin Sirega 78 Ade Yuslizar Effendy Pane Binti Rustam Effendi P 79 0 Larasati Muhammad Tukimin Binti Mhd.Tukimin 80 Nur Mislainy Mat Narif Binti Ulong Mat Narif 81 Sri Asnita Ismail Siregar Binti Ismail 82 Rosnani Harun Manurung Binti Harun Manurung 83 Halimah Bahrum Hasibuan Binti Bahrum Hasibuan 84 Siti Aisyah Usman Binti Usman 85 Syariman Rohadi Tokaryo Bin H Rohadi 86 Pujawati Paelan Astrosentono Binti H Paelan 87 Muhammad Syarip Nasution Bin H.M.Tambinuh Nst 88 Hanimah Mahmun Sitorus Binti H.Mahmun Sitorus 89 Amirsyah Mahidin Jasmitak Bin Mahidin 90 Suriati Saiman Abdullah Binti Saiman 91 Zulfikar Rahman Sagala Bin Sahmuda Sagala 92 Asniwaty Kamaruddin Bandaro Binti Kamarudin 93 Nur Harifah Tukiran Binti H. Tukiran 94 Mardeli Erti Muchtar Binti Muchtar 95 Junes Tri Minsa Bin H.Wagimin 96 Mukhlisin Suradi Abdullah Bin Suradi 97 Nurhayati Rasimin Abdullah Binti Rasimin 98 Muhammad Thahir Hasibuan Bin H Mohd Noor Hasibua 99 Nurifah Lukman Siregar Binti Lukman Siregar 100 Syarifuddin Abdullah Nongah Bin Abdullah 101 Waliyati Sukip Abdullah Binti Sukip 102 Chairmawati Muhammad Said Binti H.Mhd Said 103 Wagini Kardi Dollah Binti Kardi 104 Tumin Nimin Siin Binti Nimin 105 Suyatik Lamus Santika Binti Lamus 106 Usman Umar Pohan Bin Umar Pohan 107 Jaimah Kasan Taruno Binti Kasan Taruno 108 Darwis Hasan Nasution Bin Lobe Hasan Nasution 109 Elidar Akhir Harahap Binti Akhir Hrv 110 Arsad Muhammad Yusuf Panjaitan Bin M.Yusuf 111 Marianum Muhammad Yusuf Binti Mdh.Yusuf 112 Aisyah Zainuddin Yusuf Binti Zainuddin 113 Chaidir Muhammad Ali Panjaitan Bin Muhammad Ali 114 Muhammad Yunus Suriya Bin Sariya Sentana 115 Khadijah Wagio Abdullah Binti Wagio 116 Ramlah Muhammad Marpaung Binti Mhd Ali Marp 117 Usman Mariem Tosumito Bin Marien 118 Misni Amat Komeri Binti Amat Komeri 119 Asril Achmad Nasution Bin Achmad Bey 120 Arum Lesmana Selamat Binti Selamat Budi 121 Wagino Musiran Amat Bin Musiran 122 Baharuddin Kamat Manurung Bin H.Kamat Manurung 123 Derhana Parlahutan Pospos Binti Parlahutan Pos P 124 Nuraini Nongah Samat Binti Nongah 125 Nafsiah Uteh Sinurat Binti Uteh Sinurat 126 Susy Armaya Tanjung Binti Sufni Tanjung 127 Pariyati Adi Wijoyo Binti Adi Wijoyo 128 Tutur Muliono Mardi Bin Mardi 129 Sutinah Amat Nawi Abdullah Binti Amat Nawi 130 Rusli Agus Salim Nasution Bin Agus Salim Nasutio 131 Suprapti Surianto Suwiro Binti Surianto 132 Sukiyah Suwiryo Sunarto Binti Suwiryo 133 Ahmad Suprayogi Nur Bin Nur Ahmad 134 Syamsul Hanif Sagala Bin Muhammad Rosul 135 Yusna Wati Suman Binti Suman 136 Siti Rahma Mat Yuteh Binti Mat Yuteh 137 Ali Markianus Saragih Bin J.Markianus Saragih 138 Ramlah Ibrahim Ulong Binti Ibrahim 139 Syahnum Abdul Rojak Binti Abdul Rojak 140 Sanifah Ulung Nurdin Binti Nurdin 141 Ahmad Masri Siti Rahmah Bin Masri 142 Suhartini Ponidi Said Binti Ponidi 143 Aripin Abu Husin Hasibuan Bin Abu Busin Hasibuan 144 Sumiati Alang Tayip Binti Alang Tayip 145 Abdul Aziz Lubis Bin H.Abdul Rahman 146 Nurhawi Kamarudin Sinaga Binti Kamarudin 147 Amri Muhammad Saleh Bin M.Saleh Ar 148 Yushabibah Bahrum Hasibuan Binti Bahrum Hasibuan 149 Paini Parman Abdullah Binti Parman 150 Risman Samsul Bahri Bin Samsul Bahri 151 Tumisah Ruslan Abdullah Binti Ruslan 152 Nurpiah Ali Husin Lubis Binti Ali Husin Lubis

153 Agus Suratman Harjo Bin Suratman 154 Jamilah Abdul Salam Binti Abdul Salam 155 Husaini Abdul Salam Bin Abdul Salam 156 Ubat Nani Abdul Wahab Binti Abdul Wahab 157 Supiyah Samaan Abdullah Binti Samaan 158 Mintan Hasan Harun Binti Hasan 159 Maryam Wahab Manurung Binti Wahab Manurung 160 Siti Maryam Panjaitan Binti Akup Panjaitan 161 Nizwati Husnan Saragih Binti Husnan Srg 162 Basuni Sanusi Ungkal Bin H.Sanusi 163 Asmah Mukhtar Abdullah Binti H.Mukhtar 164 Taufik Kurchman Sudarjo Bin Sudarjo 165 Jamilah Mukidi Marsum Binti Mukidi 166 Siti Amsyah Sirait Binti Tupang Sirait 167 Sarwen Karto Miarji Binti Karto Miarji 168 Jaharuddin Mukidi Marsum Bin Mukidi 169 Dewi Sri Manja Daeng Rahmad Binti D. Rahmad 170 Yusna Zahara Syamsuddin Binti Syamsuddin 171 Sudarni Rajimin Karsowi Binti Rajimin 172 Salmah Nongah Usman Binti Nongah 173 Hatisyah Abdul Kadir Munthe Binti Abdul Kadir Mu 174 Kartik Sagimin Abdullah Binti Sagimin 175 Ahmad Syafii Hasanuddin Bin H Hasannuddin 176 Aini Jamhur Ridwan Binti Ridwan 177 Menah Sanbas Binti Ramli Binti H Ramli R 178 Nuraida Hasanuddin Lubis Binti H Hasanuddin 179 Salbiyah Abdullah Muhammad Binti Abdullah 180 Asiyah Datuk Saari Itam Binti Dt Saari 181 Bainah Adam Ahmad Binti Adam 182 Ramidah Rolidi Amat Binti Kolidi 183 Sanimin Sandem Abdullah Bin Sandem 184 Habibi Tambi Aritonang Binti Tambi 185 Mariamah Mad Ngumar Binti Mad Ngumar 186 Hasnul Basri Simangungsong Bin Mhd.Sonang 187 Zuraidah Muhammad Idham Binti Mhd.Idham 188 Abdul Hamid Bahrum Marpaung Bin Bahrum Marpaung 189 Asnah Gagah Panjaitan Binti Gagah Panjaitan 190 Musrifah Ahmad Syahroni Binti A.Syahroni 191 Ngatemin Suto Dikromo Bin Suto Dikromo 192 Nelly Naccir Panjaitan Binti Naccir Panjaitan 193 Chairuddin Ilmi Samad Turmudi Bin A. Samad Turmu 194 Ratna Juita Sulaiman Pospos Binti H. Sulaiman Po 195 Kahar Kasim Simanjuntak Bin Kasim 196 Nurhayati Usman Abdullah Binti Usman 197 Barauddin Abdul Gani Bin Abdul Gani 198 Sabar Sagi Abdullah Bin Sagi 199 Sahat Lumban Tobing Bin Bahrum L.Tobing 200 Emelia Kusen Tukimin Binti Kusen 201 Nasibun Sali Abdullah Bin Sali 202 Jumini Sanmurdi Abdullah Binti Sanmurdi 203 Indun Sanraji Abdullah Binti Sanraji 204 Maniah Sumo Mejo Binti Sumomejo 205 Wagiman Sumop Wikarjo Bin Sumowikarto 206 Sadikem Saiman Abdullah Binti Saiman 207 Komari Karto Pawiro Bin Karto Pawiro 208 Indrawati Iman Makali Binti Iman Makali 209 Kariama Pattun Simanjuntak Bin Pattun 210 Hanum Muhammad Kasim Sitorus Binti M.Kasim Sitor 211 Nisip Bin Karto Suwito Bin Karto Swito 212 Sugiyem Kasimin Abdullah Binti Kasimin 213 Tukijem Gino Nitirejo Binti Gino 214 Sumiardi Joyo Sumarno Bin Yoyo Sumarno 215 Halimah Sarmo Sakimin Binti Sarmo 216 Sukiar Sonomo Kamino Bin Sonomo 217 Triswati Diswanto Kartayasak Binti Suanto 218 Surtik Dawitanom Sedda Binti Dawitanom 219 Hadini Mustawi Abdullah Binti Mustawi 220 Supardi Amat Jauri Bin Ahmad Jauri 221 Tolimah Jaosen Haboko Binti Jaosen 222 Kasinah Kasiran Basimun Binti Kasiran 223 Baidun Gelek Siahaan Bin Gelek Siahaan 224 Samsiah Mahidin Tambunan Binti Mahidin Tambunan 225 Abdul Manaf Abdul Wahab Bin H.Abdul Wahab 226 Efendi Batoran Marpaung Bin Batoran Marpaung 227 Usman Sukeri Abdullah Bin Sukeri

228 Juminem Jemeno Abdullah Binti Jemeno 229 Sakinah Mulyani Abdullah Binti Mulyani 230 Sudarrum Wagio Abdullah Binti Wagio 231 Muhammad Saleh Tanjung Bin Marsim 232 Suwito Jasman Atmoharjo Bin Jasman 233 Adlina Abdul Kamal Binti Abd Kamal Hasibuan 234 Habibah Kandak Tambunan Binti Kandak Tambunan 235 Sugiyem Karto Dinomo Binti Karto Dinomo 236 Karto Muraji Mat Karta Bin Mat Karta 237 Narseh Nameja Abdullah Binti Nameja 238 Ali Akbar Ahmad Bin Ahmad 239 Imanuddin Harahap Burhanuddin Bin Burhanuddin Ha 240 Asmaniar Rasiam Amdar Binti Rasiam 241 Sarmah Amat Musele Binti Amat Musele 242 Tuminah Rebo Abdullah Binti Rebo 243 Lokot Udin Panjaitan Bin Udin Panjaitan 244 Boniem Tasam Martowiryo Binti Tasam 245 Aminuddin Djailani Lubis Bin Ongah Lubis 246 Napsiah Maun Silalahi Binti H.Maun Silalahi 247 Sukino Rakiyo Silalahi Bin H.Rakiyo 248 Supariah Muhammad Sodali Binti Muhammad Sodali 249 Suminem Kromowiryo Abdullah Binti Kromowiryo 250 Hasan Juara Siahaan Bin Juara Siahaan 251 Herlina Jakbar Siagian Binti Jakbar Siagian 252 Suriyani Subari Ponidin Binti Subari 253 Parto Miarjo Harjo Suwito Bin Harjo Suito 254 Misman Rono Sentono Bin Ronosentono 255 Suparmi Parto Rejo Binti Partorejo 256 Masngut Dollah Kasmuni Bin Dollah Kasmuni 257 Mariam Kusman Amzah Binti Kusman 258 Sahlan Sastro Diharjo Bin Sastro Diharjo 259 Tarwini Mat Wirya Binti Mat Wirya 260 Maharani Anwar Ongah Binti Anwar 261 5nurmala Tarukkit Panjaitan Binti Tarukkit Panjai 262 Tirapiah Badu Hasibuan Binti Badu Wahab Hasibuan 263 Elma Yetti Syukurudiin Binti Syukurudin 264 Nilawati Hasnan Gukguk Binti Hasnan 265 Zulkarnaen Abdul Manan Bin Abd.Manan 266 Asmadi Ahmad Jauhari Hasibuan Bin A Jauhari Hasi 267 Ernawati Harun Abdullah Binti Harun 268 Abdul Rohman Bakhri Bin Bakhri 269 Jumatun Narsan Abdullah Binti Narsan 270 Husin Arif Sarnan Bin Sarnan 271 Abu Darda Muhammad Talhah Bin Mhd Talhah 272 Umi Salamah Amat Kosem Binti Ahmat Kosem 273 Syahyuda Ningsing Sudirman Binti Sudirman 274 Asmawati Dosep Panjaitan Binti Dosep Panjaitan 275 Aswiluddin Hasanuddin Rambe Bin Hasanuddin Rambe 276 Aliaman Urung Maraja Sinaga Bin Urungmaraja Sina 277 Khuwalid Batara Hasan Ismail Bin Hasan Ismail 278 Jainun Lassani Manurung Bin Lassani 279 Ninawati Abdul Maim Binti Abdul Naim 280 Agus Halim Ismail Pane Bin Ismail 281 Halimatussadiyah Isa Ali Daud Binti Isa Ali Daud 282 Asmah Yatimin Abdullah Binti Yatimin 283 Muhammad Saleh Sinambela Bin Mhd. Musa Sinambela 284 Saodah Kasman Muhadi Binti Kasman 285 Rasmia Ngadimun Sastra Binti Ngadimun 286 Rubiah Abdul Hamid Sitorus Binti Abd.Hamid Sitor A 287 Asnan Muhammad Rawini Sinurat Bin Mhd.Rawini Sin 288 Ady Iswanto Marahtamin Masri Bin Marahtaminmasri 289 Jamaluddin Utuh Jam Jam Bin Utuh Jam-Jam 290 Ngatinem Kiyo Abdullah Binti Kiyo 291 Suyanto Gio Tokarso Bin Gio 292 Ngatemi Boimin Kamiran Binti Boimin 293 Dasimun Wongso Karyo Bin Wongso Karyo 294 Kasmi Parman Sukiban Binti Parman 295 Subandi Suyono Abdullah Bin Suyono 296 Asraniah Tuana Rambe Binti H.Tuana Rambe 297 Paiso Amat Rajiman Bin Amat Rajiman 298 Ahmad Efendi Matsirin Bin Madsirin 299 Sutimin Ngatijo Kasmiran Bin Ngatijo 300 Usman Majin Sinaga Bin Majin Sinaga 301 Domrah Jahadim Manurung Binti Jahadim 302 Lolom Jahadim Manurung Binti Jahadim

303 Muhammad Yakup Manurung Bin Malem Manurung 304 Ulimah Uteh Meneng Sitompul Binti Uteh Meneng Si 305 Mangajani Markum Pandiangan Bin Markum Pandianga 306 Helmina Losa Situmorang Binti Losa Situmorang 307 Lami Paijo Abdullah Binti Paijo 308 Tumini Mukayat Abdullah Binti Mukayat 309 Nurhaya Abdul Sani Sinaga Binti Abd Sani Sinaga 310 Sueb Siswanto Sukemi Bin Sukemi 311 Basirun Amat Romli Bin Amat Romli 312 Sri Natun Ponimin Binti Ponimin 313 Nurlen Baharuddin Siagian Bin Baharuddin Siagian A 314 Dahniar Adnan Margolang Binti Adnan Margolang 315 Benteng Silam Panjaitan Bin H Silam Panjaitan 316 Rayo Rani Sofyan Binti Sopian 317 Mipahaida Baharuddin Marpaung Binti Baharuddin M 318 Nurmawati Ramli Pangaribuan Binti Ramli Pangarib 319 Nur Aini Arbain Ibrahim Binti Arbain 320 Jami Karem Ibrahim Binti Karem 321 Hamdan Wagimin Ibrahim Bin Wagimin 322 Bariah Sumerejo Mawi Binti Sumerejo 323 Oniyah Mawiraji Abdullah Binti Mawiraji 324 Rumini Wagiman Wagimin Binti Wagiman 325 Sakinah Sakimin Abdullah Binti Alm.Sakimin 326 Hasan Masum Lubis Bin H.Mahmud Lubis 327 Zulhalma Ali Mahdinir Binti Ali Mahdinir 328 Muslim Mahyudin Manurung Bin Mahyudin Manurung 329 Enny Hasroni Amir Hasan Lubis Binti Amir Hasan L 330 Nurmiyah Muhammad Jamil Binti Mhd Jamil Nas 331 Buyung Umar Sirait Bin Umar Sirait 332 Masnah Jaronda Sihombing Binti Jaronda Sihombing 333 Ahmad Syarifuddin Rangkuti Bin M Syarif Rangkuti 334 Roro Sulasmi Abdullah Surur Binti Raden Abdullah 335 Fauziah Hanum Bahrin Binti Bahrin Bs 336 Muhammad Nurdin Nasution Bin Alwi Nasution 341 Mursyid Saleh Bin Saleh Bin Saleh 342 Pardi Sirait Bin Jarail Sirait Bin Jarail Sirait 343 Eva Mahdalena Parinduri Binti Ibrahim Parinduri 344 Nurbayani Binti Bahrumsyah Lubis Binti Bahrumsya 345 Dede Faunita Binti Yusri Binti Yusri Ramali 346 Ngatmi Binti Sulaiman Itam Binti Sulaiman 347 Semiwati Binti Sanari Supangat Binti Sanari 348 Siti Nur Aini Binti Burhanuddin 349 Alamsyah Bin Sarmadi Ahmad Bin Sarmadi 350 Hasan Usman Bin Usman Bin H. Usman 351 Syamsiah Binti Mohammad Amin Binti Tgk.M.Amin 352 Irianto Bin Amat Taman Bin Ahmad Taman 353 Kasbiah Binti Basirun Sihite Binti Basirun 354 Maimunah Rusnun Abdullah Binti Rusmun 355 Nadiah Basirun Sihite Binti Basirun Sihite 356 Elya Susyanti Martini Binti Samad Effendi 357 Kasnik Jilan Mingun Binti Jilan 358 Nursiati Abdul Muthalib Kromo Binti Abdul Muthol 359 Nurhamidah Abdul Mutholib Binti Abdul Mutholib 360 Prayitno Temon Kasmin Bin Temon 361 Mulyadi Paimin Reso Bin Paimin 362 Putri Sentika Binti Prayitno Binti Prayitno 363 Teguh Putra Prayitno Bin Prayitno 364 Hebban Muhammad Khair Bin H. Muhammad Chair 365 Zakaria Ansori Bin Baedlowi Bin H.Baedlowi Ichsa 366 Warsid Smat Ahmad Tasrip Bin Ahmad Tasrip 367 Ramah Pujiati Binti Djonny Binti Djonny 368 Yahya Martua Hutasuhut Bin Mara Tua Hutasuhut 369 Ida Widayani Binti Oyon Haryana Binti Oyon Harya 370 Mariani Johana Panjaitan Binti Ahmad 371 Amisyah Muhammad Hasyim Binti M Hasyim 372 Rohana Binti Abdul Madjid Binti H Abdul Majid 373 Nurhasanah Kaharuddin Idris Binti Khairuddin 374 Saerma Syahbudin Hitam Binti Syahbudin 375 Turiman Bin Sabar Asmo Bin Sa’ban 376 Harun Bin Pokir Ritonga Bin Bokir Ritonga 377 Datuk Delizar Bin Amirsyah Bin Datuk Amirsyah Sa 378 Datuk Faisal Syamsura Bin Dt. Amirsyah Syamsura 379 Syamrinah Binti Amin Lubis Binti Amir Lubis 380 Yuniar Binti Mac Chalil Binti Mac.Chalil 381 Fristiwaty Umar Syehman Binti Umar Syehman

382 Usnah Binti Syarif Badano Binti Syarif 383 Ida Srinanda Siregar Binti H.Badaruddin Siregar 384 Ernawati Binti Wildan Jamil Binti Wildan 385 Rosmalinar Binti Hasan Basri Binti Hasan Basri 386 Zahriah Binti Sofyan Djuned Binti Sofyan Djuned, 387 Rinaldi Idroes Bin Yusuf Bin Idroes 388 Aswin Bin Asrafin Sastro Bin Asrafin 389 Sri Warsih Binti Tamsi Binti Tamsi 390 Karmi Binti Kasan Mardi Binti Suro Drono 391 Suparman Bin Tamsi Kasan Munadi Bin Tamsi 392 Yulisma Binti Yunus Muhammad Binti Yunus 393 Poniyem Binti Amat Sakidi Binti Ahmad Syakidi 394 Surianto Bin Pardi Mat Daris Bin Pardi 395 Rostini Lubis Binti Danial Lub Binti Danial Lubi 396 Sri Ningsih Andania Suprapto Binti Suprapto 397 Nuril Amnah Nasution Binti Muchtar Jamil 398 Siti Fatimah Muhammad Zenu Binti Mhd.Jenu 399 Edi Trianto Bin Wagio Bin Wagio Alm 400 Abdul Manaf Rahman Percil Bin Abd. Rahman 401 Asmawaty Abdul Muhid Gafur Binti Abdul Muhid 402 Muhammad Saleh Bin Ulung Bin Ulong Arsyad 403 Maimunah Binti Djakimin Rono Binti Djakimin 404 Ibrahim Bin Muhammad Ali Bin Ali 405 Gazali Ismail Nasution Bin H Ismail Nasution 406 Wisnu Supardjo Wonoprojo Bin Supardjo 407 Nurasni Aziz Binti Abdul Aziz Binti Abdul Azis 408 Azwardin Nasution Anwar Bin Anwar Nasution 409 Nurminah Naik Dalimunthe Binti Naik Dalimunthe 410 Erwansyah Bin Akup Saragih Bin Akup Saragih 411 Rudi Witono Suharjo Bin Suhardjo 412 Syaifah Muhammad Yusuf Binti Muhammad Yusuf 413 Parman Mulyo Wiyono Bin Mulyowiyono 414 Yati Aryati Binti Idit Binti Idit Supriadi 415 Sarikem Kariyo Utomo Binti Karyo Utomo 416 Rafna Binti Sidi Awang Binti M.Tahar 417 Jeanetta Nur Betty Setiawati Binti Mhd.Sanin Dja 418 Ida Novita Binti Janawar Binti Janawar 419 Nurhayati Solok Pense Binti Solok 420 Janiar Muhammad Yusuf Binti Yusuf 421 Anting Doyok Bungo Binti Doyok 422 Muhammad Syarif Bin Edi Bin Edi Suhandi 423 Jumiati Binti Samijo Kromo Binti Samijo 424 Iman Santoso Bin Soedarmadi Bin R.Sudarmadi 425 Suharyani Misran Abdullah Binti Misran Alm 426 Taufik Repiawan Bin Nadi Bin Nadi 427 Yunita Nur Binti Nurdin Binti H.Nurdin 428 Siti Habsyah Binti Kosim Binti Kosim Nasution 429 Aminah Yumin Abdul Gani Binti Tumin 430 Kartini Binti Mariun Pranoto Binti Mariyun 431 Mariaty Mariyun Pranoto Binti Mariyun 432 Mariana Mariyun Pranoto Binti Mariyun 433 Irfan Dewan Bin Ibrahim Laboh Bin H. Ibrahim Lab 434 Junaidi Abidin Bin Imam Bin Imam Hanafi 435 Asmini Satimin Sonto Winangun Binti Satimin 436 Rahmayani Syamsuddin Thaib Binti Syamsudin Sireg 437 Sabrina Hayati Binti Syamsudin Binti Syamsudin S 438 Shandra Himalaya Binti Sardjuki Waldi Binti Sard 439 Seniati Anitha Susila Binti Sardjuki Waldi 440 Sudarmin Bin Sukemi Ahmad Dahlan Bin Sukemi 441 Risnawati Binti Dullawi Ronoyoso Binti Dullawi 442 Nurbaya Binti Hasan Basri Binti Hasan Basri.H 443 Muhammad Zunaidi Bin Abdur Bin Abdul Rahman 444 Ismail Bin Abbas Redjo Bin Abbas 445 Suprijadi Bin Prawiro Oetomo Bin Prawiro Oetomo 446 Rahmawaty Binti Abdul Rahim Hasby Binti H.Abd.Ra 447 Nurbaiti Binti Abdul Rahim Binti H.Abd.Rahim Has 448 Sutiani Binti Abdul Rahim Binti H Abd Rahim Hasb 449 Anekawati Ngadimoen Sastro Binti Ngadimun 450 Elida Binti Libernius Damanik Binti Libernius Da 451 Ahmad Chairuddin Aman Bin H.Ahmad Aman 452 Ainal Hanum Muhammad Nur Binti H.M Nur 453 0 Liana Djuwita Atmadja Binti H.Wagiman Atmadja 454 Sukarni Darsin Kasmuri Binti Darsin 455 Maulinar Binti Maskur Yusuf Binti Masykur (csf/m50/m37/m32)


WASPADA Selasa 18 Oktober 2011

Kasus Penyedotan Pulsa Akan Dibongkar MEDAN (Waspada): Indonesia Telecommunication Users Group (IDTUG) Sumatera Utara (Sumut) akan membongkar kasus baru yang diduga kuat, ikut menyedot pulsa dan sekaligus merugikan pengguna (users) Handphone (HP). Hal itu dilakukan terkait maraknya penyedotan pulsa yang disinyalir dilakukan sejumlah content provider (CP). “Kita sudah lakukan audit teknis dan bisnis, siap untuk ungkap dan kini tahap koordinasi ke IDTUG Pusat. Tapi secara manual kita sudah ungkap, dimana kasusnya untuk sementara bersifat penyalahgunaan fasilitas untuk bisnis, sangat berpotensi menyedot pulsa pengguna HP,” tegas Ketua IDTUG Sumut Drs Hendrik Sitompul, MM kepada wartawan di Graha IDTUG di Jalan Setia Budi Medan, kemarin, sekembalinya dari Jakarta usai mengikuti rapat dengan BRTI di Gedung Kominfo Jakarta.

Menurut Hendrik, kasus itu akan menyeret operator terbesar di Indonesia, tidak tertutup kemungkinan ada keterlibatan CP untuk menjalankan modus yang digunakan selama ini. “Kita akan dalami terus kasus ini, jika data sudah lengkap, tidak tertutup kemungkinan persoalan ini akan kita lapor ke Badan Regulasi Telekomunikasi Indonesia (BRTI),” tambah Hendrik. Selain itu, kata Hendrik, IDTUG Sumut telah membuka posko pengaduan di Graha IDTUG Jl Setia Budi untuk menampung segala bentuk penipuan dan kasus penyedotan pulsa yang dialami pengguna HP. “Segala bentuk pengaduan akan kita terima, selanjutnya akan kita tindaklanjuti dengan mensurvei dan pembuktian di lapangan disesuaikan dengan kasus yang dialami user,” kata Hendrik. Terkait berbagai permasalahan dan pemberitaaan tentang adanya kecurigaan para content provider yang nakal yang

menyedot pulsa pelanggan. Hal itu kata Hendrik, tentu akan mencederai rasa keadilan masyarakat dan konsumen secara keseluruhan. Untuk itu, IDTUG menegaskan agar mengetahui duduk perkara yang sebenarnya dan mengetahui mana-mana saja CP yang nakal, yang tidak mengindahkan kaidah dalam berusaha. Tentu ada beberapa hal yang menjadi sikap IDTUG dan perlu diambil oleh pemerintah, Kominfo, BRTI dan operator yakni diantaranya audit secara keseluruhan baik teknis dan audit secara bisnis. IDTUG meminta seluruh operator untuk menggunakan shortcode yang sama dan universal berlaku untuk semua operator (misal 999), yang mudah diakses masyarakat pengguna baik untuk mengetahui layanan SMS Premium apa saja yang me-reka pakai dan dapat pula digunakan untuk melakukan penghentian layanan tersebut. (m08)

Kasus Perampokan Bank CIMB

Mantan Kapoldasu Sayangkan Tak Ada Penghargaan

Waspada/Hasriwal AS

Standing banner bebas korupsi terlihat di ruang kerja Kalemdikpol Komjen Pol Oegroseno guna menjadikan Polri bebas dari tindak pidana korupsi yang kian memperburuk mental dan perekonomian rakyat Indonesia. Foto diambil Senin (17/10).

Bakosurtanal Berubah Jadi BIG


SEJUMLAH pengunjung mengamati foto dari daftar pencarian orang (DPO) jaringan bom bunuh diri Cirebon dan Solo di Tunjungan Plasa, Surabaya, Minggu (2/10). Pemasangan foto DPO yang dilakukan Polrestabes Surabaya tersebut, sebagai antisipasi masuknya aksi terorisme di wilayah Jatim.

Polri Tetapkan Tujuh DPO Tindak Pidana Terorisme JAKARTA (Antrara): Kepolisian Negara RI saat ini menetapkan tujuh pelaku yang masuk daftar pencarian orang (DPO) Tindak Pidana Terorisme. “DPO yang masih kita cari masih tujuh orang dan ini ada dari kelompok Cirebon dan Poso,” kata Kepala Divisi Hubungan Masyarakat (Kadiv Humas) Polri, Irjen Pol Anton Bachrul Alam, Senin (17/10). Mereka yang masuk DPO adalah Yadi Al Hasan, Nanang Irawan, Umar, Santoso, Cahya, Imam Rasyidi dan Taufik Bu-

laga, ujarnya. “Mereka masuk kategori orang-orang berbahaya di kalangan terorisme. Bagi masyarkat yang mengetahui informasi para DPO diharapkan melapor ke kepolisian,” kata Anton. Para DPO ini mampu merakit bom dan merekrut orang untuk masuk dalam jaringan terorisme, katanya. Pelaku jaringan Cirebon adalah di balik aksi bom bunuh diri di Mesjid Adz Zikra di Mapolres Cirebon Kota, Mochammad Syarif. Sedangkan pelaku bom

bunuh diri di Gereja Bethel Injil Sepenuh (GBIS), Solo adalah Pino Damayanto, alias Ahmad Urip alias Ahmad Yosefa alias Hayat alias Raharjo. Ahmad dan Syarif aktif dalam keanggotaan JAT wilayah Cirebon pimpinan Agung Nur Alam alias Abu Husama. Syarif dibaiat oleh Amir Markasiah, ustadz Abu Bakar Baasyir di Tasikmalaya pada tahun 2008 bersama sepuluh anggota JAT wilayah Cirebon. Syarif juga aktif mengikuti majelis taklim pimpinan Baasyir di beberapa tempat di wilayah Jawa Barat.

1.000 TKI Belajar Di UT JAKARTA (Waspada): 1.000 Tenaga Kerja Indonesia (TKI) menjalani perkuliahan di Universitas Terbuka (UT). Mereka tersebar di berbagai negara seperti Taiwan, Hongkong, Singapura, Korea Selatan, Malaysia, Arab Saudi hingga Yunani. “Sudah banyak yang lulus. Tapi data terakhir ada sedikitnya 1.000 TKI yang kini masih menuntut ilmu di UT,” kata Rektor UT Tian Belawati saat seminar Wisuda periode III, di kantor UT Pusat, Pondok Cabe, Tangerang Selatan, Banten, Senin (17/10). Para TKI yang kuliah sebagian besar adalah pekerja informal, seperti pembantu rumah tangga, sopir atau peker-

jaan informal lainnya. Hal itu dimungkinkan karena biaya kuliah yang sangat terjangkau. Sistem belajarnya pun, kata Tian, sama dengan mahasiswa UT lainnya. Selain belajar mandiri lewat tutorial online atau modul-modul yang disediakan mitra UT di negara masingmasing, para TKI juga melakukan tatap muka sebanyak 8 kali dalam tiap semester. Semangat para TKI menuntut ilmu tersebut dikatakan Tian bisa menjadi motivasi para TKI untuk terus maju. Karena pendidikan adalah alat penting dalam meningkatkan derajat hidup seseorang. “Ada lulusan UT yang bekerja di Singapura sebagai tenaga

pembantu rumah tangga. Sekarang dia sudah jadi kontributor di sebuah koran lokal,” kata Tian. Ke depan, UT akan lebih meningkatkan akses pendidikan tinggi bagi kaum marjinal. Selain TKI, masyarakat yang tinggal di daerah terpencil dan perbatasan akan diberi perhatian khusus supaya bisa ikut menuntut ilmu di UT. Dalam acara tanya jawab, salah seorang peserta wisuda asal Nias, Sumut, meminta agar UT pusat membangun Unit Pelaksana Belajar Jarak Jauh (UPBJJ) di Kabupaten Nias. Hal itu karena jauhnya jarak tempuh dengan UPBJJ Medan. (dianw)

3.000 WNI Overstayer Dipulangkan Bulan Ini JAKARTA (Antara): Sebanyak 3.000 Warga Negara Indonesia yang overstayer di Jeddah akan dipulangkan menggunakan pesawat Garuda Indonesia ex-haji yang kembali dari Arab Saudi. “Pemerintah akan memulangkan sekitar 3.000Warga Negara Indonesia yang overstayer di Jeddah dengan menggunakan pesawat Garuda Indonesia,” kata Menteri Koordinator bidang Kesejahteraan Rakyat Agung Laksono usai memimpin rapat koordinasi tingkat menteri yang membahas mengenai pemulangan WNI overstayer di Jakarta, Senin (17/10). Hadir juga dalam rapat koordinasi tersebut Menteri

Tenaga Kerja Transmigrasi Muhaimin Iskandar, Menteri kesehatan Endang Rahayu Sedyaningsih, Menteri Pemberdayaan Perempuan dan Perlindungan Anak Linda Amalia Sari Gumelar, Menteri Perhubungan Freddy Numberi dan Menteri Agama Suryadharma Ali. Agung menjelaskan, pesawat Garuda Indonesia yang melayani pemberangkatan haji akan pulang kembali ke Tanah Air dengan kondisi kosong atau empty flight. “Kondisi pesawat kosong tersebut kita manfaatkan untuk mengangkut WNI overstayer ke Indonesia,” katanya. Garuda Indonesia, tambah Agung menyarankan penggu-

naan empty flight satu penerbangan tanggal 30 Oktober 2011 dan sembilan penerbangan tanggal 31 Oktober 2011. Agung menjelaskan, pesawat Garuda Indonesia yang akan mengangkut WNI overstayer adalah kloter terakhir. Selain itu, Agung mengatakan bahwa total biaya yang dikeluarkan pemerintah untuk memulangkan WNI overstayer sekitar Rp3,5 miliar. Agung menambahkan, pemerintah akan mengirimkan tim pendahulu yang akan berangkat ke Arab Saudi untuk mendampingi dan mengurus persetujuan selama perjalanan agar proses pendataan saat kedatangan bisa dipercepat.


JAKARTA (Waspada): Badan Koordinasi Survei dan Pemetaan Nasional (Bakosurtanal) resmi berganti nama menjadi Badan Informasi Geospasial(BIG). Menteri Riset dan Teknologi, Suharna Surapranata disaksikan Menkokesra Agung Laksono, meresmikan terbentuknya BIG sebagai rangkaian kegiatan Geospasial Untuk Negeri. Pergantian nama ini sesuai Undang-undang no 4 tahun 2011 tentang Informasi Geospasial. “Saya harap BIG ini bukan lembaga yang hanya ganti baju tapi memiliki semangat baru yang mampu melahirkan berbagai ide baru, mengingat tugas dan fungsi yang lebih besar dalam pembangunan nasional di bidang Informasi Geospasial sebagaimana diamanatkan UU,” kata Menristek dalam acara peluncuran di Hotel Sahid Jakarta, Senin (17/10). Dalam kesempatan itu, sejumlah produk informasi geospasial yaitu Geoportal Nasional, peta NKRI, Peta Taktile yakni peta untuk tunanetra dan Atlas Nasional Indonesia volume III untuk melengkapi atlas nasional volume I dan II, diluncurkan. Peta Taktile sendiri diserahkan kepada para penyandang tunanetra melalui Inspektur Jenderal Kemdiknas, Musliar Kasim. Sementara itu, Menko Kesra Agung Laksono merasa yakin dengan referensi tunggal Informasi Geospasial di bawah BIG. Dengan begitu, peta seluruh provinsi, kabupaten/kota dapat diintegrasikan secara utuh dan BIG bisa menjadi salah satu media koordinasi nasional yang handal. Kepala BIG Dr Asep Karsidi mengungkapkan, selama ini berbagai Informasi Geospasial sering tidak sesuai dengan yang seharusnya dan tumpang tindih karena tidak menggunakan standar geospasial yang sama. Karenanya, dengan terbentuknya BIG, Informasi Geospasial Tematik harus mengacu pada Informasi Geospasial Dasar yang disusun oleh BIG dan pembuatannya mengacu pada standar titik kontrol geodesi. (dianw)

Wakil Menteri Bisa Ciptakan Suasana Tidak Sehat JAKARTA (Waspada): Ketua Dewan Pertimbangan Partai Golkar Akbar Tandjung mengkhawatirkan penambahan wakil menteri yang akan dilakukan Presiden Susilo BambangYudhoyono pada perombakan kabinet kali ini akan menciptakan suasana yang tidak sehat. Apa lagi pengangkatan wakil menteri itu dilakukan tanpa terlebih dahulu berkordinasi dengan menterinya. “Sekarang kita dengan akan banyak wakil menteri dan ini bisa membuat makin sulit dan pemerintahan tidak makin efektif. Bahkan, yang mengkhawatirkan, bisa jadi seorang wakil menteri, nantinya memata-matai menteri, dan jelas susana begi tidak sehat,” ujar Akbar Tanjung kepada wartawan di kantor Akbar Tandjung Institute, Jakarta, Senin (17/10). Kekhawatiran ini makin jelas dimana ada satu kementerian mempunyai dua wakil. Seharusnya, kata Akbar, jika ingin melakukan perombakan yang diganti itu adalah menterinya dan bukan menambah wakil menteri . “Yang bertanggungjawab atas kinerja kan nantinya menteri, bukan wakil menterinya. yang di nilai itu menteri dan bukan wakil menterinya, “ ujar Akbar dengan nada pesimis dengan bakal kehadiran banyaknya wakil menteri yang akan diangkat SBY. Ketika ditanya penambahan wakil menteri dilakukan SBY, karena tekanan dari partai politik yang tidak ingin kadernya diganti, Akbar tidak memastikannya, tetapi kata Akbar hal itu bisa terjadi, dimana SBY kesusahan untuk mengganti menteri dari partai politik yang diajaknya dulu berkoalisi. Sehingga mau tidak mau SBY hanya dapat menempatkan wakil menteri. Dan saya pikir ini bukan solusi, tukas Akbar. Soal peranan Wakil Presiden Bodiono dalam perombakan kabinet ini, Akbar melihat peranan Wakil Presiden sangat kecil. Mungkin hanya menyodorkan satu dua nama saja,” ujarnya. Pendapat yang sama juga dilontarkan Wakil Ketua Dewan Perwakilan Rakyat Pramono Anung. Menurutnya, keputusan menambah jumlah wakil menteri oleh Presiden SBY dapat memicu rivalitas antara menteri dan wakil menteri. “Potensial terjadi gesekan antara menteri dan wakil menteri itu ada. Apalagi wakil menterinya sudah merasa dirinya calon menteri. Itu menjadi persoalan sendiri,” katanya. (aya)

JAKARTA (Waspada): Mantan Kapolda Sumut Komjen Oegroseno menyayangkan tidak adanya penghargaan dari pimpinan Polri terhadap korban dan kinerja bekas anak buahnya di Polda Sumut atas kasus perampokan Bank CIMB Medan yang merupakan kasus besar dan luar biasa kejahatan yang dilakukan kelompok teroris perampok tersebut. “Sampai sekarang saya tidak mendengar adanya penghargaan dari pimpinan di Mabes Polri atas kinerja besar mengungkap kasus kejahAtan yang luar biasa itu. Tidak hanya kerbehasilan mengungkap kasus besar itu tetapi juga lebih dari itu, korban jiwa jatuh pada anggota polisi yang sedang bertugas dan markas Polsek diserang,” kata Oegroseno yang ditemui Waspada di kantornya Lembaga Pendidikan dan Latihan Polri (Lemdikpol) Jakarta, Senin (17/10). Oegroseno yang kini menjabat sebagai Kepala Lemdikpol itu menuturkan, kinerja anak buahnya di Poldasu saat itu sungguh luar biasa sehingga waktu tidak lama dapat mengungkap kasus kejahatan yang luar biasa itu dari kelompok teroris perampok. Setelah berhasil membongkar dan menangkap para pelaku teroris perampok Bank CIMB, Oegroseno langsung memberikan apresiasi kepada

anakbuahnya. “Sebagai Kapolda saya memberikan penghargaan mulai kenaikan pangkat dan apresiasi terhadap kinerja semua anggota baik yang korban maupun yang berhasil turut membantu menangkap para pelaku teroris perampok itu,” kata Oegroseno. Perampokan Bank CIMB di Jalan Aksara Medan yang terjadi pada 18 Agustus 2010, yang menewaskan Briptu Emanuel (korban tewas di Bank CIMB) dan melukai dua Satpam Bank CIMB dan penyerangan ke markas Polsek Hamparan Perak pada 22 September 2010 sekitar pukul 00.30 dengan menggunakan senjata api serbu yang canggih jenis, Revolver, SS1, M16, dan AK47 mengakibatkan tiga anggota polisi yang sedang bertugas di markas Polsek Hamparan Perak, Deliserdang, yakni Aiptu Deto Sutejo, Bripka Riswandi, Aiptu B. Sinulingga tewas seketika diserang para kelompok teroris perampok tersebut. Menurut Oegroseno perampokan dan kemudian penyerangan markas Polsek oleh pelaku yang sama merupakan kejahatan besar dan luar biasa yang pernah terjadi di tanah air. ”Ini adalah kejahatan besar dan sangat luar biasa, seharusnya pimpinan Polri memberikan penghargaan dan apresiasinya langsung kepada anak buah. Tetapi hal itu tidak dilaku-

kan, saya hanya sangat menyayangkan kinerja mereka seharusnya mendapat perhatian dari pucuk pimpinan Polri. Siapa lagi yang harus memperhatikan anakbuah kalau bukan pimpinan,” kata Oegroseno. Sementara untuk jabatan yang kini diembannya sebagai Kepala Lembaga Pendidikan dan Latihan Polri, Oegroeseno lebih banyak memberikan perhatian khusus terhadap profesional, kemandirian dan menjadikan polisi yang bersih serta benar-benar menjadi polisi yang diharapkan masyarakat. Beberapa kurikulum pendidikan dan latihan tengah disiapkan Oegroseno untuk cepat dan memudahkan polisi dalam menunjang pendidikan. “Bagi masyarakat yang terpenting Polisi harus bersih dari korupsi. Sehingga lebih professional untuk memberantas korupsi yang sangat menjamur di negeri ini dan merupakan kejahatan yang segera dihentikan untuk membangun bangsa,” kata Oegroseno. Pemberantasan korupsi dari pendidikan di Lemdikpol tidak semata wacana, tetapi Oegroseno mempraktikkannya dengan memasang satu standing banner di depan ruangnya bertuliskan ‘Daerah Bebas Korupsi’. Tentu saja hal ini sangat langka didapatkan di ruang kerja kepolisian apalagi jenderal seperti Oegroseno. (j02)

Anggota Banggar DPR Polisikan Ombudsman JAKARTA (Waspada): Dituduh minta fee, anggota Badan Anggaran (Banggar) DPR Miryam S Haryani melaporkan Sekretaris Jenderal Ombudsman Repbulik Indonesia (ORI) Suharyono ke Sentra Pelayanan Kepolisian (SPK) Polda Metro Jaya dengan dugaan pencemaran nama baik tersebut disampaikan Suharyono di beberapa media. “Yang bersangkutan telah mencemarkan nama baik, dikatakan (Suharyono) adanya permainan dalam pembahasan APBN -P 2011 dimana Miriam Haryani dituduh meminta fee berupa komitmen proyek anggaran ORI bisa dikabulkan,” ujar Miryam S Haryani didampingi kuasa kukumnya Elza Syarif, usai melaporkan Suharyono di Mapolda Metro Jaya, Senin (17/10). Sementara Elza Syarif menjelaskannya, sebelum melaporkan pencemaran nama baik ke Polda Metro Jaya, pada 12 Oktober 2011 lalu pernah memin-

ta Suharyono mengklarifikasi ucapannya tersebut ke kantor Miryam. Namun Sekretaris Jenderal ORI itu justru melaporkan masalah tersebut ke Badan Kehormatan (BK) DPR. “Karena Sekjen Ombudsman tersebut tidak merespon secara positif peringatan kami, maka hari ini kami melaporkan yang bersangkutan,” kata Elza. Disamping itu kata bekas pengacara Tommy Soeharto itu, anggota Komisi II DPR ini juga melaporkan pimpinan ORI tersebut dengan pasal dugaan penistaan dan fitnah. “Ya, ada lima SMS datang ke klien kami berisikan, ’bahwa klien kami ini mafia anggaran’, ‘Kamu punya uang banyak, bagi kami nanti saya blow up,” kata Elza menirukan kalimat di SMS itu. Untuk itu lanjut Elza pihaknya meminta polisi polisi segera mengungkap SMS tersebut karena menuding kliennya dan ada unsur pemerasan. Disamping itu kata Elza, kliennya mengakui pernah

memanggil Sekjen ORI ke ruang kerjanya, pada saat anggota Komisi II DPR ini meminta agar Ombudsman merevisi Rencana Kerja Kementerian Lembaga (RKKL) yang diajukan, karena harus memuat masukan hasil rapat pleno dengan Komisi II DPR yang belum dicantumkan dalam RKKL. ”Dan itu tidak melanggar kode etik, karena berlangsung pada jam kerja sekitar pukul 13.00,” katanya. Menurut Elza, kliennya sangat menyayangkan pernyataan Suharyono, karena tudingan tersebut bukan saja telah mencemarkan nama baiknya secara pribadi, namun juga turut mencemarkan institusi Komisi II dan Banggar DPR yang belakangan ini banyak disorot publik. Kedatangan tersebut ke Polda Metro Jaya membawa bukti terbit beberapa koran nasional yang memberitakan dugaan pencemaran nama baik dan lima pesan pendek (SMS). (j02)

Masyarakat Sudah Tidak Antusias Ikuti Perkembangan Reshuffle JAKARTA (Waspada): Wakil Ketua DPR Pramono AnungWibowo berpendapat, saat ini masyarakat sudah tidak antusias lagi mengikuti perkembangan reshuffle atau perombakan kabinet yang akan dilakukan Presiden Susilo Bambang Yudhoyono. “Saya kira, buat masyarakat sudah tidak menarik lagi. Masyarakat telah kehilangan minat untuk mengikuti perkembangan hal itu,” ujar Pramono Anung di Gedung DPR Jakarta, Senin (17/10). Menurutnya, wacana perombakan yang sudah digembar-gemborkan hampir satu setengah bulan yang menyita energi bangsa ini membuat masyarakat jenuh . “Saya melihat akhirnya masyarakat jenuh dengan hal itu. Orang saat ini sudah tidak lagi melihat siapa menjadi apa, tetapi yang ditunggu adalah apakah hasil reshuffle itu performa pemerintahan akan menjadi baik dari sebelumnya,” tegas politisi PDIP ini. Kalau reshuffle ini sekadar

untuk menyenangkan semua orang, sehingga hanya ada penambahan wakil-wakil menteri yang berasal profesional, Promono yakin hal itu tidak akan menyelesaikan persoalan dan justru menambah ma-salah. Wakil Ketua Komisi VI DPR RI dari Fraksi Hanura Ir Nurdin Tampubolon menegaskan sebenarnya reshuffle kabinet pada pemerintahan SBY dilakukan sebab kinerja sejumlah kementerian selama ini tidak berjalan dengan baik. Karena itu, seharusnya, kinerja di satu kementerianbermasalahituyang harus dirombak dan bukan malahmenambahwakilmenteri. “Jika akar masalah ada pada menteri yang bersangkutan, seharusnya menteri tersebut yang diganti. Kalau menambah wakil menteri yang dinilai menterinya tidak bisa bekerja, justru akan menambah kegaduhan politik birokrasi baru,” kata Nurdin Tampubolon. Menurut Nurdin ada tiga hal dengan kebijakan prerogatif

pengangkatan para wakil menteri. Pertama, dalam sistem presidensial harus dipahami bahwa kedudukan menteri sangat kuat. Menteri adalah pemerintahan dalam seharihari yang menguasai hal ihwal kementerian yang dipimpinnya. Banyaknya wakil menteri justru menambah mata rantai birokrasi yang sudah tidak efisien. Kedua, sistem presidensial menempatkan kepemimpinan presiden sangat sentral. Presiden menjadi penentuan arah haluan pemerintahannya. Karena itulah presiden memiliki kewenangan mengangkat dan memberhentikan menteri tanpa intervensi siapapun. Pengangkatan para wakil menteri justru menunjukkan langkah kompromi presiden SBY. Ketiga, banyaknya wakil menteri justru memperpanjang rentang kendali kekuasaan. Akibatnya selain memboroskan anggaran, kebijakan tsb tdk akan meningkatkan efektivitas pemerintahan. (aya)

Indonesia Miskin Film Lokal BENGKULU (Antara): Lembaga Sensor Film menyatakan Indonesia masih miskin film produksi lokal yang memiliki potensi besar untuk mengangkat perfilman nasional. “Kita harus mengakui bahwa Indonesia masih miskin film produksi lokal, padahal potensinya besar, dengan sejarah dan kekayaan alam dan adat budaya yang beragam yang bisa diangkat menjadi cerita film,” kata Wakil Ketua Lembaga Sensor Film (LSF) Nunus Supardi di Bengkulu, Senin (17/10). Dia mengatakan hal itu di sela-sela pertemuan Forum Koordinasi dan Diskusi Kerjasama Dinas Kebudayaan dan Pariwisata dengan Lembaga Sensor Film Republik Indonesia yang digelar di Bengkulu. Menurutnya, tema lokal yang sangat minim diangkat dalam film yang diproduksi

masyarakat membuat genre film yang ditawarkan ke konsumen sangat terbatas. “Masyarakat penikmat film memang tidak punya banyak pilihan sehingga film Indonesia belum menjadi tuan rumah di negara ini,” tambahnya. Nunus mencontohkan film lokal yang mampu menghipnotis penikmat film salah satunya adalah “Laskar Pelangi” yang disadur dari novel karya Andrea Hirata. Film tersebut membuktikan ide cerita lokal yang sederhana tapi menarik serta sarat pesan, ternyata mampu mendapat tempat di hati penikmat film di Tanah Air. “Laskar Pelangi salah satu contoh nyata, bagaimana ide cerita lokal ternyata bisa diterima seluruh masyarakat kita dari Sabang sampai Merauke,” ujarnya. Hal ini kata Nunus menjadi salah satu strategi yang

diusung para pembuat film di Nigeria yang berhasil mendunia dengan Nollywood dan mulai disejajarkan dengan Bollywood dan Hollywood. Film yang diproduksi Nollywood kata dia hampir 65 persen menggunakan bahasa daerah dan tetap diterima oleh masyarakat setempat, bahkan para imigran asal Nigeria yang tersebar di sejumlah benua. “Kita juga punya potensi untuk distribusi seperti yang dilakukan Nollywood karena banyak sekali tenaga kerja asal Indonesia yang bisa dijadikan target pemasaran ke luar negeri, selain di dalam negeri,” katanya. Sementara itu tokoh masyarakat Bengkul Tantawi Jauhari mengatakan film bertema lokal semakin minim padahal potensi untuk diterima pasar cukup besar. “Sebagian besar pembuat film kita masih

lebih suka mencontek ide cerita dari film luar, padahal banyak materi menarik dari daerah yang bisa diangkat ke film,” katanya.

Sejumlah daerah yang kaya sejarah menurutnya bisa dijadikan latar belakang atau setting ide cerita yang akan difilmkan.


SALAH satu film lokal “Tendangan dari Langit” yang dibintangi beberapa pesepakbola nasional diantaranya Irfan Bachdim.

Luar Negeri


WASPADA Selasa 18 Oktober 2011

Perang Di Libya:

Seputar ASEAN

Pasukan NTC Belum Berhasil Kuasai Sirte Dan Bani Walid TRIPOLIU, Libya (Waspada): Pasukan pemerintah transisi Libya mengatakan belum kuasai Bani Walid, namun sudah mulai memasuki kota itu, yang merupakan salah satu benteng terakhir pasukan yang setia kepada Moammar Khadafi. Komandan militer Dewan Transisi Nasional (NTC) mengatakan menghadapi perlawanan keras dari loyalis Khadafi di kota itu, terletak sekitar 170km tenggara Tripoli. Sementara pertempuran berlanjut juga di kota kelahiran Khadafi, di Sirte. DiTripoli, mesin berat buldoser mulai meratakan komplek kediaman Khadafi yang mirip benteng di Bab al-Aziziya. Menurut pemimpin NTC, sudah tiba saatnya “merontokkan simbol tirani”. BBC melaporkan Senin (17/ 10),KomandanNTCmengatakan

pasukannya mengepung Bani WalidsejakMinggudariarahutara dan selatan setelah sebelumnya melancarkan serangan artileri terhadap posisi petempur proKhadafi, seperti dikutip dari kantor berita Agence France-Presse. “Pagi ini kami menyerbu dari baratdaya.Siangnyaorang-orang kami sudah masuk kota.Tapi perlawanannya sengit sekali” kata komandan NTC Jamal Salem. Di kota itu diperkirakan masih ada 1.500 pendukung Khadafi. Penjarahan Pekan lalu pasukan NTC mundur dari kota itu dengan ke-

kalahan telak. Sementara di Sirte, komandan pasukan NTC mengorganisirkembalikekuatandalam upayauntukmencegahterjadinya bentrokan saling tembak antar sesama pasukan, yang sebelumnya diklaim telah menyebabkan laju pasukan mereka lambat. Wartawan BBCWyre Davies di Sirte mengatakan Minggu dilakukan upaya koordinasi serangan bersama dengan pasukan TNC dari Misrata di barat kota itu akan tetap di posisi mereka, sementara pasukan dari Beng-

hazi di timur mencoba bertahan di pusat kota. Meski demikian situasi pertempurantetappenuhkekacauan dan mematikan. Tim liputanBBC di Sirte ditembaki habis-habisan dan seorang warga Libya di dekat lokasi tertembak tewas saat mencari tempat berlindung. Selain soal pertempuran, NTC kini juga dipusingkan dengan urusan penegakan otoritasnya di seantero negeri. Munculsejumlahlaporanterjadinya penjarahan oleh pasukan

perlawanan sekitar Sirte, saksi mata menyebut barang-barang curian dibawa dengan truk keluar kota itu. Laporan The Associated Press menyatakantruk-trukmembawa traktor, alat berat sampai barang rumah tangga seperti karpet, kulkas, sampai meja-kursi juga dibawa kabur. Kompleks kediaman Khadafi yang dijaga sangat ketat itu, berupa seluas tanah 6 km3, adalah tempat kekuasaan dan tempat kediamanKhadafidiTripoli.Tem-

Mantan Presiden Arroyo Dituduh Lakukan Kecurangan Dalom Pemilu

pat itu telah diserang oleh pesawat-pesawat NATO beberapa kali sebelum jatuh ke DewanTransisi Nasional (NTC) yang berkuasa sejak Agustus. Gambar televisi belum lama ini memperlihatkan istana puteri Khadafi, Aisyah Khadafi, dibiarkan tetap berdiri. Tempat kediaman yang sangat diperlengkapi untuk menunjang kegiatannya sebagai seorang pengacara dan utusan sebuah badan PBB itu hanya tampak berantakan. (dari berbagai sumber/m10)

Gajah Sirkus Banting Gadis Kecil Vietnam Sampai Tewas HANOI,Vietnam (Antara/AFP): Gajah sirkus diVietnam menewaskan anak perempuan yang berumur 11 tahun ketika dia hendak memberi makan hewan itu dengan mengangkat gadis cilik itu denganbelalainyadanmembantingnyaketanahkemudianmenginjaknya hingga tewas, kata Polisi pada Senin (17/10). Ketika insiden itu terjadi, anak perempuan bernama Nguyen Thao Anh itu memberikan tebu kepada gajah sirkus di kota Lao Cai,yangberbatasandenganChinaMinggu,kataPolisiyangbernama Phan Van Quang. “Dia diinjak hingga tewas di tempat kejadian,” katanya kepada AFP. Deputi Direktur Federasi SirkusVietnam Nguyen Xuan Quang mengatakan ayah sang gadis membawa anaknya masuk untuk memberi makanan kepada gajah di dalam kandang yang kakinya telah dirantai. Ayah anak itu sedang berkomunikasi melalui telefon ketika serangan terjadi, ujar Quang. Anak itu sepertinya mengganggu gajah karena biasanya hewan yang bermain di sirkus berperilaku baik, tambah dia. “Kami telah menunda pertunjukan kami yang terakhir di kota itu pada Minggu akibat insiden tersebut,” kata Quang.

