Page 1

Harga Eceran Rp2.500,-

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

SELASA, Wage, 13 September 2011/14 Syawal 1432 H

No: 23622 Tahun Ke-65

Terbit 24 Halaman




PRESIDEN Susilo Bambang Yudhoyono menyambut kunjungan kenegaraan dari PM Kerajaan Thailand Yingluck Shinawatra di Istana Merdeka, Jakarta, Senin (12/9).

Jeffry Edo Siahaan Korban Rusuh Ambon

RI-Thailand Sepakat Tingkatkan Kerja Sama

Tak Ada Firasat Buruk Keluarga MEDAN (Waspada): Pininta Br Tambunan, ibu kandung Jeffry Edo Siahaan,32, (foto) korban tewas kerusuhan Ambon, tidak menyangka putranya menjadi korban dalam kerusuhan di Ambon. Bahkan, Pininta mengaku tidak memiliki firasat buruk mengenai kematian anaknya. Bahkan, ketika bertelefon untuk rencana kepulangannya dengan keluarga, Jeffry tidak menunjukkan tanda-tanda apa pun. Namun, rencana bertemu orang tuanya tinggal cerita, setelah Jeffry tewas dalam kerusuhan Ambon pada Minggu (11/9). Pada Sabtu malam, Jeffry, anak pertama dari tiga bersaudara itu, memberitahu orangtuanya tentang rencana kepulangannya ke Medan.’’ Malam itu dia bertelefon dan mengatakan akan pulang ke Medan. Tetapi rencana itu tidak kesampaian,’’ kata Pininta. “Dia nanya kabar saya terus dia bilang mau pulang Desember nanti sama tunangannya yang di Lampung. Dia juga bilang sudah kirim uang ke rekening saya,” ujar Pininta. Jeffry selama ini mengajar di Yayasan Pelita Harapan Ambon. Hal yang sama dikatakan ayah korban, Manganar Siahaan. Dia tidak punya firasat apa pun ketika anaknya menelefon beberapa hari lalu. “Kita tidak ada firasat apaapa. Dia menghubungi kami terakhir kali malam Minggu kemarin,”kata Manganar Siahaan, Senin (12/9).

Lanjut ke hal A2 kol. 6


PERSONIL Detasemen Kaveleri (Denkav) 5/BLC - Kodam XVI Pattimura melakukan patroli dengan menggunakan tank di sejumlah kawasan di Kota Ambon, Senin (12/9). Situasi dan kondisi keamanan di Kota Ambon mulai kondusif setelah sebelumnya Minggu (11/9) terjadi kericuhan antar warga.

JAKARTA (Antara): Indonesia dan Thailand sepakat untuk terus meningkatkan kerja sama di berbagai bidang sebagai upaya meningkatkan kesejahteraan kedua pihak. Presiden Susilo Bambang Yudhoyono dan Perdana Menteri Yingluck Sinawatra membicarakan penigkatan kerja sama tersebut dalam pertemuan kedua kepala pemerintahan di Istana Negara Jakarta, Senin (12/9). “Ada beberapa hal yang kami diskusikan dengan tujuan untuk lebih meningkatkan kerja sama dan kemitraan pada waktu mendatang,” kata Presiden dalam keterangan pers bersama PM Yingluck usai pertemuan bilateral itu. Sejumlah hal yang dibicarakan, kata Presiden, antara lain di bidang ekonomi, pertanian, perikanan, energi, pariwisata, politik, hukum dan militer. “Di bidang perdagangan, pada 2011 total perdagangan Indonesia dan Thailand mencapai 12 miliar dolar AS atau naik 34 persen dari total volume perdagangan pada 2010. Kami percaya pada masa depan masih ada peluang baru untuk meningkatkan kerja sama perdagangan, juga agrobisnis,” kata Presiden. Kepala Negara menambahkan pentingnya kerja sama bidang pertanian karena Thailand memiliki teknologi yang kuat di bidang agroindustri. “Karena itu kita berharap kerja sama di bidang penelitian dan pengembangan terus ditingkatkan,” katanya. Lanjut ke hal A2 kol. 1

Diburu Penyebar SMS Rusuh Ambon Prabowo Yakin Jadi Capres Alternatif JAKARTA ( Waspada): Ketua Dewan Pembina Partai Gerindra Prabowo Subianto menyatakan Pemilu 2014 adalah momentum strategis bagi Partai Gerindra. Oleh karenanya, dia meminta kadernya untuk berjuang keras agar Partai Gerindra lolos dalam verifikasi partai politik. “Kita harus berjuang untuk lolos verifikasi. Pemilu 2014 sangat strategis,” kata Prabowo dalam acara halal bihalal di kantor DPP Gerindra, Ragunan, Jakarta Selatan, Senin (12/9). Dia menilai pertarungan politik pada 2014 akan jauh lebih ramai. Terlebih, Partai Demokrat sudah tidak bisa mencalonkan Susilo Bambang Yudhoyono sebagai calon presiden kembali. “Rakyat bosan dengan janji-janji lama. Bosan dengan politisi-politisi yang tukang ngomong,” katanya. Mantan pasangan Megawati Soekarnoputri dalam Pemilu Presiden 2009 lalu ini mengisyaratkan akan maju dalam Pilpres 2014 mendatang. Dia menyatakan hakulyakin dapat menjadi figur alternatif. “Rakyat minta alternatif dan kita yang harus berani memberi harapan baru untuk rakyat Indonesia,” katanya.(vn)

Ricuh Suporter Bola Di Dairi, Puluhan Luka-luka SIDIKALANG (Waspada):Puluhan orang menderita lukaluka, kini dirawat di RSUD Sidikalang Kab. Dairi, akibat kericuhan massa seusai pertandingan sepak bola antara Desa Pasi (tempat kelahiran Wakil Bupati) dengan Desa Laehole (tempat kelahiran Bupati), Senin (12/9) sore. Polisi masih mengumpulkan informasi dan melakukan penyelidikan atas peristiwa ini. Informasi dihimpun Waspada, kericuhan terjadi tak lama setelah pertandingan usai. Pertandingan yang berakhir dengan kemenangan Desa Pasi, melalui adu tendangan penalti itu adalah partai final turnamen sepakbola tersebut. Usai penyerahan piala, para pemain dan suporter tim tamu hendak pulang kembali dengan menumpang beberapa mobil. Tapi setahu bagaimana, mobil mereka tiba-tiba dilempari dengan batu dan lainnya. Lemparan batu itu begitu derasnya dan bertubi-tubi hingga kaca sejumlah mobil pecah dan batu masuk ke dalam. Beberapa orang mengalami luka, termasuk Doan Sitohang, putra Bupati Dairi Johnny Sitohang. Korban yang kebanyakan merupakan suporter dari Lae Hole kemudian dilarikan ke RSUD Sidikalang. “Informasinya kericuhan diawali waktu suporter Lae Hole main atau melemparkan mercon saat main bola itu, mercon

Lanjut ke hal A2 kol. 6

JAKARTA (Waspada): Polisi masih mengusut dugaan penyebaran pesan singkat atau SMS yang menyulut kerusuhan di Ambon, Maluku, Minggu (11/9) kemarin. SMS berantai itu berisi mengenai tewasnya tukang ojek, Darfin Saimen, yang disebut dibunuh. “Nomor yang kirim SMS itu sudah terlacak,” kata Juru Bicara Polri, Inspektur Jenderal Anton Bachrul Alam, di Markas Besar Kepolisian RI, Jakarta, Senin (12/9). Hingga

saat ini, menurutnya, polisi masih memburu penyebar SMS tersebut. Menurut Anton, kondisi Ambon pasca rusuh sudah berangsur kondusif. Polri pun

Lanjut ke hal A2 kol. 6

Waspada/Rudi Arman

Golkar Usung Aburizal Bakrie Jadi Capres DENPASAR (Antara): Konsolidasi nasional Partai Golkar se-Indonesia di Kuta, Bali, sepakat mengusung Aburizal Bakrie sebagai kandidat calon presiden RI net pada Pemilu tahun 2014. “Pertemuan tersebut rencananya dua hari sejak Minggu hingga Senin (12/9), tetapi dipersingkat karena seluruh pengurus Partai Golkar menyepakati satu hal, yaitu mengusung Aburizal Bakrie jadi calon presiden pada pemilu 2014,” kata Ketua DPD Partai Golkar Bali Ketut Sudikerta di Denpasar, Senin (12/9). Ia mengatakan, Aburizal Bakrie dianggap sosok tepat untuk mewakili nurani rakyat Indonesia. Di internal Partai Golkar, kata dia, Aburizal mampu menjadi corong pemersatu seluruh kader Golkar yang tersebar di seluruh Tanah Air. “Pak Ical (panggilan Aburizal) sosok tepat pemimpin Indonesia ke depan. Kami optimistis mendukung beliau,” kata Sudikerta. Keputusan yang disepakati di Bali itu, menurut Sudikerta akan dituangkan kembali secara resmi pada rapat pimpinan nasional yang akan segera digelar.

Kasus Penganiayaan Khatib Jumat

Geng Kereta Rusak Pos Polisi

Enam Ditangkap, 54 Diburon

Penahanan Anggota DPRK Tunggu Surat Gubernur Aceh

MEDAN (Waspada): Aparat Polsek Sunggal bekerjasama dengan Polsek Medan Baru menangkap enam anggota Geng Kereta Cekak Merah G-1 di lokasi terpisah, Senin (12/9) sore. Dengan tertangkapnya keempat orang tersebut, polisi mulai mengidentifikasi 54 anggota Geng Kereta lainnya yang diduga terlibat pengrusakan pos polisi di persimpangan Jl. Iskandar Muda – Jln. Pattimura. Informasi dihimpun Waspada di lapangan, keempat anggota Geng Kereta Cekak Merah G-1 yang ditangkap yakni MM, 16, penduduk Simpang Melati; PS, 16, penduduk Simpang Glugur Rimbun;

SIGLI (Waspada) : Pemeriksaan dan penahanan terhadap oknum anggota Dewan Perwakilan Rakyat Kabupaten (DPRK) Pidie Tgk Il, tersangka penganiayaan khatib shalat Jumat di Masjid Raya Keumala, Kab. Pidie, Jumat (9/9) masih menunggu surat dari Gubernur Aceh Irwandi Yusuf. Demikian dikatakan Kasat Reskrim Polres Pidie AKP Jatmiko, Senin (12/9). Kata dia, Satuan Reserse Kriminal (Satreskrim) Polres Pidie telah meyurati Kapolda Aceh untuk meminta izin pemeriksaan dan menahan Tgk Il, sebab yang bersangkutan adalah anggota dewan. “Kami sudah mengirim

FRN, 17, penduduk Tanjung Anom; DP, 17, penduduk Medan Permai; Jk, 18, penduduk Simpang Melati dan BA, 16, penduduk Jl. Flamboyan 6, Komplek IKIP simpan g Melati. Selain menangkap enam tersangka, polisi menyita barang bukti dua sepedamotor dan lainnya. Penangkapan itu bermula ketika Tim Khusus (Timsus) Polsek Sunggal dipimpin Kanit Reskrim AKP Victor Ziliwu, SH, SIK, sedang melakukan patroli di Jln. Sunggal, Kec. Medan Sunggal. Saat itu diperoleh informasi tentang keberadaan tiga anggota Geng Kereta

Lanjut ke hal A2 kol. 3

Waspada/Ismanto Ismail

TERSANGKA MM, 16, anggota geng kereta G-1 diperlihatkan foto-foto pelaku terlibat perusakan pos polisi melalui laptop.

Prof Dr Syahrin Harahap, MA

Waspada/Gito Rolies

Lanjut ke hal A2 kol. 3

BANDA ACEH (Waspada): Polresta Banda Aceh meringkus sembilan pelaku pengedar uang palsu (upal) di Aceh, pecahan Rp50.000. Seorang di antaranya merupakan anak seorang perwira TNI yang masih berumur di bawah 17 tahun. Kapolresta Banda Aceh Kombes Pol Armensyah Thay, Senin (12/9) mengatakan, pada 7 September 2011, polisi Lanjut ke hal A2 kol. 3


BUS Sumber Kencono nopol W 7181 UY dan minibus nopol AG 7103 ML ringsek setelah tabrakan.

Bus Vs. Minibus 21 Tewas

9 Pengedar Upal Diringkus

the star

IKA menenangkan Dr Catherine di lokasi kejadian.

Lanjut ke hal A2 kol. 2

Orangutan Dipaksa Berhenti Merokok

AMPANG JAYA, Malaysia (Waspada): Ika, 35, seorang pembantu rumahtangga (PRT) Indonesia menyelamatkan majikannnya dari serangan OTK (orang tak dikenal). PRT menerjang sang penyerang yang jauh lebih besar tubuhnya. KAPOLRESTA Banda Aceh Kombes Pol Armensyah Thay bersama Kasat Reskrim Polresta Banda Aceh AKP Isharyadi, menunjukkan upal Rp13 juta pecahan Rp50 ribu

surat permohonan izin pemeriksaan terhadap tersangka yang merupakan anggota dewan kepada Kapolda Aceh. Selanjutnya Kapolda Aceh mengirim surat tersebut ke gubernur. Namun sampai kini surat dari gubernur belum kita terima,” ungkap Jatmiko. Jatmiko berjanji apabila pihaknya sudah menerima surat izin dari gubernur segera mungkin memanggil tersangka untuk diperiksa dan apabila seluruh unsur terpenuhi, pihaknya akan melakukan penahanan. Kasat Reskrim Polres Pidie AKP Jatmikomengungkapkan

Ada-ada Saja

PRT Selamatkan Majikan Dari Serangan OTK

Karakter Fitrah

Lanjut ke hal A2 kol. 6

akan kembali berkumpul untuk melakukan evaluasi. “Jangan sampai kejadian kemarin terulang lagi,” ujar Anton. Jangan mudah terprovokasi Pemerintah meminta kepada masyarakat khususnya di Kota Ambon untuk tidak mudah terprovokasi oleh isuisu yang belum dicek

PETUGAS dari Polresta Medan mendata jumlah sepeda motor di depan gedung Bag Ops Polresta Medan, Senin (12/9).


SELAMAT datang manusia fitrah. Engkau hadir kembali di dunia nyata. Duniamu kini adalah dunia bebas. Setan tak lagi dibelenggu. Ia kembali leluasa mencelakakanmu jika engkau tidak punya nyali untuk menghindar dari siasatnya. Pintu surga tak lagi terbuka kecuali dengan kunci pas ketakwaanmu. Sementara pintu neraka selalu menganga menunggu khilaf, lupa, dan kelalaianmu. Tetapi Ramadhan telah memberi ‘imunos’ memperkuat daya tahanmu terhadap segala macam kerawanan hidup di lautan bebas kehidupan. Berlayarlah di atasnya d e n g a n k a r a k t e r f i t ra h m u k a re n a Ra m a d h a n

meminta warga Ambon untuk tak mudah terprovokasi dengan pesan yang tak jelas. “Kami mengimbau masyarakat untuk menahan diri,” kata dia. Anton menambahkan, tewasnya Darfin murni karena kecelakaan. Selain polisi, kata Anton, tokoh agama dan tokoh masyarakat setempat juga ikut membantu mengatasi konflik yang terjadi. Hari ini, mereka

MOJOKERTO (Antara): Kecelakaan lalu lintas antara bus Sumber Kencono W 7181 UY dan minibus elf AG 7103 ML di jalur By Pass di Desa Balongmojo, Kec. Puri Mojokerto, menewaskan 21 orang. Kepala Unit Kecelakaan Satuan Lalu Lintas Polres Mojokerto, Ipda Sariyanto di Mojokerto, Senin (12/9) mengatakan, kecelakaan terjadi saat bus Sumber Kencono

Lanjut ke hal A2 kol. 6

LARANGAN merokok ternyata bukan hanya diperuntukkan bagi manusia saja, namun juga bagi satwa jenis orangutan. Orangutan yang berada dalam penangkaran sering kali kedapatan menghisap rokok yang diberikan oleh

Lanjut ke hal A2 kol. 2

erampang Seramp ang - Dua nama mencuat untuk 2014 - He...he...he...

Prabowo Capres Alternatif

JAKARTA ( Waspada): Ketua Dewan Pembina Partai Gerindra Prabowo Subianto menyatakan Pemilu 2014 mendatang adalah momentum strategis bagi Partai Gerindra. Oleh karenanya, dia meminta kadernya untuk berjuang keras agar Partai Gerindra lolos dalam verifikasi partai politik. Lanjut ke hal A2 kol 7

WASPADA Demi Kebenaran Dan Keadilan

Ical Capres Golkar

DENPASAR (Antara): Konsolidasi nasional Partai Golkar se-Indonesia di Kuta, Bali, sepakat mengusung Aburizal Bakrie sebagai kandidat calon Presiden RI pada Pemilu tahun 2014. “Pertemuan tersebut rencananya dua hari sejak Minggu hingga Senin (12/9), Tetapi

Lanjut ke hal A2 kol 6

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

SELASA, Wage, 13 September 2011/14 Syawal 1432 H  z No: 23622 * Tahun Ke-65

Terbit 24 Halaman (A1-12, B1-12)  z Harga Eceran: Rp 2.500,-

SBY-Yingluck Sepakat Tingkatkan Kerjasama JAKARTA (Antara): Pemerintah Indonesia dan Thailand sepakat untuk terus meningkatkan kerjasama di berbagai bidang sebagai upaya meningkatkan kesejahteraan kedua pihak. “Ada beberapa hal yang kami diskusikan dengan tujuan untuk lebih meningkatkan kerja sama dan kemitraan pada waktu mendatang,” kata Presiden Susilo Bambang Yudhoyon dalam keterangan pers bersama PM Yingluck Yingluck Sinawatra usai pertemuan bilateral, Senin (12/9). Kedua kepala pemerintahan membahas kerjasama bidang ekonomi, pertanian, perikanan, energi, pariwisata, politik, hukum, dan militer. Pada 2011, sebut Yudhoyono, total perdagangan Indonesia dan Thailand mencapai 12 miliar dolar AS atau naik 34 persen dari total volume perdagangan pada 2010. “Kami percaya pada masa depan masih ada peluang baru untuk meningkatkan kerja sama perdagangan, juga agrobisnis,” kata Presiden. Sementara Yingluck menghargai peran Indonesia dalam peningkatan kerja sama dengan Thailand. Ia sepakat dengan Yudhoyono bahwa kedua negara memiliki hubungan yang sangat baik

Lanjut ke hal A2 kol 5

Kemenpolhukam Minta KIP Jalan Terus


PRESIDEN Susilo Bambang Yudhoyono menyambut kunjungan kenegaraan dari Perdana Menteri (PM) Kerajaan Thailand Yingluck Shinawatra di Istana Merdeka, Jakarta, Senin (12/9). Kunjungan kenegaraan PM Kerajaan Thailand Yingluck Shinawatra ini merupakan kunjungan kenegaraan pertama kalinya ke Indonesia sejak terpilih menjadi Perdana Menteri menggantikan Abhisit Vejjajiva.

BANDAACEH (Waspada): KIP Aceh menyambut baik surat yang disampaikan Sekretaris Menko Polhukam kepada Menteri Dalam Negeri terkait pelaksanaan Pilkada di Provinsi Aceh. Menurut anggota KIP Aceh Akmal Abzal, Senin (12/9), surat itu membuat KIP Aceh semakin nyaman dalam menjalankan tahapan lanjutan Pilkada Aceh dengan tetap mengakomodir kehadiran calon perseorangan. Surat Menko Polhukam itu sebenarnya bersifat internal dan dikirimkan pada 25 Agustus lalu. Namun baru terungkap ke publik pekan ini saat kedatangan Dirjen Otonomi Daerah Djohermansyah Djohan ke Banda Aceh bebe-rapa waktu lalu. Surat ditandatangani Sekretaris Menteri Polhukam Hotmangaradja Panjaitan. Intinya, Kemenko Polhukam berharap pemerintah tetap mendorong agar DPR Aceh segera melakukan pembahasan ulang qanun Pilkada dengan mengakomodir calon perseorangan yang diputuskan Mahkamah Konstitusi. “Kalau saja klausul calon perseorangan tidak masuk dalam qanun itu, maka Kemendagri dan KPU, kami minta agar membantu KIP Aceh untuk melanjutkan tahapan Pilkada Aceh dengan merujuk qanun yang lama No. 7 Ta h u n 2 0 0 6 ,” t u l i s

Lanjut ke hal A2 kol 7

9 Pengedar Uang Palsu Diringkus Pelakunya Anak Remaja

BANDA ACEH (Waspada): Polresta Banda Aceh meringkus sembilan pelaku pengedar uang palsu di Aceh, pecahan Rp50.000. Seorang di antaranya merupakan anak seorang perwira TNI yang masih berumur di bawah 17 tahun. Kapolresta Banda Aceh Kombes Pol Armensyah Thay kepada war tawan, Senin (12/9) mengatakan, pada 7 September 2011, polisi mendapatkan informasi dari masyarakat bahwa telah beredar uang palsu di Banda Aceh, kemudian tim Reserse Polresta menelusuri jejak pelaku.

Tim reserse menangkap dua pelaku berinisial HBB, 19, dan NS,18, di jembatan Krueng Daroy Kota Banda Aceh. Setelah dilakukan pengembangan, polisi menangkap SlA, 19, di Keudah Banda Aceh.

Lanjut ke hal A2 kol 7

Kasus Penganiayaan Khatib Shalat Jumat Waspada/Gito Rolies

KAPOLRESTA Banda Aceh Kombes Pol Armensyah Thay bersama Kasat Reskrim Polresta Banda Aceh AKP Isharyadi, Senin (12/9) memaparkan barang bukti uang palsu Rp13 juta pecahan Rp 50 ribu yang diamankan dari sembilan pengedar.

Anggaran Pegawai Di Bawah 50% Daerah Boleh Terima CPNS MEDAN (Waspada): Meski moratorium penerimaan Pegawai Negeri Sipil (PNS) diberlakukan, daerah yang memiliki anggaran di bawah 50% untuk pegawai masih diperkenankan melakukan seleksi Calon Pegawai Negeri Sipil (CPNS). Namun demikian,

bidang yang diperbolehkan tersebut masih harus dikonsultasikan dengan Badan Kepegawaian Nasional (BKN). “Memang ada keputusan yang memperbolehkan pengangkatan CPNS untuk belanja APBD pegawainya masih di bawah 50%. Namun, bukan

berarti semua usulan akan dikabulkan. Karena itu masih akan dikonsultasikan dulu dengan BKN,” kata Kabid Pengadaan dan Pembinaan Badan Kepegawaian Daerah (BKD) Pemprovsu Kaiman

Lanjut ke hal A2 kol 6

Penahanan Tgk Ilyas Tunggu Surat Gubernur Aceh Dua Tersangka Ditahan SIGLI (Waspada): Pemeriksaan dan penahanan terhadap oknum anggota Dewan Perwakilan Rakyat Kabupaten (DPRK) Pidie Tgk Ilyas, tersangka penganiayaan khatib shalat Jumat di Masjid Raya Keumala, Kabupaten Pidie, Jumat (9/9) masih menunggu surat dari Gubernur Aceh Irwandi Yusuf. Demikian dikatakan Kasat Reskrim Polres Pidie AKP Jatmiko, Senin (12/9).

Kata dia, Satuan Reserse Kriminal (Satreskrim) Polres Pidie telah meyurati Kapolda Aceh untuk meminta izin pemeriksaan dan menahan Tgk Ilyas, sebab yang bersangkutan adalah anggota dewan. “Kami sudah mengirim surat permohonan izin pemeriksaan terhadap tersangka yang merupakan anggota dewan kepada Kapolda Aceh.

Lanjut ke hal A2 kol 1

Waspada/Dede Basri Hasibuan

MOBIL pemadam kebakaran Pemko Karo memadamkan api berasal dari gedung pendingin – teknik PT Digantara Polindo, sebagai PLTPB yang juga rekanan PT Pertamina.

PLTB Sibayak Terbakar MERDEKA ( Waspada): Pembangkit Listrik Tenaga Panas Bumi (PLTB) di Desa Semagat Gunung, Kec. Merdeka, Kab. Tanah Karo, terbakar, Senin(12/9). Api diduga berasal dari pengelasan di atas motor pendingin yang terbuat dari fiber. Kerugian akibat peristiwa itu ratusan juta rupiah dan tidak ada korban jiwa.

PLTB PT Digamatra Polindo, tenaga uap pembangkit listrik yang sudah beroperasi lima tahun di Desa Semagat Gunung, berada di lokasi PT Pertamina, sebagai rekanan. Api dengan cepat membakar gedung pendingin – teknik di lantai dua, sebagian besar alat pendingin terbuat dari fiber. Enam mobil dinas kebakaran

Karo dikerahkan untuk memadamkan api. Pantauan Waspada, dua motor pendigin terbakar, yang terbuat dari bahan fiber pelastik, serta tampak pengawalan ketat dari pihak PLTB, Dandim, serta personil Polsek Simpang Empat.

Lanjut ke hal A2 kol 5

Ada-ada Saja

Al Bayan

Orangutan Dipaksa Berhenti Merokok

Sarang Laba-laba Oleh: Tgk. H. Ameer Hamzah Terjemahan bahasa Aceh: Umpama ureueng—ureueng nyang minta lindong bak seulaen Allah na keueh lagee rambideuen nyang peugot umpueng Dan sunggoh umpueng nyang paleng leumoh na keueh umpeueng rambideuen.... (QS. Al-Ankabut:41—42) ORANG-orang beriman senantiasa meminta perlindungan kepada Allah SWT. Karena Allah sajalah yang mampu memberi perlindungan kepada mereka. Sebaliknya orang-orang musyrik dan munafik sering keliru dalam memahami akidahnya sendiri. Selain mereka meminta kepada Allah, mereka juga tergelincir

Lanjut ke hal A2 kol 2


Ika menenangkan Dr Catherine di lokasi kejadian.

PRT Indonesia Selamatkan Majikan AMPANG JAYA, Malaysia (Waspada): Melihat seorang pria tanpa busana menghujani majikannya dengan pukulan, seorang pembantu rumahtangga (PRT) Indonesia tanpa pikir panjang segera menerjang sang penyerang yang jauh lebih besar tubuhnya. PRT tersebut yang dikenal hanya dengan nama Ika, 35, telah bekerja dan tinggal bersama Prof Dr Catherine Yule, berusia 50an tahun, seorang dosen di satu universitas

Lanjut ke hal A2 kol 2

LARANGAN merokok ternyata bukan hanya diperuntukkan bagi manusia saja, namun juga bagi satwa jenis orangutan. Orangutan yang berada dalam penangkaran sering kali kedapatan menghisap rokok yang diberikan oleh pengungjung kebun binatang. Pejabat di lembaga bidang satwa liar Malaysia mengatakan akan memaksa hewan primata ini menghentikan kebiasaan merokok mereka, seperti dilansir the Straitstime, Senin (12/9). Pihak pemerintah setempat telah menyita orangutan dewasa bernama Shirley dari Lanjut ke hal A2 kol 5


PERKEMBANGAN MoU HELSINKI Ketua Umum Palang Merah Indonesia (PMI) Jusuf Kalla (kiri) berbincang dengan Pemangku Wali Naggroe Tengku Malik Mahmud (tengah) dan dr Zaini Abdulah (kanan) ketika bertemu di Banda Aceh, Aceh, Senin (12/9). Pertemuan silaturahmi itu untuk melihat langsung perkembangan MoU Helsinki di Aceh.

Serampang - Genderang perang mulai ditabuh - He.... he....he....

Berita Utama


Bentrokan Ambon, 3 Tewas

Tragedi 11 September Dalam Kenangan Dubes RI Untuk AS NEW YORK (Antara): Duta Besar Indonesia untuk Amerika Serikat, Dino P Djalal, punya sahabat Amerika Serikat. Namanya Michael Carlo, seorang anggota brigade pemadam kebakaran Metropolitan New York. Sayang, Carlo tidak bisa lagi bersama sahabatnya itu karena dia gugur dalam penyelamatan korban reruntuhan Gedung WTC pada serangan 9/11. Carlo hanya seorang dari ribuan korban langsung ataupun tidak langsung dari serangan teroris ke gedung lambang supremasi ekonomi Amerika Serikat dengan memakai dua pesawat terbang sipil itu. Untuk mengenang Carlo, Djalal berjalan kaki bersama massa setempat ke boardwalk di Pantai Long Beach kota itu. Peristiwanya memang sudah lama, 10 tahun lalu, namun kepedihan serangan teroris itu masih sangat membekas bagi Amerika Serikat. Sejak serangan itu, bisa dibilang, muka dunia berubah dan pendekatan sekuriti mengemuka di mana-mana. Dengan ditemani ayahnya, diplomat senior dan ahli hukum laut internasional Prof Hasjim Djalal, Dino Djalal berjalan ke sana bersama istrinya, Rosa Rai, dan salah satu puterinya, Alexa. Mereka berbaur begitu saja dengan massa yang datang dengan muka murung... Bagaimana kisahnya Carlo dan Dino Djalal bersahabat? Pada 1983, Dino Djalal masih menempuh pendidikan tinggi di Queensborough Community College di New York. “Saya dulu tinggal dengan keluarga Carlo, atau istilahnya “kos”, selama sekitar enam bulan. Hubungan saya dengan mereka sangat erat, sampai-sampai mereka tidak mau menerima uang kos yang seharusnya saya bayar,” ujar Dino. Saat WTC mengalami serangan pada 11 September 2001 pagi, Carlo yang tergabung dalam brigade Engine 230 di BedfordStuyvesant, dikerahkan untuk menolong para korban, namun sejak itu ia tidak pernah kembali ke keluarganya di kota Long Beach. Saudara kandung Michael yang pada waktu itu juga merupakan petugas pemadam kebakaran, Rob Carlo, mengatakan ia sempat bercakap-cakap dengan Michael sebelum gedung WTC runtuh. “Kami sempat saling telefon karena besoknya berencana berlibur bersama-sama. Saat itu dia mengatakan sedang akan memasuki wilayah gedung WTC sebelah selatan yang sedang terbakar. Saya berpesan selamat bertugas dan hati-hati. Itu adalah komunikasi terakhir kami,” tutur Rob. Rob juga hadir di sana bersama Dino Djalal. Di boardwalk itu, terdapat nama-nama korban plus fotonya; salah satunya berisikan nama Michael Carlo dalam pakaian kebanggaannya, seragam brigade pemadam kebakaran... Carlo, dalam kenangan Dino saat itu, adalah seorang penolong tanpa pamrih. “Karenanya saya tidak heran mendengar dia menjadi petugas pemadam kebakaran. Beliau juga pribadi yang memiliki pandangan terbuka, juga menghormati budaya berbeda, misalnya waktu itu terhadap saya yang orang Indonesia,” katanya. Kini sahabat Carlo itu telah menjadi duta besar Indonesia untuk Amerika Serikat. Persahabatan abadi kedua manusia itu tentu mewarnai persahabatan kedua bangsa yang sepakat meningkatkan kualitas dan kuantitas kerja sama dalam berbagai hal demi kebaikan bersama-sama. Menurut diplomat muda Indonesia itu, sejak 2002, sahabatsahabat Michael selalu mendatangi bangku ini setiap tanggal 11 September untuk mengenang Michael. “Sudah beberapa kali mendapat undangan, tapi baru kali ini akhirnya saya berkesempatan bisa datang ke sini,” katanya, yang selalu mengenang sahabatnya itu sebagai sosok yang penolong.

Penahanan ....

Selanjutnya Kapolda Aceh mengirim surat tersebut ke gubernur. Namun sampai kini surat dari gubernur belum kita terima,” ungkap Jatmiko. Jatmiko berjanji apabila pihaknya sudah menerima surat izin dari gubernur segera mungkin memanggil tersangka untuk diperiksa dan apabila seluruh unsur terpenuhi, pihaknya akan melakukan penahanan. Kasat Reskrim Polres Pidie AKP Jatmiko juga mengungkapkan dari hasil pemeriksaan, polisi telah menahan dua orang yaitu Zulkifli, 40, dan Muktaruddin, 39, keduanya tercatat sebagai warga Keumala. “Mereka berdua kita

tahan, Sabtu (10/9). Kini bereka berdua ada dalam Sel tahanan kita” ungkap Jatmiko. Sedangkan Sabirin, 38, tersangka lainnya yang juga warga Keumala, yang bersangkutan mangkir dari pemanggilan pertama polisi. Dan sekarang sudah dilakukan pemanggilan kedua. Menurut Jatmiko, para tersangka dikenai Pasal 351 dan 170 tentang pengeroyokan dengan ancaman hukuman di atas lima tahun. Pihaknya akan memproses kasus ini dan akan diteruskan ke pengadilan. (b20)

PRT Indonesia ....

swasta di Lembah Klang, selama lima tahun di Taman TAR, yang berada dekat di Ampang Jaya, Malaysia. Jawaban Problem Catur, Dia selalu menemani Dr Catherine dan dua ekor anTTS Dan Sudoku jingnya melakukan pendakian di Bukit Belacan yang terletak Dari Halaman Sport. di belakang rumah mereka. Teror tersebut terjadi pada 9 September lalu sekitar pukul Jawaban Problem Catur: 03:00 dinihari. “Peristiwa tersebut terjadi 1. Gg7+, Rh7 (jika demikian cepat. Pria bugil itu Rg8, Kf6+mat). berlari langsung ke arah majikan saya (Dr. Catherine) sebe2. Kf6+, BxK. lum dia memukul wanita itu dan keduanya jatuh ke selo3. GxB+, Bd7. kan,” kata Ika. “Dia memukul 4. BxB+, Ge7. kepala dan wajah korbannya. Saya segera mengambil seba5. BxG+, Rh6. tang bambu yang jatuh di sekitar situ dan memukul bela6. Gg5+mat. kang pria tersebut. “Karena kerasnya pukulan Jawaban TTS: tersebut menyebabkan bambu itu patah dua. Namun pria TTS Topik Politik & Hukum itu kesakitan dan marah serta R N A Z A R U D D I N berbalik untuk menyerang saya,” kata Ika menambahkan. I O A P D Dengan rasa sakit dan Z A N K P D I P R cedera yang dialaminya, Dr E R I O E A Catherine keluar dari selokan, L W N E P I L P R E S dan dia melihat pria tersebut N U N I R D I N E G R A D P J A



Sarang Laba-laba ....

menyarikatkan Allah dengan makhluk-Nya yang lemah. B I N Betapa banyak orang Islam L yang datang ke makam-maT E kam keramat, pohon kayu, guG nung, dan laut tertentu karena mereka percaya di tempatB A tempat itu ada “dewa” penyeL lamat. Mereka meminta perJawaban Sudoku: lindungan kepada “arwah” tersebut lewat perantara 6 9 7 4 1 3 8 2 5 dukun-dukun yang sudah mahir dalam bidang itu. Selain 4 1 5 2 8 7 3 9 6 model memuja syaithan ada 2 3 8 9 5 6 4 1 7 juga model memuja makam 8 6 3 5 7 1 2 4 9 nenek moyang mereka, padahal nenek moyangnya 5 4 1 6 9 2 7 3 8 sudah lama meninggal dunia. 7 2 9 3 4 8 6 5 1 Model-model syirik itu 1 8 4 7 3 5 9 6 2 masih terdapat di seluruh Nusantara. Para wali (pendak3 7 6 1 2 9 5 8 4 wah agama Islam) tempo dulu

9 5 2 8 6 4 1 7 3

WASPADA Selasa 13 September 2011

Satu Korban Jefry Siahaan Asal Sumut Polri Kirim 400 Personil Tambahan Ke Ambon


SEJUMLAH anggota TNI membersihkan puing di Kota Ambon, Senin (12/9). Situasi dan kondisi keamanan di Kota Ambon kini mulai kondusif setelah sebelumnya Minggu (11/9) terjadi kericuhan antar warga.

Pemkab Dan DPRD Rekomendasi Cabut Izin PTS Di G. Sitoli GUNUNGSITOLI (Waspada): Dewan Perwakilan Rakyat Daerah (DPRD) dan Pemerintah Kota Gunungsitoli merekomendasikan agar Derektorat Jenderal Pendidikan Tinggi Departemen Pendidikan Nasional, mencabut dan membekukan izin penyelenggaran program studi sejumlah perguruan tinggi swasta di Kota Gunungsitoli, karena belum memiliki izin dan akreditasi yang jelas. Rekomendasi itu disimpulkan dari hasil rapat dengar pendapat umum DPRD bersama Dinas Pendidikan Kota Gunungsitoli dan sejumlah Pengurus Yayasan Perguruan Tinggi Swasta yang telah beroperasi di Kota Gunungsitoli, Jumat (9/9), antara lain STT Poliprofesi, Politeknik Poliprofesi, AMIK Universal, STT Universal dan STMK Apignosis. Rapat dipimpin Ketua Komisi B DPRD Kota Gunungsitoli, Damili. R. Gea, SH didampingi Pimpinan DPRD masing-masing, Armansyah Herfa, SE dan Hadirat ST Gea,

anggota dewan, Dinas Pendidikan Kota Gunungsitoli serta para pengurus yayasan perguruan tinggi swasta di Kota Gunungsitoli. Pada rapat tersebut STT Poliprofesi, Politehnik Poliprofesi, AMIK Universal, STT Universal dan STMK Apignosis tidak dapat menunjukkan izin pendirian dan penyelenggaran Program Studi PTSnya sehingga rapat dengar pendapat menyatakan ilegal. Perguruan Tinggi Swasta ini beserta pengelolanya dilarang melanjutkan kegiatan d i w i l a y a h h u k u m Ko t a Gunungsitoli, kecuali ada izin Dirjen Pendidikan Tinggi. Terkait dugaan penipuan terhadap ribuan mahasiswa dan calon mahasiswa baru yang dilakukan oleh yayasan pengelola dan atau pihak yang menjalankan PTS tersebut akan dilaporkan DPRD melalui Komisi B DPRD Kota Gunungsitoli ke Polda Sumut dan Polres Nias. Yayasan dan pengelola PTS tersebut diwajibkan mengem-

balikan uang pendaftaran serta uang yang pernah dikutip dari mahasiswa dan calon mahasiwa tanpa syarat dan potongan apapun. Kerugian material dan in material yang telah dirasakan oleh mahasiswa dan calon mahasiswa adalah tanggung jawab penuh yayasan atau pengelola PTS dimaksud. Pemerintah dan DPRD Kota Gunungsitoli berkewajiban mengeluarkan surat ke Dirjen Dikti untuk melaporkan yayasan atau pengelola PTS yang beroperasi di wilayah Kota Gunungsitoli dengan rekomendasi agar izin penyelenggaraan PTS dan Prodi dibekukan atau dibatalkan. Sementara, informasi diterima, sejumlah PTS di Kota Gunungsitoli khususnya pada penerimaan calon mahasiswa baru 2011, mencapai ribuan calon mahasiswa telah mendaftar dan membayar sejumlah uang pendaftaran bahkan uang kuliah tahap pertama bila ditotal miliaran rupiah. (a25)

Rumah Ketua BRA Lhokseumawe Dilempar Granat LHOKSEUMAWE (Waspada): Satu granat meledak setelah dilemparkan kawanan OTK (orang tidak dikenal) bersepedamotor di rumah Ketua Badan Reintegraski Aceh (BRA) Kota Lhokseumawe, Hamdani alias Mukim Ham di Gampong Ulee Jalan, Kec. Banda Sakti,Pemkot Lhokseumawe,Senin(12/9). Dalam peristiwa itu, tidak ada korban jiwa, hanya dua ban belakang mobil Toyota Kijang pick-up milik Hamdani kempis, dan serpihan granat menganai tiang dan dinding rumah. Beberapa personil polisi di lokasi kejadian menemukan

pen granat di depan rumah korban. Ada dugaan, pelaku datang dengan menggunakan sepeda motor dan diparkir di lapangan berjarak 50 meter dari rumah yang menjadi target.”Ada warga yang mendengar suara sepeda motor berhenti di lapangan itu beberapa menit sebelum terdengar ledakan,” kata seorang anggota polisi. AKBP Kukuh Santoso, Kapolresta Lhokseumawe sekira pukul 09:10 tiba di lokasi. Di sana dia memperhatikan dan memotret lubang bekas jatuh granat. Di lokasi itu Kapolres menginterogasi korban. AKBP Kukuh Santoso, Ka-

melemparkan pembantunya ke dalam lubang Ika sedalam satu meter dan memukuli Ika beberapa kali. “Saya melihat pria tersebut mengambil batu dan memukulkan ke kepala Ika. Namun, Ika timbul keberaniannya dan ketika pria tersebut kewalahan menghadapi perlawanan itu, segera melarikan diri sambil menyambar telefon selular Ika yang terjatuh dari sakunya,” katanya. Pertarungan itu berlangsung hanya lima menit, yang menyebabkan Dr Catherine mengalami memar dan beberapa lecet pada kaki dan tangannya serta mata kirinya sedikit lebam. Ika juga menderita luka memar pada bagian kaki, tangan dan kepalanya. “Saya berutang budi karena dirinya (Ika) sudah menyelamatkan diri saya dan amat bersyukur keadaan tidak berlangsung lebih parah,” jelas Catherine yang berkewarganegaraan Australia tersebut. Lokasi tempat kejadian ini memang biasa dikunjungi oleh Cather ine bersama dengan anjing serta pemban-

tunya untuk mendaki. Dia mengaku sempat bertemu dengan pelaku penyerangan itu dua hari sebelum kejadian berlangsung. Saat itu Catherine mengaku pria seperti sosok yang sopan. Serangan ini juga membuat warga yang biasa mendaki di wilayah Klang Valley merasa takut. Mereka berharap polisi dapat meringkus pelaku penyerangan ini. “Saya tidak demikian buruk, Ika mengalami kondisi lebih buruk karena dia mendapat beberapa jahitan untuk luka pada punggung dan kepalanya, banyak cedera dan lecet pada kaki, tangan dan kepalanya,” kata wanita Australia itu yang telah tinggal di Malaysia selama 15 tahun dan dia lancar berbahasa Melayu. Dr Catherine mengatakan dia telah melakukan pendakian di daerah itu sejak tiga tahun lalu dan sebelumnya dia tidak pernah menghadapi serangan di tempat itu. Seorang jurubicara kepolisian mengatakan mereka kini sedang menyelidiki kasus tersebut. (thestar/m10)

telah berusaha untuk menyingkirkan kesyirikan itu, namun belum berhasil seluruhnya. Kita mengharapkan ada wali lain (pendakwah masa kini) yang dapat menghapuskan syirik itu. Sayang sekali para wali zaman sekarang tidak punya nyali untuk itu. Malah mereka terkena imbas kesyirikan. Contoh syirik baru adalah cerita-cerita sinetron di televisi seperti sinetron yang diputar pada malam Jumat. Para sutradara dan pemainnya umumnya orang Islam, tetapi mereka membuat cerita agama nenek moyang mereka zaman Hindu dan Budha. Mereka berpakaian seperti pakaian nenek moyangnya, menyembah patung seperti

nenek moyangnya, dan meniru-niru perbuatan nenek moyang mereka. Menurut Syaikul Islam Imam Ibnu Taimiyah mereka telah membuat kemusyrikan yang merusak aqidah mereka. mereka meniru dan menghidupkan kembali kepercayaan nenek moyangnya. Naudzubillahi min zhalika! Mengapa mereka tidak meminta perlindungan dari Allah? Mengapa mereka justru kembali kepada selain Allah? Apakah mereka tidak tahu mereka telah menjerat tempat berpijak yang lemah seperti sarang laba-laba. Apakah mereka tidak sadar akan merusak aqidah jutaan para pemirsanya?

polres Kota Lhokseumawe menyatakan dugaan sementara, motif pelemparan granat ke rumah Hamdani mengarah pada persoalan pribadi antara korban dan rekannya. Informasi tentang pelemparan granat diketahui Kapolres pada pukul 07:30. Karena itu, petugas langsung diturunkan ke lokasi. “Barusan kita sudah interogasi korban. Pengakuannya, beberapa waktu lalu, menjelang meugang, ada teman datang menemuinya meminta sejumlah uang dan sempat mengancam karena tidak diberikan uang. Sebab biasanya saat diminta, dikasih. Karena itu kita menduga ini lebih mengarah kepada persoalan pribadi antara korban dan temannya,” terang Kapolres. (cmun)

JAKARTA (Waspada): Jefry Siahaan, Klivord Belebur dan Darfin Saimen tewas akibat pertikaian antar warga di Ambon, Maluku. Mereka merupakan warga Nusaniwe. Kadivhumas Polri Irjen Pol Anton Bachrul Alam mengatakan, penyebab tewasnya para korban masih diselidiki. Namun, Anton memastikan salah satu korban mengalami luka tembak. “Korban meninggal dunia, Jefry Siahaan, Klivord Belebur dan Darfin Saimen,” kata Anton, Senin (12/9). Khusus Jefry Siahaan disebut-sebut warga asal Sunggal, Deliserdang, Sumut. Anton menjelaskan situasi Ambon saat ini telah aman dan berangsur normal. Ia berharap masyarakat tidak mudah terprovokasi SMS yang menyesatkan. Polri Kirim 400 Personil Polri mengirim pasukan tambahan sebanyak 400 personil ke Kota Ambon, Maluku, untuk menambah kekuatan pasca pertikaian antara dua kelompok yang terjadi pada Minggu 11 September 2011. Usai menghadiri upacara penyambutan PM Thailand Yingluck Shinawatra di Istana Merdeka, Jakar ta, Senin (12/9), Kapolri Jend Pol Timur Pradopo mengatakan pasukan tambahan yang dikirim dari Jakarta tersebut telah tiba di Ambon pada Senin pagi pukul 04.00. “Kita menambah personel yang ditugaskan ke Ambon, sudah datang tadi jam empat

JAKARTA (Antara): Pemerintah menyiapkan dana Rp1,7 triliun untuk mengatasi potensi kekeringan yang melanda beberapa wilayah di Indonesia akibat badai El Nino yang menyebabkan kekeringan sepanjang tahun. Menteri Perekonomian Hatta Rajasa di Istana Kepresidenan, Jakarta, Senin (12/9), mengatakan dana mengatasi kekeringan itu diambil dari kontijensi pangan sebesar Rp3 triliun yang telah dianggarkan dalam APBN 2011. “Kita kan mempunyai dana Rp3 triliun untuk kontijensi pangan. Baru digunakan Rp300 miliar untuk pergantian puso dan sekitar Rp1 triliun

Anggaran Pegawai ....