Israel Siarkan Daftar 500 Tahanan Palestina

JERUSALEM (Waspada): Israel menyiarkan daftar 500 tahanan Palestina yang akan dibebaskan. Ratusan tahanan tersebut akan ditukar dengan satu orang pasukan Israel yang saat ini ditahan oleh Hamas, yakni Gilad Shalit. Banyak orang yang tergabung dalam tahanan Palestina adalah para pejuang dari fraksi Hamas Palestina. Salah satunya adalah Nasser Iteima yang sempat melakukan pengeboman terhadap Israel. Pertukaran tahanan itu direncanakan akan berlangsung pada Selasa besok. “Bila Mahkamah Agung memiliki keputusan lain atau adanya tekanan yang dilakukan oleh Hamas, kesepakatan ini akan ditunda selama dua hari,” ujar juru bicara Perdana Menteri Israel, Yaakov Amidror, seperti dikutip Daily Mail, Senin (17/10). Para petinggi fraksi Hamas yang berkuasa di Gaza sudah menyiapkan sambutan yang hangat bagi ratusan tahanannya yang akan dibebaskan oleh Israel. Mereka akan disambut selayaknya seorang pahlawan. Jalanan di Gaza dipenuhi dengan bendera Palestina dan juga didekorasi untuk menyambut mereka. “Saya sangat bahagia, saya sudah tidak tahu lagi apa yang akan sayakatakan.Sudah20tahunlamanyasayatidakbertemudengannya,” ujar seorang ibu dari tahanan Palestina, Naseem al Kurd. Naseem adalah anggota fraksi Hamas yang ditahan oleh Israel sejak 1992 silam karena dirinya membunuh seorang warga Israel. Ibunya juga sudah memperingatkan Naseem agar tidak melakukanperlawanandantinggaldirumah,namunNaseemmenegaskan, dirinya harus tetap melakukan perlawanan.

Pusat Bisnis Thailand Dikosongkan BANGKOK, Thailand (Waspada): Daerah industri Navanakorn, Thailand, terpaksa dikosongkan dari penghuni setelah luapan air menggenangi daerah tersebut. Banjir masih terjadi di Bangkok, sebelumnya pihak berwenang telah menyatakan sebagian besar Bangkok bebas banjir. BBC dalam laporannya, air mulai memasuki area industri tertua di Thailand yang berlokasi 45 km dari Bangkok itu Senin (17/10). Sebanyak 1.000 tentara dan pekerja sibuk mengisi kantong pasir, memperkuat tanggul, serta menambal lubang sejak akhir pekan. PMYingluck Shinawatra sebelumnya sempat mengekspresikan optimisme bahwa Navanakorn tidak akan terdampak banjir. Namun hari ini ia harus mengakui bahwa usaha untuk menghalau banjir di Navanakorn gagal. “Saya prihatin mendengar air sudah memasuki Navanakorn karena kami sudah mengupayakan supaya zona industri tidak ikut kebanjiran,” kata PM Yingluck seperti dikutip dari Bangkok Post. Menurut Yingluck, kondisi diperparah dengan hujan deras sepanjang akhir pekan, ditambah dengan luapan air yang meninggi di utara Thailand. Marah Ratusan warga yang tidak senang terhadap para pejabat dari satu kawasan yang terkena banjir karena menghambat arus alami air di satu kanal besar di Ayutthaya Senin, dengan mengatakan mereka telah cukup menderita untuk menyelamatkan Bangkok dari banjir. Lebih dari 300 penduduk dari beberapa komunitas terkena banjir di distrik Uthai dan Phra Nakhon Si Ayutthaya berkumpul di satu jembatan di Khlong Khaomao di distrik Uthai. Para pekerja diinstruksikan oleh para pejabat irigasi yang mengendalikan saluran yang berada di kanal di bawah jembatan yang menyebabkan terhambatnya arus natural air dalam usaha menyelamatkan beberapa kawasan dari banjir. Khlong Khaomao menerima demikian besar volume air dari sungai Pasak, sebelum air tersebut mengalir ke kanal Khlong Nueng di provinsi Pathum Thani, melintasi lapangan Hantra, Rojana Industrial Park di distrik Uthai dan kawasan sebelah timur distrik Bang Pa-in. (bp/m10)

Para Putra Mubarak Miliki Jutaan Dolar AS Di Swiss


PARA wanita Palestina memegang gambar putra mereka — yang berada di penjara Israel — pada satu unjukrasa yang menyerukan

pembebasan mereka di markasbesar Palang Merah Internasional di Gaza City, Jalur Gaza, Senin (17/10). Israel dan Hamas telah saling menyetujui untuk melakukan tukar tahanan antara Gilad Shalit dengan ratusan tahanan Palestina di penjara Israel Selasa, demikian menurut seorang pejabat yang terlibat dalam perundingan yang ditengahi Mesir itu.

Protes Anti-Kapitalis Makin Marak Di Inggris LONDON, Inggris (Waspada): Para aktivis anti-kapitalis Inggris melancarkan aksi protes di London. Protes yang mereka gelar telah memasuki hari kedua dan sekira 250 orang saat ini mendirikan tenda di dekat kantor Bursa Saham London (LSX). Minggu, sekira 500 orang melancarkan protes dan 70 tenda didirikan. Kai Wargalla, adalah seseorang yang menjadi penggagas aksi protes ini. Dirinya mengorganisir aksi ini lewat jejaring sosial Facebook. “Para pekerja keuangan akan datang ke kota dan sulit untuk mengatakan, bagaimana mereka akan bertindak, namun kami merencanakan akan selalu terbuka,” ujar perempuan berusia 26 tahun itu, seperti dikutip AFP, Senin (17/10). Pada Sabtu pekan lalu, diperkirakan 2.000 hingga 3.000 sudah melancarkan protes mengecam keserakahan kaum korporat dan juga kebijakan ekonomi Pemerintah Inggris. Mereka juga melakukan aksi protesnya di depan

Katedral St Paul. Sebanyak delapan orang akhirnya ditangkap oleh kepolisian karena melakukanseranganterhadapkepolisian, dan juga melakukan tindak kekerasan. Kelompok demonstran ini menamakan dirinya sebagai Occupy LSX (London Stock Exchange). Mereka sudah mendapatkan dukungannya lewat jejaring sosial facebook dan juga twitter. Demonstrasi yang terjadi di Inggris tak jauh berbeda dengan apayangterjadidiAmerikaSerikat (AS). Pada pekan lalu, AS pun dilanda demonstrasi besar-besaran. Para demonstran AS bahkan memberikan nama pada kelompoknya dengan nama Occupy Wall Street. Mengglobal Para pengunjuk rasa di seluruh dunia turun ke jalan-jalan sejak Sabtu untuk memprotes kerakusan kaum kapitalis besar dan pemotongan anggaran pemerintah. Para penyelenggara menga-

takan demo diadakan di 951 kota di 82 negara dari Asia, Amerika, Afrika dan Eropa. Protes ini dilakukan menyusul demonstrasi anti-Wall Street di Amerika Serikat yang telah dilakukan dalam beberapa minggu terakhir. Ribuan orang berunjuk rasa di Australia dan Selandia Baru dan juga sejumlah kota di Asia. Beberapa ribu orang melakukan demonstrasi di Selandia Baru dan sekitar dua ribu orang di Sydney, Australia dalam gerakan yang bermula dari protes OccupyWall Streeet atau Duduki Wall Street di New York. Penyelenggara demo dunia 15Oktoberinimengatakandalam situs mereka tujuannya adalah “melakukan perubahan global seperti yang kami inginkan. Kami bersatu dalam satu suara, kami akan memberitahu politisi dan pihak elit keuangan bahwa kamilah, rakyat yang memutuskan masa depan kami,” kata pernyataan penyelenggara. Demonstrasi lebih kecil diselenggarakan di Hongkong, Tai-

Sheikh Mohammad Al-Nujaimi:

Wanita Tak Boleh Bicara Dengan Pria Bukan Muhrimnya Meski Via Telefon


SEORANG tentara Thai menggendong seorang wanita melalui jalanan yang digenangi banjir di provinsi Pathum Thani, Thailand, Senin (17/10). Pemerintah Thailand meminta sejumlah pabrik besar di Zona Industri Nava Nakorn di provinsi Pathum Thani untuk menghentikan operasinya karena banjir, kata Pusat Operasi Pengendalian Banjir Senin.

MANILA, Filipina (AP): Seorang senator Filipina telah mengajukangugatankriminalterhadapmantanPresidenGloriaMacapagal Arroyo karena dugaan melakukan kecurangan dalam pemilihan 2007 yang merampoknya kemenangan dari tangannya. Senator Aquilino‘Koko’ Pimentel III mengatakan bahwa dia juga memasukkan suami Arroyo dan sejumlah pejabat senior lainnya selamamasakepresidenannyadalamgugatantersebutyangdiajukannya Senin(17/10)kepadasatupanelpenyelidikgabungandariDepartemen Kehakiman dan Komisi Pemilihan (Comelec). Pimentelmengatakantindakankecuranganitumemungkinkan calon pro-Arroyo ketika itu, Juan Miguel Zubiri, untuk mengalahkannya hanya beberapa ribu suara saja. Pimentel mengajukan protes kepada mahkamah pemilihan Senat, yang menyatakan dia sebagai pemenang pemilihan August setelahdilakukanpenghitunganulangyangpanjang.Zubirimengundurkan diri dan Pimentel mengambil alih kursinya. Arroyo membantah telah melakukan kecurangan dalam pemilihan tersebut.(m10)

ADA sebagian orang yang beranggapan sepasang wanita dan pria yang tak punya hubungan darah dapat saja berhubungan telefon karena mereka tidak saling bersentuhan atau saling pandang, namun menurut seorang ulama Saudi tindakan seperti itu sama sekali tidak dibenarkan menurut ajaran Islam. Susahnya ada yang sengaja memutarbalikkan pernyataan seorang ulama Saudi itu seolaholah dia tidak melarang pembicaraan telefon tanpa diawasi antara kaum wanita muda dan para pria sebelum mereka terikat pertunanganan. Sheikh Mohammad al-Nujaimi mengatakan dia tidak pernah mengatakan melalui media online bahwa Islam tidak melarang pembicaraan telefon tanpa pengawasan antara perempuan muda dan laki-laki sebelum mereka bertunangan. Sheikh itu sebelumnya dilaporkan telah memberitahu pemberitaan online Awj bahwa sahsah saja bagi seorang pria dan wanita untuk saling berkenalan lewat telefon satu sama lain sebelum sang pria mengajak untuk mengikat tali perkawinan dengan sang wanita. Al-Nujaimi menambahkan dalam wawancara itu bahwa wanita tidak harus diawasi oleh seorang lelaki walinya atau ibunya saat berbicara dengan pria tersebut dan mereka keduanya seharusnya tahu batas-batasnya. Al-Nujaimi mengatakan kepada Arab News wartawan telah salah kutip pernyataannya. “Ini benar-benar keliru, saya tak pernah mengatakan para wanita dapat berbicara lewat telefon dengan

kaum pria sebelum mereka menikah. Apa yang saya katakan, benar-benar berlawanan,” katanya. “Saya katakan padanya bahwa jika kedua keluar-ga senang dengan pembicaraan sang pengantin dan mempelai pria di telefon, maka sang wanita harus ditemani oleh ibunya atau pria walinya guna mengawasi pembicaraan yang mereka lakukan.” Rusaknya, ketika Arab News melakukan kontak dengan sang wartawan yang dikatakan salah kutip itu, dia menolak untuk memberikan rekaman wawancaranya. Awj juga melaporkan bahwa Al-Nujaimi menyarankan agar para wanita menikah dengan pria yang telah mereka kenal dan dengar tentang keluarganya. Namun, ini bukan berarti mencegah perkawinan dengan partner potensialnya dari daerah lain, katanya, yang menambahkan bahwa lebih baik jika sang pengantin wanita tahu sedikit tentang mempelai prianya sebelum mereka menikah. Seorang wali harus mengawasi pembicaraan telefon antara pasangan yang belum menikah itu, kata Al-Nujaimi kepada Arab News. “Tanpa seorang wali, wanita seharusnya tidak boleh berbicara dengan pria yang tak punya hubungan keluarga dengannya,” katanya. “Seandainya seorang wanita muda merasa canggung dengan kehadiran orangtuanya pada saat dia berbicara melalui telefon dengan seorang pria asing, maka dua harus diawasi oleh abangnya,” kata al-Nujaimi. (an/mujo)

peh,Tokyo dan Manila menyusul seruan di Facebook untuk mengecam ketidakadilan ekonomi. The Associated Press melaporkandariRoma,kepolisianItalia menembakkan gas airmata dan meriamairsetelahsejumlahpemrotesmemecahkanjendelapertokoan dan bank-bank, membakar mobil dan melemparkan bombom botol. Kritikan Di Sydney, Australia, sekitar 2.000 orang termasuk perwakilan kelompokAborigin,komunisdan serikat buruh, turun ke jalan-jalan di luar bank sentral Australia, kata Reuters. Sekitar 1.000 orang berkumpul di Melbourne dan ratusan di Selandia Baru, termasuk kota Auckland, Wellington dan Christchurch. Unjuk rasa yang sama juga dilangsungkan di Korea Selatan dan Hongkong. Sekitar 1.500 orang mengatakan melalui Facebook bahwa mereka akan ikut serta dalam unjuk rasa Duduki Taipeh di luar gedung tertinggi di Taiwan. WartawanBBCdiTaipeh,Cindy Sui mengatakan demonstrasi seperti itu jarang terjadi di Taiwan yang memiliki tradisi lebih memperhatikan keluarga dibandingkan kepentingan negara. (bbc/cnn/ap/m10/m23)

KAIRO, Mesir (AP): Seorang pejabat Kementerian Kehakiman Mesir mengatakan dua putra presiden terguling Hosni Mubarak memiliki rekening kira-kira AS$340 juta di bank Swiss. Assem al-Gohary mengatakan pihak berwenang Swiss sedang menyelidiki apakah salah seorang putranya, Alaa, terlibat dalam pencucian uang bersama dengan tokoh-tokoh dari bekas rezim tersebut. Di dalam negeri, Mubarak dan putra-putranya telah dituduh melakukan korupsi. Swiss telah membekukan aset Mubarak dan konco-konconya. Al-Gohary mengatakan hampir semua aset tersebut adalah milik putra-putranya. Jaksa Agung Mesir telah membekukan aset keluarga mantan presiden tersebut pada 20 Februari lalu, 18 hari setelah terjadi pergolakan yang menggulingkan Mubarak. (m10)

PM Jordania Undurkan Diri AMMAN, Jordania (AP): Seorang pejabat senior pemerintah Jordania mengatakan PM negeri itu telah mengajukan pengunduran diri, sehari setelah satu mayoritas parlemen menyerukan penggulingannya. PMMaroufal-Bakhitsecaraluasdianggap sebagaitelahmenyeret kakinya untuk menawarkan paket reformasi politik. Pengumuman pengunduran dirinya Senin (17/10) dikeluarkan sehari setelah 70 dari 120anggotapalemenmenyerukanagarRajaAbdullahIImemecatnya. Pejabat pemerintah mengatakan Awn al-Khasawneh, deputi ketua Mahkamah Internasional merupakan calon kuat untuk menggantikan al-Bakhit. Pejabat tersebut tak ingin disebutkan namanya karena dia tidak dibenarkan memberikan keterangan mengenai perubahan di pemerintahan sebelum raja menyetujuinya. (m10)

Presiden Taiwan Ingin Damai Dengan China TAIPEH,Taiwan (AP): PresidenTaiwan MaYing-jeou mengatakan Senin (17/10) dia ingin menandatangani satu perjanjian damai dengan China, jika rakyat Taiwan menyetujuinya. Ma menghadapi satu usaha untuk terpilih kembali dalam pemilihan Januari dan pertanyaan hubunganTaiwan dengan China diperkirakan akan mendominasi kampanyenya. Masa kepresidenannya 3 1/2 tahun telah berlabuh pada peningkatanhubungandenganBeijing.Meskipungagasantentangperjanjian damai telah datang sebelumnya, ini adalah indikasi terkuat namun dia berniat untuk menekankan kemajuan hubungan itu selama masa jabatan keduanya. Taiwan memisahkan diri dari China di tengah perang saudara tahun 1949. China masih menyatakan kepulauan Taiwan adalah milikChinadanbersumpahakanmenggabungkannyakembali,kalau perlu scara paksa. Berbicara kepada para wartawan Senin, Ma mengatakanjikaterpilihkembalidiaakanmemajukanidepersetujuan damai — yang didasarkan pada konsensus domestik. “Sayainginmempertimbangkankemungkinanmenandatangani satuperjanjiandamaidenganChinadibawahpengawasanparlemen. Ma juga menyarankan agar kedua belah pihak harus mendirikan kantor-kantor perwakilan di masing-masing wilayah untuk merembukkan kelanjutan perundingan lintas selat, yang sejauh ini hanya terkonsenstrasi pada hubungan ekonomi. Ma dalam pemilihan mendatang akan menghadapi Tsai Ing-wen dari Partai Demokrat Progresifpadapemilihan14Januari.Pollpendapatumummenunjukkan terjadinya persaingan ketat antara keduanya.(m10)


SEORANG anggota keluarga mencium wajah seorang jamaah calon Haji Kashmir sebelum dia berangkat menuju Makkah, Arab Saudi, di Srinagar, Kashmir, Senin (17/10). Gelombang pertama jemaah calon haji yang terdiri dari 145 warga Kashmir berangkat Senin untuk menunaikan ibadah Haji di Makkah. Sebanyak 8.300 jamaah calon Haji dari Kashmir mengharapkan akan dapat menunaikan ibadah Haji tahun ini, kata salah seorang pejabat.


WASPADA Selasa 18 Oktober 2011

Klasemen Liga Premier Man City Man United Chelsea Newcastle Liverpool Tottenham Stoke City Aston Villa Norwich Arsenal QPR West Brom Swansea Fulham Everton Wolves Sunderland Bolton Wigan Blackburn

8 8 8 8 8 7 8 8 8 8 8 8 8 8 7 8 8 8 8 8

7 6 6 4 4 4 3 2 3 3 2 2 2 1 2 2 1 2 1 1

1 2 1 4 2 1 3 5 2 1 3 2 2 4 1 1 3 0 2 2

0 0 1 0 2 2 2 1 3 4 3 4 4 3 4 5 4 6 5 5

27-6 22 25-6 20 20-9 19 11-6 16 11-9 14 13-12 13 6-8 12 10-9 11 10-11 11 12-17 10 6-14 9 7-10 8 7-12 8 10-9 7 7-11 7 6-12 7 10-10 6 12-22 6 6-14 5 9-18 5

Minggu, 16 Oktober West Brom v Wolves Arsenal v Sunderland Newcastle v Tottenham

Sabtu, 15 Oktober Liverpool v Man United Norwich v Swansea Stoke City v Fulham Wigan Ath v Bolton QPR v Blackburn Man City v Aston Villa Chelsea v Everton

2-0 2-1 2-2 1-1 3-1 2-0 1-3 1-1 4-1 3-1

Pencetak Gol Terbanyak 9 8 6 5

Wayne Rooney (MU) Sergio Aguero (Man City) Edin Dzeko (Man City) Robin Van Persie (Arsenal) Demba Ba (Newcastle)

Klasemen Liga Seri A Juventus 6 3 3 0 9- 3 12 Udinese 6 3 3 0 7- 1 12 Cagliari 6 3 2 1 8- 5 11 Lazio 6 3 2 1 9- 7 11 Napoli 6 3 1 2 10-5 10 Palermo 6 3 1 2 9- 9 10 Chievo 6 2 3 1 6- 5 9 Catania 6 2 3 1 7- 8 9 Parma 6 3 0 3 8-11 9 Fiorentina 6 2 2 2 6- 4 8 Genoa 6 2 2 2 9- 8 8 AS Roma 6 2 2 2 7- 6 8 AC Milan 6 2 2 2 8- 8 8 Siena 6 1 3 2 4- 4 6 Novara 6 1 2 3 10-12 5 Atalanta 6 3 2 1 8- 7 5 Inter Milan 6 1 1 4 8-13 4 Bologna 6 1 1 4 4-10 4 Lecce 6 1 1 4 3- 9 4 Cesena 6 0 2 4 2- 7 2 *Atalanta minus 6 poin karena judi.

Levante Realistis Selevel Barca



bahnya. Tim yang terhindar dari degradasi dengan keunggulan dua poin pada musim lalu itu, memimpin laga melalui gol Jose Barkero mdengan memanfaatkan bola yang melenting dari gelandang Malaga Enzo Maresca menit 14. Derita Malaga tambah parah ketika kipernya Willy Caballero mendapat kartu merah menit 28, karena memegang bola di luar daerah pertahanannya. Bola dari titik bebas yang ditendang Barkero, dimanfaatkan Juanlu Gomez untuk menaklukkan penjaga gawang pengganti Ruben Martinez. Menit 40 Ruben kembali gagal menjalankan tugasnya dengan baik. Dia kebobolan saat bola melayang dari jarak jauh dan Arouna Kone berhasil menjentikkannya. “Di sepakbola sangat sulit untuk meraih kemenangan, terutama lima kemenangan beruntun di La Liga, tetapi kami berhasil melakukannya,” klaim Ignazio. (m15/goal/espn)

kompetisi masih panjang,” katanya menambahkan. Penyerang Prancis itu memecahkan kebuntuan PSG menit kedua pada laga yang berlangsung di Stade Francois Coty di Pulau Korsika. Gameiro menendang jitu bola dari jarak pendek, memanfaatkan umpan dari Anderson Nene. Tim tuan rumah menyamakan skor menit 24 melalui Carl Medjani, setelah PSG gagal memanfaatkan kemelut di mulut gawang lawan. 11 Menit jelang turun minum, Nene menghalau bola dari kaki Richard Socrier yang nyaris nyelonong ke gawang PSG. Socrier juga mencoba kiper Salvatore Sirigu lewat tendangan keras pada babak kedua, sebelum Gameiro menambah angka timnya beberapa saat kemudian. Clement Chantome menjadi penentu permainan menit 54. Ketika mendapat bola, dia meneruskannya kepada Gameiro yang dengan cepat membuat hatrik keduanya musim ini. PSG pun menang untuk keempat kalinya secara beruntun di Ligue 1 dan pelatih Antoine Kombouare memuji permainan pasukannay, terutama Gameiro. “Dia memiliki mental pemain besar dan tidak pernah merasa khawatir. Dia harus mendapat penghargaan karena tiga golnya itu,” sanjung Kombouare. (m15/ant/afp)

Menlu Lepas Peserta Peduli Hutan Sumatera JAKARTA (Waspada): Menteri Luar Negeri Marty Natalegawa dan Gubernur DKI Jakarta Fauzi Bowo resmi melepas peserta kegiatan petualangan menggunakan 40 unit bajaj yang melintasi tiga negara dalam rangka penggalangan dana bertajuk ‘ASEAN Rickshaw Run 2011’ (ARR), di Gedung ASEAN Secretariat Jakarta, Minggu (16/10). Sebanyak 66 peserta dari 12 negara akan menempuh perjalanan mengendarai bajaj sejauh 3000 km dari Gedung ASEAN Jl SM Raja Jakarta menuju arah Barat dan Sumatera menuju Belawan (Sumut), menyeberangi Selat Malaka ke Penang (Malaysia), lalu singgah di daratan Satun (Thailand) sebelum diperkirakan finish di Bangkok, 30 Oktober mendatang. Sehari sebelumnya, ASEAN Secretariat menggelar pertandingan persahabatan antara Tu-


Putih melangkah, mematikan Hitam dalam empat langkah.

Jawaban di halaman A2. 8







1 D


Catania v Inter Milan Napoli v AC Parma AC Milan v Palermo

2-1 1-2 3-0

Pencetak Gol Terbanyak 5 Sebastian Giovinco (Parma) Rodrigo Palacio (Genoa) 4 German Denis (Atalanta) Antonio Di Natale (Udinese) Miroslav Klose (Lazio) Pablo Osvaldo (Roma)

Klasemen Liga Primera Barcelona Levante Real Madrid Sevilla Valencia Malaga Real Betis Atl Madrid Zaragoza Espanyol Mallorca Sociedad Villarreal Osasuna Vallecano Ath Bilbao Getafe Grenada Santander S Gijon

7 7 7 7 7 7 7 7 7 7 7 7 7 6 7 6 7 7 7 7

5 5 5 4 4 4 4 2 2 3 2 2 1 1 1 1 1 1 0 0

2 2 1 3 2 1 0 3 3 0 2 1 4 4 3 2 2 2 4 1

0 0 1 0 1 2 3 2 2 4 3 4 2 1 3 3 4 4 3 6

26-4 17 11-3 17 24-6 16 8-4 15 10-7 14 10-7 13 10-11 12 8-6 9 9-13 9 6-11 9 6-8 8 7-10 7 7-11 7 5-12 7 6-11 6 7-9 5 6-10 5 2-8 5 4-12 4 3-12 1

Minggu, 16 Oktober Vallecano v Espanyol Zaragoza v Sociedad Levante v Malaga Sevilla v S Gijon

Sabtu, 15 Oktober Barcelona vs Santander Getafe vs Villarreal Granada vs Atl Madrid Mallorca vs Valencia Madrid vs Real Betis

0-1 2-0 3-0 2-1 3-0 0-0 0-0 1-1 4-1

Pencetak Gol Terbanyak 10 8 7 5

Lionel Messi (Barcelona) Gonzalo Higuain (Madrid) Cristiano Ronaldo (Madrid) Radamel Falcao (Atletico) Roberto Soldado (Valencia) 4 Imanol Agirretxe (Sociedad) Santi Cazorla (Malaga) Cesc Fabregas (Barcelona) Nicolas Miku (Getafe)

Klasemen Ligue 1 Paris SG Montpellier Lyon Lille Rennes Toulouse Lorient Caen St-Etienne Auxerre Sochaux Dijon Nice Valencs Marseille Brest Evian Bordeaux Ajaccio Nancy

10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10

7 6 6 5 5 5 4 4 3 2 3 3 2 2 1 0 1 1 1 0

2 2 2 4 3 3 4 3 4 6 3 2 4 3 6 8 5 5 4 5

1 2 2 1 2 2 2 3 3 2 4 5 4 5 3 2 4 4 5 5

19- 8 23 22-14 20 17-10 20 18-11 19 20-14 18 12-10 18 12- 9 16 14-12 15 10-13 13 16-14 12 16-22 12 11-20 11 11-10 10 12-12 9 10-12 9 8-10 8 10-15 8 11-17 8 10-20 7 7-13 5


Sukses I Biancoceleste sekaligus mengakhiri lima kekalahan beruntun mereka dalam laga antar tim sekota melawan Srigala Merah. Pablo Osvaldo membuat Roma unggul lebih dahulu menit kelima. Itu gol keempatnya dalam empat laga beruntun dan skor 0-1 bertahan hingga turun minum. Lima menit memasuki babak kedua, Simon Kjaer dikeluarkan dari lapangan karena menjatuhkan gelandang Lazio Christian Brocchi di kotak terlarang. Hernanes pun menyamakan angka melalui tendangan 12 pas. Saat derbi ibukota Italia sepertinya akan berakhir seri, Klose muncul sebagai penentu kemenangan dengan membikin malu Il Lupo. “Mamma mia, hasil akhir apa ini! Ini memalukan. Kami berpikir hasilnya akan imbang, tapi kami tidak mendapat keberuntungan,” ujar allenatorre Roma Luis Enrique dalam Football Italia, Senin (17/ 10). “Tanpa keraguan, kami harusnya bisa melakukan performa lebih di babak pertama. Kami mengawali

laga dengan penguasaan bola luar biasa,” tambah pelatih asal Spanyol tersebut. Pelatih Lazio Edy Reja yang diusir wasit karena berlebihan merayakan sukses skuadnya, mengaku kemenangan itu akan mengangkat martabat Biancoceleste. “Akhirnya kami pantas menang dan kami memenangi laga derbi, ini membuat lega pendukung kami. Saya harap, setelah saya dikeluarkan segala sesuatunya lebih mudah,” tutur Reja. “Ini kemenangan yang layak kami dapatkan. Sudah lama kami merindukannya,” timpal Hernanes. “Kami mengupayakan segala cara untuk meraih kemenangan ini. Akhirnya Matuzalem mengimkan umpan manis yang kemudian diselesaikan dengan baik oleh Klose,” lanjut gelandang asal Brazil itu. Hernanes pun berharap, Biancoceleste bisa mempertahankan performa terbaiknya. Dia juga lega, akhirnya bisa membantu Lazio mematahkan rekor lima kekalahan beruntun dari Srigala Merah dalam Derby Della Capitale. “ Rasanya seperti mele-

Minggu, 16 Oktober Ajaccio v Paris SG Valencs v Sochaux Rennes v Lorient

Sabtu, 15 Oktober Montpellier v Dijon AJ Auxerre v Lille Lyon v AS Nancy Toulouse v Marseille Stade Brest v Caen Evian v St-Etienne Nice v Bordeaux

1-3 3-0 2-0 5-3 1-3 3-1 0-0 1-1 1-2 3-0

Pencetak Gol Terbanyak

8 Kevin Gameiro (PSG) 7 Olivier Giroud (Montpellier) Bafetembi Gomis (Lyon) 6 Alain Traore (Auxerre) 5 Dennis Oliech (Auxerre) Javier Pastore (PSG) (jonny/afp/espn)


pas segala beban yang ada di bahu. Sekarang yang

harus dilakukan adalah tetap terus meningkatkan

per mainan,” pungkas Hernanes. (m15/afp/fi/tf)

kan kedudukan. Namun hasil imbang tidak bertahan lama, trio striker Polres yang dipercayakan kepada Marzuki, Budiman Bostang Panjaitan, dan Bambang Rubiatno membongkar pertahanan lawan. Alhasil, Bambang Rubiatno mencetak gol di menit 39 dan

42. Barulah di babak kedua gawang Polres Asahan yang dikawal Rizal kemasukan lagi berkat andil Suheri. Masuknya Tri Pamungkas, Faisal Napitupulu, dan Ridean Lubis pun menambah denyut tekanan bagi Polres. Akhirnya Bambang Rubiatno membukukan hatrik dengan mencetak gol keempat bagi Polres Asahan di menit 83. Kemenangan skuad polisi ini disempurnakan Marzuki jelang bubaran. (a10/a15/a31)

Polres Asahan Pukul BSP 5-2 Pemanasan Liga Waspada KISARAN (Waspada): Persiapan PS Polres Asahan menuju Liga Waspada Oldcrack semakin matang. Teraktual, Polres memukul tim tangguh BSP 5-2 dalam laga ujicoba di Stadion Mutiara Kisaran, Senin (17/10). Sebelumnya, mereka mem-

bungkam PS Wartawan dan PS DPRD Asahan. Turun awal tanpa Faisal Napitupulu di lini depan, PS Polres Asahan langsung mengepung pertahanan BSP yang diperkuat Warimin, mantan pemain PSSA Asahan. Dalam kemelut di depan gawang BSP

pada menit 14, Polres mencetak gol hasil tendangan Alfid Pasaribu yang meneruskan umpan Rusdi. Tak lama berselang, BSP bangkit dan mulai menekan Polres Asahan sekaligus memperkuat pertahanan. Menit 19, BSP melalui Zulfan menyama-

nas Kinantan melawan Rickshaw Lover’s (pecinta kendaraan roda tiga) di Lapangan Bhayangkara, Jakarta. Tunas Kinantan, klub Divisi III Persija Jakarta yang diperkuat mantan pemain PSMS Medan, Aulia Siregar, masih terlalu tangguh bagi lawannya. Aulia cs sukses menekuk tim ‘gadogado’ itu 9-5. Penanggungjawab event, Drs Henry Gultom SH MPP, menjelaskan ARR 2011 bertujuan menyukseskan kegiatan ASEAN termasuk promosi pariwisata. Selain itu, pria kelahiran Tapanuli Utara ini mengatakan ARR juga bertujuan menggalang dana bagi konservasi hutan di Sumatera yang menjadi wilayah kerja “Birdlife International”, yakni organisasi konservasi independen berbasis keanggotaan dan jaringan. (yuslan)

Problem Catur


Sabtu, 15 Oktober

0-0 0-0 0-0 0-0 0-0 0-2 2-1

ROMA (Waspada): Gebrakan Miroslav Klose (foto) 20 detik jelang akhir laga, Minggu (Senin WIB), memastikan SS Lazio menaklukkan AS Roma 2-1 dalam derbi di Olimpico Stadium.

Gameiro Harapkan Bukan Hatrik Terakhir PARIS (Waspada): Hatrik gol Kevin Gameiro memenangkan Paris Saint-Germain 3-1 atas Ajaccio, Minggu (SeninWIB), sehingga tim ibukota itu makin mantap di puncak klasemen Ligue 1 Prancis. “Saya gembira dapat membuat hatrik. Ini yang kedua dalam karir saya dan saya harapkan itu bukan yang terakhir,” ujar Gameiro melalui AFP, Senin (17/10). “Kami memimpin. Tetapi kami belum dapat mengomentari pertandingan lebih lanjut, karena


Cesena v Fiorentina Atalanta v Udinese Cagliari v Siena Chievo v Juventus Genoa v US Lecce Novara v Bologna Lazio v AS Roma

Mamma Mia Srigala Merah

MADRID (Waspada): Levante menggunduli 10 pemain Malaga 3-0, Minggu (Senin WIB), sehingga kini selevel dengan juara bertahan Barcelona di puncak klasemen La Liga Primera. Klub semenjana bermarkas di Kota Valencia itu kini mengoleksi 17 poin, hanya kalah selisih gol dari El Barca yang sebelumnya juga menang telak 3-0 atas Racing Santander. Rasa tidak percaya pun ditunjukkan entrenador Levante Juan Ignazio (foto) setelah skuad menggebuk tim penuh bintang Malaga. “Kami jelas memenangkan laga ini, tapi kami harus realistis. Saya tidak menyangka bisa mendapatkan hasil ini. Malaga memiliki banyak pemain bagus,” ucap Ignazio, seperti dilansir Goal, Senin (17/10). Padahal, Levante hanya mengandalkan serangan balik dalam duel tersebut. Kendati kini selevel Barca, Ignacio enggan jumawa mengenai kans timnya. Dia Ignacio tetap berpegang pada target awal timnya, hanya lolos dari degradasi pada akhir musim nanti. “Kami mesti menikmati semua yang telah terjadi, tetapi kami tahu liga masih sangat panjang dan kami akan menderita dalam mencari poin. Kami akan mengejar target untuk mendapat 42 poin di bulan April, saya berharap kami bisa mendapatkan itu sebelum waktunya,” tam-


Minggu, 16 Oktober




STRIKER PS Polres Asahan, Marzuki, melengkapi kemenangan timnya atas BSP dalam laga ujicoba jelang Liga Waspada Oldcrack di Stadion Mutiara Kisaran Senin (17/10). -Waspada/Nurkarim Nehe-



1. Perbuatan (hal dsb) memperteguh atau memperkuat (persatuan dsb), misalnya di dalam tubuh parpol. 5. Partai berlambang Ka’bah. 7. Reka ulang. 10. Surat Perintah. 12. Singkatan Pusat Pelaporan dan Analisis Transaksi Keuangan, pengusut aliran dana korupsi. 13. Bundel. 15. Negara yang hancur dibuat AS dan sekutunya, hanya untuk menangkap Saddam dkk. 17. Hak perlindungan kepada seseorang dari peniruan, pembajakan dsb. 18. Bantuan Likuiditas Bank Indonesia. 20. Ahli dalam bidang menyusun, mengawasi dsb tata buku dan administrasi perusahaan atau instansi pemerintah. 21. Bersikap bertahan. 23. Kertas bernilai untuk sogok menyogok. 24. Perbuatan menyelesaikan perbedaan. 25. Panitia Khusus. 26. Salah satu hak DPR.


1. Hak Mahkamah Agung dalam meninjau atau membatalkan putusan hakim. 2. Negara Kesatuan Republik Indonesia. 3. Minta dengan sangat; Memaksa 4. Masalah yang dikedepankan; Kabar angin. 6. Wanita yang berurusan dengan pengadilan versus rumah sakit. 8. Kudeta. 9. Orang yang menderita akibat suatu kejadian atau perbuatan. 11. Lapisan sosial yang paling rendah, khususnya golongan buruh yang hanya mampu hidup dari menjual tenaga. 12. Peninjauan Kembali. 14. Kata sifat (adjective) dari segala sesuatu yang berhubungan dengan senat atau senator. 16. Bersifat berpihak; Suka menyusahkan. 17. Bingkisan lebaran, selalu diimbau agar tidak diterima pejabat. 19. Bagian dari Kementerian Hukum dan HAM yang mengeluarkan paspor. 20. Pelepasan hak, wewenang atau kekuasaan; Turun tahta dengan sukarela (tentang seorang raja). 22. Kelompok dalam badan legislatif.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: mudah (**), bisa diselesaikan dalam waktu tak sampai tujuh menit. Jawabannya lihat di halaman A2 kolom 1.

8 1 3 2 4 7 9 5 6

6 4 9 1 5 3 2 8 7

7 2 5 8 6 9 4 1 3

2 7 8 9 1 6 5 3 4

9 6 1 5 3 4 7 2 8

5 3 4 7 8 2 6 9 1

4 5 7 3 2 1 8 6 9

1 9 2 6 7 8 3 4 5

3 8 6 4 9 5 1 7 2 **201



WASPADA Selasa 18 Oktober 2011

Madrid-Lyon Lebih Dini MADRID (Waspada): Real Madrid (Spanyol) dan Olympique Lyon (Prancis) cukup sering bertemu di Liga Champions dalam satu dasawarsa terakhir.


BEK senior MU Rio Ferdinand belum bisa berkolaborasi dengan tandemnya Nemanja Vidic (kanan belakang) di markas Otelul Galati.

MU Tinggalkan Ferdinand LONDON ( Waspada): Manajer Manchester United (MU) Sir Alex Ferguson mesti membuat keputusan sulit di tengah padatnya jadwal laga pasukannya. Ferguson bahkan meninggalkan bek Rio Ferdinand untuk partai tandang melawan Otelul Galati pada matchday 3 Liga Champions Grup C dinihari WIB nanti. Ferdinand tampil impresif saat Setan Merah menahan 1-1 Liverpool akhir pekan lalu di Anfield. Namun menurut Sky Sports, Senin (17/10), Ferguson tidak memboyongnya ke Rumania, agar kondisi Ferdinand fit ketika melawan Manchester City akhir pekan mendatang di Liga Premier. Peran pemimpin di jantung pertahanan MU akan diemban bek Serbia Nemanja Vidic, yang dicadangkan ketika menghadapi Liverpool. Posisi Phil Jones kemungkinan dikembalikan sebagai bek tengah, setelah dia sempat menjadi gelandang di Anfield. “Itu sebuah kejutan. Tetapi pelatih mengatakan, saya ber-

Matchday 3 Liga Champions Malam Ini (GMT) Grup A Napoli (Italia) v Bayern Munich (Jerman) Man City (Inggris) v Villarreal (Spanyol) Grup B CSKA Moscow (Rusia) v Trabzonspor (Turki) LOSC Lille (Prancis) v Inter Milan (Italia) Grup C FC Basel (Swiss) v SC Benfica (Portugal) Otelul Galati (Rumania) v Man United (Inggris)

18.45 18.45 15.00 18.45 18.45 18.45

Grup D Dinamo Zagreb (Kroasia) v Ajax (Belanda) Real Madrid (Spanyol) v Lyon (Prancis) *RCTI Live mulai pkl 01.45 WIB main di sana, tidak ada argumentasi,” jelas Jones. “Cukup sulit (main sebagai gelandang) karena saya lama tidak bermain di sana. Terakhir kali saya bermain di sana ketika membela Blackburn beberapa waktu lalu,” kenangnya. “Tetapi saya telah beradaptasi dan berpikir mengenai upaya menghancurkan skema permainan dan membuat (duel) menjadi sulit bagi Liverpool di lini tengah,” tambah Jones. Vidic dan Jones akan di-

18.45 18.45

dampingi Patrice Evra dan Chris Smaling, karena Rafael masih bergelut dengan cedera bahu. Mereka akan membentengi gawang kiper David De Gea, yang menurut Ferdinand, kemungkinan mampu meneruskan peran kiper legendaris MU Edwin van der Sar. “De Gea punya tugas besar menggantikan kiper legendaris United, tapi dia akan menjawabnya dengan penampilan di bawah mistar,” tegas bek Inggris tersebut. (m15/okz/sky)

Napoli Menyerang Demi Redam Gomez ROMA (Waspada): Napoli mesti menemukan cara menghentikan mesin gol Bayern Munich Mario Gomez pada matchday 3 Liga Champions Grup A dinihari WIB nanti di San Paolo. Gomez sedang bersinar di awal musim ini. Dia telah mencetak sepuluh gol di sembilan laga Bundesliga dan membukukan dua gol saat Munich menundukkan Citizens 2-0 pada matchday 2 lalu. Caranya menurut allenatorre Napoli Walter Mazzarri dengan bermain menyerang. “Kami harus 100 persen bermain brilian, dan mencari cara untuk memecah kebuntuan,” ujar Mazzarri, Senin (17/10). “Tim yang bermain dengan imbang, memberi kami peluang untuk mengekpresikan diri. Bermain melawan tim tersebut, akan membuat beberapa hal berjalan baik,” katanya lagi. Munich diprediksi akan bermain menyerang dan sejauh ini memang sangat subur dalam mencetak gol. Musim ini mereka malah pernah membukukan tujuh gol dalam satu laga. Selain Gomez, FC Hollywood juga masih memiliki sosok berbahaya dalam diri pemain sayap asal Prancis Franck Ribery dan bintang Belanda Arjen Robben. Tetapi Napoli pun punya trisula maut yang bisa mengimbangi ketajaman Bayern. Edinson Cavani, Marek Hamsik dan Ezequeil Lavezzi. Berkat mereka, musim ini buat pertama kalinya I Partenofei berlaga di Liga Champions, pasca era kebintangan Diego Armando Maradona. Napoli memulai perjalanan dengan cukup baik, imbang saat menghadapi Manchester City dan menang atasVillarreal. Bersama mereka, Mazzarri optimis bahwa laga melawan tim besar justru sangat positif bagi permainan Napoli. “Saat sebuah tim datang ke sini (San Paolo) dengan tu-

Namun laga pada matchday 3 Grup D di Santiago Bernabeu dinihariWIB nanti, terjadi lebih dini ketimbang pertemuan dalam dua musim terakhir. Musim lalu, kemenangan agregat 4-1 mengantarkan Madrid ke babak perempatfinal. Setahun sebelumnya, Lyon yang melaju dengan keunggulan agregat 2-1. Los Blancos yang lebih sering menjadi pecundang dibanding pemenang saat menghadapi Les Gones, sangat berambisi merengkuh titel juara Liga Champions yang kesepuluh. Itulah misi utama entrenador Jose Mourinho, yang terbukti sukses pada tahun keduanya bersama FC Porto dan Inter Milan. Mourinho pun cenderung diuntungkan saat menjamu langganan timnya. Sebab, hanya Raul Albiol, Ricardo Carvalho, Lass Diarra dan Nuri Sahin yang tidak dapat dimainkannya. Pelatih asal Portugal itu bahkan sedang bergembira dengan kembalinya performa terbaik bintang Brazil Ricardo Kaka dan penyerang Argentina Gonzalo Higuain. Kaka menyumbang satu gol saat Madrid melibas Real Betis 4-1 akhir pekan lalu di La Liga Primera. Higuain lebih gemilang lagi dengan mencetak hatrik, yang ketiga kalinya dalam sebulan terakhir.

Klasemen Grup A Bayern Munich Napoli Manch City Villarreal

2 2 2 2

2 1 0 0

0 1 1 0

0 0 1 2

4-0 3-1 1-3 0-4

6 4 1 0

Klasemen Grup B Trabzonspor Inter Milan LOSC Lille CSKA Moscow

2 2 2 2

1 1 0 0

1 0 2 1

0 1 0 1

2-1 3-3 3-3 4-5

4 3 2 1

Klasemen Grup C FC Basel Benfica Man United Otelul Galati

2 2 2 2

1 1 0 0

1 1 2 0

0 0 0 2

5-4 2-1 4-4 1-3

4 4 2 0

Klasemen Grup D Real Madrid Lyon Ajax Dinamo Zagreb

2 2 2 2

2 1 0 0

0 1 1 0

0 0 1 2

4-0 2-0 0-3 0-3

6 4 1 0

Klasemen Grup E Chelsea Leverkusen Valencia RC Genk

2 2 2 2

1 1 0 0

1 0 2 1

0 1 0 1

3-1 2-2 1-1 0-2

4 3 2 1

Klasemen Grup F Marseille Arsenal Dortmund Olympiakos

2 2 2 2

2 1 0 0

0 1 1 0

0 0 1 2

4-0 3-2 1-4 1-3

6 4 1 0

Klasemen Grup G APOEL Zenit SP Porto Shakhtar

2 2 2 2

1 1 1 0

1 0 0 1

0 1 1 1

3-2 4-3 3-4 2-3

4 3 3 1

Klasemen Grup H Barcelona AC Milan Viktoria BATE

2 2 2 2

1 1 0 0

1 1 1 1

0 0 1 1

7-2 4-2 1-3 1-6

4 4 1 1

Namun muncul dilema, karena Karim Benzema sudah bugar untuk menjamu mantan klubnya. Higuain dan Benzema memiliki keunggulan masingmasing di garis serang Madrid. Higuain telah mencetak delapan gol El Real pasca pulih dari cedera parah. Sedangkan Benzema mampu membukukan lima gol ketika mengisi posisi striker Argentina tersebut. “Higuain lebih baik dari sebelumnya. Antara dia dan Benzema cukup sukar untuk membicarakan siapa yang harus menjadi pemain cadangan, dan siapa yang akan turun bermain,” beber Mourinho kepada AFP. “Mereka dua penyerang yang berbeda, tetapi memiliki kesamaan, keduanya mampu mencetak gol,” tambah mantan pelatih Inter Milan, Chelsea dan Porto tersebut. Akhir pekan lalu, Lyon juga merengkuh hasil positif di Ligue 1 dengan menggasak AS Nancy 3-1 di Stade Gerland. Hasil ini membuat Lyon tetap berada di posisi kedua, hanya tertinggal tiga poin di bawah pimpinan klasemen Paris Saint-Germain. Pelatih Remi Garde malah mengklaim, Les Gones mestinya bisa menang lebih telak lagi atas Nancy. Namun timnya menurut Garde masih kurang maksimal, kemungkinan karena mereka bermain dengan memikirkan Madrid dalam benaknya. (m15/ant/afp/uefa)

Real Madrid Vs Lyon Di Liga Champions 16 Besar 16 Besar 16 Besar 16 Besar Penyisihan Penyisihan Penyisihan Penyisihan

16/03/11 22/02/11 10/03/10 16/02/10 21/11/06 13/09/06 23/11/05 13/09/05

Real Madrid v Lyon Lyon v Real Madrid Real Madrid v Lyon Lyon v Real Madrid Real Madrid v Lyon Lyon v Real Madrid Real Madrid v Lyon Lyon v Real Madrid

3-0 1-1 1-1 1-0 2-2 2-0 1-1 3-0

BOMBER Real Madrid Karim Benzema (kiri) tampak bugar ketika melakukan pemanasan dalam sesi latihan El Real di Madrid, Senin (17/10). -AP-

Mancini Minta Fokus Villarreal LONDON (Waspada): Roberto Mancini meminta kepada anak asuhnya di Manchester City untuk tetap fokus pada laga Liga Champions melawan Villarreal besok malam di Etihad Stadium. Citizens mesti memenangkan duel dimaksud, sehingga mesti menepikan dulu derbi Liga Premier melawan Manchester United pekan depan di Stadion Old. “Sangat penting bagi kita untuk berkonsentrasi pada Villarreal. Jika kami bisa mengalahkan Villarreal, mungkin kita akan memiliki kesempatan yang lebih baik untuk pergi ke tahap knock-out,” ucap Mancini seperti dilansir Goal, Senin (17/10). “Jika kita tidak bisa mengalahkan mereka di Stadion Etihad, tentu saja tidak mungkin untuk menyelesaikan hasil di grup dengan maksimal,” tambah pelatih asal Italia itu. Mancini mengakui, tantangan yang dihadapi timnya menjelang pertandingan sangat berat. Untungnya di garis serang, masalah berkurang setelah striker Sergio Aguero dinyatakan pulih dari cedera. “Dia (Aguero) akan siap melawan Villarreal. Kami bermain di Liga Champions untuk pertama kalinya dan kami tidak bisa berpikir bahwa akan memenangkan setiap laga,” katanya lagi dalam The Eastlands tengah onfire menyusul kemenangan 4-


MANAGER City Roberto Mancini memberikan keterangan pers di Carrington, Manchester, Senin (17/10). 1 atas Aston Villa akhir pekan lalu di Liga Premier. Hasil itu membawa Yaya Toure cs merebut puncak klasemen dari Manchester United. Tetapi situasinya berbanding terbalik di Liga Champions. The City baru meraup satu angka dan berada di urutan tiga klasemen Grup A. “Kami tahu kami membutuhkan lebih banyak pengalaman, tapi kami masih memiliki empat partai tersisa. Jika kami mengalahkan Villarreal, kami masih bisa mendapat tempat pertama dalam grup,” jelas Man-

cini. “Jika tidak, kita bisa berjuang untuk tempat kedua. Setelah Villarreal, kami memiliki empat hari untuk pulih dan mempersiapkan derbi,” tambah mantan pelatih Lazio dan Inter Milan itu. Mancini juga akan mempercayakan David Silva yang tampil impresif musim ini. Sebagai mantan pemainValencia, Silva pasti sangat mengenal gaya permainan The Yellow Submarines. “Saya pikir Silva salah satu pemain terbaik dunia. Dia ba-

nyak berkembang dibandingkan musim lalu,” tandas Mancini. Demikian pula Aguero sebagai mantan mesin gol Atletico Madrid. Striker yang sudah membukukan delapan gol di Liga Premier itu bisa saja diduetkan bersama Edin Dzeko di lini depan Citiznes. “Target kami ingin mencapai babak knock-out. Kami telah memperbaiki prestasi di Liga Premier, sekarang kami ingin meningkatkan di Liga Champions,” tekad Mancini. (m15/okz/goal/thestar)

Lille Maksimalkan Masalah Inter PARIS (Waspada): LOSC Lille akan memaksimalkan masalah Inter Milan pada matchday 3 Liga Champions Grup B dinihari WIB nanti, guna mengincar peluang lolos ke babak 16 besar. AP

BOMBER Bayern Mario Gomez sedang di puncak performa.