Sementara Kapolsek Simpang Empat Akp Kandar megatakan, kebakaran sekira pukul 12.00. Asal api masih diselidiki. “Pegawai di sini hanya 50 orang, kami disuruh tutup mulut, sementara PLTB yang berada persis di belakang Pertamina sudah berdiri sekira 5 tahun,” terang seorang warga. Namun pimpinan Digantara Polindo tidak bisa dijumpai, meski wakil pimpinan berdalih, semua pertanyaan melalui manejer. Manejer berada di Jakarta. (c19)

SBY-Yingluck ....

Ical Capres ....

dan berpeluang untuk terus meningkatkan kualitas dan kuantitas kerja sama. “Kami harus perkuat dan tingkatkan kerja sama. Banyak mitra swasta Thailand berinvestasi di Indonesia terutama di sektor energi, dan Thailand mendukung kerja sama dengan Indonesia dengan dasar sama-sama menguntungkan,” katanya.

Orangutan ....

sebuah kebun binatang di negara bagian selatan Johor pada minggu lalu, setelah ia dan beberapa hewan lainnya dianggap hidup dalam kondisi yang tidak layak. Shirley kini berada di karantina setelah dipindahkan dan akan dikirim ke pusat satwa liar di pulau Kalimantan dalam beberapa pekan mendatang. Direktur Kebun Binatang Melaka, Ahmad Azhar Mohammed, mengatakan bahwa Shirley kini tidak lagi mendapatkan rokok karena ‘merokok bukanlah perilaku normal bagi orangutan’. (st/rzl)

siur, supaya tidak salah nanti disampaikan resmi oleh Kadiv Humas (Mabes Polri-red),” katanya. Pertikaian di Ambon dipicu oleh kecelakaan tunggal yang menimpa seorang tukang ojek bernama Darkin Saimen ketika sedang mengendarai sepeda motor dari arah stasiun TVRI, Gunung Nona, menuju pos benteng. Di daerah sekitar tempat pembuangan sampah, ia kehilangan kendali sehingga menabrak pohon Gadihu dan akhirnya menabrak rumah seorang warga bernama Okto. Nyawa Darkin tidak terselamatkan ketika dalam perjalanan ke rumah sakit dan akhirnya menimbulkan dugaan warga bahwa ia sebenarnya meninggal karena dibunuh, bukan akibat kecelakaan. Berdasarkan keterangan kepolisian, hasil otopsi dokter menyatakan Darkin murni meninggal karena kecelakaan, bukan akibat luka-luka kekerasan. Keterangan saksi dari lokasi peristiwa kecelakaan juga menyatakan demikian. Pertikaian akibat kematian Darkin menyulut aksi lempar batu dan perusakan sejumlah fasilitas umum antara dua kelompok. Kadiv Humas Mabes Polri Anton Bachrul Alam menyatakan pertikaian itu melibatkan dua kelompok yang tergolong “pemain lama” tanpa menyebut identitas masing-masing kelompok tersebut. (ant/m09)

Pemerintah Siapkan Rp1,7 T Atasi Kekeringan

Turnip, Senin (12/9). Dikatakannya, keputusan tersebut tertuang dalam surat keputusan bersama Nomor 02/SP.B/M-PAN-RB/8/2011 dan Nomor 800-032 tahun 2011 serta Nomor 141/ PMK.01/2011 tertanggal 24 Agustus 2011. Mekanismenya, kata Kaiman, masing-masing kabupaten/kota mengajukan permohonan ke pemerintah pusat melalui kementerian terkait. “Yang kami terima kan baru sekedar edaran keputusan tersebut, belum dijelaskan secara rinci mengenai bagaimana maksud dari keputusan tersebut. Tentunya, akan ada lagi sosialisasi mengenai hal itu,” lanjutnya. Namun, Kaiman Turnip mengaku, Pemprovsu maupun kabupaten/kota masih menunggu petunjuk lebih lanjut terkait pemberlakuan moratorium tersebut. (m28)

PLTB Sibayak ....

pagi. Kita menambah kekuatan di sana,” ujarnya. Penambahan pasukan itu, menurut Kapolri, sebagai tindakan antisipasi sekaligus upaya pencegahan yang dilakukan oleh pihak kepolisian guna mengendalikan situasi agar pertikaian tidak meluas. Polri, lanjut dia, siap untuk menambah pasukan lagi untuk dikirim ke Ambon apabila terjadi lagi dinamika di lapangan. Kapolri mengatakan saat ini semua kendali keamanan dilakukan oleh Kapolda Ambon dibantu oleh unsur pemerintah daerah. “Intinya preemptive dan preventif yang kita lakukan sekarang dari beberapa yang bertikai. Dari pemerintah daerah sudah melakukan langkah-langkah itu. Kita memperkuat. Semua kendali oleh Kapolda,” tuturnya. Kapolri menjelaskan saat ini kepolisian mengutamakan langkah-langkah preventif seperti memberlakukan ketentuan hukum agar masyarakat tidak membawa senjata api dan senjata tajam. “Itu yang kita lakukan, itu dilakukan bersama dengan tokoh masyarakat,” ujarnya. Kapolri menolak untuk menyebutkan jumlah korban yang tewas akibat pertikaian antar kelompok itu maupun kondisi terakhir di lapangan dengan alasan menghindari kesimpangsiuran. “Masih diupdate, nanti akan disampaikan. Masih dalam situasi yang simpang

dipersingkat karena seluruh pengurus Partai Golkar menyepakati satu hal, yaitu mengusung Aburizal Bakrie jadi calon presiden pada pemilu 2014,” kata Ketua DPD Par tai G olkar Bali Ketut Sudikerta di Denpasar, Senin (12/9). Ia mengatakan, Aburizal Bakrie dianggap sosok tepat untuk mewakili nurani rakyat Indonesia. Di internal Partai Golkar, kata dia, Aburizal mampu menjadi corong pemersatu seluruh kader Golkar yang tersebar di seluruh Tanah Air. “Pak Ical (panggilan Aburizal) sosok tepat pemimpin Indonesia ke depan. Kami optimistis mendukung beliau,” kata Sudikerta. Keputusan yang disepakati di Bali itu, menurut Sudikerta akan dituangkan kembali secara resmi pada rapat pimpinan nasional yang akan segera digelar. “Keputusan untuk mengusung Ical akan dituangkan lagi secara resmi pada rapat pimpinan nasional atau Rapimnas mendatang,” katanya.

untuk raskin ke-13. Nah, sisanya itu Rp1,7 triliun akan digunakan untuk program pompanisasi,” tuturnya. Program pompanisasi, jelas dia, akan mengalirkan dan menyediakan air bersih di daerah yang berpotensi sangat kering untuk mencukupi kebutuhan sehari-hari masyarakat maupun pengairan pertanian. Selain itu, pemerintah juga mempercepat program pembangunan waduk karena Badan Meterologi, Klimatologi, dan Geofisika (BMKG) telah

mengingatkan Indonesia dilanda badai El Nino yang bisa menyebabkan kekeringan sepanjang tahun. Dari 16 waduk utama di Pulau Jawa, Sumatera, dan Sulawesi, sebanyak 10 waduk berada dalam kondisi normal sedangkan enam lainnya berada dalam kondisi waspada. Enam waduk yang berada dalam kondisi waspada adalah Waduk Djuanda, Cirata, dan Saguling di Jawa Barat, Sermo di Yogyakarta, Bili-Bili di Sulawesi Selatan, dan Keuliling di Aceh.

9 Pengedar ....

yang ditangkap. Sementara tersangka yang ditangkap di antaranya Ansy, Frd, Sai, Chali, Dn, Ha, Rd, Hbb, Md dan dua orang yang menjadi DPO yaitu, Ju dan Naz, semua pelaku masih baru tamat SMA. Kasat Reskrim Polresta Banda Aceh AKP Isharyadi menambahkan, uang palsu pecahan Rp50 ribu itu telah beredar di wilayah Kota Banda Aceh dan Sigli selama September. “Uang palsu Rp50 ribu yang diedarkan mempunyai nomor seri yang sama UEA687701, jadi masyarakat yang mempunyai uang yang sama nomor serinya bisa melaporkannya ke polisi,” katanya. (cgto)

Kemenpolhukam ....

yang diperlihatkan Kemenko Polhukam itu. “Prinsipnya KIP Aceh siap dan bertanggungjawab dalam menjalankan tahapan yang sedang kami siapkan,” kata Akmal. Meskipun Badan Legislatif DPR Aceh sudah memutuskan tidak akan membahas ulang Qanun Pilkada Aceh, bagi KIP Aceh hal itu tidak mengganggu proses tahapan yang berjalan. Pangdam dan Kapolda Mendukung Sejalan dengan surat Kemenko Polhukam tersebut, Pangdam Iskandar Muda Mayjen TNI Adi Mulyono juga menyatakan pendapatnya agar sebaiknya Pilkada di Aceh jangan ditunda. “Saat ini kondisi keamanan di Aceh kondusif. Kalaupun suhu politik terasa agak naik, itu masih dalam tahap yang wajar. Oleh sebab itu kami sangat mendukung agar Pilkada Aceh tetap dilaksanakan tepat waktu,” katanya saat menghadiri pertemuan di ruang rapat Gubernur Aceh beberapa waktu lalu. Kalau Pilkada Aceh ditunda, Adi Mulyono kuatir hal itu akan memberi ruang kepada pihak-pihak tertentu untuk merencanakan kekacauan. Hal yang sama juga disampaikan Kapolda Aceh Irjen Pol Iskandar Hasan. Ia berharap agar tidak ada penundaan Pilkada Aceh, sehingga setelah masa jabatan Gubernur Aceh yang sekarang berakhir, segera dilakukan pelantikan terhadap gubernur yang terpilih. (cgto)

Menurut Kapolresta, SIA merupakan otak pembuatan uang palsu, karena di rumahnya ditemukan beberapa barang bukti alat pencetakan uang palsu, barang bukti di antaranya seperangkat alat komputer lengkap dengan CPU, mesin print lengkap dengan tinta, sebatang pisau carter dan penggaris. “Uang palsu pecahan Rp50.000 dibuat dengan cara diprint memakai kertas HVS, jumlah total yang dicetak Rp16 juta, sedangkan yang disita polisi sebanyak Rp13 juta, sehingga jumlah uang palsu yang telah beredar sebanyak Rp3 juta,” kata Armensyah Thay sambil menunjukkan barang bukti dan tersangka

Hotmangaradja dalam surat itu. Ia menegaskan, KIP Aceh selaku pelaksana kegiatan Pilkada di daerah ini agar tidak diintervensi siapapun, khususnya dalam menyusun penetapan tahapan Pilkada. Kemenko Polhukam tetap berharap agar pelaksanaan Pilkada di Aceh jangan sampai ditunda. Para komisioner KIP Aceh sendiri menyambut baik sikap

Prabowo Capres ....

“Kita harus berjuang untuk lolos verifikasi. Pemilu 2014 sangat strategis,” kata Prabowo dalam acara halal bihalal di kantor DPP Gerindra, Ragunan, Jakarta Selatan, Senin (12/9). Dia menilai pertarungan politik pada 2014 akan jauh lebih ramai. Terlebih, Partai Demokrat sudah tidak bisa mencalonkan SBY sebagai calon presiden kembali. “Rakyat bosan dengan janji-janji lama. Bosan dengan politisi-politisi yang tukang ngomong,” katanya. Mantan pasangan Megawati Soekarnoputri dalam Pemilu Presiden 2009 lalu ini mengisyaratkan akan maju dalam Pilpres 2014 mendatang. Dia menyatakan hakulyakin dapat menjadi figur alternatif. “Rakyat minta alternatif dan kita yang harus berani memberi harapan baru untuk rakyat Indonesia,” katanya. (vn)

Berita Utama

A2 Anggaran Pegawai Di Bawah 50% Daerah Boleh Terima CPNS MEDAN (Waspada): Meski moratorium penerimaan Pegawai Negeri Sipil (PNS) diberlakukan, daerah yang memiliki anggaran di bawah 50 persen untuk pegawai masih diperkenankan melakukan seleksi Calon Pegawai Negeri Sipil (CPNS). Namun demikian, bidang yang diperbolehkan tersebut masih harus dikonsultasikan dengan Badan Kepegawaian Nasional (BKN). “Memang ada keputusan yang memperbolehkan pengangkatan CPNS untuk belanja APBD pegawainya masih di bawah 50 persen. Namun, bukan berarti semua usulan akan dikabulkan. Karena itu masih akan dikonsultasikan dulu dengan BKN,” kata Kabid Pengadaan dan Pembinaan Badan Kepegawaian Daerah (BKD) Pemprovsu Kaiman Turnip, Senin (12/9).

Dikatakannya, keputusan tersebut tertuang dalam surat keputusan bersama Nomor 02/ SP.B/M-PAN-RB/8/2011 dan Nomor 800-032 tahun 2011 serta Nomor 141/PMK.01/2011 tertanggal 24 Agustus 2011. Mekanismenya, kata Kaiman, masing-masing kabupaten/kota mengajukan permohonan ke pemerintah pusat melalui kementerian terkait. “Yang kami terima kan baru sekedar edaran keputusan tersebut, belum dijelaskan secara rinci mengenai bagaimana maksud dari keputusan tersebut. Tentunya, akan ada lagi sosialisasi mengenai hal itu,” lanjutnya. Namun, Kaiman Turnip mengaku, Pemprovsu maupun kabupaten/kota masih menunggu petunjuk lebih lanjut terkait pemberlakuan moratorium tersebut. (m28)

Jhoni Alen Dilaporkan Ke KPK JAKARTA (Waspada): Wakil Ketua Partai Demokrat Jhoni Alen Marbun dilaporkan ke Komisi Pemberantasan Korupsi (KPK) dalam kasus dugaan menggelembungkan dana pembebasan lahan pemakaman umum Pondok Rangon, Jakarta Timur, sebesar Rp 10 miliar. “Saya menduga dia bermain dengan Pemerintah DKI Jakarta agar biaya pembebasan dikat-

Mantan Dirut Merpati Dicekal JAKARTA (Antara): Mantan Direktur Utama PT Merpati Nusantara Airlines berinisial HN, resmi dilarang berpergian ke luar negeri menyusul keluarnya surat pencekalan yang ditandatanganiJaksaAgungMudaIntelijen. “Jamintel sudah menandatangani pencekalan mantan Dirut Merpati,” kata Kepala Pusat Penerangan Hukum (Kapuspenkum) Kejagung, Noor Rachmad di Jakarta, Senin (12/9). HN menjadi tersangka dugaan korupsi penyewaan dua pesawat Boeing 737-400 dan 737-500. Ia menjelaskan alasan pencekalan itu untuk kepentingan penyidikan dan pencekalannya berlangsung selama enam bulan ke depan.

RI-Thailand ... Sementara di bidang perikanan, Presiden mengajak Thailand untuk meningkatkan kerja sama terutama dalam upaya mencegah pencurian ikan di masing-masing perairan milik kedua negara. PM Yingluck mengatakan, menghargai peran Indonesia dalam peningkatan kerja sama dengan Thailand. Ia sepakat dengan Presiden Yudhoyono bahwa kedua negara memiliki hubungan yang sangat baik dan berpeluang untuk terus meningkatkan kualitas dan kuantitas kerja sama. “Presiden dan saya sepakat ada cara untuk meningkatkan kerja sama energi dan perikanan. Kami harus perkuat dan

Jawaban Problem Catur,

Jawaban Problem Catur: 1. Gg7+, Rh7 (jika Rg8, Kf6+mat). 2. Kf6+, BxK. 3. GxB+, Bd7. 4. BxB+, Ge7. 5. BxG+, Rh6. 6. Gg5+mat.

Jawaban TTS: R N A Z A R I O A Z A N K A E R W N E L N A M U N I S O V I P S R D A R B I I D I N E G A R A H R S A D I L C P I J A K S A A

Politik & Hukum


tingkatkan kerja sama. Banyak mitra swasta Thailand berinvestasi di Indonesia terutama di sektor energi, dan Thailand mendukung kerja sama dengan Indonesia dengan dasar samasama menguntungkan dan mendorong swasta melakukan bisnis dengan cara bertanggung jawab contohnya CSR,” katanya. PM Yingluck Sihanwatra merupakan adik dari mantan PM Thaksin Sinawatra. Kunjungan sehari ke Indonesia merupakan salah satu paket kunjungan kerja luar negeri yang pertama. Dalam kunjungan ke di Indonesia, PMYinluck Sihawatra didampingi Menlu Thailand Surapong Tovichhakchaikul, Dubes Thailand untuk Indonesia Thanatip Upatising dan sejumlah pejabat Thailand lain.

Penahanan Anggota ...

TTS Dan Sudoku Dari Halaman Sport.

TTS Topik

rol,” kata Selestinus Angelo Ola selaku pelapor di KPK, Senin (12/9). Selestinus mengatakan Pemerintah DKI memperluas lahan pemakaman Pondok Rangon 3,5 hektare sejak 2007. Namun sebelum pemerintah melakukan pembebasan, Jhoni tiba-tiba membeli lahan ini seharga Rp 10 miliar. Pemerintah, lanjut dia, kemudian membeli lahan tersebut dari Jhoni sebesar Rp 22 miliar. Ia pun menduga Jhoni membeli lahan itu agar bisa me-markup dananya. “Kalaupun pemerintah beli dari Jhoni harusnya hanya Rp 10 miliar,” ucap dia. Pria yang mengaku mantan ajudan Jhoni ini menduga mantan bosnya bekerja sama dengan pimpinan proyek pembebasan lahan untuk memuluskan pencairan dana proyek. Jhoni yang kini anggota Komisi Energi Dewan Perwakilan Rakyat itu juga dituduh bermain dengan anggota DPR DKI Jakarta. “Indikasinya, kenapa lahan ini tidak langsung dibeli dari masyarakat?” ucap dia. Selestinus mengaku memiliki sejumlah data yang mendukung laporan tersebut. Namun ia belum menyetornya ke KPK karena menunggu respons lembaga antikorupsi tersebut. “Nanti saya akan beberkan semuanya,” ucap dia. (ti)


dari hasil pemeriksaan, polisi telah menahan dua orang yaitu Zul, 40, dan Muk, 39, keduanya tercatat sebagai warga Keumala. “Mereka berdua kita tahan, Sabtu (10/9). Kini bereka berdua ada dalam sel tahanan kita” ungkap Jatmiko. Sedangkan Sab, 38, tersangka lainnya yang juga warga Keumala, yang bersangkutan mangkir dari pemanggilan pertama polisi. Dan sekarang sudah dilakukan pemanggilan kedua. Menurut Jatmiko, para tersangka dikenai Pasal 351 dan 170 tentang pengeroyokan dengan ancaman hukuman di atas lima tahun. Pihaknya akan memproses kasus ini dan akan diteruskan ke pengadilan. (b20)

Ada-ada Saja ...

pengunjung kebun binatang. Pejabat di lembaga bidang satwa liar Malaysia mengatakan akan memaksa hewan primata ini menghentikan kebiasaan merokok mereka, seperti dilansir the Straitstime, Senin (12/9). N Pihak pemerintah setempat telah menyita orangutan dewasa bernama Shirley dari sebuah kebun binatang di negara bagian selatan Johor pada minggu lalu, setelah ia dan beberapa hewan lainnya dianggap hidup dalam kondisi Jawaban Sudoku: yang tidak layak. Shirley kini berada di ka6 9 7 4 1 3 8 2 5 rantina setelah dipindahkan dan 4 1 5 2 8 7 3 9 6 akan dikirim ke pusat satwa liar 2 3 8 9 5 6 4 1 7 di pulau Kalimantan dalam beberapa pekan mendatang. 8 6 3 5 7 1 2 4 9 Direktur Kebun Binatang 5 4 1 6 9 2 7 3 8 Melaka, Ahmad Azhar Moham7 2 9 3 4 8 6 5 1 med, mengatakan bahwa Shirley kini tidak lagi mendapat1 8 4 7 3 5 9 6 2 kan rokok karena ‘merokok bu3 7 6 1 2 9 5 8 4 kanlah perilaku normal bagi 9 5 2 8 6 4 1 7 3 orangutan’. (st/rzl)

WASPADA Selasa 13 September 2011

Pemkab Dan DPRD Rekomendasi Cabut Izin Sejumlah PTS Di G. Sitoli

Waspada/Dede Basri Hasibuan

PETUGAS pemadam kebakaran Pemko Karo memadamkan api .

PLTPB Sibayak Terbakar MERDEKA ( Waspada): Pembangkit Listrik Tenaga Panas Bumi (PLTB) di Desa Semagat Gunung, Kec. Merdeka, Kab. Tanah Karo, terbakar, Senin(12/9). Api diduga berasal dari pengelasan di atas motor pendingin yang terbuat dari fiber. Kerugian akibat peristi-

wa itu ratusan juta rupiah dan tidak ada korban jiwa. PLTB PT Digamatra Polindo, tenaga uap pembangkit listrik yang sudah beroperasi lima tahun di Desa Semagat Gunung, berada di lokasi PT Pertamina, sebagai rekanan. Api dengan cepat membakar gedung pendi-

Putra Khadafi Di Niger TRIPOLI, Libya (AP): Saadi Kadhafi dipastikan berada di Niger. Sebelumnya, putra mantan pemimpin Libya Moammar Khadafi tersebut dilaporkan masih berada di dalam Libya. Kepastian keberadaan Saadi ini disampaikan jurubicara pemerintah Niger. “11 September, patroli militer Niger menghentikan sebuah konvoi militer. Ternyata dalam konvoi tersebut ada seorang anak dari (Moammar) Khadafi,” ucap jurubicara pemerintah Niger Marou Ama-

dou seperti dikutip AFP, Senin. Jumat lalu, pemerintah Niger berjanji untuk menghormati hukum internasional jika beberapa tokoh Libya menyeberang ke wilayahnya. Mereka memastikan tiga orang jenderal era Khadafi telah tiba di Agadez. Namun, pemerintah setempat membantah bahwa Khadafi saat ini sudah berada di Agadez yang berbatasan langsung dengan Libya. Sementara keberadaan Khadafi belum diketahui hingga kini. (m10)

Enam Ditangkap, ...

Waspada konfirmasi Waspada mengatakan, seluruh tersangka yang ditangkap langsung dikirim ke Polresta Medan. Peristiwa pengrusakan pos polisi terjadi pada Minggu (21/ 8) dinihari. Puluhan anggota Geng Kereta bersenjata kelewang dan batu ini merusak pos polisi, kantor, sekolah, mobil dan sejumlah tempat usaha di tiga lokasi terpisah. Diamankan Sementara itu, mengantisipasi aksi sejumlah Geng Kereta di Kota Medan, petugas Reskrim Polsek Percut Seituan dan Unit Lalulintas Polresta Medan menjaring 126 unit sepedamotor dari Jln. Pertiwi, Kec. Medan Tembung, Senin (12/9) siang. Sejumlah sepedamotor yang terjaring ditengarai milik anggota Geng Kereta dan seorang diantaranya membawa senjata tajam. Pantauan Waspada di lokasi razia di Jln. Pertiwi persis di depan SMA Negeri 11 Medan dan SMK Teladan, di sepanjang jalan menuju kedua sekolah tersebut, sejumlah personel Sabhara, Reskrim Polsek Percut Seituan dan Unit Lalulintas berdiri di beberapa persimpangan jalan sembari memasang plang razia. Razia yang terkesan mendadak tersebut membuat sejumlah warga terlihat kalang kabut, bahkan balik memutar arah. Beberapa warga yang sedang mengantar anaknya ke sekolah juga terkena razia karena tidak memakai helm saat mengendarai sepedamotor. Warga

Cekak Merah G-1 di kawasan Pasar Melati. Ketiga anggota Geng Kereta ini diduga terlibat kasus pengrusakan pos polisi. Setiba di lokasi, anggota Timsus Polsek Sunggal Brigadir Samuel Sitepu, SH, mencoba mendekati tiga anggota Geng Kereta tersebut, namun mereka langsung melarikan diri dengan cara berpencar. Dalam pengejaran itu, Brigadir Samuel Sitepu, SH, berhasil menangkap tersangka MM tidak jauh dari Pasar Melati. Kemudian polisi melakukan pengembangan dan menangkap tersangka PS, FRN, JK,DP dan BA tidak jauh dari kediaman masing-masing. Dari keempat tersangka, polisi memperoleh informasi tentang kasus pengrusakan pos polisi di persimpangan Jln. Iskandar Muda – Jln. Pattimura yang melibatkan 54 anggota Geng Kereta Cekak Merah G-1, Gak Sor Main (GSM) dan Kreak-Kreak Bantai (K2B). Kini, polisi mulai mengidentifikasi ke-54 anggota Geng Kereta tersebut dan memburonnya. Saat ditanya Waspada, tersangka MM mengatakan, pengrusakan pos polisi tersebut melibatkan 60 anggota Geng Kereta Cekak Merah G-1, Gak Sor Main (GSM) dan Kreak-Kreak Bantai (K2B). “Setelah merusak pos polisi, kami terus berpencar dan pulang ke rumah masingmasing,” katanya. Kapolsek Sunggal AKP M. Budi Hendrawan, SH, SIK ketika

PRT Selamatkan ... Ika telah lima tahun bekerja dan tinggal bersama Prof Dr Catherine Yule, 50, seorang dosen di satu universitas swasta di Lembah Klang, Ampang Jaya, Malaysia. Dia selalu menemani Dr Catherine dan dua ekor anjingnya melakukan pendakian di Bukit Belacan di belakang rumah mereka. Teror tersebut terjadi pada 9 September lalu sekitar pukul 03:00 dinihari. “Peristiwa tersebut terjadi demikian cepat. Pria bugil itu berlari langsung ke arah majikan saya (Dr. Catherine) sebelum dia memukul wanita itu dan keduanya jatuh ke selokan,” kata Ika. Dengan rasa sakit dan cedera yang dialaminya, Dr Ca-

9 Pengedar Upal ... mendapatkan informasi dari masyarakat bahwa telah beredar uang palsu di Banda Aceh, kemudian tim Reserse Polresta menelusuri jejak pelaku. Tim reserse menangkap dua pelaku berinisial HBB, 19, dan NS,18, di jembatan Krueng Daroy Kota Banda Aceh. Setelah dilakukan pengembangan, polisi menangkap SlA, 19, di Keudah Banda Aceh. Menurut Kapolresta, SIA merupakan otak pembuatan uang palsu, karena di rumahnya ditemukan beberapa barang

ngin – teknik di lantai dua, sebagian besar alat pendingin terbuat dari fiber. Enam mobil dinas kebakaran Karo dikerahkan untuk memadamkan api. Pantauan Waspada, dua motor pendingin terbakar, yang terbuat dari bahan fiber plastik, serta tampak pengawalan ketat dari pihak PLTB, Dandim, serta personil Polsek Simpang Empat. Sementara Kapolsek Simpan Empat AKP Kandar megatakan, kebakaran sekira pukul 12:00. Asal api masih diselidiki. “Pegawai di sini hanya 50 orang, kami disuruh tutup mulut, sementara PLTB yang berada persis di belakang Pertamina sudah berdiri sekira 5 tahun,” terang seorang warga. Namun pimpinan Digantara Polindo tidak bisa dijumpai, meski wakil pimpinan berdalih, semua pertanyaan melalui manejer. Manejer berada di Jakarta.(c19)

therine keluar dari selokan. Dia melihat pria tersebut melemparkan pembantunya ke dalam lubang Ika sedalam satu meter dan memukuli Ika beberapa kali. Namun, keberanian Ika muncul, pria tersebut kewalahan menghadapi perlawanan itu dan melarikan diri sambil menyambar telefon selular Ika yang terjatuh dari sakunya. Wanita Australia itu yang telah tinggal di Malaysia selama 15 tahun dan lancar berbahasa Melayu mengatakan dia telah melakukan pendakian di daerah itu sejak tiga tahun lalu. Sebelumnya dia tidak pernah menghadapi serangan di tempat itu. Seorang jurubicara kepolisian mengatakan mereka kini sedang menyelidiki kasus tersebut. (thestar/m10)

juga tak menduga kalau di kawasan Jln. Pertiwi digelar razia terhadap para pengendara kendaraan bermotor. Umumnya, pengendara yang terkena razia tersebut karena tidak memiliki surat izin mengemudi (SIM) atau STNK, knalpot blong, dan tidak memiliki kaca spion. Banyak juga sepeda motor ‘bodong’ alias tanpa dilengkapi nomor plat polisi. Sebagian lagi diduga milik anggota Geng Kereta sesuai dengan nama kelompok masingmasing yang tertera di bagian bawah nomor plat polisi kendaraannya. Dalam razia tersebut, petugas Reskrim Polsek Percut Seituan mengamankan seorang pengendara sepedamotor berinisial MT alias Dimas ,19, warga Jln. Pasar Baru Gang Ateng, Desa Bandarkhalifah, Kec.Percut Seituan, karena membawa pisau bergagang warna putih. Akibatnya, buruh bangunan tersebut dijebloskan ke dalam sel. Kepada petugas, Dimas mengaku senjata tajam tersebut ditemukannya di tengah jalan dan digunakan untuk memperbaiki karburator sepedamotornya yang sering ngadat. “Pisau tersebut hanya kupakai kalau karburator keretaku rusak tibatiba di tengah jalan,” ujarnya. Kapolsek Percut Seituan Kompol Maringan Simanjuntak didampingi Kanit Reskrim AKP Faidir Chaniago menyebutkan, dari 100 lebih sepedamotor yang dijaring, sebagian tidak dilengkapi STNK dan kelengkapan lainnya.Dari 126 sepedamotor yang dirazia, 86 unit ditahan dan diserahkan ke Polresta Medan. Razia yang sama juga dilakukan petugas Polsek Medan Barat tepatnya di Jln Pertahanan, Pulo Brayan, persis di depan S MA Martadinata, Senin (12/9) sekira pukul 13:00. Sebanyak 20 unit sepedamotor tanpa dilengkapi dokumen kepemilikan diamankan ke Polresta Medan. Kapolsek Medan Barat AKP Nasrun Pasaribu menjelaskan, sebelum melakukan razia, terlebih dahulu melakukan penyuluhan di sekolah tersebut. Bahkan, sesuai hasil penyelidikan diduga ada murid yang masuk menjadi anggota Geng Kereta. Dikatakannya, 20 unit sepedamotor yang dimankan, masing-masing telah diberikan surat tilang kepada pengendarannya. (m36/m25/h04)

bukti alat pencetakan uang palsu, barang bukti di antaranya seperangkat alat komputer lengkap dengan CPU, mesin print lengkap dengan tinta, sebatang pisau carter dan penggaris. “Uang palsu pecahan Rp50.000 dibuat dengan cara diprint memakai kertas HVS, jumlah total yang dicetak Rp16 juta, sedangkan yang disita polisi sebanyak Rp13 juta, sehingga jumlah uang palsu yang telah beredar sebanyak Rp3 juta,” kata Armensyah Thay sambil menunjukkan barang bukti dan tersangka yang ditangkap. Sementara tersangka yang

ditangkap di antaranya Ansy, Frd, Sai, Chali, Dn, Ha, Rd, Hbb, Md dan dua orang yang menjadi DPO yaitu, Ju dan Naz, semua pelaku masih baru tamat SMA. Kasat Reskrim Polresta Banda Aceh AKP Isharyadi menambahkan, uang palsu pecahan Rp50 ribu itu telah beredar di wilayah Kota Banda Aceh dan Sigli selama September. “Uang palsu Rp50 ribu yang diedarkan mempunyai nomor seri yang sama UEA687701, jadi masyarakat yang mempunyai uang yang sama nomor serinya bisa melaporkannya ke polisi,” katanya. (cgto)

GUNUNGSITOLI ( Waspada): Dewan Perwakilan Rakyat Daerah (DPRD) dan Pemerintah Kota Gunungsitoli merekomendasikan agar Derektorat Jenderal Pendidikan Tinggi Departemen Pendidikan Nasional, mencabut dan membekukan izin penyelenggaran program studi sejumlah perguruan tinggi swasta di Kota Gunungsitoli, karena belum memiliki izin dan akreditasi yang jelas. Rekomendasi itu disimpulkan dari hasil rapat dengar pendapat umum DPRD bersama Dinas Pendidikan Kota Gunungsitoli dan sejumlah Pengurus Yayasan Perguruan Tinggi Swasta yang telah beroperasi di Kota Gunungsitoli, Jumat (9/ 9), antara lain STT Poliprofesi, Politeknik Poliprofesi, AMIK Universal, STT Universal dan STMK Apignosis. Rapat dipimpin Ketua Komisi B DPRD Kota Gunungsitoli, Damili. R. Gea, SH didampingi Pimpinan DPRD masing-masing, Armansyah Herfa, SE dan

Hadirat ST Gea, anggota dewan, Dinas Pendidikan Kota Gunungsitoli serta para pengurus yayasan perguruan tinggi swasta di Kota Gunungsitoli. Pada rapat tersebut STT Poliprofesi, Politehnik Poliprofesi, AMIK Universal, STT Universal dan STMK Apignosis tidak dapat menunjukkan izin pendirian dan penyelenggaran Program Studi PTSnya sehingga rapat dengar pendapat menyatakan ilegal. Perguruan Tinggi Swasta ini beserta pengelolanya dilarang melanjutkan kegiatan di wilayah hukum Kota Gunungsitoli, kecuali ada izin Dirjen Pendidikan Tinggi. Terkait dugaan penipuan terhadap ribuan mahasiswa dan calon mahasiswa baru yang dilakukan oleh yayasan pengelola dan atau pihak yang menjalankan PTS tersebut akan dilaporkan DPRD melalui Komisi B DPRD Kota Gunungsitoli ke Polda Sumut dan Polres Nias. Yayasan dan pengelola PTS tersebut diwajibkan mengem-

balikan uang pendaftaran serta uang yang pernah dikutip dari mahasiswa dan calon mahasiwa tanpa syarat dan potongan apapun. Kerugian material dan in material yang telah dirasakan oleh mahasiswa dan calon mahasiswa adalah tanggung jawab penuh yayasan atau pengelola PTS dimaksud. Pemerintah dan DPRD Kota Gunungsitoli berkewajiban mengeluarkan surat ke Dirjen Dikti untuk melaporkan yayasan atau pengelola PTS yang beroperasi di wilayah Kota Gunungsitoli dengan rekomendasi agar izin penyelenggaraan PTS dan Prodi dibekukan atau dibatalkan. Sementara, informasi diterima, sejumlah PTS di Kota Gunungsitoli khususnya pada penerimaan calon mahasiswa baru 2011, mencapai ribuan calon mahasiswa telah mendaftar dan membayar sejumlah uang pendaftaran bahkan uang kuliah tahap pertama bila ditotal miliaran rupiah. (a25)

Diburu Penyebar SMS ...

dian beredar informasi korban meninggal bukan karena kecelakaan. Sekarang penggunaan teknologi melaui sms, twitter tidak bisa dicegah, bagaimana masyarakat mencerna setiap menerima informasi itu. “Masyarakat harus memiliki daya tangkal, apa benar diajak untuk bakar toko, apa iya mau diajak keroyok si A, si B,” katanya. Ketika ditanya apakah ada tokoh atau kelompok masyarakat daerah setempat di Jakarta yang mendorong provokasi itu, Djoko mengatakan sejauh ini tidak ada. Justru yang ada imbauan dari tokoh Maluku di Jakarta agar bentrokan bisa diredam dan masyarakat kembali hidup berdampingan. Mengenai situasi Ambon saat ini, Djoko mengatakan sudah mendekati kondisi normal meski masih ada penjagaan di sejumlah sudut wilayah. Ia mengatakan ada personel aparat keamanan tambahan dari Makassar untuk menjaga situasi, diharapkan kondisi dapat normal sepenuhnya dalam waktu dekat. 6 Orang Tewas Puluhan Luka-luka Sementara Gubernur Maluku Karel Albert Ralahalu bersama musyawarah pimpinan daerah (Muspida) mengunjungi para korban luka tembak serta memberikan santunan sejumlah uang tunai kepada mereka yang menjalani perawatan di tiga Rumah Sakit. “Ada 16 korban luka tembak yang sedang menjalani perawatan, enam di antaranya masih menunggu waktu untuk dioperasi karena peluru masih bersarang di tubuh mereka,” kata Direktur Rumah Sakit umum Daerah (RSUD) dr. M. Haulussy Ambon, dr. Frona Koedoeboen saat menerima rombongan gubernur di Ambon, Senin. RSUD dr. Haulusy sejak Minggu (11/9) menerima 29 korban luka ringan, 16 korban luka berat dan dua orang di antaranya meninggal dunia. Sementara itu Direktur RS Alfatah Ambon, dr. Nona Maricar menjelaskan, telah menerima 94 pasien korban bentro-

kan menderita luka ringan, 10 orang luka berat dan empat korban lainnya meninggal dunia, sementara satu korban lainnya telah dirujuk ke Rumah Sakit Tentara (RST) Ambon. Sebelum memasuki halaman RS Alfatah, Gubernur dan rombongan menyempatkan diri menemui puluhan Kepala keluarga (KK) pengungsi di Masjid Jami dan melakukan dialog. “Sejak mengungsi hari Minggu (11/9), kami belum mendapat bantuan apa pun dari pemerintah daerah dan tidak mungkin kami kembali ke rumah karena sudah terbakar,” teriak sejumlah pengungsi. Para pengungsi ini berasal dari kawasan Lorong Tahu Mardika danWaringinTanah Lapang Kecil. Meski sempat emosi dengan situasi pertikaian antarwarga, Kepala Kanwil Kementerian Agama Provinsi Maluku, Umar Atamimi yang datang bersama rombongan muspida sempat menenangkan warga. “Kami minta saudara-saudara tetap tenang dan tabah serta tetap bersabar karena sudah menjadi tanggung jawab pemerintah untuk memperhatikan seluruh pengungsi yang menjadi korban pertikaian,” katanya. Gubernur dan rombongan juga mengunjungi korban bentrokan yang sementara menjalani perawatan medis di Rumah Sakit Bhakti Rahayu Ambon. Sejak bentrokan Minggu, RS tersebut menerima 16 pasien luka ringan dan tujuh lainnya menderita luka berat. Kerusuhan Merembes Aksi massa merembes ke kawasan Mardika - Batumerah, Kec. Sirimau (Kota Ambon), Senin (12/9) dinihari, ditandai dengan pembakaran sejumlah rumah penduduk. Pantauan wartawan, meski kawasan tersebut dijaga aparat keamanan dari Brimob Polda Maluku danTNI-AD, namun belum bisa menghalau konsentrasi massa yang berhasil membakar sejumlah rumah warga. Padahal sejak Minggu siang hingga sore hari, lokasi itu hanya dijaga sejumlah aparat polisi lalu lintas untuk mengatur arus kendaraan bermotor yang hilir mudik, meski terlihat konsetrasi massa tapi tidak disertai tindakan penghadangan maupun pengrusakan. Bahkan sejumlah warga dari dua kawasan itu masih sempat berkumpul untuk menenangkan suasana, namun menjelang tengah malam situasinya jadi berubah dan tidak terkendali sehingga terjadi aksi pembakaran di kawasan Mardika-Batu-merah dan seputaran kawasan Amans Hotel ke arah Mardika pantai. Akibatnya banyak warga yang memilih mengungsi untuk menyelamatkan diri ke sanak keluarga yang dirasakan aman, terutamawanitadananak-anakserta lansia dengan pakaian seadanya termasuk surat-surat penting. Aparat keamanan berulang kali melepaskan tembakan ke udara sebagai tanda peringatan, sementara Kapolres Pulau Ambon dan Pp Lease, AKBP Djoko Susilo belum bisa dikonfirmasi. (vvn/ant)

kebenarannya sehingga tidak terjadi salah pengertian. “Tolong sampaikan kepada masyarakat,janganterlalumudah diajak atau diprovokasi,” kata Menko Polhukam Djoko Suyanto di Istana Negara Jakarta, Senin (12/9), terkait bentrokan massa di Kota Ambon kemarin. Djoko Suyanto mengatakan saat ini berbagai informasi melalui perangkat teknologi dan jejaring sosial sangat deras sehingga masyarakat harus dapat memilah dan mencek kebenaran setiap informasi tersebut sehingga tidak terjadi kesalahpahaman yang berujung pada bentrokan sosial. Ia mengatakan, sesuai arahan Presiden Yudhoyono, permasalahan tersebut segera ditangani dengan cepat dan menyeluruh. Komunikasi dan laporan selalu diberikan Gubernur Maluku, Pangdam Pattimura dan Kapolda Maluku. “Tadi yang disampaikan Presiden, jangan terlalu membiarkan kejadian sekecil apapun sampai meluas,” katanya Karena itu segera ‘all out’ dalam menyelesaikannya mulai dari Gubernur, tokoh masyarakat, Pangdam, Kapolda dilaksanakan dengan baik, ujarnya. Djoko mengatakan aparat kepolisian saat ini masih mencari provokator penyebar pesan singkat atau pesan dijejaring yang mendorong masyarakat untuk bentrok. “Ini sedang dicari, nomornya masih ada, kepolisian juga sudah ada,” tegasnya. Menurut laporan, kata Djoko, bentrokan diawali adanya warga yang meninggal karena kecelakaan, namun kemu-

Jeffry Edo Siahaan ... ‘’ Sekarang, rencana itu tinggal rencana,’’ kata Siahaan seraya menarik nafas panjang. Jeffry tewas tertembak di bagian perut saat berada di depan rumahnya di Ambon. Saat itu, Jefrry yang sudah berada di Ambon sejak Juli lalu diduga ingin melihat situasi kerusuhan antar kelompok yang terjadi di kota itu. (m11/s)

Ricuh Suporter Bola, ... kemudian mengenai pendukung Pasi dan dari situlah awalnya dan kemudian suasana makin panas, puncaknya setelah pertandingan usai,” ujar seorang warga. Dikatakan, korban yang mengalami luka dan dirawat di RSUD antara lain Paizis Aritonang, Rondang Malau, Azis Limbong, Rudy Sagala, Anju Si-

Bus Vs Minibus ... berjalan dari arah Surabaya menuju Jombang, sedangkan minibus dari Jombang menuju Surabaya. “Korban yang meninggal dunia 21 orang penumpang dan untuk kronologi kejadian masih simpang siur,” katanya. Sebagian korban yang meninggal dibawa ke Rumah Sakit

hombing, Abdul Purba, Dwi Pinem, Tanamal Siregar, Supriyadi Sitanggang, Sugito Sihombing, Tindoan Sitohang. Kapolres Dairi AKBP Yustan Alpian SIK yang pada Senin malam langsung turun ke TKP bersama Wakil Bupati Irwansyah Pasi, dihubungi wartawan, Senin malam mengatakan pihaknya masih menyelidiki kasus itu. Belum ada warga yang diamankan. (a20) Umum Dr Wahidin Sudiro Husodo Kota Mojokerto sekitar lima kilometer dari lokasi. Petugas kamar jenazah RSU DrWahidi Sudiro Husodo, Didik Rudiono, mengatakan, sebagian besar jenazah berasal dari wilayah Kab. Nganjuk. “Saat ini kami masih terus melakukan koordinasi dengan petugas kepolisian terkait denganperistiwamautini,”katanya.

LENTERA ... menempamu menjadi manusia takwa dengan karakter kefitrian. Karakter kefitrian menampakkan tiga kapasitas pribadimu yang handal. Pertama, kebeningan atau kejernihan pandangan dan pikiranmu melihat segala hal termasuk pandanganmu terhadap Tuhan, kerja, profesi, dan orang lain, hingga engkau selalu mengagungkan Allah dalam segala aktifitas dan gerak gerikmu.(Q.S.2/al-Baqarah: 185). Kedua, sikap perlawanan dan daya tarungmu untuk melawan dan mengantisipasi setan serta iblis dengan segala bentuknya. Karena lawanmu ini bisa berbentuk para penjahat, bisa pula keluarga atau lingkunganmu yang menjadi jahat, dan bahkan bisa dirimu sendiri yang menjadi penjelmaan setan dan iblis. Lawan dan antisipasilah dengan karakter fitrahmu. (Q.S.35/Fathir:6)

Ketiga, karakter fitrah telah membekalimu dengan kecintaan dan penghargaan terhadap ilmu pengetahuan. Sebab saat makhluk lain diminta tunduk pada nenek moyangmu Adam dan Hawa, itu karena mereka unggul dalam ilmu pengetahuan (Q.S. 2/al-Baqarah: 31). Kini engkau dapat dihormati jika memiliki keunggulan ilmu dan teknologi. Sebaliknya engkau akan dipermalukan dan bisa saja diludahi mukamu jika komunitasmu tidak memiliki keunggulan dalam hal ilmu dan teknologi. Begitulah, di dunia bebas engkau akan diuji, apakah masih dapat bertahan sebagai manusia takwa berkarakter fitrah, atau akan hanyut dan tidak pernah mempengaruhi keadaan. Itulah sebabnya Allah memintamu mempertahankan karakter dan pakaian ketakwaan yang telah engkau tenun selama Ramadhan.(Q.S. 16/ al-Nahl: 92). Berlayarlah di samudera kehidupan bebas dengan karakter kefitrahanmu. Wa Allahu Â’lamu bi al-Shawab.