Napoli Vs Bayern Munich Di Eropa 19/04/89 Semifinal UEFA : Bayern Munich vs Napoli 05/04/89 Semifinal UEFA : Napoli vs Bayern Munich juan meraih dua kemungkinan dari tiga hasil, akan sulit untuk menemukan irama permainan. Sebab mereka selalu menghancurkannya,” tutur Mazzarri. Namun The Bavarian akan menjadi musuh besar Napoli untuk dua pertandingan ke depan secara berturut-turut. Pelatih Bayern Jupp Heynckes bahkan yakin, cara bermain

2-2 2-0

timnya merupakan momen yang sangat solid dan meyakinkan. “Bagaimanapun, setelah memperlihatkan kinerja tim yang bagus, tidaklah tepat untuk mengesampingkan permainan individu-individu begitu saja,” pungkas Heynckes. (m15/ant/afp/rtr)

Modal utama mereka, kemenangan 3-1 atas Auxerre lewat penampilan gemilang Eden Hazard dan Joe Cole akhir pekan lalu di Ligue 1 Prancis. Lille pun kini mantap menghuni peringkat empat Ligue 1, beda

dengan Inter yang terpuruk di papan bawah klasemen Liga Seri A. Pelatih Lille Rudi Garcia, mengaku tidak terkejut ketika timnya memulai duel dengan permainan kurang maksimal lawan Auxerre. “Lihatlah iramanya. Normal, setelah 15 hari libur internasional, kami sedikit kurang dinamis, dan terlihat begitu kelelahan di babak pertama,” ujar Garcia, seperti dikutip dari AFP, Senin (17/10). “Saya gembira karena kami mampu menemukan keseimbangan antara liga dengan Liga Champions, yang merupakan fokus kami sekarang,” katanya menambahkan. Menurut gelandang Florian TRIO Inter Milan Esteban Cambiasso, Dejan Stankovic dan Walter Samuel (kiri ke kanan). -AP-

Balmont, hasil positif kontra Auxerre merupakan persiapan bagus sebelum menjamu I Nerazzurri. Namun kemenangan mereka harus dibayar mahal, sebab kiper Mickael Landreau terkena cedera otot. Vincent Enyeama, kiper yang didatangkan pada musim panas lalu dari Hapoel Tel Aviv, berarti menjalankan debutnya dalam duel nanti. Winger Dimitri Payet juga kemungkinan tidak dimainkan Garcia lantaran cedera betis yang dideritanya. Musim lalu, Lille mengakhiri puasa gelar selama 56 tahun. Hebatnya lagi, mereka meraih gelar ganda dengan menjuarai Ligue 1 dan Piala Prancis. Berbanding 180 derajad dengan La Beneamata yang sedang berada dalam masalah pelik, bahkan nyaris kritis. Setelah 15 bulan silam berjaya menjuarai Seri A dan dan Liga Cham-

pions, Inter terpuruk pasca ditinggalkan Jose Mourinho. Kekalahan 1-2 atas Catania, Sabtu lalu, membuat La Beneamata tetap terpuruk kendati sudah merekrut allenatorre Claudio Ranieri untuk menggantikan Gian Piero Gasperini. Di Grup B, penampilan Inter pun kurang meyakinkan. Mereka takluk 0-1 ketika menjamu Trabzonspor, lantas bangkit memetik kemenangan 3-2 atas CSKA. “Kami akan memperbaikinya. Sebab tim ini masih memiliki banyak hal untuk diberikan,” tekad kapten Inter Javier Zanetti. “Tak seorang pun yang mengharapkan kami akan memulainya seperti ini. Saya berjuang keras untuk menganalisa situasi,” timpal kompatriotnya Esteban Cambiasso. (m15/ant/afp/espn)

Sport A11 Helvetia Juara Umum Tinju Porkot Medan WASPADA

Selasa 18 Oktober 2011

MEDAN (Waspada): Kecamatan Medan Helvetia memenuhi ambisinya merebut gelar juara umum tinju Porkot Medan 2011, setelah merebut medali terbanyak hari kedua di Pusat Latihan Tinju Pertina Jl Jaya Medan, 16-17 Oktober. Medan Helvetia yang ditangani pelatih berpengalaman Amir Hasan Siregar menyabet 3 medali emas, 1 perak dan 2 perunggu. Di hari pertama, Helvetia sudah memastikan 1 emas melalui pertarungan di kelas (91kg) putra. Sudrajat yang menjadi andalan kelas berat, mengatasi perlawanan petinju Medan Selayang, Andre dengan kemena-

Waspada/Armansyah Th

PETINJU putri Sinar Pagi Simbolon (kanan), juara cabang tinju kelas 48kg putri Porkot Medan 2011.

Amplas Dominasi Senam Ritmik MEDAN (Waspada): Kontingen Medan Amplas mendominasi senam ritmik Pekan Olahraga Kota (Porkot) III dengan meraih empat medali emas dan dua perak. Pada perlombaan yang dilangsungkan di GOR Prof Jepta Hutabarat Medan, Senin (17/ 10), emas Medan Amplas dipersembahkan Thasya Selivya dari nomor gala ritmik dengan nilai 7,50.Yolanda dari Medan Johor meraih perak nilai 4.00, perunggu direbut Reneta (Medan Tembung) nilai 3,10. Medali emas Amplas lainnya didulang Tata Miranda yang turun di nomor simpai ritmik putri dengan nilai 4.00. Disusul Dinda Permata nilai 3,05 dan Rosalinda nilai 2,83. Mutiara Octavia melengkapi sukses Amplas dengan meraih emas nomor bola ritmik putri. Stevani Olivia Siregar (Medan Denai) meraih perak, Soraya A Syam dari Medan Johor medali perunggu.

Pesenam lainnya yang berhasil meraih medali emas adalah regu ritmik putri Medan Tembung (Reneta Heavenly, Regina Gita Valentine, dan Revinta Dita Valentine). Kemudian Regina Gita Valentine (Medan Tembung) di nomor serba bisa ritmik putrid, serta Manurung (Medan Kota) nomor pita ritmik putri. Dengan hasil itu, Medan Kota memastikan diri sebagai pengumpul medali emas terbanyak cabang senam Porkot 2011, karena menambah satu medali lagi sehingga total menjadi tujuh emas. Penyelenggaraan cabang senam Porkot ditutup Ketua Umum KONI Medan Drs Zulhifzi Lubis didampingi Kabid Binpres KONI Medan Drs Bambang Riyanto. “Porkot berfungsi sebagai wahana pembinaan atlet dan juga sebagai persiapan menghadapi even-even regional nanti,” terang Zulhifzi. (m47)

POBSI Sumut Apresiasi KONI Medan 44 Atlet Ikut Cabang Biliar MEDAN (Waspada): Ketua Umum Pengprov POBSI Sumut Salomo TR Pardede SE memberikan apresiasi tinggi kepada KONI Medan, yang konsisten menggelar Pekan Olahraga Kota (Porkot). “Ajang ini dinilai sangat strategis untuk mencari bibit-bibit atlet dari Kota Medan,” kata Salomo saat membuka Porkot Cabor Biliar di Puslat POBSI Sumut, Jl Pattimura Medan, Senin (17/10). Menurut Salomo, saat ini perkembangan biliar di Sumatera Utara mengalami peningkatan signifikan. Bahkan pada PON XVII/2008 di Kaltim, Sumut mengirimkan 3 atlet dan meraih satu medali perunggu. “Itu sejarah baru bagi Biliar Sumut, yang selama ini tidak pernah meraih medali di event nasional apalagi setingkat PON,” ucapnya.

Peningkatan drastic pun terjadi, karena delapan atlet Sumut berhasil lolos PON 2012 melalui Kejurnas 2011 lalu di Medan, mayoritas atlet binaan POBSI Sumut berasal dari Kota Medan. “jadi ajang Porkot ini sangat penting dalam rangka menggali potensi atlet biliar dari Kota Medan. Diharapkan, melalui Porkot ini akan muncul pebiliar-pebiliar tangguh yang nantinya bisa diandalkan di ajang nasional,” tambah Salomo. Ketua Panitia Biliar Porkot 2011 Ferry M Simanjuntak melaporkan, cabor biliar diikuti 44 atlet (32 putra dan 12 putri) dari 16 Kecamatan, berlangsung 17-20 Oktober 2011. Biliar mempertandingkan 6 nomor, yakni single bola 8 putra, single bola 9 putra, single bola 10 putra, single bola 8 putri, single bola 9 putri dan english biliard putra. (m47)

Potensi Atlet PABBSI Medan Mumpuni MEDAN (Waspada): Panitia Pekan Olahraga Kota (Porkot) 2011 cabang angkat besi/berat dan binaraga siap menggelar event tahunan yang diprakarsai KONI Medan tersebut. Demikian Ketua Harian Pengcab PABBSI Medan, Mirzan Leo baru-baru ini di Medan. Didampingi Ketua Panpel Lilik Kurniadi, Musnan PM, Rizal Fahmi, Evi Susanti, Mirzan mengatakan, angkat besi/berat dan binaraga akan dilaksanakan selama dua hari penuh pada 18-19 Oktober nanti di Gedung Pengda PABBSI Sumut, Jl Veteran. Khusus binaraga akan dihelat di GOR Pengcab PABBSI Medan, Jl Mandala. “Tentunya ini hajatan besar bagi kita, karena dari data yang telah ada total 70-an atlet dari 19 kecamatan dinyatakan lolos dan siap mengikuti

Porkot tahun ini. Artinya, kerja keras panitia dalam melakukan pendataan atlet yang bertanding cukup baik,” kata Mirzan. “Dari pantauan bersama Ketua PABBSI Medan Kompol Drs H Joko Susilo, kesiapan panpel telah rampung seratus persen. Kami sudah lihat dan memantau kesiapan panitia menggelar event tahunan KONI yang telah memasuki tahun ketiga ini,” pungkasnya lagi. Ke depan, kata Mirzan, program yang sifatnya melahirkan prestasi akan terus dijalani guna mengangkat nama Kota Medan ke level tertinggi. Hal itu sudah mulai terlihat dengan lolosnya dua atlet angkat berat Kota Medan, Dodo Gowasa dan Rico Gonzalves, tampil di PON XVIII mendatang. (m15)

Waspada/Setia Budi Siregar

KETUA PSSI Medan Drs HM Darwin Syamsul foto bersama tim sepakbola Medan Denai dan Medan Area sebelum pertandingan Grup E di Lapangan USU II, Senin (17/10).

Denai, Tuntungan Buka Kans 8 Besar MEDAN (Waspada): Kecamatan Medan Denai dan Medan Tuntungan membuka kans melaju ke babak delapan besar cabor sepakbola Porkot Medan 2011. Dalam pertandingan terakhir penyisihan grup, Medan Denai bermain 0-0 melawan Medan Area, sedangkan Tuntungan mengatasi Medan Baru 2-1 di Lapangan I dan II USU, Senin (17/ 10) sore. Medan Denai memimpin Grup E nilai 4. Sebelumnya tim yang diarsiteki Rajali itu menggunduli Medan Tembung 6-0. Medan Denai masih menunggu hasil laga Medan Area versus Medan Tembung, Selasa (18/10) sore ini di tempat sama. Sedangkan Tuntungan yang bermain di Lapangan I, menang 2-1 atas Medan Baru berkat gol Novriandi Syahputra menit 15 (penalti) dan menit 40. Gol balasan Medan Baru dihasilkan Fadli menit 50. Pertandingan di Lapangan USU tersebut turut disaksikan Ketua Pengcab PSSI Medan Drs HM Darwin Syamsul, yang juga Ketua Umum PSSI Sumut terpilih. “Porkot Medan khususnya cabang sepakbola memiliki nilai positif dalam menggairahkan sepakbola di Kota Medan sekaligus menjaring

Hasil Senin, 17 Oktober Medan Perjuangan vs Marelan Medan Labuhan vs Belawan Medan Maimun vs Sunggal Medan Baru vs Tuntungan Medan Timur vs Polonia Medan Denai vs Medan Area

0-7 (B) 1-1 (A) 1-2 (D) 1-2 (C) 4-0 (F) 0-0 (E)

bibit-bibit potensial untuk membela Sumatera Utara di kancah Pekan Olahraga Nasional,” kata Darwin. Menurut pelatih Rajali, tim Medan Denai sulit mengembangkan permainan disebabkan lapangan becek. Dia pun berharap Medan Tembung bermain fight hari ini melawan Medan Area. Perebutan tiket 8 besar ditentukan Selasa (18/10) ini. Di lapangan Mabar; Medan Belawan vs Medan Deli (Grup A), Medan Marelan vs Medan Helvetia (Grup B). Lapangan USU I; Medan Baru vs Medan Petisah (Grup C), Medan Sunggal vs Medan Kota (Grup D). Lapangan USU II; Medan Area vs Medan Tembung (Grup E) dan Medan Timur vs Medan Johor (Grup F). (m18)

ngan angka. Tambahan dua medali emas Helvetia dipersembahkan Deru M Siregar di kelas 52kg putra. Deru yang tampil dominan membuat pertarungan final hanya berlangsung satu ronde. Lawannya Fadli B Ginting dinyatakan kalah outclass oleh wasit Binner Dabuke, karena tak mampu memberi perlawanan berimbang.

Petinju Helvetia, Anto Hutajulu, yang menunjukkan keunggulan teknis juga memaksa petinju Medan Denai Hotman Sitanggang kalah outclass pada ronde kedua di final kelas 60kg putra. Medali perunggu diraih Arwanda (Medan Selayang). Andalan Medan Kota Inri German Hutagaol menggondol emas setelah memaksa Daniel Sipayung (Medan Selayang) harus mengundurkan diri ronde ketiga final kelas 49kg putra. Amat Nasution meraih perunggu di kelas ini. Zakaria Pasaribu menyumbangkan medali emas untuk Medan Barat dengan memaksa Sukarman Munthe (Medan Kota) harus mengundurkan diri

ronde ketiga di final kelas 56kg putra. Perunggu direbut Mulyadi dari Medan Denai. Kalfi Batubara dari Medan Timur meraih medali emas kelas 64kg lewat kemenangan outclass atas Jhosua Sipahutar pada ronde pertama. Perunggu menjadi milik Kalvin (Medan Helvetia). Di bagian putri, Sinar Pagi Simbolon mencatat kemenangan angka atas Adinda Siregar (Medan Helvetia) sekaligus meraih medali emas kelas 48kg. Sukses Helvetia disambut gembira pelatih Amir Hasan Siregar dan Bendahara KONI Medan Helvetia Julian Effendi, sebab hal itu memang sudah menjadi target mereka. “Kami

memang bertekad merebut gelar juara umum yang tahun lalu diraih Medan Kota,” sebut Amir. Menurut Julian, mereka memang bertekad merebut kembali gelar juara umum yang diraih pada penyelenggaraan Porkot I. “Keberhasilan cabang tinju ini akan membantu kami untuk meraih target juara umum yang memang kami incar,” ucapnya. Ketua Panpel cabor tinju Timbul Halomoan Hutagalung menyebutkan, penyelenggaraan tinju yang berlangsung dipantau langsung oleh Ketua Umum KONI Medan Drs H Zulhifzi Lubis dan Ketua Pertina Medan Sahala Nainggolan. (m47)

PSMS Ingin ‘Paksakan’ Suharto Tolak Roberto ‘Beto’ Bianchi MEDAN (Waspada): Niat konsorsium merekomendasikan sosok pelatih kepala untuk PSMS Medan menemui jalan terjal. Pasalnya, PSMS lebih memprioritaskan pelatih lokal dengan alasan fanatisme kedaerahan yang harus terjaga. Sebelumnya, konsorsium menawarkan pelatih asing sebagai juru taktik Ayam Kinantan musim depan. Mantan pelatih klub Batavia Union, Roberto Bianchi, disebut-sebut sebagai kandidat utama. Namun, PSMS memastikan tidak akan memakai rekomendasi dari konsorsium tersebut. “Konsorsium menawarkan pelatih asing dan PSMS menolaknya. Bukan pelatih asing yang kita butuhkan, tapi pelatih lokal,” ujar Pelaksana Teknis PSMS, Idris SE, di Stadion Kebun Bunga Medan, Senin (17/10).

Menurut Idris, fanatisme kedaerahan bisa dijaga jika PSMS tetap ditangani pelatih lokal. Selain itu, rencana pelatih asing membawa lima pemain juga dikhawatirkan merusak kerangka yang sudah dibentuk tim seleksi yang terdiri atas Suharto, Roekinoy, dan Sugiar. “Saya yakin publik Medan mengharapkan pelatih lokal, apalagi pelatih lokal tentu bisa membawa fanatisme kedaerahan yang tinggi. Belum lagi rencana membawa lima pemain yang takutnya merusak suasana yang ada saat ini,” ujar Sekretaris Umum Demisioner itu. Untuk nama lokal, PSMS sebelumnya sempat menunjuk Abdul Rahman Gurning. Namun kesepakatan tersebut batal dan pelatih yang bersangkutan sudah berlabuh di Arema Malang. Beberapa nama lokal lain juga sempat beredar seperti M Khaidir, Syafei Pilly hingga Suimin


MANAJEMEN PSMS menolak tawaran pelatih asing dari konsorsium dengan lebih memilih Suharto (tengah) sebagai arsitek bagi Osas Saha cs pada kompetisi nanti. Diharja. Tanpa ragu, nama Suharto dikedepankan. Kapasitas Suharto dinilai pantas untuk memimpin skuad PSMS saat ini setelah sukses mengantarkan Zul-

PANGDAM I/BB Mayjen Lodewijk Paulus disaksikan Kapoldasu Irjen Wisjnu Amat Sastro dan Wali Kota Medan Rahudman Rarahap menyerahkan bola kepada Ketua Panitia Yongky Haurissa pada acara seremoni pembukaan turnamen antarklub PSMS 2011 di Stadion Kebun Bunga Medan, Senin (17/10).

namun hanya untuk legalitas di mana nantinya yang memegang kendali penuh tetap Suharto. “Yang menangani tim nanti Suharto. Soal legalitas pelatih, kami sedang mencari sosok pelatih yang lisensinya A sebagai legalitas saja,” ucapnya. (m33)

Pembinaan PRSI Masih Minim Amphibi Buat Silabus Dongkrak Prestasi

-Waspada/Surya Efendi-

Gumarang Ungguli Bank Sumut Turnamen Antarklub PSMS 2011 MEDAN (Waspada): Gumarang FC berhasil melewati rintangan pertama dengan menundukkan tim unggulan Bank Sumut 2-1 pada laga pembuka Grup A Turnamen Antarklub PSMS Medan 2011 di Stadion Kebun Bunga Medan, Senin (17/10). “Ini kemenangan yang cukup fantastis mengingat yang kita kalahkan adalah salah satu tim unggulan dan baru saja menjuarai Porseni AntarBank Pembangunan Daerah (BPD) Nasional di Medan baru-baru ini. Kemenangan ini juga menjadi modal penting untuk tim melangkah lebih jauh,” ujar Manajer Tim Gumarang FC, Hengki Ahmad.

karnain cs menginjak babak delapan besar musim lalu. Namun sertifikat kepelatihan Suharto yang masih di level B menjadi kendala, sementara regulasi menetapkan pelatih minimal level A AFC. Terkait itu, Idris berencana mencari pelatih berlisensi A

Tampil dengan kombinasi pemain muda dan senior, Gumarang langsung menerapkan permainan menyerang. Belum genap lima menit laga berlangsung, tim asuhan duo pelatih Zulimri Purba dan Suwarto Gogok sukses membobol gawang Bank Sumut yang dikawal mantan kiper PSMS, Irwin Ramadhana. Gol pembuka Gumarang dicetak Feri Anggraiawan memanfaatkan umpan pojok. Selang lima menit, Bank Sumut menyamakan skor lewat tandukan Dolly Ronald. Gol penentu kemenangan Gumarang tercipta di babak kedua lewat aksi individu Zailani. Turnamen yang diikuti 34

tim itu dibuka resmi Wali Kota Medan Drs H Rahudman Harahap MM dan dihadiri Kapoldasu Irjen Pol Wisjnu Amat Sastro, Pangdam I/BB Mayor Jenderal TNI Lodewijk Paulus,WakilWali Kota Dzulmi Eldin serta undangan lainnya. “Saya berharap digelarnya kembali turnamen antarklub PSMS yang hampir 15 tahun vakum ini dapat mengembalikan semangat klub melakukan pembinaan yang lebih baik, terprogram, dan berkesinambungan. Kami berharap dari turnamen ini lahir pemain andal yang dapat memperkuat PSMS Medan ke depan,” ujar Wali Kota. (m42)

MEDAN (Waspada): Pembinaan yang dilakukan Pengcab Persatuan Renang Seluruh Indonesia (PRSI) Kota Medan dinilai masih minim akibatnya terus merosotnya prestasi atlet di ibukota Sumatera Utara ini. “Kondisi ini tidak terjadi kalau olahraga air ini dikelola secara profesional,” kata Ketua Amphibi Swimming Club (ASC), Ismal Sinaga, kepada wartawan di Kolam Renang Unimed, Senin (17/10). Seperti pelaksanaan Pekan Olahraga Kota (Porkot) Medan 2011 sekarang, Ismal mencontohkan kurangnya koordinasi antara Pengcab PRSI Medan dengan pengurus kecamatan dan klub renang mengakibatkan kegiatan tidak sesuai harapan. “Padahal event itu bisa jadikan momentum bagi klub untuk melakukan perbaikan-perbaikan atau evaluasi, hingga ke depan bisa mencetak atlet berprestasi baik di tingkat nasional maupun internasional,” tegas Isma menambahkan untuk meningkatkan prestasi renang Medan dibutuhkan kebersamaan dari klub dan Pengcab PRSI. “Harusnya ada perubahan dilakukan Pengcab PRSI Kota Medan berupa penajaman program pelatihan dalam rangka peningkatan kualitas atlet,” paparnya. Isman mengatakan PRSI harus memahami peran klub sangat penting sebagai ujung tombak pembinaan prestasi. Kendati perhatian dan dukungan Pengcab PRSI Medan terhadap keberadaan klub maupun pembinaan atlet masih minim, Isma mengaku pihaknya tidak lantas pasrah. “Kami sudah membuat silabus berstandar nasional sebagai panduan mendongkrak prestasi atlet renang Kota Medan guna mengembalikan kejayaan di masa lampau,” paparnya. Isma mengatakan silabus tersebut diyakini menjadikan atlet mampu bersaing di tingkat nasional maupun internasional, sebab pembinaannya sesuai standar rancangan program latihan berprestasi. (m49)



WASPADA Selasa 18 Oktober 2011

Pebalap Indycar Tewas Tabrakan Libatkan 15 Mobil LAS VEGAS, AS (Waspada): Seri terakhir balapan IndyCar 2011 di Las Vegas Motor Speedway memakan korban. Dalam tabrakan yang melibatkan 15 mobil, pebalap Inggris Daniel Wheldon dinyatakan tewas, Senin (17/10). Kecelakaan maut itu terjadi di lap 11. Mobil yang dikendarai Wheldon sebenarnya tidak termasuk dalam kelompok mobil yang mengalami kecelakaan awal. Namun, saat ingin menghindari kecelakaan di depannya, mobil dua kali juara Indianapolis 500 dan juara IndyCar Series 2005 tersebut justru terlempar ke udara dan menghantam tembok pembatas. Mobil Sam Schmidt Motorsports yang dikendaraiWheldon pun mengalami rusak berat di bagian atas. Sesaat setelah kecelakaan, pihak keamanan menutup semua mobil, termasuk milik Wheldon dengan terpal.

Dalam kondisi kritis, Wheldon diterbangkan ke University Medical Centre, Las Vegas, menggunakan helikopter. Sayang, semua usaha yang dilakukan tim dokter tidak mampu menyelamatkan nyawa pebalap berusia 33 tahun tersebut. “IndyCar sangat sedih untuk mengumumkan bahwa Dan Wheldon telah meninggal dunia karena cedera tak terselamatkan. Belasungkawa dan doa kami untuk Dan dan keluarganya. IndyCar, pebalap, dan tim memutuskan untuk menghentikan balapan,” ujar Direktur IndyCar Series, Randy Bernard. Balapan sendiri diputuskan

ditiadakan dua jam setelah kecelakaan. Semua pebalap kemudian melakukan lima kali putaran di LasVegas Motor Speedway untuk penghormatan bagi Wheldon. Begitu mendengar musibah tersebut, Jenson Button dan Lewis Hamilton terkejut. Sebagai rasa solidaritas sesama pebalap, duo McLaren asal Inggris tersebut turut mengungkapkan belasungkawa. Kepada Autosport, kedua mantan juara dunia F1 itu mengenang Wheldon sebagai pebalap dan juara sejati. Button dan Hamilton sama-sama mengenal Wheldon sejak memulai karier di ajang gokart. “Saya punya banyak kenangan bagus saat balapan dengannya di awal 1990an. Kita kehilangan legenda di olahraga ini. Saya tidak bisa membayangkan perasaan keluarganya dan

Pra PON Sumut Protes PSSI Soal Babak Lanjutan Kualifikasi MEDAN (Waspada): Pihak manajemen tim sepakbola Pra PON Sumut mengaku kecewa dengan keputusan PSSI soal lanjutan babak kualifikasi Pra PONWilayah Sumatera, di mana PSSI langsung meloloskan juara Grup A dan B, yakni Sumbar dan Jambi, untuk tampil di PON XVIII/2012. Hal itu berdasarkan hasil rapat Komite Kompetisi PSSI, Rabu (12/10) lalu. Rapat itu memutuskan juara grup untuk kualifikasi PON Sumatera otomatis lolos ke PON dan tidak perlu melakukan pertandingan silang seperti peraturan yang sudah ditetapkan sebelumnya. Sedangkan tim runner-up Grup A dan B, yakni Sumut dan Bengkulu harus melalui babak playoff untuk merebut satu tiket ke PON yang dijadwalkan berlangsung 27 Oktober mendatang. “Sistem ini jelas berbeda dengan rencana awal, di mana babak kualifikasi lanjutan kedua seharusnya menggunakan sistim silang. Ini artinya, Jambi dan Bengkulu mewakili grup B dan Sumbar serta Sumut mewakili grup A akan saling berkompetisi lagi untuk memperebutkan tiga tiket ke PON,” ujar Manajer Tim Pra PON Sumut, Dr M Nur Rasyid Lubis, Senin (17/10). Tetapi, lanjut pria akrab disapa Dr Mamad itu, secara sepihak PSSI mengeluarkan keputusan sendiri dengan langsung meloloskan juara grup dan kita (Sumut) harus melewati babak playoff dengan Bengkulu. “Ini kan aneh, mengapa pe-

Lorenzo Absen Di Sepang PHILLIP ISLAND, Australia (Waspada): Cedera akibat kecelakaan saat pemanasan di Sirkuit Phillip Island, Minggu (16/10) lalu, memaksa Jorge Lorenzo (foto) harus istirahat lebih lama. Setelah absen di MotoGP Australia, juara dunia 2010 ini juga dipastikan absen di MotoGP Malaysia, akhir pekan ini. Lorenzo jatuh dalam posisi yang cukup menakutkan ketika kecelakaan di Phillip Island itu. Semula ditengarai pebalap Yamaha yang baru saja kehilangan gelar tidak mengalami hal yang menakutkan, tetapi jari keempat pada tangan kanannya diketahui patah. Rider Spanyol ini pun menjalani operasi yang berjalan sukses. “Operasi untuk memperbaiki kerusakan pada jari Jorge Lorenzo di Melbourne berlangsung sukses. Operasi tersebut bisa menyelamatkan syaraf dan otot jari keempatnya yang bisa berakibat kehilangan fungsinya, baik pada jari maupun tangannya,” demikian pernyataan yang dikeluarkan pihak Yamaha, Senin (17/10). “Sayang, waktu penyembuhan yang dibutuhkan lebih panjang sehingga Jorge tidak akan membalap di Sirkuit Sepang pada MotoGP Malaysia nanti. Kepastian tampil di MotoGPValencia akan diambil tergantung kepada kondisi Jorge setelah kembali ke Barcelona,” lanjut pernyataan tersebut. Akibat absen di Sepang, hampir pasti Lorenzo tidak bisa ambil bagian dalam semua latihan penting pasca-MotoGP Malaysia di mana Yamaha merencanakan untuk menguji motor 1.000cc yang bakal digunakan pada musim 2012 mendatang. (m33/auto)

raturan yang sudah dibuat sebelumnya seenaknya saja diubah. Kalau memang ingin peraturannya seperti itu, mengapa tidak dari awal? Terus terang kami tidak terima dengan keputusan itu dan telah melayangkan surat ke PSSI. Kami berharap PSSI dalam hal ini Ketua Umum Prof Djohar Arifin Husin lebih peduli dengan masalah ini dan mengambil langkah bijak. Terlebih yang dirugikan adalah Sumut yang notabene daerahnya sendiri,” ucap Dr Mamad. Kekecewaan juga diungkapkan pelatih tim Pra PON Sumut, Rudi Saari. Mantan arsitek PSMS Medan ini menilai keputusan PSSI tidak bijak dan telah merugikan timnya yang jauh hari mempersiapkan diri untuk menghadapi babak empat besar. “Belum lagi soal Jambi, di mana protes kami soal penggunaan kiper Sumut, Edy Syahputra Daulay belum diselesaikan PSSI. Ini rasanya kita harus menanggung dua kali kekecewaan, pemain kita dipakai dan mereka (Jambi) langsung lolos,” ung-

kapnya. (m42)

belasungkawa saya untuk mereka di masa-masa sulit ini,” ujar Button. Sementara itu, Hamilton menganggap Wheldon sebagai salah satu panutannya. Runnerup GP Korea ini mengatakan Dan adalah pebalap yang diikuti karier sejak dulu karena penuh talenta, pria Inggris sejati, dan memberi inspirasi baginya. (m33/auto/ap)

INSIDEN tabrakan yang melibatkan 15 mobil Indycar Series menewaskan Dan Wheldon saat mobil yang dikendarainya terbang ke udara di Las Vegas Motor Speedway, Las Vegas, Senin (17/10). -AP-

Pasang Iklan Telp.4528431 HP. 081370328259 Email:

Sumatera Utara

WASPADA Selasa 18 Oktober 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:14 12:27 12:14 12:21 12:21 12:18 12:14 12:10 12:17 12:16

‘Ashar 15:29 15:44 15:30 15:38 15:37 15:31 15:29 15:25 15:32 15:33

Magrib 18:16 18:28 18:17 18:23 18:23 18:21 18:17 18:12 18:19 18:18



Shubuh Syuruq


19:24 19:37 19:25 19:31 19:31 19:30 19:25 19:21 19:28 19:27

04:45 04:59 04:45 04:53 04:52 04:47 04:45 04:41 04:48 04:48

04:55 05:09 04:55 05:03 05:02 04:57 04:55 04:51 04:58 04:58

L.Seumawe 12:20 L. Pakam 12:13 Sei Rampah12:12 Meulaboh 12:24 P.Sidimpuan12:11 P. Siantar 12:12 Balige 12:12 R. Prapat 12:09 Sabang 12:27 Pandan 12:13

06:09 06:24 06:10 06:18 06:17 06:12 06:10 06:05 06:12 06:12

Zhuhur ‘Ashar 15:37 15:28 15:28 15:40 15:25 15:27 15:26 15:23 15:44 15:27





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:21 18:15 18:14 18:26 18:15 18:15 18:15 18:12 18:28 18:17

19:30 19:24 19:23 19:35 19:23 19:23 19:24 19:21 20:37 19:25

04:51 04:44 04:44 04:55 04:41 04:43 04:43 04:39 05:59 04:43

05:01 04:54 04:53 05:05 04:51 04:53 04:53 04:49 05:09 04:53

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:13 12:15 12:25 12:17 12:14 12:21 12:09 12:20 12:13 12:12

18:17 18:17 18:26 18:21 18:17 18:23 18:12 18:22 18:16 18:14

19:25 19:26 19:35 19:29 19:25 19:32 19:21 19:31 19:24 19:23

04:43 04:45 04:56 04:48 04:45 04:52 04:40 04:50 04:43 04:43

04:53 04:55 05:06 04:58 04:55 05:02 04:50 05:00 04:53 04:53

Panyabungan 12:10 Teluk Dalam12:17 Salak 12:15 Limapuluh 12:11 Parapat 12:13 GunungTua 12:10 Sibuhuan 12:10 Lhoksukon 12:19 D.Sanggul 12:13 Kotapinang 12:08 AekKanopan 12:10

06:16 06:09 06:08 06:20 06:06 06:07 06:07 06:04 06:24 06:08

15:27 15:29 15:41 15:31 15:30 15:37 15:24 15:35 15:26 15:27

06:08 06:10 06:21 06:12 06:10 06:17 06:05 06:15 06:07 06:07

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur ‘Ashar 15:23 15:29 15:29 15:26 15:27 15:23 15:22 15:36 15:27 15:22 15:24




Shubuh Syuruq

18:14 18:21 18:18 18:13 18:15 18:13 18:13 18:21 18:16 18:11 18:13

19:22 19:29 19:26 19:22 19:24 19:22 19:22 19:30 19:25 19:20 19:21

04:40 04:47 04:45 04:42 04:43 04:40 04:39 04:51 04:44 04:38 04:40

04:50 04:57 04:55 04:52 04:53 04:50 04:49 05:01 04:54 04:48 04:50

06:04 06:11 06:10 06:06 06:08 06:04 06:04 06:16 06:08 06:03 06:05

Langkat, Binjai Dan Deliserdang Terima Bantuan Mobile Internet STABAT(Waspada):Kemajuanteknologiinformasi dan komunikasi ibarat sebuat mata pisau karena berdampak positif dan negatif, karenanya teknologi seperti layanan internet mampu menciptakan transformasi sosial menuju masyarakat yang lebih produktif, inovatif dan kolaboratif sehingga memiliki daya saing yang lebih kuat guna meningkatkan kualitas hidup material dan spiritual. Sebaliknya, ada dampak negatifnya karena teknologi tersebut dapat melemahkan karakter bangsa serta merosotnya moralitas etika dalam kehidupan masyarakat. Plt. Gubsu Gatot Pujo Nugroho mengemukakan hal itu ketika memberi sambutan sekaligus bertindak selaku pembina upacara Apel Hari Kesadaran Nasional, dirangkaikan penyerahan perdana 9 unit Mobil Pusat Layanan Internet Kecamatan (MPLIK) untuk Langkat,BinjaidanDeliserdangdihalamankantor Bupati Langkat di Stabat, Senin (17/10). Menurutnya, teknologi sebagai bagian yang tak terpisahkan dalam kehidupan manusia saat ini, merupakan sarana untuk meningkatkan pengetahuandankemampuanmasyarakatdalam mengakses informasi. Kebutuhan akan sentuhan teknologi, selayaknya diterima dan dirasakan masyarakat tanpa kecuali, sungguhpun mereka yang berada di daerah terpencil. Upaya pemerintah memberikan kecerdasan kepada anak bangsa harus dibarengi semangat melayani jajaran PNS di daerah ini, lanjut Gatot Pujo Nugroho seraya berharap agar Kabupaten/ Kota yang menerima MPLIK tersebut mampu merawat dan memanfaatkan keberadaan mobil tersebut untuk kemudahan masyarakat termasuk pemeliharaan, anggaran serta personil petugas agar ditanggung masing-masing dana daerah.

Dalam kesempatan itu Plt. Gubsu Gatot Pujo Nugroho secara simbolis menyerahkan kunci mobile internet tersebut masing-masing empat unit untuk Pemkab Langkat , Binjai satu unit dan Deliserdang memperoleh empat unit. Usai acara Plt Gubsu Gatot Pujo Nugroho didampingi Bupati Langkat H. Ngogesa Sitepu,Walikota Binjai HMIdahamdanWakilBupatiDeliserdangZainuddin Mars melakukan uji coba dengan teleconference jarak jauh dengan Camat Kutalimbaru Deli Serdang, Secanggang, Langkat dan Binjai Selatan. Dalam percakapan tersebut Plt. Gubsu juga menerima keluhan warga Kutalimbaru seputar minimnya sarana transportasi di sana. “Untuk ke Medan tidak ada angkutan umum,” kata Ali Syahbana, warga Kutalimbaru. Plt. Gubsu juga berdialog dengan Camat Secanggang Ibnu Hajar tentang masalah keamanan wilayah, dan Camat Binjai Selatan seputar pelaksanaan e-KTP. Sementara itu Kadis Kominfo Pemprovsu Asren Nasution mengemukakan, untuk Sumut pengadaan mobile internet untuk kecamatan secara bertahap bakal menerima 96 unit, tahap pertama diserahkan 9 unit dan nantinya bertahap akan diserahkan untuk Kabupaten/Kota yang jumlahnya disesuaikan dengan luas dan keterisoliran daerah. HalyangsamajugadiutarakanBupatiLangkat H. Ngogesa Sitepu. Keberadaan mobile internet untuk kecamatan sangat membantu sesuai dengan mottonya,‘Jangan BiarkanYangTerpencil MenjadiTerkucil’. Langkat sangat membutuhkan jaringan internet pada beberapa kecamatan. Dari 23 kecamatan se Kabupaten Langkat, 15 kecamatan belum memiliki jaringan internet,” ujar Bupati Ngogesa.(a01/a03)

Pembangunan Ruang Kantor Dishub T. Tinggi, Menyimpang TEBINGTINGGI (Waspada): Pembangunan ruangan kantor Dinas Perhubungan KotaTebingtinggi di Jalan Gunung Leuser, Kel. Tj. Marulak, Kec. Rambutan, diduga menyimpang. Penyimpangan itu, dalam bentuk manipulasi material bangunan, selain tidak sesuai dengan dokumen Rencana Anggaran Biaya yang jadi pedoman pembangunan. Sumber di Dishub, menyebutkan ada sejumlah penyimpangan yang dilakukan. Di antaranya, dalam DPA merupakan kegiatan penambahan ruangKabidSaranadanPrasaranaDishub.Namun, faktanya penambahan luas ruang Kadishub dan tempatparkirkenderaanPNS.“Seharusnyaperubahan itu menotakan dulu kepada Walikota, tapi Kadishubtidakmelaksanakannya,”ungkapsumber. Selain itu, bahan bangunan juga tidak sesuai denganRencanaAnggaranBiaya,misalnyapemakaian besi meskinya menggunakan besi ukuran 0,7ml,tapiyangdipasangkanukuran0,5ml.Demikian pula penggalian fondasinya harusnya 1,5 meter, tapi dibuat cuma 0,5 meter.“Karena proyek

itu dikerjakan keluarga Kadishub, semuanya dianggap baik oleh dia,” terang sumber. Proses pekerjaan juga molor, seharusnya berakhir pada 13 Oktober. Namun, fakta di lapangan, pembangunan baru sekira 60 persen saja. Terkait itu, Kadishub Djajardi Rinal, BE, Senin (17/10),usaibertemuWalikota,mengatakaninformasi itu tidak benar. Misalnya soal fondasi 1,5 meter.“Jika infonya pondasi 1,5 meter, memangnya mau bangun apa,” ujar dia. Demikian pula soal perubahan dari bangunan ruangan Kabid SaranadanPrasarana,halitudiakuiKadishubsebagai kebijakannya. “Itu memang kebijakannya saya merubahnya, dan itu dibolehkan,” kilah dia. Sedangkan soal adanya manipulasi bahan bangunan, misalnya penggunaan besi yang tak sesuaiRAB,DjajardiRinal,BE,mengatakanbahwa itu merupakan wewenang konsultan. “Kalau yang itu tanya saja konsultannya,” tandas dia, sambil berlalu. Berdasarkan data di buku APBD TA 2011, proyek itu bernama “Program PembangunanGedungKantor,senilaiRp150juta.(a09)

PANTAICERMIN (Waspada): Diduga akibat masalah ekonomi, seorang ibu rumah tangga (IRT), A Tju, 40, warga Dusun IV, Desa Ujung Rambung, Kec. Pantai Cermin, Kab. Serdang Bedagai nekat menenggak satu sachet cairan serangga, Sabtu (15/10) sekira pukul 14:30. Menurut keterangan, peristiwa itu pertama kali diketahui salah seorang putrinya, Nopita ,18, yang baru pulang sekolah. Dia melihat ibunya tidur di kamar, tapi dengan kondisi mulut mengeluarkan busa. Melihat kejanggalan itu, Nopita coba membangunkannya, namun sudah tidak ada reaksi lagi. Tidak jauh dari posisi ibunya tergeletak dite-

mukannyasatubungkusracunseranggaserangga. Warga membawanya ke RSU Sawit Indah Perbaungan, namun karena kondisinya sudah kritis kemudian dirujuk ke RSU Lukuk Pakam. Di perjalanan,ATjunmenghembuskannafasterakhir. Menurut warga, tewasnya A Tju diduga akibat tekanan ekonomi rumah tangga, karena suaminya, Abun , 42, hanya bekerja serabutan, sehingga penghasilannya tergolong pas-pasan, terlebih lagi dua anak mereka masih sekolah. Kapolsek Pantai Cermin, AKP Efendi Sirait membenarkan peristiwa itu. Menurutnya, korban tewas akibat minum cairan racun serangga, karena di sekitar korbanditemukansatubungkuscairanserangga.(c03)

IRT Tewas Minum Racun Serangga

Waspada / Ibnu Kasir

PLT. Gubsu Gatot Pujo Nugroho diabadikan bersama Bupati Langkat H. Ngogesa Sitepu, Walikota Binjai HM Idaham dan Wakil Bupati Deliserdang Zainuddin Mars usai menerima secara simbolis kunci mobile internet di halaman kantor bupati di Stabat, Senin (17/10).

Pungutan Liar Mengganas Dua Kelompok Pemuda Bentrok STABAT (Waspada): KelompokpemudaDesaPekubuanKec. Tanjungpura dengan kelompok pemuda Desa Buluh Telang Kec. Padangtualang bentrok, Senin (17/10) pagi, mengakibatkan seorang terluka. Informasi dihimpun, bentrok dipicu akibat mengganasnya pungutan liar di bebe-

rapa lokasi eksploitasi minyak ilegal di Kec. Padangtualang. Bentrokberawal,Minggu(16/ 10) malam, ketika beberapa pemuda Desa Pekubuan yang melintas di Desa BuluhTelang untuk membeli minyak hasil eksploitasi ilegal, merasa tidak senang karena dipungut ’uang melintas’

Tahanan Polres Sergai Tewas Di Rumah Sakit SEIRAMPAH (Waspada):Tahanan Polres Serdang Bedagai( Sergai) kasus pencabulan terhadap seorang Mahasiswi, TEJ alias Teja, 46, warga Jalan Menggarai, Dusun I, Desa Pematang Bandar, Kec. Pematang Bandar, Kab. Simalungun, tewas setelah dirawat di RSU Sultan Sulaiman di Desa Firdaus, Kec. Sei Rampah, Senin (17/10) sekira pukul 09:00. Menurut Petugas RSU Sultan Sulaiman, TEJ diterima petugas Instalasi Gawat Darurat (IGD) Sabtu (15/10) sekitar pukul 24:00, akibatpenyakittekanandarahtinggi berat(KrisisHypertensi),selanjutnya dirawat diruang Melur V. Setelahbeberapaharidirawat, kondisinya semakin memburuk yang kemudian, Senin (17/10) sekitarpukul07:00dirujukkeruang ICU, namun karena kondisinya semakinmemburukakhirnyaTEJ meninggal sekira pukul 09:00. Wati, 47, istri TEJ, mengakui

suaminyamemangmemilikiriwayat penyakit tekanan darah tinggi. Sebelumnya, TEJ yang berprofesi sebagai orang pintar (Dukun-red) ditangkap petugas, Sabtu (17/9) lalu atas pengaduan orang tua korban, sebut saja Cempaka, 20, mahasiswi salah satu Politehnik di Medan, warga Desa Togap Majawa, Kec. Tanah Jawa,Kab.Simalungunyangdicabuli pelaku hingga hamil. Kapolres Sergai, AKBP Arif Budiman melalui Kassubag Humas, AKP ZN Siregar membenarkan tersangka TEJ kasus Pencabulan,293KUHPidanameninggal dunia akibat penyakit tekanan darah tinggi berat yang dideritannya. “Sebelumnya TEJ sempat dirawatdiRSUDSultanSulaiman, Sabtu (15/10) sekira pukul 24:00 dan meninggal Senin (17/10) sekira pukul 09:00,” imbuh ZN Siregar.(c03)

Rp1.000 per jerigen yang dibawa. Umumnyasatuorangmembawa empat jerigan. Kemudian Senin pagi sekelompok pemuda Desa Pekubuanmengendaraisepedamotor sambil membawa senjata tajam, menyerang pos jaga kelompok pemuda Desa Buluh Telang hingga terlibat bentrok. Saat itu salah seorang pemuda dari Desa BuluhTelang, Evi, 28, terkena bacokandanhinggakinibelumdiketahuikeberadaannya.KanitPolsek Padangtualang Ipda MI Saragih yang dikonfirmasi awalnya mengatakan tidak ada bentrok, sesaat kemudian dia membenar-

kan, hanya saja dikatakannya korban menderita luka ringan. “Saya belum tahu korban dirawat dimana,”katanyasingkatterkesan menutupi kejadian. Pasca bentrok situasi masih memanas, setiap warung di sepanjang Jalan Tanjungpura menuju Padangtualang berkumpul banyak pemuda. Kondisi itu tidak pernah terlihat sebelumnya karena jalan disana sehari-hari sunyi tidak ada rumah penduduk, hanya areal perkebunan rambung. Beberapa personil Polsek Padang tualang masih berjaga di lokasi kejadianagarbentroktidakterulang. Bebasnya eksploitasi minyak

secarailegalyangdilakukankelompok masyarakat Padangtualang terus menuai masalah, diantaranya pungutan liar. Banyaknya warga-warga luar Padangtualang yang datang membeli minyak dimanfaatkankelompokpemuda Padangtualanguntukmemungut uangdenganistilahuangmelintas. “Bukanhanyadisatuposjaga ada pengutipan liar, melainkan lebih. Karena itu pembeli minyak merasadipermainkan,”katasalah seorang warga setempat seraya menambahkan, memproduksi maupun membeli minyak samasamakegiatanilegalyangmelanggar hukum.(a03)

Polisi Ringkus Jurtul Togel Singapura BINJAI (Waspada): Anggota Polsek Binjai Kota, Minggu (16/ 10 ) pukul 16:00 meringkusY alias Boy, 30, warga Perumnas Berngam, Kecamatan Binjai Kota Jurtul (juru tulis)Togel Singapura, tidak jauh dari rumahnya ketika menulis tebakan judi tersebut. Untuk pengusutan selan-

jutnya tersangka bersama barang bukti handphone penuh berisi nomor tebakan dan jumlah uang pasangan serta uang Rp37.000, diduga uang tebakan pemasang beserta alat judi lainnya, diamankan di Polsek Binjai Kota. Sementara itu Kapolres Binjai,AKBPDraRinaSariGinting

melalui Kapolsek Binjai Kota Kompol ZA Harahap ketika dikonfirmasi, Senin (17/10), membenarkan. Menurut Kapolsek, ter sangka dijerat mnelanggar Pasal perjudian 303 subs 303 bis KUHPidana ancaman hukuman 5 tahun penjara.(a05)

Dilema Finishing Bandara Kualanamu, 2012 Mungkinkah? (2) AIR TraficServices(ATS)Regional Coordinator,Syafei Samsudin pada salah satu situs berita onlinemengatakan,perpindahan bandar udara ada dua, perpindahan air servicenya dan perpindahan airport (sisi darat). Menurutnya, ada sejumlah tahapan yang harus dilakukan sebelum sebuah Bandar udara dipindahkan. Satu diantaranya, pengumuman kepada seluruh dunia bahwa akan ada perpindahan bandara 56 hari atau dua bulan sebelumbandarabaruberoperasi. Selain itu, lanjutnya, tahapan lain yang tak kalah penting

adalah trial operation.”Karena kan peralatan di sana semuanya baru. Karena itu harus ada trial operation, mencoba peralatan, mana kira-kira yang layak atau enggak, dimana kekurangannya, itu kan user-nya kita sebagai pengatur lalu lintas udara,”ujarnya hari ini. Syafei menambahkan, trial operation bukanlah hal yang sederhana. Dibutuhkan pelatihan untuk memahami dan bisa menggunakan peralatan baru tersebut. “Tidak mudah, misalnya alat ini suka mati setiap detik, yang lain masih kurang, atau

bagaimana. Ini membutuhkan waktuyangtidaksedikit,”bebernya. Syafei menyebutkan, untuk trial operation, dibutuhkan waktu paling cepat tiga bulan. Dalam tahap itu, jika belum puas, pelatihan dapat diperpanjang lagi hingga peralatan tersebut bisa mengakomodir apa yang diinginkan. Bila trial operation tidak berhasil, waktu percobaan dapat diperpanjang hingga sampai setahun, bahkan bisa lebih. “Trial itu bisa sampai satu hingga tiga tahun. Di Jepang, pernah trial alat sampai empat tahun. Dan kita juga pernah sam-

Waspada/Surya Efendi

BAGIAN terminal bandara baru di Kuala Namu, Deli Serdang sedang dalam tahap pengerjaan.

pai tiga tahun. Karena itu enggak mudah,” ungkapnya. Tak hanya itu, lanjut Sjafei, masih ada tahapan lain yang harus dilakukan bila trial operation berhasil dilalui dengan baik. Yakni tahap komisioning yang memakan waktu sekitar tiga bulan. Menurutnya, traning ini merupakan apilkasi dari trial training, misalnya apakah alat itu bisa dipakai atau tidak. Ada juga shadow operation saat perpindahan, belum lagi training SDM yang diperkirakan memakan waktu paling sedikit tiga bulan. Bila digabungkan, maka waktu untuk melewati seluruh tahapan itu genap satu tahun. Sementara waktu yang tersisa untuk penyelesaian Bandara Kuala Namu tinggal setahun lagi. “Makanya kalau ada statement 2012 akan pindah, kami sebagai orang-orang dari profesi itu menjadi miris, ini betul enggak,” paparnya. Menurut Sjafei, hingga kini, belum ada satu pun dari tahapan tersebut yang sudah dilakukan dalam konteksi perpindahan Bandara Polonia ke Bandara Kuala Namu tersebut. “Kita enggak tahu. Seharusnya Kuala Namu counter part-nya adalah kita, ternyata kita tidak dijadikan counter part mereka. Dan ini bukan salah mereka. Mereka kan punya proyek, ya dilakukan saja yang ada di situ, kalau tidak ada,ya tidak dilakukan,”jelasnya. Oleh karena itu, ujar Sjafei, jika Bandara Kuala Namu tetap dioperasikan pada 2012 nanti, sementara seluruh tahapan tersebut belum dilalui,maka ATS

berhak menolak. “Kita berhak menolak. Kalau kita belum tahu alat itu apa, makanya harus ada training. Dalam UU No 1 tahun 2009 tentang penerbangan, orang yang mengoperasikan sesuatu tanpa sertifikat itu bisa dihukum,” cetusnya. Di lain pihak, GM PT Angkasa Pura II cabang Polonia Medan, Bram Baroto Ciptadi mengatakan, pihaknya didesak untuk melancarkan perpindahan bandara itu. Dan perpindahan Bandara Polonia ke Kuala Namu sangat mendesak mengingat kapasitas Bandara Polonia yang sudah tidak memadai dengan jumlah penerbangan. Bandara Polonia yang kapasitasnya 900 ribu per tahun kini pergerakannya sudah 192 penerbangan dalam sehari. Bahkan, pada tahun 2011 ini, sudah 7 juta kapasitas. Akhir tahun 2012, diprediksi penumpang akan mencapai 8 juta, sehingga Bandara Kuala Namu diharapkan selesai tepat waktu. Pada kesempatan yang sama, Razali Abubakar, Kepala Otoritas Bandar UdaraWilayah II mengatakan, bila melihat interval waktu yang tinggal setahun, perpindahan ini sangat mepet dan rasanya dikhawatirkan tidak akan cukup waktunya. Selain itu, masih ada hambatan untuk perpindahan itu sendiri. “Namun, bila ini dipacu, apalagi pengerjaan seudah 84 persen, maka Bandara Kuala Namu dapat selesai tepat waktu,” ujarnya.Bersambung R. Anwar

Waspada/Eddi Gultom

WABUP Sergai Ir. H. Soekirman bersama anggota Komisi A DPRD Sumut Syamsul Hilal, anggota DPRD Sergai Suaripin, S.Sos berdialog tentang ketahanan pangan dengan masyarakat petani pada peringatan Hari Pangan se Dunia XXXI tahun 2011 di Dusun IV Sinangkong Desa Maria Padang, Kec. Tebing Tinggi, Minggu (16/10).

Wabup Sergai Ir. H. Soekirman

Harus Konsumsi 98 Kg Beras TEBINGTINGGI (Waspada): Setiap manusia khususnya masyarakat Indonesia harus mengkonsumsi beras sebanyak 98 kg per orang per tahun sesuai standar menu makanan berimbang. Namun kenyataannya ada yang mengkonsumsi beras hingga 131 kg per orang per tahun. Hal ini dapat menimbulkan berbagai gangguankesehatansepertikolesterol, gula darah yang meningkat dan lainnya . DemikiandisampaikanWakil Bupati Sergai Ir. H. Soekiman pada peringatan Hari Pangan se Dunia XXXI tahun 2011, dilaksanakan Organisasi Tani Maju Bersama terdiri dari Kelompok Tani (Poktan)Bersaudara,PoktanSuka Rasmi,PoktanTunasBaru,Poktan Karang Seroja, Poktan Lembah Harapan, Serikat Petani Serdang

Bedagai(SPSB)danYayasanBITRA IndonesiadiDusunIVSinangkong Kec. Tebing Tinggi, Kab. Serdang Bedagai, Minggu (16/10). Peringatan Hari Pangan se Dunia dengan tema, ‘Rakyat butuhpangan,rakyatbutuhlahan dan rakyat butuh hidup’, dihadiri anggota Komisi A DPRD Sumut Syamsul Hilal, Ketua DPC GOPTKI Sergai Ny. Hj. Marliah Soekirman, Direktur Yayasan Bitra IndonesiaWahyudi, Ketua Tim Advokasi Swaldi, anggota DPRD Sergai Suaripin S.Sos dan Mahyudin Purba, S.Sos, Kepala BP2KP Sergai Ir. H. Safaruddin, Kadis Pertanian Ir. Setyarno, Kabag Humasy Drs. H. Mariyono SP, Camat Tebing Tinggi Drs. Ramadhan Purba, SH, tokoh masyarakat dan ratusan petani yang tergabung dalam berbagai ke-

lompok tani. Wabup Sergai Ir. H. Soekirman menegaskan, selain mengkonsumsiberassebagaimakanan pokoksecaraberimbang,kitajuga harus memperhatikan menu makanan pendukung lainnya seperti lauk pauk, sayur, buahbuahan dan susu yang tergabung dalam menu 4 sehat 5 sempurna guna mendapat gizi berimbang. “Dalam peringatan Hari Pangan se DuniaXXXI tahun 2011 ini, mari kita juga turut menjaga kelestariansungaisebagaisumber kehidupan dari berbagai macam ikan air tawar yang banyak dikonsumsi, dengan tidak menyetrum atau meracun saat mengambil ikan dari sungai karena hal itu dapatmengurangijumlahpopulitas ikan yang ada,” imbauWabup Ir. H. Soekirman.(a08)

Sumatera Utara


CP Pencuri Pulsa ‘Terus Menggila’


TANJUNGBALAI (Waspada): Aksi Contet Provider (CP) yang mengirimkan berbagai sms berakibat raibnya ribuan rupiah per pesan sepertinya ‘terus menggila’. Pasalnya, dalam satu hari, pesan yang tak diharapkan tersebut masuk hingga lima kali. “Jumlahkan saja, dua ribu dua ratus rupiah dikali lima sms berarti sebelas ribu rupiah dalam satu hari, dan itu baru satu orang,” kata Rahmat Hidayat seorang guru sekolah swasta di Kota Tanjungbalai kepada Waspada, Minggu (16/10). Diamendapatsmsyangtidakjelasisidantujuannya berasal dari nomor 9117. Rahmat mengaku kecewa karena menjadi korban penipuan dan pencurian pulsa berkedok sms. Rahmat menduga CP tersebut bekerjasama dengan layanan penyedia telekomunikasi untuk meraup keuntungan besar. Apalagi lebih dari 50 persen rakyat Indonesia telah menggunakan jasa telekomunikasi. “Kalau cuma sms saja paling harganya seratus lima puluh rupiah, tapi mengapa kok sampai di atas dua ribu, bahkan ada yang lima ribu, jelas

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Aji Wahyudi (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Feirizal Purba (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, Rizaldi Anwar, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Kebijakan Pemko ‘Runtuhkan’ Pasar Bahagia Harus Ditinjau Ulang TANJUNGBALAI (Waspada): Kebijakan Pemko Tanjungbalai menghancurkan bangunan Pasar Bahagia untuk akses mobilitas material bangunan harus ditinjau ulang. Demikian Wakil Ketua DPRD Kota Tanjungbalai Surya Darma AR didampingi anggota Hakim Tjao Kian Lie dikonfirmasi terkait kedatanganbelasanpedagangikanPasarBahagiakegedungterhormat itu, Kamis (13/10). Mereka bermaksud memprotes rencana peruntuhan dan penggusuran meja dagangan permanen. “Belasanmejapermanenyangakandiruntuhkanitubarudibangun beberapa bulan lalu, dan saat ini masih dalam tahap perawatan. Sementara anggaran berasal dari APBD,” jelas Surya. Padahal warga di dekat pasar mengizinkan truk pengangkut material melintas di tanah miliknya, tanpa mengganggu bangunan yang ada. Pemilik meja yang akan dipindah tidak relah digusur karena Pemko tidak menyediakan tempat yang layak. “Sesuai surat edaran dari Dinas Pasar, tempo 1x24 jam mereka harus pindah. Namun mereka tidak menyediakan meja melainkan menyuruh berdagang di atas tanah dan pasir,” terang Surya. “Kita mintaWali kota membatalkan kebijakan tersebut dan turun tangan guna memberi solusi kepada pedagang, dan menyelamatkan aset pemerintah,” tandas Hakim sembari menambahkan, peruntuhan bangunan bukanlah jalan terakhir.(a32)

Waspada/Deni Syafrizal

TRUK pengangkut Tandan Buah Segar (TBS) kelapa sawit sedang melintas di ruas Jl. Simpang Aek Batu-Sumberjo, Senin (17/10). Meskipun sudah ada tanda maksimal kendaraan melintas 8 ton, namun masih banyak truk bermuatan 17 ton ke atas masih melintas di kawasan itu.

Truk TBS Dan CPO Picu Kerusakan Jalan LABUSEL (Waspada): Sejumlah warga Dusun Sumberjo, Desa Asam Jawa, Kec. Torgamba, Kab. Labuhanbatu Selatan (Labusel) memasang portal di badan jalan. Aksiitusebagaibentukprotes, atas banyaknya truk pengangkut Tandan Buah Segar (TBS) kelapa sawit dan Crude Palm Oil (CPO) bermuatan rata-rata 17 ton melintas di kawasan itu, sehingga mengakibatkanbadanjalanrusak, sebab kapasitas maksimal badan jalan dusun tersebut hanya 8 ton. Berdasarkan catatan Waspada, aksi blokir jalan bukan pertama kali dilakukan warga. Aksi serupa juga pernah dilakukan warga di ruas Jalan Tandan, Desa Tanjung Medan, Kec. Kampungrakyat pada 25 November 2010 lalu. Pemblokiran yang sama juga dilakukanwargaCikampakterhadap ruas Jl.Torgamba-Cikampak, Desa Aek Batu, Kec. Torgamba pada 9 November 2010. Alasannya hanya satu, warga keberatan atas rusaknya badan jalan. Mereka menuding, truk pengangkut TBS dan CPO milik sejumlah Pabrik Minyak Kelapa Sawit (PMKS) yang melintas di kawasanitujadipemicukerusakan jalan, pasalnya berat angkutan melebihikapasitasjalanyakniratarata 17 ton ke atas. Berdasarkan data di Dinas Perindustrian, Perdagangan, Koperasi, dan UKM hingga tahun 2011 tercatat sebanyak 27 PMKS yang beroperasi di Labusel. Seba-

gian besar perusahaan-perusahaan tersebut mengoperasikan truk berkapasitas 17 ton ke atas. PadahalkelasjalanmenujuPMKS tersebut adalah IIIC, dengan kapasitas berat maksimal kendaraan melintas di atasnya 8 ton. Keberatan warga tersebut cukup beralasan, seperti ruas Jalan Besar Dusun Sumberjo misalnya, kini kondisinya mulai rusak di beberapa bagiannya. Padahal, ruas jalan ini baru saja selesai dilakukan pengaspalan oleh rekanan Dinas Pekerjaan Umum, Pertambangan,danEnergi(PUPE)Labusel. Padahal bagi warga, ruas jalan tersebut jadi penentu perekonomian mereka. Berdasarkan pengamatan Waspada, Senin (17/10), meski di persimpangan jalan tersebut telah terpampang rambu yang menunjukkan bahwa kelas jalan tersebut IIIC dan hanya truk bermuatan8tonkebawahyangboleh melintas, namun truk bermuatan 17 ton tetap nekat melintas. Bahkan, akibat dimensi kendaraan yang tidak sesuai dengan lebarbadanjalan,terpaksakendaraan yang melintas saling bergantian saat berselisih. Anehnya, petugas Dishub Pemkab Labusel yang menerbitkan rambu tersebut, justru tidak mengambil tindakan apapun ketika truk berlebihan muatan tersebut melintas. Menanggapi hal tersebut, Ketua Aliansi Penyelamat Indonesia (API) Labusel, Rustam Sitompul SH mengatakan, harusnya Pemkab khususnya Dinas Perhubungan tegas menindak masalah ini. Dengan dibiarkannya truk-truk melebihi kapasitas itu beroperasi, terkesan

Dishubmenerimaupetidaripihak perusahaan,sehinggatidakberani mengambil tindakan. Padahal kata dia, UU No. 22 Tahun 2009 tentang Lalu Lintas dan Angkutan Jalan dengan tegas sudah mengatur ketentuan jalan dan sanksi yang dapat dilakukan terkaitmasalahkelebihanmuatan tersebut. Namun, Dishub justru tidak menggunakan kewenangannya itu untuk menjaga aset daerah.“Dishubmemilikipayung hukum untuk bertindak. Lalu kenapa tidak diambil langkah tegas?,” katanya. Sayangnya Kepala Dinas Perhubungan, Informasi, dan Komunikasi, Tuahta Rama Jaya Saragih tidak dapat dikonfirmasi terkait persoalan tersebut. Saat Waspada menemui ke kantornya,salahseorangstafnyamengatakan, Tuahta tidak berada di tempat. Beberpa kali dihubungi melalui telepon seluler, panggilan tersebut juga ditolak. Terpisah, Kabag Humas Pemkab Labusel, Milhan Harahap menanggapi masalah itu mengakui banyaknya keluhan tersebut. Namun, sejauh ini Pemkab sudah berupaya menjalin komunikasi yang baik dengan perusahaan yang ada di Labusel. Dari sejumlah pertemuan yang dilakukan, akhirnya pihak PMKS bersedia membantu Pemkab untuk memelihara dan meningkatkan kualitas jalan. Namun diakuinya, masih ada beberapa perusahaan yang belum setuju dengan kesepakatan tersebut. “Dan kita masih terus menjajakikesepakatanuntukbersama menjaga kondisi jalan tersebut,” katanya. (c18)

Benteng Beton Hempang Abrasi DiTgTiram PERUSAHAAN tidak saja berkewajiban membangun, namun menjaga dan melestarikan lingkungan sekitar dari ancaman kerusakan. Seperti dilakukan CV Inti Atlantik atau dikenal dengan nama Facifik di Tanjungtiram yang membuat benteng percontohan beton pemecah ombak bersamaan penanaman bibit mangrove di sisi Pantai Bogak Sebrang, Desa Bandar Rahmad, pemekaran dari Desa Bogak, Kec. Tanjungtiram, Kab. Batubara. Tujuannya, tidak lain guna menyelamatkan daratan pantai lingkungan sekitar dari keganasan ancaman abrasi. “Mudah-mudahan langkah ini dapat menyelamatkan pantai dan lingkungan sekitar dari ancaman abrasi,” tukas Amir dan Jamal nelayan yang bermukim di kawasan itu kepada Waspada, Minggu (16/10) menanggapi pekerjaan pembuatan benteng beton dilakukan salah satu perusahaan pengolahan ikan tersebut. “Ini kita tanggulangi sendiri sebagai proyek percontohan di Batubara,” tukas Eri selaku managemen perusahaan sembari menjelaskan

pembentengan dilakukan sepanjang 500 meter dimulai dari titik nol sampai ke kawasan kubah pekerjaannya sekarang sedang berjalan. Melihat kondisi pantai kini memprihatinkan tidak menyisakan hutan mAngrove lagi (gundul) sebagai pelindung.Akibat dari perkembangan pembangunan dan pemukiman penduduk sebelumnya merupakan kawasan hutan. Disamping tindakan pengambilan pasir kuarsa secara besar - besaran di tengah laut semasa Batubara belum dimekarkan. Tingkat abrasi tak dapat dihindarkan meluluhlantakan bagian pinggir daratan ke laut tersisa kini sekitar 3 hingga 4 meter dari pinggir laut dijadikan sebagai jalan oleh warga setempat bila bepergian keluar maupun memasarkan hasil perikanan. Langkah ini dapat di tiru dan dilakukan bagi yang lain dalam menyelamatkan lingkungan dari kepunahan apakah dilakukan oleh tangan jahil maupun karena alam demi menjaga kelestarian nya di masa akan datang. Iwan Has

sekali ini pencurian dan penipuan,” kata Rahmat. Sementara, Thesa Alfantia, 15, salah seorang siswi SMK Swasta di kota itu mengatakan mendapatkan pesan singkat (SMS) dari nomor 2627 tentang selebritis. Begitu masuk, pulsanya secara otomotis terpotong Rp2.200, padahal dia tidak pernah mendaftarkan kepada nomor tersebut maupun lainnya. “SMS itu hampir setiap hari masuk. Saya tidak tahucaramenonaktifkannyakarenabelumpernah mendaftarkan sebelumnya,” ujar siswi warga tinggal di Jalan Pematang Pasir tersebut. Kapolres Tanjungbalai AKBP Puja Laksana dikonfirmasi Waspada melalui Kasat Reskrim AKP RD Firman Darwin didampingi Kasubbag Humas AKP Y Sinulingga mengatakan belum pernah menerima laporan dan keluhan masyarakatterkait smsitu.Firmanmengatakanpersoalan itu menjadi isu Nasional dan pembahasannya telah sampai ke tingkat menteri. Namun, hingga kini belum ada kesimpulan apakah termasuk dalam Cyber Crime (kejahatan telekomunikasi dan dunia maya) atau bukan. (a32)

Polisi Amankan PNS Calo Penyisipan CPNS KISARAN(Waspada):SeorangPNSdiamankan Polres Asahan, karena terlibat dalam penipuan dan penggelapan uang senilai Rp 140 juta yang digunakan untuk penyisipan penerimaan CPNS di Kabupaten Asahan 2010. Informasi dihimpun Waspada, tersangka DAB, 35,seorangPNSdiDinasPendidikanAsahan,warga Jl. Ir.Sumantri, Kisaran, diamankan Polres Asahan, di Mess Pemda Asahan, Jl. Armada Medan, Minggu (16/10) dinihari, karena sudah dua kali tidak memenuhi panggilan. Namun tersangka tidak ditahan karena dijamin oleh suaminya yang juga tokoh masyarakat Asahan. Tersangka terlibat dalam penipuan sebesar Rp140jutayangdiberikanolehduaorangkorbannya RS sebesar Rp 80 juta dan Rp YA, Rp 60 juta, yang digunakan untuk penyisipan penerimaan CPNS pada 2010 lalu. Namun kenyataannya saat pengumuman dua orang yang disisipkan tersebut tidaklulus,sehinggaduakorbanmenuntutuangnya namun tidak dikembalikan sehingga berujung dengan pengaduan ke Polres Asahan. Kapolres Asahan AKBP Marzuki MM, dikonfirmasi Waspada, melalui KasaT Reskrim AKP Fahrizal didampingi Kasubag Humas AKP R Berutum, Senin (17/10), membenarkan dan kini tersangka masih dalam tahapan pemeriksaan dan wajib lapor. Dalam perkara ini ada seorang PNS insial SZ lagi yang diduga terlibat, dan kini kabarnya berada di Jakarta sehingga belum diamankan. “Masalah ini telah dilaporkan April 2010 lalu, dan Polres telah memeriksa dua saksi, dan memanggil tersangka sebanyak dua kali. Namun, tanpa ada alasan yang jelas DAB tidak datang, sehingga dilakukan pemanggilan paksa dan menjemputnya di Kota Medan, untuk menjalani pemeriksaan,” jelas Fahrizal.

KASAT Reskrim Polres Asahan, AKP Fahrizal, menunjukkan dua lembar bukti transfer uang senilai Rp 140 juta yang dilakukan DAB, kepada SZ, terkait dalam penipuan dan penggelapan untuk penyisipan penerimaan CPNS Pemkab Asahan 2010.

RANTAUPRAPT (Waspada): Ribuan massa yang berasal dari berbagai penjuru Kab. Labuhanbatu tumpah ruah membanjiri kota Rantauprapat untuk menyaksikan parade etnis yang diselenggarakan dalam rangka memperingati Hari Jadi Pemkab Labuhanbatu yang ke-66Tahun 2011, Sabtu (15/10). Parade etnis dengan titik start dan finish di lapangan Ika Bina Rantauprapat itu diikuti seluruh Etnis yang ada di Kab. Labuhanbatu. Disamping itu berbagai marching band sekolah, sepeda hias, barongsai dan penampilan tari-tarian turut memeriahkan parade etnis hari jadi Pemkab Labuhanbatu kali ini. Para Unsur Pimpinan Daerah, ketua TP PKK, kepalaSKPD,pimpinanBUMN/BUMD,pimpinan Etnis, pemuka agama dan tokoh masyarakat serta siswa dan Pramuka membaur menjadi satu meramaikan kemeriahan parade etnis hari jadi yang baru pertama kali dilaksanakan. Menurut Asisten Pemerintahan Drs Karlos Siahaan yang juga sebagai ketua panitia pelaksana peringatan hari jadi pemerintahan kabupaten Labuhanbatu ke-66 tahun 2011, bahwa parade etnis ini diselenggarakan mengganti kegiatan

Panggung Budaya yang diselenggarakan setiap menjelang HUT Pemkab Labuhanbatu. Selain kegiatan parade etnis juga dilaksanakan berbagai lomba olah raga tradisional seperti tarik tambang, lomba bakiak, panjat pinang, lomba masak makanan non beras, gerak jalan santai, sepeda santai, donor darah dan launching e-KTP. Sepeda Santai Kegiatansepedasantaijugamewarnaikegiatan peringatan hari jadi ke-66 Pemkab Labuhanbatu tahun2011dengantitikstartdanfinishdiLapangan IkaBina,RantauprapatberlangsungJumat(14/10). Bupati Dr H Tigor Panusunan Siregar SpPD, Wakil Bupati Suhari Pane SIP, Ketua DPRD Hj Ellya Rossa Siregar SPd, Kapolres AKBP Hirbak Wahyu Setiawan, Plt Sekdakab H Ali Usman Harahap SH, para Asisten, para kepala SKPD, para Kabag dan berbagai lapisan masyarakat turut memeriahkan acara sepeda santai ini. Sepedasantaiyangmenelusuribeberapasudut kota Rantauprapat itu terlihat menambah keakraban sesama unsur pimpinan daerah dan diantara para PNS itu sendiri. Sepanjang jalan diwarnai dengan canda tawa dari peserta dan lambaian dari masyarakat yang dilalui. (c07)

Fahrizal mengatakan, tersangka tidak ditahan karena ada jaminan dari suaminya. Namun tersangka wajib lapor sampai kasus ini terkuat. “Berdasarkan pemeriksaan, tersangka mengirim uang Rp 140 juta kepada rekannya SZ melalui rekning bank.” ujar Fahrizal. Disinggungdengankasussuapuntukkelulusan CPNS,Fahrizalbelumbisamemastikannya,karena dalam pemeriksaan awal tersangka terlibat penipuan dengan bukti penerimaan uang melalui kwitansi. Oleh sebab itu, Fahrizal akan terus mendalami kasus ini dan mencari SZ, sehingga aliran uang sebesar Rp 140 juta bisa terungkap. “Kita akan terus tingkatkan penyidikan sehingga masalah ini bisa selesai, dan tersangka yang seharusnya bertanggung jawab bisa diringkus,” kata Fahrizal. (a15)


Ribuan Warga Saksikan Parade Etnis Hari Jadi Pemkab Labuhanbatu

Kantor SMPN I Talawi Dibongkar Maling LABUHANRUKU (Waspada) Kantor SMPN I Talawi di Labuhanruku Batubara dibongk ar maling,peralatan kantor berupa kompu termonitor,CPU dan sebuah infocus hilang,Minggu (16/ 10) dinihari. Kerugian di taksir lebih Rp.5 juta Menurut keterangan,kawanan maling masuk setelah mencongkel kunci pintu ke mudian mengambil seperangkat komputer (komputer, monitor,cpu) dan sebuah infocus Dikantor terdapat

5perangkatkomputer,yangdiambil1 dankawanan maling sempat mengerjai brankas tetapi tidak berhasil Pihak sekolah, menurut seorang guru melaporkan kejadian terbongkarnya kantor pagi Minggu itu ke Polsek Labuhanruku, sementara petugas jaga malam sekolah, Su, sudah dimintai keterangannya. Jabatan Kasek SMPN I Talawi baru sebulan lalu diganti, tetapi belum dilaksanakan serah terima. (a12)

Tim Penelusuran Dana Rp80 M Harus Publikasikan Hasil Kunjungan LIMAPULUH (Waspada): Tim penelusuran dana kas Pemkab Batubara Rp80 miliar yang hilang bentukan DPRD, harus mempublikasikan hasil kunjungannya kepada masyarakat demi transparansi, akuntabilitas dan integritas lembaga yang tugasnya mengontrol pemerintah. Demikian disampaikan juru bicara Lintas Elemen Masyarakat (LEM.BB) Arsyad Nainggolan, Senin (17/10) pasca kepulangan tim tersebut dari Jakarta mengunjungi Bank Indonesia, PPATK dan Kejagung. “Hari ini kita tidak melihat adanya jadwal tim menyampaikan laporan hasil kunjungannya kepadapimpinan.Kitakhawatiradaupayapengka-

Budidaya Ikan Air Tawar Di Batubara Menggembirakan SEI.BALAI (Waspada) Kerjasama pihak Di nas Kelautan dan Perikanan Batubara de ngan petani tambak budidaya ikan air ta war dinilai menggembirakan. “Dengan petunjuk diberikan petugas Di nas Kelautan dan Perikanan,hasil kerja menanam bibit ikan gurami menggembi rakan” jelas Burhan Ketua Pokmas Ikan Perintis Desa Sei.Balai Kec.Balai Batubara, Sabtu (15/10). Dia menyampaikan rasa terimakasih nya kelompok Ikan Perintis dipimpinnya mendapat bantuan melalui program Bantuan Otorita Asahan tahun 2010/2011 berupa 9000 bibit gurami beserta biaya pakan perbulannya. Sekretaris Diskanla Batubara Anton Ritonga, Minggu (16/10) mengatakan bantuan Otorita Asahan untuk petani tambak budi daya ikan kerapu di Talawi,Medangderas dan budidaya ikan air tawar ikan gurami di Sei.Balai,lele jumbo,ikan mas di Lubuk Cuik beserta pakan. Juga bantuan peralatan kincir sampan,pompa air,mesin pencacah,jaring,mesin pencetak pelet/bahannya. Bantuan Otorita Asahan di Batubara,sebut Anton Rp.2,8 miliar terdiri Diskanla Rp.1,5 miliar,Dinas Pertanian Rp 900 juta lebih dan Lingkungan Hidup Rp 400 juta lebih.(a12)

WASPADA Selasa 18 Oktober 2011

buran dalam proses penyampaian laporan ini, sehingga keberangkatan mereka ke Jakarta untuk penelusuran dana itu berakhir tidak jelas. Sama denganhasilbimtekataustudibandingyangselama ini dilakukan hanya menghabiskan biaya,” tuding Arsyad. Menurutnya publikasi hasil kunjungan itu mutlak dilakukan karena selama ini informasi yang diterima masyarakat Batubara dinilainya adalah kabar bohong. Sebab masalah deposito uang kas Pemkab ini disebutkan Pusat Pengkajian AnalisisTransaksiKeuangan(PPATK)adalahmoney loundry, atau pencucian uang yang itu adalah kejahatan. (c05)

Terkait Pemecatan 18 CPNS Labuhanbatu, API Surati BKN

Waspada/Iwan Has

BENTENG beton pemecah ombak di sisi Pantai Bogak Sebrang Desa Bandar Rahmad pemekaran dari Desa Bogak Kec Tanjungtiram, Batubara, bersamaan menanam bibit Mangrove oleh CV Inti Atlantik.

KOTAPINANG (Waspada): Terkait kasus pemecatan 18 CPNS/PNS di lingkungan Pemkab Labuhanbatu pada 2009 lalu, Tim Advokasi yang tergabung dalam Aliansi Penyelamat Indonesia (API) menyurati Badan Kepegawaian Negara (BKN) Regional Medan. Surat tersebut meminta BKN meninjau ulang SK pemecatan yang dikeluarkan Bupati Labuhanbatu. “Secara resmi kita telah menyampaikan surat kepada BKN agar SK Kepala BKN No.176/KR.VI/ BKN/IX/2009 tentang pembatalan Nip CPNS dan SK Bupati No.800/BKD/2663/2009 22 Oktober

2009 tentang pemecatan 18 CPNS/PNS ditinjau ulang dan dibatalkan,” kata Sekretaris Tim Investigasi API Sumut, Andi Khoirul Harahap kepada Waspada, Senin (17/10) sambil menunjukkan surat No. 15/TIM/API-SU/X/2011 tertanggal 10 Oktober 2011 itu. Dijelaskan, 18 CPNS dan PNS yang dipecat tersebut sengaja di korbankan oleh Tim 15 yang di bentuk oleh Bupati Labuhanbatu pada 26 Agustus 2008 sesuai SK No.800/181/Org/2008 tentang pembentukan Tim seleksi dan Evaluasi berkas tenaga honorer. (c18)

Sumatera Utara

WASPADA Selasa 18 Oktober 2011

Ranperda Karo Mendesak Disahkan Jadi Perda 2011 KABANJAHE (Waspada) : Sesuai amanat Undang - undang (UU) No. 28/2009 tentang pajak daerah dan retribusi daerah yang telah disahkan membuat sejumlah Peraturan Daerah (Perda) Kab. Karo harus segera di revisi, dan Ranperda harus segera disahkan menjadi Perda paling lambat 31 Desember 2011. Jika 31 Desember 2011 Ranperda Kab. Karo belum menjadi Perda, maka yang lama tidak diberlakukan lagi, sehingga sangat merugikan Pemkab Karo dalam pemasukan pendapatan asli daerah (PAD). karena tidak dapat melakukan pengutipan retribusi daerah sebelum Ranperda tersebut disahkan. Hal itu dikatakan Plh Kadis Pendapatan Pengelola Keuangan dan Aset Daerah (PPKAD) Riyadi Tarigan melalui Sekertaris Thomas Ginting didampingi Kabid Pemberitaan Dinas Infokom, dan PDE Pemkab Karo Jhonson Tarigan, Rabu (12/10). Hal itu juga akan berdampak kepada penyusunan APBD, karena APBD tidak akan dapat diproyeksikan atau target perkiraan dari PAD pada APBD tidak dapat ditentukan. Dikatakan Thomas, sejumlah Ranperda yang harus disahkan tersebut Ranperda tentang pajak daerah, retribusi jasa umum, Retribusi Jasa Usaha, dan Ranperda tentang restribusi perizinan tertentu. Draft Ranperda tersebut telah dikirim ke DPRD Karo Semtember 2011. (c19)

Oknum Guru Dituduh Menggelapkan Perhiasan P. SIANTAR (Waspada): Oknum guru RS, 49, warga Jalan Laguboti, Kel. Toba, Kec. Siantar Selatan, Kota Pematangsiantar diadukan ke polisi atas tuduhan penggelapan barang perhiasan yang digadaikan. Berbagai keterangan dihimpun menyebutkan dan pengaduan korban Ria Mora Lumbantobing, 50, wiraswasta, warga Jalan Laguboti, Kel.Toba, Kec. Siantar Selatan, di Polres, Kamis (13/10) menyebutkan, RS menggelapkan perhiasan korban di kantor Perum Pegadaian UPC Siantar Plaza, Jalan Merdeka, Kel. Proklamasi, Siantar Barat, Pematangsiantar, Senin (10/10). RS meminjam perhiasan milik korban berupa satu gelang plat berlian dan satu kronyot 14 Februari 2011 dengan tujuan akan digadaikan ke Pegadaian dan RS berjanji akan mengembalikan seminggu kemudian. Namun, seminggu kemudian, RS tidak mengembalikan barang milik korban dengan alasan tidak memiliki uang. Penasaran dengan jawaban RS, korban melakukan pengecekan ke kantor Perum Pegadaian UPC Siantar Plaza, Senin (10/10). Ternyata, perhiasan itu masih berada di Pegadaian dan akan jatuh tempo 18 Oktober 2011. Akibat perbuatan RS, korban mengalami kerugian Rp36 juta. Kapolres Pematangsiantar AKBP Alberd TB Sianipar, SIK, MH saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu dan Kasat Reskrim AKP Azharuddin, Jumat (14/10) membenarkan.(a30)

Pelantikan Kadis PU Palas Ricuh SIBUHUAN (Waspada): Pelantikan Kepala Dinas Pekerjaan Umum Pertambangan dan Energi Padanglawas (Palas) Chairul Windu, Senin (17/10) sore, di Aula Kantor Bupati Sibuhuan, diwarnai keributan. Keributan terjadi saat Sekretaris Daerah Gusnar Hasibuan membacakan sumpah jabatan, dimana mahasiswa yang berada disisisebelahkirilokasipelantikan menyebutkan Kadis PU jangan dilantik. Mereka yang melakukan aksi tersebutberasaldariGerakanMahasiswa Peduli Pemerhati Padanglawas (GMP3 PALAS), Gerakan Mahasiswa Padanglawas (Gema Palas), Forum Komunikasi Mahasiswa Padanglawas (FKMP) dan Mahasiswa Padanglawas dan sekitarnya (MPDAS). Mereka menyebutkan agar oknum penyebab masalah tersebut jangan dilantik karena terlalu banyakpermasalahandiPadang-

lawas yang ditimbulkannya. Pak Sekda, sudah terlalu banyak permasalahan ditimbulkan oknum Plt Kadis PU, kami memohon agar dia jangan dilantik,” ujar Sahruddin Sahala. Kemudian Mardah Hanapi Hasibuan mengatakan, proyek multi years pembangunan kantor bupati hingga kini bermasalah dan menimbulkan hal negative terhadap pemkab. “Kami menyatakan tidak akan demo lagi bila Kadis PU tidak dilantik,’’ ujar mereka bersama-sama. Namun Sekda tidak menggubris permintaan yang berasal dari mahasiswa tersebut. dia tetap membacakannya hingga sumpah yang akan dipertanggungjawabkan di akhirat tersebut selesai. Keributan semakin memuncaksaat pesertayangdilantikakan menandatangi sumpah jabatan yang dilaksanakan di tengah tengah lokasi pelantikan. Aksi tolak-menolak antara mahasiswa dan Satpam kantor bupati tak terelakkan. Kondisi tersebut dapat dikendalikan saat anggota Polsek

Upaya Damai Akhiri Aksi Demo Siswa SMAN 2 Sibolga

Barumun tiba di lokasi. Merekayangdilantikbersama Kadis PU yakni Pelaksana tugas (Plt) Kadis Pertanian Ir.Sahril Harahap dilantik menjadi Kadis Pertanian, Plt Kabid Akutansi Paruhuman Harahap menjadi Kabid Akutansi. Dalam sambutannya, sekda mengatakan pelaksanaan pelantikan tersebut merupakan disposisi bupati dan wakil bupati. “ Apapun yang terjadi saya harusmelaksanakanamanahtersebut,” ujar sekda. Kepada Kadis PU dia mengatakan, kedepanagar dapatmemperbaiki sikap dan dapat merobah apa yang menjadi gonjangganjing di masyarakat. “Bahwa terhadap pembangunan fisik yang ada adalah tanggung jawab saudara Kadis PU,untukitusaudaraharusdapat merobah sikap,” ujar Sekda. Hadir dalam pelantikan tersebut Kacabjari Sibuhuan H. RamlanHarahap,KapolsekBarumun AKP Tongku Bosar Harahap, mewakili Danramil Sibuhuan, Kaban BKD H.Hamzah Hasibuan serta Kadis dan Kaban lainnya. (a34)

PMII Dan Himmah Palas Gelar Bakti Sosial SIBUHUAN (Waspada); Dalam rmenyongsong pereingatan hari Sumpah Pemuda 28 Oktober mendatang, elemen mahasiswa yang tergabung dengan Pergerakan Mahasiswa Islam Indoensia (PMII)CabangPalassertaHimpunanMahasiswaAlwasliyah(Himmah) Cabang Kab. Padang Lawas melakukan bakti Sosial membersihkan Lingkungan Mesjid di sekitar pusat kota Sibuhuan. Demikian Koordinator kegiatan A Rifai Rangkuti didampingi Irham Habibi Habibi Harahap,Ali Tohir Batubara,Chandra Muda Nasution,Elisna Rahmi,Adnan Hamidi Lubis, kepadaWaspada, Kamis (13/10) ketika pelepasan kegiatan bakti Sosial itu di lapangan Merdeka Sibuhuan, Kec. Barumun. Dikatakan, kegiatan bakti sosial yang dilaksanakan, merupakan gerakan peduli lingkungan yang bersih dan sehat, khususnya di lingkungan mesjid yang ada di sekitar pusat Pasar Sibuhuan, termasuk mesjid Annur LingkunganVI Sibuhuan, mesjid Miftahul Jannah Pasar Sibuhuan, Mesjid Alhuda JlVeteran Lingkungan II, Mesjid Purba Tua di Dessa Purbatua, dan mesjid Al Ikhlas Jl Ikpos Sibuhuan. (a33)

Tim Evaluasi Kelurahan Percontohan Kunjungi Gurilla P. SIANTAR (Waspada): Tim Evaluasi Kelurahan Percontohan PTP2W-KSS PKK Provsu mengunjungi Kel. Gurilla, Kecamatan Siantar Sitalasari, Kota Pematangsiantar untuk melakukan penilaian. “PTP2W-KSS salah satu upaya pemberdayaan masyarakat untuk merubah kebiasaan perilaku hidup dari kurang sehat menjadi sehat, tadinya hanya sekedar konsumen tetapi bisa menjadi produsen,” sebut Wali Kota Pematangsiantar Hulman Sitorus, saat menerima Tim Evaluasi Kelurahan Percontohan PTP2W-KSS PKK di kantor Lurah Gurilla, Senin (10/10). Demikian dipaparkan Kabag Humas dan Protokoler Pemko Daniel H. Siregar, Selasa (11/10). Selain itu, PTP2W-KSS merupakan salahsatuprogrampeningkatanperananwanitadalampembangunan yang berupaya untuk mengembangkan sumber daya manusia dan sumber daya alam serta lingkungan untuk mewujudkan dan mengembangkan keluarga sehat, sejahtera dan bahagia. (a30)

Waspada/Syarif Ali Usman

APARAT Polsek Barumun menghadang mahasiswa yang mendatangi meja penandatanganan sumpah jabatan pada pelantikan di aula Kantor Bupati Palas, Senin (17/10).

Pejabat Palas Terkesan Makin Jauh Dari Rakyat MEDAN(Waspada):Caradan pola berpikir pejabat birokrasi di Pemerintahan Kabupaten (Pemkab) Padangawas tak kunjung mengalami perubahan. Sehingga, pejabat semakin jauh dari kebutuhan dan kepentingan pemberdayaan serta pertumbuhan ekonomi masyarakat. Demikian dituturkan Ketua Umum Gerakan Mahasiswa Padanglawas (Gema Padanglawas) Ansor Harahap didampingi Sugianto dan Jabaluddin Siregar kepada Waspada di Medan, Senin (17/10) menyikapi perkembangan pemerintahan di kabupaten tersebut. Ditegaskannya, walau cibiranmasyarakatsemakintajam dan makin tidak percaya kepada pemerintah kabupaten karena belum jelas apa yang dikerjakan selama ini, namun para pejabatnyaseakanlarutdalamkekuasaan birokrasi. ‘’Potensi atau daya untuk memberi manfaat kehadiran pemerintah di tengah-tengah masyarakatsemakinlemahdankabur. Sementara arogansi kekuasaan semakin merasuki sikap pemerintahan,’’kata Ansor. Dengan demikian, lanjutnya, pejabat Pemkab Padanglawas semakin jauh dari harapan masyarakat, cara pandang mereka terhadap jabatan yang sedang diduduki sudah salah sehingga sikap dan tindakan dalam kehidupan birokrasi pemerintahan tidakmencerminkansebagaiabdi negara yang memberikan pelayanan kepada masyarakat, sehingga masyarakat semakin tersingkir dari upaya pemberdayaan menujupertumbuhanyanglebih

baik. Lebih memprihatinkan lagi, kataAnsor,jabatanyangdiduduki di semua hirarki mulai dari atas hinggapalingbawahdilingkungan Pemkab Padanglawas terkesan memiliki kekuasaan tersendiri untuk berbuat semaunya. ‘’Hal ini ditandai dengan banyaknya kekuasaan pejabat di hirarki tertentu yang melampaui wewenangnyadanmenampilkan perilaku arogan dan kesombongan di tengah-tengah masyarakat. Dan saat bersamaan pula dia mengabaikan tugas dan tanggungjawabnya sebagai PNS yang harus siap selalu memberikan pelayanan,’’papar Ansor. Kemudian, katanya lagi, saya melihat dalam birokrasi Pemkab Padanglawas telah terbangun kerajaan pejabat yang makin berpotensi mengaburkan tujuan pemekaran dan menciptakan pengaruhyangtidakbaik.Artinya, juga telah terjadi simbiosis mutualismediantarasesamapejabat dan kelompok-kelompok yang ingin ikut bersama melakukan eksploitasi. Disamping itu, kata Ansor yang juga mantan Bendahara HMI Sumut ini, telah berjalan polarisasi kepentingan di tubuh Pemkabditengah-tengahmasyarakat Padanglawas yang tujuannyauntukkepentinganpolitikpada suksesi kepala daerah mendatang. Menurut Ansor pula, pejabat tinggi di Pemkab Padanglawas telah mengalihkan konsentrasinya sebagian besar untuk kepentingan politik pragmatis tanpa memperdulikan realitas sosial yang makin merosot.

Hutan Di Kawasan Danau Toba Rusak Dan Gundul PEMATANGSIANTAR (Waspada): Pencanangan DanauToba Go Green yang dilakukan Pangdam I/BB sudah ditindaklanjuti Danrem 022/PT bersama Polri,

Pemda dan komponen masyarakat di wilayah Korem 022/PT, dan dimulai sejak 5 Oktober 2011. Itu program penghijauan di kawasan Danau Toba di sekitar

Waspada/Edoard Sinaga

DANAU Toba Go Green yang dicanangkan Pangdam I/BB ditindaklanjuti dengan penggalian lubang tanaman pohon penghijauan yang dilakukan para prajurit di Wilayah Korem 022/PT di sekitar perbukitan di Kota Wisata, Parapat, Kabupaten Simalungun.

SIBOLGA (Waspada): Problematika yang tengah terjadi di SMA Negeri 2 Sibolga pasca aksi mogok dan demo secara spontanitas ratusan siswa beberapa hari lalu, menemui titik terang berupa perdamaian antara pihak guru dan oknum Kepala sekolah Ali Sutan Lubis, Kamis (13/10) di ruang kerja para Guru di SMA Negeri 2 Sibolga, di Kelurahan Sarudik, Tapteng. Pertemuan itu dihadiri KapolresTapteng AKBP Dicky Patrianegara SS Sik Msi, anggota DPRD Sibolga dari Komisi III Jamil Zeb Tumory, Kepala Dinas Pendidikan Kota Sibolga Drs.Alpian Hutauruk MPd, Kapolsek Pandan Iptu H.Edy Sidauruk SH, Kepala Sekolah SMA Negeri 2 Sibolga Ali Sutan Lubis,danpuluhantenagapendidikyangmengabdi di SMA Negeri 2 Sibolga. Kapolres Tapteng AKBP Dicky Patrianegara SH Sik Msi mengatakan adapun maksud kehadirannya, tidak lain adalah bertujuan memberikan pencerahan dan sosialisasi tentang hokum. Menurut Kapolres, bahwa didalam kehidupan sangat penting menerapkan kesadaran hukum, keterbukaan, dan saling menghargai antar sesama agar terciptanya komunikasi yang baik antar guru, siswa, dan kepala sekolah. “Kita hanya memberikan pencerahan bagi kalangan guru agar mereka tauh bahwa pentingnya kesadaran hukum dalam kehidupan

sehari-hari, dan menghilangkan rasa iri hati dan dengki antar guru maupun siswa, dan untuk itu nggakadamasalahlagi,”ungkapKapolresTapteng, usaipertemuandiSMANegeri2SibolgadiSarudik. Hal senada juga disampaikan Kadisdik Kota Sibolga Drs.Alpian Hutauruk MPd di Sarudik, kendati diakuinya dirinya sangat menyesalkan terjadinya aksi demo para siswa. Menurutnya dalam pertemuan itu oknum kepsek Ali Sutan Lubis, pihak guru dan siswa sudah saling memaafkan,danoknumkepsektersebutdalampertemuan ituberjanjiakanmerubahgayakepemimpinannya sebagai Kepala Sekolah Sesalkan Sementara, meski upaya perdamaian telah terjadi, namun dalam hal ini sungguh sangat disesalkan. Pasalnya, pihak-pihak berkompeten dinilai seolah-olah terkesan membuat skenario baru dan terindikasi saling menutup-nutupi permasalahan terjadi. Hal itu dikatakan Aktivis Lembaga Bantuan Hukum (LBH) Sekolah Wilayah Sibolga dan Tapteng, Lasmaria Simatupang kepada Waspada Jumat(14/10) di Pandan. nLanjut Lasmaria, sikap oknum Kepsek tersebut dinilai bukan sematamata untuk menegakkan kedisplinan, namun hal itu merupakan salah satu cara yang bertujuan untuk merendahkan martabat siswa. (a23)

Polres Pakpak Bharat Amankan 2 Kg Ganja Dan Pemiliknya P. BHARAT (Waspada): Polres Pakpak Bharat mengamankan 2 kg ganja dalam operasi, Kamis (12/10) malam di jalan lintas Pakpak Bharat-Aceh Selatan. Operasi tersebut di pimpin langsung Kapolres AKBP Suriadi Bahar di dampingi Kasat Reskrim AKP Bonar Silalahi, Kasat Lantas AKP Radu, Ka Ops Kompol Nukimin dan Kapolsek Kerajaan AKPT.Ruslan. AKBP Suriadi Bahar yang dihubungi Waspada melalui telepon selulernya, Senin (17/ 10) mengatakan, ganja tersebut diamankan dari sebuah mobil Kijang warna hitam BK 600 DO. Sedangkan tersangka pemilik barang haram itu, R, 46, warga Jalan Gaharu Medan, dan kini

mendekam dalam tahanan Polres. Dikatakan, mobil yang ditumpangi tersangka dengan beberapa penumpang lainnya datang dari Blang Pidie, Banda Aceh tujuan Medan. Saat mobil di stop, lalu dilakukan penggeledahan. Sebuah bungkusan plastik ditemukan di bawah tempat duduk R, lalu diperiksa ternyata berisiganja.Saatdiinterogasi,siapapemilikbarang itu, R mengaku lalu digelandang ke komando. Polres Pakpak Bharat, menurut Suriadi terus melakukanoperasidijalanlintasmenghubungkan daerah itu dengan Aceh Selatan.Tujuan utama, adalah memberantas jaringan Narkoba dan sejata api, sesuai perintah Kapoldasu.(a20)

DPRD Minta Usut Kebocoran Anggaran Di Pemko Gunungsitoli

Pemkab Paluta Bentuk Satgas Awasi PNS Nakal GUNUNGTUA (Waspada): Pemkab Padanglawas Utara (Paluta) terus berupaya untuk menegakkan disiplin para pegawainya dengan membentuk Satuan Tugas (Satgas) untuk mengawasi PNS nakal dan disiplin di lingkungan tersebut. Bupati Paluta, Drs. H. Bachrum Harahap dikonfirmasi Waspada melalui Asisten III Pemkab Paluta, Drs Hailullah Harahap, Kamis (13/10) menyebutkan, tim satgas sudah terbentuk di Kab. Paluta beberapa waktu lalu untuk mengawasi kinerja dan disiplin PNS di lingkungan Pemkab Paluta. Satgas ini dibentuk, sebagai tindak lanjut dari hasil sidak PNS pada hari pertama dan hari kedua usai lebaran lalu. “Setelah hasil sidak dilaporkan ke Bapak Bupati, Bupati langsung memerintahkan kepada kami untuk membentuk satgas ini. Hingga saat itu juga kami menggelar rapat bersama instansi terkait untuk pembentukan tim khusus guna mengawasi kinerja dan disiplin PNS,” ucap Hailullah. Hailullahmengaku,saatituialangsungterpilihsebagaiKetuaSatgas tim khusus guna mengawasi kinerja dan disiplin PNS, di mana anggota tim satgas berasal dari Badan Kepegawaian Daerah (BKD), instansi lintas sektor lain seperti Inspektorat, Satpol PP, dan Perizinan. (a35)


Kabupaten Simalungun, mengingat keberadaan hutan di kawasan Danau Toba sudah banyak yang rusak dan gundul akibat dirusak serta ketidakpedulian masyarakat sekitar. “Sasaran yang ingin dicapai dalam kegiatan Danau Toba Go Green yakni terselenggaranya penghijauan dan kelestarian lingkungan di kawasan Danau Toba serta target pohon ditanam 60.360 batang,” sebut Danrem 022/PT Kolonel Inf Karsiyanto melaluiKapenrem022/PTMayor Caj Drs Prinaldi, usai peninjauan lokasi penanaman pohon dalam pencanangan Danau Toba Go Green tahun 2011, di penginapan prajurit di Wisma Pemda, Kota Wisata Parapat, Simalungun, Sabtu (15/10). Kapenrem menyebutkan, semua pohon itu akan ditanam di wilayah Koramil 11/Parapat, Koramil 12/Seribu Dolok, Koramil13/Tigaras,Koramil15/Sipintu AngindanKoramil17/Sidamanik dengan melibatkan 401 orang

personel. Untuk mendukung pelaksanaan Danau Toba Go Green ini, prajurit sudah membuat serta mencari lahan dan bahkan sudah membuat 5.883 lobang. Menurut Kapenrem, saat ini Korem 022/PT sudah mensosialisasikan kegiatan Danau Toba Go Green kepada masyarakat DanauToba dan sekitarnya, melalui selebaran yang berisi untuk mendukung program pemerintah di bidang kelestarian lingkungan alam. “Dipilihnya daerah objek wisata Danau Toba sebagai pencanangan Danau Toba Go Green tahun 2011, karena daerah ini merupakansumbermataairyang sangat berpengaruh bagi kelangsunganhidupmasyarakatbanyak. Namun, kondisi hutan sebagai penyerap air yang ada di wilayah DanauTobasaatinisudahbanyak berkurang. Jika kondisi dan keadaan hutan di wilayah ini tidak dilestarikan, hal itu dapat berdampakburukbagikelangsungan hidup masyarakat.”(a30)

Untuk itu, rakyat dan juga mahasiswa yang peduli perubahan harus meningkatkan perhatiannya dalam melakukan kontrol bersama terhadap pemerintahanPadanglawasyang masa tugasnya tinggal 38 bulan lagi.(m34)

GUNUNGSITOLI (Waspada): DPRD Kota Gunungsitoli melalui Fraksi Perjuangan Rakyat mendesak penegak hukum mengusut dugaan kebocoran APBD 2011 Pemerintah Kota Gunungsitoli Rp500jutayangdigunakansebagaibantuankepada Badan Persiapan Pembentukan (BPP) Provinsi Kepulauan Nias. Pemberian dana bantuan tersebut dinilai cacat hukum karena tidak pernah diparipurnakan oleh DPRD Kota Gunungsitoli. Fraksi Perjuangan Rakyat juga menemukan adanya kebocoran APBD 2011 yang terindikasi mengarah korupsi di beberapa SKPD. Hal itu dinilai terjadi akibat ketidaktaatan aparatur Pemko Gunungsitoli,sehinggainilaisebagaipengkhianatan terhadap masyarakat Kota Gunungsitoli. Demikian antara lain disampaikan Fraksi Perjuangan Rakyat DPRD Kota Gunungsitoli pada penyampaianpemandanganumumfraksitentang Rancangan Perubahan Anggaran Pendapatan dan Belanja Daerah (R APBD) Kota Gunungsitoli 2011 di DPRD Kota Gunungsitoli, baru-baru ini. Sidang paripurna dipimpin Ketua DPRD Kota Gunungsitoli,Sowa’aLaoli,didampingiWakilKetua

Armansyah Harefa dan Hadirat Gea serta dihadiri Wali Kota Gunungsitoli Martinus Lase,WakilWali Kota Gunungsitoli Aroni Zendrato, Unsur Muspida, Sekda Kota Gunungsitoli Firmasn Harefa, para Asisten, Kepala Badan, Kepala Dinas, Kepala KantordiLingkunganPemerintahKotaGunungsitoli. Fraksi Perjuangan Rakyat dalam pemandangan umumnya juga menyoroti beberapa hal, di antaranya pemerintah dan dewan tidak berkemampuanmengajukanhakinisiatiftentangpenetapan logo Kota Gunungsitoli yang hingga saat ini belum di Perdakan. Fraksi Perjuangan Rakyat menolak pembangunan Kantor Camat GunungsitoliSelatanyanglokasinyatidakterletakpadaibukota kecamatansebagaimanadiamanatkandalamPerda No. 5 tahun 2007 tentang ibu kota kecamatan. Fraksi Perjuangan Rakyat juga menyoroti kebijakan Pemko Gunungsitoli dalam menempatkan pejabat aparatur pemerintah yang tidak sesuai dalam visi misi kepala daerah yang mampu menempatkan pejabat sesuai dengan prinsip the right man on the right place, melainkan berdasarkan bisikan atau selera sekelompok atau kedekatan dengan kepala daerah.(a25)



Panitia Pengadaan Barang/ Jasa pada Dinas Kesehatan Kota Gunungsitoli, akan melaksanakan Pelelangan Umum Pascakualifikasi untuk paket pekerjaan dengan uraian sebagai berikut: No.

Nama Paket Pekerjaan


Metode Pelelangan

Nilai Total HPS (Rp)


Pengadaan Obat Program

1 Paket

Pelelangan Umum

810.615.000 DAK/DAU 2011


Pengadaan Peralatan Penyimpanan/ Pemeliharaan Vaksin di Puskesmas

2 Unit

Pelelangan Sederhana


Sumber Dana

DAU 2011

1. Persyaratan Peserta a. SIUP, SBU, SITU, TDP, NPWP, dan akta pendirian/akta perubahan yang masih berlaku. b. Klasifikasi sesuai paket yang ditawar. 2. Pendaftaran dan Pengambilan Dokumen Dan Dokumen Kualifikasi dan Pelaksanaan Pengadaan : Tanggal : Selasa , 18 Oktober S/D Rabu, 26 Oktober 2011 Hari/ Waktu : Senin S/D Jumat : Pukul 09.00 s.d. 15.00 Wib. : Sabtu, : Pukul 09.00 S/D 12.00 Wib. Tempat dan alamat : Sekretariat Panitia Pengadaan Barang dan Jasa Jln. Pancasila No. 14 Gunungsitoli. 3. Jadwal Pelaksanaan Pengadaan dapat dilihat pada Papan Pengumuman Pemerintah Kota Gunungsitoli 4. Pendaftarandan pengambilan Dokumen Pengadaan dapat diwakilkan dengan membawa surat tugas dari Direktur Utama/ Pimpinan perusahaan/ kepala cabang dan kartu pengenal. 5. Seseorang dilarang mewakili lebih dari 1 (satu) perusahaan dalam mendaftar dan mengambil Dokumen Pengadaan. 6. Dokumen Pengadaan dapat diambil dalam bentuk cetakan. Demikian disampaikan untuk menjadi perhatian. Gunungsitoli, 18 OKTOBER 2011




WASPADA Selasa 18 Oktober 2011

All New BMW Seri 3 Yang Paling Sporti BMW akhirnya meluncurkan Seri 3 generasi terbaru dengan kode F30. Generasi ke enam sedan premium berukuran ringkas ini, menjadi penerus dari model yang pertama kali diluncurkan 1975 dan terjual lebih dari 12 juta unit diseluruh dunia. Sukses Seri 3 sebagai standar di kelasnya tetap tak berubah hingga kini. Menurut CEO BMW Norbert Reithofer, Seri 3 baru ini adalah, “mobil paling sporti di segmennya dan menawarkan kenikmatan mengemudi di level tertinggi.” Sedan ini dipasarkan keseluruh dunia mulai 11 Februari 2012. Dibandingkan generasi sebelumnya, BMW Seri 3 tumbuh lebih besar. Panjanya bertambah 93mm dan wheelbase tambah 50mm jadi 2810 dan jarak antar roda depan juga lebih lebar (+37mm) sementara yang belakang (+47mm). Dimensi yang bertambah besar akan dinikmati sepenuhya oleh penumpang belakang, sesuatu yang sering dianggap kelemahan Seri 3 dibandingkan rivalnya.

Model baru ini menawarkan ruang kaki lebih lapang (+15mm) dan ruang kepala (+8mm) untuk penumpang belakang. Namun pertambahan dimensi ini tidak menambah berat. Justru lebih ringan 40kg dibandingkan pendahulunya berkat aplikasi beragam teknologi pemangkas berat. Seri 3 bensin terdiri dari 328i dan 335i. Keduanya dilengkapi paket EfficientDynamics yang hemat bahan bakar. 328i mesin twin-turbo 2.0 liter 4 silinder dengan direct injection, twin-scroll turbocharging, double-Vanos variable camshaft timing dan Valvetronic variable valve timing. Mesin ini bisa memproduksi 240hp dan torsi 350Nm diputaran mulai 1250rpm – 4800rpm. Hasilnya, 328i mampu melesat dari 0 – 100km/jam dalam 5.9 detik dengan top speed 250km/jam (dibatasi secara elektronik). Sementar konsumsi bahan bakarnya 6.4liter/100km dengan 6-speed manual atau 11% lebih rendah dari versi lawas. Dibalik kap mesin 335i ter-

simpan mesin enam silinder segaris turbocharged 306hp dan torsi 400Nm (1200rpm - 5000 rpm). Akselerasinya dari 0 100km dalam 5.5 detik dengan top speed 250km/jam. Konsumsi bensin rata-rata 7.27.9liter/100km tergantung spesifikasinya. BMW 320d dan 320d EfficientDynamics turbodiesel diperkirakan bakal popular di Eropa. 320d bisa memproduksi 184hp dan berakselerasi dalam 7.5 detik dan top speed 235km/jam. Mesin ini butuh 4.5liter tiap 100km dan emisi CO2 sebanyak 118g/km. 320d EfficientDynamics turbodiesel memproduksi 163hp dan akselerasi 8.0 detik dan top speed 230km/jam. Mesin ini lebih irit yaitu 4.1 liter/ 100km serta emisi lebih bersih 109g CO2/km. Musim gugur 2012 akan ada tambahan mesin-mesin baru yait satu mesin bensin dan dua diesel. Mesin bensinya adalah 320i (180hp/270Nm) yang merupakan varian dari mesin 2.0 liter TwinTurbo. Dua mesin turbodiesel yaitu 316d akan

BMW Seri 3 terbaru, kiri mesin yang dilengkapi paket hemat bahan bakar. memproduksi 116hp dan 260Nm serta 318d menghasilkan 143hp dan 320Nm. Efficient Dynamics Selanjutnya akan ada lebih banyak varian mesin termasuk 6-silinder diesel dan all wheel drive xDrive hingga Active Hybrid 3 yang menggunakan teknologi yang sama seperti

dilengkapi paket Efficient Dynamics yang hemat bahan bakar.ActiveHybrid 5. Seri 3 baru ini akan dilengkapi dengan fitur Driving Experience Control system yang melengkapi tiga basiz mode yaitu Comfort, Sport dan Sport+ serta EcoPro yang membantu mengurangi konsumsi bahan bakar hingga 20%.

Sedan ini menggunakan double-joint front axle dengan aluminium struts dan wishbone yang membantu mengurangi unsprung weight serta rear multi-link. Juga system elektromekanikal baru yang disebut-sebut mampu menambah kelincahan, sekaligus mengurangi berat dan konsumsi bahan bakar, (mkc/m47)

Mobil Murah Honda Bakal Jadi Kenyataan Kehadiran mobil murah di Indonesia dari produsen otomotif ternama seperti Honda, nampaknya akan menjadi kenyataan. Honda Prospect Motor (HPM), sebagai agen pemegang merk Honda di Indonesia, memang telah mengisyaratkan untuk menghadirkan varian hatchback terbaru dan termurah, Honda Brio pada 2012 mendatang. “Saat ini Brio masih dalam tahap survey dan study. Jadi belum bisa dipastikan apakah sudah bisa diluncurkan pada awal tahun depan,” kata Marketing & Aftersales Service Director AHM, Jonfis Fandy, Senin (17/10). Kalau pun nantinya di rilis di Indonesia, Honda Brio, baru bisa CBU (Completely Built Up), namun jika penjualan bisa di atas 1.000 unit, akan diterapkan

Honda Brio CKD (Completely Knock Down). Positioning segmen Honda Brio akan berada di bawah Honda Jazz dan juga Honda

Freed. Dan Honda kembali tidak menyertakan pilihan mesin diesel untuk varian terbarunya ini. Kisaran harga diperkirakan

sekitar Rp120 jutaan. Honda Brio berukuran sangat kompak, yakni berdimensi 3.610x1.680x1.485 mm.