WASPADA Selasa 13 September 2011

Medan Metropolitan


Program BKKBN Diskriminasi

Waspada/Andi Aria Tirtayasa

PETUGAS Satlantas Polresta Medan menangkap sejumlah siswa SMA yang tidak memiliki SIM dan tidak memakai helm saat melakukan razia di Jalan Pertiwi, Kecamatan Medan Tembung, Senin (12/9) siang.

Terlibat Geng Kereta

Siswa SMAN 17 Dipecat MEDAN (Waspada): Seorang siswa SMA Negeri 17 dipecat karena terlibat geng kereta. Hal itu dilakukan untuk menghindari hal-hal yang tidak diingiinkan. Selain itu, masing-masing orangtua siswa dikirim surat memohon ikut mengawasi anak-anaknya. “Siswa itu kita pecat karena terlibat geng kereta. Kita tidak ingin siswa lainnya terikut, makanya begitu terbukti siswa itu ikut dalam geng kereta, langsung dikeluarkan dari sekolah ini,” kata Kepala Sekolah SMA Negeri 17 Marnaek Nainggolan pada saat apel bendera di SMA Negeri 17 Jalan Jamin Ginting Km 13,5, Kelurahan Lau Cih, Kecamatan Medan Tuntungan, yang dihadiri Wali Kota Medan Rahudman Harahap didampingi Kepala Dinas Pendidikan Kota Medan Hasan Basri, Senin (12/9). Dikatakannya, pada saat petugas Polresta Medan datang melakukan razia beberapa wak-

tu lalu sekitar 17 sepeda motor siswanya yang terjaring. Namun tidak seluruhnya diamankan terkait keterlibatan geng kereta. “Hanya beberapa saja yang kemungkinan diduga terlibat geng kereta,” ujar Marnaek. Sementara itu, Wali Kota Medan Rahudman Harahap dalam arahannya menegaskan kepada kepala sekolah se Kota Medan untuk menindak tegas siswanya yang terlibat geng kereta. Langkah ini harus dilakukan karena tindakan yang dilakukan sejumlah geng kereta selama ini sudah bertentangan dengan hukum dan sangat meresahkan masyarakat. Selain itu dalam upaya untuk terus men-

ciptakan kondisi Kota Medan tetap aman dan kondusif “Saya minta kepada kepala sekolah untuk mengambil tindakan tegas terhadap siswanya yang terlibat dengan geng kereta dan siswa yang tidak mampu mengawasi dirinya sendiri. Saya ingin siswa itu belajar serta menjalankan isi janji siswa dengan baik dan sungguhsungguh,” sebut Rahudman. Dikatakannya, terkait adanya sejumlah siswa SMA yang terlibat dengan geng kereta dan melakukan kerusuhan di sejumlah lokasi, termasuk beberapa siswa SMA Negeri 17. Atas dasar itulah tindakan tegas harus dilakukan, sebab wali kota tidak ingin ulah beberapa oknum siswa itu merusak nama baik sekolah. “Jangan pernah menyuruh orang lain untuk mengawasi kita. Justru begitu masuk SMA, kitalah yang mengawasi diri kita sendiri. Untuk itu saya minta

kepada seluruh siswa untuk tidak pernah melakukan tindakan melanggar hukum dan terlibat dengan geng kereta. Tugas siswa adalah belajar dan menjalankan isi janji siswa dengan baik,” tuturnya. Rahudman mengaku imbauan ini disampaikannya sebagai bentuk rasa kasih sayangnya kepada para siswa. Dia ingin para siswa belajar dengan baik sehingga berpretasi. Untuk itu diminta kepada kepala sekolah dan guru-guru supaya memberikan pemahaman kepada para siswa sehingga tidak melakukan tindakan kurang terpuji dan melanggar hukum. Kepada kepala sekolah dan guru, Rahudman mengingatkan untuk membangun pendidikan yang berkualitas harus dilakukan rasa kebersamaan dan rasa memiliki. Kepala sekolah harus mampu membuat terobosan sehingga mampu membuat muridnya tetap mengikuti pen-

Senior Dan OKP Dukung Ridho MEDAN (Waspada) Kendati pelaksanaan Musprov DPD KNPI Sumut berlangsung pada Oktober 2011, namun dukungan kepada Ir H Ahmad Yasyir Ridho Loebis agar melanjutkan kepemimpinan sebagai Ketua DPD KNPI Sumut, mulai berdatangan dari para senior KNPI serta kalangan OKP. Dukungan itu diungkapkan pada acara halal bihalal DPD Komite Nasional Pemuda Indonesia (KNPI) Sumatera Utara di Pantai Cermin Theme Park, Sergai, Kamis (8/9). Halal bihalal dihadiri Bupati Sergai HT Erry Nuradi, tokoh pemuda, senior KNPI Sumut serta seluruh DPD KNPI dari kabupaten/kota seSumut. Ketua Dewan Penasehat DPD KNPI Sumut H Ajib Shah mengatakan sangat salut dengan kepengurusan DPD KNPI Sumut di bawah kepemimpinan Yasyir Ridho. Di tengah

pertikaian di DPP KNPI, Yasyir Ridho mampu menjaga kondusifitas dan keharmonisan organisasi kepemudaan di Sumut, sehingga tidak terpecah belah seperti terjadi di sejumlah daerah di Indonesia Satu lagi nilai plus Yasyir Ridho yang patut diacungi jempol, kata Ajib yang juga aggota DPRDSU ini, KNPI Sumut mampu membuat berbagai kegiatan positif bagi elemen pemuda, meski tidak menerima alokasi anggaran dari Pemprovsu. “Ini menunjukkan KNPI Sumut bisa mandiri, tidak mengharapkan kucuran dana Pemprovsu. Karena itu, saya meminta Ir H Yasyir Ridho agar memimpin kembali DPD KNPI Sumut untuk kedua kalinya,” tegas Ajib Shah Dukungan senada juga disampaikan mantan Ketua DPD KNPI H Firdaus Nasution. Dalam sambutannya, Wakil

Ketua MPW Pemuda Pancasila (PP) Sumut ini menegaskan, Ketua MPW PP Sumut Anuar Shah telah memerintahkan dan mendukung Yasyir Ridho sebagai kader terbaik Pemuda Pancasila untuk memimpin kembali DPD KNPI Sumut. Sedangkan Ketua DPD KNPI Sumut Ir H Ahmad Yasyir Ridho Loebis mengatakan, dirinya membuka pintu kepada kader-kader pemuda di Sumut agar mencalonkan diri menjadi kandidat dalam bursa Ketua KNPI Sumut pada Musyawarah Provinsi (Musprov) DPD KNPI Sumut yang akan digelar pada Oktober 2011 mendatang. Pada kesempatan itu Ridho menyampaikan permohonan maaf kepada semua pihak bila selama kepemimpinannya telah menyinggung perasaan atau membuat sakit hati, baik dalam kebijakan yang diperbuatnya sebagai Ketua DPD

KNPI ataupun hal lainnya. “Mungkin ini halal bihalal terakhir dalam kepengurusan kami. Jadi pada momentum ini saya mohon maaf kepada semua pihak,” ujarnya. Sebelum pelaksanaan halal bi halal, pengurus DPD KNPI Sumut periode 2008-2011 melakukan rapat pleno untuk membahas pelaksanaan Musprov XII DPD KNPI Sumut tahun 2011. Rapat pleno itu menghasilkan tiga agenda, yakni menetapkan Sugiat Santoso sebagai Ketua Panitia Musprov ke-XII DPD KNPI Sumut. Disamping itu rapat pleno juga menetapkan Ketua Steering Comite (SC)Wempi Saragih dan pelaksanaan Musprov berlangsung pada Oktober 2011. Agenda lain juga menetapkan jumlah peserta musyarawah menjadi 72 OKP bertambah 10 OKP dari Musprov XI lalu yang diikuti 62 OKP. (m14)

didikan selama proses jam belajar berlangsung. “Tak lupa saya minta kepada Forum Komunikasi Pimpinan Kecamatan untuk ikut membantu dan terus memantau sekolah-sekolah yang berada di wilayah hukumnya, sehingga para siswanya tidak melakukan tindakan melanggar hukum maupun terlibat dengan geng kereta. Dengan kerjasama ini kita harapkan upaya untuk menjadikan kota ini tetap aman dan kondusif bisa diwujudkan,” ujarnya. (m50)

MEDAN (Waspada): Praktisi hukum Marasamin Ritonga, SH,M.hum mengakuli, program BKKBN Sumut tidak merata dan diskriminasi dalam mensosialisasikan penyuluhan keluarga berencana (KB) kepada masyarakat secara kolektif terhadap suku, etnis dan golongan. Ritonga mengatakan kepada Waspada, Senin (12/9), menanggapi program utama BKKBN dalam penyuluhan keluarga berencana tidak berjalan dan terkesan diskriminasi serta ada dugaan penyalahgunaan anggaran. Menurutnya, pada orde baru (orba) masa kepemimpinan Presiden Soeharto masih diakui kredibilitasnya dan berhasil dalam upaya menekan angka pertumbuhan penduduk. Selain tegas, program KB betul-betul diprioritaskan dan sarana prasarana ketika itu cukup memadai untuk melakukan sosialisasi. “Tapi sekarang ini, dinilai jauh dari ketika masa orba. Setelah masa reformasi muncul baru ada perhatian. Menurut hemat saya, program KB secara kolektif harus kembali diprioritaskan kepada semua masyarakat tanpa memandang status maupun golongan. BKKBN harus benarbenar melaksanakan programnya terutama dalam mengatur laju pertumbuhan penduduk,” kata Ritonga. Dia menilai, saat ini laju pertumbuhan penduduk terutama di Sumatera Utara sama sekali tidak terkendali. Padahal pemerintah menaruh harapan besar kepada BKKBN untuk mengatur laju pertumbuhan penduduk, karena masalah kependudukan merupakan program utama pemerintah. Apalagi BKKBN Sumut menghabiskan anggaran hingga Rp60 miliar untuk program KB tahun 2011. “Tapi cukup aneh, dengan anggaran sebesar itu, kok laju pertumbuhan penduduk di Provinsi Sumut terus meningkat pesat. Maka ke depan untuk menekan jumlah penduduk program BKKBN harus dirubah total agar dapat dilakukan secara merata,” ujarnya. Ketika disinggung masalah anggaran, Ritonga

menyebutkan, sekecil apapun sepanjang masih memakai anggaran pemerintah harus diaudit oleh BPK, BPKP dan KPK sebagai pengawasan sosial kontrol, walau mereka (BKKBN-red) mengatakan jumlah Rp60 miliar masih kurang. “Jika memang masih kurang pemerintah harus menambahnya, sehingga program KB dapat dilakukan secara maksimal,” sebutnya. Menurutnya, dalam soal promosi, sosialisasi, maupun penyuluhan, hampir tidak kelihatan, kalau pun ada dikategorikan bersifat seremonial saja. Karena masalah korupsi diduga tetap ada disemua instansi yang menggunakan anggaran negara. Secara terpisah advokat Muhammad Sai Rangkuty yang dihubungi di kantornya Jl. Willem Iskandar Medan Estate, mengatakan, dilihat dari pelaksanaan program KB belum maksimal dan terkesan masih seremonial belaka atau tidak meratanya program yang dijalankan oleh BKKBN Sumut yang dipimpin H Nofrijal, SP,MA. Terbukti jumlah penduduk yang terus meningkat pesat saat ini. Untuk dapat diduga terhadap anggaran BKKBN sebesar Rp60 miliar tersebut telah terjadi penyalahgunaan anggaran dan tidak menutup kemungkinan telah terjadi tindak pidana korupsi di dalamnya. “Berdasarkan analisa saya, sebagai praktisi hukum meminta kepada aparat penegak hukum untuk mengaudit dan memeriksa oknum-oknum di tubuh BKKBN Provsu. Apabila terindikasi telah terjadi tindak pidana korupsi, maka terhadap aset-aset mereka harus disita sebagai pengganti kerugian keuangan negara yang mencabik-cabik hati rakyat Sumatrera Utara khususnya,” kata Rangkuty. Sementara itu, Kepala Seksi Advokasi, Komunikasi Informasi dan Edukasi Kantor BKKBN Provsu Anthony, S.Sos ketika dikonfirmasi melalui telepon selularnya mengatakan, meningkatnya jumlah penduduk di Sumut bukanlah sematamata hanya wewenang BKKBN melainkan ada badan lainnya. (m24)

PTMHB Desak Poldasu Ungkap Pembunuhan Guru MEDAN (Waspada): Punguan Tuan Maruji Hutagaol Boru, Bere (PTMHB) mengancam akan melakukan aksi demo di Polda Sumut jika pihak kepolisian tidak segera mengungkap kasus pembunuhan Rosida Ferawati Hutagaol yang telah terpendam hingga tujuh bulan. Menurut Parlindungan Hutagaol, SP mewakili keluarga korban didampingi Wakil Sekretaris PTMHB Hendra Hutagaol, SH di redaksi Waspada, Senin (12/9), pihak kepolisian khususnya Polres Asahan bersama Poldasu harus segera menuntaskan kasus pembunuhan Rosida Ferawati Hutagaol. Korban merupakan guru PNS yang berstatus mahasiswa Unimed, warga Desa Parhitean, Kecamatan Balige, Tobasa, ditemukan tewas di aliran sungai Dusun I, Desa Padang Pulau, Bandar Pulau, Asahan, pada 11 Februari 2011. “Namun, sejak ditemukan tewas hingga kini,

kasus pembunuhan guru SD tersebut belum dapat diungkapkan Polres Asahan, sementara Polresta Medan sangat cepat mengungkap kasus pembunuhan seperti kasus Sri Wahyuni,” tutur Parlindungan. Sementara Wakil Sekretaris PTMHB Hendra Hutagaol, SH mewakil PTMHB yang diketuai Djumongkas Hutagaol, Wakil Ketua Horman Hutagaol SE, Sekretaris Marolop Hutagaol mendesak Polda Sumut segera membentuk tim khusus gabungan Polres Asahan dan Tobasa untuk mengungkap kasus pembunuhan Rosida. “Jika tindakan tersebut tidak dilakukan, maka PTMHB bersama warga Tobasa dan keluarga korban pembunuhan akan melakukan aksi demo di halaman kantor Polda Sumut mendesak pihak kepolisian bekerja secara profesional sehingga pelaku pembunuhan tidak bisa bebas begitu saja melakukan perbuatannya,” tuturnya. (m40)

Medan Metropolitan


WASPADA Selasa 13 September 2011

Puluhan PNS Bolos Terjaring Razia MEDAN (Waspada): Puluhan Pegawai Negeri Sipil (PNS) di jajaran Pemerintah Kota (Pemko) Medan terjaring Satuan Tugas (Satgas), Senin (12/ 9). Para PNS tersebut ditangkap pada saat berkeliaran di pusat perbelanjaan seperti Palladium dan sebagainya pada waktu jam kerja. Tim Satgas terdiri dari Kepala Badan Kepegawaian Daerah (BKD) Kota Medan Parluhutan Hasibuan, Asisten Pemerintahan Daudta P Sinurat, Kepala Inspektorat Farid

Wajedi dan Satpol PP dipimpin Plt Asisten Umum Ceko Wakdha Ritonga ini melakukan inspeksi mendadak (sidak) ke beberapa Plaza, Mall dan pasar tradisional.

Tim memulai sidak dari lokasi terdekat yakni Palladium Plaza persis berada di samping Kantor Wali Kota Medan dan menemukan dua orang guru status honorer mengenakan seragam PNS dari SD Center 78 Jalan Krakatau Medan, sedang asik melihatmelihat sovenir dan baju. Keduanya bahkan terlihat malu-malu dan sedikit takut saat mengetahui Kepala BKD Parluhutan juga ikut dalam sidak tersebut. Saat ditanya mengenai keberadaan mereka di Palladium saat jam kerja, keduanya mengaku sudah selesai mengajar dan ingin berjalan-jalan sembari pulang ke rumah. “Kita cuma singgah pak. Baru selesai mengajar,” ucap keduanya yang tidak menggunakan bed nama pada seragam PNS. Selain Palladium, Tim se-

lanjutnya kembali menemukan 5 orang pegawai berkeliaran pada saat jam kerja di Pasar Petisah. Dua orang diantaranya merupakan pegawai di Dinas Kesehatan (Dinkes) Medan, dua orang pegawai di Puskesmas Amplas dan 1 orang pegawai Dinas KB Kota Medan. Sementara itu, Tim kembali menuju Plaza Medan Fair, Carrefour dan kembali menemukan 1 orang guru SD di Asam Kumbang, Kecamatan Medan Sunggal. Plt Asisten Administrasi Umum Ceko menjelaskan, seluruh Pegawai Negeri Sipil yang ditemukan di pusatpusat perbelanjaan dan pasar tradisional akan diberikan peringatan dan melapor ke Badan Kegawaian Daerah (BKD) Medan dengan membuat surat pernyataan tidak akan melakukan kembali.

“Nama-nama mereka seluruhnya sudah kita catat. Seluruhnya tetap kita berikan sanksi berupa peringatan untuk tidak mengulangi perbuatan mereka lagi apapun alasan mereka keluar pada jam kerja kantor. Ini kita lakukan agar lebih meningkatkan disiplin pegawai di jajaran kita,” katanya. Sementara itu, Kepala Inspektorat Kota Medan Farid Wajedi mengimbau seluruh Pegawai Negeri Sipil maupun pegawai honor dibawah Pemko Medan agar tidak berkeliaran pada saat-saat jam dinas kerja. Pengawasan ini dilakukan salah satu upaya untuk meningkatkan disiplin PNS. “Kita akan secara rutin dan terus melakukan pengawasan lapangan untuk lebih meningkatkan disiplin PNS,” sebutnya. (m50)

Gubsu Minta Tambah Tenaga Penyuluh Pertanian Waspada/ist

HR Agung Laksono didampingi Sekretaris Kosgoro 1957 Sumatera Utara Riza Fakhrumi Thahir BBA pada silaturahmi kader dan sekaligus memberikan santunan kepada anak yatim di Panti Asuhan Al-Washliyah di Pinang Baris Medan.

Pengunduran Diri Surya Paloh Tak Akan Pengaruhi Suara Golkar MEDAN (Waspada): DPP Partai Golkar tetap menghormati kebijakan Surya Paloh mengundurkan diri dari partai, karena hal itu merupakan haknya sebagai kader partai. “Mudah-mudahan keluarnya Surya Paloh dari Golkar tidak akan mempengaruhi perolehan suara partai pada Pemilu mendatang,” kata Wakil Ketua Umum DPP Partai Golkar HR Agung Laksono pada acara silaturahim Idul Fitri 1432 H dengan kader Kosgoro 1957 di Panti Asuhan Al-Washliyah Jln. Pinang Baris Medan, Minggu (11/9). Dalam partai politik, menurut Agung, merupakan hal biasa ada kader yang keluar dari partai. Hal itu merupakan hak kader jika dia pindah ke partai lain. “Saya rasa sikap dari bung Surya Paloh itu patut dihargai. Akan lebih baik tentunya Surya bergabung, namun kalau ingin keluar, ya silahkan,” tambah Agung. Kehadiran Agung Laksono ke Panti Asuhan Al-Washliyah disambut Ketua PDK Kosgoro 1957 H Irwansyah Nasution, SH, MHum; Sekretaris Riza Fakhrumi Thahir dan tokoh Golkar Sumut di antaranya, H Wagirin Arman S.Sos dan Richard Edi Lingga. Selain bersilaturahmi, Agung juga memberikan santunan. Dia berharap santunan yang diberikan kepada anak yatim di Panti Asuhan Al-Washliyah dapat bermanfaat. “Ya, inilah kepedulian kami Kosgoro 1957 dengan masyarakat,” pungkas Agung. Sebelumnya, H.Irwansyah Nasution SH, MHum menyatakan, silaturahmi kader Kosgoro 1957 Sumatera Utara kali yang diadakan di Panti Asuhan ini bertujuan lebih mendekatkan diri kepada masyarakat.(m25)

MEDAN (Waspada): Plt. Gubsu Gatot Pujo Mugroho, ST, meminta pemerintah pusat melalui Kementerian Pertanian, Kementerian Kelautan dan Perikanan serta Kementerian Kehutanan agar dapat menambah tenaga penyuluh pertanian terampil. Hal ini untuk mewujudkan program satu desa, satu penyuluh di sektor pertanian di Sumut. Kemudian, tiga penyuluh masing-masing kelautan, perikanan dan kehutanan untuk setiap kecamatan yang berpotensi di daerah ini. Permintaan itu diutarakan Plt. Gubsu melalui sambutan tertulis yang disampaikan Staf Ahli Bidang Pemerintahan dan Hukum Pemprovsu Johan Samosir Harahap pada pembukaan sosialisasi Undang-Undang No.16 tahun 2006 tentang Program Pemberdayaan Penyuluhan Pertanian, Perikanan dan Ke-

hutanan di Convention Hall Hotel Garuda Plaza, Senin (12/9). Plt. Gubsu selaku Ketua Badan Koordinasi Penyuluhan Pertanian, Perikanan dan Kehutanan Sumut mengharapkan pemerintah pusat mempercepat ditetapkannya Peraturan Presiden RI tentang Kelembagaan Penyuluhan Tiga Sektor: Pertanian, Perikanan dan Kehutanan sebagai tindak lanjut dari UU No.16 tahun 2006 sehingga menjadi acuan bagi daerah untuk membentuk kelembagaan penyuluhan secara mandiri tanpa harus bergabung dengan dinas atau instansi terkait. Plt. Gubsu mengakui kelembagaan penyuluhan pertanian, perikanan dan kehutanan telah dibentuk di Sumut berdasarkan Perda no. 6 Tahun 2009 serta telah melaksanakan tugas dan fungsinya. Namun pelaksanaan di tingkat kabupaten/kota di

RSHAM Bantah Terlantarkan Bayi Korban Gempa MEDAN (Waspada): Pihak RSUP H. Adam Malik (RSHM) melalui Direktur Umum dan Operasional drg Tinon Resphati, M.Kes dan Kasubbag Humas Sairi M Saragih, DCN, M.Kes membantah telah menelantarkan bayi korban gempa sebagaimana pernyataan anggota Komisi E DPRDSU Richard Edi Lingga di Harian Waspada, Senin (12/9). Dalam surat hak jawabnya No: HK.02.03.1/IV.2.2/7208/2011 tanggal 12 September 2011, pihak RSUP H. Adam Malik menyatakan tidak benar bahwa rumah sakit tersebut sempat menelantarkan bayi berusia tiga minggu yang menjadi korban gempa. Dijelaskannya, pasien masuk IGD RSHAM pada Rabu (7/9) pukul 16.57 dan langsung ditangani dokter anak dan dokter bedah syaraf. Pelayanan telah dilakukan terhadap pasien Ucok Nababan, asal Sidikalang berusia 22 hari dengan keluhan utama luka lecet di kepala. Hal itu dialami pasien empat hari yang lalu setelah tertimpa reruntuhan dinding rumah saat terjadi gempa bumi. Bayi tersebut terjatuh dari gendongan ibu. Riwayat penurunan kesadaran, muntah, kejang tidak ada. Didiagnosa head injury GCS 14, kesadaran buka mata spontan, menangis kuat, gerakan spontan, GCS 14. Pemeriksaan rontgen Thorax AP menyimpulkan tidak tampak fraktur tulang-tulang dinding dada, tidak tampak pneumothoraks, dan tidak tampak gambaran perdarahan di kedua paru. Pasien masuk ruangan rawat inap Perinatologi pada Rabu (7/9) pukul 20.00 wib. Sementara kesimpulan Head CT-Scan tanpa kontras, pukul 22:00 menyimpulkan tidak tampak perdarahan intraserebral, sutura diastasis dan sub galeal hematom di pariental kiri dan hasil laboratorium dalam batas normal. Sedangkan Direktur Medik dan Keperawatan dr. Lukmanul Hakim, SpKK mengungkapkan Ucok Nababan, bayi korban gempa telah dibolehkan pulang karena keadaanya sudah membaik dan dijemput pihak Pemkab Dairi. (csf)

SKPD Respon Jumat Bersih MEDAN (Waspada): Gerakan Jumat Bersih yang dicanangkan Plt Gubsu H Gatot Pujo Nugroho, ST pada hari pertama kerja setelah libur panjang Lebaran, Senin (5/9), mendapat respon positip dari hampir seluruh unit kerja pada pelaksanaan perdananya, Jumat (9/9). Pantauan wartawan sejumlah pimpinan satuan kerja perangkat daerah (SKPD) turun langsung bersama pejabat struktural, staf dan pegawai setelah mengikuti senam pagi. Ada mengutip sampah, menyapu, membersihkan kaca jendela, kursi dan meja. Bahkan di beberapa SKPD bersih-bersih menyebar hingga luar ruangan, mengorek parit, menyapu halaman dan memotong rumput. Di Kantor Gubsu yang 10 lantai di Jalan P Diponegoro Medan, gerakan ini kelihatan menggeliat sejak dari lantai 1 yang langsung dikomandoi Kepala Biro Umum Setdaprovsu Hj Nurlela, SH. Di lantai 2 Kepala Biro Keuangan H Mahmud Sagala juga ikut langsung mengutip sampah, membersihkan kaca lemari dan sebagainya. Turunnya kedua Kepala Biro yang masih mengenakan pakaian senam di masing-masing unit membuat staf dan pegawai di Biro Umum maupun Biro Keuangan yang selain di lantai 2 juga menem0pati sebagian ruangan di lantai 3 dan 4 tampak antusias mengambil peran. Para pegawai pria sibuk menggeser meja dan lemari agar para pegawai wanita menyapu sampai sudut-sudut ruangan. Kepala Biro Umum Hj Nurlela yang juga memanfaatkan momentum ini untuk berdiskusi dan bersilaturrahmi dengan para pegawai memotivasi jajarannya untuk terus membudayakan susana bersih-bersih, bukan hanya hari Jumat melainkan setiap hari dan bukan hanya membersihkan ruangan secara fisik, melainkan juga membersihkan hati untuk tetap ikhlas memberikan pengabdian terbaik kepada tugas fungsi. (m28)

Waspada/Aidi Yursal

DR. H. IBRAHIM Saragih dampingi Drs. Pulung Hutabarat menyampaikan makalah pada acara sosialisasi UU No. 16 Tahun 2006, Senin (12/9).

Sumut, belum sesuai dengan amanat UU No.16 Tahun 2006. Dari 33 kabupaten/kota di Sumut, hanya lima kabupaten yang keberadaannya sudah sesuai UU No.16 tahun 2006 yakni Kabupaten Karo, Pakpak Bharat, Tapanuli Utara dan Padang Lawas serta Nias Selatan. Sementara 16 kabupaten/kota masih tetap bergabung dengan ketahanan pangan. Begitu juga 12 kabupaten/kota lainnya, termasuk Kota Medan, Kabupaten Deliserdang, Pematangsiantar dan Tebingtinggi sama sekali tidak sesuai amanat UU No.16 karena masih melekat di Dinas Pertanian atau Kelautan atau Kehutanan. Sementara itu, Ketua Panitia Pelaksana yang juga Kepala Badan Koordinasi Penyuluhan Pertanian, Perikanan dan Kehutanan Provinsi Sumatera Utara Drs. Pulung Hutabarat, AK, MM mengatakan, salah satu dari tujuan sosialisasi UU No.16 Tahun 2006 agar pemerintah kabupaten/kota di Sumut dapat mengetahui dan memahami tentang sistem penyuluhan di tiga instansi tersebut, serta pemerintah kabupaten/kota segera membentuk kelembagaan penyuluhan yang selama ini masih melekat di Dinas Pertanian. Acara sosialisasi itu menghadirkan beberapa narasumber di antaranya Dr. H. Ibrahim Saragih dari Kementerian Pertanian. Sosialisasi yang berlangsung 12-13 September 2011 ini diikuti 100 peserta dari 33 kabupaten/kota serta utusan dari Provinsi Sumut. (m22)

STIE-STMIK IBBI Gelar Pemaru MEDAN (Waspada): Sekolah Tinggi Ilmu Ekonomi (STIE) dan Sekolah Tinggi Manajemen Informatika dan Komunikasi Komputer (STMIK) IBBI menggelar acara Pembekalan Mahasiswa Baru (Pemaru) 2011 di Kampus IBBI Jln. Sei Deli No 18 Medan. Pembekalan yang berlangsung hingga 17 September 2011 ini, diikuti ribuan mahasiswa baru. Pembukaan Pemaru ini dihadiri Ketua Pengurus Yayasan Pendidikan IBBI Amrin Susilo Halim; Ketua STIE IBBI Prof Dr Amrin Fauzi; Ketua STMIK IBBI Ir B Ricson Simarmata, MSEE; Waka I STIE Lusiah, SE, MM; Waka I STMIK Sukiman, ST; Waka II STIE - STMIK IBBI Lili Suryati, SE; Waka III STMIK IBBI Andriasan Sudarso, S.Mn; Waka III STIE IBBI Budijanto, S.Si, M.Si serta para ketua program dan staf akademik STIE-STMIK IBBI. Ketua Pelaksana Pemaru Andriasan Sudarso, S.Mn me-

ngatakan, tujuan dari kegiatan tersebut yakni bagaimana membentuk karakter calon mahasiswa/i berkarakter, berilmu, serta kreatif dan tetap menjunjung tinggi norma serta nilai-nilai kekeluargaan. Ketika masuk ke dunia kampus, mereka lebih mudah memahami dan mengenalnya dengan segala pernak-pernik dan prosedur kampus yang berlaku. Sementara itu, Ketua STIE IBBI Prof Dr Amrin Fauzi mengatakan, mahasiswa/i baru telah menetapkan tujuan dan arah karir mereka sedini mungkin agar lebih fokus dalam pencapaiannya. Karena itu, mereka dituntut mampu bersaing dengan sumber daya manusia yang lain sehingga harus memiliki skill dan nilai lebih. Amrin Fauzi juga memaparkan tentang enam tipe manusia yakni Easy Convert, tipe manusia yang cenderung gampang beradaptasi dengan


KETUA Yayasan STIE – STMIK IBBI menyematkan topi pembekalan Pemaru 2011 kepada mahasiswa baru.

keadaan lingkungan. Tourist model, tipe manusia yang melakukan tugasnya hanya untuk kesenangan diri sendiri. Expatriote model,tipe manusia yang tidak suka berbaur atau hanya menyendiri saja. Kemudian Missionar y Model, tipe manusia yang bisa menjadi pemimpin atau menyampaikan pesan. Mistic Model, tipe manusia yang menyukai hal-hal berbau mistis atau misteri. Terakhir Critict Model, tipe manusia yang suka memberikan kritik atau bersikap kritis. Sedangkan Ketua STMIK IBBI Ir B Ricson Simarmata, MSEE mengingatkan pentingnya disiplin dan moral yang tinggi. Sebab, disiplin dibutuhkan untuk mengantarkan mereka ke gerbang keberhasilan. Namun keberhasilan tidak akan langgeng tanpa dibarengi moralitas yang tinggi. Sebelumnya Ketua Pengurus Yayasan Amrin Susilo Halim mengingatkan betapa berharganya menjadi orang sukses. Bila kesuksesan diraih, maka akan dihargai orang lain, keluarga dan teman-temannya. Menurut Amrin, ada empat hal yang harus dimiliki jika ingin terjun di masyarakat yakni kemampuan, penampilan, uang dan kekuasaan. “Dengan demikian, kita menjadi karakter yang sukses,” ujarnya. Pada kesempatan itu, Amrin Susilo Halim memberi penghargaan kepada para mahasiswa berprestasi terdiri dari ranking 1, 2 dan 3 dari setiap tingkat dan jurusan dengan studi banding ke luar negeri. (m25)

Waspada/Ismanto Ismail

TAK PERNAH DIASPAL: Warga Jln. Sutomo Dalam, Jln. Seram, dan Jln. Veteran, Kelurahan Pandau Hilir, Kecamatan Medan Perjuangan, mengeluh karena kondisi badan jalan di kawasan itu bagai kubangan kerbau karena 10 tahun lebih tidak pernah diaspal. Foto diambil barubaru ini.

Penderita Gangguan Jiwa Perlu Perhatian Keluarga MEDAN (Waspada): Penderita gangguan jiwa perlu mendapat perhatian keluarga dan sekitarnya untuk perkembangan jiwa dan mentalnya. Jika ditelantarkan dan tidak ditanggulangi sejak awal oleh keluarga, maka bisa semakin parah. “Sebenarnya tidak perlu malu untuk mengobati gangguan jiwa. Soalnya, gangguan jiwa sama dengan gangguan medis pada umumnya yang juga memerlukan pengobatan dan perhatian darikeluarga,” kata Elmeida Effendy SpKj, Rabu (7/9). Menurutnya, selama ini banyak mitos soal penyakit jiwa. Gangguan jiwa dianggap berkaitan dengan hal-hal gaib, ajaib, aneh. Orang yang mengalami gangguan jiwa sering dianggap karena kemasukan roh atau menuntut ilmu khusus (black magic), sehingga pengobatan cenderung mencari pengobatan supranatural dibandingkan medis. Elmeida mengatakan, gangguan jiwa berbeda dengan gangguan medis lainnya. Pada gangguan medis, jelas terlihat organ tubuh yang sakit, sedangkan pada gangguan jiwa tidak tampak organ tubuh yang sakit. Bahkan pemeriksaan laboratorium dan scanning pun tidak kelihatan. “Sehingga orang menganggap ini penyakit mistik, selain itu orang yang mengalami gangguan jiwa sering dicap orang yang malas, lemah, dan mengalami penyakit yang dibuat-buat.

Bahkan ada yang menganggap tinggal atau berinteraksi dengan orang yang mengalami gangguan jiwa adalah berbahaya,”sebutnya. Disebutkannya, di negara-negara berkembang dengan pendidikan masyarakat yang relatif lebih rendah, masih ada stigma terhadap gangguan jiwa. Sehingga orang tidak mau berkonsultasi dengan psikiater. Berbeda dengan negara maju. Kebutuhan akan psikiater sudah merupakan hal yang biasa. “Di sela-sela makan siang, para profesional terkadang akan berkonsultasi dulu dengan psikiaternya. Demikian juga sudah merupakan hal lazim ditemui, remaja yang tengah mengikuti perkuliahan juga memiliki jadwal khusus bertemu dengan psikiaternya untuk berbagi masalah dan menjadikan psikiaternya teman baik,” ujar Elmeida. Sementara itu, Haru T Parinduri SpKj (K) menyebutkan, kesehatan jiwa berhubungan erat dengan kabahagiaan seseorang. Seusai survey, paling tidak 30 persen orangtua mengaku tidak bahagia. Apalagi mereka yang tidak bisa menerima kehidupan dan status secara realistis sehingga munculkeputusasaandanketidakberdayaanyang dapat menimbulkan gangguan depresi. Dia menilai, banyak faktor untuk dikatakan bahagia. Faktor tersebut di antaranya kesehatan fisik, lingkungan, kebutuhan jasmani dan psikis, faktor dicintai oleh keturunan hingga soal kedekatan kepada Tuhan Yang Maha Esa. (csf)


KETUAYayasan Sari Mutiara Drs.W. Purba (empat kanan) dan Ketua STIKEs Mutiara Indonesia DR. Dra. Ivan Elisabeth Purba, M.Kes (empat kiri) pada wisuda 626 ahli madya kesehatan di Griya Dome, Sabtu (10/9).

Kualitas Tenaga Kesehatan Harus Ditingkatkan STIKes Mutiara Indonesia Wisuda 626 Ahli Madya MEDAN (Waspada): Penyelenggaraan upaya kesehatan harus dilakukan oleh tenaga kesehatan yang memiliki etik dan moral tinggi. Keahlian dan kewenangan harus ditingkatkan melalui pendidikan berkualitas sesuai perkembangan ilmu pengetahuan dan teknologi kesehatan. Demikian ditegaskan Ketua Sekolah Tinggi Ilmu Kesehatan (STIKes) Mutiara Indonesia DR. Dra. Ivan Elisabeth Purba, M.Kes pada acara wisuda 626 ahli madya kesehatan yang berlangsung di Griya Dome, Sabtu (10/9). Karena itu, lanjut Ivan, Yayasan Sari Mutiara yang mengelola STIKes Mutiara Indonesia terus berusaha meningkatkan kualitasnya dengan cara mengembangkan kurikulum, peningkatan pendidikan dosen, peningkatan sarana dan prasarana pendidikan serta meningkatkan hubungan dengan instansi dan asosiasi profesi terkait di Indonesia. Saat ini, seluruh program studi maupun akademi kesehatan di lingkungan Yayasan Sari Mutiara telah terakreditasi oleh Badan Akreditasi Nasional Perguruan Tinggi (BAN-PT) Kementerian Pendidikan Nasional RI, Kementerian Kesehatan dan asosiasi profesi. “Sebagai tempat praktik bagi para mahasiswa, kami juga bekerjasama dengan RSUP H. Adam Malik, RSU Dr. Pirngadi, RS Jiwa Daerah Provinsi Sumut, Laboratorium Kesehatan Daerah (Labkesda), sejumlah perusahaan farmasi, RS Persahabatan Jakarta, RS Harapan Kita Jakarta, RS Taman Harapan Baru Jakarta, RS Budi Kemuliaan Jakarta, RSUD Tarakan dan Ambulans Gawat Darurat (118) Dinas Kesehatan DKI Jakarta,” jelas Ivan. Pada kesempatan itu, Ivan melaporkan STIKes mewisuda sebanyak 626 ahli madya dari empat program studi yakni Kebidanan 462 orang, Keperawatan 52 orang, Analis Kesehatan

54 orang serta Analisa Farmasi dan Makanan sebanyak 58 orang. Sedangkan lulusan terbaik dari program studi Kebidanan diraihVeronika Margaret Siregar (IPK 3,64); Meri Klementina Hutasoit (IPK 3,61) dan Paulina Silaen IPK 3,60 Program Studi Kebidanan. Program studi Keperawatan yakni Eva Lidya Silaban (IPK 3,68);Yessi Debora Ambarita (IPK 3,58) dan Rika Melva Rumahorbo (IPK 3,41). Kemudian, program studi Analis Kesehatan yakni Renni Zubaidah (IPK 3,45), Elvis Siahaan (IPK3,38)danEsterJulianaSihite(IPK3,36).Terakhir program studi Analisa Farmasi dan Makanan yakni Clara Stepani (IPK 3,60), Ciciana Nababan (IPK 3,54) dan Meliana Kristina (IPK 3,50). Sementara itu, Kadis Kesehatan Sumut dr. Candra Syafei, SpOG dalam sambutannya disampaikan drg.Wan Jauhari, MARS memberikan apresiasi kepada STIKes Mutiara Indonesia yang telah banyak menghasilkan lulusan terbaiknya. Hal ini sebagai bentuk dukungan kepada pemerintah guna memenuhi kebutuhan tenaga kesehatan berkualitas. Sebelumnya, Ketua Badan Pelaksana Harian (BPH)Yayasan Sari Mutiara Parlindungan Purba, SH, MM mengharapkan para alumni STIKes Mutiara Indonesia dapat terus berperan di tengah-tengah masyarakat dan mengharumkan nama almamater. “Harapan kami kiranya para alumni STIKes Mutiara Indonesia tetap menjalin persaudaraan dengan almamater. Bila perlu, para alumni membentuk suatu wadah sebagai tempat berhimpunnya seluruh alumni STIKes Mutiara Indonesia,” ujar Parlindungan. Turut hadir dalam wisuda mahasiswa STIKes tersebut antara lain Ketua Yayasan Sari Mutiara Drs. W. Purba, Kopertis Wilayah I NAD-Sumut dan seluruh civitas akademi STIKes Mutiara Indonesia. (cag)

Medan Metropolitan

WASPADA Selasa 13 September 2011


Tas Ditarik Perampok

Tewas Jatuh Dari Sepedamotor MEDAN (Waspada): Akibat tarik-tarikan tas dengan dua perampok mengendarai sepedamotor, Ii Kesuma, 22, tewas terjatuh dari boncengan, di Jln. Sunggal depan PDAM Tirtanadi Medan, Minggu (11/9) malam. Informasi Waspada peroleh di lapangan, korban Kesuma, karyawati toko busana, pada pukul 21:30 dijemput adiknya Ade Kesuma, 17, dengan mengendarai sepedamotor Yamaha Vega ZR. Kedua kakak beradik itu hendak pulang ke rumahnya di Jln. Sri Gunting, Blok XVII, Desa Sei Beras Sekata, Kecamatan Sunggal, Kabupaten Deliserdang.

Namun, dalam perjalanan di Jln. Sunggal depan PDAM Tirtanadi, Medan Sunggal, tibatiba tas sandang warna coklat yang disandang korban, ditarik dua perampok mengendarai Kawasaki Ninja warna hijau dengan ciri-ciri si pengendaranya memakai baju kaos warna gelap dan yang dibonceng pakai topi (keduanya tanpa memakai helm).

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.30 08.40 10.45 11.55 13.55 15.45 18.35 18.30 19.50 09.40 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

07.55 08.55 11.10 13.00 14.05 15.10 17.50 19.05 21.35 12.25 17.45

CITILINK 1 Jakarta 2 Jakarta

09.45 19.00

Jakarta Jakarta

GA-040 GA-044

09.15 18.30

06.15 09.40 08.05 17.55 10.05 18.25 21.20 13.30 15.05 14.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Jakarta Bangkok (2,4,6) Hongkong (1,3,5,7)

QZ-8051 QZ-8055 AK-450 AK-454 QZ-8073 AK-5836 AK-456 QZ-7502 QZ-8085 QZ-7431

08.40 12.05 07.35 17.30 09.40 18.00 20.55 13.05 20.10 23.15

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabay Surabaya Banda Aceh Batam

JT-380 JT-300 JT-394 JT-302 JT-210 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 8289 JT-8287 JT-206 JT-208 JT-388 JT-308 JT-218 JT-971 JT-973 JT-397 JT-970

08.20 09.20 10.20 11.20 11.50 12.20 13.20 14.20 15.20 16.20 17.20 17.50 18.20 11.35 15.00 19.20 20.20 21.55 22.20 23.20 12.16 15.55 07.40 12.15

GA-041 GA-045

AIR ASIA 1 Kuala Lumpur QZ-8050 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 451 4 Kuala Lumpur AK-455 5 Penang QZ-8072 6 Penang AK-5937 8 Kuala Lumpur AK-457 9 Jakarta QZ-7503 10 Bangkok (1,4,6) QZ-8084 11 Hongkong (1,3,5,7) QZ-7.430 LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Batam

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 213 JT-201 JT- 387 JT-399 JT-383 JT-205 JT-8288 JT-8286 JT-385 JT-203 JT-215 JT-309 JT-209 JT-972 JT-972 JT-396 JT 970

06.00 07.00 08.20 09.00 10.00 11.00 12.00 12.30 13.00 14.00 15.00 16.00 16.35 09.10 12.30 17.00 18.00 18.30 20,00 21.00 07.00 12.55 19.00 07.00



MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.45

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 15.00

SILK AIR 1 Singapura 2 Singapura 3 Singapura (7)

MI-233 MI-237 MI-241

08.40 20.35 21.05

Singapura Singapura Singapura (7)

MI-232 MI-238 MI-242

07.50 19.50 20.00

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

09.35 17.25

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

09.10 17.50

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam

Y6-592 Y6-594 Y6-596 7P-568

10.10 16.15 20.00 13.00

Jakarta Jakarta Jakarta Batam

Y6-591 Y6-593 Y6-595 7P-567

09.55 18.30 19.20 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.00 16.20 10.20 16.00 11.55 07.20 15.25

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.20 18.35 15.45 12.50 15.25 13.25 10. 00 14.50

13.15 11.00

Subang Penang

FY-3412 FY-3402

12.56 10.40

SRIWIJAYA AIR 1 Subang FY -3413 2 Penang FY- 34.03

Jadwal Perjalanan Kereta Api No KA

Nama KA




U.2 U.4 U.6 U.8 U.1 U.3 U.5 U.7 U.10 U.12 U.9 U.11 U.14 U.16 U.18 U.13 U.15 U.17 U.22 U.21 PLB 7000 PLB 7007 PLB 7014 PLB 7017 PLB 7002 PLB 7004 PLB 7008 PLB 7010 PLB 7012 PLB 7001 PLB 7006 PLB 7015 PLB 7003 PLB 7005 PLB 7009 PLB 7011 PLB 7013

Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Siantar Ekspres Siantar Ekspres Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa

Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonom Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Medan Medan Medan Tebing Tinggi Belawan Belawan Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Belawan Belawan Belawan Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan Medan Medan

Berangkat Datang 08.00 10.30 15.00 22.50 08.00 14.45 17.10 23.00 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 16.50 12.00 07.30 05.00 09.50 12.15 14.40 06.20 08.40 17.50 08.55 06.30 11.00 13.30 15.50

13.21 15.25 20.28 03.52 13.22 19.59 22.01 04.24 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.17 17.37 12.47 08.22 05.52 10.42 13.07 15.32 07.21 09.27 18.27 09.47 07.22 11.52 14.22 16.42

Informasi Pemesanan -Stasiun KA Medan (061) 4514114, -Stasiun KA R. Prapat (0624) 21617.

Melihat hal itu, korban mempertahankan tasnya sehingga terjadi tarik-tarikan dengan perampok tersebut. Namun, akibat hentakan keras perampok itu, korban terjatuh dari boncengan sepedamotor dan terhempas ke aspal, sedangkan tasnya berisikan handphone dan uang berhasil dibawa kabur pelaku. Dalam kondisi kritis akibat terjatuh dari sepedamotor, korban dilarikan ke RS Bina Kasih

Jln.TB Simatupang Medan Sunggal. Setelah mendapat perawatan sekitar setengah jam, korban Ii Kesuma menghembuskan nafas terakhirnya. Menurut Kapolsek Sunggal AKP M Budi Hendrawan, SH,SIK didampingi Kanit Reskrim AKP Victor Ziliwu, SH,SIK, berdasarkan permintaan pihak keluarga, jenazah korban dibawa ke rumah duka untuk disemayamkan.

Senin (12/9) siang, jenazah korban dishalatkan di Mushola Nurul Hidayah lalu dikebumikan di perkuburan muslim di sekitar mushola tersebut. Kata Budi Hendrawan, pihaknya sudah membentuk tim khusus dipimpin Kanit Reskrim mengusut kasus tersebut. “Timsusnya kini sedang bekerja mengumpulkan berbagai informasi dari masyarakat maupun saksi lainnya,” sebutnya. (m36)

Pasutri Kehilangan Rp50 Juta Di Quan Spa JW Marriot MEDAN (Waspada): Sepasang suami istri (Pasutri) yang lagi menikmati fasilitas Quan Spa Hotel JW Marriot kehilangan barang berharga dan uang senilai Rp50 juta yang disimpan di locker no 6 hotel tersebut. Kedua korban yakni Milka Kusnardy, 45, dan suaminya Jawaris Asiah, 47, warga Jln Bambu I, Kel. Durian, Kec. Medan Timur. Kasus ini sudah dilaporkan korban ke Polresta Medan, Senin (15/8). Korban usai menjalani pemeriksaan ulang di Polresta Medan, Senin (12/9) mengatakan, mereka sudah menjadi member di Quan Spa. “Saya punya member tiga bulan lagi disitu (Quan Spa Hotel JW Marriot),” ujar Milka. Diceritakannya, peristiwa itu berawal ketika akan berganti pakaian, dia berjalan menuju locker Quan Spa yang ada di lantai 17. Ketika berjalan, Milka berpapasan dengan Zulaika (karyawati Quan Spa) dan seorang wanita tak dikenal.

Milka pun sempat menyapa wanita tak dikenal itu dengan senyuman, karena wanita yang sehari-hari berprofesi sebagai pengusaha bahan kimia ini menganggap wanita tersebut karyawan Quan Spa. Dia tak menaruh curiga dan langsung meletakkan tasnya yang berisi uang Rp5,2 juta, uang 3000 US dollar, 425 dollar Singapore, sepasang anting berlian, HP Nokia N91, HP Black Berry Bold dan surat berharga lainnya di locker no 6. Namun saat Milka melepas anting dan memasukkan ke dalam tas, wanita tak dikenal itu memperhatikannya dan mengutarakan maksudnya untuk bergabung menjadi member Quan Spa. Milka mengaku tak pernah mengenal wanita itu sebelumnya. Sedikit curiga, Milka lalu mengunci locker yang dititipinya barang. Korban kemudian masuk keruangan spa untuk menikmati fasilitas Hotel JW Marriot itu.

Usai Spa sekitar 45 menit, dia kembali ke locker no 6 untuk mengambil barang-barang miliknya. Namun, korban terkejut menemui locker tempatnya menyimpan barang sudah rusak dan terbuka. Dia melihat tas berisi barang berharga raib dan langsung menemui suaminya. Tak terima, pasutri itu pun langsung menemui Manager hotel JW Marriot bernama Assraf. Ketiganya sempat berdebat karena pihak hotel tak mau bertanggung jawab. Merasa dirugikan, korban mendatangi Polresta Medan dan membuat pengaduan. Sementara, Assraf selaku Manager Hotel JW Marriot enggan berkomentar. “Nanti saja ya saya hubungi, saya sedang sibuk,” ujarnya sembari menutup ponsel saat dihubungi wartawan, Senin (12/9) siang Kasat Reskrim Polresta Medan, AKP M Yoris Marzuki mengaku masih menyelidiki kasus ini. “Masih kita lidik,” katanya. (m39)

Mantan Kadis Pariwisata Didakwa Korupsi Rp700 Juta MEDAN (Waspada): Mantan Kepala Dinas Pariwisata Kota Medan didakwa telah melakukan korupsi dengan mencairkan dana APBD 2008 yang diperuntukkan sebagai honor pegawai yang melalukan penertiban sebesar Rp50 juta. Jaksa Penuntut Umum (JPU) Rehulina Purba, SH dalam dakwaannya mengatakan, dana tersebut digunakan terdakwa untuk kepentingan pribadi. “Padahal, Kasi Rekreasi dan Hiburan Maradoli telah membayar duluan menggunakan dana kutipan. Setelah dana itu cair, terdakwa mengambil dan menggunakannya untuk kepentingan pribadi,” ujar JPU di depan majelis hakim Pengadilan Tipikor di Pengadilan Negeri Medan, Senin (12/9).

Sementara terdakwa mantan Kadis Pariwisata Syarifuddin membantah telah menerima sejumlah uang dari Kepala Seksi Rekreasi dan Hiburan Maradoli hasil uang retribusi tempat hiburan Kota Medan pada tahun 2008 sebesar Rp450 juta yang tidak disetorkan ke kas daerah. “Saya tidak pernah menerima uang itu dari Maradoli. Uang itu sama Maradoli semua,” ujar Syarifuddin ketika didengarkan keterangannya sebagai terdakwa dalam dugaan korupsi retribusi Izin Usaha Pariwisata (IUP) tahun 2007 dan 2008 sebesar Rp772,8 juta. Menurutnya, sebagian dana itu digunakan Maradoli untuk membayar honor-honor pegawai yang melakukan penertiban selama bulan Ramadhan. “Ka-

rena dana APBD 2008 belum cair sementara dana operasional mendesak, Maradoli menggunakan dana retribusi untuk membayar honor anggota,” ujarnya seraya mengaku memang ada menandatangani surat perintah untuk melakukan penertiban selama bulan suci Ramadhan. Terbongkarnya dugaan korupsi itu, sebutnya, karena ada pemeriksaan dari Badan Pemeriksa Keuangan (BPK) pada tahun 2009. “Ketika itu, ditemukan kerugian hingga Rp700 juta lebih,” sebutnya. Usai mendengarkan keterangan terdakwa, sidang ditunda hingga Kamis (22/9) mendatang, dengan agenda pembacaan tuntutan oleh Jaksa Penuntut Umum. (m38)

Mantan Kabag Keuangan Langkat Dihukum 16 Bulan Penjara MEDAN (Waspada): Terbukti melakukan tindak pidana korupsi dana Perubahan APBD Langkat 2007 sebesar Rp1,7 miliar terkait proyek pematangan lahan Bukit Lawang, mantan Kepala Bagian Keuangan Langkat H Taufik dihukum 16 bulan penjara pada sidang di Pengadilan Tipikor PN Medan, Senin (12/9). Selain dijatuhi hukuman penjara, Taufik dibebankan membayar denda Rp50 juta subsider dua bulan kurungan. Namun, Taufik dibebaskan majelis hakim dari hukuman membayar uang pengganti atas kerugian negara karena ia tidak menikmati uang hasil korupsi tersebut. “Hal yang meringankan terdakwa bersikap sopan santun di persidangan, belum pernah dihukum dan tidak menikmati hasil perbuatannya,” kata ketua majelis hakim Erwin Mangatas Malau. Putusan majelis hakim itu

lebih ringan dari tuntutan JPU Kejatisu sebelumnya dua tahun penjara. Taufik dinyatakan terbukti bersalah melanggar Pasal 3 UU Pemberantasan Tindak Pidana Korupsi jo Pasal 55 ayat (1) ke1 KUHP. Ia terbukti menyalahgunakan kewenangan untuk menguntungkan diri sendiri dan orang lain, serta merugikan keuangan negara. Majelis hakim dalam amar putusannya menyatakan, anggaran pembayaran pokok utang kepada pihak ketiga (CV Surya Nusantara Indah/SNI) terkait dengan pengerjaan pematangan lahan Bukit Lawang tidak pernah dibahas di DPRD. Anggaran itu masuk dalam draf Kebijakan Umum Anggaran (KUA)-Plafon Penggunaan Anggaran Sementara (PPAS) PAPBD 2007 tanpa melalui pembahasan. Taufik terbukti menyalahgunakan kewenangannya yang saat itu sebagai Kabag Keua-

ngan sekaligus Ketua Tim Anggaran Pemkab Langkat dengan memerintahkan Zulkarnain, staf komputer, untuk menyisipkan mata anggaran pembayaran pokok utang kepada pihak ketiga terkait pematangan lahan Bukit Lawang sebesar Rp1,7 miliar ke dalam draf KUA-PPAS P- APBD Langkat 2007 sebelum ditandatangani Bupati dan Pimpinan DPRD Langkat. Dia menyalahgunakan wewenangnya sebagai Bendahara Pemkab Langkat dengan menyetujui pencairan dana Rp1,7 miliar tersebut dan membayarkannya kepada Richard Tamir selaku Dirut CV SNI tanpa didukung dokumen pendukung yang sah. Menanggapi putusan majelis hakim itu, Taufik dan pengacaranya menyatakan pikir-pikir. Majelis hakim memberikan tujuh hari bagi Taufik dan tim jaksa untuk mempertimbangan putusan itu. (m38)

Poldasu Segera Gelar Perkara Dugaan Korupsi Polmed MEDAN (Waspada): Polda Sumut dalam waktu dekat akan melakukan gelar perkara terhadap dugaan kasus korupsi Politenik Medan (Polmed). Rencana itu dikemukakan Direktur Reserse Kriminal Khusus (Dir Reskrimsus) Polda Sumut Kombes Pol. Sadono Budi Nugroho melalui Kasubbid Pengelola Informasi dan Data Humas Polda Sumut AKBP MP Nainggolan, Senin (12/9). “Kita akan melakukan gelar perkara pada minggu ini. Waktunya nanti diberitahukan,” sebutnya. Mengenai pemanggilan Dewi Komaria (DK), Direktur CV Medika Karya, Nainggolan menyatakan, DK sudah pernah

dipanggil oleh Tipikor Polda Sumut beberapa waktu lalu. “Dari keterangannya, semuanya menjurus pada pemenang tender pengadaan alat laboratorium, pendidikan bengkel jurusan Elektro Polmed pada 1 Oktober 2010 yaitu Herman Taher dari PT Astasari Sartika. Yang bersangkutan mengaku menjadi boneka dari Herman Taher. Kendati demikian DK tetap akan kita lakukan pemeriksaan dalam kasus ini,” katanya. Dia mengatakan, Tipikor Poldasu telah mengagendakan pemanggilan terhadap pimpinan Polmed, baik itu direktur dan pembantu direkturnya. “Rencana pemanggilan tersebut

sudah diagendakan, namun terlebih dulu akan dilakukan gelar perkara kasus ini,” tuturnya. Terkait kasus ini, Tipikor Poldasu telah melakukan penyitaan barang bukti berupa satu paket alat peraga masingmasing, tiga item robot, mikrowelle, network analyzer (untuk menangkap sinyal) serta sejumlah dokumen yang berkaitan dengan kasus itu. Berdasarkan audit Badan Pengawasan Keuangan dan Pembangunan (BPKP) Sumut, proyek itu mengakibatkan kerugian negara Rp2,1 miliar dari total anggaran Rp4,5 miliar dari Anggaran Pendapatan Belanja Negara (APBN) 2010. (m27)

Waspada/Andi Aria Tirtayasa

MEMBAWA SENJATA TAJAM: Kapolsek Percut Seituan Kompol Maringan Simanjuntak menginterogasi pengendara sepedamotor karena membawa senjata tajam saat dilakukan razia di Jalan Pertiwi, Medan Tembung, Senin (12/9) siang.

4 Perusahaan Terkait Kapal MT Cosmic 11 Belum Diperiksa BELAWAN (Waspada): Empat perusahaan yang diduga terlibat dengan masalah minyak yang diangkut kapal MT Cosmic 11 yakni PT Pelayaran Nasional Aeromic beralamat di Batam selaku pemilik kapal, PT Cosmic Indonesia beralamat di Batam selaku penjual BBM yang dimuat ke MT Cosmic 11, PT Petrobas beralamat di Jakarta selaku penjual BBM ke Inalum, dan PT Inalum selaku pembeli, belum diperiksa polisi. Akibatnya LSM Koalisi Masyarakat Demokrat Pemantau Minyak dan Gas Bumi (KomdepMigas) Sumatera Utara yang sebelumnya memberikan apresiasi kepada Ditpolairdasu atas keberhasilan Polair mengungkap masalah itu, kecewa. “Masalah ini sudah lebih dua minggu, kenapa mereka belum dimintai keterangan,” ucap CP Siregar, ketua LSM itu, Senin (12/9). Padahal, kata Siregar perbuatan para pihak terutama PT Petrobas bisa dikategorikan melanggar pasal 54 UU No 22 tahun 2001 tentang Migas karena perusahaan itu diduga tidak memiliki izin niaga BBM jenis IDO atau Industri Disel Oil dari Dirjen Migas, sehingga dapat dipidana penjara selama 3 tahun dan denda Rp30 miliar. LSM itu juga curiga dengan dipindahkannya kapal MT Cosmic 11 yang sebelumnya ditahan dan sandar di salah satu dermaga di Belawan, kini telah berada di Kwala Tanjung, Batubara. “Kami dapat kabar kapal itu berangkat dari Belawan, Minggu sore,” sebut Siregar. Menurutnya, di dalam dokumen kapal disebut BBM yang diangkut Cosmic 11 adalah

BBM jenis solar (marine gas oil) namun berdasarkan hasil labolatorium Pertamina kilang Dumai yang dimintakan Ditpolair Sumut, diketahui BBM yang diangkut itu berjenis IDO yang jelas berbeda dengan solar. “Jika kasus ini tidak dituntaskan, maka Komdep-Migas akan membawa masalah ini ke menteri terkait dan Mabes Polri,” sebutnya. Dirpolair Sumut Kombes Ario Gatut Kristianto saat dikonfirmasi melalui HP membantah kalau kapal itu dilepas. Pihaknya mengeser kapal tersebut ke Kwala Tanjung karena posisi kapal saat berada di Belawan mengganggu alur pelayaran. “Gak dilepas, cuma digeser dan kapal itu masih disegel disana,” katanya. Disinggung tentang pemeriksaan atau kelanjutan terhadap empat perusahaan yang diduga terlibat, Dirpolair mengatakan pihaknya akan memeriksa PT Inalum. “Anggota masih disana menjemput mereka dan perusahaan lain akan tetap kita periksa karena masalah ini masih terus berlanjut,” ujar Ario. Sebagaimana pemberitaan sebelumnya, Ditpolairdasu menangkap kapal tanker (MT) Cosmis 11 yang mengangkut 1000 ton minyak jenis Industri Diesel Oil (IDO) atau MDO di perairan Kuala Tanjung pada 22 Agustus 2011 sekaligus menahan nakhoda kapal Kapten Johanes Salamun, warga Surabaya. Kapal tanker ditangkap tim patroli Mabes Polri Anismadu649saatkapaltersebuthendakmembawa muatannya ke PT Inalum. Dugaan sementara ketikaitu,kapal ditangkapkarenadaftarmanifesnya tidaksesuaidokumenpajakyangdibayarkan. (h03)

Larikan Gadis Di Bawah Umur

Anggota DPRD Sergai Akan Diperiksa MEDAN (Waspada): Polda Sumut akan menggelar kasus dugaan persetubuhan dan melarikan gadis di bawah umur dengan tersangka anggota DPRD Serdangbedagai berinsial Rus. Setelah itu penyidik melakukan pemeriksaan. Anggota DPRD dari Partai Hanura itu dilaporkan telah membawa lari gadis AZ, 17, sehingga penyidik perlu membuktikan kebenaran laporan itu. “Gelar perkara dilakukan untuk “mendudukkan” kasusnya. Kalau ditemukan unsur pidana, maka kasusnya ditingkatkan dari penyelidikan ke penyidikan,” kata Kasubbid Pengelola Informasi dan Dokumentasi Humas Poldasu AKBP MP Nainggolan, di Mapoldasu, Senin (12/9). Nainggolan mengatakan, sampai saat ini pihaknya belum mengajukan permohonan izin pemeriksaan yang bersangkutan kepada Gubsu, karena kasusnya masih dalam tahap penyelidikan. Tetapi jika sudah masuk tahap penyidikan dan ditetapkan sebagai tersangka, maka

penyidik segera mengajukan izin permohonan pemeriksaan itu, sekaligus penahanannya. Rus, anggota DPRD Sergai, dilaporkan ke polisi oleh Srigema Ayu karena melarikan anak gadisnya berinisial AZ. Semula laporan disampaikan ke Polres Sergai, 22 Januari 2010, namun 30 November 2010 dilimpahkan ke Polda Sumut. Dalam laporannya, Srigema turut melampirkan hasil visum et repertum dari RS Bhayangkara Tebingtinggi, menyatakan selaput dara anaknya telah robek. Dikatakan, wakil rakyat tersebut telah membawa kabur AZ sekitar setahun lalu. Bahkan Rus sempat membawa AZ ke Jakarta pada 8 Januari 2010, setelah 1 Januari 2007, Rus menyetubuhi AZ di salah satu hotel di Parapat. Ibu korban menemukan AZ saat bersama seorang teman Rus bernama Nur, disebut-sebut penasihat Ru, saat berada di Supermarket Berastagi, Medan. Saat ditemukan ibunya, Rus juga berada di tempat itu, namun keduanya berhasil kabur. (m27)

Poldasu Segera Ajukan Penahanan Wabup Batubara Ke SBY MEDAN (Waspada): Penyidik Subdit II Direktorat Reserse Kriminal Umum (Dit Reskrimum) Poldasu akan segera mengajukan atau mengirim surat izin penahanan tersangka Wakil Bupati (Wabup) Batubara Gong Matua Siregar kepada Presiden Susilo Bambang Yudhoyono (SBY). Ini terkait kasus penipuan jual beli besi bekas milik PT Indonesia Asahan Alumunium (Inalum). “Setelah penyidik menetapkan Gong Matua Siregar menjadi tersangka, maka langkah selanjutnya penyidik mengajukan permohonan penahanan kepada presiden,” kata Kasubbid Pengelola Infomasi dan Data Humas Poldasu AKBP MP Nainggolan kepada wartawan, di Mapoldasu, Senin (12/9). Tetapi, Nainggolan belum bisa menyebutkan kapan surat permohonan itu dikirim. “Sabar saja, nanti kalau sudah dikirim kita beritahu,” katanya. Menurutnya, penyidik juga belum selesai memeriksa yang bersangkutan. “Sambil berjalan menunggu permohonan izin, kita akan periksa kembali dia,” katanya. Pengusutan kasus penipuan jual beli besi

bekas milik PT Inalum itu atas perintah Presiden SBY, dibenarkan Naingggolan. Tetapi alasan yang bersangkutan belum ditahan, karena izin presiden hanya pengusutan, bukan penahanan. “Prosedur penahanan kepala daerah dan wakilnya harus ada izin presiden. Izin dari presiden kemarin hanya pengusutan, bukan penahanan,” sebutnya. Diberitakan sebelumnya, Gong Matua Siregar ditetapkan sebagai tersangka setelah diperiksa tim penyidik Subdit II Dit Reskrimum Poldasu pada Kamis (8/9), atas perintah resmi Presiden SBY yang tertuang dalam surat bernomor R- 32/Pres/06/2011 ditujukan kepada Kapolri JenderalTimurPradopodengantembusan Mendagri Gamawan Fauzi, Jaksa Agung Basrief Arief dan Gubsu. Surat itu merujuk dua surat yang dilayangkan Kapolri bernomor R/910 dan R/911 yang masing-masing dibuat April 2011. Persoalan ini terkait adanya dugaan penipuan dilakukan Wakil Bupati Batubara senilai Rp500 juta terhadap seseorang bernama Zakaria. Korban merasa dirugikan secara material dalam transaksi pembelian besi bekas (limbah) PT Inalum. (m27)

Larikan Pacar Dilaporkan Ke Polisi MEDAN (Waspada): Seorang pemuda berinisial P, 22, warga Jln. Gaharu Medan, yang melarikan pacarnya masih dibawah umur dilaporkan orangtua si gadis ke Polresta Medan, Senin (12/9). Hanaif, 52, ibu korban, mengadukan P dengan tuduhan telah mencabuli dan membawa lari anak dibawah umur. Menurutnya kepada wartawan usai membuat pengaduan di Unit Pelayanan Perempuan dan Anak Polresta Medan, anaknya telah dipengaruhi oleh P. Informasi di Polresta Medan, sebelumnya antara korban dan pelaku telah terjalin hubungan asmara. Perkenalan keduanya melalui jejaringan sosial facebook 2010. Dari perkenakan ini, keduanya kemudian bertemu dan selanjutnya menjalin hubungan cinta.

P yang memang mencintai pacarnya itu berniat menyuntingnya kemudian mengajak jalan-jalan. Setelah itu, korban diajak menginap di rumah pelaku selama 2 minggu. Di rumahnya ini pelaku mengajak pacarnya melakukan hubungan suami istri. Merasa bertanggung jawab, P mendatangi orangtua pacarnya bermaksud untuk menikah. Orang tua korban mengetahui putrinya belum cukup umur menolak mentah-mentah lamaran pemuda tersebut. Akhirnya P kembali membawa kabur pacarnya. Akibatnya, orangtua pacarnya melaporkannya ke Polresta Medan dengan tuduhan menyetubuhi dan membawa kabur anak dibawah umur. Kini kasus tersebut masih diproses di Reskrim Unit PPA Polresta Medan. (m39)



WASPADA Selasa 13 September 2011

Mobil-mobil Murah Siap Menyerbu Indonesia beberapa tahun mendatang akan diserbu mobil-mobil murah dunia. Ju m l a h p e n d u d u k y a n g mencapai 240 juta dan rasio kepemilikan kendaraan yang masih rendah menjadi alasan utama masuknya produkproduk ini. General Motors misalnya, saat ini tengah mengembangkan dan menghidupkan pabrik kembali di Bekasi. Rencananya mobil ini akan menjadi basis produksi mobil multi fungsi murah Chevrolet PM7 di wilayah Asia Tenggara. Tak tanggung-tanggung, pabrikan asal Amerika Serikat ini menggelontorkan Rp1,2 triliun. Mobil ini diperkirakan akan bersaing dengan Toyota Avanza dan Daihatsu Xenia yang saat ini menguasai pasar mobil nasional. Sementara itu, meski

Chevrolet PM7. belum ada keterangan resmi, Honda juga disebut-sebut bakal memboyong Honda Brio

yang harganya cuma 339,9 ribu bath atau sekitar Rp115 juta. Untuk wilayah Asia

Tenggara, Brio saat ini sudah diproduksi di Thailand. Daihatsu Motor Co. juga

membenamkan investasi 20 miliar yen atau sekitar Rp2,1 triliun untuk meningkatkan kapasitas produksi mobil di pabrik Karawang, Jawa Barat. Seperti dikutip Nikkei, pabrik ini nantinya akan menjadi basis produksi mobil murah seharga Rp85-95 juta. Kabarnya mobil A-Concept yang diperkenalkan pada Indonesia International Motor Show 2011 lalu, merupakan cikal bakal mobil murah ini. Tak mau ketinggalan, pabrikan mobil asal India, Tata Motors juga dikabarkan tengah menjajaki pembangunan pabrik mobil supermurah di Indonesia. Laman DNA India menyebut, Tata tengah mendekati PT Astra International Tbk. Namun kabar ini belum terkonfirmasi. (vvn/m47)

Honda Brio (kiri), dan Daihatsu A-Concept.

Honda, Subaru Tarik Ratusan Ribu Mobil Honda mengatakan penarikan kembali 310.773 SUV Pilot produksi 2009-2011 karena mengalami kerusakan pada sabuk pengaman pengemudi dan penumpang depan. Pada kondisi tertentu, pangkal sabuk pengaman itu bisa terlepas dari jangkar pengait, akibatnya membahayakan penumpang dan pengemudi saat terjadi kecelakaan. Pernyataan Honda juga menyebut, kesalahan tersebut terjadi saat proses perakitan, di mana jahitan pada pangkal sabuk pengaman tidak sempurna. “Namun, tidak ada laporan korban luka atau meninggal akibat permasalahan tersebut,” tulis pernyataan Honda seperti dilansir Detroit News, Senin (12/9). Sementara itu, produsen mobil yang juga dari Jepang, Subaru, menarik hampir 500

BMW R1200GS Adventure Tambah Warna Baru Motor BMW R1200GS Adventure mendapat pilihan warna baru yakni Triple Black. Edisi spesial ini kombinasi GS sebagai motor yang mengusung tema sebagai motor adventure dengan gaya klasik. Tiga warna istimewa, seperti sapphire black, granite grey dan asphalt grey mampu mengubah mengubah penampilan garpu depan, mesin DOHC Boxer, frame belakang,

lengan ayun dan cover silinder atas. BMW R1200GS adalah motor adventure sport yang paling laris di Inggris dan versi Adventure ada di posisi kedua. Kombinasi keduanya mampu merajai penjualan motor besar di Inggris. Triple R 1200 GS diluncurkan pada 2010 dan telah terbukti sangat populer. Adventure Triple Black menawar-

Yamaha FZ8 Kekar Dan Agresif Salah satu motor yang masuk dalam daftar model edisi khusus 50 tahun Yamaha dalam kejuaraan balap dunia motor (Grand Prix) adalah Yamaha FZ8. Motor sport bergaya Streetfighter ini akan mendapat baju baru seperti yang dikenakan motor Jorge Lorenzo dan Ben Spies saat beraksi di kejuaraan MotoGP di seri Laguna Seca dan Assen. Lantas bagaimana dengan spesifikasi motor ini? Mari kita telisik lebih dalam. Mulai dari rangka. FZ8 ditopang dengan sasis berbahan full alumunium. Untuk meningkatkan efektifitas suspensi belakang, Yamaha menggunakan mate-

rial CF alumunium. Meski bobot motor lebih ringan, namun mampu memberikan kestabilan meski dilaju dengan kecepatan tinggi. Ta m p a k d e p a n d a n buritan FZ8 memancarkan keagresifan, hal tersebut diwujudkan lewat desain dengan sudut-sudut lancip pada cover lampu utama dan model bodi ser ta lampu b e l a k a n g . Ta n g k i b e s a r membuat tampilan motor ini tampak lebih kekar. Ur u s a n d a p u r p a c u , Yamaha tidak perlu diragukan kualitas performanya. FZ8 mengusung mesin 4 silinder segaris dengan pendingin air

Honda Pilot (kiri) dan Subaru Outback. ribu kendaraan. Penarikan itu mencakup 300 ribu kendaraan yang dijual di 20 negara, termasuk Michigan, Ohio, New York, dan Washington DC, untuk mengganti bracket kendaraan yang berpotensi

karatan. Bracket ini letaknya di bawah kendaraan. Penarikan ini mencakup Impreza buatan 2002-2007, Forester buatan 2003-2008, dan Saab 9-2x buatan 20052006.

Administrasi Keselamatan Lalu Lintas Jalan Raya AS (NHTSA) telah membuka penyelidikan masalah ini pada April setelah menerima tujuh keluhan, termasuk dua kegagalan di jalan raya pada

kecepatan tinggi. Penarikan kedua mencakup 195.000 Legacy dan Outback buatan 2010-2011 untuk menggantikan wiper yang bisa tiba-tiba berhenti bekerja. (vvn/m47)

VW Aplikasi Fitur Hemat BBM Pada Mesin 4 Silinder

Mesin hemat BBM VW.

Mengirit bensin dengan menonaktifkan sejumlah silinder mesin bukan hal baru. Honda sudah menerapkan teknologi ini pada Accord. Namun terobosan yang dilakukan di Volkswagen ( VS) ini patut diapressiasi karena mengaplikasikan teknologi ini di mesin 4 s i l i n d e r. S e b e l u m n y a teknologi ini hanya dipakai di mesin 6 atau 8 silinder. VW yang pertama di dunia mengaplikasikan di mesin empat silnder dalam skala besar.

Penjualan Motor Agustus Turun Akibat banyaknya libur di bulan Agustus yang bertepatan dengan bulan ramadan dan libuer lebaran, pasar motor Indonesia mendapat imbas negatif. Penjualan roda dua di Indonesia mengalami penurunan akibat hal tersebut. Dari data penjualan yang diberikan seorang sumber di Asosiasi Industri Sepedamotor Indonesia (AISI) terungkap bahwa pasar motor Indonesia mengalami penurunan yang cukup signifikan akibat banyaknya libur di Ramadan. Empat merek motor asal Jepang yakni Honda, Yamaha, Suzuki dan Kawasaki yang sudah memberikan laporan penjualannya mengungkapkan kalau terjadinya penurunan tersebut. “Kanzen dan TVS belum berikan laporan. Mungkin beberapa hari lagi,” ujar sumber di AISI, pada akhir pekan. Dalam data penjualan Agustus, total keempat merek tersebut menjual 677.775 unit saja. Turun dari penjualan total keempat-nya di bulan Juli yang mencapai angka 737.044 unit. Dari penjualan Agustus tersebut, Honda berhasil mempertahankan diri menjadi market leader di industri roda dua Indonesia dengan pangsa pasar sebesar 51,2 % setelah menjual 336.363 unit motor meski harus turun dari penjualan Juli yang mencapai 363.400 motor.

Honda Revo, Suzuki Smash, dan Yamaha Vega ZR.

Di bawahnya ada Yamaha dengan market share 41 persen yang hanya sanggup menjual 284.719 motor saja. Angka tersebut juga turun dari penjualan Juli yang 312.906 unit. Ada pun Suzuki yang di bulan ke delapan lalu berhasil meraih market sebesar 6,5 persen setelah membukukan penjualan mencapai 47.618 motor meski harus mengalami penurunan setelah di bulan Juli mencapai penjualan 50.667 unit. Disusul Kawasaki yang berhasil meraih 1,2 persen market share dari hasil menjual 9.075 unit, turun dari 10.071 unit di Juli. Total, sampai Agustus, Honda tercatat telah mampu menjual 2.798.950 motor dan menjadi pabrikan motor paling laris di Indonesia. Di posisi dua ada Yamaha yang berhasil menjual 2.243.309 motor, disusul Suzuki yang berhasil menjual 354.005 motor dan Kawasaki yang mampu melepas motor selama Januari sampai Agustus silam. Penjualan motor Agustus: Merek Penjualan Agustus 2011 Total 2011 Honda 336.363 unit 2.798.950 unit Yamaha 284.719 unit 2.243.309 unit Suzuki 47.618 unit 354.005 unit Kawasaki 9.075 unit 65.408 unit TVS (belum masuk) 9.647 unit Kanzen (belum masuk) 340 unit

Mesin pertama yang menggunakan teknologi ini adalah 1.4 liter TSI mulai tahun depan. Mesin ini secara berkala akan menonaktifkan dua dari empat mesin saat beban ringan hingga menengah. Dengan cara ini bisa di peroleh peningkatan efisiensi 0.4 liter sampai 1 liter tiap 100km. Yang menarik, Volkswagen bisa mengeliminasi sisi negative dari teknologi ini yaitu noise dan getaran. Dengan keseimbangan mesin yang luarbiasa, pengemudi sulit membedakan kapan mesin beroperasi dengan dua silinder atau empat silinder. Di mesin 1. 4 TSI, cylinder shut-off aktif antara 1.400 rpm – 4000rpm atau saat produksi torsi antara 25 – 75 Nm. Yang pertama adalah mengisi ruang bakar denga udara. Udara yang terperangkap di mengurangi tekanan silinder dan selanjutnya mengurangi konsumsi energy. Selanjutnya system menutup intake dan exhaust valve silinder no 2 dan 3, pembakaran hanya terjadi sekali setiap putaran crank-

shaft. Piston di silinder yang tidak aktif di geser oleh crankshaft. Dilain pihak, efisiensi silinder yang aktif bekerja menjadi lebih baik karena titik operasi mereka digeser ke beban lebih tinggi. Menutup valves dilakukan sejumlah actuator. Di masingmasing cam shaft ada cam pieces yang yang bertanggung jawab membuka valves. Khusus cam penggerak katup masuk dan keluar silinder 2 dan 3 sedikit beda. Cam di sini bisa geser. Saat computer mesin memerintahkan untuk menonaktifkan mesin, cam ini bergeser sehingga yang berputar adalah cam tanpa tonjolan. Karena itulah katup-katup tidak terbuka. Seluruh proses terjadi dalam waktu 13 – 36 milisekon, atau satu setengah putaran camshaft, sangat cepat. Komputer mobil menggunakan informasi yang dikumpulkan sensor pedal gas untuk mendeteksi style mengemudi. Jika ada pola yang tidak biasa, fungsi nonaktif silinder tidak di gunakan. (mkc/m47)

12.420.000 13.020.000 14.220.000 14.860.000 16.980.000 14.810.000 15.600.000 16.750.000 17.900.000 15.560.000 16.010.000 17.070.000 14.724.000 19.510.000 20.750.000 26.690.000 18.530.000 13.540.000 12.770.000 13.570.000 43.280.000 50.150.000 15.530.000

Shogun Axelo FL 125 SCD 15.300.000 Shogun Axelo FL 125 RCD 16.300.000 Shogun Axelo FL 125 RMCD 16.550.000 Satria FU 150CD 20.100.000 Spin UY 125S 12.925.000 Spin UY 125SC 13.500.000 Spin UY 125 Daytona 13.850.000 Sky Drive UK 125SC 14.400.000 Thunder EN 125KS 16.800.000 Titan FW 115D 11.875.000 Titan FW 115SD 12.975.000 Titan FW 115 SCD 14.050.000 Shogun FL 125 SD 14.625.000 Shogun FL 125 RCD 15.855.000 Shogun FL 125 RCMD 16.075.000 Shogun FL 125 RCDZ 16.305.000 Sky Wave UW 125 SC 15.430.000

berkapasitas 779 cc. Mesin ini klaim mampu menyemburkan tenaga 106,2 PS pada putaran 10.000 rpm dan torsi maksimum 82.0 Nm pada kisaran 8,000 rpm. Emisi gas buang yang dilepas lewat knalpot dengan konverter kata-lis pun rendah karena telah standar Euro3. Suspensi Yahud Tenaga besar dan postur yang gagah harus didukung suspensi yahud agar nyaman saat berkendara. Disektor depan berdiri tegak shock upside down 43mm dan shock Monocross dibelakang untuk menaklukan getaran atau guncangan saat melintasi jalan bergelombang. Selain itu suspensi ini dirancang sebaik mungkin agar bekerja dengan baik saat melibas tikungan tajam. Bagaimana dengan sistem pengeremannya? YZ8 telah diperkuat cakram ganda berdiameter 310mm yang dijepit oleh kaliper rem monoblok empat piston yang ditempatkan dibagian depan. Sementara belakang menggunakan cakram tunggal 267mm dengan kaliper satu piston dari Nissin. (oz/m47)

Toyota Pasok Ractis Untuk Subaru Toyota Motor Corp akan memasok sekitar 10 ribu unit Toyota Ractis setiap tahun untuk Fuji Heavy Industries, pemilik merek Subaru. Ini bentuk kerja sama lain dari kedua perusahaan Jepang itu, setelah sebelumnya ToyotaSubaru mengembangkan bersama-sama sports car berukuran ringkas. Seperti dikutip dari laman resmi Toyota, pada akhir pekan, Subaru membutuhkan mobil-mobil berukuran ringkas dengan mesin berkapasitas 1.3 hingga 1.5 liter untuk memenuhi kebutuhan pasar Jepang. Subaru ingin ikut berpartisipasi menyediakan mobilmobil berharga terjangkau sekaligus irit bahan bakar yang diperkirakan akan tumbuh pesat dalam beberapa tahun ke depan. Padahal line up mereka tidak memiliki mesin


HONDA: Revo 110 Fit Revo 110 SW Revo 110 CW Absolute Revo DX Revo Techno Scoopy Supra X 125 Jari jari Supra X 125 CW Supra X 125 Injec R Vario CW Vario Techno Std Vario Techno CBS Blade 110 CW Mega Pro Jari-jari Mega Pro Racing Tiger Racing CS 1 Beat CW Spacy Spoke Spacy CW CBR 250 Std CBR C-ABS SUZUKI Hayate

kan warna-warna gelap, fitur tangki bahan bakar yang besar 33 liter, kaca depan lebih tinggi, suspensi perjalanan (ideal untuk ekspedisi on dan off-road) dan cover mesin. The BMW R 1200 GS Adventure Triple Black sudah tersedia di dealer BMW Motorrad Inggris dan dilepas dengan harga 11.730 poundsterling atau Rp160 jutaan (On The Road). (oz/m47)

YAMAHA: Vega ZR-DB 13.143.500 Mio 12.779.000 Mio CW 13.577.000 Mio Soul 14.601.000 Mio CW SE 14.569.000 Xeon 16.759.000 Jupiter Z 15.023.000 Jupiter Z CW 15.788.000 Jupiter Z CW SE 16.262.000 Jupiter MX CW 17.725.000 Jupiter MX AT CW 17.000.000 V-ixion 22.257.000 V-ixion SE 24.405.000 Byson 21.035.000 Scorpio Z CW 24.884.000 Lexam 16.814.000 (harga sewaktu-waktu dapat berubah) * Sumber main dealer di Medan

dengan kapasitas seperti. Untuk menutup kekosongan itu, Subaru melirik hatchback mungil buatan Toyota yang sudah dipasarkan di Jepang sejak 2005.

Toyota Ractis dipasok dalam keadaan utuh dengan sedikit modifikasi. Toyota mulai memasok Ractis setelah city car ini mengalami redesain. (vvn/m47)

Toyota Ractis.




Cegah Rantai Motor Putus

Tidak sedikir pengendara motor yang rantainya putus di tengah jalan. Berikut beberapa tim menghindari kejadian tersebut. 1. Yang wajib Anda lakukan adalah melumasi rantai motor secara berkala dengan menggunakan pelumas khusus rantai atau chain lube 2.000-3.000 km. Minimal satu bulan sekali. Langkah itu perlu dilakukan agar menjaga rantai tidak kering dan karatan. Gunakan dengan sikat kecil seperti sikat gigi supaya merata. Dan, tidak perlu dilakukan ketika rantai motor Anda menggunakan O-ring. Rantai yang menggunakan O-ring tidak perlu pakai pelumas cukup di bersihkan. 2. Bersihkan rantai dari kotoran dan air sebelum rantai dilumeri dengan pelumas. Sesering Anda mengecek kebersihan rantai, maka lebih baik. 3. Pastikan rantai memiliki ketegangan yang cukup. Tidak terlalu tegang dan tidak terlalu kendur. Umumnya, rantai yang disetel terlalu kencang akan memberi beban yang berlebih. Namun sebaliknya jika rantai yang disetel terlalu kendur dikhawatirkan akan membuat rantai terlepas dari mata gir. Rantai kendur akan mengeluarkan suara aneh dan akan memberikan sentakan yang berlebih saat motor pertama kali dijalankan. Tingkat kekeduran optimalnya 23 cm. 4. Cek kondisi gir kecil. Biasanya banyak kotoran banyak menempel pada bagian itu. Putaran rantai juga menjadi keset dan tidak lancar. Setelah itu pastikan gir depan dan gir belakang sejajar. 5. Ganti sproket depan, sproket belakang serta rantai begitu usianya sudah 1,5-2 tahun (15.000 km keatas). Jangan potong rantai dengan alasan menghemat kantong. 6. Jangan keseringan melakukan akselerasi sejak awal, karena memperpendek usia logam rantai. (bbg sumber/m47)


WASPADA Selasa 13 September 2011


JK: Aceh Harus Maju Dalam Segala Hal BANDA ACEH (Waspada): Mantan Wakil Presiden Dr (HC) Muhammad Jusuf Kalla mengatakan, untuk mencapai suatu kemajuan yang diutamakan adalah semangat untuk maju. Kita tidak hanya bersaing dengan daerah dan negara lain, tapi juga bersaing dengan diri sendiri dalam meraih suatu kesuksesan. “Suatu daerah dan negara bisa maju, apabila pemerintah dan masyarakat dapat meningkatkan hasil tambah. Aceh ke depan harus lebih maju dari sekarang dalam semua hal. Di Sumut dan Jakarta harus ada pengusaha dari Aceh seperti dulu. Untuk mencapai kesuksesan kita juga harus berani

mengambil risiko. Apabila risiko yang kita ambil itu kecil tentu keberhasilan atau kesusksesan yang kita dapatkan juga kecil,” kata Jusuf Kalla saat menghadiri Dies Natalis ke-50 Universitas Syiah Kuala (Unsyiah) Darussalam, Banda Aceh di Gedung Akademic Activity Center (AAC) Prof Dr Dayan Dawood. MA, Senin (12/9). Sementara itu, Universitas Syiah Kuala Darussalam, Banda Aceh, telah meluluskan 75.770 sarjana yang terdiri dari berbagai disiplin ilmu seperti D3, Sarjana (S1), pendidikan profesi dan pascasarjana serta 20.000 lulusan diploma. Hal itu disampaikan Rektor Unsyiah Darussalam, Banda Aceh, Prof Dr H Darni M Daud,

MA pada rapat senat terbuka Unsyiah dalam rangka Dies Natalis ke-50 dan orasi ilmiah oleh Dr (HC) H Muhammad Yusuf Kalla. Dikatakan Darni, puncak peringatan hari jadi atau ulangan emas ke-50 Unsyiah seharusnya diperingati pada 2 September 2011. Berhubung tanggal tersebut bertepatan dengan 3 Syawal 1432 H dan masih dalam suasana lebaran, puncak ulang tahun emas universitas jantung hati rakyat Aceh dilaksanakan saat ini. “Dies Natalis atau hari jadi merupakan bagian tak terpisahkan dari rangkaian kegiatan akedemik suatu perguruan tinggi. Ritual akademik tahunan ini berfungsi sebagai ranah kilas

Waspada/H Rusli Ismail

MANTAN Wakil Presiden RI Dr (HC) Muhammad Jusuf Kalla foto bersama dengan Rektor Unsyiah Darussalam, Banda Aceh Prof Dr H Darni M Daud, MA dan Wakil Gubernur Aceh H Muhammad Nazar usai rapat senat terbuka Dies Natalis ke-50, Senin (12/9).

balik terhadap pelaksanaan program yang telah dilakukan. Momen ini juga sebagai awal merancang program dan tindakan ke depan guna meraih prestasi lebih baik,” kata Darni. Atas berbagai prestasi yang telah dicapai Unsyiah selama ini, pihak akademisi terus berupaya mencari format terbaik dan lebih maju, seperti membuka beberapa program studi baru. Tahun ini telah keluar izin empat prodi baru jenjang S1 (Teknis Industri, Teknis Geofisika, Informatika, dan Farmasi). Sementara untuk program S2, Pendidikan Sains melalui program Aliansi dan Magister Kebencanaan. “Tahun ini juga Unsyiah telah memperoleh izin Program Spesialis Ilmu Bedah dan Program Spesialis Penyakit Kulit,” sebut Rektor. Sedangkan penerimaan mahasiswa, tahun ini Unsyiah membuka empat jalur penerimaan, jenjang S1 dan D3. Penerimaan melalui Undangan Seleksi Masuk Universitas (USMU), Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN), Ujian Masuk Bersama (UMB) dan Jalur Mandiri Unsyiah (JMU). Hasil seleksi keempat jalur tersebut tercatat ada 6.140 dinyatakan lulus menjadi calon mahasiswa Unsyiah. Dengan demikian, kata Darni, jumlah mahasiswa Unsyiah sampai semester ganjil 2010/2011 sekira 31.000 orang, terdiri dari mahasiswa Diploma, Program Sarjana, Pendidikan Profesi dan Pascasarjana. Sementara, jumlah lulusan Unsyiah dari 2 September 2010 hingga 2 September 2011 berjumlah 5.028 orang, terdiri dari lulusan D3, Sarjana S1, Pendidikkan Profesi dan Pascasarja-

na. Sehingga jumlah lulusan sarjana/profesi hingga saat ini mencapai 55.770 orang dalam berbagai disiplin ilmu. Jumlah itu belum termasuk lulusan diploma yang mencapai 20.000, hingga totalnya menjadi 75.770 orang. Sementara itu, untuk meringankan beban biaya pendidikan mahasiswa, Unsyiah menyediakan beasiswa berasal dari berbagai sumber, yang hingga Juli 2011 terdapat 4.950 orang (22,07 persen) dari total mahasiswa S1 dan D3 mendapat beasiswa dari 22 sumber beasiswa. Total dana untuk beasiswa ini mencapai Rp15 miliar. Jumlah ini tidak termasuk beberapa sumber yang hingga saat ini belum terealisasi meskipun komitmennya sudah ada dan beasiswa untuk mahasiswa pascasarjana. Menurut Rektor, guna mempercepat implementasi standar mutu, kita terus mendorong peran dan aktivitas lembaga Sistem Jaminan Jaminan Mutu Fakultas (SJMF) semakin meningkat di masa mendatang. Walaupun belum mencapai hasil maksimal sebagaimana diharapkan, katanya, namun kualitas dosen Unsyiah terus meningkat. Yakni dari 1.516 tenaga akademik, 284 orang telah menyelesaikan pendidikan S3 di dalam dan luar negeri, dan 582 telah lulus sertifikasi. Diharapkan jumlah ini terus bertambah, apalagi saat ini tercatat 193 dosen sedang mengikuti pendidikan S3 di dalam dan luar negeri. Sekarang yang bergelar magister 907 orang, bertambah 47 orang. Diharapkan tahun 2014 semua dosen Unsyiah berkualifikasi magister dan doktor. (b21)