Kemahalan, Tata Nano Gagal Meluncur Di Bangladesh

Dimensi yang mungil ini membuatnya lincah bermanuver, nyaman parkir di tempat sempit, juga mudah diken-

dalikan. Dapur pacunya menggunakan mesin 1.200 cc i-VTEC, 4 silinder, mampu memompa tenaga hingga 90 dk atau terbesar dibandingkan rivalnya di kelas city car.Tingkat konsumsi bahan bakar Brio juga diklaim sangat irit, yakni lima liter untuk 100 kilometer(standaremisiEuro 4). Untuk transmisi, Brio menggunakan continuously variable transmission (CVT) dan teknologi Honda’s G-Force Control (GCON). Dilengkapi pula dengan dual SRS front airbags, disc brakes, anti-lock brake system (ABS), electronic brake distribution (EBD),serta fitur immobilizer. Seperti diketahui, Honda Brio sudah lebih dulu mengaspal di India dan Thailand. (vvn/m47)

Spark Listrik Di 2013 Pabrikan mobil asal Amerika, Chevrolet mengabarkan akan segera memproduksi Chevrolet Spark EV (Electrik Vechile) pada awal 2013 mendatang. Saat ini, mobil tersebut sedang dalam pengetesan oleh pihak General Motors (GM) di Amerika Serikat. “Spark EV ini akan ditawarkan pada masyarakat kota yang memiliki rencana untuk berkendara hanya disekitaran kota saja dan tidak akan pergi jauh. Mobil ini juga melengkapi jajaran mobil listrik Chevrolet termasuk Volt ectended-range EV dan Malibu Eco dengan teknologi eAssist model 2013,” terang Jim Federico, Global vehicle chief enginner for electric vehicles, Chevrolet. Mobil listrik ini rencananya akan dipasarkan di beberapa Negara bagian AS saja, termasuk California. Sebab, masyarakat di sana lebih menyukai berkendara dengan jarak dekat. Mobil versi listrik besutan Chevrolet ini didesain sebagai mobil listrik perkotaan. Dan GM selaku produsennya telah menargetkan 2.000 unit Chevrolet Spark listrik ini untuk pasar otomotif AS. Mobil ini dibekali dengan baterai lithium-ion dengan 300 cell dengan kapasitas energi total 20 kWh. Dengan demikian baterai tersebut dapat bekerja dengan temperature minus 20 derajat hingga 45 derajat dan dapat diisi ulang dalam waktu kurang dari delapan jam dengan menggunakan daya listrik 240V. (oz/m47))

General Motors Siapkan Teknologi Mobil Tanpa Sopir

Produsen mobil asal Negara Bangladesh sebelumnya menjadi Amerika Serikat (AS), General negara berikut yang akan mendapatkan mobil M o t o r s ( G M ) t e n g a h termurah sejagat buatan India, yakni Tata Nano. mengembangkan sebuah Namun pada saat-saat terakhir, Tata Motors harus teknologi yang memungkinkan membatalkan acara peluncurannya di setiap mobil bisa berkendara dengan sendirinya. Bangladesh. “Mobil-mobil berkendara Seperti dilansir AFP, Senin (17/10), tadinya Nano akan diluncurkan di Bangladesh pada 15 sendiri dengan teknologi lebih Oktober 2011, namun distributornya menunda rumit akan terwujud pada akhir dekade,” kata Alan Taub, General peluncuran untuk menghitung kembali harga Motors Vice President of Global Nano di Bangladesh. Nitol Motors, distributor Tata di Bangladesh Research and Development, tadinya akan menjual mobil ini seharga AS$ 7.900. saat menghadiri Intelligent Itu lebih mahal hampir 3 kali lipat dibanding harga Transport Systems World Congress di Orlando, seperti dilansir aslinya di India yang mencapai AS$ 2.870. “Banyak orang datang ke kami, setidaknya situs resmi General Motor, Senin 23 orang mengkonfirmasi untuk (17/10) Setelah sempat terseokmembeli Nano. Tapi kami menunda peluncurannya di seok akibat gempuran krisis Tata saat terakhir karena harganya e k o n o m i y a n g m e n d e r a Nano. yang dianggap kemahalan,” ujar Amerika Serikat (AS) dan Direktur Nitol Motors Abdul sebagian belahan dunia pada 2007-2009 silam. General Matlub Ahmad. Selain Nano, memang Motors, Kini terus melakukan mobil kecil yang diproduksi di inovasi terbaru dari setiap Seperti dilansir situs resmi Suzuki, Senin Bangladesh oleh pabrikan asing produknya. Hal itu sebagai (17/10/), GW250 akan mengusung mesin 4 menjadi lebih mahal. Pajak yang wujud kebangkitan kembali langkah twin-cylinder 250 cc berpendingin cairan harus dibayarkan mencapai 132 raksasa otomotif dari negeri Paman Sam tersebut. dengan teknologi ramah lingkungan. persen per mobilnya. Menurut Alan, teknologi ini Mesin ini memiliki vibrasi rendah dan lebih Kami memperkirakan Nano sunyi, namun memiliki output tinggi dan akan populer karena mobil ini memadukan peralatan seperti sangat irit BBM. Mobil ini bisa sensor, radar, alat komunikasi durabilitas yang bagus. Dari sisi dimensi, motor ini memiliki ukuran melaju sampai 25 km untuk 1 bergerak (portable), GPS dan kamera, dengan peta-peta panjang x lebar x tinggi 2.145 x 760 x 1.075 (mm). liter BBM-nya,” ujarnya Sebelum Bangladesh, Sri digital. Sehingga memungGW250 akan diproduksi oleh Changzhou Haojue Suzuki Motorcycle Co., LTD, yang Lanka menjadi negara pertama kinkan pengemudi membiarkan merupakan perusahaan joint venture antara setelah India yang mendapatkan mobil berkonsentrasi berkendara, sementara pengeSuzuki dan Dachangjiang. Di China motor ini Nano. (do/m47) akan didistribusikan mulai 2012 nanti. Sementara, penampakan GW250 di IndoDAFTAR HARGA SEPEDA MOTOR: nesia sudah tercium beberapa waktu lalu, saat Shogun Axelo FL 125 SCD HONDA: diler Suzuki memperlihatkannya. (oz/m47)

Suzuki Luncurkan GW250 Di China Setelah menjadi obrolan yang hangat beberapa waktu lalu, pabrikan motor Suzuki resmi meluncurkan motor sport GW250. Motor ini diluncurkan pertama kali di China dan juga bakal menyusul ke Indonesia. Seperti dilansir situs resmi Suzuki, motor ini diluncurkan di ajang China International Motorcycle Trade Exhibition (CIMAMotor 2011) pada pekan lalu. Setelah diproduksi di China, motor sport berkapasitas 250 cc ini pun dipastikan akan dikirim keluar negeri seperti di Eropa, Indonesia, dan di Amerika Serikat. Motor dengan mesin yang memiliki pendingin tersendiri ini juga akan mengusung teknologi fuel injection. Meskipun kali ini tampilannya agak meniru dari saudara kandungnya Suzuki B-King.

Suzuki GW250.

Revo 110 Fit Revo 110 SW Revo 110 CW Absolute Revo DX Revo Techno Scoopy Supra X 125 Jari jari Supra X 125 CW Supra X 125 Injec R Vario CW Vario Techno Std Vario Techno CBS Blade 110 CW Mega Pro Jari-jari Mega Pro Racing Tiger Racing CS 1 Beat CW Spacy Spoke Spacy CW CBR 250 Std CBR C-ABS SUZUKI Hayate

12.420.000 13.020.000 14.220.000 14.860.000 16.980.000 14.810.000 15.600.000 16.750.000 17.900.000 15.560.000 16.010.000 17.070.000 14.724.000 19.510.000 20.750.000 26.690.000 18.530.000 13.540.000 12.770.000 13.570.000 43.280.000 50.150.000 15.530.000

15.300.000 Shogun Axelo FL 125 RCD 16.300.000 Shogun Axelo FL 125 RMCD 16.550.000 Satria FU 150CD 20.100.000 Spin UY 125S 12.925.000 Spin UY 125SC 13.500.000 Spin UY 125 Daytona 13.850.000 Sky Drive UK 125SC 14.400.000 Thunder EN 125KS 16.800.000 Titan FW 115D 11.875.000 Titan FW 115SD 12.975.000 Titan FW 115 SCD 14.050.000 Shogun FL 125 SD 14.625.000 Shogun FL 125 RCD 15.855.000 Shogun FL 125 RCMD 16.075.000 Shogun FL 125 RCDZ 16.305.000 Sky Wave UW 125 SC 15.430.000

Chevrolet Equinox. mudinya untuk mengerjakan hal lain. Tidak hanya itu, GM juga telah siap menanamkan beberapa sistem keselamatan aktif ke mobil-mobil tersebut. Saat ini GM memiliki beberapa teknologi seperti Lane Departure Warning System pada Chevrolet Equinox dan GMC Terrain, dan peringatan blind-

YAMAHA: Vega ZR-DB 13.143.500 Mio 12.779.000 Mio CW 13.577.000 Mio Soul 14.601.000 Mio CW SE 14.569.000 Xeon 16.759.000 Jupiter Z 15.023.000 Jupiter Z CW 15.788.000 Jupiter Z CW SE 16.262.000 Jupiter MX CW 17.725.000 Jupiter MX AT CW 17.000.000 V-ixion 22.257.000 V-ixion SE 24.405.000 Byson 21.035.000 Scorpio Z CW 24.884.000 Lexam 16.814.000 (harga sewaktu-waktu dapat berubah) * Sumber main dealer di Medan

zone samping di Cadillac Escalade, Buick LaCrosse, GMC


Yukon serta Chevrolet Tahoe dan Suburban. (vvn/m47)

P SSeputar Hal Mengisi BBM

Mengisi bensin adalah sesuatu hal yang mudah dilakukan, tinggal putar tutup tangki dan isi bensin. Tetapi di balik itu, ada proses rumit dan kompleks. Di masyarakat pun beredar mitos mengisi bensin di pagi hari lebih bagus untuk kendaraan ketimbang mengisi bensin di siang hari, apakah betul begitu? Memang hal ini terdengar tidak logis, tetapi ada baiknya mengisi bensin di pagi hari. Seperti dilansir autoevolution, hal itu bukanlah mitos belaka. Soalnya panas akan membuat bensin menguap dan akhirnya membutuhkan lebih banyak ruangan di dalam tangki. Jadi kesimpulannya? Mengisi bensin di saat udara dingin, seperti pagi hari atau malam berarti temperaturnya lebih rendah dan lebih banyak bensin daripada uap bensinnya sendiri. Mitos yang kedua. Beberapa orang mengatakan lebih baik mengisi tangki bensin penuh daripada mengisi secara rutin bensin dalam beberapa waktu dengan jumlah yang sedikit. Ada dua penjelasan untuk ini, namun hal itu tergantung pada risiko mana yang akan anda pilih. Pertama, makin sedikit bensin di dalam tangki, berarti lebih banyak udara. Hal ini akan membuat mobil lebih boros mengonsumsi BBM karena penguapan dari bensin yang tersedia. Sebagai tambahan, dikatakan kalau mengisi bensin dalam rentang waktu yang pendek akan membuat fuel pump dan saringan gampang rusak. Ketika kita mengisi tangki bensin di atas saran yang disampaikan pabrikan, itu harus kita hindari, meskipun kita akan melakukan perjalanan jarak jauh. Jika Anda melakukan ini, akan merusakkan sensor di tangki dan juga akan membuat beban mobil bertambah dan akhirnya mengurangi performa mobil. Selain membuat mobil tambah berat, bahan bakar berlebih juga akan menyebabkan tambahan uap udara yang akan membuat bensin lebih gampang menguap. Mitos ketiga. Hindari mengisi bensin ketika truk BBM tengah mengisi bensin di SPBU. Mitos ini ada benarnya benar. Selain rawan terbakar, Anda harus menghindari mengisi bensin saat ada truk tangki, karena semua debu atau partikel yang berada di dasar pompa bensin bisa tersedot masuk ke dalam mobil. (bbg sumber/m47)

Ekonomi & Bisnis

WASPADA Selasa 18 Oktober 2011


SMS Premium Dihentikan JAKARTA (Waspada): Sesuai dengan surat Edaran BRTI Nomor 177/BRTI/IX/2011, 10 operator telekomunikasi yang bergabung dalam Asosiasi Telekomunikasi Seluler Indonesia (ATSI) sepakat untuk menghentikan layanan SMS premium per 18 Oktober 2011. Sarwoto Atmosutarno, Ketua Umum ATSI menyebutkan, penghentian layanan tersebut akan dimulai besok, sampai batas waktu yang belum ditentukan. Seluruh layanan konten premium akan distop, termasuk misalnya layanan seperti ring back tone (RBT). “Meski begitu, pelanggan tidak perlu khawatir. Mereka

yang telah membayar untuk layanan tersebut, akan tetap mendapatkan hak mereka hingga masa layanan berakhir,” kata Sarwoto di Jakarta, Senin (17/10).. “Setelah itu, layanan akan kita hentikan,” ucapnya. Langkah ini, kata Sarwoto, merupakan bukti komitmen ATSI untuk mengikuti regulasi yang telah diterapkan oleh

pemerintah, dalam hal ini BRTI. “Seluruh konten premium akan dideaktivasi,” kata Sarwoto. “Ke depan, setelah ada perbaikan, layanan tersebut akan digelar kembali oleh operator telekomunikasi,” ucapnya. Perbaikan pada layanan di sini, kata Sarwoto, termasuk konten serta kemudahan registrasi dan unreg. Saat ini, pengguna layanan operator seperti Telkomsel dan XL dapat melakukan unreg all terhadap seluruh layanan SMS premium lewat menu UMB di operatornya masing-masing. Bagi pengguna mengalami kerugian, kata Sarwoto, operator-operator tergabung dalam

ATSI seperti Axis,Tri, XL, Indosat, Telkomsel, Telkom, Smartfren, Bakrie Telecom, dan Ceria sepakat untuk memberikan restitusi. “Pengguna yang merasa dirugikan silakan datang ke gerai-gerai operator telekomunikasinya masing-masing untuk melakukan pengaduan,” kata Sarwoto. “Jika setelah diperiksa oleh petugas layanan pelanggan memang diketahui terjadi sistem failure, akan ada penggantian,” ucapnya. Selain itu, kata Sarwoto, terhadap 60 content provider (CP) yang bermasalah, ATSI juga meminta kepada operator yang tergabung di dalamnya untuk tidak lagi melanjutkan kerjasama mereka. (vvn)

Panen Raya Harga Gabah Anjlok Drastis MEUREUDU (Waspada) : Ternyata panen raya dalam dua pekan terakhir, tidak bisa menggembirakan petani di Kabupaten Pidie Jaya dan Pidie, malah sebaliknya menyengsarakan mereka. Pasalnya, setelah hasil produksinya merosot, harga jual gabah kering panen (GKP) itu juga ikut anjlok drastis. Kalangan petani di sana mengeluhkan kondisi itu. Betapa tidak, harga gabah yang dari awal-awalnya panen dipatok agen pengumpul Rp3.800 per kg, kini anjlok drastis menjadi Rp3.500 hingga Rp3.400 per kg, kata beberapa petani setempat kepada Waspada, Jumat (14/10). Sementara harga Gabah Kering Giling (GKG) saat ini dihargai Rp3.900 hingga Rp4.000 per kg. Namun ini sangat disayangkan karena petani tidak bisa menikmati harga GKG yang tinggi itu, menyusul stok gabah sudah tidak ada lagi di tingkat petani. “Kami kurang mengerti apa penyebab merosotnya harga gabah ini. Apa ada kaitanya dengan kondisi guyuran hujan sehingga mutu gabah yang di-

hasilkan menjadi kurang bagus, harga gabah justru semakin anjlok lagi, “sebut salah seorang petani bernama Syahbuddin. Dikatakan, akibat merosotnya harga penjualan gabah membuat petani kehilangan semangat untuk mengikuti musim tanam padi berikutnya. Sedihnya lagi ada diantara petani yang tidak sanggup membiayai modal musim tanam mendatang, karena gabah yang ada sekarang sudah habis untuk membayar pinjaman yang pernah diambil sebelumnya dari pedagang pengumpul, katanya. “Panen kali ini kami bakal tidak dapat apa-apa, karena harga gabah sudah tidak sesuai lagi dengan biaya produksi dikeluarkan petani sejak mulai pengolahan lahan hingga perawatan dan panen dilakukan, “timpal petani lainnya M Yusuf. Menurut petani, anjuran Dirjen Tanaman Pangan dan Gubernur Aceh, sebelum untuk tidak menjual habis hasil gabah, apalagi diangkut ke Medan, Sumatera Utara, tapi lebih mengutama untuk stok konsumsi

keluarga hingga menungga panen mausim mendatanya itu sangat baik dan sangat tepat. Tetapi bagi petani sulit untuk menerapkannya, karena terdesak dengan berbagai kebutuhan. Dikatakan Yusuf, petani menjual padinya karena terpaksa untuk menutupi biaya kebutuhan keluarga sehari-hari. Bukan hanya itu, petani juga saat perawatan tanaman padinya sudah berutang untuk beli pupuk dan obat-obatan. “Tidak ada kata lain lagi, petani terpaksa menjual gabahnya, “beber Yusuf yang juga dibenar beberapa petani lainnya. Sementara sejumlah petani juga mengeluhkan curahan hujan yang tinggi saat sedang melakukan panen ini. Pasalnya, jika hujan masih mengguyur terus, gabah yang mereka hasilkan terancam membusuk di dalam air. “Kami sangat kewalahan menghadapi kondisi ini, harga gabah tidak menentu dimungkinkan akibat curah hujan semakin tinggi melanda sebagian daerah Aceh, selain itu para

petani terkendala menjemur padi akibat cuaca tak menentu, “katanya. Lanjutnya, terhadap pemerintah agar memantau harga gabah petani di Aceh, sehingga masyarakat petani tidak banyak rugi akibat tidak stabilnya harga gabah. Selain itu, tambahnya, peredaran beras dari luar masuk ke Aceh agar dipantau juga oleh pemerintah sehingga harga gabah petani di daerah ini tetap stabil. Sekretaris Komisi II DPRK Pidie Jaya, Fakhruzzaman Hasballah, mengatakan tidak stabilnya harga gabah di Pidie Jaya kita tengarai masuknya beras dari luar daerah, sehingga harga gabah petani mengalami fluktuasi harga. “Harapan kita terhadap dinas terkait agar memantau dan membatasi masuknya beras dari luar daerah, agar harga gabah petani tetap stabil, namun kalau masih dari daerah sekitar Pidie Jaya, itu tak masalah, seperti dari Kabupaten Pidie, Bireuen dan Aceh Besar, “ungkapnya.(b09)

Produksi Berkurang, Harga Ikan Asin Melonjak BANDA ACEH (Waspada): Pedagang ikan asin di sejumlah pasar tradisional di kawasan Kota Banda Aceh dan Aceh Besar, mengeluhkan ikan asin olahan karena dampak dari berkurang produksi ikan basah hasil tangkapan nelayan akhir-akhir ini. Merosot tajam stok uikan asin, seperti dialami para pedagang di pasar Peunayong, Ulee Kareng, Pasar Aceh, Neusu, Kampong Baro, Gampong Ateuek, Seutui (Banda Aceh), Keutapang Dua, Lam Ateuek dan Lambaro (Aceh Besar) sangat berpengaruh melonjaknya harga ikan yang telah diawetkan alias digaramkan itu. Kenaikan harga itu tidak saja terjadi terhadap ikan asin, tapi harga jual ikan segar juga ikut melonjak dibandingkan sebelumnya. Ini diakui sejumlah

pedagang ikan segar (basah) di Pasar Seutui, Peunayong dan Pasar Neusu. Beberapa ibu rumah tangga (IRT) yang sempat dicegat Waspada saat berbelanja di Pasar Seutui, Senin (17/10) mengatakan, kenaikan harga ikan asin dan ikan segar dalam beberapa pekan terakhir ini sangat terasa bagi kalangan keluarga berkantong tipis (miskin). Akibat kondisi tersebut, sebagian IRT memilih mengkonsumsi telur. Hal itu juga sebagaimana diakui seorang penjual ikan asin di pasar tradisionl Banda Aceh, Nurdin, Senin, akibat produksi ikan berkurang harga ikan asin tidak stabil naik turun. Saat ikan lokal minus terpaksa memesan ikan asin dari Medan atau Sumut, karena di sana para

pengusaha modal kuat menyimpan puluhan ton ikan asin yang telah diawetkan. Di Medan atau Sumut stok ikan asin berbagai jenis itu cukup tersedia dalam jumlah banyak. Namun, harganya juga diakui terjadi kenaikan dari harga sebelum. “Kalau kita pesan dari Medan tentu harga ikan asin akan lebih tinggi (mahal) lagi, karena modalnya harus dihitung termasuk ongkos tranportasi alias angkutan dari Medan ke Banda Aceh, “kata seorang pedagang ikan asin lainnya. Diakui para pedagang ikan asin, akhir-akhir peminat ikan asin semakin banyak dibanding sebelumnya. Karena mengkonsumsi ikan asin itu akan bisa menambah selera makan seseorang.

Harga pasaran ikan asin saat ini , kata Ahmad, seperti ikan Gulama Rp15.000 per kg, sebelumnya Rp11.000, pisang Rp.18.000 dari Rp15.000, belanak Rp18.000 Rp13.000. Jenis teri lebih mahal, teri pithot/ nasi Rp60.000-Rp65.000 per kg, teri pekto Rp.45.000, teri kacang Rp22.000. Mansur pengolah ikan asin mengatakan, dia sudah lebih 10 tahun mengolah ikan asin mengaku harga pasar ikan asin ditentukan produksi ikan tangkapan nelayan bila tangkapan merosot harga jual ikan asin mahal, sebaliknya saat ikan banjir harga ikan asinpun ikut turun. (b09)


Lokal Kalah Saing Dengan Buah Impor MEDAN (Waspada): Dalam berbagai bidang, produk lokal selalu kalah saing dengan produk impor. Salah satu adalah buah asal China yang menguasai pasar dalam negeri terutama di Medan. Buah-buahan itu antara lain seperti apel, pir, jeruk, anggur dan lengkeng. Berdasarkan pantauan Waspada di Pusat Pasar dan Pasar Simpang Limun, Senin (17/10) hal itu diakui sebagian pedagang buah. Salah satunya Nurlia, 51, pedagang buah di

bertujuan untuk mensosialisasikan konsumsi telur dan daging ayam ke masyarakat Sumut. “Kebutuhan per kapita masyarakat kita masih rendah, bila dibandingkan dengan Malaysia dan negara tetangga lainnya. Maka dari itu kegiatan seperti ini merupakan kesempatan yang bagus untuk mensosialisasikan konsumsi telur dan ayam lebih banyak,” tutur Bethman Siagian yang juga ketua panita acara peringatan hari ayam dan telur nasional. Lanjut Anwar, adapun produksi telur di Sumut mencapai delapan juta per tahun, sementara kebutuhan telur berjumlah lima sampai enam juta per tahunnya. Namun, Sumatera Utara belum mampu mendis-

tribusikan telur ke luar daerah, sebab Sumut baru mampu memenuhi kebutuhan telur sendiri. Adapun daerah penghasil telur terbanyak tersebar di wilayah Binjai, Pantai Labu dan Kisaran. Menanggapi harga telur yang sempat naik pada bulan Ramadhan lalu, Anwar mengungkapkan hal itu memang sesuai hukum ekonomi. Bila permintaan banyak maka harga naik, meskipun produksi telur Sumut melebihi kebutuhan. “Sudah hukum ekonomi, biarpun produksi kita lebih banyak dari permintaan. Hal itu w a j a r, d i m a n a b a n y a k permintaan maka harga akan naik,” tuturnya. (cag)

Petani hortikultura jenis tanaman kentang mengaku mulai resah dan sebagian terpaksa melakukan panen dini di Aceh Tengah. Pasalnya dalam sebulan terakhir hama cendawan (busuk daun ) menyerang tumbuhan itu. “Hampir 30 persen tanaman kentang milik petani, diserang hama cendawan daun. Padahal tinggal 1,5 bulan lagi kami akan melakukan panen. Namun karena serangan penyakit terpaksa dilakukan penggalian dini,” sebut Suwito seorang petani kentang di Kecamatan Atu Lintang, kepada Waspada, Minggu (16/10). Menurutnya, panen kentang layaknya dilakukan setelah berusia 3,5 bulan. Kendati telah dilakukan upaya pencegahan dengan memberi fungisida (obat pencegah cendawan daun). Namun sangat sulit menanggulanginya. “Kendati penyakit itu pernah ada pada musim tanam sebelumnya, namun masih dapat kami atasi. Kini serangannya terbilang parah, dalam sehari

mulai lanas (layu),” keluhnya. Secara bersamaan, Suwan petani kentang lainnya juga membenarkan tentang ancaman hama daun tersebut. Dimana kini telah menyerang hampir setiap tanaman kentang milik petani di sana. “Kendati serangan hama, masih menyisakan sekira 70 persen lagi dari jumlah ditanam. Namun saya juga khawatir panen kali ini terancam gagal, padahal telah banyak modal yang dikeluarkan,” sebutnya. Dipaparkan, untuk bertanam kentang dengan luas setengah hektar dibutuhkan bibit sebanyak 250 kg (harga bibit Rp 11 ribu perkilo). Sementara pemupukan dilakukan dua kali selama musim tanam. “Untuk setengah hektare lahan dibutuhkan pupuk dasar berupa Za, TSP, SS, NPK dan KCL sebanyak 80 persen. Kemudian untuk pemupukan lanjutan (setelah kentang berusia satu bulan dari awal tanam) dibutuhkan pupuk yang sama sebanyak 20 persen lagi,” terangnya. Dikatakan, untuk satu kilo

hingga tiba masa panen dilakukan pemberian pupuk dengan ‘dosis’ sebanyak 1 Kg. Kemudian untuk menjaga kesuburan, dilakukan penyemprotan batang dan daun dengan memberi berbagai jenis pestisida (obat pencegah hama). “Penyemprotan dilakukan tergantung cuaca. Artinya bila musim panas penyemprotan dilakuakan cukup sekali dalam sepekan. Namun jika musim penghujan hendaknya dilakukan dua kali selama seminggu dengan jarak waktu tiga hari sekali,” jelas Suwan. Ditambahkan petani itu, bila tanaman kentang normal (tanpa hama) dari 250 kg bibit , hasil panen biasanya mencapai 5 ton. Namun saat ini jumlah itu sulit didapat karena serangan hama cendana daun yang telah menyerang 30 persen tanaman. “Untuk setengah hektar lahan saya menghabiskan Rp 5 juta. Dana itu belum dihitung tenaga,” timpal Suwito seraya mengaku sejak adanya bakteri cendana daun, petani kentang belum mampu mengatasinya. (cb09)

Pusat Pasar. Menurutnya, buah lokal seperti markisa, jeruk, melon, apel Malang dan salak kalah saing dengan buah asal China. Menurutnya, dari segi harga dan kualitas produk impor lebih unggul dibanding buah lokal. “Buah impor harganya lebih murah bila dibandingkan dengan buah lokal, dan kualitasnya lebih baik. Kalau apel Malang per kg harganya mencapai Rp26.000 sampai Rp28.000, sedangkan apel hijau

impor hanya Rp20.000 per kg,” ungkapnya. Sementara itu, apel impor RP 170.000 per dus, sedangkan buah pir Rp100.000 per dus, hal ini membuat Nurlia beralih menjual buah impor ketimbang buah lokal. Dengan harga demikian Nurlia mampu menjual apel seharga Rp10.000 per kg. “Dulu saya pernah jual buah lokal, tapi kurang laku. Makanya saya suka jual buah impor,” tuturnya. Nurlia tidak mengetahui dampak ekonomi bila terus

menjual buah impor, sebab ia hanya sebagai pedagang biasa. Sementara itu, Julia, 28 seorang pembeli mengungkapkan bahwa dia terpaksa membeli buah impor ketimbang buah lokal. Sebab buah lokal di pasaran jarang dijumpai, sehingga mengharuskannya membeli produk impor. “Mau beli buah apa lagi, buah lokal jarang jumpa. Paling yang ada hanya semangka, salak, alpukat, tapi kalau apel kebanyakan memang impor,” jelas Juli. (cag)

Keanekaragaman Konsumsi, Sumber Ketahanan Pangan MEDAN (Waspada): Dalam memperingati hari ketahanan pangan se dunia ke XXXI, manggadong merupakan salah satu keanekaragaman konsumsi pangan yang dapat dijadikan sumber ketahanan pangan sekaligus untuk menekan konsumsi beras sebanyak 1,5 persen sesuai implementasi Peraturan Presiden No 22 Tahun 2009. Pola makan manggadong itu sendiri disosialisasikan dalam peringatan hari ketahanan pangan dunia di Kantor Badan Ketahanan Pangan Sumatera Utara, Sabtu ( 15/10) siang. Menurut Kepala Badan Ketahanan Pangan Sumut Setyo Purwadi ketahanan pangan Sumatera Utara perlu memb a n g u n g ra n d d e s i g n d i beberapa sektor, salah satunya masyarakat mandiri pangan.

Selain itu, dengan adanya keanekaragaman konsumsi pangan juga turut membantu menekan konsumsi beras sebagai makanan pokok. “Makan ubi jalar lima gram sebelum mengkonsumsi beras, yang penting secara kontiniu, untuk itu perlu sosialisasi dan bangkitkan animo masyarakat,” terangnya kepada wartawan. Sementara itu, Sumatera Utara telah memproduksi ubi jalar sebanyak 200 ton per tahun dan ubi kayu sebanyak 1 juta ton per tahun. Sehingga memungkinkan masyarakat untuk beralih ke sumber pangan lain. Selain ubi jalar, pisang juga dapat dijadikan sumber keanekaragaman konsumsi. Sebab pisang, mengandung sumber

karbohidrat tinggi sesuai dengan konsumsi pangan yang Beragam, Bergizi, Berimbang dan Aman (3BA). Konsumsi ubi jalar sebelum makan nasi itu sendiri merupakan budaya lokal masyarakat Tapanuli. Biasanya sebelum makan nasi, masyarakat Tapanuli mengkonsumsi ubiubian seperti ubi kayu, ubi jalar, dan keladi sehingga konsumsi nasi berkurang. Acara peringatan hari ketahanan pangan se dunia itu, turut dihadiri Pj Gubernur Gatot Pujo Nugroho beserta istri. Dalam Surat Edaran Gubernur Sumatera Utara, dikemukakan bahwa perlu dilaksanakan Percepatan Penganekaragaman Konsumsi Pangan melalui

peningkatan konsumsi ubiubian,buah-buahan, sayursayuran dan jenis pangan lainnya yang berbasis sumber daya lokal. Hal ini bertujuan untuk meningkatkan konsumsi pangan yang 3BA. Maka dari itu dihimbau kepada pemilik hotel, restoran, café, rumah makan dan pengusaha catering agar menerapkan modernisasi makanan Manggadong atau menyediakan ubi-ubian sebagai kudapan. Dalam kesempatan itu pula Gatot turut memperingati hari cuci tangan sedunia dan mencanangkan hari ayam dan telur nasional. Sejumlah ratusan siswa siswi SD begitu antusias mengikuti peringatan hari cuci tangan tersebut.(cag)

Minat Mahasiwa Unimal Berwirausaha Meningkat LHOKSEUMAWE ( Waspada) : Sejak tiga tahun terakhir minat mahasasiswa Universitas Malikussaleh (Unimal) Lhokseumawe dalam berwirausaha semakin meningkat. Kondisi ini terbukti pada pembekalan Program MahasiswaWirausaha (PMW) kepada 68 calon penerima dana PMW di Gedung ACC Unimal, Cunda, Lhokseumawe, Minggu (16/10). Proses pencairan dana PMW dilakukan sebanyak tiga tahap. Pertama seleksi berkas berupa administrasi dan daya tarik bisnis, tahap ini diterima 120 mahasiswa dari tiga orang tiap kelompok, kemudian tahap wawancara menyisakan hanya 68 mahasiswa, yaitu yang sedang mengikuti pembekalan dan pendidikan dasar PMW

Konsumsi Telur Masyarakat Sumut Rendah MEDAN (Waspada): Konsumsi telur Sumut masih rendah bila dibandingkan dengan Malaysia yang mengkonsumsi 250.000 butir per hari per kapita, sedangkan konsumsi telur masyarakat Sumut hanya 87 butir per hari per kapita. Hal itu diungkapkan ketua Gabungan Perusahaan Pembibitan Unggas (GPPU), Anwar Tandiono di sela-sela acara peringatan hari ketahanan pangan se dunia di pelataran Kantor Badan Ketahanan Pangan Provinsi Sumatera Utara, yang juga dihadiri Pj Gubernur Sumut Gatot Pujonugroho, Sabtu (15/10). Dalam kesempatan itu pula, dicanangkan peringatan hari ayam dan telur nasioal yang

Waspada/Abdul Mukthi Hasan

Seorang petani garam Desa Tanjongan, Jangka, Bireuen, Minggu (16/10), menghitung garam telah dikemas dalam plastik untuk dipasarkan. Nasib petani garam di Jangka khusunya di Tanjongan dan di Desa Tanoh Anoe belum memadai apalagi kini mulai merambah garam impor.

selama dua hari ini (Sabtu dan Minggu-red) “Tahap terakhir mereka diwajibkan magang ke tempattempat usaha sesuai dengan judul PMW-nya masing-masing, tahap final ini menyisakan 44 orang mahasiswa. Oleh karena itu mahasiswa yang ingin lulus tahap seleksi harus sungguh-sungguh mengkuti setiap tugas sudah diembankan. Bagi mahasiswa yang memanipulasi data kami sungkan-sungkan memberikan sangksi akademik,” tegas Fauzan, ST, MT selaku ketua panitia. Fauzan mengaku, dana PMW bersumber dari Dirjen Dikti Kemendiknas RI khusus program PMW diberikan sejak tiga tahun terakhir, untuk tahun ini diberikan sebesar Rp352 juta.

Apabila dana tersebut tidak sukses dijalankan, kemungkinan besar tahun depan didapatkan tipis. “ Ta p i A l h a m d u l i l l a h kampus kita image-nya masih bagus, karena saat ini banyak mahasiswa sedang menjalankan usahanya dengan mandiri setelah mengikuti PMW ini,” sebutnya Abuzar seorang peserta PMW berharap kepada panitia PMW agar tidak terlalu memberatkan peserta seperti tahuntahun lalu saat pembuatan Studi Kelayakan Bisnis (SKB). ’’Kami sangat berkeinginan menjalankan usaha PM,’’ kata mahasiswa dari jurusan Teknik Mesin itu seraya mengungkapkan proposalya ‘Jasa Servis Perbengkelan’. (cmk)

Hasil Jual Dengan Biaya Perawatan

Kopi Di Aceh Tengah Hampir Berimbang Hama Cendawan Daun Ancam Petani Kentang XL Tour Dukung Pariwisata Jadi, tambahnya, bila TAKENGEN (Waspada): merawat kebun dalam sepansehektare kopi diperlukan Setelah harga kopi hijau (green jang tahun. Sail Wakatobi – Belitung TAKENGEN (Waspada): saja ratusan batang kentang bibit kentang dari awal tanam “Kebun kopi saya meru- pupuk organik 1 ton, maka beans) jenis arabika gayo, di SEIRING diluncurkannya pekan pariwisata Sail Wakatobi Belitung dan terus bertumbuhnya pelanggan telekomunikasi selular di wilayah Bangka Belitung, PT XL Axiata Tbk (XL) terus melakukan inovasi untuk meningkatkan dan memberikan layanan yang lebih baik kepada pelanggan, termasuk dalam hal penambahan fasilitas jaringan 3G. Dari total populasi penduduk Bangka Belitung yang lebih dari 1.250.000 jiwa, XL masih menguasai lebih dari 50 persen pasar telekomunikasi selular di wilayah Bangka Belitung. VP XL Regional Sumatera, Agus P Simorangkir mengatakan XL sudah hadir di Bangka Belitung sejak September 2003 dan mengawali layanannya pertama kali di daerah Muntok, Bangka. Secara bertahap, XL terus memperluas jangkauannya di kepulauan Bangka dan Belitung, termasuk daerah-daerah lain yang saat ini tengah dalam tahap pembangunan insfrastruktur. “Berbagai upaya kami tempuh agar masyarakat di Belitung dan Bangka yang tersebar di banyak pulau bisa menikmati layanan telekomunikasi selular sehingga bisa mendorong kemajuan perekonomian daerah. Hari ini, XL mengoperasikan layanan jaringan 3G baru di lokasi wisata tempat berlangsungnya acara Sail Wakatobi Belitung, diantaranya di daerah Tanjung Binga, Tanjung Kelayang, Tanjung Tinggi dan beberapa tempat di Kota Tanjung Pandan,” katanya. “XL merupakan satu-satunya operator telekomunikasi yang menyediakan layanan 3G di lokasi tempat berlangsungnya Sail Wakatobi – Belitong. ‘From Belitong to The World’. Ini merupakan komitmen XL untuk mendukung program pariwisata daerah yang sedang giat-giatnya dilakukan oleh pemerintah” jelas Agus. Agus Simorangkir menambahkan XL juga memberikan manfaat lebih bagi masyarakat yang bermata pencaharian sebagai nelayan yang tinggal di pulau-pulau yang tersebar di Babel. Mereka akan lebih mudah memantau harga komoditas hasil tangkapan laut. Layanan video call dan akses data yang cepat Untuk menjamin kenyamanan para tamu dan undangan serta masyarakat yang hadir dan ikut memeriahkan pekan pariwisata Sail Wakatobi Belitung yang rencananya akan diresmikan oleh Presiden RI pada pekan kedua bulan Oktober 2011, XL sudah menyiapkan infrastruktur jaringannya yang saat ini didukung oleh 325 BTS (3G/2G).

Aceh Tengah, sempat membaik pada Januari hingga Juni 2011 dengan capaian harga Rp 65 ribu per kilogram, kini nilai jual komoditi pertanian itu, mulai memburuk alias anjlok, berkisar Rp 52 ribu per kilogram. Dari informasi dihimpun, menurunnya harga pasaran kopi saat ini dipengaruhi belum maksimalnya kualitas biji kopi telah dipetik di awal musim. Dampaknya kendati banjir biji kopi diperkirakan akan terjadi. Namun petani mengaku belum ‘bergairah’. “Meski tiba musim panen kopi sejak Oktober ini nilai jual semakin menurun. Untuk jenis kopi terbaik saja yakni biji hijau hanya dihargai Rp52 ribu per Kg. Gabah Rp 20 ribu per bambu dan gelondongan ( cherryred) hanya Rp 80 ribu per kaleng, “ keluh Sarhan, seorang petani kepada Waspada, Minggu (16/10). Disebutkan, dengan turunnya harga kopi saat ini, maka perolehan akan berimbang dengan ongkos yang dikeluarkan

pakan penghasil buah khusus biji pilihan. Karena itu harus digunakan pupuk organik. Untuk sehektare lahan dalam sekali pemupukan dibutuhkan 1 ton kompos. Jumlah itu mencukupi untuk 1.200 batang kopi,’’ terangnya. Menurutnya, selain kompos berbagai jenis pupuk organik lainnya kerap digunakan sebagai penyubur dan menjaga biota tanah yakni: pupuk kandang dan guano (kotoran kalong berasal dari dalam goa). Sementara jelas petani dari DesaWih Nongkal, Kute Panang Aceh Tengah ini. Untuk bahan kompos biasanya ia menggunakan ‘limbah’ pertanian seperti; kulit kopi dari sisa penggilingan buah, cangkang dan gulma rumput yang telah dibabat . “ Dari setiap jenis kompos hanya guano yang membutuhkan biaya besar karena bahan bakunya dari luar daerah. Harganya Rp 2 ribu per kilo. Sementara pemupukan dilakukan 2 kali dalam setahun.”

selama setahun menghabiskan 2 ton kompos. Artinya ongkos dikeluarkan petani mencapai Rp 4 juta per tahun. Karena kini harga kompos Rp 2 ribu per kg. Namun dari jumlah itu, belum dihitung biaya perawatan dan ongkos jasa panen. “Dalam satu tahun dilakukan pembersihan gulma (rumput) sebanyak tiga kali. Artinya bila memanfaatkan jasa buruh (tukang babat), biayanya Rp 600 ribu per hektare. Namun jika dicangkul, ongkos lebih mahal Rp 1 juta per hektare. Dan bila disemprot dengan pestisida Rp 500 ribu per hektare,” terangnya. Bukan itu saja lanjutnya, dalam setahun dibutuhkan biaya perawatan lainnya, berupa pemangkasan ceding (tunas yang tidak menghasilkan buah) dengan ongkos Rp2.500 per batang . Kemudian ditambah jasa ngutip (panen buah) Rp 20 ribu per kaleng (1 kaleng sama dengan 10 bambu kopi merah, gelondongan). (cb09/b32)

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

Xenia DP 12 Jt-an Sirion DP 18 Jt-an Pick Up DP 7 Jt-an Luxio DP 6 Jt-an

Ready Stock n Full Bonus Hub. NITHA: 0812 60 1111 98 DAIHATSU 100% BARU

Xenia Angs. 2,7 Jt-an Pick Up Angs. 2,4 Jt-an Terios Angs. 3,6 Jt-an Minibus, Luxio, Sirion Hubungi: ADEK ASTRA 0812 63 400 55 (Simpan No. ini sewaktu2 Anda Butuh)


Ready Stock Xenia, Sirion, Luxio, Pick Up, Terios, Dapatkan DP dan angsuran Ringan, Data dijemput. Hub. SURYA PURBA 0852 9618 7070 / 0813 7637 9292

DAIHATSU BARU PAKET MURAH...!! Xenia Li.....DP 13 Jt-an......Angs. 3 Jt-an Terios.........DP 18Jt-an.......Angs. 4 Jt-an Pick Up......DP 8 Jt-an........Angs. 3 Jt-an Proses Cepat dan Data Dijemput Hub. Capella Medan (Josua) 0812 6311 0820

TONO CAPELLA DAIHATSU 100% BARU 0813 7067 5757 Xenia, Terios, Pick Up, Luxio, Gran Max 0852 9644 3457 Dapatkan Discount

5 CM 6 CM

Rp. 65.000 Rp. 78.000

DAIHATSU BARU Terios, Xenia, Pick Up. Hub. 0813 6237 8733 Sitorus Astra. DAIHATSU Zebra Prima 21 Thn. 94 biru metalik, mobil mulus, mesin bagus dan siap pakai. Harga Rp. 23 Juta/damai. Pemakai serius Hub. Iwan 0852 7630 4256 TP.

DAIHATSU Xenia LG Th. 2004. Lengkap, warna hitam, BK Mdn, 1 tangan. HP. 0813 6212 2339 DAIHATSU Rocky exe Thn. 90/91, 80% original luar dalam. Jok kulit, Velg Racing, Medan asli. Pajak panjang, AC Dingin, Kondisi siap pakai. 0813 6233 5544 (TP)


Beli Sekarang langsung dapat Harga terbaik + GPS + Camera Parkir + KF.V-kool + TV-Roof 0813 7099 9998 / 061-77388133

HONDA Jazz Thn. 2007 A/T. Warna silver Stone HP. 0811 600 1722

7 CM 8 CM

Rp. 91.000 Rp. 104.000


Mobil Honda City Type Z Tahun 2000. Balik DP Rp. 40 Juta, Sisa Angsuran 2.743.000 x 20 Bln. Peminat serius Hub. 0812 6313070 ISUZU BARU

New Panther Grand Touring Type J.LS, LV, Adventure, Smart, Pick Up. Handal Untuk Usaha Diesel TVR 80, Kuat dan Irit, Isuzu ELF, Hadiah langsung. Honda Revo. Astra Isuzu: INDRA (0813 7591 5420, 061-6844 8554

MERCY E 230 Boxer Thn 90 AMG Original luar dalam, Medan Asli Kondisi siap pakai, 0852 6158 2168 (TP) MERCY C200 ‘97

Abu2 met, BK Mdn, AC DB, Air bag, ABS, Jok klt, CD, MP3, Sound System, PW, VR, CL, EM, PS, Ban Baru, Original 95%, DP 30Jt. Angs. 1,9Jt. Hub. 0852 7630 3900 / 0852 7507 6512

MITSUBISHI Eterna DOHC ‘89 warna hijau metalik, AC Dingin, Pajak hidup. Harga 30 Juta. Hubungi: 0852 6277 2566 / 7796 3325


Hitam, AC, VR (15”), Jok Sued Plat BL (Mutasi Medan). Mulus sekali. 0813 611 38100 (TP)

MITSUBISHI BARU MURAH Hub. Tampubolon. 0821 6652 9982 / 061-68777744

ISUZU Panther Hi Grade Thn. 95. Hijau met, mobil siap pakai. Jual Cepat khusus pemakai. Hub. 0853 62 555 172 - 0813 7094 4002

MITSUBISHI Lancer 82 BK Mdn, Biru, AC, Tape, VR, Cantik/Tdk kecewa. Jual Cepat 13.5 Jt Nett. Hub. Jl. Karya Jaya Gg. Eka Budi 9 B (Gd. Johor)

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli TI-HA TI apabila anda ingin produk anda, dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih MITSUBISHI BARU Angs 3 Jt-an....ready L300, T120SS. FE 74 HDV, FE 71, FE 73 dan Triton, Pajero Dakkar. Serius Hub: 0812 653 3319 dan 081 370 765 319

MITSUBISHI Lancer 1600cc SE 1 EVO IV Thn. 2000. Biru, TV, DVD, VR, CL, AC Dingin, Hub. 0812 6310 107 Amin OPEL BLAZER MONTERA ‘00

Htm met, CL, PW, PS, Ban Besar Baru, RT, Jok kulit, Sound Syst, DP 20 Jt. Angs. 1,94Jt. Hub. 0852 7690 3900 / 0852 7507 6512


Carry PU 1.5 FD, Rp. 8 Jt-an Angs. 2.672.000,APV Arena Rp. 11 Jt-an Angs. 4.073.000,Splash GL Rp. 13 Jt-an Angs. 4.069.000,Hub: 0812 654 0809 / 77722121

SUZUKI Carry Alexander Minibus Thn. 90, jok kulit, Velg Racing, Pajak panjang, kondisi siap pakai. 77765 444 (TP)

SUZUKI Carry Pick Up/Separoh Box

Thn. 90, Sosis asli, Pajak panjang, Medan, Kondisi siap pakai. 77400033 (TP)

ALL NEW COROLLA 97 Biru met mulus Hub. 0852 6113 7592


Warna Silver, Harga Rp. 145 Jt/ Bisa nego Hari libur ada di Jl. Suka Cerdas II No. 8 HP. 0813.7016.3500 Hari kerja ada di Jl. Mayjend Sutoyo (Jl. Perdana) No. 123 Medan

TOYOTA Kijang Grand Extra Thn. ‘93, 1.5 Shock, Benar2 sehat dan terawat Warna. Abu-abu Metalik, Jok kulit. H. 71Jt. BK asli Medan. Hub. 0813.6126.5117

# PESAN TOYOTA BARU # New Innova, New Fortuner, Avanza Yaris, Rush, Dyna, Hilux. Hub. 0853 7388 3777 TOYOTA Kijang Commando Long Thn. 90, Body mulus, jok kulit, Velg Racing, lampu depan Grand Extra, pajak panjang, Medan Asli, Baru 2 nama, kondisi siap pakai. 0852 7010 4444 (TP)

TOYOTA Greed Corolla Thn. 95, Baru 1 nama, jok kulit, pajak panjang, Medan Asli. Kondisi siap pakai. 0812 6344 444 (TP)

TOYOTA Kijang Super Th. 93, 1500cc, warna abu2 met, BK Medan, mulus, Rp. 58Jt. Hub. 061 699 811 77 TOYOTA BARU

Selasa, 18 Oktober 2011


TOYOTA Starlet Kapsul 1300cc Thn. 92 hitam metalik, AC, Tape PW, VR, ban radial, body kaleng mulus dan mesin bagus, harga Rp. 47juta/damai. Pemakai serius Hub. Iwan 0852 7630 4256 TP.

TOYOTA Avanza VVTI G 2008. W. Hitam, BPKB 1 nama, BK Medan, mulus, lengkap. Hub. 0813 7692 7611

TOYOTA Kijang Super G Th. 1996. 1.8, BK Mdn, wrn abu hitam. Mobil cantik. Siap pakai. HP. 0821 630 7718

TOYOTA Avanza Th. 2010 G VVTi W. Silver, sangat mulus. Hub. 061 7508 6164 TOYOTA Kijang LGX Solar Th. ‘01, silver met, pakai TV, CD, Mobil mulus, Kaleng2, pajak panjang, asli Medan, Rp. 123Jt. Kembar Ponsel Jl. SM. Raja No. 200 (Depan UISU). 0815 3373 3688 / 785 1402 TOYOTA Kijang Kapsul Thn. 2002, Bensin, LGX, warna hitam met, Tape, VR, BR, Power Window, power Steering, AC DB, Original, Satu tangan dari baru (Beli Baru dari Toko). A/n. Saya Sendiri Hub. HP. 0811 648358, Km. 76rb.

TOYOTA Avanza 2009 Akhir, warna silver, Tipe S. Tangan pertama, Khusus untuk pemakai. Hub. 0813 6101 3738 TOYOTA Kijang Grand Extra mulus, Thn. 1993 Short Wrn Abu2 metalic. Hrg. Rp. 66 Jt Nego. Hub. 0812 6079 9511



DANA Th 75 -2011 MOBIL + Sp. MOTOR % T. OVER: D. TRUCK + TRONTON, BM: KILAT SHM + SK C K COVNAS SKC BPKB Mr.JG.0852 756 30.000, 777 90 557 BUTUH DANA TUNAI Proses Cepat Jaminan BPKB Mobil Thn. 94 Up Hub. 0812 635 76669 - 0852 9634 7333


BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

TOYOTA Avanza Th. ‘09, 1300cc. Type G, wrn abu2 metalik, pajak panjang, mobil ctk sekali, 1 tangan dr baru, Rp. 141 Jt. Kembar Ponsel Jl. SM. Raja No. 200 (Depan UISU). 0812 6038 5555 / 7851402


PURBA : 0813 9736 0333

TOYOTA Innova V Thn. 2005 dijual. Warna biru. Harga 148Jt Nego. Hub. HP. 0821 6302 3781


HONDA Scoopy Violet Putih 2010 Siap pakai. Harga Rp. 11,9 Juta. Hub. 0812 6515 3460

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput



SIM A & C dan STNK. An. Erick A. Zega, Hub. 0812 647 8889 / 0852.7750.0889 (diberi hadiah)

HILANG/TERCECER Sertifikat Tanah No. 413/3/84. Atas nama Drs. H. Ahmad KS. Yang terletak di Dusun VII Psr. IV Helvetia Kec. Lab. Deli. Dengan Ukuran 1195, 50M2 TERCECER

BPKB Sp. Motor Yamaha BK 212 A CT a/n. Phan Muk Kioen. Alamat Gg. Sederhana No. 15 Kel. Sukaraja Medan. Yang menemukan mohon dikembalikan


BPKB Mopen Toyota Innova BK 661 S a/n. Elfian Iskandar SE. Alamat Jl. Seroja Kec. Medan Sunggal yang menemukan mohon dikembalikan.


Sertifikat HGB No. 1293 a / n . S . M . Ta u f i k Te r l e t a k P e r u m Perumnas Simalingkar Jl. Rotan 17 No. 2

TERCECER Surat Jual Beli Tanah tertanggal 16 Februari 1968 dan Surat Keterangan bersegel tahun 1986 a/n. Perguruan Muslimat Al Washliyah Kel. Labuhan Deli di kawasan Simpang Kantor-Belawan. Jl. Yos Sudarso sekitar Oktober 2011. Bagi yang menemukan tolong dikembalikan ke alamat perguruan diatas.


BPKB Sp. Motor Yamaha BK 3310 ABP a/n. YEVRI alamat Gg. Sederhana No. 15. Kel. Sukaraja Medan yang menemukan mohon dikembalikan.




SERVICE: AC, Kulkas, M. Cuci, TV, Instalasi Listrik, Bergaransi Hub: 061-77913537, 0813 75533375 REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757- 082162005114 Siap Ketempat


KHUSUS REPARASI /SERVICE Kulkas, M. Cuci, Sanyo Air, Dispenser, Bongkar Pasang AC Hub. PRATAMA ELECTRIC GARANSI Telp. 7343789




JUAL BELI AC BEKAS, DLL HP. 0812 6053 690 7352833 0812 6064 9333


Telah hilang Surat Hibah a/n. Jumiati sesuai SK Lurah Jati Makmur No. 470-1304 dan a/n. Syafraini dengan SK Lurah Jati Makmur No. 470-1305 tertanggal 13 Oktober 2010. Yang menyatakan Hibah sebidang tanah dari Murnasih (Alm) pada tgl. 29 O k t o b e r 1 9 9 7 . Ta n a h y a n g dihibahkan kepada Jumiati seluas 76,5M dan kepada Syafraini seluas 77,60 M2. Terletak di Jalan T. Amir Hamzah Lk. V Kel. Jati Makmur Kec. Binjai Utara.