SDN Teupin Pukat Raih Penghargaan Inklusif JAKARTA ( Waspada): Kementerian Pendidikan Nasional melalui Direktorat Pembinaan Pendidikan Khusus dan Layanan Khusus Pendidikan Dasar (PPK-LK Dikdas) bekerja sama dengan Helen Keller Internasional (HKI) Indonesia mengumumkan penerima Inclusive Education Award (Penghargaan Pendidikan Inklusif) 2011. SDN Teupin Pukat, Aceh Timur, Provinsi Aceh, berhasil meraih penghargaan untuk kategori sekolah terbaik. Penghargaan diterima Kepala SDN Teupin Pukat Sumarni. Selain itu, SDN 16 Cempaka Putih Jakarta Pusat juga meraih prestasi yang sama. Pemberian penghargaan yang didukung USAID ini, seperti siaran pers yang diterima Waspada, diumumkan pada pembukaan ajang Olimpiade Sains Nasional (OSN) X tahun 2011 di Manado, Sulawesi Utara, Senin (12/9). OSN ke-10 ini melibatkan peserta dari tingkat SD, SDLB, SMPLB, SMA dan SMALB ini digelar hingga 16 September mendatang. Menurut Direktur PPK-LK Dikdas Dr. Mudjito, penghargaan dibagi dalam tiga kategori. Pertama, kategori pemerintah daerah. Kepala daerah yang mendapatkan penghargaan masingmasing Gubernur Jawa Barat Ahmad Heryawan dan Gubernur Jawa Timur Soekarwo. Kedua, kategori sekolah dan ketiga kategori individu. Untuk kategori individu masingmasing diberikan kepada Prof. Dr. IimWasliman, MSi dari Jawa Barat dan Dra. Iis Masdiana, MPd dari Sulawesi Selatan. Nomine yang masuk ke panitia, kata

Mudjito, seluruhnya mencapai 127 berkas. Dengan rincian, sembilan berkas untuk kategori pemerintah daerah, 57 untuk kategori sekolah dan 61 untuk kategori individu. Mudjito memaparkan pada tahun 2008 jumlah sekolah penyelenggara pendidikan inklusif (sekolah umum/reguler seperti SD, SMP, SMA yang menerima siswa penyandang ketunaan/ ABK) ada sebanyak 254 sekolah dengan jumlah siswa kurang dari 2.000 siswa ABK. Data sementara tahun ini, Direkrorat PPKLK Dikdas telah mencatat 1.664 sekolah penyelenggara pendidikan inklusi dengan 354.000 siswa ABK. Saat ini HKI yang didukung USAID menjalani program OVC (Opportunities for Vulnerable Children) di tujuh provinsi (DKI Jakarta, Jawa Barat, Jawa Tengah, DI.Yogyakarta, Jawa Timur, Aceh, Sulawesi Selatan) di Indonesia dan terus meningkatkan perluasan pendidikan inklusi. Emilia Kristiyanti, National Program Manager OVC, HKI–Indonesia, pihaknya akan terus bekerjasama dengan pemerintah Indonesia. Salah satunya adalah memberikan pendampingan bagi pemerintah provinsi dan kabupaten/kota dalam mengembangkan kebijakan dan tatalaksana pendidikan inklusif dan sistem layanan pendukung. “Tujuannya adalah menjamin peluang bagi anak-anak berkebutuhan khusus dalam memperoleh pendidikan yang layak dan setara menuju tercapainya pendidikan untuk semua,” ujar Emilia. (dianw)

HKBP Harus Ikut Aktif Memasyarakatkan Empat Pilar JAKARTA (Waspada): Huria Kristen Batak Protestan (HKBP) sebagai gereja terbesar di Indonesia harus menjadi contoh dan pionir dalam membangun hubungan antar umat beragama. Untuk itu jemaat HKBP harus ikut aktif memasyarakatkan empat pilar berbangsa dan bernegara yakni Pancasila, UUD 1945, NKRI, dan Bhineka Tunggal Ika. Keempat pilar berbangsa dan bernegara ini harus menjadi pegangan bersama dalam membangun bangsa ini ke depan. Ajakan ini disampaikan Ketua Fraksi MPR RI dari Partai Gerindara Martin Hutabarat, SH saat jadi pembicara dalam seminar memperingati Jubileum 150 Tahun HKBP di STT Nommensen P. Siantar, Sabtu, (10/9). Anggota Komisi III DPR RI ini mengakui tingginya kesadaran masyarakat dan pemukapemuka/tokoh-tokoh agama di Sumatera Utara untuk tetap memelihara kerukunan sebagai kunci terpenting dalam setiap usaha memajukan kesejahteraan rakyat. Pluralitas masyarakat dan semangat toleransi yang tinggi dalam menjaga kerukunan sudah terbukti sangat kuat, dan pada tahuntahun yang lalu, Sumut telah menunjukkan hal itu. Meskipun daerah ini berkali-kali diprovokasi oleh provokator dengan meledakkan bom di beberapa tempat dan rumah ibadah, untuk menimbulkan konflik antar umat beragama, tetapi usaha itu tetap tidak berhasil, ujar Martin Hutabarat. Berdasarkan pengalaman-pengalaman ini, kita tidak boleh berpuas diri terhadap keadaan yang kita alami sekarang. Kita harus tetap waspada terhadap banyaknya analisis tentang masa depan Indonesia di luar negeri dengan bermacam-macam pendekatan, diantaranya ramalan bahwa negara kita akan mengalami disintegrasi seperti Uni Soviet dan

Jugoslavia. Kajian Jared Diamond dalam buku Collapse di tahun 2005 meramalkan kehancuran Indonesia, apabila tidak dijaga dengan baik. Kehidupan keagamaan yang tidak harmonis, pendapatan daerah yang timpang dan ketidakadilan diberbagai sektor adalah potensi laten bagi perpecahan yang harus diwaspadai. “Kita telah memetik pengalaman yang mahal dan menyakitkan dari kelengahan saudara-saudara kita di Maluku dan Sulawesi Tengah, yang gagal menjaga kerukunan dari usaha-usaha provokator untuk memecah belah mereka. Setelah pengorbanan yang begitu besar dan menyakitkan, papar tutur wakil rakyat dari daerah pemilihan Sumut ini, semua baru sadar bahwa tidak seorangpun diuntungkan atau merasa beruntung dari konflik yang terjadi tersebut, kecuali provokator itu sendiri. “Kita sadar dan yakin seyakin-yakinnya Sumut tak akan mungkin jatuh ke dalam percobaan seperti itu. Sumut yang dikenal sebagai daerah yang sangat heterogen, diharapkan menjadi contoh bagi kerukunan, toleransi dan persatuan anak-anak bangsa. Ke depan, ujarnya lagi, di samping tantangan yang berkaitan dengan pembangunan, teknologi dan peningkatan kualitas kehidupan, ada kecenderungan, akibat globalisasi dan demokrasi ini, benturan antar nilai dan kelompok masyarakat sangat rentan terhadap perpecahan. Pada sisi lain Martin menyoroti kehidupan kepartaian sebagai perwujudan dari demokrasi, yanh perlu dikaji ulang perannya bagi kehidupan negara kita di masa mendatang. Begitu juga halnya kepala daerah, tidak boleh larut dalam ekses-ekses demokrasi yang memberhalakan materi (money politics) dan menomorduakan tanggung jawab pada kepentingan publik, tegas Martin. (aya)


JUMLAH PENUMPANG: Sejumlah bocah menonton pesawat angkutan udara yang akan mendarat di sekitar kawasan Bandara Soekarno-Hatta, Tangerang, Banten, Senin (12/9). Kementerian Perhubungan mencatat, penumpang angkutan udara sepanjang seminggu sebelum hingga seminggu sesudah Lebaran 2011 mencapai 2,7 juta orang, atau meningkat meningkat 15,99 persen dari jumlah penumpang tahun lalu yaitu sebanyak 2,3 juta orang.

Polisi Tangkap 15 Ribu Ekstasi Dari Belanda


KARTU TKI: Petugas dari Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia (BNP2TKI), menunjukkan Kartu Tenaga Kerja Luar Negeri(KTKLN), saat melakukan inspeksi mendadak di Asrama Putri PT Citra Putra Indarab, di Kawasan Duren Sawit, Jakarta, Senin (12/9). KTKLN yang dikeluarkan oleh Pemerintah Indonesia bagi tenaga kerja Indonesia memuat data asal usul TKI bersangkutan.

RKA Menneg PP Rp181 Miliar Disetujui JAKARTA (Waspada): Rencana Kerja dan Anggaran Kementerian Negara Pemberdayaan Perempuan dan Perlindungan Anak (PP dan PA) Tahun Anggaran 2012 sebesar Rp181 miliar akhirnya disetujui Komisi VIII DPR RI. Untuk itu, Kementerian Negara PP dan PA diminta segera menyampaikan rincian Rencana Kerja dan Anggaran Tahun 2012. Demikian kesimpulan rapat kerja Komisi VIII DPR dengan Menneg PP dan PA Linda Amalia Sari, di Gedung DPR, Jakarta, Senin (12/9). Wakil Ketua Komisi VIII Ahmad Zainuddin yang memimpin rapat kerja itu Kementerian Negara PP dan PA dalam penyusunan Rencana Kerja dan Anggaran Tahun 2012 memperhatikan beberapa catatan yang disampaikan anggota Komisi VIII meliputi penguatan program pemberdayaan perempuan dan perlindungan anak, dan penguatan koordinasi lintas sektor pusat dan daerah. Sebelumnya, Menneg PP dan PA Linda Amalia Sari dalam paparannya menjelaskan, prioritas usulan penambahan anggaran tahun 2012 adalah untuk tuan rumah the 4th ministerial conference on the role of women in the development of the OIC mem-ber states pada tahun 2012 sebesar Rp10,8 miliar. Persiapan untuk renovasi gedung Kementerian PP dan PA sebesar Rp24,552 miliar. Indonesia menjadi tuan rumah the 4th ministerial conference on the role of women in the development of the OIC member states tahun2012,menurut MennegPPdanPA telahditetapkanolehSekretaris Jenderal Organisasi Konferensi Islam (Sekjen OKI). (aya)

Mengurangi Potensi Korupsi Perlu Perbaikan Birokrasi JAKARTA (Waspada): Wakil Ketua Komisi VI DPR RI dari Fraksi Hanura Ir Nurdin Tampubolon berpendapat bahwa salah satu cara untuk mengurangi potensi korupsi, maka harus dilakukan perbaikan prosedur birokrasi yang dinilainya selama ini berteletele dan membuka peluang terjadinya unsur korupsi. Menurut wakil rakyat dari daerah pemilihan Sumut 1 ini, korupsi bukan hanya menggerogoti uang negara dan merugikan rakyat, tetapi akibat tindakan korupsi yang masih menjamur di negeri ini, juga mempengaruhi kemampuan Indonesia untuk meningkatkan daya saing di tengah perdagangan bebas. “Jika kita ingin meningkatkan daya saing, harus ada kemauan pemerintah untuk memperbaikan prosedur birokrasi guna mempersempit ruang melakukan korupsi. Birokrasi yang cenderung rumit semakin mengundang terjadinya unsur korupsi,” ujar Nurdin Tampubolon menjawab Waspada di gedung DPR RI Jakarta, Jumat (9/9). Nurdin juga menyatakan keprihatinannya atas bermunculannya kasus tindak pidana korupsi yang berhasil diungkap aparat penegak hukum. Keprihatinan itu, bukan hanya karena kerugian negara tetapi, sedihnya diantara pelaku tindak pidana korupsi itu kebanyakan adalah orang muda. Melihat kenyataan ini, Nurdin mendukung perlu adanya upaya konkrit untuk memberantas korupsi. sehingga negara ini tidak mengalami kehancuran. Nurdin secara tegas mengatakan, bangsa ini memerlukan tokoh yang memiliki idealisme, komitmen dan kejujuran. Tidak perlu lagi terjebak dikotomi tokoh tua atau muda, yang paling utama adalah siapa yang memiliki komitmen. (aya)

JAKARTA (Waspada): Direktorat Narkoba Polda Metro Jaya menangkap seorang wanita tersangka bandar narkoba jaringan internasional berinisial DP. Dari tangan DP polisi menyita 15 ribu butir ekstasi dan memburu dua pria warga negara Malaysia yang menyuplai ekstasi senilai Rp3 miliar tersebut. DP ditangkap di salahsatu apartemen di kawasan Ceng-

kareng, Jakarta Barat, Senin (12/ 9). Menurut Direktur Narkoba Polda Metro Jaya Kombes Pol Nugroho Aji, ekstasi yang dimiliki oleh DP merupakan jenis ekstasi dengan kualitas terbaik. Barang haram yang berhasil disita dari tangan DP merupakan ekstasi impor dari Belanda, kata Nugroho kepada wartawan di Jakarta, kemarin. Tersangka DP dijerat UU No 35Tahun 2009 tentang narkotika

dengan ancaman hukuman di atas lima tahun penjara. Saat ini DP ditahan di rutan Narkoba Polda Metro Jaya. Saat ini, ekstasi bernilai Rp3 miliar itu masih terus mengembangkan jaringan tersebut kepada dua WN Malaysia. “Dua orang DPO berkewarganegaraan Malaysia tengah kita diburu. Anggota kita sedang menuju ke Malaysia,” kata Nugroho. (j02)

Polri Agar Tidak Basa-basi Revitalisasi PEKAN BARU (Waspada): Dosen Sekolah Tinggi Ilmu Komunikasi Pembangunan (STIK-P) Medan Ustadz Drs. H. Amhar Nasution, MA menekankan, Polri untuk tidak basa-basi terhadap revitalisasi Polri yaitu tuntutan masyarakat agar Polri dan jajarannya lewat kaderisasi Ramadhan. Amhar menyampaikan tausyiah Halal bi halal di aula Mapolda Riau, Pekan Baru, atas undangan Kapolda Riau Brigjen. Pol. H. Suwedy Husein, SH, MH, Kamis (8/9). Kaderisasi Ramadhan memiliki empat ketahanan yaitu, ketahanan sosial agar tetap berhemat dan mensyukuri dari apa yang diberikan negara kepadanya. Ambisi dibolehkan dalam Islam, tapi jangan ambisius sehingga lupa diri, selama Ramadhan sikap konsumeris terkendali dengan baik. Kata Amhar, jati diri kita pun ditempa lewat Ramadhan untuk berpenampilan humanis,

jujur (siddiq), rendah hati (tawaduq), fathonah (cerdas IQ, EQ,SQ), amanah (menjaga kepercayaan negara-masyarakat). Ketahanan Iman, adalah iman itu tumbuh menjadi sebuah generator, stabilitator dan dinamisator. Sehingga kekuatan generator itu bersumber kepada Illahi (Allah SWT), bertindak berbuat karena Allah dan melakukan yang terbaik pun ingin mendapatkan kehormatan dari Allah. Ketahanan moral, selama Ramadhan kita mampu mengharamkan yang halal tentu di bulan Syawal yang haram tetaplah haram. Maka tinggikanlah semangat halal bi halal untuk mencapai kehormatan yang tinggi di sisi Allah SWT. Kemudian ketahanan idealisme, siapapun yang menggoda kita selama berpuasa kita tetap tidak terpengaruh. Artinya sebagai polisi dalam penegakan hukum kita berangkat dari

praduga tak bersalah dan menghindari intervensi si kaya, penguasa, uang, politik dalam rangka penegakan hukum yang benar, sampai kita rela lewat syariat Allah kita diberi lapar saat puasa, tetapi kita tidak marah kepada Allah selama 17 jam. Kata Amhar, pegawai saja pun jika tidak THR atau anak tidak diberi makan, maka dia akan demo (mengamuk), itulah jiwa hewaniahnya. Polisi yang baik pun, dengan serba kesederhaan dana, jumlah personel, sara prasana dia harus semangat membangun partnership building yaitu kemitraan dengan masyarakat agar masyarakat bisa membangun dirinya atau mempolisikan dirinya dengan kekuatan daya cegah, daya tangkal dan daya lawan. Sebelum tausyiah pembacaan ayat suci Alquran oleh qari juara 1 nasional 2011 Drs. Djafar Hasibuan. (m24)

Tidak Hadir Uji Kelayakan

Anggota Komisi III Diusulkan Tidak Ikut Memilih JAKARTA (Waspada): Anggota Komisi III DPR RI dari Fraksi Gerindra Martin Hutabarat, SH mengusulkan anggota Komisi III DPR yang malas apa lagi tidak menghadiri agenda uji kelayakan, mengusulkan untuk tidak ikut memilih calon pimpinan KPK, yang saat ini sedang diproses Komisi III. “Saya mengusulkan agar anggota DPR yang tidak pernah hadir atau kehadirannya kurang 50 % dari waktu yang disediakan untuk mengikuti uji kelayakan terhadap calon pimpinan KPK sebaiknya tidak ikut memilih. Jika mereka ikut memilih, akan mengusik pertanggungjawaban moral kita sebagai anggota DPR,” ujar Martin Hutabarat kepada Waspada di Gedung DPR-RI, Jakarta, Senin (12/9). Usulannya ini diakui Martin, untuk mencegah kekhawatiran terulangnya proses uji kelayakan pimpinan Komisi Yudisial (KY) berapa waktu lalu, dimana saat itu beberapa anggota Komisi

III tak hadir, namun muncul saat pemilihan. “Sering saya bertanya, kapan kawan-kawan di komisi III ini berkesempatan mengenal dan menguji visi dari calon-calon yang mau dipilih? Kalau tidak pernah, apa dasarnya dia harus memilih,” katanya. Menurut wakil rakyat dari daerah pemilihan Sumut ini, jika anggota dewan yang tidak hadir di uji kelayakan dan muncul saat mempergunakan hak pilih, tentu akan menciptakan kondisi yang tidak baik, sebab terkesan pimpinan lembaga-lembaga negara tidak dipilih dengan dasar yang benar. “Jangan-jangan bisa terjadi seorang calon Pimpinan KPK menang atau terpilih karena dipilih anggota DPR yang tidak pernah hadir dalam proses uji kelayakan, kan rusak negara ini,” lontar Martin. Pada sidang perdana Komisi III Senin ini, Komisi III yang telah menerima delapan nama yang diusulkan pemerintah untuk

dipilih DPR menjadi pimpinan KPK, akan menggelar uji kelayakan untuk memilih empat dari delapan calon pimpinan KPK. Anggota Komisi III DPR dari Fraksi Partai Amanat Nasional (F-PAN) Yahdil Abdi Harahap mengaku tak masalah dengan langkah Presiden Susilo Bambang Yudhoyono, yang hanya mengirim delapan nama calon pimpinan KPK ke DPR. “Kalau PAN menilai itu kan sudah melalui putusan MK. Panitia Seleksi pun sudah memutuskan dan mengikuti apa yang menjadi putusan MK. Begitu pula Presiden. Jadi tidak ada masalah, ujar Yahdil Abdi Harahap. DPR telah menerima delapan nama calon pimpinan KPK dari Presiden. Kedelapan nama itu adalah BambangWidjojanto, Yunus Husein, Abdullah Hehamahua, Handoyo Sudrajat, Abraham Samad, Zulkarnaen, Adnan Pandupraja, dan Aryanto Sutadi. (aya)


Luar Negeri

WASPADA Selasa 13 September 2011

Australia Usir Pencari Suaka CANBERRA, Australia (AP): Pemerintah Australia ingin menjalankan kebijakan mendeportasi para pencari suaka ke negara lain guna menghentikan usaha mereka menuju Australia, meski pengadilan tertinggi di negara itu telah membuat perjanjian pertukaran pengungsi dengan Malaysia. Perjanjian dengan Malaysia itu ditujukan untuk menghalangi para migran dari Afghanistan, Sri Lanka, Irak dan negara lain yang melintasi laut-laut berbahaya, dan seringkali dengan menggunakan kapal rusak, dalam usaha mereka memasuki Australia secara illegal. Dengan perjanjian itu Australia menerima 4.000 pengungsi terdaftar dari Malaysia dan sebagai balasan dari kesediaan Malaysia menerima 800 pencari suaka yang sudah sampai di Australia. Namun Pengadilan Tinggi Australia bulan lalu menetapkan perjanjian itu melanggar hukum imigrasi Australia. PM Julia Gillard Senin (12/9) mengumumkan bahwa pemerintahnya akan mengusulkan RUU untuk mengubah hukum imigrasi yang akan menegaskan bahwa pemerintah punya hak untuk memutuskan negara mana yang cocok sebagai tempat tujuan para pencari suaka. “Amandemen ini akan diberlakukan secara alami,” kata Gillard kepada wartawan, sambil menambahkan bahwa RUU tersebut akan diusulkanminggudepan.“RUUiniakanmemungkinkanpemerintah yang berkuasa untuk merancang dan menerapkan solusi terbaik.” Australia menarik minat para migran yang berharap memulai hidup baru, dengan jumlah lebih 6.200 jiwa tiba di negara itu tahun lalu. Banyak di antara pencari suaka itu menjadikan Malaysia atau Indonesia sebagai titik awal dan membayar para penyelundup guna membantu perjalanan mereka ke Australia. Partai politik besar Australia mendukung konsep mengirim pencari suaka ke negara lain untuk menghalangi pendatang lainnya. Namun partai-partai tersebut berbeda pendapat soal negara ketiga yang mana yang lebih tepat. Anggota parlemen dari Partai Liberal menolak mengirim pencari suaka ke Malaysia dengan mengatakan mereka bisa jadi objek pelanggaran HAM. Sementara, prospek bagi RUU tersebut tidak pasti karena Partai Buruh pimpinan Gillard butuh dukungan anggota parlemen dari pihak oposisi. Sementara Partai Greens, yang berkoalisi dengan Partai Buruh, sendiri menentang RUU tersebut. “Keputusan yang tepat bagi negara ini…adalah memproses para pencari suaka di kawasan pantai Australia seperti yang dilakukan negara lain di atas planet ini,” kata Senator Bob Brown, pemimpin Partai Greens, kepada wartawan.(m23)

Iran: Serangan Ke Kedubes Israel Sama Seperti Serangan Ke Kedubes AS 1979 TEHERAN, Iran (Waspada): Iran memuji tindakan para demonstran mesir yang menyerang kantor Kedutaanbesar (Kedubes) Israel di Kairo Jumat pekan lalu, di mana dinding kantor Kedubes berhasildirobohkan.Iranjugamembandingkantragedipenyerangan tersebut dengan penyerangan yang dilakukan para aktivis di Iran terhadap Kedutaanbesar AS di era Revolusi Islam 1979 silam. “Penyerangan terhadap sarang Israel di Kairo, akan menjadi sejarah baru Islam dan dunia,” ujar penasihat senior untuk urusan luar negeri Iran, Ali Akbar Velayati, seperti dikutip Mehr, Senin (12/9). Iran merupakan musuh besar bagi Israel. Selain menolak untuk memberi pengakuan kepada Israel, Iran juga berniat akan menghancurkanIsrael.Iranjugasebelumnyatidakmemilikihubungan yang baik dengan Mesir semenjak negara tersebut berdamai dengan Israel. Namun saat ini, Iran tampak menyambut pergantian rezim di Mesir dan peristiwa penyerangan kantor Kedubes Israel. Pada Jumat pekan lalu, kantor Kedubes Israel diserbu para demonstran Mesir. Duta Besar Israel beserta para staf kedutaan dilarikan ke bandar udara dan diselamatkan oleh pesawat militer. Setelahberhasilmenjeboldindingkantorkedutaan,parademonstran masuk ke ruangan pertama kedutaan dan membuang dokumendokumen yang ada di kedutaan tersebut lewat jendela.(okz)

Dalai Lama Pidato Di Depan Ribuan Orang Di Mexico City MEXICO CITY, Mexico (Antara/AFP): Ribuan orang berkumpul untuk mendengarkan pidato Dalai Lama di Mexico City pada Minggu (11/9), setelah China mengeluh bahwa Presiden Mexico Felipe Calderon bertemu dengan pemimpin spiritual Tibet di pengasingan itu. “Kita semua sama, kita semua ingin memiliki kehidupan yang bahagia, dan kita semua memiliki hak untuk bahagia,” kata Dalai Lama di tengah kerumunan sekitar 35.000 orang, beberapa di antara mereka membawa spanduk bertuliskan “Mexico mencintai Tibet.” Pidato, dibuat selama kunjungan ketiga pemimpin spiritual itu ke Mexico, berjudul “Menemukan Kebahagiaan di Masa Sulit.” Beijing menyuarakan kemarahan pada Sabtu setelah Calderon bertemu dengan Dalai Lama sehari sebelumnya.Sejalan dengan sikap kebiasaannya, kementerian luar negeri dan dutabesar China untuk Mexico membuat pengaduan resmi atas pertemuan itu. Selamapembicaraanpribadi,bagaimanapun,pemimpinMexico itu mengulangi pengakuan negaranya tentang kedaulatan penuh Tiongkok atas Tibet. Beijing menganggap Tibet sebagai bagian “tak terpisahkan” dari China, dan Dalai Lama - yang tinggal di pengasingan di India - sebagai seorang “pemecah-belah” yang bermaksud membagi negara. Secara teratur Beijing memprotes pertemuan-pertemuan Dalai Lama di luar negeri. Pemenang Hadiah Nobel Perdamaian itu meninggalkan Tibet setelah pemberontakan yang gagal terhadap China pada tahun 1959. Dia kemudian mendirikan pemerintah Tibet di pengasingan di Dharamshala, India utara, tapi menyerahkan peran kepemimpinan politik pada Mei lalu.

Pesawat American Airlines Mendarat Setelah Dapat Ancaman Keamanan WASHINGTON, AS (Antara/Xinhua-OANA): Pesawat American Airlines tujuan New York mendarat dengan selamat di Bandara Internasional John F. Kennedy (JFK) dengan dikawal dua pesawat militer karena masalah keamanan. Pesawat dengan nomor penerbangan34danberangkatdariLosAngeles,California,itumemberitahu Badan Keamanan Transportasi (TSA) pukul 15.00 waktu setempat bahwa sejumlah penumpang pesawat itu bertingkah mencurigakan, kata TSA dalam pernyataannya. Dua pesawat jet F-16 dikirim untuk mengawal penerbangan tersebut dengan selamat, demikian pernyataan tersebut Minggu (11/9). Pesawat komersial tersebut segera mendarat di Bandara JFK pukul 16.00 dan FBI (Biro Penyelidikan Federal) meluncur ke lokasi pendaratan untuk melakukan penyelidikan. Tiga penumpang pesawat tersebut mengunci diri di dalam kamar mandi dan menolak untuk keluar, kata media setempat. Penyebab insiden tersebut masih belum jelas dan sejumlah aparat keamanan mengatakan hal itu bukanlah ancaman teror. Pihak maskapai American Airlines tidak meminta pengawalan dan keamanan tambahan setelah mendarat di JFK, demikian NBC Ney York, yang mengutip juru bicara American Airlines Andrea Huguely. Insiden tersebut terjadi saat Amerika Serikat berada dalam status waspada tinggi saat memperingati sepuluh tahun insiden penyerangan 11 September, Minggu.

Kebakaran Texas Hanguskan 1.554 Rumah, 17 Orang Hilang


MASYARAKAT dan regu pertolongan berkerumun di sekitar lokasi di mana terjadi kebakaran di daerah kumuh dekat kawasan industri di Nairobi, Kenya, Senin (12/9).Lebih dari 100 orang hangus terbakar dan 100 lainnya terpaksa dilarikan ke rumah sakit setelah kebakaran minyak yang dipicu sebatang puntung rokok melalap daerah kumuh berpenduduk padat di ibukota Kenya itu, kata media lokal Senin.

100 Orang Tewas Dalam Ledakan Pipa Minyak Kenya NAIROBI, Kenya (AP): Lebih dari 100 orang tewas terbakar dan kira-kira 100 lainnya segera dilarikan ke rumah sakit setelah kebakaran minyak yang disulut oleh puntung rokok terjadi di satu daerah kumuh yang padat di Nairobi, ibukota Kenya, kata media lokal Senin (12/9). Polisi mengatakan sejumlah besarkorbantewasdalamkondisi hangus terbakar, namun belum ada hitungan resmi yang dilakukan karena pihak berwenang sibuk mengatasi kebakaran. Saluran televisi lokal menayangkan gambar kerangka yang hangus pada saat kebakaran melanda daerah kumuh itu. Banyak penghuni kawasan kumuh yang terbakar itu berjalan terhuyunghuyung dengan kulitnya yang lecet-lecet. Televisi warga mengutip seorang pejabat di lokasi kejadian mengatakan, dia telah menghitung lebih dari 120 orang tewas. Radio Capital FM mengatakan

korban tewas lebih dari 150 jiwa. “Lokasi kejadian itu demikian buruk, banyak orang yang tewas terbakar,” kata deputi jurubicara kepolisian Charles Owino kepada Reuters. “Banyak mayat di sana, kami belum menghitungnya.” Owino mengatakan kebakaranberawaldarisatutangkibahan bakar di satu depot milik Kenya Pipeline Company yang mengalami kebocoran yang minyaknya mengalir ke daerah kumuh itu. Para penduduk di kompleks kumuhberusahamenghentikanaliran dari pipa yang bocor itu dan yang lainnya dari saluran pembuangan, tetapi minyak terbakar ketika seseorang melemparkan

puntung rokok ke dalam saluran pembuangan, kata Owino. “Ada satu sekolah non-informal di dalam kompleks kumuh tersebut, banyak orang yang mengalami luka bakar di sana,” kata Daniel Mutinda, seorang jurubicara Palang Merah Kenya. “Saya kehilangan sejumlah sanak saudara,” kataWilfred Mbithi, polisi yang ditugaskan berbagai operasi di Nairobi pada saat dia berdiri di lokasi kejadian. “Banyak orang yang menyelam ke dalam sungai dalam usahanya mendapatkan keluarganya.” Komisioner Provinsial NjorogeNdirangumengatakanpuluhan mayat telah ditemukan sejauh ini, namun angka korban akan terus bertambah dengan cepat. Kobaran api masih menyala di antara reruntuhan lembaran seng dan harta benda yang berserakan. Jarak pandang demikian buruk karena hujan dan asap. Penduduk Joseph Mwangi, 34,mengatakandiasedangmem-

beri makan sapinya ketika orang berlarian melintasinya dan menyerukan ada kebocoran pipa minyak. Dia mengatakan yang lainnya mulai memungut bahan bakar dan dia sendiri akan pergi mencari ember, namun tibatiba dia mendengar ledakan sekitar pukul 09:00 pagi. Kemudian bahan bakar yang bocor ke sungai dan beberapa bagian sungai tersulut api. Mwangi masih terus mencari putrinya yang berusia 6 tahun. Sekurang-kurangnya 112 korban luka bakar tiba di RS Nasional Kenyatta dan mereka membutuhkan bantuan darah yang mendesak dan selimut, kata RichardLisiyampe,kepalarumah sakit itu. Banyak anak-anak terdapat di antara para korban. Pada 2009 lalu, sekurangkurangnya 120 orang tewas ketika mereka berusaha menyerobot minyak yang keluar dari tanki bahan bakar di Kenya. (m10)

Di Inggris, Peringatan 10 Tahun Tragedi 9/11 Diwarnai Protes LONDON, Inggris (Waspada): Aksi protes mewarnai peringatan tragedi serangan 11 September di London, Inggris. Protes yang dilakukan di luar Kedutaanbesar AS tersebut, disertai dengan aksi bakar bendera AS. Protes ini dilakukan menjelang dilakukannya hening cipta mengenang pertama kalinya pesawat yang ditabrakan ke menara kembar World Trade Center di NewYork, AS, Minggu. Sekitar 100 orang yang berasal dari kelompok radikal di Inggris meneriakan slogan anti-AS dan menyebut AS sebagai teroris. Seorang pengunjuk rasa dari kelompok radikal Islam menilai AS akan terus mendapatkan rasa sakit bila tidak menarik pasukannyadarinegara-negaraIslamyang dikuasainya. Namun aksi protes ini mendapatkan tentang dari kelompokIslamlainnya.Merekamenentang para warga Muslim yang mendukung aksi ekstrimisme. “BilakalianinginsyariahIslam, pindah saja ke (Arab) Saudi,” ungkap seorang pengunjuk rasa antiradikal Islam seperti dikutip Daily Mail, Senin (12/9). Seorang warga menilaiapayangdilakukankelompok radikal ini membuat malu Islam. “Saya seorang Muslim, apa yang mereka lakukan sungguh telah membuat malu Islam. Ini bukanajarandariIslam,”ujarAbdul Sallam seorang warga Glasgow. Bagi Sallam, Islam mengajar-

BASTROP, Texas (AP): Jumlah rumah yang rusak berat akibat kebakaran Texas bertalmbah menjadi 1.554 dan diperlukan penambahan pejabat yang memasuki kawasan lebih luas di mana api sudah berhasil dipadamkan, kata para pejabat , Namun 17 orang masih dinyatakan hilang. Pejabat Bastrop dibantu tokoh Demokrat Lloyd Doggett berusaha memberikan informasi baru kepada ratusan penduduk yang dievakuasi dari rumah mereka seminggu lalu ketika angin kencang akibat Badai Tropis Lee melanda Texas yang tengah kemarau, sehingga menimbulkan lebih dari 190 kebakaran hutan. Kebakaran terburuk menghanguskan kawasan seluas 13.800 hektar di wilayah terletak di tenggara Austin ini. Disaat menyampaikan kabar buruk tentang jumlah rumah yang hancur akan bertambah, para pejabat juga mengatakan kepada 100 penduduk yang berkumpul pada satu konferensi pers Minggu (11/9) bahwa orang-orang akan mulai kembali ke kawasan yang terbakar itu Senin Rencana rinci akan memungkinkan penduduk secara bertahap memasuki kawasan yang telah ditinggalkan setelah petugas pemadam kebakaran dan penanggulangan kondisi darurat memastikan tanah di sana sudah dingin, titik-titik api telah padam dan kebakaran sudah berhasil ditangani. Pemerintah federal Jumat mengumumkanTexas sebagai wilayah bencana, sehingga membuka jalan bagi individu mendapatkan bantuan keuangan. Senin (12/9), sekolah-sekolah akan dibuka untuk pertama kali sejak Bastrop dilalap api. Direktur manajemen darurat Bastrop Mike Fisher mengatakan, kebakaran sudah berhasil ditangani sebanyak 50 persen.(m23)

PM Carlos Gomes: Khadafi Disambut Di Guinea Bissau DAKAR, Senegal (Antara/Xinhua-0ANA): Perdana Menteri Guinea Bissau mengatakan, pemimpin Libya Moammar Khadafi akan diterima di negara Afrika barat itu jika dia berlindung di sana, kata berita yang sampai di Dakar dari Bissau, ibu kota Guinea Bissau. Khadafi pantas mendapatkan semua kehormatan dan pengobatan yang baik dari pemerintah dan rakyat Bissau Guinea, kata Carlos Gomes kepada Radio independen Bombolom. Dia menambahkan bahwa “kami akan menyambut baik jika dia membutuhkan perlindungan di negara kita.” Keberadaan Khadafi tetap tidak diketahui untuk saat ini. Pemimpin Libya yang digulingkan itu mengatakan pekan lalu bahwa ia tidak lari ke Nigeria dan akan berjuang sampai mati di negaranya. Sementara itu Menteri Kehakiman Nigeria, Marou Adamou, mengatakan Saadi putra Moammar Khadafi telah memasuki wilayah Nigeria, kata laporan media, Minggu. Menteri kehakiman mengatakan pada konferensi pers, bahwa anak Khadafi itu dicegat di dekat pusat kota Niger Agadez dengan konvoi kecil. Menurut laporan, iring-iringan Libya itu kemudian dibawa ke ibu kota Nigeria, Niamey. Sebelumnya, seorang juru bicara pemerintah Nigeria mengatakan, pada 11 September, sebuah patroli angkatan bersenjata Nigeria menyergap konvoi yang membawa putra Khadafi. Saadi, 38 tahun, adalah putra ketiga dari tujuh putra Khadafi, meninggalkan karir sepak bola pada 2004 untuk bergabung dengan angkatan darat. Dia memimpin satu kesatuan elit. Nigeria Jumat berjanji akan menghormati komitmen internasional jika orangorang Libya yang diburu memasuki wilayahnya, dan memastikan bahwa tiga jendral era Khadafi, termasuk kepala staf angkatan udaranya, Al-Rifi Ali Al-Sharif, telah tiba di Agadez. Niamey menekankan bahwa Khadafi sendiri tidak berada di wilayah Nigeria.

15 tahun, 24 Orang Dipaksa Jadi Budak LONDON, Inggris (Waspada): Inggris dikenal sebagai negara maju. Tetapi negara ini sepertinya masih membiarkan praktek perbudakan berlangsung. Baru saja sekira 24 orang pria berhasil dibebaskan setelah dipaksa bekerja selama 15 tahun. Lebih dari 200 petugas Kepolisian Bedfordshire, merangsek masuk ke sebuah wilayah karavan di Leighton Buzzard, London, dan menangkap empat pria dan seorang perempuan yang diduga melakukan praktek perbudakan. Kelima tersangka tersebut adalah warga dari lokasi karavan itu. Dalam temuannya, polisi berhasil membebaskan seluruh 24 pria yang sebagian besar warga negara Inggris. Sementara sisanya diketahui berasal dari negara-negara wilayah EropaTimur. Kepolisian Bedfordshire melakukan penyelidikan panjang mengenai tindak perbudakan modern ini. Polisi mengetahui seluruh korban dibiarkan hidup dalam kondisi menyedihkan dan dipaksa bekerja tanpa memperoleh bayaran. “Semua korban ditemukan dalam kondisi fisik mengenaskan, mereka dipaksa hidup dalam lingkungan kotor dan dan tidak layak,” ungkap Kepala Penyelidik Polisi Sean O’Neil seperti dikutip BBC, Senin (12/9). “Kami yakin beberapa dari mereka bekerja tanpa dibayar dan sebagian dari mereka sudah ada yang hidup di tempat ini selama beberapa minggu hingga 15 tahun terakhir,” jelas O’Neil. Dirinya menambahkan, pada awalnya para pekerja ini dijanjikan bayaran sebesar 80 poundsterling atau sekira Rp1 juta (Rp13,640 per poundsterling). Tetapi pada kenyataannya, ketika mereka tiba di tempat kerja justru keadaan berbeda yang ditemuinya. 24 orang itu pun disekap dan tinggal dibekas kandang kuda dan karavan bekas. Mereka juga dipukuli bila hendak meninggalkan tempat tersebut.Tetapi beberapa pria berhasil menyelamatkan diri dari tempat itu dan melaporkan tindakan yang mereka alami. Berdasarkan laporan saksi, polisi pun langsung bergerak dan melakukan operasi penangkapan kepada pihak yang melakukan perbudakan modern ini. (okz)

Uni Eropa Dukung Palestina

PROTES di tengah peringatan ulang tahun tragedi 11 September di London, Inggris kan tentang perdamaian, tetapi protes yang dilakukan kelompok radikal ini dimatanya justru hendakmenyuburkankebencian antar manusia. “Islam mengajarkan untuk berbicara keras bila melihat sesuatu yang jahat dan berusahamelawannya.BilaIslam moderat keluar melawan aksi protes ini, mereka tentunya akan kalah,” Sallam menambahkan. Menurut pria berusia 41 ta-

hun ini, apa yang dilakukan oleh pengunjuk rasa hanya membuat Inggris terpecah belah. Sebelumnya kelompok sayap kanan Inggris, EDL, sempat melakukan protesuntukmenentangaksiyang dilakukan kelompok radikal ini. Tetapi 60 anggota EDL langsung terlibat bentrokan dengan pihak Kepolisian London, dari wilayah dimana dilakukan peringatan 9/11 di Grosvernor Squa-


re, London. 20 orang ditangkap, setelah mereka dianggap mengganggu ketentraman di sekitar wilayah peringatan tersebut. Sementara seorang keluarga dari korban tragedi 9/11 yang turut serta mengikuti peringatan ini, mengecam protes anti-AS yang terjadi. Menurutnya, aksi protes tersebutamattidakmenghormati korbandariserangan menewaskan sekira 3.000 jiwa tersebut. (okz)

BRUSSELS, Belgia (Waspada): Banyak dari warga negara anggota Uni Eropa (UE) seperti Prancis, Jerman, dan Inggris mendesak pemerintah di negaranya agar mendukung pengakuan berdirinya negara Palestina. Survei dilakukan oleh YouGov dan Ifop untuk organisasi non pemerintah yang pro-Palestina. Survei menunjukkan sebanyak 69 persen warga Prancis, 71 persen warga Jerman, dan 59 warga Inggris menginginkan pemerintah di negaranya untuk mengakui Palestina. Palestina berencana untuk memperbaharui statusnya di Perserikatan Bangsa-Bangsa (PBB) dari negara pengamat menjadi anggota PBB. Rencananya, Presiden Palestina Mahmoud Abbas akan memberikan pidato di New York, Amerika Serikat (AS) pada 23 September mendatang. Bila Palestina mendapatkan pengakuannya, mereka akan dapat bergabung dalam organisasi internasional lainnya seperti Mahkamah Kriminal Internasional di Denhaag, Belanda. Mereka juga berpotensi untuk mendakwa Israel atas perlakuannya selama ini. “Inihanyamerupakanlangkahawaldisebuahjalanyangpanjang. Tujuan kami meminta pengakuan adalah bukan untuk menyerang siapa pun, namun kami bertujuan untuk menyatakan okupasi yang dilakukan Israel ilegal,” ujar negosiator Palestina, Saeb Erekat seperti dikutip EU Observer, Senin (12/9). “Bila mendapatkan pengakuan, kami tidak yakin proyek pemukiman Israel akan segera dihentikan dan kejahatan yang dilakukan Israel akan berhenti. (okz)


WASPADA Selasa 13 September 2011 Klasemen Liga Premier Man United Man City Chelsea Stoke City Liverpool Newcastle Wolves Aston Villa Wigan Everton Arsenal West Brom Bolton Tottenham QPR Sunderland Norwich Fulham Swansea Blackburn

4 4 4 4 4 3 4 4 4 3 4 4 4 3 3 4 4 4 4 4

4 4 3 2 2 2 2 1 1 1 1 1 1 1 1 0 0 0 0 0

0 0 1 2 1 1 1 3 2 1 1 0 0 0 0 2 2 2 2 2

0 18-3 12 0 15-3 12 0 7-3 10 0 3-1 8 1 6-3 7 0 3-1 7 1 4-3 7 0 5-3 6 1 3-4 5 1 3-3 4 2 3-10 4 3 3-5 3 3 7-11 3 2 3-8 3 2 1-6 3 2 2-4 2 2 3-6 2 2 2-5 2 2 0-5 2 3 3-7 1

Senin, 12 September (GMT) QPR vs Newcastle


Minggu, 11 September Norwich vs West Brom Fulham vs Blackburn

0-1 1-1

Sabtu, 10 September Arsenal vs Swansea City Bolton vs Man United Everton vs Aston Villa Manchester City vs Wigan Stoke City vs Liverpool Sunderland vs Chelsea Wolves vs Tottenham

1-0 0-5 2-2 3-0 1-0 1-2 0-2

Pencetak Gol Terbanyak 8 Wayne Rooney (MU) 6 Sergio Aguero (Man City) Edin Dzeko (Manchester City) 3 Ivan Klasnic (Bolton)

Klasemen Liga Primera Real Madrid Valencia Real Betis Barcelona Sociedad Sevilla Osasuna Espanyol Mallorca Levante Vallecano Santander Ath Bilbao Atl Madrid Getafe Villarreal Zaragoza Malaga Granada S Gijon

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 2

2 2 2 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0

0 0 0 1 1 1 1 0 0 2 2 1 1 1 1 1 1 0 0 0

0 0 0 0 0 0 0 1 1 0 0 1 1 1 1 1 1 1 1 2

10-2 5-3 2-0 7-2 4-3 4-3 2-1 2-2 1-1 1-1 1-1 3-4 2-3 0-1 3-5 2-7 0-6 1-2 0-1 2-4

6 6 6 4 4 4 4 3 3 2 2 1 1 1 1 1 1 0 0 0

Senin, 12 September (GMT) Malaga vs Granada


Minggu, 11 September Real Betis vs Mallorca Osasuna vs S Gijon Santander vs Levante Vallecano vs Zaragoza Real Betis vs Mallorca Espanyol vs Ath Bilbao

Sabtu, 10 September Real Madrid vs Getafe Sociedad vs Barcelona Valencia vs Atl Madrid Villarreal vs Sevilla

1-0 2-1 0-0 0-0 1-0 2-1

4-2 2-2 1-0 2-2

Pencetak Gol Terbanyak 4 Cristian Ronaldo (Madrid) Roberto Soldado (Valencia) 3 Imanol Agirretxe (Sociedad) Alvaro Negredo (Sevilla) Miku Fedor (Getafe)


Klasemen Ligue 1 Montpellier Lyon Lille Paris SG Toulouse Rennes Sochaux Lorient St Etienne Auxerre Bordeaux Evian TG Caen Dijon Ajaccio St Brest Marseille AS Nancy Nice Valencs

5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5

4 3 3 3 3 3 2 2 2 1 1 1 2 2 1 0 0 0 0 0

0 2 1 1 1 1 2 2 1 3 3 3 0 0 2 4 3 2 2 1

1 10-3 12 0 9-5 11 1 9-6 10 1 7-4 10 1 7-4 10 1 10-8 10 1 8-7 8 1 5-5 8 2 5-6 7 1 8-7 6 1 5-5 6 1 4-4 6 3 6-7 6 3 5-9 6 2 6-9 5 1 3-4 4 2 6-8 3 3 3-6 2 3 2-6 2 4 3-8 1

Minggu, 11 September AS Nancy vs Auxerre Montpellier vs Nice Paris SG vs St Brest

Sabtu, 10 September Ajaccio vs Valenciennes SM Caen vs Toulouse Dijon vs Olympique Lyon Sochaux vs Lorient Bordeaux vs Evian TG Marseille vs St Rennes St Etienne vs Lille

0-0 1-0 1-0 3-1 0-1 1-2 1-1 0-0 0-1 1-3

Pencetak Gol Terbanyak 5 Alain Traore (Auxerre) 4 Frederic S (Ajaccio) 3 Brice Jovial (Dijon) Ryad Boudebouz (Sochaux) Souleymane C (Montpellier) Bafetimbi Gomis (Lyon) Kevin Gameiro (Paris SG)

Klasemen Bundesliga B Munich W Bremen M’gladbach Leverkusen Hoffenheim Schalke Nuremberg Hertha Berlin Hanover Stuttgart Dortmund Mainz Wolfsburg Freiburg FC Koeln Augsburg K’lautern Hamburg

5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5

4 4 3 3 3 3 3 2 2 2 2 2 2 1 1 0 0 0

0 0 1 1 0 0 0 2 2 1 1 1 0 1 1 2 2 1

1 1 1 1 2 2 2 1 1 2 2 2 3 3 3 3 3 4

16-1 12 11-5 12 7-3 10 6-3 10 9-4 9 11-8 9 5-5 9 6-5 8 6-7 8 7-3 7 6-4 7 7-10 7 6-9 6 9-16 4 7-14 4 4-10 2 2-8 2 6-16 1

Minggu, 11 September FC Koeln vs Nuremberg VfL Wolfsburg vs Schalke

1-2 2-1

Sabtu, 10 September Bayern Munich vs Freiburg Dortmund vs Hertha Berlin Gladbach vs Kaiserslautern FSV Mainz vs Hoffenheim VfB Stuttgart vs Hanover Werder Bremen vs Hamburg

Jumat, 9 September Augsburg vs Leverkusen

7-0 1-2 1-0 0-4 3-0 2-0 1-4

Pencetak Gol Terbanyak 8 Mario Gomez (Bayern Munich) 4 Klaas-Jan Huntelaar (Schalke) P Demba Cisse (Freiburg) 3 Claudio Pizarro (Werder Bremen) Ryan Babel (Hoffenheim) Franck Ribery (Bayern Munich) (jonny/afp/espn)

Milan Maju Tak Gentar MILAN, Italia (Waspada): Pelatih AC Milan, Massimiliano Allegri, mengatakan kepada timnya agar tidak takut kepada Barcelona. Nasihat ini disampaikan Allegri menjelang laga penyisihan Grup H Liga Champions di Nou Camp Stadium, Rabu (14/9) dinihari nanti. “Kita adalah Milan! Kita memiliki pemain-pemain yang hebat. Kita adalah Milan dan apa pun bisa terjadi dalam sepakbola” katanya seperti ditulis oleh Football Italia, Senin (12/9). Allegri mengatakan Rossoneri tak perlu takut kepada Barca. Hanya saja, dia meminta anak-anak binaannya tetap menghormati Lionel Messi cs sambil tetap melakukan permainan terbaik mereka dalam STRIKER AC Milan asal Brazil, Alexandre Pato (kanan), akan menjadi tandem Zlatan Ibrahimovic saat bertandang ke markas Barcelona guna melakoni laga penyisihan Grup H Liga Champions di Nou Camp Stadium, Rabu (14/9) dinihari nanti. -AP-

Jadwal Rabu (14/9) dinihari WIB Grup E Di London Di Genk Grup F Di Athens Di Dortmund Grup G Di Oporto Di Nicosia Grup H Di Barcelona Di Pilsen

: Chelsea vs Bayer Leverkusen : Genk vs Valencia : Olympiakos vs Marseille : Borussia Dortmund vs Arsenal : FC Porto vs Shakthar Donetsk : Apoel Nicosia vs Zenit St Petersburg : Barcelona vs AC Milan *RCTI Live pkl 01.45 WIB : FC Plzen vs Bate Borisov

bertahan dan menyerang. “Kita termasuk salah satu tim sepakbola yang menunjukkan permainan terbaik pada saat ini. Kita hanya perlu tetap bermain dengan fokus,” ungkapnya sembari berharap pemain belajar dari kesalahan saat imbang melawan Lazio 2-2 di laga pembuka Serie A, Sabtu (10/9) lalu. Melawan Barca, Allegri pun memutuskan tidak akan memasang Antonio Cassano di starting eleven nanti. Menurut pelatih Milan itu, Cassano memang tampil dengan sangat baik melawan Lazio. Namun, dirinya mengira Alexandre Pato menjadi pilihan terbaik untuk memulai pertandingan bersama Zlatan Ibrahimovic. Dari Dortmund, Arsitek Arsenal Arsene Wenger mewantiwanti Borussia Dortmund agar

mewaspadai sepak terjang The Gunners di Liga Champions. Pasalnya, Arsenal baru memetik kemenangan perdana di Liga Premier dengan membungkam klub promosi Swansea 1-0. Bagi Wenger, kemenangan ini cukup mengembalikan kepercayaan diri klub London Utara setelah menelan kekalahan telak 2-8 dari Manchester United di laga sebelumnya. Hasil ini dijadikan modal berharga ketika Robin van Persie cs melawat ke Signal-Iduna Park untuk meladeni Dortmund di Grup F. “Kepercayaan diri sudah kembali sekarang. Dalam pekerjaan kami, momentum memegang peranan vital. Kami hanya ingin bermain dan menang,” tandas The Professor. (m15/m33/espn)

Inter Lengkapi Kejutan Pekan Perdana PALERMO, Italia (Waspada): Setelah sebelumnya AS Roma takluk di tangan Cagliari, kejutan lain terjadi di pekan perdana Serie A. Dalam laga di Stadion Renzo Barbera, Senin (12/9) dinihariWIB, Inter Milan ditumbangkan Palermo 3-4. Di laga ini, Pelatih Inter Gian Piero Gasperini menggunakan formasi 4-3-3 dengan menurunkan dua penyerang anyarnya, yakni Diego Forlan dan Mauro Zarate, mendampingi bomber Diego Milito di depan. Inisiatif penyerangan langsung

diambil Palermo yang bertindak sebagai tim tuan rumah. Dalam interval 10 menit pertama, Inter terus dalam tekanan tim tuan rumah dan baru bisa ke luar dari tekanan kala pertandingan memasuki menit 15. Gol Inter sendiri tercipta di menit 33. Dari luar kotak terlarang, tendangan Dejan Stankovic membentur tubuh Diego Milito dan mengecoh penjaga gawang Alexandros Tzorvas. Palermo

pun tampil lebih agresif di babak kedua. Hasilnya, mereka mampu menyamakan kedudukan. Diawali umpan terobosan terukur Edgar Barreto, Fabricio Miccoli langsung melepaskan tendangan terukur ke pojok kiri gawang Inter yang dikawal Julio Cesar. Namun, gol itu langsung dibalas Inter berkat pelanggaran Matias Silvestre. Hadiah penalti dari wasit

pun langsung dimanfaatkan Milito untuk membawa Inter memimpin 2-1. Tetapi, Palermo lagi-lagi mampu menyamakan kedudukan. Umpan silang terukur Miccoli dikonversi menjadi gol oleh Abel Hernandez. Hebatnya, tuan rumah ber-balik unggul di menit 86. Memanfaatkan bola mati, Miccoli mencetak gol

keduanya. Dua menit berselang, Mauricio Pinilla membawa Palermo unggul jauh 4-2 melalui tendangan spekulasi. Namun, Diego Forlan yang tampil pertama kali berseragam Inter memperkecil ketertinggalan Inter menjadi 4-3 beberapa saat sebelum bubaran. Hingga pertandingan berakhir, kemenangan 4-3 Palermo tetap tak berubah. Kemenangan ini mengantar Palermo menampati peringkat enam klasemen. Sedangkan, Inter terjerembab di posisi 14. (m33/ini/ap) Hasil Pekan Perdana Serie A AC Milan vs Lazio Cesena vs Napoli AS Roma vs Cagliari Catania vs Siena Chievo vs Novara Fiorentina vs Bologna Genoa vs Atalanta Juventus vs Parma Lecce vs Udinese Palermo vs Inter Milan

2-2 1-3 1-2 0-0 2-2 2-0 2-2 4-1 0-2 4-3

DUA gol dari Fabrizio Miccoli (kanan) sudah cukup bagi Palermo menumbangkan Inter Milan yang sudah diperkuat Diego Forlan dalam pekan perdana Serie A di Palermo, Senin (12/9). -AP-

Real Betis Gabung Ke Puncak MADRID (Waspada): Racing Santander dan Levante membagi poin ketika bermain 0-0 dan kedua tim itu belum memenangi pertandingan La Liga Primera. Di lain pihak, Real Betis unggul atas Mallorca dan bergabung dengan Real Madrid dan Valencia di puncak klasemen, Senin (12/9). Santander tampil lebih bagus pada babak pertama ketika Adrian Gonzalez, Pedro Munitis, dan Manuel Arana berhasil menemukan ruang tembak dan menguji ketangguhan penjaga gawang Levante. Gustavo Munua pun harus mengamankan tendangan keras Lautaro Acosta pada menit 31. Untuk Levante, tendangan bebas Jose Barkero dari jarak 25 yard membuat kiper Santander Tono Rodriguez bersusah

payah menyelamatkan gawangnya. Acosta masih memiliki peluang, namun harus berbuat lebih baik ketika usahanya melayang tipis di atas mistar gawang kala babak kedua baru dimulai. Di laga lain, Betis tampil mengesankan seperti yang diperagakan Ruben Castro pada menit 42 ketika tendangan kaki kirinya membenturkan bola ke tiang gawang dan Jorge Molina melakukan hal sama dua kali dalam usahanya mencetak gol. Castro selalu bergerak membuat manuver berbahaya dan tendangan kaki kanannya nyaris membobol gawang lawan pada menit 56. Ketika Mallorca kelihatan sudah akan mendapatkan satu poin, Castro melakukan gebrakan pada menit 87. Tanpa diduga, bola tendangannya melesat ke dalam ga-

wang kepala Molina. Sebelumnya, Osasuna mengalahkan Sporting Gijon 2-1 sekaligus memetik kemenangan pertama musim ini dan Rayo Vallecano berbagi angka dengan Real Zaragoza. Espanyol mengalahkan Athletic Bilbao 2-1 berkat dua gol dari Sergio Garcia. Garcia membuat Espanyol unggul pada menit 25 setelah melakukan kerjasama bagus dengan Alvaro yang mengirimkan umpan crossing. Mantan pemain muda Barcelona itu pun sukses menyundul bola masuk ke dalam gawang. Kiper Espanyol Cristian Alvarez mampu menjaga pergerakan Fernando Llorente dan juga pemain pengganti Ander Iturraspe yang sempat memiliki peluang emas. Bilbao akhirnya

mampu menyamakan kedudukan melalui aksi Llorente. Tim tuan rumah melakukan reaksi yang bagus dan kembali unggul pada menit 74 saat Garcia berhasil memanfaatkan bola hasil tangkapan tidak sempurna dari Gorka Iraizoz. (m33/ant/afp)

RUBEN CASTRO dan kawankawan tampil impresif ketika Real Betis menumbangkan Real Mallorca dalam lanjutan La Liga Primera, Senin (12/9). -AP-


Villas-Boas Ragu Torres LONDON (Waspada): Fernando Torres (foto) tampaknya belum akan memberikan kontribusi besar kepada Chelsea di Liga Champions, terlebih setelah beredar kabar El Nino akan kembali dibangkucadangkan. Striker seharga “50 juta poundstering” ini hanya menjadi pemain pengganti saat Chelsea membekuk Sunderland 2-1 di pentas Liga Premier, Sabtu (10/ 9) lalu. Besar kemungkinan Andre-Villas Boas belum akan memberikan kepercayaan kepada El Nino di laga penyisihan Grup E Liga Champions mela-

wan Bayer Leverkusen, Rabu (14/9) dinihari nanti. Ironisnya lagi, seperti dikutip The Sun, Senin (12/9), VillasBoas juga tak akan menurunkan Torres sebagai starter pada laga krusial melawan Manchester United akhir pekan nanti. Kabar ini jelas menjadi pukulan telak bagi striker termahal Liga Premier asal Spanyol itu. Sejak dibeli The Blues dari Liverpool pada Januari lalu dengan banderol 50 juta poundsterling, Torres baru mencetak satu gol dari 22 laga. Sebenarnya bomber internasional Negeri Matador tersebut menjalani

debut musim ini secara meyakinkan saat menghadapi Stoke City. Tapi, Torres seperti kehilangan kepercayaan diri di depan gawang sesudahnya. Villas-Boas pun lebih mempercayakan Daniel Sturridge di laga terakhir dan striker muda itu membayar kepercayaan pelatih dengan sumbangan satu gol ke gawang Sunderland. Kini, Blues dihadapkan pada dua partai penting (Leverkusen dan United) dan Villas-Boas sendiri telah menegaskan hanya menurunkan pemain yang menunjukkan kemampuan terbaik di lapangan. (m33/espn)



WASPADA Selasa 13 September 2011

Juara Bertahan SLTA Tumbang SMK Ar-Rahman Kalahkan SMAN 1 MEDAN (Waspada): SMK Ar-Rahman Medan berhasil melewati rintangan pertamanya pada Kejurnas Kit Futsalismo 2011 Seri II Medan dengan mencukur juara bertahan SMAN 1 Medan 3-0 di GSG Unimed, Senin (12/9). Kemenangan itu sekaligus menuntaskan dendam skuad asuhan pelatih Wahyono atas kekalahan mereka dari SMAN 1 Medan di final 2010 lalu. Ar-Rahman, 90 persen masih diperkuat pemain tahun lalu, pun kembali bertekad merebut tiket final. “Kami lebih diuntungkan karena memiliki materi pemain yang memang sudah lama bergabung dengan tim. Keuntungan ini akan kami manfaatkan untuk bisa kembali merebut tiket final dan berjuang menjadi juara,” ucap Wahyono. Begitupun, Wahyono berharap tim asuhannya tidak cepat puas karena perjuangan untuk meraih prestasi membanggakan baru saja dimulai dan kemenangan atas SMAN 1 harus menjadi motivasi tampil lebih baik pada laga berikutnya. “Persaingan pada Kejurnas Kit Futsalismo 2011 sepertinya akan lebih ketat dengan tampilnya tim-tim luar Kota Medan seperti Deliserdang, Binjai, dan Asahan. Tidak tertutup kemungkinan mereka menjadi lawan tangguh kita nanti,” pungkasnya. Mendapat dukungan puluhan suporter, anak-anak ArRahman langsung menerapkan permainan cepat. Namun serangan yang dibangun Agung cs kerap mampu dimentahkan SMAN 1 yang diuntungkan dengan keunggulan postur tubuh. Tiga gol Ar-Rahman baru tercipta di babak kedua hasil cetakan Agung (2) dan Fahrul. Laga lainnya, SMAN Harapan 1 Medan harus puas berbagi angka setelah ditahan SMA Asahan 2-2. Di lain pihak, SMA Nusantara Lubukpakam tampil gemilang dengan mencukur SMA Amir Hamzah 6-0 dan SMAN 3 Medan menundukkan SMAN 15 Medan 2-0. (m42)

STOK Binaguna, USU Buktikan Kelas MEDAN (Waspada): Tim futsal STOK Binaguna Medan mengawali debut gemilang pada laga pembukanya pada Kejurnas Kit Futsalismo 2011 Seri II Medan di Gedung Serba Guna (GSG) Unimed, Senin (12/9). Tampil dengan status juara bertahan, Binaguna berhasil membungkam Universitas Medan Area (UMA) 5-0. Perlawanan ketat diberikan UMA pada babak pertama dan memaksa M Ridwan cs hanya mampu melesakkan satu gol lewat Isnardi. Permainan berubah di babak kedua kala Binaguna berhasil menguasai jalannya laga. Keadaan itu mampu dimanfaatkan Binaguna untuk menambah empat gol lewat M Ridwan (2), Darma, dan Sandi sekaligus memperjelas keberadaan mereka sebagai salah satu tim unggulan. Sukses Binaguna diikuti runner-up tahun lalu, Universitas Sumatera Utara (USU). Diperkuat 60 persen pemain tahun lalu, USU berhasil menaklukkan LP3I Glugur 2-1. Kemenangan USU sendiri tidak diraih dengan mudah karena sempat tertinggal 0-1 di babak pertama. USU baru menyamakan skor di paruh babak kedua lewat gol Agung. Setelah itu, duel kedua tim kembali ketat. Anakanak asuhan pelatih Hendra Samhari akhirnya memastikan kemenangan di menit-menit akhir laga lewat gol Fahrul. “Anak-anak belum dapat tampil maksimal dan terkesan bermain terburu-buru. Terlebih setelah mereka tertinggal satu gol di babak pertama. Tapi saya yakin karena ini laga pertama mereka dan saya berharap pertandingan selanjutnya anak-anak dapat bermain lebih baik,” ucap Hendra yang juga berharap timnya mampu menjadi juara. Pertandingan lainnya, tuan rumah Unimed A dan B samasama meraih kemenangan. Bila Unimed A mengungguli STIE ITMI 4-2, maka Unimed B mengalahkan ITM 6-1. (m42)

Kategori Umum Pesta Gol MEDAN (Waspada): Persaingan tidak seimbang berlangsung di kategori Umum saat Blue Barrets dan Teledor 97 merayakan pesta gol atas lawan-lawannya pada hari pertama Kejurnas Kit Futsalismo 2011 seri II Medan, Senin (12/9). Bila Blue Barrets membungkam Bea Cukai Sumut 9-3, maka Teledor 97 mencukur habis PLN Sumut 9-0. Sukses keduanya pun telah membuka peluang lolos ke semifinal. Pada laga penentu, Selasa (13/9) ini, Blue Barrets akan berhadapan dengan Lintas Angkasa dan Bea Cukai menghadapi PLN Sumut esok harinya. Pesta gol juga dirayakan Lintas Angkasa yang membungkam GS One Asahan 8-1. Delapan gol Angkasa masing-masing dicetak Fauzul (3), M Taufan, Wiku, Nopi Andi, Abu Bakar, dan Dollis. Sedangkan gol balasan Asahan disumbangkan Azli. Di laga lainnya, Pegadaian Binjai membukukan kemenangan atas Lokomotif 4-2. Empat gol Binjai dihasilkan lewat hatrik Jaka dan satu gol Junaidi, sedangkan Lokomotif mencetak dua gol dari Habibi. (m42)


KETUA Umum KONI Sumut Gus Irawan Pasaribu, Pemimpin Umum Harian Waspada Hj Rayati Syafrin, Rektor Unimed Prof Ibnu Hajar Damanik, Pembantu Rektor I Drs Chairul Azmi MPd, Dekan FIK Unimed Drs Basyaruddin Daulay MKes, Senior Product Manager PT SC Johnson & Son Indonesia, Triatmaja Wardhanahadi serta unsur panitia lainnya diabadikan bersama tim SMAN 3 Medan dan SMAN 15 Medan usai acara pembukaan Kejurnas Kit Futsalismo 2011 Seri II Medan di GSG Unimed, Senin (12/9).

Wakil Medan Harus Juara Nasional Kejurnas Kit Futsalismo 2011 Seri II Medan MEDAN (Waspada): Ketua Umum KONI Sumut, Gus Irawan Pasaribu, mengaku bersyukur Sumut dalam hal ini Kota Medan kembali dipercaya menjadi tuan rumah Kejurnas Kit Futsalismo Seri II Medan untuk Regional Sumatera di Gedung Serba Guna (GSG) Unimed, 12-15 Septermber ini. “Kejuaraan ini sangat tepat dalam menambah jam tanding tim-tim futsal di Medan sekitar, sehingga berdampak positif dalam meningkatkan pembinaan dan prestasi futsal daerah ini,” ujar Gus dalam sambutannya pada pembukaan Kejurnas Kit Futsalismo 2011, Senin (12/9). Gus juga berharap tim juara dari Seri II Medan dapat mengukir prestasi maksimal di Jakarta. Terlebih pada 2010 lalu, wakil seri Medan hanya SMAN 1 Medan saja mampu mengukir prestasi dengan menduduki posisi ketiga. “Tim-tim yang nantinya berhasil menjadi wakil Seri II Medan harus berjuang lebih maksimal lagi sehingga bisa merebut gelar juara nasional dan mem-

beri kebanggaan bagi masyarakat Sumut,” ujar Gus. Seperti diketahui, wakil Sumut yang pernah sukses menjurai event sama adalah SMK Mulia Medan pada 2007, saat kejuaraan masih bernama Kelme Futsalismo. Setelah itu, baru pada 2010 Sumut yang diwakili SMAN 1 Medan nyaris mengulang sejarah sebelum akhirnya harus puas menduduki posisi ketiga. Ketua Panpel Lokal Seri II Medan, Jonny Ramadhan Silalahi, mengatakan Kejurnas mempertandingkan tiga kategori, yakni SLTA, Perguruan Tinggi, dan Umum. Medan kembali dipercaya sebagai tuan rumah 2011 tidak terlepas dari keberhasilan tahun 2010 ketika dinobatkan sebagai penyeleng-

Hasil Senin (12/9) Pegadaian Binjai vs Lokomotif Unimed B vs ITM GS One Asahan vs Lintas Angkasa STOK Binaguna vs UMA Blue Barrets vs Bea Cukai Sumut USU vs LP3I Glugur SMK Ar-Rahman vs SMAN 1 SMA Harapan 1 vs SMA Asahan SMAN 3 Medan vs SMAN 15 SMA Nusantara vs SMA A Hamzah PLN Sumut vs Teledor 97 STIE ITMI vs Unimed A

4-2 6-1 1-8 5-0 9-3 2-1 3-0 2-2 2-0 6-0 0-9 2-4

Jadwal Selasa (13/9)

Waspada/Arianda Tanjung

SALAH satu peserta lomba dance unjuk kebolehannya dalam pembukaan Kejurnas Kit Futsalismo 2011 Seri II Medan.

09.00 10.00 11.00 12.00 13.00 14.00 15.00 16.00 17.00 18.00 19.00 20.00

Lapan FC vs Cemara Sport LP3I G Mada vs STIK-P BBM FS vs KIM FC UNA vs UMSU Lokomotif vs GS One Asahan ITM vs STOK Binaguna Tunas Pelita vs SMA Hasapan Bangsa SMK Mulia vs SMA YPK SMAN 1 Medan vs SMA Harapan 1 SMA Asahan vs SMAN 3 Medan Lintas Angkasa vs Blue Barrets UMA vs USU


PEMIMPIN Umum Harian Waspada Hj Rayati Syafrin turut melakukan tendangan bola pertama.

gara terbaik dari tujuh seri yang digelar. “Hal itu juga tidak terlepas dari dukungan semua pihak, khususnya dukungan penuh Universitas Negeri Medan (Uni-

med). Lagipula sudah menjadi tekad seluruh panitia untuk kembali menyukseskan Kejurnas 2011 ini,” ucap Jonny. Seremoni pembukaan Kejurnas Kit Futsalismo 2011 Seri

II Medan kemarin dihadiri Pemimpin Umum Harian Waspada Hj Rayati Syafrin, Rektor Unimed Prof Ibnu Hajar Damanik, Pembantu Rektor I Drs Chairul Azmi MPd, Dekan FIK

Unimed Drs Basyaruddin Daulay MKes, Senior Product Manager PT SC Johnson & Son Indonesia, Triatmaja Wardhanahadi, dan undangan lainnya. (m42)


KETUA Umum KONI Sumut Gus Irawan Pasaribu, Rektor Unimed Prof Ibnu Hajar Damanik, dan Ketua PWI Sumut M Syahrir melakukan tendangan bola pertama sebagai tanda dimulainya Kejurnas Kit Futsalismo 2011 Seri II Medan.


WASPADA Selasa 13 September 2011


Indonesia Kalah Kelas YANGON, Myanmar (Waspada): Timnas U-19 Indonesia harus mengakui ketangguhan tim kuat Vietnam dalam lanjutan AFF U-19 Champhionship 2011 Grup B di Aung San Stadium, Yangon, Myanmar, Senin (12/9). Tim Merah Putih kandas 1-6 dari Vietnam. Tampil tanpa diperkuat kiper andalannya, Goldy Aulia Syahrizan dan Suherman, Indonesia bermain di bawah tekanan sejak menit-menit awal. Goldy terpaksa absen akibat cedera dalam latihan dan Suherman terkena hukuman larangan main. Waspada/ist

PEMAIN PS Albatros melakukan selebrasi usai menjuarai turnamen sepakbola di Malaysia, Minggu (11/9).

PS Albatros Juara Di Malaysia MEDAN (Waspada): PS Albatros mencetak hasil gemilang dengan memperoleh juara pada turnamen sepakbola terbuka di Kuala Lumpur, Minggu (11/9). Di final, tim binaan Alexander Gho mengalahkan tim Brunei Darussalam 4-3. Keberhasilan PS Albatros merupakan prestasi gemilang. Walaupun bermain dengan kekuatan pemain U-40 tahun, PS Albatros yang diperkuat mantan pemain PSMS dan PSDS Deliserdang memperlihatkan permainan solid. “Kemenangan ini diperoleh dengan perjuangan keras pemain,” kata pelatih Albatros Iwan Karo Karo kepada Waspada sesampainya di Bandara Polonia Medan, Senin (12/9). Di semifinal, PS Albatros memetik kemenangan 1-0 atas Penang FC. Pada final, PS Albatros mengandalkan Iwan Karo Karo, Alexander Gho,

Supriadi, Safrizal, Zakaria Lesmana, Indra Jaya, Anton, Amran, Erwin, Juanidi, Petrus Barus, dan Rizaldi. Gol kemenangan PS Albatros dihasilkan Petrus Barus, Zakaria, Alexander Gho, dan Iwan Karo Karo. Selain PS Albatros, Brunei Darussalam, Penang FC, turnamen yang rutin dilaksanakan setiap tahunnya itu diikuti tim asal Australia, Sabah, Malaka, Taiwan, Singapura, dan Melodi Jaya Malaysia. Atas prestasi tersebut, Manajer Tim Alexander Gho mengakui puas dengan keberhasilan PS Albatros yang menampilkan permainan konsisten sejak awal turnamen. Keberhasilan ini, sebut mantan manajer tim PSMS Junior, merupakan kegembiraan bagi mantan pemain yang masih dapat mengharumkan nama bangsa dan negara. (m18)

33 Pengcab/Klub Ikuti Musdalub PSSI Sumut MEDAN (Waspada): Musyawarah Daerah Luar Biasa (Musdalub) PSSI Sumut diikuti 33 klub Pengcab PSSI dan klub sesuai acuan Musda PSSI Sumut 2009. Pengcab dan klub diwakili dua orang delegasi yang terdiri atas satu pemilih dan satu peserta dengan surat mandat dari kepengurusan Pengcab yang hadir pada Musda PSSI Sumut 2009 (dibuktikan Chairullah SIP MAP) dan kepengurusan klub terbaru (dibuktikan akta notaris). Demikian disampaikan Ketua Panitia Pelaksana Catur Agus Saptono didampingiWakil Ketua Panpel Sarluhut Napitupulu di Medan, Senin (12/9). Menurut Catur, PSSI tidak menginginkan masuk kepada “daerah konflik” dalam arti diberlakukannya peserta sesuai dengan daftar hadir pada Musda 2009. Jadi, tambah Catur, dengan demikian diambil kebijakan para peserta yang mengikuti Musdalub adalah mereka yang menghadiri Musdalub PSSI Sumut yang dilaksanakan 4 Desember 2009 silam. Dia mengakui ada peserta yang meneken daftar hadir dua kali. Ini dilakukan Pengcab PSSI Simalungun dengan nama dan tekenan yang sama pula. Dengan demikian, diputuskan 20 Pengcab PSSI yang diundang mengikuti Musdalub. Untuk klub, ada 13 utusan yang hadir pada Musdalub 2009, walaupun terdaftar 14 klub. PSS Simalungun terdaftar pada Musda PSSI Sumut 2009, namun dalam daftar hadir tidak ada yang tandatangan. Catur yang juga adalah Wakil Ketua Komisi Disiplin PSSI menambahkan bahwa panitia pelaksana sudah mengonfirmasikan kepada 33 Pengcab PSSI dan klub yang mengikuti Musdalub pada Minggu (18/9) di Hotel Asean International, Jl H Adam Malik Medan. Disebutkan pula, surat mandat hanya dapat diberikan kepada orang yang namanya ada dalam kepengurusan Pengcab dan klub turut dibuktikan dengan fotokopi kartu tanda pengenal. Delegasi harus menyerahkan foto warna ukuran 4x6 sebanyak 2 lembar. Menanggapi calon ketua umum, Catur menjelaskan pendaftaran calon Ketua Umum Pengprov PSSI Sumut periode 2011-2015 dibuka mulai Senin (12/9) pukul 10:00 WIB dan ditutup Jumat (16/9) pukul 17:00 WIB. Penyerahan surat pencalonan langsung diserahkan kepada panitia Musdalub PSSI Sumut di Sekretariat KONI Sumut, Jl Willem Iskandar Pasar V No 9 Medan Estate. Namun pada hari pertama belum ada calon Ketua Umum PSSI Sumut periode 2011-2015 yang menyerahkan berkas. Untuk kriteria calon Ketua Umum Pengprov PSSI Sumut dijelaskan

20 Daftar Pengcab PSSI Diundang 1. Pengcab PSSI Kota Medan 2. Pengcab PSSI Langkat 3. Pengcab PSSI Binjai 4. Pengcab PSSI Deliserdang 5. Pengcab PSSI Simalungun 6. Pengcab PSSI Toba Samosir 7. Pengcab PSSI Humbahas 8. Pengcab PSSI Pakpak Bharat 9. Pengcab PSSI Tanah Karo 10. Pengcab PSSI Mandailing Natal 11. Pengcab PSSI Padang Lawas Utara 12. Pengcab PSSI Padangsidimpuan 13. Pengcab PSSI Dairi 14. Pengcab PSSI Batubara 15. Pengcab PSSI Labuhanbatu 16. Pengcab PSSI Serdang Bedagai 17. Pengcab PSSI Sibolga 18. Pengcab PSSI Asahan 19. Pengcab PSSI Tanjungbalai 20. Pengcab PSSI Padang Lawas

13 Klub Diundang 1. PS Madina Medan Jaya 2. PSS Asahan 3. Persebsi Sibolga 4. PSTS Tanjungbalai 5. PSSD Dairi 6. PS Sergai 7. Poslab Labuhanbatu 8. PS Tri Mantra Esa 9. PS Madina 10. PSSK Karo 11. Pesitas Tapsel 12. PS TT Tapteng 13. PSN Nias pula bahwa calon diharuskan berdomisili dan menetap di Medan dengan bukti fotokopi KTP. Kriteria lain adalah calon ketua umum minimal mendapat dukungan delapan peserta dengan hak suara yang ditandatangani pengurus sah. Dukungan peserta dianggap sah apabila hanya diberikan kepada satu orang calon. Di samping itu, calon ketua umum tidak pernah dinyatakan bersalah atas suatu tindakan kriminal dengan membuat surat pernyataan tidak pernah dipidana yang dibuat dan ditandatangani oleh calon ketua umum di atas materai Rp 6000. Dokumen pencalonan yang harus diserahkan, yakni surat pernyataan sebagai calon Ketua Umum Pengprov PSSI Sumut. Dengan melampirkan fotokopi surat keputusan kepengurusan Pengcab atau akta notaris pengurus klub. Selanjutnya fotokopi calon yang bersangkutan. (m18)

Problem Catur


Putih melangkah, mematikan lawannya enam langkah habis-habisan.

Jawaban di halaman A2.

Timnas U-19 juga tak bisa diperkuat Bagus Penara Amru yang dibelit cedera. Sejak peluit ditiup wasit asal Malaysia, Nagor Amir Noor Muhamed, Syahru cs terlihat tampil tanpa gairah. Mereka pun harus membayar mahal kelesuan ini. Gawang Indonesia yang







Renovasi Teladan Selesai 7 Oktober MEDAN (Waspada): Drs H Rahudman Harahap MM, menyebutkan dirinya siap menjadi Ketua Umum periode 2011/2014. Demikian dikatakan Ketua Umum KONI Medan, Drs H Zulhifzi Lubis, di Sekretariat KONI Medan, Senin (12/9). Sebagai ketua umum, dia mengajak seluruh elemen termasuk masyarakat Kota Medan untuk mendukung klub kebanggaan Kota Medan itu, sehingga dalam kompetisi tahun ini di kasta tertinggi Liga Super Indonesia (LSI) dapat berpartisipasi. Pengakuan Wali Kota Medan itu diungkapannya kepadanya baru-baru dalam pertemuan keduanya sekaligus menjawab tekateki selama ini Rahudman disebut-sebut enggan memimpin Ayam Kinantan. Rahudman juga telah meminta Kadis Perkim bersama Kadis Pertamanan Medan untuk merenovasi Stadion Teladan dan harus selesai 7 Oktober mendatang, agar stadion yang dibangun tahun 1953 itu layak digunakan untuk kompetisi Liga Indonesia mendatang. Namun Opung tidak membantah seharusnya pekerjaan merenovasi stadion seperti drainase, bangku penonton dan cadangan, press room serta pengecatan sudah harus dimulai tetapi belum juga dilaksanakan pihak Dinas Perkim dan Pertamanan Medan. “Ini juga nanti akan dipertanyakannya kepada Kadis Perkim dan Kadis Pertamanan, karena mengindahkan instruksi wali kota berikut alasan mereka belum memulai pekerjaannya,” kata Opung, sapaan akrab Zulhifzi. Padahal wali kota telah meninjau Stadion Teladan sebanyak dua kali dan kerap meminta kedua kepala dinas tersebut memulai renovasi. Menjawab pertanyaan tentang dana PSMS setelah dihapuskannya APBD Kota Medan, Opung mengatakan Rahudman akan mengupayakan PSMS dimasukkan dalam Perda Kota Medan. Hal tersebut dinilai memungkinkan setelah sejumlah 40 klub anggota PSMS menyerahkannya untuk dikelola Pemko Medan. Penyerahan itu tertuang saat pertemuan 40 klub beberapa waktu lalu di Hotel Grand Aston Medan yang sepakat pengelolaan Ayam Kinantan diserahkan kepada Pemko Medan. Menanggapi tentang posisi Direktur Utama PT PSMS yang belakangan mencuat nama Doli Siregar dan adanya pertemuan beberapa klub, posisi tersebut semuanya tergantung keputusan ketua umum termasuk dengan CEO PSMS. Terkait pertanyaan wartawan yang menganggap pengurus PSMS saat ini tidak becus dan perlu dirombak, Opung seluruhnya menyerahkannya kepada ketua umum. Secara terpisah, Opung menilai pengurus PSMS sekarang ini sudah cukup baik dengan bukti PSMS tetap ikut kompetisi. “Kalau gagal mencapai target, bukan berarti pengurus PSMS yang tidak becus tetapi pemain belum mampu. Sebaiknya kita menilai orang itu haruslah secara rasional, bukan emosional,” sebutnya. (m17)









Grup B Vietnam Laos Myanmar Indonesia Brunei DS

3 2 2 2 3

2 1 1 0 0

1 1 1 1 0

0 14-2 7 0 10-3 4 0 5-1 4 1 4-9 1 3 0-18 0

Darussalam dan Myanmar pada dua laga tersisa. Apalagi pada saat yang sama, Myanmar membekap tim lemah Brunei Darussalam 4-0 di Thuwanna Stadium. “Kami sudah minta anakanak tak perlu kecewa dan tetap semangat,” papar pelatih Zulkifli Alfat danWahidin Usman. (b05)


KETUA Umum KONI Kota Medan, Drs H Zulhifzi Lubis (tengah), foto bersama dengan atlet PABBSI Kota Medan yang akan bertarung di babak kualifikasi PON, Senin (12/9).

KONI Medan Harapkan Prestasi PABBSI MEDAN (Waspada): Ketua Umum KONI Kota Medan, Drs H Zulhifzi Lubis, meminta atlet PABBSI Medan bisa mengangkat nama Kota Medan dan Sumatera Utara untuk bisa lolos ke PON XVIII Riau 2012 mendatang. Hal itu disampaikannya ketika melepas dan memberi uang saku kepada lima atlet PABBSI Kota Medan yang akan bertanding di babak prakualifikasi PON di Jawa Barat di kantor KONI Kota Medan, Kompleks Stadion Teladan, Senin (12/9). “Saya sangat ingin atlet PABBSI Kota Medan dapat lolos

ke PON Riau mendatang. Untuk itu, saya juga mengharapkan bertandinglah dengan sungguhsungguh nanti,” sebutnya. Lebih lanjut, pria yang akrab disapa Opunk Ladon itu menjelaskan langkah yang diambil KONI Kota Medan ini sama dengan atlet cabang lainnya tanpa membeda-bedakan. Opunk pun mengharapkan kelima atlet tampil maksimal di Jawa Barat (angkat besi/berat) pada 21-26 September nanti dan Jawa Timur (binaraga), 17-20 September 2011. Kelima atlet yang ikut pada kualifikasi PON tersebut adalah Faebolo Dodo Gowasa, Rico

Goncalwes (angkat berat), Isma Sumarwana (angkat besi), Lilik Ruspianto dan Agung Waw (binaraga). Kepada Waspada, Lilik Ruspianto mengatakan dirinya telah mempersiapkan diri untuk menghadapi kualifikasi PON dengan latihan intensif untuk mencapai target lolos PON. “Saya telah menanamkan target pribadi untuk lolos ke PON mendatang. Untuk itu, saya akan tampil semaksimal mungkin dan mengharapkan keberangkatan bersama rekanrekan diiringi doa restu dari masyarakat Kota Medan,” harapnya. (m47)

Limbong Sikapi Dingin Ancaman Pemain J A K A RTA ( Wa s p a d a ) : Penanggungjawab Timnas Indonesia, Bernhard Limbong, tidak begitu ingin menanggapi rumor ancaman sejumlah pemain timnas senior yang menolak bergabung sekiranyaWim Risjbergen tetap menjadi pelatih kepala timnas. Menurut Limbong, apa yang terjadi saat ini di timnas senior hanya karena miskomunikasi semata. Karena itu, pria yang juga mantan anggota Komite Eksekutif (Exco) PSSI ini memastikan dalam waktu dekat akan menemui semua pihak, termasuk pemain timnas. “Saya berharap semua pihak menahan diri dengan tidak lagi melakukan provokasi. Apa yang terjadi di timnas saya pikir hanya miskomunikasi saja,” tegas Limbong saat dihubungi Waspada, Senin (12/9). Ditambahkan, selaku penanggungjawab timnas, pihaknya sudah menegur secara lisan pelatihWim Rijsbergen menyusul pernyataannya di media massa yang menyudutkan pemain timnas pascakekalahan menyakitkan 0-2 atas Bahrain dalam laga lanjutan putaran ketiga Pra Piala Dunia 2014. “Kami sudah meminta dia (Wim Rijsbergen) untuk menahan diri dan bisa lebih menjaga sikap. Bagaimana pun, suasana kondusif di dalam skuad timnas

harus terus diciptakan. Apalagi, kita masih harus fokus menghadapi empat laga lagi,” urai Limbong menambahkan. Seperti diketahui, buntut keributan di skuad Garuda Senior membuat tujuh pemain dikabarkan menolak berbaju timnas Merah Putih, sekiranyaWim masih menjadi pelatih. Pernyataan ketujuh pemain timnas ter-

sebut bahkan dibenarkan kapten Bambang Pamungkas dalam situs pribadinya. “PSSI tidak perlu takut, konsisten saja untuk membenahi semua, termasuk mental pemain timnas,” kata Balian Siregar SSos MSi, pengamat sepakbola nasional, menyikapi polemik di timnas saat ini. (yuslan)

Rifat Incar Podium Di Bali JAKARTA (Waspada): Pereli nasional Rifat Sungkar tampak semakin menekuni bidang otomotif baru. Di tengah waktu senggang dari kegiatannya mengikuti seri Asian Pacific Rally Championship musim 2011, anak pertama mantan pereli kawakan Helmi Sungkar ini mulai bergeliat di dunia drifting. Setelah sempat mencoba peruntungan di ajang yang terbilang cukup baru di tanah air pada Drift War pada Jakarta International Motor Show beberapa waktu lalu, pereli berusia 32 tahun ini memastikan bakal kembali menjajal kemampuan drifting di Sirkuit Bali Speed City, 16-19 September nanti. “Ajang kali ini cukup kompetitif karena informasi yang saya peroleh, ada beberapa drifter mancanegara yang akan ikut ambil bagian. Bahkan dari Jakarta saja ada sekitar 26 mobil yang akan tampil,” kata Rifat dalam konferensi pers di kediamannya, Senin (12/9). Dikatakan, Rifat yang nantinya bakal memperkuat tim Speedy Drift, meski belum mengetahui trek yang akan digunakan, target naik podium tetap dicanangkan. Hal tersebut mengingat power mobil yang akan digunakan lebih baik dari saat tampil di Kemayoran beberapa waktu lalu, yakni Nissan 180 XX. Pada ajang Drift Bash yang masuk dalam kegiatan Bali Auto Fiesta itu, Rifat mengaku tidak hanya ingin menjajal sirkuit baru, akan tetapi bakal menggunakannya sebagai ajang pemanasan sebelum tampil dalam Kejuaraan Formula Drift di JIEXPO Kemayoran, 29-30 Oktober mendatang. (yuslan)




Menurun 1

membuat Vietnam meningkatkan tensi permainan. Hasilnya, Nguyen Van Manh membawa timnya memimpin 1-3. Pada babak kedua,Vietnam kembali menambah tiga gol masing-masing pada menit 47 lewat tendangan Nguyen Xuan Nam, menit 54 hasil kontribusi Ho Sy Sam, dan gol terakhir lewat kaki NguyenViet Phong pada menit 58. Menyikapi hasil buruk pada laga kedua, membuat posisi Indonesia kritis dan perlu perjuangan berat. Jika ingin lolos ke semifinal, Indonesia harus mampu mengalahkan Brunei

Suharto Pimpin Latihan Perdana MEDAN (Waspada): Asisten Pelatih Suharto memimpin latihan sekaligus seleksi perdana PSMS Medan jelang kompetisi Liga Indonesia 2011/2012 di Stadion Kebun Bunga Medan, Senin (12/9). Pasalnya, H Abdul Rahman Gurning belum terlihat di lapangan karena alasan keluarga. Akibatnya, Suharto yang sukses membawa Ayam Kinantan lolos ke babak 8 Besar Divisi Utama Liga Indonesia 2010/2011 lalu berinisiatif memimpin latihan bersama dua rekannya, Roekinoy dan Mardianto. Seleksi diawali dengan laga mempertemukan PSMS senior kontra PSMS muda. Pada latihan tersebut, keseluruhan pemain seleksi belum hadir dan hanya melibatkan 11 pemain, yakni Ramadhan Saputra (Persita Tangerang), Arie Priatna, Zainal Anwar (Persipasi Bekasi), Anton Samba (Persikabo Bogor), Simon Kujiro (Semarang United), Arifin Genuni (PSAP Sigli) plus Zulkarnain, Novi Handriawan, Mahadi Rais, dan M Syahbani (mantan PSMS). Roekinoy, asisten pelatih PSMS, mengatakan kelengkapan skuad belum dapat terakomodir karena pemain memiliki kendala teknis masing-masing. Ferdiansyah (Persipura Jayapura) belum rampung kontraknya dan masih membela Mutiara Hitam di ajang Liga Champions Asia. Irfan Raditya masih terlibat persiapan SEA Games untuk Timnas U-23, sedangkan Erol FX Iba juga masih melakoni pemusatan latihan bersama Timnas PPD. Sementara itu, sejumlah pemain asing mengurus kepindahan dari klub masing-masing seperti Osas Saha, Pierre Njanka, dan Mbom-Mbom Julien. “Latihan perdana tetap komit kita lakukan. Apalagi sebelas pemain sudah ada dengan posisi berbeda. Jadi tidak terkendala menurunkan format tim. Rabu (14/9) besok diperkirakan skuad sudah lengkap,” kata Roekinoy. Sekretaris Umum PSMS, Idris SE, menjelaskan hal serupa terkait tidak lengkapnya pemain seleksi. Ia menyebutkan pihaknya harus memaklumi kendala teknis itu. Terkait seleksi yang dilakukan, Idris menerangkan seleksi tidak bersifat terbuka. “Publik punya anggapan keliru. Sistem yang dibuat adalah seleksi pemain yang direkrut, bukan sebaliknya yang diseleksi dulu baru direkrut,” imbuhnya menambahkan Zulkarnain cs mengalahkan PSMS muda 1-0 berkat gol Ari Priatna. (m17)

2. Mantan bendahara Partai Demokrat yang kini ditahan dan diperiksa KPK setelah ditangkap di Kolombia. 6. Syak; Curiga (Arab). 7. Partai dipimpin Megawati. 11. Singkatan umum warganegara. 12. Singkatan untuk pemilihan presiden. 13. Negara komunis yang awalnya satu dan kemudian runtuh. 15. Ancaman hukuman terhadap penyelundup narkoba, pelaku pembunuhan berencana. 16. ____ Sanit, pengamat politik. 18. Singkatan gelar sarjana doktoral. 19. Badan Intelijen Negara. 21. Arti “rechtstaat” dalam bahasa Indonesia (dua kata, tulis tanpa spasi). 23. Yang diurus ke notaris, BPN. 24. Diharapkan dari hakim. 27. Singkatan orde untuk pemerintahan Soeharto. 28. Bosnya Kejaksaan Tinggi.


dikawal Adel Satri Nanda langsung bobol di menit ketiga lewat aksi Nguyen Thann Hien. Dua menit kemudian, gawang Indonesia kembali kemasukan lewat tusukan Nguyen Xuan Nam. Kebobolan dua gol dalam tempo singkat membuat mental anak-anak Indonesia turun, apalagi kiper yang acap membuat blunder sejak laga dimulai. Pun begitu, Fitra dan kawankawan tetap semangat. Menit 12, Zoel Fadhli memberi asa Indonesia saat mampu memperkecil keunggulan menjadi 1-2. Kecolongan satu bola

1. Nama Gubsu yang mengangkat istilah “good governance” dan diperingati enamtahun tewasnya

pada 5 September lalu. 2. Tidak; Bukan. 3. Koalisi dalam bahasa Belanda populer. 4. Dewan Pimpinan Pusat. 5. Bersangkut paut dengan dasar atau falsafah negara. 8. Sah, diumumkan oleh pihak berwenang. 9. Pengurangan hukuman pada narapidana. 10. Singkatan orde untuk pemerintahan Soekarno. 11. Nama koran perjuangan di Medan. 14. Pengadilan khusus yang diinginkan untuk mengadili koruptor. 15. Ketuanya Taufiq Kiemas. 17. Berat sebelah. 18. Politisi yang pandai menarik simpati rakyat dengan janji-janji muluk. 20. Tidak sah. 22. Zaman. 25. Singkatan Dewan Pertimbangan Agung, lembaga tinggi negara yang ditiadakan setelah amendemen UUD 1945. 26. Singkatan badan intelijen AS, sering disebut berperan dalam kudeta suatu negara.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: mudah (**), bisa diselesaikan dalam waktu tak sampai tujuh menit. Jawabannya lihat di halaman A2 kolom 1.