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:



Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347


Selasa 18 Oktober 2011


Anthrax Siap Hibur Penggemar Metal Indonesia

Maia Estianty Anti Lypsink

PARA penggemar musik beraliran trash metal tak lama lagi bisa bernostalgia dengan salah satu band beraliran trash metal legendaris asal New York AS, Anthrax. Konser direncanakan berlangsung pada 10 Desember di Pantai Karnaval Ancol Jakarta, dalam rangkaian tur Asia untuk album terbaru mereka Worship Music. “Kami sangat ingin berkunjung ke Indonesia, kami punya banyak energi dan kami ingin menyapa kalian di Bulan Desember,” kata Scott Ian dalam wawancara jumpa pers via Skype di Jakarta. Sementara itu Girindra Pradana dari Blade Indonesia selaku promotor mengatakan bahwa perjalanan membawa Antrhax ke Indonesia ini cukup panjang. “Kesempatannya ada karena saat kami dengar mereka akan menggelar tur asia di Jepang dari agennya langsung, dan kami menawarkan bagaimana jika Anthrax menggelar konsernya lebih dulu di Indonesia pada tanggal 10 Desember dan akan dilanjutkan pada tanggal 12 Desember di Jepang,” katanya. Pihak Anthrax langsung menyetujuinya karena mereka belum pernah ke Indonesia dan mereka memutuskan untuk memulai tur pertama Asianya. Untuk harga tiket konser Anthrax pihak Blade membagi kedalam dua kelas yaitu Presale festival A (front) Rp520.000 dan Presale festival B (back) Rp410.000, dan pihak panitia menyediakan Tiket sebanyak 15 ribu lembar yang bisa di beli melalui raja karcis, atau ibu Dibyo. (ant)




Jl. Tegal Sari Laut Dendang, masuk dari Jl. Pancing/ Unimed lewat Komp. Veteran, LT. 9,75x20m², LB. 9,75x17mm², Lt. Keramik, PAM, Listrik 1300 Watt, Surat Sertifikat, H. MIlik, Boleh tukar dengan mobil Peminat serius hub. 0812.659.3973, Maaf TP




Comp. Pemda Tk. I Tg. Sari Jl. Cempaka Raya Baru No. 1, L. Tnh 10x30m, Bg. Type 100 Hub. (061) 7780.6384 - 0812.6377.7729




TV LED, LCD, Kulkas, M. Cuci, Handycam DSLR, Laptop, LCD, Projector, PS 1, 2, & 3 H. Theater, Sound System, dll. Hub. CV. MARKET. Tel. 7632 4682 - 0812 6539 3000, S. Budi Tj. Sari No. 424 B, Psr IV dkt BNI


TV LCD 42” P. Sonic = 6.5Jt. 32”LCD/LG=3,2JT, 42” LCD Samsung=3,5Jt, 34 Sony = 2 Jt, 29” Flat Baru LG =2 Jt, 29” Bekas 900rb - 1,7 Jt. 14 - 21=300rb - 650rb, 17” LCD Monitor 1Jt, 22”=1,5jt. PS1=400rb, PS 2=800rb, DVD 200rb, Vortable = 700rb. Ampli Gitar=700rb, Sansui Technics-SU 7600-Pioner, SA.6300EQ, Spk. BMB - TV Mobil=500rb


Handicam Sony Hi-8=1Jt, Mini DV=2Jt, DVD/HDD=3Jt, Camera 5 Mp - 12 Mp 500rb - 1,2Jt. Fax= 600rb, LCD Projector, Toshiba 3 Jt. Computer HP. P4=1,3Jt Printer HP=450rb


Jl. Kapt. Sumarsono 107 HP. 0812.602.5000


Jual AC Baru/Bekas, 1/2, 3/4, 1,1 1/2, 2Pk1,3Jt-2 Jt. AC Window 1 Pk = 800rb, Kulkas 1 Pt - 2 Pt- 600rb- 1,2Jt. Freezer Soces. 3 RAK=1,2JT. M. Cuci 1 Tb- 2 Tb= 600rb- 1,2 Jt. M. Cuci Baru= 1,2 Jt (2 tb 9 kg). Genset 3000 w. 2Jt. Pompa Air. Sanyo - P. Cliner


Hub. 4517509 - 69677449 Jl. Sekip 67 A



Gadis/ Janda untuk PRT di Medan dgn Gaji 700 Rb/ bln bersih Hub. (061) 7636.3421 / 0812.6553.5559



Dicari Tk. Pangkas, Berpengalaman, Muslim, Rapi, Sopan, Jaminan Rp. 60.000/ hari Hub. Wisma Pangkas D & D Jl.Gaperta No. 213 depan lapangan Jasdam (Kolam renang Tirta Kartika) Hub HP. 0812.6082.1190 - 0813.9629.9964


Gadis/ Janda Muslim, untuk Jaga anak/ Orang sakit/ PRT di Medan, Gaji Rp. 700 Rb s/d 1,3 Jt/ bln + Bonus 50 Ribu, Tiap bulan Hub. “CAHAYAII” Jl. Ayahanda 44T (061) 7670.0079 / 0812.6514.3676


Gadis/ Janda Muslim di Restauran dgn Gaji Rp. 500 Rb/ bln Bersih di Medan Hub. (061) 7636.3421 - 0812.6553.5559


PERANGKAI BUNGA PAPAN BERPENGALAMAN, RAJIN & BERTANGGUNG JAWAB Dicari: 2 orang diutamakan dari luar kota (T. Tinggal tersedia), syarat: Usia 25 - 35 thn, Pria, punya identitas/ kartu R. Tangga (Foto Copy), Fasilitas: Gaji + Bonus/ Papan, Off mingguan + Off bulanan + Uang kerajinan

Hub. 0813.9746.8020 - 0813.6140.2462

LOWONGAN KERJA Sebuah perusahaan yang bergerak dibidang Penjualan dan Perbaikan Mesin Photocopy membutuhkan beberapa orang pria untuk dilatih menjadi:


Syarat: Lulusan SLTA/ sederajat Usia max. 21 tahun Rajin, ulet dan bersedia ditugasi keluar kota Surat lamaran beserta no. telp. yang dapat dihubungi ditujukan Jl. Garuda Raya No. 5 Perumnas Mandala Telp. (061) 735.7975, Paling lambat tgl. 21 Oktober 2011







Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik


Kios di Pasar Petisah Tahap II Lantai I Blok D No. 104 Hub HP. 0812.6377.7729 0812.609.5705 - (061) 7780.6384


Sdh renovasi, Lt. full keramik, Hrg 225 Jt/nego Jl. Pinus Raya No. 13 Hub. Dwi HP. 0821.6657.6894

RUMAH DIKONTRAKKAN Maaf tanpa perantara, Jl. Eka Warni I/ 38 Johor Medan, 3 KT, 2KM, R. Sholat, Garasi, Air sumur, Listrik 1300 Watt Hub. 0816.331.629



Dijual 9 Pintu, Ruko Jl. Keadilan No. 2 simp. Jalan Cemara, LB. 4x16m, Row depan 6M Fasilitas: SHM, PLN, PAM, Cocok untuk usaha praktek dokter, warnet, gudang, toko HP NB: 60m dari Jalan Cemara Jl. Lintas, H. 450 Jl. KPR, perbulan 4 Juta, Full keramik, Siap huni, ±50 Jt, Sisa 3 unit Hub: 7772.2123 - 7759.8123 HP. 0811.65.1123

RUMAH DIjual Puri Tanjung Mulia Tipe 60, 2 KT, 1 KM, 1 RT, LT. 6x19m HP. 0811.600.1722




RUMAH Komplek di Tembung dijual, Sdh renovasi, LT. 7x24m, LB. 6x17m, 3 KT, Ada teras dibelakang, Full keramik, SHM Minat hub. 0852.6214.7893





RUMAH: LT. 10x30m, Ada Kamar kos, PLN, PAM, Jl. Darussalam Gg. Turi II/ 1B Medan Petisah, Harga nego SAWAH: Luas ±1 Ha, Harga permeter Rp. 35.000/nego terletak di Jl. Sei Mencirim Desa Sukaman Deli Serdang Hub. 0813.9710.2970 - 0853.7174.2770



Tanah Jalan Dr. Mansyur (USU) masuk Jalan SMTK 1 Surat SHM........1,5 Jt/mtr Luas Tanah 24x60,7m: 1.456,8m² Cocok buat perumahan (NEGO) Hotline: 0812.6061.0800 - (061) 7505.4008 0853.6260.0653 - 0852.9778.1174


RUKO Jalan Gatot Subroto (depan PLAZA MEDAN FAIR) 3 tingkat.................4,5M 3 unit dijual sekaligus dalam 1 sertifikat @4,50m x 20m/ unit (NEGO) RUMAH Perumahan Taman Riviera Blok CL Type 57 Luas Tanah 128m².....300 Jt Hotline: 0812.6061.0800 - (061) 7505.4008 0853.6260.0655 - 0852.9778.1174


MILLENIUM PLAZA LT. DASAR: 0812.8882.1068 RP. AKSARA PLAZA : 0813.9742.2213 BINJAI SUPERMALL : 0813.9798.3820 PAJUS SUMBER : 0812.6341.8789 DELIMAS PLAZA L. PAKAM: 0821.6087.3210 SIANTAR PLAZA : 0813.9650.7030 JUTAAN





B E R A N G K AT d a r i kepriha-tinan masih banyak Boy dan Girl band melakukan Lypsink (hanya menirukan gerak bibir), artis serba-bisa Maia Estianti terpanggil menjadi salah satu juri ajang pencarian bakat Boy & Girl Band Indonesia 2011 (B&GB) gelaran SCTV. “Saya termasuk insan musik yang anti Lypsink. Karenanya, saya terpanggil untuk menjadi juri dari segi olah-vokal bersama penyanyi Melly Goelaw dan Dewi Sandra. Saya jamin peme-nang ajang B&GB SCTV ini, tak lagi melakukan lypsink ketika manggung –seperti kecendrungan dilakukan beberapa grup boy dan girl band belakangan ini,” papar Maia Estianty kepada Waspada. Menurutnya, apa pun alasannya bernyanyi secara lypsink di panggung hiburan live maupun layar kaca, merupakan tindakan tak profesional dan membohongi penonton. “ Saya khawatir, fenomena boy dan girl band merupakan siklus alami biasanya tak berlangsung lama di industri

musik nasional – bertambah singkat dengan kecendrungan insan musiknya m e l a k u k a n l y p s i n k ”, tuturnya. Jebolan ajang B&GB ini kelak wajib bernyanyi sungguh-an di setiap pentas agar penon-ton tak jenuh dan merasa dibo-hongi sehingga para boyband dan girlband bisa lebih lama menyita perhatian penggemar musik Indonesia, harap Maia, penyanyi dan komposer yang belakangan merangkap menjadi produser rekaman dan mulai banyak mengorbitkan penyanyi dan band baru. Direktur Program dan Produksi SCTV, Harsiwi Achmad menambahkan, kendati proses audisi peserta B&GB 2011 hanya dilakukan di empat kota – Bandung (22-23 Oktober), Surabaya (29-30 Oktober), Yogyakarta dan Jakarta (5-6 November), para boy dan girl band berbakat serta berkualitas dalam benyanyi dalam koreografi dari seluruh Indonesia boleh ikut serta. (AgusT)





SETIAP PEMBELIAN: TOSHIBA J50 : 2,3 TOSHIBA M500 : 2,9 IBM X40 : 1,9 LENOVO T61 : 2,9 HP NC 4400 : 2,7 IPAD FUJITSU TABLET : 2,8






Berpengalaman professional

1. 2. 3. 4. 5. 6. 7.

HOTEL MADINAH: AL-HARAM (5*) HOTEL MAKKAH: JAWHARAT ANFAL (4*) HOTEL JEDDAH: AL AZHAR (5*) Penerbangan Via Singapore * Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis * Seluruh Jamaah tertanggung asuransi Office: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4/18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488


Umroh Umroh Umroh Umroh Umroh Umroh Umroh

Reguler 9hr, 13 dan 14hr Arbain di Madinah Plus Mesir Plus Turkey Plus Jordan Aqsha Plus India Kashmir Plus Dubai



DAFTARKAN SEGERA KE: KANTOR PUSAT MULTAZAM MEDAN JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING TELP. (061) 457.6116 - 7731.3385 HP. 0812.6495.8456 - 0813.6137.2321 - 0812.648.1828





Saat ini peluang bagus untuk investasi emas, lebih safety dan sangat menguntungkan, hasil investasi bisa diambil setiap hari kerja Info: Fendi 0821.6312.5540





MLM No. 1 USA Bonus tertinggi, Produk tnp saing baru buka 18 Juni 2011, Cari mitra serius U/ jadi pelopor Medan, Sabtu 22 Okt Pkl. 16.00 Hotel Asean Best Western Medan Regs. 0818.998.345

Special Ultah ke-5, beli Laptop berhadiah “Motor Gede” 20 Agustus 2007 s/d 20 Agustus 2012 -


Izin Usaha: 503/1099.SK.HO/SL/NT/08 UMROH TAHUN 2012 / 1432 H






Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

Media yang Tepat untuk Iklan Anda


My Residence in Medan


Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.3334 HP. 0813.7580.8866

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106



Jl. Sumbawa 8 No. 5 Marelan Indah, Abu Usamah HP. 0813.6256.7965





Trading Online Forex, Index Commodity, CFD, Metal ???




Telah Hadir Di MasterForex MetaTrader Online untuk Black Berry, Iphone 3G, Android, IPAD

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

MasterForex Area Sumatera Mandiri Building Lt.6, Jl. Imam Bonjol No. 16 D Medan 20112 Sumatera Utara – Indonesia Tel. +62-61-3000 33 00 Fax. +62-61-3000 33 84

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188 e-mail :







WC WC 0812 60444275 TUMPAT/ SEDOT

“WASPADA” Telp: 061 - 4576602




0813 6147 0812 Jl. Gatot Subroto Medan Ada Garansi



WC 0812 642 71725 PAK ADI



Ingin Promosikan Produk Anda Harian

Pasang Iklan Mini






JL. SEJATI/ PUKAT II NO. 61C MEDAN (DAERAH AKSARA/ MANDALA) TELP/ FAX. (061) 732.5009 - (061) 6998.5068

Ingin Tau Strategi dan Cara Menganalisa Market Forex, Index & Commodity secara Mudah. Temukan Solusinya dan Segera Kunjungi Kantor Resmi MasterForex Medan Kami Akan Memberikan Infomasi Dan Pemahaman Secara Gratis Kepada Anda!!!




Antoimun, Lupus, Soriasis, Asma, Alergi, Rematik, Sinus, Diabetes, Kanker, Stroke Sembuhkan dari akarnya, terbukti di 60 negara produk Paten USA 0821.2570.2223

Cukup Dengan Modal $5 US Dolar Anda Sudah Bisa Bertransaksi Di Pasar Bursa Dunia. Spread Mulai dari 2 Point, Tanpa Biaya Cash Komisi


TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188


Hub. (061) 7738.4399 - 0821.6811.9314

Sejumlah Lemari Besi, Cabinet 4 Laci, Brangkas, Msn tik, Facsimil, Printer Rek Listrik dll 0852.9631.1464





Ingin Promosikan Produk Anda



Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333


TABIB H. IBRAHIM. S. DI Jl. Jamin Ginting No. 226 Binjai HP. 0813 9652 3410

(Cab. Dari Desa Guru Singa Tanah Karo)





Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat



Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari






WASPADA Selasa 18 Oktober 2011

Medan Metropolitan

Polsek Medan Timur Gelar Razia MEDAN (Waspada): Polsek Medan Timur mengamankan puluhan sepedamotor yang tidak dilengkapi dokumen kepemilikan serta sepedamotor ‘bodong’ saat menggelar razia geng kereta di Jalan Timor dekat SMA Negeri 7 Medan, Senin (17/10) sekira pukul 14:00. Razia tersebut diduga terkait dengan penangkapan terhadap dua siswa SMA dan SMK yang berlokasi di kawasan tersebut yang diduga terlibat penjarahan toko busana di Jalan Halat Medan, kemarin, yang dilakukan oleh geng kereta IKL. Razia geng kereta tersebut dipimpin oleh Wakapolsek Medan Timur AKP John Purba. “Razia ini digelar untuk mengantisipasi dan menertibkan kendaraan yang tidak memiliki dokumen lengkap, dan juga terkait dengan geng kereta,” ujar John Purba. Menurut Purba, dalam razia yang berlangsung satu jam itu, pihaknya berhasil mengamankan puluhan sepedamotor yang tidak memiliki kelengkapan dokumen. Saat disinggung mengenai aksi geng kereta, Purba mengatakan, di wilayah hukum Polsekta Medan Timur belum ada ditemui aktivitas titik kumpulnya geng kereta.“Di Medan Timur tidak ada, disini hanya menjadi perlintasan dari geng kereta ke lokasi lainnya” tuturnya. Purba menegaskan, pihaknya akan rutin melakukan razia untuk mengantisipasi aksi brutal geng kereta di wilayah hukum Polsekta Medan Timur. “Razia kita lakukan rutin dan setiap malam minggu juga dilakukan namun sifatnya hanya pemantauan,” sebutnya. (h04)

Pelaksanaan Bantuan Pertamina Di USU Sesuai Prosedur MEDAN (Waspada): Pelaksanaan bantuan PT Pertamina di Universitas Sumatera Utara (USU) berjalan baik sesuai prosedur. Secara keseluruhan, implementasi dari naskah perjanjian pemberian bantuan dana PT Pertamina (Persero) kepada USU berjalan dengan baik. Demikian disampaikan Humas USU Bisru Hafi dalam relese yang diterima Waspada, Minggu (16/10). Menurutnya, saat ini realisasi dari pembayaran bantuan telah dilakukanPT Pertamina kepada USU baru pertama sebesar 20 persen. Realisasi ini sesuai dengan naskah perjanjian antara USU dengan PT Pertamina (Persero). Katanya, USU dan PT Pertamina (Persero) telah menandatangani naskah perjanjian pemberian bantuan dana untuk pembangunan gedung penyediaan peralatan laboratorium mini hospital sistem informasi dan sarana penunjang, tanggal 31 Desember 2010. Berdasarkan perjanjian tersebut, USU menerima bantuan dana dari PT Pertamina (Persero) sebesar Rp4 miliar dengan rincian pengalokasiannya sesuai dengan naskah perjanjian tersebut, yakni diperuntukkan bagi Fakultas Ekonomi untuk Pembangunan Gedung Convention Hall dengan alokasi dana sebesar Rp2 miliar. Kemudian Fakultas Keperawatan untuk penyediaan Peralatan Laboratorium Mini Hospital dengan alokasi dana sebesar Rp1 miliar dan Biro Keuangan dan SDM untuk penyediaan sistem Informasi dan sarana penunjang dengan alokasi dana Rp1 miliar. Proses pelaksanaan pekerjaan sehubungan dengan pembangunan terhadap kegiatan itu, berjalan sesuai naskah perjanjian yang telah ditandatangani oleh kedua belah pihak dengan Nomor : 035/H00000/2010-S0 dan Nomor : 8180/H5.1R/KPM/2010, serta berpedoman pada peraturan perundangan yang berlaku. Sesuai dengan naskah perjanjian, lanjut Bisru, maka pembayaran dana bantuan yang dilakukan oleh PT Pertamina (Persero) kepada USU adalah berdasarkan termin dengan ketentuan, untuk tahap pertama akan diserahkan sebesar 20 persen setelah terbit Dokumen Penunjukan Pemenang dan Surat Perintah Kerja (SPK). Untuk tahap kedua, akan diserahkan bantuan pada USU sebesar 60 persen berdasarkan atas prestasi kerja. Demikian juga tahap ketiga akan diserahkan bantuan sebesar 20 persen berdasarkan prestasi kerja. Namun, katanya, USU sangat menyayangkan adanya pihak-pihak menyebarluaskaninformasinegatifterkaitpemberianbantuantersebut yang mengarah kepada pencemaran nama baik. Untuk ini USU akan meminta pertimbangan Tim Biro Hukum USU apakah hal ini akan diteruskan ke jalur hokum atau tidak. (m49)

Polisi Buru Geng Kereta IKL MEDAN (Waspada): Polisi terus memburon kawanan geng kereta yang menamakan dirinya kelompok IKL (Ingat Kawan Lae). Bahkan, polisi menyisir lokasi mangkal geng kereta tersebut di kawasan Stadion Kebun Bunga Medan, namun tak seorang pun ditemukan. “Polisi terus memburon para pelaku penjarahan toko busana. Identitas mereka sudah diketahui. Lokasi mangkal kelompok IKL sudah disisir namun tak seorang pun yang berada di kawasan tersebut,” kata Kanit Reskrim Polsek Medan Area AKP J Banjarnahor, Senin (17/10), saat dikonfirmasi terkait perkembangan kasus penjarahan di toko busana Konco Brother Jalan Halat Medan yang dilakukan oleh kelompok geng kereta IKL. Menurut Banjarnahor, pihaknya telah memeriksa keterangan tiga anggota geng kereta IKL yang berhasil ditangkap warga saat menjarah toko busana Konco Brother. Meski saat menjalani pemeriksaan tersebut, ketiga tersangka hanya mengaku ikut-ikutan, namun polisi tetap memproses kasus-

nya hingga ke pengadilan. “Aksiaksi geng kereta selama ini telah meresahkan masyarakat, bahkan aksi brutal geng kereta sempat memakan korban jiwa,” sebutnya. Dikatakan Banjarnahor, pihaknya mengimbau agar kelompok geng motor tersebut segera menyerahkan diri, apalagi keberadaan para pelaku yang jumlahnya 20 orang lebih itu terus diburon. Sebagaimana diberitakan sebelumnya, puluhan remaja yang mengendarai sepedamotor diduga kelompok geng kereta menjarah toko busana Konco Brother di Jalan Halat simpang Laksana Medan, Minggu (16/10). Akibatnya, pemilik toko mengalami kerugian puluhan juta rupiah namun tiga pelakunya berhasil ditangkap warga. Informasi yang diperoleh di

kepolisian, kawanan remaja berjumlah 20 orang yang mengendarai sepeda motor tersebut datang dari arah Jalan Sisingamangaraja terus membelok ke Jalan Halat simpang Jalan Laksana. Sesampainya di depan satu toko yang menjual aneka jenis busana itu, para anggota geng kereta berhenti dan masuk ke dalam toko. Berlagak hendak membeli, mereka memilih baju dan celana. Usai mengambil barang yang disukainya,parapelakulang-sung kabur dengan mengendarai sepedamotor.Kawanangengkereta tersebut membawa sedikitnya 20 potong celana pendek. Ketiga pelaku yang tertangkap masing-masing berinisial IP, 16, dan SAH, 16, keduanya warga Jalan Seriti Perumnas Mandala dan TAP, 16, warga Jalan Karya, Sei Agul Medan Barat. Dari ketiga tersangka yang masih berstatus pelajar SMA Negeri dan SMK itu, polisi menyita beberapa pakaian dan bendera salah satu partai politik sebagai barang bukti sedangkan pemilik toko bernama Zufri, 30, sudah membuat pengaduan ke Polsek Medan Area. (h04)

Residivis Menjambret Dihajar Massa MEDAN (Waspada): Baru dua hari ke luar dari Lembaga Pemasyarakatan (LP) Tanjunggusta, seorang residivis diamuk massa karena tertangkap usai menjambret tas di Jalan Prof HM Yamin Medan, Sabtu (15/ 10) sekira pukul 13:00. Selanjutnya tersangka Wira, 20, warga Jalan Sentosa Baru, Medan Perjuangan, yang baru dua hari bebas dari LP Tanjung Gusta karena terlibat kasus perampokan, diboyong petugas Polsek Medan Timur. Sedangkan seorang teman tersangka berhasil melarikan diri. Penjambretan itu berawal saat korban Cindy, 25, warga Jalan Selam II, Kecamatan Medan Area, yang akan pergi berobat ke Klinik Rosiva melintas di Jalan Prof HM Yamin, dengan di-

bonceng oleh ibunya Merry, 47, mengendarai sepedamotor Yamaha Mio BK 3870 IZ. Saat berada di dekat jembatan parit busuk Jalan Prof HM Yamin, sepedamotor yang dikendarai korban dipepet oleh dua orang pelaku mengendari sepedamotor Yamaha Jupiter Z. Kemudian salah satu pelaku menjambret tas milik Cindy. Korban spontan berteriak dan mengundang perhatian warga, kedua pelaku mencoba kabur. Namun, sepedamotor tersangka bersenggolan dengan sepedamotor korban sehingga kedua kendaraan itu terjatuh. Warga langsung menangkap tersangka Wira dan menghajarnya hingga babak belur. Sedangkan seorang lagi pelaku berhasil kabur. Sementara kor-

ban yang mengalami luka dibawa ke rumah sakit. Tersangka terselamatkan dari amuk massa setelah petugas Polsek Medan Timur tiba di lokasi mengamankan. Selanjutnya tersangka beserta barang bukti, tas berisi HP milik korban dan kedua sepedamotor diboyong ke Mapolsek Medan Timur. Kapolsek Medan Timur Kompol Patar Silalahi saat dikonfirmasi menjelaskan, tersangka Wira belum sempat diperiksa karena masih diobati akibat pukulan warga. “Setelah luka tersangka sembuh, akan segera diperiksa. Sedangkan seorang lagi teman tersangka yang sudah diketahui iden-titasnnya hingga kini maish diburon,” sebutnya. (h04)


Kejagung Sita Rumah Kadis Pendapatan Batubara MEDAN (Waspada): Tim penyidik pidana khusus Kejaksaan Agung (Kejagung) RI menyita aset pribadi Kepala Dinas Pendapatan dan Pengelolaan Keuangan dan aset Pemerintah Kabupaten Batubara,Yos Reuke. Penyitaan rumah di Jalan Teratai No 24 Ling-kungan VII, Kelurahan Hamdan, Kecamatan Medan Maimun, dilakukan sebagai langkah pengembalian kerugian negara dalam perkara pembobolan kas Pemkab Batubara sebesar Rp80 miliar. “Penyitaan aset tersangka korupsi ini dilakukan untuk menjaga agar aset tersangka tidak hilang, jika status hukum nanti inkrah dan bersalah dan kerugian tidak dikembalikan, rumah ini disita untuk negara,” kata Ketua tim penyitaan aset Kejagung RI Alex Rahman, di Medan, Senin (17/10). Disebutkanya,dalamperkara ini, topal aset yang sudah disita oleh penyidik diantaranya tiga rumahpribadi,11kendaraanroda empat, dan deposito atas nama Yos Reuke sebesar Rp600 juta di Bank Mega Kisaran. “Kita belum hitung berapa nilai aset sudah

disita, namun kerugian sebesar Rp80 miliar,” katanya. Dalam perkara ini, enam orang sudah ditetapkan sebagai tersangka, Yos Rauke, Fadil Kurniawan selaku Bendahara Pemkab Batubara, Direktur PT Pacific Fortune Management Rahman, Itman Hari Basuki selaku Kepala Cabang Bank Mega Jababeka Cikarang, Rahman Hakim dan Ilham Maratua Harahap. “Tiga tersangka lainya, Abdul Rahman, Ibrahim dan Reiska masih belum tertangkap, masuk dalam daftara pencarian orang,” katanya. Perkara ini, tersangka Yos Reuke dan Fadil diketahui memindahkan dana kas daerah Pemkab Batubara sebesar Rp80 miliar dari Bank Sumut ke dalam rekening deposito Bank Mega cabang Jababeka, Bekasi, dengan cara menyetorkan uang dalam beberapa tahap, mulai 15 September 2010 hingga 11 April 2011. Diduga untuk mendapatkan keuntungan, dana itu disimpan dalam bentuk deposito senilai Rp80 miliar di Bank Mega Jababeka, Bekasi. Atas penem-

patan dana tersebut, kedua tersangka telah menerima keuntungan dengan menerima cash back sebesar Rp405 juta. Bunga diposito kemudian disetorkan ke 2 perusahaan jasa keuangan dan jasa pengelolaan asset, yakni PT Pacific Fortune Management yang dimiliki oleh Rachman Hakim dan PT Noble Mandiri Invesment melalui Bank BCA dan Bank CIMB dalam bentuk investasi. “Perkara ini, tersangka melanggar dua butir undang-undang, korupsi dan pencucian uang,” katanya. Proses penyitaan aset tersangka korupsi itu sempat mendapatperlawanandaripihakyang menempati rumah. Pasalnya, rumah itu dalam posisi kontrak dengan pihak lain. “Saya belum berani tandatangan, sebelum ada penjelasan dari yang punya rumah,”kataseorangwanita yang berhadapandeganjaksapenyidik Kejagung. Namunwanitatidakmenahu mengenai status lahan rumah, akhirnyamenandatanganisetelah disampaikan kalau sita bukan berarti mengosongkan rumah sebagai kantor itu. (m38)

Kejari Musnahkan 15 Ribu Miras MEDAN (Waspada): Tim Jaksa Penuntut Umum Kejaksaan Negeri Medan melakukan pemusnahan barang bukti berupa 15 ribu botol miras terkait dengan tindak pidana penggelapan minuman keras yang dilakukan terdakwa Philip Jong dan Siswanto Hutajulu alias Agus alias Syamsul, di kantor Dinas Perhubungan Kota Medan, Jl.Yos Sudarso, Pulo Brayan, Senin (17/10). Pemusnahan tersebut dilakukan oleh Tim Jaksa Penuntut Umum Amrizal Fahmi SH, dan Akhmad EP Hasibuan SH, MH beserta staf pada pidana khusus Kejaksaan Negeri Medan terkait putusan Pengadilan Negeri Medan atas nama terpidana Philip Jong No. 934/pid.B/2011/PNMdn tertanggal 30 Mei 2011 dan atas nama Siswanto Hutajulu alias Agus alias Syamsul No. 1651/pid.B/2011/PN-Mdn tanggal 12 September 2011. “Terdakwa telah melanggar pasal 54 Undang Undang No. 11 Tahun 1995 tentang Cukai

sebagaimana diubah dengan Undang Undang Nomor 39 tahun 2007 Jo. Pasal 64 KUHP Pidana. Sehingga barang bukti tersebut dilakukan pemusnahan atau penghancuran dengan mesin stombwalss yang dihadiri oleh pegawai dinas perhubungan dan pegawai kelurahan,” ujarnya. Kronologis sebelumnya, Bea dan Cukai wilayah Sumatera Utara menemukan sebanyak 29.652 pita cukai palsu dari minuman anggur merk Vigour. Hal tersebut diketahui setelah petugas Bea dan Cukai berhasil menangkap pimpinan PT Pheparin Philip Jong, setelah sidang vonis kasus penggelapan cukai. Kepala Bidang Penindakan dan Penyidikan Kanwil DJBC Sumut Cerah Bangun mengatakan, pihaknya telah melakukan pemeriksaan untuk Minuman Mengandung Etil Alkohol (MMEA) jenis anggur merk Vigour yang berasal dari PT Pheparin Ria di beberapa tempat

Sumut. Antara lain Kabanjahe, Nias, Sibolga, dan gudang PT Pheparin Ria di Jalan Adam Malik dan JalanWahidin Medan. “Pita cukai yang melekat pada barang bukti oleh petugas Perum Peruri telah dilakukan pendeteksian keasliannya, dan kedapatan pita cukai tersebut palsu. Tujuannya untuk mengelak atau menghindari kewajiban pembayaran pajak,” ujar Cerah Bangun, kepada Waspada. Alhasil dengan tujuan untuk mengelak atau menghindari kewajiban pembayaran pajak Philip Jong divonis denda sebesar Rp650 juta subsider 3 bulan penjara oleh Pengadilan Negeri (PN) Medan. Philip Jong langsung ditangkap petugas Bea dan Cukai usai mendengarkan vonis karena tidak meletakkan pita cukai pada Minuman Mengandung Etil Alkohol (MMEA) jenis vodka atau whisky merk Asoka dengan kadar alkohol 15 persen dan minuman jenis anggur merkVigour dengan kadar alkohol 19 persen. (m38)



Lindungi Produk Lokal Dan Awasi Masuknya Limbah Impor


residen Susilo BambangYudhoyono segera mengumumkan nama-nama menteri baru maupun yang posisinya ditukar dalam waktu dekat ini karena dinilai kinerjanya rendah. SBY juga bakal menambah begitu banyak wakil menteri yang dimaksudkan untuk mempercepat pergerakan konsep pembangunan untuk meningkatkan pelayanan dan kesejahteraan rakyat. Siapa saja menteri baru yang duduk hasil reshuffle? Masih belum diketahui pasti karena yang tahu pastinya hanya SBY sebagai pemegang hak prerogatif dan Allah SWT. Namun begitu, sejumlah menteri tampaknya bakal ‘’hengkang’’ (tergusur) karena selama ini kebijakannya banyak disorot masyarakat dan media massa, seperti Menteri Perdagangan Mari Elka Pangestu. Namun melihat kedekatannya dengan SBY dan perimbangan komposisi kabinet dari kalangan etnis China masih terbuka peluang buat Mari Pengestu duduk di kabinet. Artinya, Mari mungkin akan pindah tempat karena sejak kemarin tersiar isu Mari disebut-sebut akan digeser oleh SBY sebagai Menteri Pariwisata menggantikan Jero Wacik. Pergantian Menteri Perdagangan dari tangan Mari Elka Pangestu kita nilai tepat. Kebijakan Mari sangat tidak menguntungkan bagi dunia usaha, khususnya para pengrajin dengan melubernya produk impor dari China dengan kualitas rendah dan sedang dengan harga murah sehingga mematikan maupun merugikan banyak pengusaha kecil dan menengah yang selama ini kalah bersaing dengan produk impor tersebut. Jika ditotal segi untung dan ruginya negara dan rakyat lebih banyak dirugikan. Sebab, produk industri kita pada umumnya sulit diterima pasar luar negeri karena kalah dalam berbagai hal, termasuk kualitas dan disain. Kebijakan pemerintahan SBY lewat Menteri Perdagangan yang terlihat jelas proneolib dengan membebaskan barang-barang impor membanjiri pasaran dalam negeri sangat memukul dunia industri di berbagai bidang. Tidak hanya di sektor industri kecil seperti mainan anak saja, tapi juga sudah merambah ke berbagai sektor lainnya, seperti pakaian sampai batik, peralatan tukang, mesin, elektronik, dan rumah tangga, sampai makanan, buah-buahan, minuman, dan obat-obatan. Semuanya dapat dengan mudah ditemui sampai di pasar-pasar tradisional. Di Sumut permasalahan barang impor tidak hanya yang baru dari China, tapi juga barang bekas dan jenis sampah atau limpah yang sudah tidak boleh dipakai di luar Intisari negeri kini membanjiri Sumut. Masuk melalui pelabuhan Belawan dan pelabuhan laut lainnya, termasuk diselundupkan lewat kapalIndonesia khususnya kapal dan sampan nelayan. Ternyata, peminat atau pembeli bangSumut surga bagi produk tersebut baik yang berkualitas rendah China dan masuknya barang dari China maupun barang limbah bekas dari limbah barang impor luar negeri cukup banyak di Indonesia, khususnya di Sumut, seperti pakaian bekas, produk makanan dan minuman yang nyaris habis masa edar atau berlakunya, sampai mesin dan truk bekas sehingga patut dipertanyakan jika semua itu dapat bebas masuk ke Indonesia/Sumut. Besar dugaan terjadi ‘’kongkalikong’’ atau permainan surat-menyurat dengan importir atau pengusaha yang bergerak di bidang limbah ini. Oleh karena itu pemerintah dan pihak terkait tidak boleh hanya berdiam diri saja. Kewajiban pemerintah untu melindungi rakyatnya dari kerugian akibat membeli barang-barang dari China yang kualitasnya rendah sehingga disebutkan dapat merusak kesehatan karena pemakaian senyawa kimia – pewarna di atas ambang batas. Konsumen pun sering dirugikan karena kualitasnya rendah sehingga hanya bertahan beberapa bulan saja kemudian rusak dan tidak dapat diperbaiki karena tanpa garansi sehingga akhirnya masuk keranjang sampah. Seputar masuknya barang makanan dan minuman yang sudah hampir habis masa berlaku atau kadaluarsanya (expired date) mudah ditemukan di berbagai pusat perbelanjaan, dari kelas modern hingga tradisional. Tentunya hal ini sangat riskan. Sebab, bisa saja sebelum habis masa berlakunya kualitasnya sudah menurun, bahkan membahayakan kesehatan, berubah menjadi racun. Kalau pihak berwenang dalam hal ini DPRD, Balai POM atau LKI tidak tanggap, atau hanya sekali setahun melakukan razia menjelang puasa pastilah masyarakat sangat dirugikan (korban). Pemerintah pusat dan daerah sudah saatnya melindungi masyarakat dari kerugian akibat membanjirnya produk asing, khususnya dari China, sehingga mengancam kelangsungan hidup dunia industri di dalam negeri. Produk lokal yang dihasilkan pengrajin kecil dan menengah wajib diberi perlindungan. Jika tidak maka dunia industri kita akan semakin berkabung, semakin banyak yang tutup (gulung tikar), dan semakin meningkat jumlah pengangguran. Selain itu, pemerintah juga wajib mengawasi, bahkan mensetop masuknya berbagai jenis produk bekas pakai yang sudah dianggap afkir atau limbah (sampah) di negeri orang tapi masih laku dijual dan dipakai di dalam negeri. Sehingga Indonesia khususnya Sumut dicap sebagai surganya produk China dan masuknya limbah barang impor.+


Faks 061 4510025

Facebook smswaspada

Andong Maha Tenda pengungsi punya Dinsos Kota Subuluussalam terkesan formalitas bahkan menggaggu aktivitas warga, yang dipasang pada saat gempa bulan yg lalu. +628126401610 Semoga jemaah haji Batubara berdoa di tempat yg makbul doa nyo...supaya uang yg 80 miliar itu..copat tau...siapo ajo yg terlibat...di sikat habis...biar tau rasa. +6283197565871 Jumpa Partai Baru. Pemilihan Legislatif mendatang kita berjumpa Partai Nasdem. Berbalut warna biru. Drs Surya Paloh suka yang biru-biru. Jika ada Tuah Badan, tentu saja akan mendapat suara sebagaimana yang diangan-angan kan . Menyusul Pemilihan Presiden. Drs Surya Paloh akan menjadi Capres dan Presiden RI yang berjambang ~ berjanggut, apabila mendapat Suara terbanyak = DMN Sejok~Medan Sumatera= +628566238659 Semua warga Sumut heran melihat para Bupati & Dinas terkait di Sumut, krn masih banyak jalan di wilayah kekuasaan mereka rusak tetap dibiarkan & ini sangat membahayakan semua pengendara, khususnya pengendara Spd.Motor. Lihatlah kondisi jembatan Jalinsum di Pulau Raja, sambungan jembatannya sdh lama rusak. +6281973008504 Ada anak bertanya pada bapak. “Wahai Bapak yg tercnta, kenapa di negeri ini begitu banyak bencana?” Bapak dgn santai menajwab “Nak, ketahuilah bahwa dunia sudah tua. selain rapuh dimakan usia & penghuninya banyak berbuat dosa. Coba lihat, mereka yg taat dituduh teroris & berbuat maksiat malah dilindungi karena itu seni, tren sesuai zaman yg dilindungi Undang2 . Nah, kalau poligami dilarang & pelakunya bisa masuk penjara. tanya saja sama Syeh Fuji. kalau alasannya masih anak2, bukankah dia sudah baligh? Sedang pelaku zina dibiarkan, asal suka sama suka. tak peduli itu org tua atau anak SD&bayi HIV justru mendapat perhatian khusus, daripada mereka yg menderita busung lapar atau kekurangan gizi” jawab bapak sambil membersihkan ulat bulu yg menempel dibaju anaknya. “Oya pak, terus bagaimana dgn ulat bulu itu?” tanya sang anak masih penasaran “Ya itu terserah dia. wong tikus aja bisa masuk Istana, apa lagi ulat bulu?.kadang2 ada gurita, buaya&teman2nya. Nah sebagai hamba yg beriman, ini semua adalah teguran bahwa alam telah bosan, maka bertobatlah.semoga ditanganmu nanti bakal ada perubahan.entahlah kalau kamu mengikuti seniormu +6287799052660 Seharusnya sebagai pemerintahan di indonesia ini, “MALU”, karena belum bisa menuntaskan masalah korupsi, Negeri ini belum MERDEKA karena masalah ini. By: masyarakat miskin. +6287890631634 Mari jaga perdamaian bumi Iskandar Muda, kepalkan tangan dan tekad menuju Aceh di masa lampau. Bersama KAMMI LANGSA mari sukseskan PILKADA ACEH, bersama kita bisa. +6285277850101 Kepada rakyat Indonesia, jangan pilih partai dan anggotanya yang ingin bubarkan KPK, seperti Fakhri Hamzah, Bambang S dan Marzuki Ali. Trims Waspada.

WASPADA Selasa 18 Oktober 2011

Di Antara Yang Perduli & Tidak Oleh Bachtiar Hassan Miraza Pengrajin ini melakukan demonstrasi besar-besaran dengan membakar hasil kerajinan rotan mereka sebagai protes serta membakar gambar Menteri Perdagangan.


paya bagi menyelesaikan masalah angkatan kerja yang menganggur di Indonesia memerlukan peran dan kerjasama pada semua kementerian dalam pemerintahan. Begitulah pesan yang disampaikan pada tulisan minggu lalu yang membahas masalah pengangguran. Ia tidak saja menyangkut pada kebijakan kementerian tenaga kerja dan transmigrasi ataupun kementerian pendidikan nasional tapi pada semua kementerian dalam pemerintahan. Belakangan ini ramai diperbincangkan “perseteruan” antara beberapa kementerian terhadap kementerian perdagangan yang menyangkut pada kebijakan perdagangan luar negeri (impor dan ekspor). Kementerian Perdagangan dituding sebagai kementerian yang tidak memperdulikan masalah penciptaan lapangan kerja dan tidak memihak pada perekonomian dalam negeri (khususnya produsen ekonomi rakyat) serta condong pada kebijakan ekonomi global. Kita tidak tahu dimana letak persoalannya sehingga terjadi perseteruan dan menggambarkan begitu jeleknya koordinasi kebijakan ekonomi antar kementerian. Koordinasi kebijakan ekonomi yang demikian jelek tentu membawa dampak pada perkembangan ekonomi nasional. Untuk menciptakan keharmonisan kebijakan, pemerintah perlu menentukan dan memastikan kembali arah perkembangan ekonomi ke depan. Tidak sekadar mengutak atik siapa yang akan didudukan sebagai menteri dalam pemerintahan. Menentukan mereka yang duduk di pemerintahan tanpa diberi arah yang jelas ke mana perekonomian akan diarahkan akan melahirkan kembali pemerintahan (ekonomi) yang tidak efektif. Tentu ini akan mengorbankan kinerja perekonomian nasional. Kinerja perekonomian nasional yang tidak baik menghasilkan angka pengangguran yang tinggi, usaha ekonomi rakyat skala kecil dan menengah tidak berkembang. Selain itu gerak perekonomian meninggalkan sektor riil dan condong pada perkembangan ekonomi sektor keuangan, menciptakan ketergantungan yang semakin kokoh pada perekonomian global. Kinerja seperti ini tentu tidak diharapkan. Oleh sebab itu pemerintah perlu menyusun kembali kebijakan (ekonomi) dengan koordinasi yang kuat. Seyogianya pada setiap kebijakan yang dilahirkan (oleh setiap kementerian) harus dengan maksud untuk memperkokoh perekonomian dalam negeri dan penciptakan lapangan kerja serta memperkokoh daya saing global di pasar interna-

sional. Untuk itulah diperlukan koordinasi kebijakan antar kementerian di dalam memajukan perekonomian nasional Indonesia. Ketidakharmonisan kebijakan (ekonomi) awalnya terlihat pada impor ikan yang jumlahnya ratusan ribu ton ke Indonesia melalui pelabuhan Belawan, Tanjung Priok dan Surabaya. Kebijakan ini dikeluarkan oleh kementerian perdagangan. Kementerian Perikanan dan Kelautan berkeberatan dengan impor ini. Kementerian ini minta agar impor ikan itu dikembalikan ke negara asal (China,Vietnam,Thailand). Menteri mengatakan, ikan yang masuk itu adalah ikan yang dicuri di perairan laut Indonesia yang kemudian diberi label negara mereka (China, Vietnam, Thailand) dan diekspor ke Indonesia. Oleh menteri ikan impor tersebut disegel di pelabuhan tujuan dan minta segera dikembalikan (re-ekspor). Sikap Menteri Perikanan dan Kelautan ini tentu didasarkan pada rasa nasionalismenya yang kokoh yang ingin membela ekonomi rakyat (sektor riil) bidang perikanan dan kelautan. Sikap ini menyangkut pada nasib para nelayan Indonesia dan upaya bagi menumbuhkan perekonomian Indonesia bidang perikanan. Kemudian perseteruan ini berlanjut pada izin Kementerian Perdagangan mengenai impor garam dari India dan Australia. Kebijakan Kementerian Perdagangan ini sangat disesalkan Kementerian Perikanan dan Kelautan karena berdampak kepada nasib petani garam nasional. Tidak saja pada lapangan kerja tapi pada harga garam dan kesejahteraan petani garam itu. Selang waktu yang tidak lama terjadi pula ketidakharmonisan antara Kementerian Perindustrian dengan (kembali) Kementerian Perdagangan yang menyangkut izin ekspor rotan ke China. Sementara industri rotan di dalam negeri kehabisan bahan baku dan berdampak pada banyak industri rotan yang tutup—justru Kementerian Perdagangan mengeluarkan izin ekspor rotan. Dampak selanjutnya banyak lowongan kerja yang hilang yang sudah tercipta di industri kerajinan rotan selama ini. Menurut Kementerian Perindustrian ekspor rotan ke China sama artinya Indonesia melakukan tindakan bunuh diri. China adalah negara pesaing Indonesia dalam pasokan hasil kerajinan industri rotan dunia. Rupanya ketidaksabaran Kementerian Perindustrian disambut oleh pusat pengrajin rotan yang berada di Cirebon. Pengrajin ini melakukan demonstrasi besar-besaran dengan membakar hasil kerajinan rotan mereka sebagai protes serta membakar

gambar Menteri Perdagangan. Dalam minggu ini terkuak lagi ketidak harmonisan itu. Kali ini menyangkut pada impor kentang dan sayur dari China dan Bangladesh. Para petani kentang JawaTengah berdemonstrasi menembus istana negara, Kementerian Perdagangan dan Kementerian Pertanian. Saling tuding menuding membela diripun terjadi. Kementerian Perdagangan mengatakan izin impor dikeluarkan karena saat ini Indonesia kekurangan pasokan kentang. Kementerian Pertanian mengatakan Kementerian Perdagangan jalan sendiri. Tidak pernah berkonsultasi dengan Kementerian Pertanian mengenai pasokan kentang nasional. Sementara Menteri Koordinator Perekonomian gagap tatkala menjawab pertanyaan wartawan mengenai masalah impor kentang. Beginilah wajah kebijakan ekonomi Indonesia yang pada dasarnya tidak terkoordinasi dengan baik. Tentu hal ini berdampak pada kinerja perekonomian Inonesia. Produsen ekonomi rakyat skala kecil dan menengah benar-benar terpukul. Wajah kebijakan seperti ini tidak saja berdampak pada melambatnya perkembangan ekonomi tapi juga pada momentum penciptaan lapangan kerja menjadi terganggu. Kita tidak mencampuri berbagai alasan yang disampaikan oleh para menteri yang berseteru tapi kita dapat merasakan dampak pahit dari perseteruan itu. Jika ditelusuri dari perseteruan ini, ada pihak kementerian yang sangat perduli akan perkembangan ekonomi nasional khususnya pada produsen ekonomi rakyat skala kecil dan menengah, yang perduli akan penciptaan lapangan kerja, yang perduli melindungi

perekonomian nasional dari persaingan global. Namun dipihak lain ada kementerian yang tidak mempunyai keperdulian akan hal tersebut dan mengeluarkan izin impor atas barang tertentu saat pasokan barang di dalam negeri berkurang. Kementerian Perdagangan mengeluarkan izin impor dengan maksud agar harga di dalam negeri tidak bergejolak. Kementerian Perdagangan tidak menghendaki masyarakat konsumen (yang umumnya tinggal di perkotaan) menjadi susah yang disebabkan oleh kenaikan harga. Kementerian Perdagangan berpandangan seolah urusan masyarakat produsen di luar tanggungjawabnya. Kita tidak mencampuri berbagai alasan yang disampaikan kementerian, baik yang punya keperdulian maupun yang tidak. Tapi kita ingat akan falsafah kehidupan China yang mengatakan hidup bersakit hari ini hanyalah penundaan kesenangan yang akan dinikmati masa mendatang. Jika demikian, Indonesia seharusnya tidak terlalu memikirkan kepentingan masyarakat konsumen dengan mengeluarkan izin berbagai impor barang. Pikirkanlah kepentingan masyarakat produsen karena strategi ini menyangkut pada kepentingan ekonomi jangka panjang walaupun hari ini kita menderita. Juga menyangkut pada penciptaan rasa keadilan bagi berbagai lapisan rakyat Indonesia, yang berada di kota dan desa, produsen maupun konsumen, pengusaha besar maupun pengusaha kecil/ menegah sektor industri dan pertanian serta perdagangan. Penulis adalah Guru Besar Emiritus USU, Pemerhati Ekonomi.

Kelaparan Tak Dapat Menunggu Ironisnya, pada waktu yang sama di belahan bumi manusia yang lain, terdapat 300 juta orang tengah berperang melawan berbagai penyakit degeneratif seperti penyakit jantung, diabetis dan kanker yang diakibatkan oleh keadaan gizi berlebih (obesitas). Inilah ketimpangan yang disebut oleh ekonom Swiss, Rudolf H Strahm, sebagai kondisi yang berlimpah dan yang merana (uber entwicklung-unter entwicklung).

yang pesat juga menjadi pemicu volatilnya harga pangan saat ini. FAO menyatakan bahwa setiap tahun bertambah 80 juta mulut baru yang menganga dan minta disuapi makanan. Tekanan pertumbuhan penduduk tersebut lebih diperparah oleh fenomena meteorologi yang tidak menentu dan sering ekstrem akibat pemanasan global dan perubahan iklim. Turbulensi harga pangan dunia saat ini juga dipicu oleh adanya krisis bahan bakar minyak serta kecenderungan investasi besar-besaran pada pasar berjangka komoditas pangan. Adanya distorsi dan proteksi dalam praktek perdagangan komoditas pertanian, juga turut memperparah kondisi pangan dunia.

Volatil Tingginya harga pangan yang terjadi sejak 2007 hingga kini telah menggerus daya beli warga miskin di negara-negara berkembang. Data Food PriceWatch dari Bank Dunia menyebutkan bahwa harga pangan global 2011 secara signifikan lebih tinggi dari 2010. Menurut Presiden Bank Dunia, Robert B. Zoellick, saat ini kita masih berada dalam zona bahaya. Harga pangan global yang masih tinggi, serta stok pangan yang rendah, jika dikombinasikan dengan ketidakpastian perekonomian dunia dapat terus mengancam warga miskin. Para pakar menuding bahwa penyebab harga pangan menjadi sangat volatil seperti sekarang ini antara lain karena para pembuat keputusan gagal memahami bahwa booming produksi pangan di banyak negara tidak berlangsung selamanya. Untuk menjaga produksi pangan yang tinggi diperlukan investasi berkelanjutan dalam bidang penelitian, teknologi, peralatan dan infrastruktur. Kenyataannya, selama 30 tahun terakhir bantuan pembangunan pertanian yang dialokasikan oleh negara-negara yang tergabung dalam Organisasi Kerjasama Ekonomi dan Pembangunan (OECD) hanya tinggal 43%. Pesatnya pertumbuhan ekonomi di negara-negara emerging economies seperti China dan India juga berkontribusi besar terhadap ketatnya pasar komoditas pangan dunia. Semakin bertambahnya pendapatan masyarakat, maka orang akan cenderung makan daging dan susu lebih banyak. Akibatnya bahan pangan yang berupa biji-bijian banyak tersedot untuk pakan ternak (feed grains). Pertumbuhan penduduk dunia

Domain negara Dalam intensitas berbeda tragedi kelaparan seperti yang melanda Somalia dapat saja melanda beberapa wilayah negeri ini jika pemerintah tidak berbuat apa-apa. Kekeringan panjang yang dialami sebagian wilayah Nusa Tenggara Timur (NTT) sangat potensial menimbulkan bencana kelaparan bila dilakukan pembiaran. Lemahnya pencegahan masalah pangan antara lain dipicu oleh lemahnya akses data dan informasi. Kondisi ini lebih diperparah dengan sulitnya medan, kurangnya sumber daya manusia yang mumpuni di bidangnya, serta terbatasnya infrastruktur transportasi yang menjangkau daerah terpencil. Semua kondisi itu kita temukan di NTT. Jika kita buka kembali teori tentang manajemen bencana, peristiwa kelaparan termasuk dalam slow on set disaster. Sebuah literatur menyatakan, jeda antara kegagalan panen hingga orang mengalami busung lapar dan meninggal, sekitar 4-6 bulan. Apabila seseorang terpapar kekurangan pangan hari ini, maka berat badannya baru akan turun secara signifikan dua bulan ke depan. Untuk mencegah terjadinya bencana kelaparan, semua daerah di Indonesia harus memiliki Peta Ketahanan dan Kerentanan Pangan (Food Security and Vulnerability Atlas). Peta tersebut memuat berbagai indikator ilmiah, terukur dan standar, meski dalam operasionalnya harus disesuaikan dengan kondisi masing-masing daerah. Tingkat kerawanan pangan suatu wilayah merupakan resultan dari empat kondisi, yaitu tingkat ketersediaan pangan, tingkat akses pangan, tingkat pemanfaatan/penyerapan pangan, serta

Oleh Toto Subandriyo FAO menyatakan bahwa setiap tahun bertambah 80 juta mulut baru yang menganga dan minta disuapi makanan.


kandal global terbesar bukanlah kelaparan. Bahkan kelaparan tetap akan ada walaupun kita memiliki cara untuk menghilangkannya. Skandal terbesar global adalah mendiamkan isu kelaparan dan tidak berbuat apa-apa”. Demikian antara lain isi deklarasi 55 negara, sehari sebelum dilaksanakannya Sidang Majelis Umum ke-60 Perserikatan Bangsa Bangsa (PBB), 21 September 2004 di New York, Amerika Serikat. Deklarasi tersebut sengaja penulis tampilkan kembali setelah dunia internasional memperingati Hari Pangan Sedunia (World Food Day) pada 16 Oktober. Sedangkan untuk Indonesia puncak peringatan diselenggarakan 20-23 Oktober 2011 di Kabupaten Bone Bolango, Provinsi Gorontalo. Selaras dengan tema internasional “Food Prices – from Crisis to Stability”, Pemerintah Indonesia menetapkan tema nasional “Menjaga Stabilitas Harga dan Akses Pangan Menuju Ketahanan Pangan Nasional”. Masyarakat dunia saat ini tengah dilanda kekhawatiran terhadap kemungkinan terjadinya krisis pangan akut yang daya rusaknya terhadap peradaban manusia sangat dahsyat. Belum lama berselang FAO melaporkan bahwa setiap enam detik terdapat seorang anak meninggal karena kelaparan. Secara kasat mata kita juga menyaksikan tragedi kemanusiaan bencana kelaparan terburuk selama 60 tahun terakhir yang melanda Somalia. Bencana kekeringan selama enam dasa warsa di negeri Tanduk Afrika itu telah menyebabkan 3,7 juta penduduk Somalia mengalami kelaparan hebat. Ibu-ibu terpaksa meninggalkan bayi mereka di jalanan dan memiliki pilihan mengerikan: menyelamatkan yang lebih kuat dari yang lemah, atau anak meninggal dalam pelukan. Direktur Jenderal FAO, Jacques Diouf, menyayangkan kurangnya respon masyarakat internasional terhadap bencana kekeringan dan kelaparan yang melanda Somalia. Hanya 63 persen dana yang terhimpun dari keseluruhan dana yang dibutuhkan PBB untuk menanggulangi bencana tersebut yaitu sebesar 2,5 miliar dolar AS.

tingkat kerentanan pangan. Interaksi dari empat kondisi tersebut akan menentukan secara agregatif apakah suatu wilayah atau individu tergolong rawan pangan. Peta Ketahanan dan Kerentanan Pangan disusun sebagai dasar pemerintah daerah membuat target prioritas pembangunan. Status rawan pangan suatu wilayah tidak berarti pemerintah daerah tidak bekerja. Sebaliknya, berdasar peta tersebut dapat dibuat kebijakan-kebijakan yang lebih fokus dan efektif bagi rakyat sesuai kondisi wilayah. Kelaparan membutuhkan penanganan cepat. Pepatah barat sudah menyatakan stomach can’t wait, perut yang lapar tidak dapat menunggu. Penulis adalah Alumni IPB Dan Magister Manajemen UNSOED

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Jumlah wakil menteri menjadi 20 - Kayak tim sepakbola, he...he...he * Plt Gubsu: Perlu metode nonteknis atasi banjir - Berarti tak perlu teori! * Sumut pastikan tidak terima CPNS tahun ini - Ya nasib... ya nasib!