3 9 1 5 3 8 9 5 6 4 1 3 5 1 2 1 6 2 7 9 3 8 6 8 4 7 3 5 9 6 7 6 5 8


3 e221



WASPADA Selasa 13 September 2011

Hari Terbaik Stosur NEW YORK, AS (Waspada): Samantha Stosur (foto) meraih gelar juara turnamen grand slam pertama kali dan tampil sebagai petenis Australia pertama yang menyandang gelar juara itu setelah Margaret Court pada 1973, Senin (12/9). Stosur mengakhiri paceklik panjang petenis putri Australia di AS Terbuka dengan menggondol gelar juara tahun ini. Setelah 38 tahun berlalu, baru kali ini ada perempuan asal Negeri Kangguru yang kembali berjaya di AS Terbuka. “Ini adalah salah satu hari terbaikku dan aku amat beruntung mendapatkannya pada tahap ini di New York,” ujar Sto-

sur usai menundukkan Serena Williams 6-2, 6-3 di USTA Billie Jean King Tennis Center. “Semenjak aku mulai bermain, adalah impianku tampil di sini pada suatu hari. Aku benar-benar tidak tahu harus bilang apa. Serena, kamu adalah pemain hebat, juara luar biasa dan sudah melakukan banyak hal positif untuk olahraga kita,” lanjutnya memuji sang runner-

up asal Amerika Serikat (AS) itu. Keberhasilan Stosur menjadi juara sekaligus memupus niat Serena untuk mengangkat trofi juara di depan publik Flushing Meadows yang juga tengah mengenang kejadian 11 September 2011. Untuk Serena, penampilan lawan Stosur bak menjadi anti klimaks, mengingat dalam lajunya ke partai puncak dirinya tidak pernah kehilangan satu set pun. Ironis, karena di final Stosur justru menyungkurkannya dalam straight set. “Ia bermain sangat baik, ia adalah pemain hebat. Aku mencoba sekeras mungkin tapi ia terus memukul dan meraih poin, dan tidak ada yang bisa aku lakukan,” komentar Serena. (m33/ap)

Daftar Juara Tunggal Putri AS Terbuka 2011 - Samantha Stosur (Australia) 2010 - Kim Clijsters (Belgia) 2009 - Kim Clijsters (Belgia) 2008 - Serena Williams (AS) 2007 - Justine Henin (Belgia) 2006 - Maria Sharapova (Rusia) 2005 - Kim Clijsters (Belgia) 2004 - Svetlana Kuznetsova (Rusia) 2003 - Justine Henin-Hardenne (Belgia) 2002 - Serena Williams (AS) 2001 - Venus Williams (AS) 2000 - Venus Williams (AS) 1999 - Serena Williams (AS) 1998 - Lindsay Davenport (AS) 1997 - Martina Hingis (Swiss)

Euforia Landa Australia SYDNEY, Australia (Waspada): Petenis Australia, Samantha Stosur, baru saja mengukir prestasi tertinggi dalam kariernya. Pemain berusia 27 tahun ini merengkuh gelar grand slam AS Terbuka dengan mengalahkan petenis tuan rumah, Serena Williams, Senin (12/9). Tak ayal, eforia melanda Australia, yang kembali memiliki bintang baru di arena tenis. Sukacita itu pun menghinggapi keluarga Stosur, terutama sang ayah, Tony. “Ini merupakan pencapaian menakjubkan yang dilakukannya dalam turnamen grand slam,” kata Tony kepada Radio ACN di kediamannya di Gold Coast, Australia. “Ia menginginkan hal ini bertahun-tahun lalu. Suatu hal luar biasa ia dapat melakukannya di Amerika, melawan pemain yang dalam kondisi sehat,” katanya setelah Stosur menjadi USAI menjuarai AS Terbuka, Senin (12/9), Samantha Stosur langsung mendatangi keluarganya di box khusus. -AP-

Pasang Iklan Telp. 4528431 Email:

petenis pertama dari Australia yang memenangi AS Terbuka dalam 38 tahun terakhir. “Ia tampil luar biasa, ia pantas mendapatkannya, tidak ada kekhawatiran tentang itu. Ia tampil fantastis,” puji sang ayah. Sebenarnya, Serena menjadi favorit juara untuk merengkuh gelar keempat di Flushing Meadows. Meskipun peringkatnya jauh lebih rendah, lantaran istirahat panjang akibat cedera dan gangguan kesehatan, kondisi Serena saat ini sangat menjanjikan untuk kembali ke puncak prestasi. Namun, Stosur menunjukkan penampilan sangat impresif. Alhasil, petenis peringkat sembilan dunia tersebut menang straight set 6-2, 6-3. Dalam laga yang dilaksanakan tepat dengan tahun ke-10 terjadinya serangan 11 September di New York, Serena tampil frustrasi dan sempat

berteriak ke arah wasit ketika harapannya meraih gelar juara terancam. “Penonton mendukung Serena dan tekanan amat berat kepada Sam. Tetapi ia bertahan dan berhasil mengatasinya,” kata Tony. Perdana Menteri Australia, Julia Gillard, juga ikut memberikan pujian dan mengucapkan selamat kepada Stosur. Menurutnya, kemenangan petenis negaranya itu akan menjadi inspirasi bagi generasi muda dan para petenis lainnya. “Ia menunjukkan kemampuan hebat untuk memenangi AS Terbuka, dan setiap orang yang terlibat dengan tenis di Australia akan merayakan kemenangan itu. Ini merupakan pencapaian luar biasa, dan tenis Australia akan menanjak di masa mendatang,” kata Gillard. (m33/rtr)


Duo Yamaha Tampil Di Motegi GERNO DI LESMO, Italia (Waspada): DuoYamaha Racing Team, Jorge Lorenzo dan Ben Spies, akhirnya bersedia tampil di lintasan MotoGP Jepang yang berlangsung di Sirkuit Twin Motegi, 2 Oktober mendatang. Awalnya, sejumlah nama tenar di kelas para raja menolak ambil bagian dalam MotoGP Jepang musim ini, menyusul radiasi yang ditimbulkan dari meledaknya reaktor nuklir di Fukushima akibat gempa dan tsunami yang melanda Negeri Matahari Terbit, Maret lalu. Valentino Rossi, Casey Stoner, hingga Lorenzo sendiri de-

ngan lantang menyuarakan menolak tampil di Jepang karena khawatir dampak radiasi yang masih ditimbulkan. Namun, Lorenzo akhirnya luluh dan siap turun lintasan dalam di Motegi. “Yamaha Factory Racing Team menegaskan Jorge Lorenzo dan Ben Spies akan berkompetisi pada seri ke-15 pada kejuaraan dunia MotoGP di Motegi, Jepang, 2 Oktober mendatang, “ demikian bunyi pernyataan Yamaha, Senin (12/9). Kepastian Lorenzo dan Spies turun lintasan pun diperkuat oleh pernyataan manajer tim Lorenzo, Wilco Zeelenberg.

Dikatakan, beberapa bulan ini Lorenzo menolak pergi karena tidak merasa aman. Namun sang juara dunia itu berubah keputusannya menyusul info terbaru. Keputusan tetap menghelat MotoGP Jepang datang dari FIM dan Dorna Motorsport setelah melihat perkembangan terbaru yang dilakukan tim independen menyelediki situasi umum di Jepang pascabencana. Laporan yang berkembang menyebut resiko radiasi dalam udara, lingkungan dan makanan selama balapan bisa diabaikan. (m33/auto)

Sumatera Utara

WASPADA Selasa 13 September 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:23 12:37 12:24 12:31 12:31 12:28 12:24 12:20 12:27 12:26

‘Ashar 15:25 15:40 15:26 15:34 15:32 15:33 15:27 15:23 15:29 15:27

Magrib 18:29 18:42 18:29 18:37 18:36 18:32 18:29 18:25 18:32 18:32



Shubuh Syuruq


19:37 19:51 19:38 19:45 19:45 19:40 19:37 19:33 19:40 19:40

04:52 05:04 04:52 04:59 04:59 04:57 04:53 04:48 04:55 04:54

05:02 05:14 05:02 05:09 05:09 05:07 05:03 04:58 05:05 05:04

L.Seumawe 12:30 L. Pakam 12:23 Sei Rampah12:23 Meulaboh 12:34 P.Sidimpuan12:21 P. Siantar 12:22 Balige 12:22 R. Prapat 12:19 Sabang 12:37 Pandan 12:23

06:16 06:29 06:17 06:23 06:23 06:21 06:17 06:13 06:19 06:19

Zhuhur ‘Ashar 15:32 15:25 15:23 15:34 15:27 15:25 15:26 15:23 15:40 15:28




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:35 18:28 18:27 18:39 18:26 18:27 18:27 18:23 18:42 18:28

19:40 19:44 19:36 19:35 19:47 19:34 19:35 19:35 19:32 19:51

04:54 04:57 04:51 04:50 04:50 04:50 04:51 04:47 05:04 04:52

05:04 05:07 05:00 05:12 05:00 05:00 05:01 04:57 05:14 05:02

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:23 12:24 12:34 12:27 12:24 12:31 12:19 12:29 12:22 12:22

18:28 18:29 18:40 18:32 18:29 18:36 18:24 18:34 18:27 18:27

19:36 19:48 20:38 19:40 19:38 18:45 19:32 19:43 19:35 19:35

04:52 04:53 05:02 04:56 04:52 04:59 04:48 04:58 04:51 04:50

05:02 05:03 05:12 05:06 05:02 05:09 05:58 05:08 05:01 05:00

Panyabungan 12:20 Teluk Dalam12:27 Salak 12:25 Limapuluh 12:20 Parapat 12:22 GunungTua 12:20 Sibuhuan 12:19 Lhoksukon 12:29 D.Sanggul 12:23 Kotapinang 12:18 Aek Kanopan 12:19

06:22 06:15 06:14 06:26 06:14 06:15 06:15 06:12 06:29 06:16

15:28 15:28 15:37 15:31 15:26 15:32 15:22 15:32 15:27 15:24

06:16 06:17 06:26 06:20 06:17 06:23 06:12 06:22 06:15 06:14

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Kualitas Mahasiswa Tak Ditentukan Asal PT TEBINGTINGGI (Waspada): Kualitas mahasiswa tidak ditentukan asal muasal perguruan tingginya. Meski pun mahasiswa itu menuntut ilmu pada perguruan tinggi tidak terkenal, tapi jika semangat menuntut ilmunya tinggi disertai dengan kegiatan akademik yang baik, mahasiswa itu kelak akan sukses ditengah masyarakat. Pesan itu disampaikan Pembantu Ketua III Sekolah Tinggi Ilmu Tarbiyah “Al Hikmah” Kota Tebingtinggi Ismail Budiman, SH, SE, Senin (12/9), saat melepas 65 mahasiswa sekolah tinggi itu melaksanakan praktek pengalaman lapangan (PPL) di berbagai sekolah. Kegiatan PPL ini, salah satunya merupakan sarana menempa diri mahasiswa dalam menerapkan ilmu pendidikan Islam yang telah dipelajarinya. “Jika kegiatan ini dilaksanakan dengan serius, manfaatnya sangat besar nantinya,” pesan PK III dan juga Sekretaris DPRD Kota Tebingtinggi itu. Ketua STIT“Al Hikmah” Salman Rasyidi, SE, MA, menyatakan saat ini keberadaan perguruan tinggi itu sudah mendapat kepercayaan luas masyarakat. Tidak hanya di Kota Tebingtinggi, tapi banyak sudah mahasiswa dari Kab. Sergai, Batubara hingga Simalungun yang menuntut ilmu di perguruan tinggi itu. Kepercayan itu akan dijaga civitas akademika STIT “Al Hikmah” dengan terus menerus meningkatkan kualitas akademik para dosen, sarana dan prasarana yang ada, kata dia. Selian STIT, imbuh Salman Rasyidi, Perguruan Tinggi itu juga mengembangkan sekolah tinggi ilmu ekonomi (STIE) yang juga diminati banyak calon mahasiswa. Sedangkan bagi sarjana yang tidak sempat melanjutkan pendidikan S2 di luar kota, juga dibuka program S2 Magister Manajemen Pendidikan bekerjasama dengan IMNI Jakarta. Ketua Panitia PPL Drs. Jumpa Ukur Sembiring, MPd, menyebutkan sejumlah sekolah yang menjadi lokasi PPL mahasiswa STIT Al Hikmah, yakni SMKN 1, SMAN 4, MAN Tebingtinggi, MAS AlWashliyah, MAS RIS, MAS Ponpes Al Hasyimiyah, SMK Tamansiswa dan SMA Diponegoro.“Mereka akan melaksanakan PPL dari 22 September s/d 22 Oktober 2011,” tandas Jumpa Ukur.(a09)

Waspada/Abdul Khalik

MAHASISWA ST IT “Al Hikmah” koat Tebingtinggi menerima pengarahan dari dosen pada pelepasan 65 mahasiswa melaksanakan PPL. Mereka diharapkan menjaga nama baik almamater.Foto direkam, Senin (12/9).

Kepsek MTsN T. Tinggi Dilantik TEBINGTINGGI (Waspada): Kakan Kamenag Kota Tebingtinggi, Drs H Hasful Huznain, SH melantik Kepala MTs N Kota Tebingtinggi, Syamsuddin, SPd.I menggantikan Kepsek lama Drs. M. Nasir Sitorus yang akan menduduki jabatan baru sebagai Kasi Penyaluran Zakat di kantor Kemenag. Syamsuddin sebelumnya menjabat Kepsek MTs Percontohan Jalan Imam Bonjol. Alumni STAIS Tebingtinggi Deli itu juga aktif di organisasi kemasyarakatan sebagai Sekretaris NU Kota Tebingtinggi. Selain melantik dua pejabat struktural, Kakan Kemenag juga melantik dua pejabat fungsional masing-masing Widia, S.PdI sebagai Pengawas PAI Tk SD/MI yang sebelumnya Guru Muda/Kepala RA Alhidayah. Sedangkan Kasi Penyaluran Zakat dan Wakaf, Dra Afnizar menjadi Kasi Haji dan Umrah menggantikan Drs H. Komaruddin Ritonga.(a11)


BUPATI Langkat H. Ngogesa Sitepu, SH Gelar Tuha Samaeri memberikan 1.000 bingkisan kain sarung kepada perwakilan Masyarakat Nias usai menyaksikan Pagelaran Budaya Masyarakat Nias Kab. Langkat yang berlangsung di halaman Gedung Persatuan Wanita Pertamina (PWP) P. Brandan, Minggu (11/8).

Bupati Langkat Soroti Kinerja Aparat

Kota Stabat Makin Semrawut STABAT (Waspada): Usai lebaran lingkungan perkotaan di Langkat seperti Pangkalanbrandan, Tanjungpura dan Stabat, kelihatan lebih semrawut dan sebagian ruas jalan dipadati pedagang kaki lima, parkir beca bermotor yang sembarangan sehingga menyulitkan pemakai jalan. Bahkan trotoar tidak berfungsi karena dipadati barang dagangan pemilik ruko. Ironisnya Kota Stabat sebagai ibu kota kabupaten yang merupakan Kota Adipura juga tidak luput dari kesemrautan tersebut. Karenanya Bupati Langkat H Ngogesa Sitepu, SH dalam rapat rapat khusus terkait evaluasi program di rumah dinas bupati diStabat,Senin(12/9),untukkesekian kalinya kembali mengingatkan para Camat punya rasa tanggung jawab terhadap kebersihan,

ketertiban dan keindahan di wilayahnya. Bupati mencontohkan masih ada gapura pintu masuk kecamatan yang warnanya memudar, juga tidak beraturannya tata letak plang kantor di instansi pemerintah maupun sekolahsekolah. Kita akan ambil tindakan tegas terhadap Camat yang tak punya tanggung jawab akan wilayahnya, tegas bupati seraya menambahkan terhadap Camat yang yang peduli akan kenyamanan daerahnya tentu akan diberikan penghargaan. Dalam rapat dihadiri seluruh pejabat Pemkab Langkat di antaranya Staf Ahli Bupati, Asisten dan seluruh Satuan Kerja PerangkatDaerah(SKPD),BupatiH.Ngogesa Sitepu juga mengemukakan kekecewaannya terhadap kinerja Kepala SKPD terutama instansi terkait. “Saya menilai kepedulian dan tanggung jawab masih perlu

dibenahi dan ada kesan kinerja SKPD jalan di tempat, bahkan beberapa di antaranya boleh dikatakan menurun,” ujar bupati sambil menambahkan, rendahnya realisasi PAD 2011 yang baru mencapai 46,14 persen dari target seharus-nya hingga Agustus harus tercapai 64 persen, pasar yang semrawut dan minimnya realisasi target Izin Mendirikan Bangunan (IMB). Selain itu disinyalir adanya unsurpembiaranterhadapkebiasaan yang kurang tepat dalam pengelolaan dan efektivitas perolehan PAD sehingga tidak sebandingdenganpotensiyangdimiliki. Kurangtanggapterhadapkeluhan masyarakat, tidak ada kepedulian terhadap tanggung jawab kerja instansinya, kerja sebatas melepas rodi tidak ada inisiatif, serta saling melempar tanggung jawab bila sesuatu masalah yang mencuat.(a01/a03)

Soal Ketua DPRD T. Tinggi, Golkar Diminta Pilih Sosok Islam TEBINGTINGGI (Waspada): PengangkatancalonKetuaDPRD kotaTebingtinggi, menggantikan HM Sjafri Chap yang dilaksanakan Partai Golkar, menimbulkan kecemasandanreaksidikalangan umat Islam kota itu. Diwakili sejumlah organisasi kemasyarakatan Islam, meminta agar Partai Golkar mempertimbangkan umat Islam yang jumlahnya mayoritas, dengan mengangkat penggan-ti beragama Islam. Tujuh Ormas Islam, yakni Majelis Ulama Indonesia, PD Muhammadiyah,PDAlJam’iyatul Washliyah, PC Al Itthadiyah, Dewan Dakwah Islamiyah Indonesia,ForumUkhuwahIslamiyah sertai disetujui Forum Komunikasi Umat Beragama, menyampaikan permohonan kepada Plt. Ketua Partai Golkar Sumut Drs. H.Andi Ahmad Dara. Melalui surat tanggal 12 September 2011 Ormas Islam itu mengajukan enam permohonan untuk mendapatkan pertimbangan. Ketujuh poin itu, bahwa Kota Tebingtinggi berpenduduk

145 ribu jiwa, di mana mayoritas 87 persen merupakan pemeluk Islam. Bahwa beberapa tahun belakangan pimpinan/pejabat lembaga penegakan hukum, mulaidariPN,KejarihinggaPolres terus menerus dipimpin pejabat non muslim. Bahkan, PN Tebingtinggi telah enam periode terus menerus dipimpin ketua non muslim. Demikian pula dengan Polres yang telah dua periode, sedangkan kepala Kejari baru saja dilantik, pejabatnya yang juga non muslim. Bahwa kami tidak bermaksud, tulis surat ditanda tangani para Ketua Ormas Islam, menjadikan perbedaan agama sebagai alasanuntuktidakrukun.Namun, tidak bisa dipungkiri, secara psikologis masyarakat yang religius sangat dipengaruhi oleh pola kepemimpinanlembagapenegakan hukum dan lembaga politik (DPRD).Karenaitu,umatIslammerindukanpimpinanyangjugaMuslim. Hasil rapat pleno Pertai GolkarKotaTebingtinggimenentukan pengganti HMSjafriChapkepada

duakadernya,yakniPahalaSitorus dan H. Syahril Malik. Dalam rapat itu diputuskan kedua nama itu ditetapkan salah satunya oleh DPD partai Golkar Sumut. “Sehubungan dengan itu kami bermohon agar kiranya Bapak Plt.DPD Partai Golkar Sumut, berkenan menetapkan ketua DPRD Kota Tebingtinggi adalah sosok pribadi beragama Islam,” tulis surat itu. Terkait itu, Ketua mUI kota Tebingtinggi Drs.H.Ahmad Dalil Harahap, saat dikonfirmasi, membenarkan pengiriman surat permohonan itu kepada DPD partai Golkar. Dasarnya, ujar Ketua MUI, Golkar harus mempertimbangkansuaraumatIslamyang memilih partai itu. “Bagaimana pun yang paling banyak memilih Golkar adalah umat Islam, sudah sewajarnya jika Ketua DPRD dari Golkar, beragama Islam,” tegas Ketua MUI itu. Sedangkan Ketua PC Al Itthadiyah H. Rahasyim Sitopu, menyatakan surat itu merupakan bentuk kegelisahan umat Islam atas konstelasi pemerintahan yang timpang. (a09)

15:26 15:34 15:28 15:23 15:26 15:25 15:25 15:31 15:27 15:22 15:23




Shubuh Syuruq

18:24 18:31 18:30 18:25 18:27 18:24 18:24 18:35 18:28 18:22 18:24

19:32 19:39 19:38 19:34 19:36 19:32 19:32 19:43 19:36 19:31 19:33

04:49 05:56 04:53 04:49 04:51 04:49 04:48 04:57 04:52 04:47 04:48

04:59 05:06 05:03 04:59 05:01 04:59 04:58 05:07 05:02 04:57 04:58

06:13 06:20 06:18 06:13 06:15 06:13 06:13 06:21 06:16 06:11 06:12

P. BRANDAN (Waspada): Bupati Langkat H. Ngogesa Sitepu, SH dianugerahi gelar kehormatan raja oleh masyarakat Nias dengan sebutan Tuha Samaeri yang berarti raja pengayom masyarakat. Gelar tersebut diberikan di tengah berlangsungnya Pagelaran Budaya Masyarakat Nias di halaman Gedung Persatuan Wanita Pertamina (PWP) P.Brandan, Minggu (11/8). “Saya mengucapkan terima kasih dan hormat saya kepada Pengetua Masyarakat Nias. Mudahmudahan penghargaan dan gelar yang diberikan mampusayajalankanuntukkebesaranmasyarakat Nias di bumi Langkat ini,” katanya yang disambut teriakan khas sebagai wujud rasa kesuka citaan dan kebanggaan bahwa Ngogesa telah menjadi warga kehormatan mereka. Saat memberikan sambutan, Ngogesa meyakinkan sungguh pun masyarakat Nias merupakan etnis yang tidak besar di Langkat, namun dengan karakteristik masyarakat yang religius, suka bergotong royong membantu meringankan beban saudaranya, serta sifat kekerabatan dan persatuan yang kuat, merupakan modal besar untuk membangun daerah. Ketua Himpunan Masyarakat Nias (HIMNI) Sumut-Aceh, Ir. SudirmanLahawayangjugaanggotaDPRD-SUberpesan

pada masyarakat Nias untuk sepenuhnya memberikan dukungan terhadap kepemimpinan Ngogesa Sitepu karena telah nyata menunjukkan kepeduliannya kepada warga Nias. Ungkapan senada juga disampaikan, Marota Telambanua.Tokoh masyarakat Nias itu menyatakana kekagumananya atas sosok kepemimpinan Bupati Langkat yang selama ini dinilai sangat familiar, peduli dan tak tinggal diam terhadap siapa pun masyarakat yang membutuhkan bantuan darinya. Sementara, Ketua Ikatan Masyarakat Nias (IMAN) Kab. Langkat, Mendrofa mengharapkan kepada Pemkab untuk mengikutsertakan komunitas masyarakat Nias dalam event budaya. Dia juga menyatakan kesiapan warga Nias mendukung kepemimpinan Ngogesa Sitepu pada suksesi Bupati Langkat untuk periode kedua. Dalam pagelaran budaya yang berlangsung sehari tersebut, bupati didampingi Asisten Adm. Ekbangsos, Indra Salahudin, Kadis Dikjar Syam Sumarno, Kakan Pariwisata Rudi Kinandung, Kabag Kesos, Sujarno, Kabag Humas Syahrizal, para camat, turut menari bersama mengikuti gerakan tarian Maena Massal serta menyaksikan atraksi Lompat Batu, dan Tari Perang.(a02)

RP-APBD 2011 Deliserdang Dari Rp1,6 T Menjadi Rp1,7 T LUBUK PAKAM (Waspada): Bupati Deliserdang Drs H Amri Tambunan melalui Wabup H Zainuddin Mars, menyampaikan Rancangan Perubahan Anggaran Pendapatan dan Belaja Daerah (RP-APBD) Kabupaten Deliserdang Tahun Anggaran 2011 dari Rp1.657.866.210.759. menjadi Rp1.751.676.131.195, pada sidang paripurna dewan di gedung DPRD Deliserdang di Lubuk Pakam, Senin (12/9). Sidang paripurna dipimpinWakil Ketua DPRD Deliserdang HWagirin Arman didampingi Ruben Tarigan SE dan H Dwi Andisyahputra Lubis Lc dihadiri sejumlah anggota dewan, Wabup H Zainuddin Mars, Muspida serta sejumlah pimpinan SKPD sejajaran Pemkab Deliserdang. Bupati melalui Wabup Deliserdang H ZainuddinMarsmengatakanpenyampaianRP-APBD Tahun Anggaran2011kepadadewansesuaidengan mekanisme perundang-undangan dan peraturan berlaku yang mengacu kepada Permendagri nomor 59 tahun 2007 tentang perubahan atas Permendagri nomor 13 tahun 2006 tentang pedoman pengelolaan keuangan daerah serta Permendagri nomor 37 tahun 20110 tentang pedoman penyusunan APBD Tahun 2011. Disebutkannya, perubahan APBD merupakan penyempurnaan dari APBD karena pada saat menyusunan APBDTahun Anggaran 2011 pendapatan dan belanja yang bersumber dari pemerintah pusat dan provinsi masih dalam pembahasan sehingga pemerintah daerah diamanahkan untuk memproyeksikan pendapatan dan belanja dari pemerintah atasan. Pada penyampaian RP-APBD Tahun 2011, bupati menjelaskan adanya penambahan pendapatan pada P-APBDTahun 2011 sebesar Rp93.809.920.436.- dari semula Rp1.657.866.210.759.-

menjadi Rp1.751.676.131.195. Penambahan pendapatan tersebut berasal dari beberapa komponen antara lain dari dana perimbangan meningkat 81,22 persen dan lain-lain pendapatan daerah yang sah meningkat 26,20 persen dari target R-APBD Tahun Anggaran 2011. Demikian juga penambahan belanja langsung dan tidak langsung pada RP-APBD Tahun Anggaran 2011 bertambah sebesar Rp119.715.954.823,54.- dari semula Rp1.666.732.220.789.menjadi Rp1.786.448.175.612,54.- Penambahan belanja tidak langsung Rp64.470.056.277.dialokasikan untuk tunjangan beras yang berlaku surut dari tahun 2010, kenaikan tunjangan profesi guru dan upah pungut PBB. Sedangkan belanja langsung Rp55.245.898.546,54 dialokasikan untuk memperkuat prioritas daerah antara lain dana penunjang program nasional E-KTP, Jamkesmas lanjutan, pembangunan Pasar tradisional Lubuk Pakam, danma pendamping tim koordinasi Penanggulangan Kemiskinan (TKPK), kegiatan operasional hari besar keagamaan/ hari besar nasional, pengembangan perumahan, pemeliharaan dan peningkatan jalan, biaya operasional sekolah (BOS) serta peningkatan kapasitas dewan. Sementarapembiayaannetto padaRP-APBD Tahun Anggaran 2011 meningkat menjadi Rp34.772.044.417,54.-yangbersumberdaripenerimaan pembiayaan Rp40.906.034.387,54.- Sedangkan pengeluaran pembiayaan Rp6.133.989.970.Untuk mendengarkan pandangan umum fraksi-fraksi atas penyampaian RP-APBD Kabupaten Deliserdang Tahun Anggaran 2011 oleh bupati, sidang paripurna dewan dilanjutkan Kamis (15/9).(a06)

Waspada/HM Husni Siregar

WAKIL Bupati Deliserdang H Zainuddin Mars bersamaWakil Ketua DPRD H Wagirin Arman, didampingi Ruben Tarigan SE dan H Dwi Andi syahputra Lubis Lc, pada sidang paripurna penyampaian RP-APBD Kabupaten Deliserdang Tahun Anggaran 2011, Senin (12/9), di Gedung DPRD deliserdang

Bupati Sergai Bersilaturahmi Kepada Tokoh Adat Melayu MENJAGA tatanan budaya sangat perlu dilakukan komunikasi terhadap orangorang yang perduli dengan keberadaan budaya, khusus-

nya di Sumatera Utara. Anjuran kepada masyarakat agar terus melestarikan budaya memang harus digalakkan, namun kepedulianparatokohadatsangat

dibutuhkan. Ini terungkap saat dialog dan silaturahmi Bupati Serdang Bedagai HT Erry Nuradi, baru-baru inikekediamantokohadatMelayu

‘Mengkritik Bukan Berarti Benci’ BINJAI (Waspada):Yayasan Putra Binjai bekerjasama dengan FSU dan wartawan, Minggu (11/9) meresmikan cakruk Pak Tengku. Cakruk ini akan membuka website untuk menjadi lumbung informasi dan berusaha menjadi media bagi wartawan memperoleh informasi akurat dan berimbang. Ketua Yayasan Putra Binjai HT Indra Bungsu dan Ketua Forum Solidaritas Ummat ( FSU) Sumatera Utara, Ir. Susewo WP menegaskan, ‘mengkritik bukan berarti benci, tapi memberikan yang baik bukan menjilat’. Media ini selain membantu informasi tentang kota Binjai,juga diusahakan sebagai mediator agar pers bisa bekerjasecara profesional dengan pemberitaan berimbang, sesuai kaidah UU Pokok Pers dan kode etik jurnalistik. Beberapa wartawan berbagai media cetak dan Direktur Eksekutif LSM P3 H Muhammad Jaspen Pardede menyambut baik gagasan tersebut, dan berharap kordinasi forum dengan wartawan dan LSM terus dilakukan seara aktif. Di sisi lain HT Indra Bungsu dan Ir. Suseno berharap Pemko Binjai dan jajarannya bisa bekerjasama, sesuai Undan-Undang keterbukaan informasi publik.(a04)

Zhuhur ‘Ashar

Ngogesa Sitepu Dianugerahi Tuha Samaeri Oleh Masyarakat Nias

276 Calon Jamaah Haji Asal Binjai Suntik Meningitis BINJAI (Waspada): 276 Calon jamaah haji asal kota Binjai mulai disuntik vaksin meningitis di Kantor Dinas Kesehatan Binjai. Kasi urusan Haji dan Umroh Kemendag Binjai Jannah Siregar didampingi staf, Labbayik Simanjorang menjelaskan, Senin (12/9), jumlah calon jamaah haji asal Binjai terjadi pergeseran, disebabkan ada calon jamaah yang meninggal dunia, kemudian tidak melunasi BPIH dan kondisi hamil. Karena itu 25 calon jamaah haji yang dijadwalkan berangkat 2012, bergeser ke musim haji tahun ini. Dari 276 calon jamaah terdapat 165 pria dan 111 wanita. Menurut Labbayik, rombongan calon haji kota Binjai didampingi tiga TPHD yaitu Agus Susanto, SH, MH, Dahniar Riza dan Dianasyah Putri Nasution, dari Binjai jemaah tertua atas nama Musa bin Bakri, 81 tahun dan jamaah wanita Poniyem binti Nasiman, 76 tahun. Dijelaskan, lima calon jamaah haji asal Binjai juga dimutasi ke Aceh, Medan, Deliserdang dan Labuhanbatu. Sebaliknya ada calon haji mutasi ke Binjai, empat dari Medan dan DS. Jannah Siregar berharap calon jamaah haji tetap menjaga kesehatan. Kasi Urusan Haji dan Umroh Kemendag Binjai, Jannah Siregar belum bisa memastikan, apakah calon haji asal Binjai bisa bertambah dengan adanya pertambahan kuota yang ditetapkan. “Kita masih menunggu, sebab pertambahan itu diprioritaskan kepada daerah yang jumlah hajinya banyak dan calon haji juga diberikan kepada usia lebih dari 60 tahun,” ujarnya. Jannah mengingatkan pengurus KBIH di Binjai, bahwa pelaksanaan suntik meningitis sudah dimulai Senin (12/9), di Kantor Dinas Kesehatan Jalan Sauh Binjai.(a04)


Waspada/Hotma Darwis Pasaribu

BUPATI Sergai (kedua kiri) bersilaturahmi Aidil Fitri 1432 ke rumah tokoh Adat Melayu Sumatera Utara OK Khaidar Aswan gelar Datuk Paduka Raja Batangkuis (kedua kanan), didampingi Ketua Simpati Syafrul Hayadi (kiri), dan pengusaha muda Christian Chandra (kanan).

Sumatera Utara, OK Khaidar Aswan gelar Datuk Paduka Diraja WazirNegeriSer-dangKedatukan Batangkuis, di Desa Bintang Meriah, Kota Batangkuis, Deliserdang. Nuradimemaparkan,banyak yang harus dilakukan untuk melestarikan budaya, seperti dilakukan Khaidar As-wan yang telah membuka pus-taka gratis di Kampoeng Nia-ga Batang Kuis, yang dalam perbendaharaan bukunya terda-pat berbagai ragam bacaan adat budaya di SumateraUtara,bah-kansejarahsejarah kerajaan Melayu. “Ini sangat berarti bagi generasi muda, namun yang penting bagaimana kesadaran para generasi muda untuk mau membaca buku peradaban budaya di SumateraUtara,”kataNuradiyang datang bersama anggota DPRD SerdangBedagai,Syaf-rulHayadi. Silaturahmi sekaligus halal bi halal merupakan kunjungan rutin Bupati Sergai. Dan ini kun-

jungan kali kedua, kunjungan persaudaraan. Menurutnya, sosok Khaidar Aswan orang yang peduli dengan keberadaan budaya, khususnya pelestarian adat Melayu di Sumatera Utara. Kepedulian Khaidar terhadap budaya sudah dibuktikan, dengan berbagai kegiatan yang selama ini dilaksanakan di Kampoeng Niaga, yang gaungnya sudah kita ketahui untuk tingkat Sumatera Utara. Menyambut kedatangan Bupati Serdang Bedagai ini, Khaidar ‘abah nda’ Aswan, mengatakan ini rasa santun beliau terhadap tokoh-tokoh melayu di Sumatera Utara, dan bukti kepedulian Erry Nuradi selaku tokoh adat dan budaya di Sumatera Utara. Selain itu, dua tokoh Melayu Sumatera Utara ini juga berbincang mengenai pembangunan usaha kecil, dengan memanfaatkan sumber daya alam yang ada didukung osumber daya

manusia. “Banyak yang bisa kita lakukan, tergantung kemauan,” kata Khaidar Aswan didampingi Dirut Dirgantara Group, Hj. Nurmah Khaidar Aswan, dan Direktur Viva Mas Motors, Christian ‘asen’ Chandra. Seperti halnya membangun bidang-bidang usaha di bawah PT Dirgantara Group, dibutuhkan kerja keras dan kemauan dalam melakukan pengembangan usaha, yang bermodal dengan rasa kepercayaan pihak-pihak yang mendukung beberapa usaha Dirgantara Group. Seperti halnya silaturahmi Bupati Sergei H. Erry Nuradi, kata Khaidar Aswan, cukup berarti, karena telah memberi masukan pemikiran tentang pengembangan usaha Dirgantara Group, yang umumnya memberi peluang pekerjaan bagi masyarakat. - Hotma Pasaribu

Sumatera Utara


Antrean Panjang Di Labura


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Aji Wahyudi (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Feirizal Purba (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, Rizaldi Anwar, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Bayi Penderita Tumor Akan Dirujuk Ke Medan KISARAN (Waspada): Bayi penderita tumor bawaan lahir dirawat di RSUD Kisaran. Namun diduga ada stela (sela/celah) pada saraf otak sehingga akan dirujuk ke RS di Medan. Bayi perempuan itu lahir, Kamis (8/9) dari pasangan, Ridho Amran,25,danWani,25,wargaBaganAsahan,KecamatanTanjungbalai, Asahan. Lahir dengan kondisi benjolan berwarna kebiruan berada tepat di bagian tengah kepala belakang, sehingga dirawat ke RSUD Kota Tanjungbalai, namun dirujuk RSUD Kisaran, Sabtu (10/9). Namun hasil pemeriksaan dokter, anak kedua pasangan muda itu harus menjalani operasi di Medan karena peralatan medis lebih lengkap. Sayangnya, orang tua yang tergolong keluarga prasejahtera masih mengeluhkan biaya hidup, baik itu di di RSUD Kisaran ataupun kalau jadi di dirujuk ke rumah sakit yang ada di Medan. “Saya hanya seorang nelayan, hanya untuk makan anak dan keluarga. Oleh sebab itu dia kebingungan dari mana untuk mendapatkan uang sehingga bisa mendampingi buah hati untuk berobat di Medan,” ungkap Ridho, ditemui Waspada, Senin (12/9) saat merawat anaknya di RSUD Kisaran. Menurutnya, saat mengandung tidak ada sesuatu yang hal yang aneh dialami istrinya, dan selalu berkonsultasi dengan bidan desa. Sedangkan untuk gizi, dirinya selalu berupaya, untuk memenuhinya walaupun di tengah kekurangan. “Sekarang istri saya dirawat di rumah karena usai melahirkan. Sedangkan anak kedua saya, harus terpisah dari ibunya karena harus menjalani perawatan medis,” kata Ridho. Direktur RSUD Kisaran, dr Herwanto SpB, dikonfirmasi, mengatakan benjolan itu diduga kuat tumor, namun untuk pembuktiannya harus dilakukan melalui scanning syaraf. Diduga ada sela di syaraf otak, sehingga menimbulkan cairan dan mengakibatkan benjolan. “Penyembuhan paling tepat dilakukan pembedahan syaraf, sehingga sela itu bisa ditutupi dan aktivitas otak tidak terganggu. Hal itu hanya bisa dilakukan di rumah sakit yangadadiMedan,karenaperlengkapanmedislebihlengkapditambah dokter yang lebih ahli dalam bidang bedah syaraf,” kata Herwanto. Mengenai penyebab tumor, Herwanto mengatakan penyakit ini tergolong dari faktor keturunan (genetik), dan hal itu biasa terjadi. Namun jiwa penderitanya dapat diselamatkan bila dilakukan penanganan dengan cepat, sehingga benjolan tidak bertambah besar, atau sela bertambah lebar. “Kita berharap pihak keluarga sabar menghadapi masalah ini dan siap bila di rujuk ke Medan,” ungkap Herwanto. (a15)

WASPADA Selasa 13 September 2011

Waspada/Syahri Ilham Siahaan

ANTREAN panjang kendaraan terlihat mengular di jalinsum Medan Rantau Prapat tepatnya di kawasan pertanian depan SMK Negeri I Desa Damuli Pekan Kecamatan Kualuhselatan Labura, Senin (12/9).

Gedung PN Tanjungbalai Bagaikan Kantor Mati TANJUNGBALAI (Waspada): Gedung Pengadilan Negeri Kota Tanjungbalai bagaikan kantor mati.

Tidak terlihat aktivitas dan kegiatan pegawai maupun hakim sebagaimana biasa hingga menjelang sore.

Waspada/Rasudin Sihotang

PENGADILAN Negeri Kota Tanjungbalai bagaikan kantor mati, tidak terlihat aktivitas persidangan maupun lainnya seperti biasa, Senin (12/9).

Pantauan Waspada, Senin (12/9), sekitar lima pegawai saja yang terlihat mondar-mandir keluar-masuk PN. Ada yang memakai seragam lengkap bermain komputer, ada juga hanya berpakaian sipil, bahkan seorang di antaranya yang mengaku staf administrasi cuma memakai kaos dan sendal. Dari sejumlah ruangan di sana seperti Kepala PN,Wakil PN, Paniteradanadministrasitampak kosong, tidak terlihat kegiatan. Bahkan, dari tiga ruangan sidang tak satu pun ada aktivitas. Waspada coba mengkonfirmasi bagian Humas PN, namun tak berhasil karena sedang tidak ada di tempat. Seorangpegawaiyangtengah santai di ruangan keuangan di-

temuiWaspadamengatakanpara hakim, panitera serta staf berada di Medan mengikuti pelantikan Ketua PN yang baru. “Semuanya berangkat, tinggal yang kelas-kelas kambing sajalah kami di sini bang,” ujar pria berpakaian dinas. Sementara, seorang pegawai menyatakan, kemungkinan semua jadwal sidang diundur mengingat para hakim berangkat ke Medan. “Karena semuanya ke Medan, jadi jadwal sidang hari ini ya diundurkanlah,” tuturnya seraya menambahkan, pekerjaannya sedikit lebih santai karena tidak ada kegiatan. Menurutnya, aktivitas pengadilan akan kembali normal , Selasa (13/9). (a32)

Tagihan Melonjak, Puluhan Pelanggan Protes Ke Kantor PLN Kisaran KISARAN (Waspada): Puluhanpelanggan,Senin(12/9)mendatangi kantor PT.PLN Ranting Kisaran di Jalan Sutomo, memprotes tagihan listrik bulan ini melonjak. Malah para pelanggan sempat adu mulut dan nyaris bentrok fisik dengan petugas PLN. Hal ini terjadi karena pelanggan menganggap petugas tidak transparanmemberiinformasipenyebab tingginya angka tagihan listrik mereka. Seorang ibu menyebutkan, sudah melapor dan minta penjelasan petugas PLN. Tapi, kata ibu itu, petugas berdalih dan coba menghindar.“Akan kami periksa, memang kami terhutang dan beban ibu di Agustus lalu akan kami alihkan ke September sehingga ibu bayar dikit aja,” ujar ibu itu menirukan ucapan petugas PT. PLN Kisaran yang tidak mengenakan kartu identitas. HalsamadialamiChairuddin, warga Kel.Sentang, Kec. Kisaran Timur. Di struk pembayaran tagihan listrik dengan nomor IDEL : 121110725295 , TARIF/ DAYA :R1/900VA,menunjukkanrincian tagihan listrik 16-8-2011 dengan stand meter 00014900-0003700 dan tagihannya mencapai Rp 109.285 ribu. Kendati demikian, ketika dicek kembali di PT.PLN Ranting Kisaran, tagihan listrik atas nama Chairuddin hanya 00001210.

Artinya, bukan pelanggan yang terhutang, melainkan PT.PLN. Akan tetapi, petugas PT.PLN Ranting Kisaran tanpa kartu identitas, menuding pelanggan tersebut yang terhutang kepada perusahaan negara itu. Kata petugas, Chaeruddin hutang hingga angka ribuan, namun petugas hanya menulis angka 570 di kertas tagihan tanpa menjelaskan dengan rinci. Selain itu, petugas juga memerintah pelanggan tersebut mengecek ulang meterannya, padahal seharusnya itu tugas PT. PLN Ranting Kisaran. Karim, 47, wargaKec.KisaranTimurmenyatakan, melonjaknya tagihan listrik pelanggan diduga kesalahan PT. PLN. “ Apakah ada main mata antara PT.PLN dengan kontraktor pencatat meteran,” duga Karim. Anggota Komisi C DPRD Asahan, T Johson, turun langsung ke Loket pembayaran Kantor PLN Ranting Kisaran untuk menindaklanjuti pengaduan masyarakat. Dalam laporannya, masyarakat menyebutkan, tidak ada pencatatan meteran di Kecamatan Buntupane. Sebab itu Jhonson menanyakan langsung kepada Manager PT Parsintauli Karya Perkasa, yang menjadi rekanan PLN Ranting Kisaran sebagai pencatat meteran. “Banyak pembayaran listrik tidak sesuai, bahkan bayarannya lebih tinggi. Ditambah

lagi sering listrik padam. Saya berharap PLN dan kontraktor mengklarifikasi masalah ini, dan menyelesaikannyatanpaadayang dirugikan,” tegas Jhonson kepada Manager PT Parsintauli Karya Perkasa. Jhonson menyatakan, Komisi C DPRD Asahan akan memanggil Manager PLN Ranting Kisaran untuk dengar pendapat dan mengevaluasi kinerja kontraktor pencatat meteran. “Kita akan membawa masalah ini dalamagendarapatKomisiCDPRD

Asahan, sehingga dapat diselesaikan dan semua masalah bisa lebih jelas,” ungkap Johnson. Manager PT Parsintauli Karya Perkasa, dalam hal ini sebagai pencatat meteran pemakaian listrik PLN Ranting Kisaran, F Matondang, menjawab pertanyaan TJhonson,mengatakanpihaknya sebenarnya menerima semua masukan atau kritikan dari pelanggan namun dia berharap dilengkapi bukti berupa rekening, sehingga bisa ditinjau ulang seberapa pemakaiannya. (a14/a15)

Tigor Siregar Ajak Jemaat HKBP Berperan Lebih Nyata RANTAUPRAPAT ( Waspada):HKBP(HuriaKristenBatak Protestan) memiliki aset sungguh besar di tengahtengah bangsa. Karena itu HKBP khususnya di Kabupaten Labuhanbatu dapat berperan lebih nyata dengan mempersiapkan generasi muda yang cerdas iman, intelektual dan emosional. Demikian sambuan Bupati L.Batu Tigor Panusunan Siregar pada acara Jubileum HKBP 150 Tahun Distrik 26 L.Batu di halaman gereja HKBP Immanuel Janji Rantauprapat, Minggu (11/9). Tigor menambahkan, secara pribadi sangat mengapresiasi

tema perayaan jubileum 150 tahunHKBPini,yakni“hendaklah hidupmu tetap di dalam dia, berakar, dibangun dan bertumbuh di dalam dia”. Subtemaacarainijugamempunyaimaknayanghampirsama dengan visi dan misi pemerintahan Tigor-Suhari “tidak bodoh, tidak lapar dan tidak sakit”. Sebagai implementasinya, kata Tigor, di dalam mencerdaskan masyarakat L.Batu, pendidikan gratis 9 tahun sudah kita jalankan dan pada tahun 2012 yang akan datang pendidikan gratis dari tingkat SD sampai SLTA akan kita wujudkan. (a18)

Untuk Berobat, Bocah Gizi Buruk Harus Empat Jam Arungi Laut TANJUNGBALAI (Waspada): Seorang pasien gizi buruk Nadira yang baru berumur 1,3 tahun, harus rela mengharungi lautan selamaempatjammenujuRSUD KotaTanjungbalai untuk berobat. Buah hati pasangan Maisyaroh, 23 dan Indra Pohan, 27, warga Desa Telukpule, Kec. Tanjung Leidong, Kab. Labuhan Batu Utara, dinyatakan gizi buruk setelah

mendapat tindakan medis dari petugas. Awalnya, kedua orang tua itu menduga anaknya terserang penyakit gatal-gatal karena kulit sekujur tubuh hingga kepala mengelupas dan bersisik. Mengetahui anaknya terserang gizi buruk, Indra masih bersyukur sebab sampai dengan selamat di kota itu. Menurut Indra, kendati berasal dari luar Kota

Waspada/Rasudin Sihotang

PASIEN gizi buruk asal Kab. Labuhan Batu Utara, Nadira, tengah mendapat perawatan intensif paramedis RSUD Kota Tanjungbalai, Senin (12/9).