D Wak


WASPADA Selasa 18 Oktober 2011


Kami Butuh Pengayom Bukan Penggarong Hiruk-pikuk teriakan anak bangsa mulai dari tuntutan aksi demonstrasi komunitas buruh. Mengeluhkan gaji rendah dan tidak dibayar serta sikap manajemen yang tidak manusiawi. Gugatan kaum tani terhadap kebijakan pemerintah, yang tidak mengangkat taraf kehidupan sosial-ekonomi petani. Tangisan balada komunitas guru tentang gaji dan insentif yang tidak mencukupi. Amukan mahasiswa korban kebijakan rektorat, dekanat, senator dan dosen. Jerit kemarahan disertai derai air mata kepedihan para pedagang kaki lima yang tergusur. Tawuran di antara sesama siswa, mahasiswa dan atau kelompok anak bangsa. Membahana menghitam-kelabukan langit biru Indonesia. Bersama seluruh problema patologis Ipoleksosbudhankam lainnya, fenomena tersebut semestinya harus dilihat semua jajaran dan lapisan sosial warga sebagai ungkapan harapan dan kebutuhan kehadiran sosok berjiwa pengelola dan pengayom di negeri ini. Bukan pemangsa (predator) dan penggarong (koruptor)..! Ketika semua hiruk-pikuk itu dilihat, dinilai dan disikapi hanya sebagai keinginan kelompok tertentu, untuk lebih mengharu-birukan kondisi Indonesia yang sudah babak-belur atau menggulingkan kekuasaan pemerintahan semata. Maka penyikapan demikian itu hanyalah patut muncul dari komunitas bermental pemangsa dan penggarong saja. Apalagi jika semua kondisi negatif patologis itu, dimanfaatkan pula sebagai momentum pengalihan isu untuk mengamankan kebusukan pemegang kekuasaan dan direkayasa melakukan pembusukan atau pelemahan dan pembunuhan karakter komunitas yang ditakuti potensinya sebagai kekuatan penyeimbang. Sungguhlah sikap demikian itu merupakan kejahatan yang terlalu sulit untuk bisa dimaafkan. Dapat dipastikan, itulah kerja komunitas Machivelian yang hidup di negeri ini. Icik seperti Kancil dan buasa seperti Singa. Namun, mereka jugalah yang mengesankan diri di pelataran pentas pergaulan bermasyarakat, berbangsa dan bernegara sebagai sosok-sosok guru, bapak, pahlawan dan pecinta negara dan bangsanya. Tidak berpretensi mengabaikan kemungkinan adanya sejumlah individu yang bermaksud menggulingkan kekuasaan pemerintahan dan tidak juga mendukung tuduhan bahwa semua keluhan, jeritan dan ledakan kemarahan anak bangsa itu sebagai upaya penggulingan kekuasaan pemerintahan. Fakta dan fenomena keterpurukan negara dan bangsa ini di bawah himpitan sejuta problema patologis Ipoleksosbudhankam, bukanlah sebatas ilusi dan halusinasi. Kenyataan fenomenal itulah pemicu semua kehiruk-pikukan yang terjadi. Faktor pemicu itu tidak akan pernah menjadi fenomena, kalau pemegang kendali sentrasentra kekuasaan pemerintahan dan lembaga kemasyarakatan lainnya, tidak bermental pemangsa dan penggarong itu. Inilah yang harus disingkirkan dari wilayah sentra kekuasaan pemerintahan dan lembaga kehidupan kemasyarakatan lainnya. Begitu jugalah kita sekarang dan esok. Ketika pemegang kendali sentra-sentra dinamika kehidupan budaya dan peradaban telah berada di tangan singa dan srigala, maka pastilah rakyat menjadi domba. Darah, air mata dan nyawa serta teriakan kepedihan merasakan kesakitan menjadilah mozaik Indonesia. Bangsa ini memiliki kekayaan catatan sejarah yang sangat panjang. Namun, tidak cukup cerdas mengambil pelajaran dan pengajaran dari sejarah itu sendiri. Karena itulah kisah perjalanan kemerdekaan selama 66 tahun beda tipis saja dengan perjalanan Keledai mengelilingi gilingan gandum. Suatu yang tidak wajar terjadi, pada saat kepemimpinan telah dikendalikan oleh komunitas intelektual dengan strata Doktoral. Sumber Daya Alam yang berlimpah-ruah. Sumber Daya Manusia jebolan Perguruan Tinggi dalam dan luar negeri. Hasil yang dinikmati hanyalah sebatas keterpurukan di bawah sejuta problema patologis Ipoleksosbudhankam bertarap KLB (Kasus Luar Biasa). Huh..! Logika apa dan siapa yang mau mengatakan realitas itu sebagai sesuatu yang sah dan wajar terjadi? Tidak sah dan wajar! Kata komunitas idealis. Namun, berdiri pada hukum kausalitas alam, begitulah yang bisa terjadi. Prima Kausanya adalah dominasi komunitas bermental pemangsa dan penggarong di pentas pemerintahan dan kemasyarakatan. Dari sisi hukum kausalitas alam, upaya pembersihan komunitas pemangsa dan penggarong itu dari pelataran kehidupan bernegara, berbangsa dan bermasyarakat adalah juga sesuatu yang sah dan wajar juga. Itulah pertarungan komunitas Idealis vs Machiavelian….! Secara umum manusia adalah makhluk peniru yang cerdas. Pemimpin penggarong. rakyat tentunya jadi pencuri. Jika Guru Kencing Berdiri, Murid pun akan Mengencingi Guru. Betapa lagi jika komunitas pemuka agama terlihat kasat mata lebih mempertontonkan diri sebagai penjilat ke atas menginjak ke bawah. Tentulah umat pun akan sangat patut menunjukkan keberanian melecehkan Kebenaran Tuhan Yang Maha Tunggal itu. Kalau sudah begitulah perilaku anak bangsa ini. Kehancuran jugalah yang sama kita tunggu. Manusia Indonesia pun akan terlihat tidak seperti manusia lagi. Itukah Indonesia yang kita cita-citakan..? Na’udzubillahi min dzalik. Bangkitlah, hei kaum Idealis ….! Lakukanlah perbaikan. Itulah permintaan kepada mereka yang masih meyakini diri bukan penggarong atau pencuri. Semoga mereka masih ada di negeri ini. Amiiin. Kh. Nazaruddin Lubis An-Naqsyabandi Al-Hajj Pembina Majelis Ta’lim Salafiyah Asy-Syafi’iyah An-Naqsyabandiyah Jalan Lampu No 28 P. Brayan Bengekel Baru – Medan.

Surat Untuk PSSI Usai menonton pertandingan Timnas melawan Qatar, kembali rasa kesal datang tak diundang. Timnas yang sangat diharapkan bisa menguasai pertandingan hanya mampu menempati posisi juru kunci group. Memang sangat mengecewakan. Seorang teman saya yang bukan pemain sepakbola, diahanya seorang dari jutaan penikmat sepak bola, tidak punya latar belakang sekolah sepakbola atau apapun yang berkaitan dengan sepak bola , apalagi pelatih , sekali lagi dia hanya sebatas penonton dan penikmat sepak bola yang menaruh harapan besar kepada Timnas untuk bisa bicara dilevel internasional. Sama seperti ratusan ribu atau bahkan jutaan penonton lainnya. Katanya, maunya PSSI itu dalam merekrut pemain dibuka secara umum dengan membuat iklan rekruitmen di media masa seluruh daerah di Indonesia, atau bila perlu rekruitmen Timnas diumumkan diseluruh kelurahan di Indonesia, maksudnya supaya semua anak negeri yang berbakat dan berkeinginan punya kesempatan. Menurut dia lagi, pengumuman rekruitmen tersebut langsung diberikan syarat, yaitu : pertama audisi/seleksi pemain timnas hanya boleh diikuti oleh Pria berusia maksimum 17 tahun, memilki tinggi badan minimal 175 Cm dengan berat badan ideal sesuai standard umum kesehatan (65 Kg). Lalu semuanya yang mendaftar diseleksi ditingkat Kecamatan dengan Seleksi awal (setelah memenuhi syarat tinggi dan berat badan) dengan uji kemampuan fisik, menurut kawan saya ini untuk lulus audisi fisik tahap pertama ini calon harus mampu berlari selama 2x45 menit, dan untuk ini memang bukan siapa dibelakang calon yang diseleksi tetapi calonnya langsung (mungkin maksudnya jangan ada KKN). Lolos tahap ini diambillah 100 orang dari seluruh Indonesia, katanya. 100 calon yang lolos kemudian diberikan pendidikan fisik dan mental ala militer selama satu tahun penuh, kurikulumnya hanya pengolahan fisik dan mental ditambah ekstra kurikulum teknik sepak bola, pendidikan ini seperti pendidikan AKABRI dan diasramakan, menurut kawan saya ini hal tersebut untuk membina mental dan fisik serta disiplin dan yang paling utama adalah memupuk rasa nasionalisme. Lulus dari pendidikan ini, barulah calon diseleksi tahap akhir untuk memilih 96 calon pemain timnas yang dibagi dalam 4 team, yakni team A, B, C dan D. dan diberikan pelatih yang menguasai teknik sepakbola yang memadai, menurut kawan saya tidak perlu juga harus membayar pelatih Internasional yang berbiaya mahal, cukup dengan pelatih lokal saja. 4 team inilah yang diberikan pelatihan sepakbola profesional dalam 1 tahun penuh dengan catatan tidak gonta ganti pelatih. Setelah melewati masa latihan terkonsentrasi selama satu tahun barulah keempat team ini diuji cobakan dengan berbagai kesebelasan yang ada di dunia ini untuk memberikan pengalaman bertanding yang cukup, menurut kawan saya ini, PSSI harus terus berupaya memberikan pertandingan persahabatan dengan berbagai negara kepada keempat tim ini dalam satu tahun. Setelah melewati proses terakhir inilah, pemain-pemain tersebut baru dapat dizinkan untuk bergabung dengan tim perserikatan atau klub atau apapun namanya dengan ikatan kontrak siap dipanggil kapan saja oleh Timnas jika diperlukan untuk membela nama negara. Jika hal-hal ini dapat dilakukan, menurut terawangan kawan saya ini barulah Timnas Indonesia biasa bicara dilevel Asia Tenggara, Asia atau bahkan level dunia. Beliau yakin Timnas Indonesia akan berjaya. Pendapat kawan saya ini memang sangat sederhana, tetapi menurut saya banyak benarnya juga, kekalahan demi kekalahan yang di alami Timnas memang tidak pernah lepas dari persoalan disiplin, daya juang , karakter, fostur tubuh dan kekuatan fisik para pemain. Belum lagi ditambahi dengan persoalan-persoalan kepelatihan yang terkadang sangat kental beraroma politis dan kepentingan. Memang sudah saatnya Squad Merah Putih adalah sepasukan pemain bola yang siap setiap saat. Karena sejujurnya saya juga sangat menaruh harapan besar untuk siapa tahu disisa umur saya yang tidak seberapa lagi ini, saya bisa melihat pertandingan skala internasional yang didalamnya ada Timnas PSSI. Abduh Luthfi Siregar Medan

Musibah Kebakaran Oleh dr Candra Syafei, SpOG Ketika korban terjebak dalam kobaran api,menjadi tidak cerdas dalam bertindak sehingga cepat menyerah pada keadaan. Lebih parah lagi pada penderita asma cepat sekali terpengaruh jika keadaan ketersediaan oksigen segar menipis.


khir-akhir ini kita selalu dibuat terhentak berita keganasan si jago merah, yakni kejadian kebakaran. Kebakaran komplek perumahan, pertokoan, gudang pabrik, kendaraan mobil, kapal laut, bahkan kebakaran hutan yang hampir setiap tahun selalu ada di Meda. Kalau seminggu saja tidak mendengar suara sirene mobil pemadam kebakaran lewat, sudah lumayan. Apalagi jika musim kemarau, musim sering terjadi pemadaman listrik, maka tidak dapat disangkal lagi akan sering terjadi peristiwa kebakaran. Kalau kita melihat latar belakang kenapa dapat terjadi kebakaran, maka banyak faktor-faktor yang perlu kita sikapi dengan arif. Mulai dari lingkungan, masyarakat maupun pemerintahan setempat. Upaya pencegahan kebakaran yang paling utama daripada memadamkan api. Kebakaran identik dengan kewaspadaan dini, jika masyarakat lalai atau karena faktor kesengajaan maka tidak dapat dipungkiri lagi kebakaran cepat muncul dan siap membinasakan semuanya tanpa kompromi. Kita tahu bahwasanya setiap kebakaran pasti akan menimbulkan kerugian, baik nyawa manusia maupun harta benda. Api yang menjadi penyebabnya sudah diketahui semua orang. Karena sebagian besar umat manusia berkepentingan dengannya. Begitu juga dalam kehidupannya di dalam rumah tangga, kadang karena kelalaian sepemilik rumah akhirnya menimbulkan kebakaran yang meluas kepada tetangga lain. Beberapa penyebab umum terjadinya kebakaran di rumah tangga serta upaya penanganan agar menghindari terjadinya kebakaran tersebut serta langkah-langkah penanggulangannya. Berdasarkan hal tersebut, kami ma-

mandang sebagai langkah awal seharusnya setiap indiviudu dalam rumah tangga wajib mengetahui cara penanggulangan kebakaran tingkat pertama menjelang datangnya bantuan dan unit pemadam kebakaran. Ada beberapa hal sebagai penyebab umum timbulnya kebakaran dalam rumah tangga yaitu : 1).Korek api atau merokok. Anak-anak sering bermain korek api, hal ini dapat membahayakan karena dapat membakar benda-benda yang lain. Merokok di sembarangan tempat kadang sambil tiduran dapat membakar kasur atau puntung rokok yang dibuang sembarangan dapat menyulut api. 2) Bahaya listrik. Akibat penanganan listrik yang salah dapat menimbulkan panas dan kebakaran, seperti misalnya a).Stop kontak bertumpuktumpuk, b).Penggantian skring secara sembarangan atau tidak sesuai ukurannya, c).Sambungan kabel atau stop kontak yang tidak baik atau kendur, d).Pemakaian kabel yang ukurannya tidak sesuai bebannya, e).Hubungan pendek/korsleting, f ).Penggunaan arus listrik tidak sesuai ketentuan pada peralatannya. 3) Pemanasan berlebihan dan bahaya memasak. Penggunaan lampu untuk pemanasan dalam lemari pakaian dan memasak yang ditinggal-kan, dapat menyebabkan pemanasan yang berlebihan dan mengakibatkan kebakaran. 4) Bahan-bahan mudah terbakar. Penyimpanan bahan-bahan mudah terbakar secara sembarangan dapat menimbulkan bahaya kebakaran, misalnya menyimpan minyak tanah atau bensin dibawah kompor memasak. 5) Gas elpiji ( LPG). Kondisi yang jelek dari peralatan kompor yang menggunakan gas elpiji dapat membahayakan, dapat mengakibatkan kebakar-

an. 6) Alat penerangan. Penggunaan lampu munyak tanpa pelindung api, dapat membahayakam demikian pula penggunaan lampu lilin. 7). Tirai atau bahan bahan dekorasi penempatan atau pemasangan atau gorden jendela, dekat kompor dapat menimbulkan kebakaran apabila tertiup angin. Dalam penangggulangan kebakaran di rumah tangga, ada beberapa peralatan yang akan digunakan yaitu. 1).Peralatan tradisional yakni berupa karung, selimut, gorden atau bahan lainnya yang akan digunakan memadamkan api harus terlebih dahulu dibasahi dicelupkan kedalam air. Maksudnya adalah mencegah supaya tidak mudah terbakar, menutup pori-pori kain dan dapat menyerap panas api nya. Kain yang basah tersebut lalu ditutupkan dengan baik di atas bahan yang terbakar dengan oksigen di udara. Alat tradisional ini hanya dapat memadamkan api kecil atau awal kebakaran karena terbatasnya lebar kain dan mengandalkan kepada fisik orang yang memadamkan. Penggunaan media padat seperti pasir, tanah, lumpur adalah dengan cara menutup di atas bahan yang terbakar dengan rata, mempergunakan alat bantu berupa sekop atau sangkul. Dengan demikian cara ini juga terbatas efektifitasnya karena mengandalkan sepenuhnya kepada kemampuan fisik dari orang yang melakukannya. 2).Alat Pemadam Api Ringan (APAR). Alat ini dengan media busa, air dan gas (Co2 atau N2) bertekanan untuk menekan busa keluar. 3).Apar dengan media gas, kadang tabung media ini dilengkapi dengan indicator tekanan gas pada bagian luarnya khusus untuk tabung Co2 corong semprotmya berbentuk melebar untuk merubah Co2 yang keluar menjadi berbentuk kabut bila disemprotkan. 4). Alat Pemadam Api Beroda (Troley Fire Extinguisher). Alat pemadam ini sama dengan APAR, hanya ukurannya lebih besar dengan berat isinya anataea 25 sampai 150 kg menggunakan media serbuk kimia atau gas. Untuk memudahkan bergerak dilengkapi roda dan digunakan untuk memadamkan api yang lebih besar. Adapun korban kebakaran kebanyakan jatuh pingsan karena menghi-

rup gas Co2 selain telah menderita luka bakar pada anggota tubuhnya. Sehingga tidak mampu lagi berlari atau bergerak menghindarkan keganasan api. Dengan tebalnya kabut asap akibat pembakaran, kadar gas Co dan Co2 meningkat sehingga menyebabkan pusing yang sangat berat bahkan pingsan. Ini dapat menyebabkan kehilangan kesimbangan pada korban. Ketika korban yang terjebak dalam kobaran api menjadi tidak cerdas dalam bertindak sehingga cepat menyerah pada keadaan sekitarnya. Lebih parah lagi pada penderita asma cepat sekali terpengaruh jika keadaan ketersediaan oksigen segar menipis. Maka banyak para korban penderita asma yang jatuh meninggal akibat kabut asap yang menyiksanya. Mengingat hal tersebut diatas disarankan kepada masyarakat kiranya agar tidak selalu terjadi kerugian oleh keganasan si jago merah. Maka perlu dilakukan hal-hal sebagai berikut : a).Lebih intensifnya melakukan monitoring dan sosialisasi kepada setiap pemilik rumah untuk dapat memiliki alat pemadam kebakaran guna memadamkan api sedini mungkin. b)Adanya pengontrolan dari PLN yang dilakukan secara rutin terhadap instalasi listrik, sehingga dapat diketahui dan ditanggulangi sedini mungkin apabila dilihat kemungkinan adanya instalasi listrik yang akan berpotensi menimbulkan kerugian. c).Lebih diperankan aktifkan aparat pemerintah di wilayah tersebut (kepala lingkungan) untuk mengingatkan bahaya kebakaran kepada warga masyarakatnya. d).Diselenggarakan pelatihan kepada masyarakat dalam rangka pemberdayaan masyarakat berupa simulasi penanggulangan kebakaran dengan peralatan sederhana tetapi cukup efektif untuk mengantisipasi bilamana terjadi kebakaran sebelum tiba pasukan pemadam kebakaran. e).Dibuatkan edaran yang dapat diketahui oleh masyarakat di tempat kita berada tentang perangkat komunikasi dari unit pemadam kebakaran yaitu telefon darurat, alamat dll. Penulis adalah Kepala Dinas Kesehatan Provinsi Sumatera Utara

TB Paru-HIV, Duet Harmonis Menyulitkan Oleh Dr dr Umar Zein Angka prevalensiTB paru lebih 2 miliar,sedangkan infeksi HIV saat ini lebih 41 juta. Duet TB Paru-HIV lebih 15 juta kasus. Sampai 2002, jumlah kasus baru di dunia mencapai 8,7 juta, dan angka kematian hampir 2 juta.


enyakit Tuberkulosis Paru (TB paru) adalah penyakit lama yang sampai saat ini masih menjadi problema kesehatan masyarakat di dunia, termasuk Indonesia. Indonesia sendiri sebagai negara dengan urutan ke 3 tertinggi kasus TB paru setelah China dan India. Sampai tahun 1980, negaranegara maju seperti Amerika dan negaranegara Eropa, sudah merasa aman karena penyakit ini tidak lagi menjadi problem kesehatan masyarakat, seperti di negara-negara berkembang. Tapi sejak awal tahun 80-an, setelah ditemukannya penyakit AIDS/virus HIV; bersamaan dengan itu, muncul kuman tuberkulosa yang menyertai infeksi HIV yang memperburuk dan malah menyebabkan kematian penderita AIDS. Imunisasi BCG yang sudah sejak lama digunakan, ternyata tidak mutlak dapat mencegah penyakit klasik ini. Di samping itu, kuman Mikobakterium tuberkulosis ini, ternyata kebal terhadap beberapa macam Obat Anti Tuberkulosa (OAT) yang selama ini

ampuh untuk mengobati tuberkulosa. Fenomena ini dikenal dengan: Tuberkulosis yang Multiresisten terhadap Obat (Multi Drugs Resistance Tuberculosis = MDR-TB). Ancaman ganda Saat ini penduduk dunia berkisar 6 miliar. Angka prevalensi TB paru lebih dari 2 miliar, sedangkan infeksi HIV saat ini lebih dari 41 juta. Duet TB paru dengan HIV lebih dari 15 juta kasus. Sampai tahun 2002, jumlah kasus baru di dunia mencapai 8,7 juta, dengan kasus Multi Drugs Resistance TB 0,3 juta dan angka kematian hampir 2 juta. Data-data kasar di atas menunjukkan ancaman ganda gabungan infeksi virus HIV dengan infeksi bakteri mikobakterium tuberkulosa. Infeksi HIV dengan ancaman akhir AIDS yang mempunyai problem multi infeksi saja sudah sulit menanganinya secara tuntas, meskipun beberapa jenis anti retroviral sudah ditemukan dan memerlukan terapi kombinasi minimal 3 ma-

cam antiretroviral seperti Zidovudine/ Stavudine, Lamivudine, dan Nevirapine/Efavirens. Infeksi opportunistik pada penderita AIDS selalu mengakibatkan kematian. Pneumonia, diare kronik oleh parasit dan bakteri seperti kriptosporidiosis, mikrosporiosis, E.coli, dan giardia lamblia, infeksi jamur, infeksi kulit dengan sitomegalovirus ataupun penisilinosis dan aneka ragam jenis infeksi yang kelihatannya seperti tiada henti nya melanda penderita AIDS ini. TB Paru dengan AIDS Infeksi HIV akan membuat meningkatnya progresifitas TB aktif, dan memudahkan munculnya kembali kuman yang dorman (tidak aktif). Sehingga TB laten menjadi aktif kembali. Bahkan, bukan saja meningkatkan infeksi TB, tapi juga meningkatkan komplikasi TB Paru ke organ lain di luar paru, dan mempermudah meluasnya kerusakan jaringan paru dan infeksi sekunder pada jaringan paru seperti pneumonia pneumosistis karinii. Dengan demi-kian, duet yang erat antara TB paru dan HIV ini jelas akan meningkatkan angka kematian kasus, meskipun pengobatan yang optimal sudah diberikan. Apa yang terjadi pada “duet” ini? Pertama, jumlah CD4+ (sel yang berperan pada kekebalan tubuh) yang menghasilkan sitokin interferon g me-

nurun pada penderita AIDS. Sementara sitokin ini memunyai peranan penting sebagai mekanisme sistim imun tubuh untuk melawan infeksi tuberkulosis. Kedua, interferon g berfungsi untuk mengaktifkan makrofag (sel yang berfungsi menghancurkan kuman) untuk menghambat pertumbuhan mikobakterium intraseluler. Ketiga, infeksi HIV menyebabkan menurunnya kapasitas T sel (bagian dari sel darah putih) untuk memroduksi interferon g. Keempat, mikobakterium tuberkulosis akan memicu produksi proinflamasi sitokin seperti TNFa, yang akan membantu perkembangan retroviral intraseluler. Kelima, risiko kematian penderita AIDS dengan TB 2 kali lebih tinggi dibanding AIDS tanpa TB, karena penurunan jumlah sel CD4+ akibat kematian sel akan lebih cepat. Keenam, beberapa pakar meyakini bahwa TB dengan HIV sangat jarang memberikan hasil tuberkulin tes yang positip. Ketujuh, tes tuberkulin (+) pada 71% kasus TB yang terjadi lebih dari 2 tahun sebelum diagnosa AIDS ditegakkan dan kekerapan ini menurun menjadi 33% setelah didiagnosis sebagai AIDS. Hasil tes yang positip membantu memastikan diagnosa TB, tetapi tes yang negatif tidak menyingkirkan diagnosa TB. Penulis adalah Praktisi Kesehatan.


B10 Judi Lotre Resahkan Masyarakat LHOKSUKON (Waspada) : Permainan judi lotre berhadiah rokok, minuman ringan dan pakaian, marak di Pantonlabu, Kecamatan Tanah Jambo Aye, Aceh Utara dalam sepekan terakhir. Kondisi ini membuat masyarakat resah dan minta pihak berwenang segera menindak pelaku. “Selain tak ada izin, lotre ini juga bertentangan dengan syariat Islam dan berdampak buruk terhadap kehidupan sosial masyarakat, termasuk anak-anak,” kata Taufik, praktisi hukum asal Pantonlabu, Senin (17/10). Menurut Taufik, lotre yang dijual Rp500 per kupon itu beredar luas hingga ke kampong di Kecamatan Tanah Jambo Aye. Buntutnya, anak-anak yang masih duduk di kelas SD bisa dengan mudah membeli lotre ini hanya dengan modal sisa uang jajan. Kapolres Aceh Utara AKBP Farid BE melalui Kapolsek Tanah Jambo Aye Iptu Muktar mengaku belum mendapat informasi soal judi lotre itu. “Akan segera kita selidiki. Jika memang ada, semua pihak yang terlibat akan kita tindak,” kata Kapolsek. (b19)

Warga Lhokseumawe Belum Pahami Program E-KTP LHOKSEUMAWE (Waspada) : Banyak dari warga Aceh khususnya di Lhokseumawe yang masih awam mengenai program E-KTP, sehingga masih ada yang mengeluh. Hal ini disebabkan mereka masih asing dengan KTP sistem online dan memang mereka gagap teknologi. “Itu memang masalah di luar kesanggupan kita. Yang jelas, Dinas Capil sudah melakukan sosialisasi, sebelum pelaksanaan pembuatan E-KTP dimulai,” jelas Kadis Kependudukan dan Catatan Sipil Lhokseumawe Adnan, Senin (17/10). Menurutnya, pihak Capil juga sudah mengirimkan selebaran ke kantor camat yang diteruskan ke sejumlah desa. Sementara itu pelaksanaan E-KTP di empat kecamatan di Lhokseumawe sudah dimulai meski tidak semuanya dapat langsung online. Alat yang dikirimkan juga tidak mencukupi yaitu baru satu set. Seharusnya alat E-KTP, seperti server, alat foto, sidik jari, scan mata dan sebagainya tiap kecamatan mendapatkan dua set. (b14)

Jalan Penuh Lubang Ditanami Pohon Pisang LHOKSEUMAWE (Waspada) : Ruas jalan di Kecamatan Buloh Blang Ara di Desa Blang Weu Baroh dan Blang Weu Panjo selama ini membuat gerah warga setempat. Sejumlah badan jalan itu sudah lama ditanami pohon pisang dan pohon pisang itu sekarang sudah berkembang biak. Berdasarkan pantauan Waspada, sudah hampir dua tahun jalan itu dibirkan rusak, berlumpur, dipenuhi lubang dan sering digenangi air bila hujan turun, dan berbahaya bagi pengguna jalan, tetapi tidak jua ada perbaikan. “Kami bosan memandangnya dan tidak sanggup berbuat apaapa. Meskipun sudah minta perhatian agar jalan ini diperbaiki, tetapi belum ada tanggapan. Akhirnya kami tanam pohon pisang,” kata seorang warga setempat, Senin (17/10). Menurut warga, jalan kecamatan yang banyak dilalui kendaraan itu menyusahkan warga dan kerap membuat kendaraan mogok dan cepat rusak karena sering terpelosok ke dalam lubang. (b14)

Kelas RSBI SMAN 1 Lhokseumawe Butuh Sarana Pendukung LHOKSEUMAWE (Waspada) : 306 siswa SMA Negeri 1 Lhokseumawe menjadi siswa kelas Rintisan Sekolah Bertaraf Internasional (RSBI). Namun untuk mencapai standar itu, pihak sekolah masih kekurangan berbagai sarana pendukung. Kepala SMAN 1 Lhokseumawe Z Abidin Ali, Senin (17/10) menjelaskan, siswa kelas RSBI sebanyak 306 orang. “Mereka mengikuti pelajaran dengan bilingual (dua bahasa, yaitu Inggris dan Indonesia,” jelas Z Abidin yang akan mengikuti MoU e-leaning dengan Kementerian Pendidikan Nasional. Wakil kepala sekolah bidang kesiswaan, Effendi menambahkan, sejumlah siswa yang masuk kelas RSBI merupakan siswa kurang mampu. “Sehingga biaya yang dibutuhkan membangun sarana prasarana tidak mungkin dibebankan kepada siswa,” jelasnya. Komite sekolah hanya mampu menarik dana Rp1,5 juta dari tiap orang tua siswa. Pihak sekolah baru bisa melengkapi sarana air conditioner (AC). Saat ini para siswa membutuhkan fasilitas LCD proyektor, CCTV dan beberapa perangkat pendukung. Sementara kebutuhan lain masih bisa diupayakan melalui fasilitas dari kelas reguler. D iantaranya, kebutuhan laptop siswa masih memanfaatkan laboratorium IT yang lengkap dengan jaringan internet. Effendi menjelaskan, meskipun SMAN 1 terus mengejar status taraf internasional, namun pendidikan agama kepada siswa juga tidak ditinggalkan. (b15)

Dominan Masyarakat Belum Paham Asuransi Laka LHOKSEUMAWE (Waspada): Masyarakat dominan belum paham dengan peran Jasaraharja. Selain tidak paham, ada juga masyarakat yang tidak mau tahu dan tidak mau berurusan dengan birokrasi yang cukup panjang Mengatasi itu, Shuparman Rakhman, Kepala PT Jasaraharja Lhokseumawe, Senin (17/10) kepada Waspada menjelaskan, pihaknya telah berhasil membuat kerjasama dengan Mapolres Kota Lhokseumawe. Kerjasama ini dibuat untuk memudahkan korban Lakalantas untuk klaim santunan. Pasalnya, hingga saat ini, dominan masyarakat masih belum paham dengan peran dari PT Jasaraharja. Setiap kecelakaan lalulintas jalan di wilayah hukum Kota Lhokseumawe dan Aceh Utara, diinstruksikan kepada unit Lakalantas di dua Mapolres tersebut untuk segera membawa korban ke RS PT. Arun untuk diberikan pelayanan medis. Pihak RS bisa langsung mengklaim seluruh biaya yang dikeluarkan ke PT Jasaraharja. “Alhamdulillah, kita sudah berhasil menjalin hubungan kerjsama dengan Polres Aceh Utara dan Kota Lhokseumawe. Mengapa korban harus dibawa ke RS PT Arun, karena rumah sakit itu sangat merespon hal ini dan setelah dikaji, RS itu layak, baik dari alat medis maupun tenaga dokter,” kata Shuparman. Shuparman mengatakan, sebelum ke RS PT Arun, pihaknya lebih dulu menawarkan program ini ke RSUD Cut Mutia Aceh Utara, namun tawaran ini tidak mendapat respon. Padahal, program ini cukup penting untuk dilaksanakan, mengingat selama ini, masyarakat dominan belum paham dengan peran Jasaraharja. (b18)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


WASPADA Selasa 18 Oktober 2011

Kinerja Dinkes Aceh Utara

Ibarat Sigeumeubeu Hana Taloe LHOKSEUMAWE (Waspada): Pj Bupati Aceh Utara, Drs H M Alibasyah, MM menyesali kinerja Dinas Kesehatan, tidak ubahnya seperti ‘sigeumeubeu hana taloe’. Ia (Pj Bupati Aceh Utara), mengaku geram kepada Waspada, ketika melihat kinerja Dinkes daerah ini yang demikian seret dan amburadul terhadap tugas pokok dan fungsinya (Tupoksinya), menyangkut pelayanan kesehatan masyarakat. “Hal ini saya rekam selama dua hari, Sabtu-15 dan Minggu16/10) melakukan kunjungan kerja ke Kec Tanah Jambo Aye, Langkahan dan Kec Baktiya,” ujarnya. Apa yang diungkapkan H Alibasyah (Pj Bupati Aceh Utara), sangat bersinonim dengan pepatah, ‘ada sampan pengayuh tidak’. Benar itu, kata dia. “Keubeu ka ek tabloe, tapi taloe han ek.” Arti harfiahnya, kita mampu membeli kerbau, tapi talinya tidak, dengan maksud yang tersirat, ‘sigeumeubeu hana taloe’, artinya sipengembala tanpa tali untuk mengendalikan ternaknya. H Alibasyah mengemukakan suatu indikasi, gedung pustu (persiapan) Puskesmas Lhok Beuringen, Kemukiman Jambo Aye Tengah, Kec Tanah Jambo Aye (Pantonlabu), salah satu contoh konkrit.“Sudah satu tahun lebihbangunan yang menelan biaya sebesar Rp 1,2 M itu rampung dibangun, namun sampai sekarang belum difungsikan, artinya belum diisi tenaga dokter dan paramedis di Puskesmas ini,” jelasnya. Pada kesempatan kunjungan kerja (kunker) Pj Bupati Aceh Utara, Sabtu (15/10), ia melihat, satu ruanganpun belum ada mobile, apalagi petu-

gas. “Hal ini sudah berulangkali kami lapor ke Dinkes Aceh Utara, baik melaui telepon selular, termasuk SMS, namun tidak digubris,” kata tokoh masyarakat setempat, MYusuf Budiman kepada Pj Bupati Aceh Utara. Tidak hanya itu, Minggu (16/10), dalam rangkaian kunkernya di Kec Langkahan, Pj Bupati Aceh Utara, menemui kembali ‘contoh barang’ kinerja Dinkes ini, yaitu satu gedung Puskesmas yang sudah lengkap dengan segala fasilitasnya, tapi sudah terbengkalai selama dua tahun terakhir. Dari sisi penghijauan, komplek Puskesmas ini sudah sangat memadai, karena rumput di halamannya sudah tumbuh subur, walau tidak ditanami dan disiram. Namun, rumah dinas dokter dan berbagai gedung (fasilitas) lain, Pj Bupati Aceh Utara, mengakui terkesan kumuh seperti gudang mesiu peninggalan zaman perang. Menurut H Alibasyah, di Kec Langkahan (perbatasan Aceh Utara-Aceh Timur) ini, mempunyai dua unit gedung Puskesmas, masing-masing di gampong (Desa) Simpang Lhei dan Desa Langkahan. Satu di antaranya berfungsi dengan baik, yaitu mempunyai tiga tenaga dokter umum dan sekitar 60 personil paramedis termasuk tenaga bides. “Kenapa tidak tenaga petugas kesehatan ini dibagi dua, demikian pula jatah obat-obatan dengan Puskesmas di Desa Simpang Lhei yang terpaut sekitar 15 kilometer itu. Karena itu saya telah mengintruksikan, Puskesmas Simpang Lhei ini, harus difungsikan dalam beberapa hari ini,” tegas H Alibasyah. Diapresiasi Ketegasan Pj Bupati Aceh Utara ini, mendapat apresiasi dari 11 desa masyarakat wilayah pelayanan Puskesmas Desa Simpang Lhei. “Terima kasih pak Bupati, sudah dua tahun

Puskesmas ini dalam keadaan tidak berfungsi. Sekarang kami minta secepatnya diisi petugas, demikian pula obat-obatan. Paling tidak, harus ada obatobat merah untuk pembalut luka,” kata Geuchik Gampong /Kepala Desa (Kades) Pante Gaki Balee, Hamdani mewakili masyarakat yang disambut geeer masyarakat yang hadir menyambut kunker Pj Bupati Aceh Utara, Minggu (16/10). Mantan Kaban Pemberdayaan Masyarakat (BPM) Provinsi Aceh ini, mengaku melihat ketidak beresan terhadap pelayanan kesehatan masyarakat pada beberapa titik, termasuk di Kemukiman Jambo Aye Utara, dengan masalah pembangunan gedung Pustu (Puskesmas pembantu) yang design kontruksinya asal-asalan. Aktivitas Pustu Desa Ulei Gle, Kemukiman Jambo Aye Barat, kurang berfungsi, sesuai laporan pimpinan Balai Pengajian (BP) Raudhatul Muta’allimin, Tgk Muhammad Amin Cut Malem dan lain-lain yang literaturnya terlalu panjang untuk disebut. “Saya mendapat informasi juga, beban kepala Dinkes di sini M Nurdin, SKM sudah terlalu berat untuk dipikulnya, kabarnya disamping kepala Dinkes, ia juga sebagai Direktur Akes. Sekarang saya sedang evaluasi, dari dua jabatan tersebut mana yang harus ditinggalkan,” lanjutnya. M Nurdin, SKM, kepala Dinkes/Direktur Akes Aceh Utara yang diminta konfirmasi melalui telepon selular, Senin (17/10), tidak mengangkat telefonnya, walau nada sambung aktif. Namun, Kabag Humas Pemerintah Kabupaten, Azhari Hasan, SH alias Ayi menjelaskan. “Benar, M Nurdin sekarang berstatus dua jabatan yang dipikulnya sekaligus. Dia sekarang tak dapat mengangkat telefon, karena sedang rapat kordinasi dengan pak Bupati di Operation Room,” sebut Ayi. (b13)

Pj Bupati Aceh Utara Hapus Tanggal Merah LHOKSUKON, (Waspada): Pj Bupati Aceh Utara, Drs HM Alibasyah, MM, menyatakan komitmennya akan ‘menghapus tanggal merah’ di kalender kerja. “Sementara ini saya ‘hapus tanggal merah’, karena masa kerja yang tersisa 4,5 bulan ini akan saya manfaatkan demi peningkatan pembangunan Aceh Utara, 5 tahun ke depan,” ujar H Alibasyah kepada Waspada, pada saat kunjungan kerja (kunker) ke Kec Baktiya, Aceh Utara, Minggu (16/10).

Pada kunker ini ia didampingi Camat Baktiya, H Fakhrurrazi, SH dan para Kadis, Kaban dan kantor di jajaran Setdakab Aceh Utara. Selama beberapa jam, memanfaatkan hari libur (Minggu) untuk meninjau beberapa titik pembangunan yang mendesak, antara lain saluran air di Minje Peut dan satu unit jembatan plat beton tanpa ruas jalan. Kepada camat, Pj Bupati juga mengharapkan untuk menyelesaikan tapal batas antara dua desa (gampong) di

sini yang masih bersengketa. “Jika persoalan ini tidak bisa tuntas di tingkat Muspika, saya harapkan untuk dibawa datadatanya ke tingkat kabupaten, guna dituntaskan oleh unsur Muspida,” pinta Pj Bupati Aceh Utara. Khususnya kepada camat dan umumnya kepada 27 camat di Aceh Utara, H Alibasyah meminta dalam waktu dekat ini menyerahkan data base di kecamatannya masing-masing, untuk dipelajari titik-titik pembangunan yang mendesak. (b13)

Penarik Becak Berkaki Buntung Ingin Dibantu Pemerintah Aceh TIDAK banyak yang dapat dia kerjakan, kaki kanannya telah diamputasi menyusul kecelakaan yang terjadi belasan tahun silam. Saat itu warga Gampong Raya Dagang, Kecamatan Peusangan, Bireuen ini bekerja sebagai kondektur truk dengan rute MedanAceh. Dia sadar, bahwa segala sesuatu itu terjadi atas izin Allah SWT. Kendati getir untuk dicerna, namun Alamsyah,50, tegar menerima cobaan ini walaupun beban keluarga yang harus dia pikul kian hari semakin meningkat untuk membiayai tiga anak dan isterinya. Kepada Waspada, Minggu (16/10), Bang Syah, sapaan akrabnya, menceritakan awal kejadian yang menyebabkan dia harus kehilangan kaki kanannya. “Pada tahun 1990 saya bekerja pada truk, malam itu kami membawa pinang ke Medan. Namun saat tiba di kawasan Aceh Timur truk kami bertabrakan. Saya tidak ingat bagaimana kejadian tabrakan itu terjadi sebenarnya, yang jelas kaki kanan saya terjepit dinding truck yang rinsek, kemudian saya dioperasi kaki di rumah sakit di Medan,” cerita Bang Syah. Usai amputasi, Bang Syah yang sudah buntung hanya mampu menghitung hari di rumahnya. Saat itu, dia bertahan hidup dari tabungannya yang tersisa serta bantuan keluarga dan toke truk. “ Dengan kondisi ini pikiran saya galau, saya bingung apa yang yang dapat saya kerjakan untuk menopang hidup,” keluh dia. Di saat kegaulauan yang


ALAMSYAH, tukang becak buntung yang mengharapkan bantuan Pemerintah Aceh diabadikan Waspada, Minggu (16/10) di Desa Gampong Raya Dagang Kecamatan Peusangan, Bireuen. menggelayut benaknya, Alamasyah memilih berjualan mi di desanya. Namun, usaha yang ditekuni ini ternyata hasilnya tidak mencukupi kebutuhan keluarga. “Kemudian menganggur lagi, lalu saya mencoba jadi tukang becak,” paparnya. Dengan dana yang sangat terbatas, Bang Syah sanggup membeli satu sepeda motor Honda Astrea Prima keluaran tahun 1990. Mengingat kondisi kendaraan sudah digerus usia, hingga biaya perawatannya pun tidak lagi terjangkau dengan hasil yang Bang Syah peroleh. “Saya tidak mampu lagi memperbaikinya, kemudian saya tukar lagi dengan Honda Astrea 800. Ya sebenarnya kita inginkan sepedamotor yang

lebih bagus lagi. Namun karena tidak ada uang akhirnya saya beli apa mampu saya beli,” ucapnya. Namun, becak penumpang bermesin yang dimilikinya kini juga mengalami nasib yang saya dengan becak sebelumnya. “Orang juga malas naiknya, ya kita maklum juga karena mereka juga takut mogok,” paparnya. Sementara untuk membeli becak yang baru tentunya diluar kemampuan Bang Syah. “Saya sangat menginginkan Pemerintah Aceh memberi becak bantuan. Ada kawan-kawan yang seprofesi dengan saya mendapatkan bantuan becak dari pemerintah. Ini sangat saya inginkan,” harap Bang Syah. Amiruddin

Waspada/ M Jakfar Achmad

PJ BUPATI Aceh Utara, Drs H M Alibasyah, MM (kanan), meminta keterangan kepala Puskesmas Kec Langkahan, Muchtar M, SKM, MSi (kiri) terhadap seretnya pelayanan kesehatan masyarakat, pada kunker pimpinan kabupaten ini, Minggu (16/10).

Buntut Kasus Amdal RSUCM Aceh Utara

Sekdakab Panggil Kepala Bappeda Dan Dinas Kesehatan LHOKSEUMAWE ( Waspada): Untuk mengetahui kebenaran kasus Amdal RSU Cut Mutia diduga tumpang tindih tahun 2004 dan 2011, Senin (17/10), Sekdakab Aceh Utara Syahbuddin Usman akan memanggil Kepala Bappeda Zulkifli dan Kadis Kesehatan M. Nurdin ke kantor bupati setempat. “Saya akan cros cek dulu kebenarannya tentang Amdal 2004 dan 2011, kadang bukan tumpang tindih. Nanti saya akan panggil Dinas Kesehatan dan Bappeda untuk dipertanyakan,” tegas Sekda. Salah satu alasan melakukan cross chek mengingat proses penyusunan dokumen Amdal RSU Cut Mutia merupakan kinerja orang yang lama, kecuali Amdal baru 2011 yang ditangani oleh pihak Dinas Kesehatan Aceh Utara. Hingga saat ini, pihak Bappeda belum juga menemukan dokumen Amdal RSU Cut Mutia tahun 2004 dan masih terus melakukan pencarian dengan membuka ulang data lama. Pengamat Lingkungan Hidup Nurkhalis mengaku dirinya memiliki duplikat dokumen Amdal RSU Cut Mutia 2004 dan 2011. Nurkhalis selaku seorang Amdalis yang juga sebagai Komisi Penilai Amdal Aceh Utara menyatakan bila kasus kerugian negara akan diusut sampai tuntas, maka dirinya siap membantu memberi bukti bila diperlukan. “Saya tidak menuding siapa yang melakukan kesalahan. Tapi justru saya tidak setuju bila negara dirugikan hanya untuk keuntungan pribadi oknum tertentu,’’ katanya. Menyangkut desakan untuk menghentikan proses pencairan dana Amdal 2011, Kepala Dinas Pendapatan dan Pengelola Keuangan dan Aset Daerah (DPPKAD) Kabupaten Aceh Utara Iskandar Nasri belum mengambil sikap respon.

Iskandar menjelaskan pihaknya tidak punya kewenangan untuk menghentikan pencairan dana yang sedang dalam proses, kecuali tidak melengkapi syarat atau tidak lengkapnya berkas dokumen pengajuan. Iskandar menyebutkan, meski terkait informasi kasus dugaan korupsi namun tidak bisa mempengaruhi atau menghentikan proses pencairan dana yang sedang dilakukan. Sementara itu, Badan Koordinator Masyarakat Transparansi Aceh (MaTA) Aceh Utara – Lhokseumawe Alfian menyayangkan sikap pejabat Pemkab Aceh Utara yang terkesan buang badan. Seharusnya Sekdakab Aceh Utara Syahbuddin Usman dan Kepala DPPKAD Aceh Utara Iskandar Nasri mengambil sikap menghentikan proses pencairan dana Amdal RSU Cut Mutia 2011. Langkah itu adalah tindakan menyelamatkan uang negara atau sebagai upaya mencegah terjadinya korupsi yang akan dilakukan oknum tertentu. Alfian menilai bila proses pencairan dana Amdal 2011 yang kini diduga tumpang tindih dengan 2004 tidak dihentikan atau tetap dilanjutkan, maka ini terkesan seperti adanya kerjasama antara atasan dan bawahan. “ Sekarang semua sudah tahu Amdal RSU tumpang tindih berarti sedang ada masalah. Jadi kalau mereka tidak menghentikan proses pencairan dana Amdal 2011, maka ini bisa memperlihatkan kesan adanya kerjasama memuluskan rencana korupsi,” tanfdas Alfian. Sementara Kadis Kesehatan Aceh Utara M. Nurdin gagal dikonfirmasi meski sudah berulang kali dihubungi via telepon selularnya, namun tidak menerima respon sambungan komunikasi. (b16)

Pembangunan Ruang Rawat RSUD Dr Fauziah Diperluas 60 Tempat Tidur BIREUEN ( Waspada) : pelayanan kesehatan bagi pasien Mengatasi kekurangan fasilitas rawat inap maupun pasien rawat ruang rawat inap RSUD Dr Faujalan tidak hanya bagi masyarakat ziah Bireuen mulai membaKabupaten Bireuen akan tetapi ngun lagi penambahan satu juga memberikan pelayanan keseunit gedung baru berlantai dua hatan bagi masyarakat Kabupaten dilokasi lahan tambahan seluas tetangga. 3.000 meter. Jika sewaktu-waktu pasien Pembangunan gedung rawat inap membludak diluar kabaru tahap pertama dapat mepasitas tempat tidur RSUD tidak nampung 60 tempat tidur memenolak pasien akan tetap menelan dana Rp 4,6 miliar lebih nampung memberikan pelayabersumber dari anggaran dana nan kesehatan kendati ditempatAPBA 2011 dan setelah pemkan di lorong-lorong UGD dan bangunannya selesai, RSUD Dr ruang rawat inap lainnya. Fauziah sebelumnya memiliki DR YURIZAL Menurut drYurizal, tahun 2012 Direktur RSUD Dr 210 tempat tidur akan bertamakan membangun lagi 3 unit geFauziah Bireuen dung aru termasuk satu unit gebah menjadi 270 tempat tidur. Direktur RSUD Dr Fauziah dung cuci darah diatas lahan tukar Bireuen drYurizal menjelaskan hal itu menjawab guling seluas 1,7 hektare akan menelan dana Waspada di ruang kerjanya Senin (17/10). Rp 14 miliar lebih bersumber dari dana Otsus Dikatakan kekurangan fasilitas ruang rawat inap dan DAK Kabupaten. yang dialami RSUD Dr Fzuziah Bireuen lantaran Berkenaan dengan tenaga medis dan paraRSUD Dt Fauziah Bireuen yang diapit oleh tiga medis seanyak 625 orang terdiri dari 17 dokter Kabupaten tetangga, Pidie Jaya, Bener Meriah spesalis, 20 dokter umum, 4 dokter gigi dan 584 dan Aceh Utara. paramedis sudah memadai untuk memberikan Setiap hari RSUD Bireuen memberikan pelayanan kesehatan bagi warga, ujarnya. (b12)

Mantan Kepala SKB Gunakan Rp205 Juta Untuk Bayar Utang LHOKSEUMAWE (Waspada): Nurdin M Ali, mantan Kepala Sanggar Kegiatan Belajar (SKB) Lhokseumawe telah menggunakan dana penunjang kegiatan SKB senilai Rp205 juta untuk bayar utang Hal itu terungkap dalam pemeriksaan lanjutan penyidik Kejaksanaan Negeri Lhokseumawe, Senin (17/10) terhadap mantan Bendahara SKB Lhokseumawe Sukardi yang juga telah ditetapkan sebagai tersangka. Karena itu, Nurdin M. Ali ditetapkan menjadi tersangka dalam kasus dugaan penyimpangan dana untuk lima kegiatan SKB yang total dananya mencapai Rp500 juta dengan rincian Rp339 juta berasal dari dana APBN yang disalurkan melalui Balai pengembangan Pendidikan Non Formal (BPPNFI) Regional I Medan dan sisanya berasal dari APBA. “Ini pemeriksaan ke dua kali yang kita lakukan terhadap Sukardi,” kata Pelaksana Tugas (Plt) Saifuddin, SH.MH melalui Kasi Pidsus Syahril, SH. Kasi Pidsus mengatakan, Sukardi menyebutkan jumlah dana yang dikirim ke rekening mantan kepala dan juga kepada H Ibrahim Direktur Tanjung Tabina mencapai Rp551,9 juta lebih. Dana diambil dari rekening SKB bersama man-

tan kepala SKB. Dirincikan pertama kali Sukardi mentransfer dana SKB itu 16 Juni 2010 dengan jumlah Rp 20 juta, kemudian 22 Juli Rp 150 juta, 23 Juli Rp 49 juta, 20 Agustus Rp 51 juta, dan 23 Agustus Rp 23 juta. Pada 23 September lanjut Syahril dana yang ditransfer mencapai Rp 53,5 juta, lalu 20 Oktober Rp 15 juta. “Sedangkan dana Rp 205 juta yang ditransfer ke rekening Direktur Tanjong Tabina H Ibrahim sebanyak empat kali, 8 November Rp 75 juta, 3 November 15 juta, 10 November Rp 20 juta, dan 29 November Rp 80 juta,” kata Syahril. Sebelumnya, saksi H Ibrahim juga mengakui telah menerima dana sebagai dana bayar utang. Syaril juga mengatakan sudah menyurati mantan kepala SKB untuk diperiksa, namun tak bisa hadir dengan alasan sakit. “Kalau memang tidak memungkinkan untuk diperiksa, maka dalam waktu dekat kita akan proses satu berkas dulu,” sebutnya. Pada kesempatan itu, Zulfira, SH, pengacara Sukardi mengatakan, kliennya mentrasnfer dana atas perintah mantan kepala SKB. “Sukardi hanya menjalankan perintah saja,” kata Zulfira. (b18)


WASPADA Selasa 18 Oktober 2011

Kepsek MIN Cot Glumpang Dimutasi, Siswa Menangis

Muzakkir Manaf Silaturahmi Dengan Sakti SUBULUSSALAM (Waspada) : Muzakkir Manaf, Ketua Partai Aceh bersilaturahmi dengan orang nomor satu di Subulussalam. Silaturahmi itu tak lebih dari satu jam itu dilakukan di ruang kerja Wali Kota Subulussalam, Merah Sakti, Senin (17/10). Tak diketahui pasti topik pembicaraan mereka, kecuali sekadar silaturahmi. “Sekadar silaturahmi,” jelas Hasby BM, Korwil PA Wilayah 7 (Singkil, Subulussalam, Gayo Lues dan Aceh Tenggara) di KantorWali Kota Subulussalam, di sela-sela kunjungan Muzakkir Manaf bersama dr Zaini Abdullah, sesepuh PA. Menurut Hasby, agenda penting calon gubernur dan calon wakil gubernur Aceh dari PA (Muzakkir-Zaini) ini ke Subulussalam dan Aceh Singkil untuk konsolidasi dan kaderisasi dengan segenap pengurus/anggota PA. Menyampaikan pesan Mualim Muzakkir Manaf, Hasby menyebutkan, perlunya sikap saling menghormati dalam praktik politik di daerah ini. Lalu, ikuti aturan dan peraturan yang berlaku.PA sebagai bagian daripada organisasi politik di Aceh, menurut Hasby, berorientasi kepada pembangunan untuk mensejahterakan rakyat. Karenanya PA berharap, tidak terjadi diskriminasi dalam kompetisi perpolitikan di Subulussalam khususnya dan umumnya di Aceh. (b28)

56 Peserta Ikuti Seleksi Calon Panwascam Bener Meriah REDELONG (Waspada) : Seleksi calon anggota panitia pengawas pemilu kecamatan (Panwascam) yang dilakukan tim seleksi Panwas Kabupaten Bener Meriah menjaring 56 peserta yang dinyatakan lulus kelengkapan administrasi dan layak mengikuti ujian tulis. Hingga berakhirnya jadwal penerimaan, peserta yang mendaftar sebanyak 68 orang, namun 12 orang tidak lulus karena tidak cukup persyaratan. “Rata-rata yang tidak lulus karena faktor usia. Dalam aturan, untuk calon anggota Panwascam minimal usia harus 30 tahun ke atas. Sedangkan yang tidak lulus ini sebagian besar belum mencapai usia tersebut,” kata Ketua Panwas Bener Meriah Tgk Al Hukama didampingi Ketua Tim Seleksi Penerimaan Panwascam Rizal Fahlevi, Senin (17/10). Terkait batas umur, penerimaan anggota Panwascam ini merupakan syarat mutlak bagi peserta. “Bagi peserta yang lulus seleksi administrasi, akan mengikuti ujian tulis yang dilaksanakan di SDN Kute Kering, Kecamatan Bukit,” papar Rizal Fahlevi. Ketua Panwaskab Bener Meriah Tgk Al Hukama berharap nantinya siapapun yang lulus pada semua Panwas di seluruh tingkatan mampu melakukan pengawasan sesuai dengan undangundang berlaku. (b33)

“Kawal” Uji Baca Alquran Bagi Cabup Simeulue MEDAN (Waspada): Terkait akan diadakannya uji baca Alquran bagi kandidat bupati dan wakil Bupati Simeulue pada hari ini, Selasa (18/10) hingga Rabu (19/10) oleh KIP setempat. Pendiri Forum Peduli Pembangunan Simeulue (FPPS) Kota Medan Mualim MA meminta kepada semua pihak agar mengawal uji kelayakan ini dengan serius. Sehingga, kata Mualim yang juga Sekretaris Himpunan Masyarakat Simeulue (HIMAS) Kota Medan ini isu yang menyatakan ada oknum kandidat yang tak bisa membaca Alquran dapat terdeteksi. “Betul atau tidak,” jelas dia. Dengan adanya penyaksian langsung sehingga kelak masyarakat dan juga organisasi politik dan organisasi sosial (LSM) lainnya tidak melakukan protes. Menurutnya pengawal perlu dilakukan menghindari kecurigaan, apalagi Panwaslu Kabupaten Simeulue belum di SK kan. Sebelumnya anggota KIP Simeulue, Mohd Insyah mengatakan untuk uji baca Alquran dilakukan dengan cara pencabutan udian bagi para kandidat. (cb08)

Tes Baca Quran Balon Bupati Aceh Utara Di Masjid Lhoksukon LHOKSUKON (Waspada): Komisi Independen Pemilihan (KIP) Aceh Utara, memastikan tes baca Quran untuk Balon Bupati dan Wakil Bupati kabupaten itu dilaksanakan di Masjid Agung, Lhoksukon. Namun jadwalnya belum jelas. “Kita masih menunggu seluruh balon selesai mengikuti uji kesehatan di Banda Aceh. Yang jelas, tes itu akan dinilai oleh tim dari Majelis Permusyawaratan Ulama (MPU) dan Lembaga Pengembangan Tilawatil Quran (LPTQ) Aceh Utara,”kata Ketua Pokja Pencalonan KIP Aceh Utara, Ayi Jufridar, kemarin. Menurut Ayi, MPU dan LPTQ sengaja dilibatkan agar tes baca Quran untuk para balon bupati dan wakil bupati, berlangsung fair dan profesional. “Tes ini akan diikuti 15 pasangan, satu pasangan dari gabungan parpol dan 14 pasangan dari jalur independen,” tandasnya. (b19)

Pilkada Aceh Makin Dekat, Panwaslu Belum Terbentuk BIREUEN (Waspada) : Meski Pilkada Aceh masih dua bulan lagi, namun keberadaan Panitia Pengawas Pilkada di Kabupaten Bireuen belum terbentuk. Wakil Ketua DPRK Bireuen Syafruddin, Senin (17/10) mengatakan, untuk pembentukan panitia pengawas ini pihaknya belum mengambil sikap. “Pembentukan Panwaslu di Bireuen kami pelajari dulu,” ucapnya. Informasi lain yang diperoleh menyebutkan, Panwaslu Provinsi Aceh telah mengirimkan surat kepada DPRK Bireuen yang berkaitan dengan Pembentukan Panwaslu di kabupaten penghasil keripik tersebut. Disebut-sebut, jika DPRK tidak menindaklanjuti surat Panwaslu Provinsi Aceh, maka perekrutan Panwaslu Bireuen akan diambilalih oleh Panwaslu Provinsi Aceh atau Bawaslu. Syafruddin menjelaskan, sampai kemarin dia belum menerima surat dari Panwaslu Aceh tersebut. (b17)

Pilkada Aceh Tak Diikuti Kandidat Perempuan LHOKSEUMAWE (Waspada) : Sejauh ini belum tampak pencalonan dari kaum perempuan untuk berpartisipasi dalam Pilkada Aceh. Para calon umumnya didominasi kaum laki-laki. “Padahal ada tokoh perempuan yang layak muncul sebagai calon kepala daerah di Aceh ini. Ini disebabkan percaturan politik saat ini masih kaku, dan berpegang kepada konsep budaya yang masih bias,” ucap aktivis sosial dan pendidikan, Syarifah Rahmah, Senin (17/10). Selain itu pergerakan demokrasi masih labil dan tidak pasti. Bahkan ada yang menganggap perwakilan perempuan tidak penting. Kesannya, politik masih identik dengan laki-laki. Selain itu, tidak adanya peran partai politik memberikan pendidikan politik secara lebih luas. Menurutnya, kaum perempuan harus mendapatkan pendidikan politik yang selama ini hanya berorientasi pada lakilaki. “Perlu ditegaskan keterlibatan perempuan jangan hanya pelengkap. Pentingnya pendidikan harus diutamakan sebagai bentuk pengkaderan,” kata Dosen Sekolah Tinggi Agama Islam Negeri (STAIN) Lhokseumawe ini. Dikatakan, keterlibatan kaum perempuan dalam legislatif sudah terlihat, meski tidak begitu menonjol. Keberadaan mereka masih sangat minor, amat tidak sebanding dengan jumlah kaum lelaki. (b14)


Waspada/Muhammad Riza

SEORANG guru MIN Cot Glumpang, Pidie sedang berusaha menenangkan para siswa yang menangis karena tidak rela kepala sekolahnya dimutasi, Senin (17/10).

Mantan Kadis Sosial Abdya Ditahan BLANGPIDIE (Waspada) : Kejaksaan Negeri (Kejari) Blangpidie, Senin (17/10) menahan para tersangka kasus korupsi di Aceh Barat Daya. Empat tersangka dugaan kasus korupsi dalam proyek pembangunan Gudang Sosial Abdya ditahan Kejari Blangpidie dan langsung digiring ke mobil tahanan untuk selanjutnya dititipkan ke rumah tahanan di Tapaktuan. Keempat tersangka yang ditahan yakni Hanafiah (mantan Kadis Sosial dan Tenaga Kerja Abdya), Ikhsan A Majid (PPTK), Rizal Hariadi (Kontraktor Pelaksana) dan Said Arfan (Konsultan Pelaksana). Para tersangka diduga melakukan tin-

dakan melawan hukum dengan modus melakukan pembangunan fiktif proyek gudang sosial Abdya. “Akibat perbuatan para tersangka, negara dirugikan ratusan juta rupiah,” ujar Kajari Blangpidie Umar Z, Senin (17/ 10). Kasi Pidsus Kejari Blangpidie Adenan Sitepu menyebutkan, modus yang dilakukan para tersangka berupa pencairan dana proyek dengan memberikan pelaporan tak sesuai kondisi di lapangan. Padahal proyek tersebut tidak terlaksana seratus persen. “Tersangka dijerat dengan UU korupsi,” tutur Adenan Sitepu. DPRK Abdya Apresiasi Di kantor Kejari Blangpidie, Senin (17/10), para tersangka sudah berada di ruang pemeriksa mulai pukul 11:30, kecuali Said Arfan (Konsultan Pelaksana) yang dijemput paksa de-

ngan bantuan petugas SatReskrim Polres Abdya. Tersangka lain seperti Hanafiah, Ikhsan A Majid dan Rizal Hariadi mendatangi sendiri kantor Kejari Blangpidie. Hanafiah AK sesaat sebelum digiring ke mobil tahanan sempat berkomentar dirinya mengaku pasrah apa yang dialaminya sebagai risiko jabatan. “Saya pasrah dan ikhlas jika memang seperti ini akhirnya, saya tidak ingin memfitnah siapapun,” tutur Hanafiah. Anggota DPRK Abdya Muhammad Nasir menyampaikan apresiasinya terkait ‘action’ yang dilakukan Kejari Blangpidie dalam penindakan kasus korupsi di Abdya. Dirinya menaruh harapan besar dengan kinerja positif yang terus diperlihatkan selama kurun waktu sebulan terakhir oleh pihak kejaksaan. (cb05)

Hutan Rawa Tripa Kritis Digerus Pembukaan Lahan BANDAACEH (Waspada) : Kawasan Rawa Tripa yang merupakan hutan rawa yang berada di pantai barat Pulau Sumatera dengan luas 61.803 hektare, saat ini kondisinya semakin kritis akibat pembukaan lahan perkebunan kelapa sawit. Secara administratif, 60 persen luas Rawa Tripa berada di Kecamatan Darul Makmur, Nagan Raya. Sisanya berada di wilayah Babahrot, Aceh Barat Daya. Wilayah tersebut berada dalam Kawasan Ekosistem Leuser (KEL), yang ditetapkan sebagai kawasan strategis nasional untuk pelestarian lingkungan hidup.

Hutan rawa gambut Tripa juga kaya dengan berbagai jenis ikan dan hasil hutan non kayu yang secara tradisional dimanfaatkan masyarakat setempat sebagai sumber ekonomi keluarga. “Namun Rawa Tripa saat ini mengalami kerusakan yang parah. Menurut perkiraan, luas hutan di Rawa Tripa hanya tersisa 50 persen dari luas total 61.000 hektare,” kata Direktur EksekutifWalhi Aceh T Muhammad Zulfikar usai melakukan aksi di bundaran Simpang Lima Banda Aceh, Senin (17/10). Zulfikar menyebutkan, saat ini 36.185 hektare luas Rawa

Tripa sudah menjadi wilayah konsesi bagi empat perusahaan kelapa sawit besar yang beroperasi di Rawa Tripa yaitu PT Astra Agro Lestari (13.177 ha), PT Kalista Alam (6.888 ha), PT Gelora Sawita Makmur (8.604 ha) dan PT Cemerlang Abadi (7.516 ha). Akibatnya kerusakan lingkungan terus terjadi. Kerusakan hutan ini akan menimbulkan bencana banjir dan longsor, intensitas banjir juga mengalami kenaikan dari tahun 2005, yaitu dari 30 kejadian menjadi 39 kejadian pada 2006, atau rata-rata tiap bulan terjadi 3-4 kali banjir dan longsor. (cb01)

In Memoriam Makmursyah Putra ENAM bulan menjelang berakhirnya masa kepemimpinannya, Bupati Aceh Singkil H Makmursyah Putra dipanggil menghadap Sang Pencipta, Sabtu (15/10) siang dalam usia 55 tahun. Almarhum yang lahir di Lae Kombih Penanggalan, 12 Oktober 1956 silam, pada periode kedua kepemimpinannya bersama Wakilnya H Khazali Bahar dijadwalkan berakhir Maret 2012 mendatang. Kendali kepemimpinan Aceh Singkil kini menjadi tanggung jawab Khazali. Selain sebagai bupati, almarhum juga merupakan Ketua DPD Partai Golkar setempat untuk periode kedua kalinya 2010-2015 yang dipilih secara aklamasi. Dalam perjalanan kepemimpinan periode pertama almarhum sebagai bupati pada 2000-2005 bersama wakilnya Muadz Vohry, merintis pembangunan di Aceh Singkil yang dimekarkan menjadi kabupaten pada 27 April 1999 dari perwakilan bupati wilayah Singkil, Kabupaten Aceh Selatan, yang kala itu dipercayakan kepada Makmur sebagai pejabat bupati perdana. Selain kasus bobolnya kas daerah sebesar Rp4 miliar tahun 2001, karena digunakan bermain valuta asing (Valas) oknum pemegang Kasda Dedy Bancin dan komplotannya saat itu meski tidak terlibat, namun kasus tersebut merupakan guncangan kuat kepemimpinan almarhum pertamanya sebagai bupati.


Di akhir periode pertamanya tahun 2005, muncul kasus cas bon atau dana kas yang dipinjamkan kepada pihak ketiga yang ditangani Kejaksaan Tinggi Aceh dan menjadikan Bupati Makmur, Wakilnya Muadz Vohry dan sejumlah pejabat terkait menjadi terdakwa perkara tindak pidana korupsi cas bon berkisar Rp3,7 miliar. Dalam persidangan putusan para terdakwa dibebaskan majelis hakim. Berbeda dengan perjalanan kepemimpinan periode kedua, Bupati Makmur dan Wabup Khazali 2007-2012 yang terpilih melalui Pemilukada Desember 2006 silam. Sejumlah catatan kepemimpinannya saat itu, seperti 2007, lima kecamatan dimekarkan menjadi Pemko Subulussalam dari wilayah Aceh Singkil. Sekira lebih dua tahun memimpin, Makmur didera penyakit jantung hingga menjalani operasi di Malaysia, sejak saat itu kondisi fisiknya sering terkendala dalam menjalankan tugas. Peristiwa pembakaran

Kantor Bupati Singkil, 30 Mei 2011 merupakan catatan tersendiri. Kondisi kesehatan bupati drastis menurun sejak empat bulan terakhir memaksanya harus lebih banyak istirahat. Upaya berobat untuk penyembuhan terus diupayakan, namun takdir berkata lain, Makmur menghembuskan nafas terakhirnya, Sabtu lalu. Karier PNS Almarhum Makmur alumni Fakultas Hukum Universitas Syiah Kuala Banda Aceh 1982, jurusan Pengetahuan Masyarakat mengawali karier sebagai PNS sebagai Fungsional Umum Sekretaris Wilayah Daerah (Setwilda) Aceh Selatan tahun 1982. Kemudian menjadi Kepala Bidang Pendataan dan Laporan pada Badan Perencanaan Daerah (Bappeda) Aceh Selatan 1983-1985 dan Sekretaris Bappeda Aceh Selatan 1986-1988. Kepala BP-7 Aceh Selatan 19901996 merupakan jabatan terakhirnya di Tapaktuan, kemudian diberi tugas sebagai Pembantu Bupati wilayah Singkil di Singkil tahun 1996–1999. Karier Organisasi Makmur mulai dipercaya memimpin organisasi sekolah sebagai Ketua Umum Organisasi Siswa Intra Sekolah (OSIS) SMA Subulussalam periode 1972-1973, kemudian Ketua Umum Himpunan Mahasiswa Islam (HMI) Fakultas Hukum Unsyiah mulai 1978-1979. Selanjutnya memimpin organisasi pemuda sebagai Ketua Umum Komite Nasional Pemuda Indonesia (KNPI) Aceh Selatan untuk periode 19881991. (b27)

SIGLI (Waspada) : Sebanyak 293 siswa Madrasah Ibtidaiyah Negeri (MIN) Cot Glumpang, Kecamatan Glumpang Baro, Kabupaten Pidie, Senin (17/10) menangis setelah mengetahui Kepala Sekolah (Kepsek) mereka Rahimah harus dimutasi. Tidak hanya kalangan siswa, anggota dewan guru juga larut dalam kesedihan setelah mendengar kabar mutasi kepsek mereka itu. Rahimah menjabat sebagai Kepsek MIN Cot Glumpang sejak sembilan tahun lalu. Para siswa dan guru menolak kepseknya dimutasi, karena mereka menilai Rahimah selama bertugas memimpin sekolah itu sangat baik dan penuh kasih sayang terhadap siswa dan para guru. “Kami tidak ingin ibu kepala sekolah diganti. Kami masih menginginkan sekolah ini dipimpin oleh Ibu Rahimah,” ujar seorang guru sekolah itu, Senin (17/10). Bustamam, guru MIN Cot Glumpang menuturkan para siswa mengetahui kabar bahwa ibu kepala sekolahnya pindah tugas saat mengikuti apel upacara Senin pagi di sekolah itu. Dalam sambutannya, Rahimah meminta izin kepada para siswa dan dewan guru karena beliau telah dipindahtugaskan ke sekolah yang

lain. Mendengar kabar itu, para siswa dan dewan guru langsung terisak tidak bisa membendung perasaan sedihnya, sebab sosok kepala sekolah yang dicintai karena menyayangi mereka selama ini dipindahkan tugasnya. Ekses dari peristiwa itu, menyebabkan kegiatan proses belajar mengajar di sekolah itu selama dua jam terganggu. Para siswa menolak masuk dalam ruang belajar, karena ingin terus bersama ibu kepala sekolah, meskipun terus dibujuk dan dirayu oleh para guru agar para siswa masuk ke kelas karena sudah waktu belajar. “Kami berpikir wajar anak-anak menangis, karena mereka sangat dekat dengan ibu kepala sekolah,” jelas seorang. Kepala Kementerian Agama Pidie M Jafar M Nur menjelaskan, mutasi kepala sekolah yang dilakukan pihaknya dalam upaya penyegaran. Terlebih Kepsek MIN Cot Glumpang Rahimah telah bertugas di MIN sekira sembilan tahun lebih. “Kita juga mengakui prestasi Rahimah selama bertugas di MIN tersebut sangat baik, sehingga lumrah para siswa dan dewan guru mencintai beliau,” tutur Jafar. (b10)

Warga Kampung Ateuk Keluhkan Debu BANDA ACEH (Waspada) : Pembangunan drainase bebas banjir di Gampong Ateuk Dayah Tanoh, Kecamatan Baiturrahman, Banda Aceh meninggalkan masalah buruk berupa debu yang dirasakan warga setempat. Hendra Saputra, warga Kampung Ateuk Jawoe menyebutkan masyarakat yang tinggal di sepanjang Jalan Ateuk Jawo, terpaksa menghirup debu dari tumpukan tanah dan pasir yang sengaja dibiarkan berada di badan jalan. “Padahal proyek itu telah selesai dikerjakan dua pekan lalu,” ungkap Hendra, Senin (17/10) Kepulan debu menurut Hendra cukup me-

ngganggu aktivitas warga setempat. “Apa lagi cuaca terik begini, kami dan keluarga lain terpaksa menutup pintu rumah karena banyak debu.” Sebut Hendra. Debu juga menyebabkan pernafasan warga tergangu. Terutama anak-anak. Akibat lain adalah debu jalan itu juga lengket di dinding dan atap rumah warga. Selain itu tumpukan tanah dan pasir di badan jalan menyebabkan ruas jalan di kawasan itu semakin sempit sehingga menggangu lalulintas masyarakat.“Apa lagi lebar jalan kurang dari 5 meter,” ungkap Hendra.(b08)

Proyek Belum Sesuai Spek Diprotes TAKENGEN (Waspada) : Proyek pembuatan jalan menuju lokasi perkebunan warga di Atu Gajah, Aceh Tengah menuai protes. Pasalnya selain jalan tidak sesuai spek, warga menduga terhambatnya pembangunan jalan sekitar 400 meter, karena adanya ‘permainan’ oknum tertentu di PNPM-Mandiri Perdesaan, Kecamatan Bebesen. “Sesuai spek disepakati di kontrak, seharusnya pembuatan jalan 3 km (3.000 meter) dengan material 10 persen tanah, 30 persen koral (kerikil) dan 60 persen pasir dengan motif punggung sapi dan lebar jalan 5 meter. Namun realisasi pelaksanaannya belum sesuai. Kami telah melaporkan persoalan ini ke FK, FT PNPM-MP, tapi belum ditanggapi,” tutur Amin Munthe, TPK PNPM-MP, warga Kampung Atu Gajah, Bebesen, Aceh Tengah, Minggu (16/10). Bukan itu saja, lanjutnya, seharusnya

sebelum penyerakan material dilakukan, didahulukan pembuatan parit di kiri kanan jalan, dengan ukuran 50 cmx 50 cm. Namun hingga kini tanda-tanda pengerjaan parit belum terlihat. Selebihnya volume kepadatan jalan di sepanjang jalur Gegarang menuju Paya Sawi ini masih sekitar 05 cm. Padahal dalam spek ketebalan sarana tersebut 20 cm. Ketua UPK PNPM-MP Bebesen, Suprapto menyebutkan, terhambatnya pembuatan sisa jalan sepanjang 400 meter tersebut, bukan kesalahan FT, FK kecamatan dan suplayer. Namun lantaran masih ada pihak pemilik tanah belum memberi izin pembebasan lahan. Fasilitator Kecamatan (FK) Mursal dan Fasilitator Teknis (FK) Munawir Alil menyatakan, pembuatan jalan tersebut sesuai program dan telah berjalan 40 persen. (cb09)

BANDA ACEH (Waspada) : Jaksa Penyidik Kejaksaan Tinggi Aceh, Senin (17/10) kembali memeriksa dua saksi atas kasus dugaan korupsi pengadaan Alat Kesehatan (Alkes) RSUD Aceh Tamiang. Saksi yang diperiksa di antaranya MS, anggota pemeriksa barang dan BN anggota panitia pengadaan. “Pemeriksaan berlangsung dari pagi hingga sore hari, di ruang terpisah,” kata Kepala Kejati Aceh melalui Kasipenkum dan Humas Kejati Aceh Amer Hamzah. Amer Hamzah mengatakan, pemeriksaan akan dilanjutkan hari ini, Selasa (18/10) terhadap tiga saksi yang berinisial R, direktur perusahaan (rekanan), AD, sebagai PTK dan JM, sebagai pengguna anggaran.

Bila ketiga saksi tersebut memenuhi panggilan jaksa, maka jumlah saksi yang telah diperiksa atas tindak pidana korupsi proyek pengadaan alat-alat kesehatan (Alkes) RSUD Aceh Tamiang sebanyak 19 saksi. Sebelumnya, jaksa penyidik telah memeriksa 14 saksi di antaranya ZS, Kasubbag Penyusunan Program, PK Ketua Panitia Pengadaan, HF sekretaris panitia, RS Ketua Panitia Pemeriksa Barang, RIS anggota panitia pengadaan, II anggota panitia pengadaan, AL anggota panitia pengadaan, MU Sekretaris Panitia Pemeriksa Barang, MH anggota panitia pemeriksa barang. Selain itu ZU sebagai anggota panitia pemeriksa barang, MA selaku bendahara Dinas Kesehatan, MS sebagai PPK, MR sebagai PPK dan MS selaku Direktur RSUD Tamiang. (cb01)

Korupsi Alkes RSUD Tamiang, Kejati Kembali Periksa Dua Saksi

Masyarakat Aceh Tamiang Kecam Gedung Penangkaran Walet KUALASIMPANG (Waspada) : Berbagai elemen masyarakat di Aceh Tamiang mengecam keberadaan gedung yang dijadikan lokasi penangkaran sarang burung walet di tengah permukiman penduduk. Masyarakat setempat dan menuding pihak terkait tidak punya nyali menindak pemilik rumah toko penangkaran air liur burung tersebut. Jika pihak Pemkab enggan menindak, maka OKP, Ormas, LSM, mahasiswa dan elemen masyarakat lainnya di Aceh Tamiang menyatakan siap untuk berdiri di garda terdepan untuk membumihanguskan penangkaran burung wallet itu. Hal itu diungkapkan Ketua KNPI Aceh Tamiang, M Andis Prawira di Sekretariat KNPI di Kota Kualasimpang, Minggu (17/10). Andis menyatakan, pernyataan sikap secara tertulis ditandatagani dan distempel berbagai organisasi pemuda, mahasiswa,LSM dan berbagai organisasi lain. Menurut Andis, pihak yang mengecam keberadaan gedung/ruko penangkaran burung walet itu antara lain Kesejahteraan Pemuda Kota Kualasimpang (KPK), Pemuda Kampung Sriwijaya, Pemuda Kampung Kota Lintang, Pemuda Kampung Perdamaian, Pemuda

Kampung Bukit Tempurung. Selain itu, kecaman datang dari Pergerakan Mahasiswa Islam Indonesia (PMII) Kota Langsa, Gerakan Mahasiswa Aceh Tamiang (GEMATA) Kota Langsa, Ikatan Mahasiswa dan Pelajar Islam Tamiang, Badan Eksekutif Mahasiswa Sekolah Tinggi Kesehatan Aceh Tamiang, Pembela Tanah Air (PETA) dan Pemerintah Mahasiswa Universitas Islam Tamiang (UIT). Menurut Andis, pernyataan sikap itu diterbitkan setelah mendengar pendapat dari berbagai kalangan masyarakat yang berdomisili di Kota Kualasimpang dan sekitarnya. Sekdakab Aceh Tamiang H Syaiful Bahri, Senin (17/10) membenarkan pihaknya pernah menggelar pertemuan dengan berbagai elemen masyarakat. Menurut Syaiful Bahri, gedung penangkaran walet di Aceh Tamiang memang sudah didirikan ketika Aceh Tamiang belum terbentuk atau semasa Tamiang masih bergabung dengan Aceh Timur. Ketua Komisi C DPRK Aceh Tamiang, Hermanto Pakeh menyatakan, DPRK Aceh Tamiang sudah berulangkali melaksanakan Pansus terhadap permasalahan sarang burung walet tanpa izin ,namun hasil pansus diabaikan pihak eksekutif dan tidak ada tindakan. (b23)

Ketua Pokja Pendaftaran Pemilukada Abdya Dilaporkan Ke Panwaslu BLANGPIDIE (Waspada) : Pasangan bakal calon bupati dan wakil bupati Fadly Ali – Suryadi Razali secara resmi melaporkan tindakan ketua Pokja Pendaftaran yang juga komisioner KIP Abdya T.Renaldi ke Panitia Pengawas Pemilukada Abdya. Mereka menilai tindakan ketua Pokja pendaftaran T.Renaldi tidak menjalankan aturan tahapan pemilukada sesuai dengan mekanisme yang telah ditetapkan. “Semua yang hadir pada malam pendaftaran tanggal 7 Oktober lalu itu secara jelas melihat semua kejadian yang ada, dimana kami mengalami sebuah perlakuan yang sangat tidak adil serta diluar ketentuan yang diatur dalam sebuah tahapan pemilukada,” ulas Fadly Ali dalam siaran persnya yang dikirim melalui surat elektronik ke Waspada, Sabtu (15/10). Atas kondisi tersebut, Fadly Ali bersama pasangan dan timnya secara resmi membuatkan

surat keberatan dan pengaduan kepada Panwaslu Abdya dengan tembusan ke KIP Aceh, Panwaslu Aceh, Polres Abdya, Dandim 0110 Abdya, DPRK Abdya serta Bupati Abdya. Dalam surat pengaduan dan laporan keberatan terkait sikap KIP Abdya yang telah menolak pendaftaran yang mereka lakukan pada tanggal 7 Oktober lalu itu. Secara rinci pasangan itu menyebutkan adanya upaya dan kondisi yang mengarah untuk ‘menjegal’ langkah pencalonan mereka. Padahal Panwaslu Abdya sudah memberi arahan agar ketua Pokja Pendaftaran dapat menerima berkas pasangan Fadly Ali – Suryadi Razali terlebih dahulu dan tidak melakukan verifikasi pada malam pendaftaran itu. Melalui sambungan telepon selularnya, Fadly Ali kepada Waspada juga menyebutkan akan melakukan langkah gugatan secara hukum terkait sikap T.Renaldi dan KIP Abdya. (cb05)



WASPADA Selasa 18 Oktober 2011

Puluhan Gajah Terancam Punah

Truk Pembawa Beras Terbalik LANGSA (Waspada): Sebuah truk bermuatan beras 30 ton terbalik di jalan lintas sumatra, persisnya di kawasan Gampong Matang Seulimeng, Kecamatan Langsa Barat, Kota Langsa, Senin (17/10). Truk jenis tronton BL 8688 AT hendak menuju Medan, terbalik akibat sopirnya mengantuk berat sehingga tidak bisa menjaga keseimbangan ketika kenderaannya sedang melaju. Tidak ada korban jiwa dalam kecelakaan tunggal itu, baik sopir maupun kernet truk keduanya selamat tanpa luka apapun. Namun puluhan ton beras tumpah dan nyaris mengenai rumah salah seorang warga setempat. Ketika dijumpai di lokasi kejadian, sopir truk tronton Daud, warga Tanjong Minjei, Aceh Timur menerangkan, peristiwa naas itu terjadi sekira pukul 04:25. Saat itu dirinya bersama seorang kernet sedang bergerak dari Panton Labu, Aceh Utara menuju Kota Medan untuk membawa beras sebanyak 30 ton. Namun, tiba-tiba dia diserang rasa ngantuk berat yang membuat dirinya linglung sehingga truk yang dikendarainya oleng dan terbalik dalam parit jalan setelah sebelumnya sempat menubruk pohon Mahoni di pinggir jalan negara itu. “Saya berangkat dari Panton Labu, Aceh Utara tadi malam pukul 12:00 dengan tujuan Medan untuk membawa beras, tiba di Langsa tadi pagi sekira pukul 04:00, tapi entah mengapa setiba di sini (TKP) tiba-tiba mata saya terasa berat sehingga linglung dan hilang kendali, maka terbalik seperti ini,” sebut Daud seraya menambahkan dirinya masih bersyukur karena dalam kecelakaan itu dia bersama kernet selamat dan sehat wal afiat, serta puluhan ton beras yang hendak dibawa ke Medan pun tidak ada yang hilang. (b20)

Walikota Langsa Serahkan Beasiswa Untuk 12 Pelajar Berpretasi LANGSA (Waspada): Walikota Langsa, Drs Zulkifli Zainon, MM menyerahkan bantuan beasiswa berupa uang tunai kepada 12 orang pelajar berprstasi di tribun lapang Merdeka Langsa, Senin (17/10). Penerima bantuan tersebut terdiri dari pelajar tingkat SD, SLTP, SLTA dan mahasiswa . Penyerahan bantuan biaya pendidikan bagi pelajar berprestasi itu dilakukan memeriahkan Hari Ulang Tahun (HUT) Kota Langsa yang ke-10 sejak lahirnya dari pemekaran kabupaten induk Aceh Timur tahun 2001 lalu. Adapun 12 pelajar berprestasi yang mendapatkan bantuan biaya pendidikan masing-masing, tingkat SD Jihan Mawaddah dari SDN-1, Reyhan Zanuar Imsan dari SDN-5 dan Siti Husna dari SDN-11. Tingkat SLTP T.Miranda dari SMPN-1, Puspa Ningrum dari SMPN-5 dan Sherli Maulida dari SMPN-3 Langsa. Tingkat SLTA, Alif Akbar dari SMAN-1, Murniwati dari SMAN2 dan M.Iwan Kurniawan dari SMAN-3. Serta tingkat perguruan tinggi, Tika Rahayu Syahputri dari STAIN Zawiyah Cot Kala Langsa, FaizannaWulanda dari Unsam Langsa dan Faizal Rivai dari Akper Depkes Langsa. Selain dua belas pelajar berprestasi, masih ada lima pelajar berprestasi lainnya yang mendapat bantuan biaya pendidikan dari PT Jamsostek Langsa. Dimana bantuan juga diserahkan langsung secara simbolis olehWalikota Langsa kepada perwakilan pelajar ditempat yang sama. (b20)

Pidato Camat Sungai Raya Dinilai Mengecewakan SUNGAI RAYA (Waspada): Ratusan warga dalam Desa Gajah Mentah, Kecamatan Sungai Raya, Kab. Kabupaten Aceh Timur, kecewa mendengar isi pidato dan sambutan Camat setempat saat penyelesaian sengketa tanah masyarakat dengan PT Patria Kamo yang telah menguasai tanah mereka sejak tahun 1963. Mendengar pidato yang sama sekali tidak memihak kepada masyarakat, membuat masyarakat khususnya yang tanahnya telah diambil oleh perusahaan itu berang. Pasalnya, dalam pidatonya Camat Sungai Raya Abdulah, tidak memberikan titik terang untuk masyarakat gajah mentah, padahal intruksi itu sudah diperintahkan oleh Gubernur Aceh Irwandi Yusuf kepada Bupati Aceh Timur Muslim Hasballah, agar sengketa tanah di Desa Gajah Mentah, harus di selesaikan secepatnya. Kekecewaan masyarakat berawal dari dikeluarkannya Surat Keputusan (SK) Camat Nomor 560/141/2011 tentang tim penyelesaian kedudukan Gampong Gajah Mentah, Kecamatan Sungai Raya, Kabupaten Aceh Timur. Meski sebelumnya Camat Abdullah selalu berada dalam keputusan bersama demi kemaslahatan bersama, namun dalam pidatonya Camat Abdullah tidak memperjelas dan tidak membahas tentang kedudukan tanah itu. “Bahkan Camat Sungai Raya lebih fokus kepada lahan kosong yang di terlantarkan oleh PT Patria Kamo. Kenapa hari ini camat sudah berkata lain, padahal dari dulu camat selalu komit dengan kita masyarakat tapi ketika sudah mulai ada titik terang malah camat mulai berbalik ke arah yang tidak jelas,” ujar Imam Jubir Tim 10 Pembebasan Tanah Gajah Mentah, Tgk. Imam. Camat Sungai Raya, Abdullah secara terpisah saat dihubungi Waspada, Senin (17/10) menegas, selaku aparatur pemerintah pihaknya tetap berpegang kepada hukum dan aturan yang ada sesuai dengan mekanisme, yakni meski HGU tanah yang sudah ditanami tanaman sawit dan lainnya dikembalikan ke pihak perusahaan. (b24)

Waspada/Aldin Nl

DIPLOMASI WARUNG KOPI: Pangdam IM, mayjen TNI Adi Mulyono diskusi serius bersama Wakil Ketua DPRA Sulaiman Abda dan Mayuddin Adan, tokoh Aceh yang punya jaringan luas dengan eks kombatan dan elit GAM di dalam dan luar negeri. Pertemuan diplomasi warung kopi sudah beberapa kali digelar Pangdam, untuk meredam gejolak terkait keamanan Aceh paska calon Partai Aceh (PA) tidak mendaftar ke KIP. Kali ini di Cut Nun kopi, samping Hotel Hermes, Minggu (16/ 10) malam.

Penembak Wakil Ketua KUD Hengkang LHOKSUKON (Waspada): Komplotan perampok dan penembak Supriyono, 37, wakil KUD Tani Jaya, Unit V Desa Babussalam, Baktiya, Aceh Utara, diduga sudah hengkang alias keluar dari Kab. Aceh Utara. “Kemungkinan besar, mareka sudah di luar Aceh Utara. Meski demikian proses pengejaran akan terus kita intensifkan sampai mareka tertangkap,” tegas Kapolres Aceh Utara AKBP Farid BE didampingi Kasat Reskrim, AKP Marzuki, Senin (17/ 10). Kapolres menambahkan, guna menemukan titik terang

kasus perampokan sadis itu, sejak kemarin, polisi juga mulai memeriksa sejumlah saksi, termasuk keluarga dan tetangga korban, aparat desa dan masyarakat Desa Babussalam. “Kita sengaja menunda pemeriksaan terhadap saksi, terutama saksi dari keluarga korban, karena menghormati masa berkabung. Setelah tahapan pemeriksaan saksi ini selesai, mudah-mudahan identitas pelaku terungkap dan bisa segera kita tangkap,”harap Kapolres. Supriyono yang juga toke getah di Desa Babussalam, Kecamatan Baktiya, di tembak

mati orang tak dikenal (OTK) di rumahnya, Jumat (14/10) sekira pukul 19:30. Pelaku memakai senjata laras panjang dan pendek dan berhasil menggondol uang tunai sekitar Rp30 juta. Tak lama setelah kejadian, polisi menemukan dua sepeda motor dan sepucuk pistol colt yang diduga milik pelaku. Barang bukti itu ditemukan di semak-semak Desa Batee Lhee, Lhoksukon, puluhan kilometer arah utara Desa Babussalam. Sementara pelaku yang diduga enam orang, lolos dari sergapan petugas dan berhasil kabur. (b19)

Batas Waktu Pemidahan Pedagang Pasar Langsa Berakhir LANGSA (Waspada): Kendati batas waktu pemindahan dan pengaturan tata letak lapak dagangan telah berakhir pada hari Selasa (hari ini red) namun para pedagang sayur di depan Masjid Raya Darul Falah, Kota Langsa belum juga mengatur lapak dagangan mereka seperti kesepakatan yang telah mereka lakukan bersama Dewan Perwakilan Rakyat Kota (DPRK) Langsa seminggu lalu. Pantauan Waspada, Senin (17/10) para pedagang sayur tetap mengatur lapak mereka di tengah-tengah jalan menuju pasar ikan, sehingga menutup badan jalan yang hanya dapat dilalui para pejalan kaki serta kendaraan beroda dua saja. Padahal sesuai kesepakatan yang telah dilakukan dengan anggota DPRK Langsa pada hari Selasa minggu lalu, para pedagang sepakan akan memindahkan sendiri lapak dagangan mereka sehingga memungkinkan

kendaraan roda empat melintasi jalan tersebut. Sejumlah pedagang mengaku mereka belum memindahkan lapak dagangan mereka karena lokasi berjualan memang terlalu sempit, bila memindahkan ke satu arah makan pedagang yang ada dibelakang akan kesulitan untuk berjualan. “Kalau kondisi lapak seperti saat ini akami dan para pedagang buah yang ada dibelakang akan sama-sama enak berjualan, kalau harus pindah sayang pedagang yang ada di belakang lapak,” ujar seorang pedagang. Anggota DPRK Langsa Ir Joni yang juga Ketua Komisi D, mengaku sangat kecewa melihat ulah para pedagang sayuran itu. Dia mengaku sebelumnya berharap banyak para pedagang mau memindahkan lapak sesuai kesepakatan awal yang telah mereka buat. Ditambahkan, bila kondisi

masih seperti saat ini pihaknya tidak dapat berbuat banyak dan menyerahkan persoalan pemindahan lapak berjualan ke tim penertiban pasar kembali untuk menyelesaikan persoalan itu. Kepala Satuan Polisi Pamong Praja (Satpol PP) Pemerintah Kota Langsa Muamar Khadafi yang dihubungi secara terpisah mengaku pihaknya akan segera berkoordinasi dengan pihak pasar dan Muspika Kota Langsa untuk segera mengatasi para pedagang sayur yang belum memindahkan lapak dagangan mereka. “Kita akan segera mengelar rapat dengan tim penertiban Kota langsa untuk membicarakan persoalan ini, karena batas satu minggu sebagaimana yang dibuat di kantor dewan seminggu lalu sudah berakhir dan dewan telah menyerahkan persoalan ini kembali kepada kita,” ujarnya. (b22)

IDI (Waspada): Puluhan ekor gajah yang selama ini mengamuk dalam sejumlah kecamatan di Kabupaten Aceh Timur, Provinsi Aeh, terancam punah. Hal itu menyusul tidak ada penanganan pemerintah yang membuat masyarakat membunuhnya dengan berbagai cara. “Jika Pemkab, Pemprov, Pemerintah Pusat di Jakarta, diam dan tidak mendesak Balai Konservasi Sumber Daya Alam (BKSDA) menangani konflik gajah-manusia di Aceh, maka satu persatu satwa langka itu akan punah,” ujar Ketua LSM Komunitas Aneuk Nanggroe Aceh (KANA), Muzakir, kepada Waspada, Senin (17/10) di Idi. Dia berpendapat, selama ini terjadi amukan gajah tidak terlepas dari ulah tangan manusia dalam membunuh binatang berbelalai itu, seperti dengan maracuni, menembak, dan menjerat serta menembaknya dengan senjata api. “Kondisi itu dinilai salah dilakukan masyarakat, namun melihat penanganan dari pemerintah tindakan itu dilakukan akibat diam dan tidak berkoteknya pemerintah dalam menangani gajah di Aceh Timur,” ujar Muzakir seraya menambahkan, amukan gajah terjadi di Aceh tak hanya sebatas unsur pembunuhan gajah, tapi juga faktor sempitnya habitat satwa liar.

Sebagaimana keterangan pekebun dan petani di Aceh Timur yang diperoleh pihaknya, lanjut Muzakir, kerapnya amukan gajah di sejumlah titik sudah terjadi sejak 2006 lalu pasca setahun perdamaian Aceh antara Pemerintah Aceh – GAM. Sejumlah kecamatan yang kini menjadi sarangnya gajah dan kerap mengamuk yakni, Kecamatan Alue Ie Mirah—Indra Makmur, Julok, Banda Alam—Keude Gerobak, Peunarun, Serbajadi—Lokop dan Simpang Jernih. Catatan Waspada, aksi pembunuhan gajah terjadi disejumlah tempat yakni seekor induk gajah terbunuh tabpa gading di Indra Makmur (awal 2011) dan seekor induk gajah mati disetrum dengan menggunakan kabel listrik di kawasan Banda Alam (2010) dan seekor induk gajah mati ditembak di Peunarun di tahun 2007. Bupati Aceh Timur, Muslim Hasballah secara terpisah mengatakan, pihaknya tetap menyampaikan ke pihak provinsi terkait amukan gajah di wilayahnya. Bahkan BKSDA Aceh Timur, juga dianggap lebih mengatahui kondisi mengganasnya gajah di wilayah itu. “Kita tidak bisa berbuat banyak, karena dalam hal ini BKSDA adalah pihak yang harus berada di garis depan,” tandasnya. (b24)

Kebutuhan Darah Di Aceh Timur Dan Kota Langsa Meningkat LANGSA (Waspada): Badan Eksekutif Mahasiswa (BEM) Sekolah Tinggi Ilmu Kesehatan (STIKes) Cut Nyak Dhien Langsa kembali menggelar donor darah di lingkungan kampus setempat, Jalan Perumnas Gampoeng PB.Seuleumak, Langsa Barat, Sabtu (15/10). Ketua BEM STIKes Cut Nyak Dhien Langsa Fachrurroji di sela-sela kegiatan itu mengatakan, kegiatan donor darah merupakan program kerja rutin bagi BEM setiap periodenya. Tujuan dari kegiatan itu adalah untuk mengajak mahasiswa baru STIKes Cut Nyak Dhien berbagi kesehatan dengan masyarakat lewat donor darah. “Karena donor darah ini, selain bermanfaat bagi kesehatan masyarakat yang membutuhkan juga bermanfaat bagi kesehatan pendonor itu sendiri. Maka semua mahasiswa STIKes kita wajibkan donor darah setiap ada kegiatan seperti ini, apalagi kita adalah mahasiswa kese-

hatan,” sebutnya. Selain sebagai program kegiatan rutin, donor darah yang dilakukan bekerjasama dengan UDD PMI Aceh Timur itu juga salah satu rangkaian kegiatan menyambut Milad Yayasan Cut Nyak Dhien yang akan digelar di Lapangan merdeka pada Desember nanatinya. Kepala TU dan Administrasi UDD PMI Aceh Timur, Syafrzal, SH mengatakan, pihaknya selaku mitra kerja dalam hal pelayanan kebutuhan darah menyambut baik kegiatan donor darah yang dilakukan BEM STIKes Cut Nyak Dhien ini. “Apalagi selama ini kebutuhan darah di Aceh Timur, Kota Langsa dan Aceh Tamiang semakin meningkat, maka kegiatan donor darah sukarela ini sangat penting untuk memenuhi kebutuhan tersebut. Dan kami dari UDD PMI Aceh Timur selaku pihak pengelola siap untuk melayani kebutuhan itu,” demikian Syafrizal. (b20)

Saudagar Aceh Dulu Mulai Dari Muge LANGSA (Waspada): Meskipun dulunya saudagar Aceh mulai dari muge tetapi dalam kiprahnya pernah menjadi modal bagi lahirnya kemerdekaan RI. Semengat tersebut perlu kiranya dipupuk kembali kembali agar ekonomi di Aceh bisa cepat bangkit. Demikian Ketua Kadin Aceh, H Firmandez, ketika memberi arahannya kepada 100 orang pemuda darti Kabupaten Aceh Timur yang jadi peserta pelatihan wirausahawan, selama dua hari sejak Jumat (14/10) di aula Hotel Harmoni Langsa. Sebanyak 100 pemuda yang dilatih itu terdiri dari pengusaha kecil, mahasiswa, santri, dan anggota Kadin serta Hipmi setempat. H Firmadez mengatakan, sebelum adanya APBA/APBD, dana dari saudagar menajdi penggerak ekonomi Aceh. Selat Malaka menjadi pintu perdagangan santara Timur dan Barat, serta pedagang dariYaman dan Gujarat singgah di Aceh membeli hasil bumi. Kemudian Samudra Pasai sebagai pusat Islam dan perdagangan Aceh, Malaka, dan Portugis, juga menjadi pusat pelaku perdagangan International. Aceh saat itu juga berperan dalam kemerdakaan RI, kata dia, dan saudagar bersama rakyat Aceh berhasil mmenyumbangkan pesawat RI1 dan RI-2 dan emas 20 kg. Bahkan ketika itu semangat berkongsi Aceh dengan sistem manajemen baru dilakukan dengan membentuk Firma, seperti Aceh Kongsi, Firma Murni, Fa Puspa, NV Bukti, Tenaga Desa, Lohknga Company, Damai, Indoklin, dan lainnya. “ Ketika itu saudagar kita berawal dari muge, lalu punya relasi dagang dengan Penang, India, China, kemudian menjadi saudagar besar, hingga menjadi modal bagi kemerdekaan RI” katanya. Ditambahkan, namun kondisi saudagar Aceh masa kini berawal dari tahun 1967, mulai

terbius dengan kegiatan proyek-proyek pemerintah. Para pengsuaha lebih banyak memilih kegiatan jangka pendek dasri pada masa panjang, dan para lulusan Perguruan Tinggi lebih memilih menjadi pekerja di sektor pegawai negeri maupun sektor swasta. Selanjutnya konflik berkepanjangan dan Tsunami yang melanda Aceh pada akhir tahun 2004 silam juga telah menghancurkan semangat kebanyakan saudagar. Menurutnya, bagi dunia usaha untuk bangkit kembali bukan hal yang mudah. Dengan kondisi dunia usaha di Aceh saat ini, dengan jumlah usaha relatif rendah, namun semangat cukup tinggi. Untuk itu perlu dioptimalkan kembali melalui program mewujudkan sejuta saudagar. Namun untuk mewujudkannya, di antaranya dengan adanya pengalaman di masa krisis pengusaha atau saudagar terutama UMKM di daerah Aceh lebih mampu bertahan. Sehingga dengan akan tumbuhnya lagi UMKM dan usaha lainnya akan membuka lapangan kerja, dan pengusaha atau saudagar UMKM tidak hanya menjadi tulang punggung tetapi alat perang di pasar global. Namun ada berapa faktor lainnya yang dapat menghambat kembali tumbuhnya saudagar Aceh, di antaranya isu tingginya pengangguran merupakan isu lama dan klasik yang selama ini belum dapat diatasi dengan baik. Selanjutnya isu rendahnya investasi merupakan produk dari kekurangan kepercayaan investor atau saudagar lokal terhadap kondisi perekonomian Aceh, termasuk masalah politik dan kemanan. Kemudian pengaruh isu krisis juga ikut berperan terhadap aktivitas ekonomi perekonimian Aceh ke depan, termasuk peranan pengusaha, ujarnya. (b20)

Jeritan Petani Garam Di Kecamatan Jangka

Waspada/ Ibnu Sa’dan

DIREKTUR Akbid Bustanul Ulum Langsa dr.Syarbaini, M.Kes sedang menyalami salah seorang mahasiswi yang diwisuda pada lulusan Akbid angkatan ke-8 di Aula Sekretariat Pemko Langsa, Sabtu (15/10).

142 Mahasiswi Akbid Bustanul Ulum Diwisuda LANGSA (Waspada): 142 Mahasiswi Akademi Kebidanan (Akbid)Yayasan Bustanul Ulum Langsa diwisuda sebagai lulusan angkatan ke-8 di Aula Sekretariat Pemko Langsa, Sabtu (15/ 10). Prosesi wisuda calon tenaga kesehatan kebidanan itu dihadiri langsung Kabid Pendidikan Kesehatan Provinsi Aceh drg Irfan, M.Kes. Direktur Akbid Bustanul Ulum Langsa, dr Syarbaini, M.Kes dalam sambutannya mengatakan, bahwa 142 lulusan yang diwisuda, 46 merupakan lulusan program khusus angkatan ke4 tahun 2011, sementara sisanya 96 orang merupakan mahasiswi lulusan program regular angkatan ke-8. “Semua peserta wisuda ini merupakan mahasiswi Akbid yang telah menyelesaikan proses pendidikan secara sempurna di Akbid Bustanul Ulum. Dengan demikian, Akbid Bustanul Ulum hari ini telah menelurkan kembali ratusan calon tenaga kesehatan bagian kebidanan siap pakai,” ungkap Syarbaini. Bagi lulusan Akbid yang diwisuda tersebut diharapkan dapat menjalankan tugasnya sebagai tenaga kesehatan bidang kebidanan secara professional dengan mengutamakan keselamatan pasien. Juga diwajibkan melayani kepentingan masyarakat dengan dengan konsep siap melayani secara kemanusiaan. “Saya juga berpesan kepada lulusan yang telah menjadi alumni ini, agar selalu melakukan koordinasi secara intens dengan pihak Akbid Bustanul Ulum. Tujuannya agar Akbid memiliki data base tentang keberhasilan para lulusannya yang bekerja atau belum,” demikian harap Syarbaini seraya menambahkan, walaupun sudah menjadi Alumni lulusan Akbid wajib untuk terus menjaga almamater AKbid Bustanul Ulum. (b20)

DERETAN sejumlah bangunan tua dan ada di antaranya yang sudah dimakan usia yang terbuat dari kayu dan umunya beratap daun rumbia berdiri berjejer dipinggir jalan antara Desa Tanoeh Anoe dan Tanjongan, Kecamatan Jangka, Bireuen. Sepintas pemandangan itu terlihat atau dikira itu perkampungan atau gubuk tua yang dihuni para keluarga kurang mampu. Namun, sebenarnya itulah dapur tempat memasak atau memproduksi garam warga setempat selama ini. “Neu piyoh dile, lon ba nyoe ile keunan siat beh, hana trep (singgah dulu, saya bawa ini dulu, sebentar saja (garam dalam karung-red) ke sana dulu ya,” kata Mulyadi seorang petani garam di Desa Tanjongan sambil mengendarai sepedamotor yang terlihat dibelakangnya beberapa karung berisi garam kepada Waspada, Minggu (16/ 10) begitu tiba di kawasan tempat warga memproduksi garam. Sinar matahari saat itu begitu sangat menyengat terasa dikulit, saat Waspada menunggu Mulyadi, tiba-tiba nun agak jauh dari sebuah bangunan tua keluar seorang seorang wanita setengah baya sambil memikul dua jerigen yang diikat pada satu batang kayu menuju ke sebuah tempat. Tidak lama terlihat dia kembali sambil membawa jiregen itu lagi namun kali ini terlihat jalannya

agak berat. Saat Waspada memperhatikan gerak gerik wanita itu, tibatiba dikagetkan dengan ucapan Mulyadi yang kebetulan saat itu telah berada di pinggir. “Ibu itu sedang mengangkut air asin dari luar ke dapur tempat dia memasak garam,” kata Mulyadi memecah keheningan saat itu sambil mengajak ke beberapa dapur tempat memasak garam warga setempat. Dalam perjalanan menuju ke satu dapur garam, Mulyadi kembali menyambung ucapannya dengan cara menebak. “Kamu heran melihat ibu itu mengaku air tadi kan? begitulah memang selama ini, petani garam di sini umumnya kalau tidak mengupah orang lain mengangkut air asin dia akan mengakutnya sendiri ke dapur untuk dimasak menjadi garam, lokasi ini lumanyan jauh dengan pinggir pantai dan juga pompa air yang diberikan pemerintah beberapa waktu lalu belum bisa difungsikan, makanya, selain harus menggali sumur dipinggir tambak juga harus mengakutnya dengan jiregen ke dapur, baru setelah itu dimasaknya,” ujarnya begitu tiba di satu rumah kontruksi kayu lalu dketuknya sambil mengucapkan salam dan dari dalam menjawabnya. “Rumah ini milik ibu Hafni, seorang janda miskin menghidupi empat anaknya dengan memproduksi garam selama ini,” kata Ramli bersamaan pintu ruamh itu dibuka dari dalam dan muncul seorang wanita yang dikatakan namanya Hafni tadi.

Afni yang mengaku sedang bersiap-siap hendak pergi ke tempat pesta perkawinan, membawa Waspada ke dapur tempat dia memproduksi garam selama ini. “Inilah tempat saya bikin garam selama ini untuk menutupi biaya hidup dan membiayai anak sekolah, untung saja anak pertama saya ada dibantu biayanya oleh saudara saya,” katanya begitu tiba di satu bangunan dapur garam yang tidak begitu jauh dari rumahnya. Hanya Untuk Makan Saja Singkat cerita, saat itu Hafni menjelaskan proses memproduksi garam dari mengakut air, membeli kayu bakar, membeli bahan baku lainnya termasuk bibit atau juga disebut namanya obat untuk memproduskisi garam, wanita yang pernah tinggal di Aceh Timur bersama mantan suaminya sebelum pergi meninggalkan selamanya, mengatakan, memproduksi garam hanya mendapat keuntungan pas-pasan atau hanya bisa untuk makan saja. “Saya beli kayu bakar Rp800 ribu satu truk, beli obat atau bibit juga puluhan ribu, kadangkadang kita mengupahkan orang angkut air asing dari sumur ke dapur juga dan membeli barang kebutuhan lain, banyak modal yang harus saya keluarkan, namun sekarang ini harga garam murah yaitu kami jual diambil ke dapur oleh agen antara harga Rp2.200-2.600 per kilogram. Sehari kadang-kadang saya bisa masak lima kali, sekali masak menghasilkan garam antara 30-32 Kg, totalnya antara 150 kg, sekilo kami jual

Waspada/Abdul Mukthi Hasan

DUA petani garam Desa Tanoh Anoe, jangka, Bireuen, Minggu (16/10) memasukkan hasil produksinya dalam kantong plastik dan menimbangnya, setelah itu diedarkan ke pasaran. pada agen antara Rp2.200-2.300 per kg atau kalu eceran kami jual antara Rp25.00-3.000 per bambu (siare-istilah Aceh) atau 16 bambu (sinaleh—istilah Aceh) Rp35 ribu, jadi pendapatan bersiah saya sehari antara Rp25 atau Rp30 ribu, hasil dari itulah saya menghidupi empat anak selama ini yang semuanya anak saya itu sekolah,” katanya. Menurut Hafni, banyaknya modal yang harus dikeluarkan yang tidak sebending dengan hasil pendapatannya, terpkasa juga dijalankan, karena tidak ada pilihan lain. Namun, dia mengaku yang memberatkannya adalah harus membeli atau mengakut air asing yang menambah modalnya. “Seandainya pompa air untuk mengalir air ke dapur garam kami bisa berfungsi tentunya kami tidak ba-

nyak modal yang harus dikeluarkan, sehingga kuntungan bagi kami juga agak sedikit besar dari yang sekarang ini,” katanya yang juga dibenarkan Mulyadi dan sejumlah petani garam lain di dua desa itu yang ditanya terpisah. Nasib petani garam di Jangka khusunya di Tanjongan dan di Desa Tanoh Anoe, rupanya benar seperti yang dikisahkan dalam film dokumenter yang ditayangkan satu satu televisi swasta nasional belum lama ini yang judulnya ‘garamku tak asin lagi’. Jujur saja, seandainya kawasan beberapa desa di kecamatan Jangka dijadikan kawasan tempat memproduksi garam, sungguh itu sangat membantu para petani garam di kawasan itu. Kecuali itu, di kecamatan

pesisir itu selama ini juga dikenal dengan lautnya tempat nelayan beberapa desa di kawasan itu mengakap ikan dan juga di tempat itu luas tambak yang membentang dan disitu juga dikenal dengan pliek (fatarana) satu bumbu masak khas Aceh yang ternama. Sungguh warganya disana akan makmur dan sejahtera. Namun, selama ini mereka hanya menjalankan pekerjaan itu semuanya dengan alami begitu saja. Seandainya ada sedikit perhatian atau ada pihak yang peduli kepada mereka mungkin kesejahteraan atau peningkatan ekonomi atau taraf kesejateraan mereka agak lebih baik dari sekarang ini. Mudah-mudahan harapan mereka itu akan jadi kenyataan. Insya Allah. Abdul Mukthi Hasan

Waspada, Selasa 18 Oktober 2011  

waspada daily