Tanjungbalai, namun dia yakin dan percaya paramedis rumah sakit tersebut tetap memberikan tindakan medis sebagaimana pasien lainnya. “Seharusnya kami ke Aekkanopan, tapi karena jarak cukup jauh dan transportasi sulit, kami sepakat membawa Kota Tanjungbalai saja,” tutur Maisyaroh didampingi suaminya di ruang perawatan anak, Senin (12/9). Dikatakan, untuk biaya transportasimenggunakankapalboat, dia harus menyiapkan uang dua ratus ribu rupiah dalam satu kali perjalanan. Indra mengaku kesulitan, namun karena keinginan kuat agar anaknya sembuh, dia relamelakukanapapuntermasuk meminjam uang kepada orang lain. “Biar harus meminjam uang tetangga dan famili, tapi saya harus membawanya berobat sampai sembuh,” tutur ibu sembari membelai lembut putri kesayangannya itu. Dia menuturkan pekerjaan suaminya hanya nelayan biasa dengan pendapatan paspasan. Sementara, balita yang terlihat cukup tegar itu kini mendapat

perawatan intensif di ruangan anak dengan bantuan perawat dandokter.Sejakmasukkerumah sakit beberapa hari lalu, kesehatannya berangsur membaik. Demam Berdarah Di tempat yang sama, dua pasienDemamBerdarahDengue (DBD) juga tengah mendapat perawatan intensif. Keduanya yakni,Maharani,umurtigatahun, wargaDusunII,Kec.Simpangempat, Kab. Asahan, dan Oktariansyah, 14, warga Jalan Cendrawasih, Kel. Selatlancang, Kec. Datukbandar, Kota Tanjungbalai. Mereka harus tidur menggunakan kelambu untuk menghindaripenyebarankepadaorang lain. Sementara petugas medis tetapmengontrolperkembangan kesehatan keduanya. DirekturRSUDKotaTanjungbalai, Dr Hj Diah RetnoW mengatakan semua pasien yang datang ke rumah sakit, baik dari kabupaten Asahan dan Labura tetap dilayani dengan sebaik-baiknya. Diterangkan, semua pasien belum diperbolehkan pulang mengingat kondisi kesehatan belum sepenuhnya pulih.(a32)

AEKKANOPAN (Waspada): Akibat terjadinya tabrak antara bus Intra dengan bus Pinem dan mobil truk yang rusak di Jalinsum Medan Rantau Prapat tepatnya di kawasan Pertanian Desa Damuli Pekan,KecamatanKualuhSelatanLabura,Senin(12/9)mengakibatkan antrian mobil sepanjang sekira 20 km. Informasi yang dihimpun Waspada, tabrakan antara bus Intra BK 7849 LT dan bus Pinem BK 7818 DG tidak ada korban jiwa hanya kedua bus tersebut mengalami kerusakan, namun akibat tabrakan dan adanya truk yang rusak mengakibatkan antrean panjang. Pantauan Waspada, antrian mobil tersebut terjadi sejak pukul 01:30 hingga pukul 12:00. Antrian kendaraan baik dari arah medan maupun arah Rantau Prapat menjadi dua lapis bahkan tiga lapis. untuk mengatsi kemacatan tersebut, aparat Polisi Lalulintas baik dari Polsek Kualuhhulu maupun dari Polres Labuhanbatu turun kelokasi itu. Kendaraan dapat bergerak merangkak sekitar pukul 09:00 setelah petugas membuka ruang gerak dan menarik truk colt diesel yang rusak dari lokasi itu. Antrian terlihat mulai normal pukul 12:00. Antian semakin parah akibat kondisi Jalinsum didaerah itu yang sejak beberapa tahun lalu tidak mendapatkan pelebaran jalan, sementara jumlah bus yang melintas kian bertambah banyak membuat setiap ada peristiwa tabrakan atau ada mobil yang rusak terjadi antrean panjang di daerah itu.Masyarakat pengguna jalan berharap agar ada perhatian dari Pemprovsu melakukan pelebaran jalan di Jalinsum Labura hingga Labuhanbatu karena jumlah kenderaan semakin banyak. Sementara Kasat Lantas Polres Labuhan Batu AKP Triyadi SH SIK, saat dikonfirmasi melalui Kepala Gatur Polsek Kualuhhulu Aiptu Joemakir membenarkan terjadinya kemacatan panjang itu. Dikatakannya antrian panjang itu terjadi pulul 01:30 hingga pukul 12:00 siang. Menurutnya, kemacatan itu terjadi akibat para supir bus tidak sabar dan saling menerobos.” Sewaktu petugas mengatur bus yang melintang ditengah jalan, saat itu pula para supir bus saling menerobos kedepan sehingga kendaraan menjadi berlapis dua bahkan ada yang berlapis tiga,” jelas Joemakir.(a16/c08)

Wali Kota T. Balai Didesak Cabut SK Direktur PDAM TANJUNGBALAI (Waspada): Komisi Kajian dan Advokasi Hukum (Kashum) Sumut, mendesakWalikotaTanjungbalaiThamrin Munthe mencabut kembali SK No. 539/200/K/2011 tertanggal 9 September 2011 tentang pengangkatan Zaharuddin sebagai Direktur PDAM Tirta Kualo periode 2011-2015. Demikian pernyataan Kordinator Luhut Parlinggoman Siahaan, SH kepada Waspada, Senin (12/9). Selain mendesak agar SK itu dicabut, Kashum Sumut juga minta Walikota mengangkat Direktur PDAM Tirta Kualo periode 20112015 dari tenaga profesional yang handal dan berpengalaman di bidang manajemen perusahaan. “Tidak terikat kepentingan politik serta golongan dan sesuai peraturan dan undang-undang berlaku,” kata Luhut. Dia menjelaskan, Zaharuddin yang diangkat sebagai Direktur PDAM Tirta Kualo, merupakan saudara ipar Wakil Walikota Tanjungbalai, Rolel Harahap. Sementara Perda Kota Tanjungbalai No.9 Tahun 2009 tentang Pengelolaan PDAM Tirta Kualo pasal 4 ayat 1 huruf f dengan tegas menyatakan, Direktur PDAM tidak terikat hubungan keluarga dengan Walikota atau Wakil Walikota atau Dewan Pengawas sampai derajat ketiga menurut garis lurus atau ke samping termasuk menantu dan ipar. Kemudian, menurut Luhut, publik sudah mengetahui Zaharuddin tidak memiliki pengalaman bekerja di PDAM atau perusahaan negara maupun swasta lainnya. Di Perda Kota Tanjungbalai No. 9 Tahun 2009 pasal 4 ayat 1 huruf b dinyatakan, Direktur PDAM Tirta Kualo harus punya pengalaman kerja 10 tahun bagi yang berasal dari PDAM, atau pengalaman kerja minimal 15 tahun mengelola perusahaan yang bukan berasal dari PDAM, dibuktikan dengan referensi dari perusahaan sebelumnya dengan penilaian baik. “Publikjugamengetahui,ZaharuddinsalahsatupemimpinOrmas/ OKP di Sumut dan pernah menjadi Caleg salah satu Parpol untuk DPRD Sumut pada Pemilu 2004 dan 2009,” ungkap Luhut. Sebab itu, jika ditelaah dengan fakta-fakta tersebut, maka pengangkatan Zaharuddin sebagai Direktur PDAM Tirta Kualo bertentangan dengan peraturan dan undang-undang. “Apa yang dilakukanWalikota Tanjungbalai melanggar hukum (onrechtmatigedaad) dan pelanggaran terhadap HAM, karena menutup kesempatan bagi individu lain yang memenuhi kriteria,” jelas Luhut. Di tempat terpisah, Walikota Tanjungbalai Thamrin Munthe dikonfirmasi melalui Kabag Humas DarulYana Siregar, membantah tudingan itu. “Tidak benar itu, apalagi kalau ada yang menyatakan terkait deal politik, itu salah besar. Zaharuddin dilantik menjadi Direktur PDAM Tirta Kualo Tanjungbalai setelah lulus fit and propert test diketuai Asisten I pemerintahan. Jadi pengangkatannya sesuai mekanisme,” tegas Darul Yana Siregar.(a14)

Bupati Labura Tindak 127 PNS AEKKANOPAN (Waspada): Bupati Labuhanbatu Utara (Labura) H. Kharuddin Syah SE, menindak 127 PNS di jajarannya yang tidak masuk kerja usai melaksanakan cuti bersama, Senin (12/9). Tindakan yang diberikan, para PNS disuruh berkeliling kantor bupati sepuluh kali. Selain itu, para PNS juga disuruh membuat surat pernyataan agar perbuatan serupa tidak diulang lagi. 127 PNS yang mendapat tindakan itu diberi arahan dan bimbingan dari Sekdakab saat apel pagi di halaman kantor bupati. Bupati Labura H. Kharuddin Syah melalui Sekdakab H. Amran Matondang,SH,MHum,menyatakantindakanyangdiberikankepada 127 PNS merupakan tindakan disiplin yang harus ditegakkan dan harus menjadi contoh terhadap bawahannya. “Pelaksanaan disiplin yang diberikan jangan merasa keterpaksaan, dan harus diterima dengan lklas,” kata Sekda didampingi Asisten II Bidar Alamsyah, SH, Asisten III, Ir Paijo dan Kabag Humas Syahrul Adnan Hasibuan, SE. Dikatakan, pejabat eselon harus dapat memposisikan diri sebagai teladan kepada bawahannya.” Dengan displinlah kita dapat memberi pelayanan kepada masyarakat,” jelas Sekda.(c08)

Dua Tewas Korban Lakalantas Di Labura AEKKANOPAN(Waspada):DuaTewaskorbankecelakaanlalulintas di kawasan Labuhan Batu Utara (Labura), Minggu (11/9). Korban pertama tiga pengendara sepeda motor yang ditabrak mobil Pajero di Jalinsum Gunting Saga Kecamatan Kualuhselatan, sekira pukul 20.00. Akibatnya satu tewas dan dua luka-luka. Korban tewas Nurhapizah, 4, warga Lingkungan Kampung Baru Kelurahan Aekkanopan, Kecamatan Kualuhhulu. Luka-luka Amat Pane warga yang sama, dan Nurmaisaroh, 13. Menurut informasi, kejadian maut itu berawal dari sepeda motor Honda Revo tanpa plat dikemudikan Amat Pane berboncengan dengan Nurmaisaroh dan Nurhafizah. Saat hendak ke luar dari simpang Pasar Pagi Kelurahan Gunting Saga Kecamatan Kualuhselatan menuju badan jalan, melintas mobil Pajero BK 899 ZU dengan kecepatan tinggi langsung menubruk korban. Setelah kejadian, mobil langsung kabur. Akibat kejadian itu Nurhafijah tewas dalam perjalanan menuju rumah sakit, sementara Amat Pane dan kakak korban Nurmaisaroh, luka-luka. Para korban dirawat di RS Persiapan Aekkanopan. Sementara Novi Syahputri, 17, warga Desa Aekloba Kecamatan Aekkuasan Asahan, juga tewas setelah sepeda motor Honda Beat BK 5927VAE yang dikendarainya menabrak mobil Toyota Avanza BK 1608 YK, di Jalan Jenderal Sudirman Aekkanopan, Labura, pukul 18.00. Kejadian itu berawal saat sepeda motor Honda Beat yang dikemudikanVijay Armanda berboncengan dengan korban melintas di jalan Jenderal Sudirman Aekkanopan. Dari arah yang sama melintas mobil Avanza dikemudikan Indra Sofyan Rambe. Saat Toyota Avanza berhenti dan membuka pintu mobil, langsung ditubruk sepeda motor Honda Beat. Akibatnya korban terpelanting ke badan jalan dan tewas setelah mendapat perawatan di RS Radiva Asahan. Kasat Lantas Polres Labuhan Batu AKP Triyadi saat dikonfirmasi melalui Ka Gatur Polsek Kualuhhulu, membenarkan kejadian tersebut.(c08)

Sumatera Utara

WASPADA Selasa 13 September 2011


Pengendara Sepeda Motor Tewas Tertimpa Dahan

Warga Dan Mahasiswa Demo Di DPRD Simalungun, Protes Perampasan Lahan

PEMATANGSIANTAR (Waspada): Muatan truk tronton BK 9678 BL terlalu tinggi menyenggol dahan pohon di pinggir jalan akhirnya menyebabkan penumpang sepeda motor Siti Rahmadani, 23, warga Jalan Farel Pasaribu, Kel. Pardamean, Kec. Siantar Timur, Kota Pematangsiantar tewas tertimpa dahan. Informasi dihimpun dan keterangan dari Polres Simalungun, Senin (12/9), truk tronton dikemudikan Jamaluddin, 37, warga Dusun Sukaraja, Simpang Empat, Asahan. Sedangkan peristiwa itu di jalan umum km 13-14, jurusan Pematangsiantar-Perdagangan, Nagori Senio, Kec. Gunung Malela, Kab. Simalungun, Minggu (11/9) pukul 10:00. Ketikaitukorbandiboncengtemanprianya,MuhammadBahtera Manurung, 24, dengan sepeda motor BK 3009 TAA. Saat itu, korban bersama rekan-rekan hendak ke pesta teman di Kota Kisaran. Muatan truk paling atas menyenggol dahan pohon yang agak menjorok ke badan jalan dan patah. Patahan dahan jatuh di atas kepala korban dan menghantam helm hingga pecah. Korban terjatuh ke badan jalan dan mengalami luka berat di kepala dan leher patah. Muhammad Bahtera Manurung yang tidak mengalami luka segera membawa korban ke RSUVita Insani, Pematangsiantar untuk mendapat pertolongan. Namun, korban tmeninggal dunia. Kapolres Simalungun AKBP M Agus Fajar, SIK saat dikonfirmasi melalui Kasubbag Humas AKP H Panggabean, SH, Kasat Lantas AKP Baginda Sitohang dan Kanit Laka Ipda Alsem Sinaga membenarkan.(a30)

SIMALUNGUN (Waspada): Puluhan warga Sindar Dolok, Nagori (desa) Mariah Dolok, Kec. Dolok Silou dan mahasiswa yang tergabung dalam SALING (Sahabat Lingkungan) Siantar-Simalungun melakukan aksi demo di DPRD Simalungun di Pamatang Raya, Senin (12/9). Aksi tersebut digelar menuntut janji dewan serta protes terhadap aksi perampasan lahan yang dilakukan oleh pengusaha kayu. Kedatangan warga dan puluhan mahasiswa ke gedung wakil rakyat tersebut mendapat pengawalan ekstra ketat dari Polres Simlungun dan Satpol PP Pemkab Simalungun. Selain berorasi para pengunjuk rasa juga membawa spanduk ukuran besar dan kecil yang intinya meminta pihak berkompeten serius menangani masalah perusakan tanaman di lahan masyarakat yang dilakukan oknum pengusaha kayu. Aksi yang dikordinatori John Roysen Purba dalam pernyataan sikapnya mengatakan, sudah tiga tahun lahan-lahan masyarakat di Sindar Dolok dirampas oleh pengusaha-pengusaha kayu. Masyarakat tidak dapat berbuat apa-apa, dan terpaksa membiarkan lahannya dirambah oleh oknum-oknum tertentu.“Tanaman kami dirusak di depan mata kami sendiri,” teriak Rado Damanik, saat membacakan pernyataan sikap para pengunjuk rasa. Menurutnya lagi, aksi yang digelar hari itu sebagai lanjutan aksi yang digelar 28 Juli 2011 . “ Kedatangan kami ke DPRD untuk menuntut janji dewan, sejauhmana sudah penanganan masalah yang dihadapi warga tentang perampasan lahan yang diduga dilakukan oleh oknum pengusaha kayu berinitial GT,” tambah Damanik. Lebih lanjut ditegaskannya, permasalahan masyarakat semakin berat dan tak kunjung selesai, bahkan warga dituduh dan diintimidasi membakar rumah seorang pengusaha kayu. Sekaitan dengan hal tersebut, para pengunjuk rasa melalui pernyataan sikapnya meminta pihak DPRD Simlungun serius menyelesaikanmasalahyangdihadapaiwargaSindarDolok.Kemudian, dewan juga dituntut dapat menjamin hak-hak masyarakat atas lahan dimaksud dan yang lebih penting lagi dewan dan Pemkab Simalungun dapatmenetapkanstatustanahdantapalbatas sesuaidenganundangundang dan peraturan lainnya. Menyikapi aspirasi para pengunjuk rasa, Ketua DPRD Simalungun, BintonTindaon, didampingiWakil Ketua Burhanuddin Sinaga, Ketua Komisi I Manandus Sitanggang dan anggota Komisi I Luhut Sitinjak, Evra S Damanik, Dodi, Sekwan, SML Simangunsong, AsistenIPemkabSimalungunJonniSaragih,sertastafDinasKehutanan menyampaikan rasa terima kasih terhadap warga dan mahasiswa telah peduli terhadap kelestarian lingkungan terutama hutan. Dijelaskan Binton, pihak DPRD Simalungun sangat setuju untuk menuntaskan permasalahan yang dihadapi warga Sindar Dolok. Namun, pihaknya agar diberi waktu membentuk tim dan langsung turun ke lapangan. “ Kita tetap serius menyahuti aspirasi masyarakat, namun permasalahannya tidak segampang membalik telapak tangan, sehingga perlu ada tim khusus untuk membahas dan menyelesaikan masalah ini,” terang Binton. Pendapat yang sama juga dikemukakan Asisten I Jonni Saragih. Menurut mantan Kadis Perhubungan tersebut, batas tidak menentukan hak atas tanah, tetapi yang menentukannya adalah surat atau data otentik yang dimiliki. Batas juga tidak bisa disimpulkan, namun pihak Pemkab akan menggali dokumen-dokumen sehingga nantinya batas-batas yang ditetapkan dapat diterima semua pihak. Pertemuan antara warga, mahasiswa dengan DPRD, pihak PemkabSimalungunberlangsungalotdansalingtanyajawab.Jawaban yang diberikan dewan dan pemkab dinilai mengambang, sehingga warga dan mahasiswa terus mencecar dewan dan Pemkab agar lebih serius menangani kasus tersebut. Meski belum merasa puas, setelah menerima penjelasan dari ketua DPRD dan anggota dewan, para pengunjuk rasa akhirnya membubarkan diri dengan tertib.(a29

Disperindakop Pakpak Bharat Tidak Gelar Pasar Murah SALAK (Waspada): Dinas Perindustrian, Perdagangan, Koperasi (Diperindakop) dan Usaha Kecil Menengah (UKM) Pemkab Pakpak Bharat tidak melaksanakan pasar murah. Sementara, kegiatan telah dianggarkan dalam APBD 2011 Rp72 juta. Namun, Disperindagkop menyelenggarakan pasar murah sepekan menjelang lebaran dengan dana provinsi. Kadis Perindakop dan UKM Pemkab Pakpak Bharat Mangaraja Maha saat dikonfirmasi melalui telepon seluler, Senin (12/9) mengaku kegiatan tidak terlaksana karena salah perencanaan oleh Bidang Perdagangan. ‘’Sehingga, tidak terlaksana pasar murah yang dananya bersumber dari APBD dikarenakan mengejar waktu saat lebaran. Dananya harus dikembalikan ke kas daerah,’’katanya. Disebutkannya, dari pada salah penggunaan, lebih baik tidak usah dulu digelar, dan saat perencanaan itu di belum menjabat Kadis. (a37)

Gara-gara Cubit Pinggul Karyawati, Atasan Diadukan Ke Polisi PEMATANGSIANTAR (Waspada): Gara-gara mencubit pinggul bawahannya (karyawati), Ha, 37,Wakil Pimpinan Harian KSP Karya Mulia Wilayah Sumut, warga Jalan Sisingamangaraja, Gang Supir, Kota Medan diadukan ke polisi. Informasi dihimpun dan pengaduan korban Dian Hastina, 21, karyawati KSP Karya Mulia, warga Jalan SKI, Kel. Aek Nauli, Kec. Siantar Selatan, Kota Pematangsiantar di Polres Pematangsiantar, Senin (12/9) menyebutkan, Ha mencubit pinggulnya dalam kantor KSP Karya Mulia di Jalan SKI, Jumat (9/9) pukul 19:00. Peristiwa itu terjadi, ketika korban baru selesai mandi dan masih mengenakan handuk hendak masuk ke dalam kamarnya dalam kantor KSP Karya Mulia. Saat itu, Ha sedang berada di ruang makan sedangmengambilairminum.Ketikakorbanmelintas,Hamengatakan korban cantik juga sambil mencubit pinggul korban menggunakan tangan kirinya. Sesudah dicubit, korban segera menghindar dan masuk ke dalam kamarnya. Perbuatan Ha membuat korban merasa dilecehkan hingga akhirnya memutuskan mengadukan Ha ke Polres Pematangsiantar. Kapolres Pematangsiantar AKBP Alberd TB Sianipar, SIK, MH saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu dan Kasat Reskrim AKP Azharuddin menyebutkan pengaduan korban masih dalam penyelidikan dan Ha diduga melakukan tindak kejahatan terhadap kesusilaan dan melanggar Pasal 281 KUH Pidana.(a30)

Larikan Perempuan Di Bawah Umur Berurusan Dengan Polisi PEMATANGSIANTAR (Waspada): Seorang pria, AH, 18, pengangguran, warga Gurgur, Kab. Simalungun diduga melarikan seorang anak perempuan dibawah umur sehingga berurusan dengan kepolisian. Informasi dihimpun dan pengaduan Kasian Damanik, 73, pensiunan PNS, warga Jalan Kain Sungkit, Kel. Bane, Kec. Siantar Utara, Kota Pematangsiantar di Polres Pematangsiantar, Minggu (11/9) menyebutkan AH diketahui melarikan putrinya, ED, 18, dari tempatnya bekerja di Indo Maret, Jalan Patuan Anggi, Kel. Baru, Kec. Siantar Utara, Minggu (4/9) pukul 19:00. Menurut Kasian, Kamis (1/9) pukul 12:00, ED permisi kepadanya dan menyebutkan sore pukul 14:30 akan masuk kerja. Namun sejak pergi dari rumah dan sampai, Selasa (2/9) pagi, ED tidak pulang ke rumah. Seperti biasa, bila korban masuk kerja sore, pada pukul 00:00 sudah tiba kembali di rumah. Kasian akhirnya mengetahui ED berada, ketika saksi Pangihutan Marpaung, 47, warga Sekanauli, Jalan Bali, Kelurahan Bane, , Pematangsiantar mendatangi Kasian, Minggu (4/9) pukul 19:00. Saksi memberitahukan ED berada di rumah AH di Gurgur. Saksi mengetahui ED berada di rumah AH sesudah mencek langsung ke rumah AH. Warga setempat membenarkan ED berada di rumah AH. Mendengar informasi itu, Kasian mengutus orang untuk membawa ED pulang, namun pihak AH tidak memberikan ED pulang hingga Kasian memutuskan mengadukan AH ke Polres. Kapolres Pematangsiantar AKBP Alberd TB Sianipar, SIK, MH saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu dan Kasat Reskrim AKP Azharuddin, Senin (12/9) membenarkan.(a30)

Menteri PPN/Bappenas: Penggunaan Anggaran Harus Selaras RPJM SAMOSIR (Waspada) : Menteri Perencanaan Pembangunan Nasional/Bappenas Prof DR. Armida S Alisjahbana, MA menekankan, pengelolaan alokasi dana APBN harus berhati-hati dan selaras RPJMN. Pemerintahdapat secara langsungmelakukan intervensi anggaran guna mencapai sasaran program pembangunan yang telah diprogamkan pemerintah, sebutnya. Kehadiran Menteri PPN/Bappenas ke Samosir, Sabtu (10/9) Sore didampingi Deputi Ekonomi Prasetijono, Deputi SDM Dadang Rizky Rahman, Dirjen Pengembangan Destinasi, Kabiro Humas dan Tata Usaha Kementerian Bappenas DR. Ir. Maruhum Batubara, MPA. Menteri berharap keterkaitan ekonomi antara kota dan desa, antara kota dengan kota lainnya dan antara daerah maju dengan daerah tertinggal dapat lebih ditingkatkan. Menteri Bappenas di Samosir mengunjungi pelaksanaan Program Nasional Pemberdayaan Masyarakat Mandiri (PNPM) Pariwisata di Desa Tomok dan Desa Siallagan, Kec. Simanindo. Menurutnya, Pemerintah Pusat pada RAPBN 2012 akan mengalokasikan anggaran infrastruktur Rp 54,6 Triliun yang akan digunakanuntukmelaksanakan16program.DiantaranyaKomunikasi dan Informatika, Jasa Pariwisata, Sumber Daya Air, Perumahan dan Pemukiman, Transportasi. Kunjungan Menteri ke Samosir disambut Bupati Samosir, Kapolres Samosir, dan Tokoh Masyarakat sekaligus diberikan seperangkat pakaian adat Batak Toba. (c11)

Waspada/Marolop Panggabean

SATU dari sejumlah ruas jalan di Kota Tarutung, Taput, yakni Jln Suprapto (depan rumah dinas bupati) semrawut karena tidak mengacu pada tata ruang kota. Foto diabadikan, Senin 12/9 2011.

Waspada/ Marolop Panggabean

SEJUMLAH anggota Polres Taput dan pihak PT Penerbit EM, (panitia seminar) di kamar kerja Sekdis Diknas Taput, Senin (12/9) pukul 11:30 sekaitan adanya kutipan Rp150 ribu terhadap ribuan guru peserta seminar di Sopo Partukkoan Tarutung.

Diknas Taput Bersama PT. PEM Diduga ‘Peras’ Ribuan Guru TARUTUNG (Waspada): Diduga persekongkolan oknum Dinas Pendidikan Nasional (Diknas) Taput dengan PT Penerbit EM, ‘memeras’ ribuan guru SD, SMP, SMA se-Taput dengan modus kutipan biaya seminar Rp150 ribu per orang. Seminar diselenggarakan, Kamis (8/9) dan Jumat (9/9) di Sopo Partukkoan, Jalan SM Raja Tarutung (Taput). Undangan seminar ditandatangani Kadiknas Taput Drs Joskar, pihak PT Penerbit EM, Jonnu Situmorang, diberi nomor 066/SMNR/TRT//2011 tertanggal kosong, Agustus 2011 ditujukan kepada para guru kepala SD, SMP, SMA, SMK, TK negeri dan swasta, Kepala UPT, pengawas, guru SD,SMP,SMA,SMK seTaput. Merekamenjelaskanadanyabiaya Rp 150 ribu per-peserta dengan rincianpenggunaandanaanatara lainuntuksertifikat,snack,makan siang dan satu eksemplar buku Psikologi Pendidikan. Hal tersebut kemudian menjadi sorotan tajam dari masyarakat dan DPRD Taput. Ketua Komisi A bidang pendidikan DPRD Taput Charles Simanungkalit,Senin(12/9)kepada Waspada di Tarutung mengutarakan modus tersebut. Kata Char-

les, akibat dugaan ‘pemerasan’ itu, maka sedikitnya 1000 guru di Taput telah menjadi korban. Sedangkan penyelenggara seminar sudah berhasil mengantongi uang Rp 150 juta belum termasuk ongkosparagurudarikecamatan. “Kenapa Kadiknas justru mengundangswastadengandalil seminar. Seharusnya dia harus melindungi anak buahnya dari korbankutipanliar.Merekaharus bertanggungjawabdanmengembalikan uang guru itu. Sedangkan aparat hukum harus bertindak tegas untuk mengusut peristiwa itu,” pungkas Charles. Charles menyontohkan, seminar yang diselenggarakan penerbit buku di Medan baru-baru ini dengan ribuan guru perwakilan Sumut, tanpa pungutan dan beban kepada peserta. Bahkan peserta diberi keringanan. Seperti pemberian buku gratis, makan dan minum ditanggung penyelenggara, membuat karya tulis, mendatangkan pengusaha Laptop untuk diberikreditdanmenghadirkan nara sumber (penceramah) bertarap internasional. Dalam waktu dekat, DPRD Taput resmi memanggilKadiknas Taput untuk mempertanyakan peristiwa yang menghebohkan itu. Dan persoalan itu akan kita

bawakan ke forum untuk dibahas dalam paripurna di DPRDTaput. Sebab,DPRDTaputtidakpernah dan tidak akan pernah menyetujuimengutipdanaseminardariguru.BupatiTaputToluto, harus berani bertindak tegas terhadap bawahan yang terlibat sebagai pelaku-pelaku dugaan ‘pemerasan’ ini . “Saya yakin Bupati Taput tidaktahuadakutipansepertiitu,” ujarnya seraya menyebut terima kasih kepada aparat hukum PolresTaput yang sudah memeriksa kasus tersebut. PantauanWaspada di kantor Diknas Taput di kamar Sekdis Jamilin Purba, Senin (12/9) pukul 11.00-12:30 terlihat sejumlah anggota Polres Taput, berpakaian kemeja putih berdasi, celana hitamdudukberhadapandengan sejumlah panitia seminar dari PT Penerbit EM. Sumber menyebutkan, kehadiran anggota Polres Taput menyelidiki dugaan pemerasan yang dilaksanakan Kadiknas Taput bekerjasama dengan PT Penerbit EM. Pada kesempatan tersebut Sekdiknas Taput Jamilin Purba, menjawab Waspada, menyebut tidak mengenal dan tidak mengetahui kehadiransedikitnya7tamu

dalam kamar kerjanya. “Saya sengaja pindah kamar untuk menghargai mereka. Kalau menyangkutseminardankutipan Rp 150 ribu dari peserta saya kurangmengerti.Yangtahuadalah Kabid Dikdasmen Diknas Taput M Purba, yang sedang berada di Solo,” jawab Jamilin. Apa kapasitas bapak pada saat seminar dilaksanakan ? JawabJamilin:SayamewakiliKepala Dinas untuk membuka seminar tersebut, Kamis (8/9) sebab Kadis tidak dapat hadir. Secara teknis itu bukan tanggung jawab saya, timpalnya. KadiknasTaput Joskar, Senin (12/9) saat dicoba beberapa kali dihubungi tidak berhasil. “Bapak lagi banyak tugas di dalam kamar, tidak boleh diganggu,” sebut salah satu staf kepada wartawan. Secara terpisah Kapolres Taput AKBP IKGWidjatmika SiK, di Tarutung, menjawab Waspada, sekaitan kehadiran anggotanya di Diknas Taput lewat sms mengatakan, “Saya belum ada laporan tentang itu dari Kasat saya, karena kita kemarin fokous pengungkapan kasus pembunuhan. Itu mungkin kebijakan dari Dinas Pendidikan,” jawab Kapolres. (c12)

Tiga Pria Bersenpi Rampok Uang Remaja PEMATANGSIANTAR (Waspada): Tiga pria menodongkan senjata api jenis pistol kepada remaja lalu merampok uangnya. Korban perampokan bersenpi itu Syahrul Efendi Siregar, 17, warga Jalan Kapten PierreTandean, Kel. Pahlawan, Kec. Siantar Timur, Kota Pematangsiantar. Informasi dihimpun menyebutkan korban ditodong di Jalan Manunggal Karya, Kel. Pematang Marihat, Kec. Siantar Marihat, Senin (12/9) dinihari. Korban saat itu sedang bermain game di warnet Ekstrim samping stasiun taksi Paradep, Jalan Sutomo, Kel. Pahlawan, Siantar Timur. Tiba-tiba seorang pria menepuk bahu kiri korban dari belakang. Saat korban menoleh, pria yang tidak dikenalnya mengenakan jaket hitam dan memakaitopiitumencabutsenpi dari pinggang serta menodongkan ke pinggang kanan korban. Korban terpaksa menurut ketika pria itu memerintahkannya ikut dan dipaksa naik ke sepeda motor Yamaha Vixion

warna hijau, dimana dua pria lainnyasudahmenunggu.Korban selanjutnya dibawa naik sepeda motor bonceng tiga, sedang pria yang menodong korban, menggunakan sepeda motorYamaha Jupiter MX. Penjaga warnet dan temantemankorbanhanyabisaterdiam saat itu melihat korban dibawa dengan ancaman senpi. KetikatibadiJalanManunggal Karya berjarak lebih kurang 5 km dari warnet, korban diturunkan di pinggir sungai dekat SMPN 11. Priayangmemilikisenpibertanya di mana uang Rp 9 juta dan emas yang dicuri dari pasien RSUD Dr Djasamen Saragih. Korban yang merasa tidak pernah melakukan pencurian malah balik bertanya dengan perasaan heran apa yang dicurinya. Jawaban korban membuat pria yang memegang senpi mengetokkan gagang pistol ke kepala korban dan mengatakan korban jangan berpura-pura dan memerintahkan korban membalikkan uang dan emas itu dan

korban tidak akan diapa-apakan. Saat itu, korban ditanya apakahkenaldenganKikidankorban menjawab tidak mengenalnya hinggatigapriaitukembalimemerintahkan korban mengembalikan uang dan emas itu dan merekabagidua.Namun,korban tetap mengatakan tidak ada mencuri uang dan emas itu hingga tiga pria itu menggeledah kantong celana dan baju korban serta mengambil uang korban Rp114 ribu dari saku celana. Sesudah mengambil uang korban, tiga pria itu menyuruh korban naik ke atas sepeda motor YamahaVixion dan dibawa dengan bonceng tiga ke markas Polsek Siantar Selatan di Jalan Melanthon Siregar. Satu pria yang membonceng korban dan mengenakan celana Satpam, masuk ke kantor Polsek, sedang korban dan satu pria lainnya menunggu di pinggir jalan serta pria yang memiliki senpi itu langsung pergi. Pria yang masukkekantorPolsekSiantarSelatan segera kembali dan mereka berti-

ga berangkat ke Jalan Narumonda. Korban akhirnya diturunkan dan ditinggalkan di Jalan Narumonda itu hingga korban yang tidaksempatmemakaisandalnya yang tertinggal di warnet, berjalan kaki ke rumah neneknya. Ternyata, nenek korban bersama warga sudah mencoba mencari-cari korban sesudah penjaga warnet Guntur Batubara, 19, warga Jalan Sangnawaluh, Pematangsiantar memberitahukan korban dibawa tiga pria dari warnet. Kapolres Pematangsiantar AKBP Alberd TB Sianipar, SIK, MH saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu dan Kasat Reskrim AKP Azharuddinmenyebutkanpengaduan korbanmasihdalampenyelidikan dantigapriayangbelumdiketahui identitasnyaitudidugamelakukan tindak pidana pengancaman dan perampokan terhadap anak dibawah umur serta melanggar Pasal 80 UU RI nomor 23 tahun 2003 tentang perlindungan anak masih dalam pencarian.(a30)

Infrastruktur Sejumlah SD Di Taput Memprihatinkan Serta Tidak Miliki Kasek TARUTUNG (Waspada): Di Kab. Tapanuli Utara banyak SD tidak ada kepala sekolahnya, gedung rusak dan infrastruktur sangat memprihatinkan. ‘’Kondisi itu, selain tanggung jawab pemerintah juga menjadi tanggung jawab moral bangsa ini,’’ sebut Ketua Komisi A DPRD Taput Charles Simanungkalit, kepada Waspada, Senin (12/9) di Tarutung. Kata dia, saat ini di Kec. Sipoholon terdapat 4 SD tidak ada kepala sekolahnya, yakni SD Pansinaran, SD Lobusikkam, SD Sandaran dan SD Tapiannauli. Masyarakat telah mendesak agar diisi Diknas Taput, karena berdampak pada proses belajarmengajar. Hal yang serupa tidak tertutup kemungkinan terjadi di sejumlahkecamatanlaindiTaput. Kata Charles lagi, tokoh masyarakat Sipoholon Beheri Simanungkalit telah menyampaikan permohonan kepada peme-

rintah melalui gabungan Komisi di DPRD Taput pada saat pembahsan P-APBD 2011 di kantor Camat Sipoholon barubaru ini. Pertemuan dihadiri masing-masing kepala sekolah SD, SMP, SMA se Kec. Sipoholon, Camat dan unsur Muspika setempat. Saat itu UPT Pendidikan Sipoholon B Purba, menanggapi keluhan masyarakat tersebut dan berjanji akan meneruskan permohonan tersebut ke Dinas Pendidikan Pemkab Taput seterusnya ke bupati. Kejadian yang serupa kata Charles, juga di Adiankoting . Permohonan disampaikan masyarakat kepada gabungan komisi DPRD dalam kunjungan kerjanya bertempat di kantor camat setempat. Seperti, Kepala Desa Pagaran Lambung II M Sipahutar, dalam usulannya, pembangunan in-

frastruktur sangat mendesak sebab anak SD harus berjalan kaki4kmmelewatigunung,sungai setiap hari karena tidak ada angkutan dan terbatasnya gedung sekolah. Sedangkan Kepala Desa Pansurbatu I M Lumbantobing mengusulkan agar sumur air minum di desa itu yang setiap harinya dipergunakan 100 Kepala Keluarga bisa mendapat pembangunan yang permanen guna meningkatkan kesehatan masyarakat. Sementara, Kepala Desa Adiankoting Erikson Pardede mengusulkan pengaspalan jalan menuju tanah lapang yang setiap harinya dipakai anak sekolah dan merupakan lapangan upacara setiap memperingati harihari besar. Selain itu, Direktur SMP Negeri III Adiankoting Pantun Panjaitan juga mengusulkan agar jalan menuju sekolah itu

sepanjang 100 meter mendapat pengaspalan. Katanya,setiapmusimhujan, siswa SD dan SMP yang melewati jalan itu kewalahan karena sangat licin. Pertemuan juga membicarakan pembangunan lansung menyentuh kehidupan masyarakat, antara lain pembangunan jalan, peningkatan produksi pertanian serta terkait bantuan bibit kepada para petani. Anggota DPRD Taput yang hadir dalam pertemuan itu antara lain Charles Simanungkalit,Johannes Sitohang,Betti Sidabutar dan Maulana Lumban Gaol. “Seluruh usulan masyarakat dalam pertemuan ini sudah kami catatdanakankamiperjuangkan. Namun walau tidak semuanya bisa terealisasi, masyarakat harus bersabar,”ujar Charles Simanungkalit. (c12)

Waspada/Hasuna Damanik

WARGA Sindar Dolok dan puluhan mahasiswa tergabung dalam SALING menggelar aksi di pelataran gedung DPRD Simalungun, Senin (12/9).

Bupati Resmikan Puskesmas TAPTENG (Waspada): Bupati Tapanuli Tengah akan memprioritaskan pembangunan sektor kesehatan masyarakat antara lain membenahi fisik Puskesmas tiap kecamatan dan bertekad membangun Rumah Sakit Umum di Barus pada 2012. Hal itu disampaikan Bupati Tapanuli Tengah Raja Bonaran Situmeang, Sabtu (10/9) pada peresmian Puskesmas Saragih, yang dihadiri TP PKK Tap.Teng Ny. Norma Simatupang, anggota DPRD dan Muspida Plus, Puskesmas itu di Jalan Nanjur Km. 13 ManduamasAceh Desa Saragih, Manduamas. Tujuan didirikannya Puskesmas Saragih tersebut, menurut dia agar meningkatkan kualitas kesehatan warga desa “Puskesmasinidibangundemikesejahteraanmasyarakatdibidang kesehatan, apalagi berbagai macam penyakit yang sering dikeluhkan masyarakat, untuk itu saya harapkan kepada masyarakat di Kecamatan Manduamas agar bekerjasama” imbuh bupati. Sedangkan Kadis Kesehatan Tapteng Dra. Masdiana MARS, dalam laporannya menye-butkan, Puskesmas Saragih semula berstatus Pustu (Puskesmas Pembantu) dibawah nauangan Puskesmas Manduamas, dan saat ini telah meningkat menjadi Puskesmas Induk, sedangkan sebagai bentuk kepedulian dalam pembangunan kesehatan, masyarakat telah memberikan tanahnya untuk lahan Puskesmas tersebut. “Puskesmas Saragih melayani masyarakat di empat desa, yaitu Desa Saragih, Pagaran Nauli, Sarma Nauli dan Binjohara, dengan total penduduk 6 ribu jiwa,” jelasnya. Lebih lanjut Masdiana menambahkan, secara umum di Tapteng masih didominasi penyakit menular seperti infeksi saluran pernafasan akut (ISPA), diare, kecacingan dan infeksi kulit. Penyakit ini dipengaruhi faktor sanitasi lingkungan yang kurang baik. Sebelumnya, Marudut Sibagariang salah seorang pemuka masyarakat meminta agar Raja lebih memperhatikan keluhan masyarakat khususnya di Manduamas, yakni minimnya sarana kesehatan dan kondisi jalan yang rusak parah. Menurut Marudut, warga sudah tidak ingin janji-janji, dan warga Manduamas yakin bupati yang pilihan rakyat, akan membawa perubahan serta menepati janji-janji tersebut tanpa kepentingan tertentu. Rakyat Harus Rela Seiring pembangunan dan perbaikan jalan negara hampir di seluruh wilayahTapteng, khususnya di Manduamas yang merupakan perbatasanTapteng deengan Aceh, maka bupati mengimbau masyarakat agar mendukung dengan merelakan tanahnya jika nanti digunakan untuk program pembangunan Provinsi Sumatera Utara serta lancarnya perhubungan di Manduamas. Menurut Raja, beberapa minggu lalu dia telah membuat persetujuankesepakatandenganpemerintahprovinsiterkaitperbaikan jalan Manduamas Desa Saragih Manduamas-Aceh. “Karenaitusayaharapkanmasyarakatmendukungataumerelakan tanahnya yang terkena pembangunan jalan tersebut, dan saya yakin masyarakatrelademipembangunan.Itusudahterbuktisaatkampanye Pemilukada lalu, masyarakat rela berkorban menyumbang calon bupatinya agar menang dan itu pertama kali terjadi di Indonesia,” jelasnya. Bupati juga mengharapkan masyarakat selalu memberi motivasi, kritik dan saran secara positif kepada program pemerintah Tapteng yang telah dicanangkan sebelumnya. “Jangan ada nanti omongan fitnah kepada pemerintah mengenai program kerja Pemkab Tap.Teng,” tegasnya. Pantauan Waspada infrastruktur jalan negara di berbagai desa di Kec. Mandumas, Sosorgadong dan Sorkam rusak parah.(a23)

B4 Cari Pelaku Penembakan, Aparat Polres Madina Turun Ke Hutatua PANYABUNGAN (Waspada): Jajaran Polres Madina dipimpin Kasat Reskrim AKP HS. Siregar, SH terus mencari pelaku yang diduga menganiaya dan menembak tiga warga Desa Gunung Baringin, termasuk menggerebek rumah tersangka ke Desa Hutatua Kecamatan Panyabungan Timur, Minggu (11/9). “Penggerebekan kami lakukan di Desa Hutatua Minggu sekira pukul 15:00 atau sekitar tujuh kilometer dari Gunung Baringin, namun tak satu pun pelaku ditemukan, karena diduga telah melarikan diri,” ujar Kapolres Madina melalui Kasat Reskrim AKP HS. Siregar, SH, Senin (12/9). Pihaknya terus mengejar pelaku pada peristiwa yang terjadi Kamis (8/9) dinihari, saat ada acara panggung hiburan di Desa Gunung Baringin Kecamatan Panyabungan Timur. Menurutnya, ada empat nama yang diduga menjadi tersangka, masing-masing Mu (pelaku pembacokan), Ma dan Su (penganiaya) dan Sa, diduga melakukan penembakan. “Saat digerebek tak seorang pun ada laki-laki di desa itu, yang ada hanya perempuan dan anak-anak. Diperkirakan mereka lari ke hutan maupun daerah perbukitan sekitar,” ungkapnya. Sebelumnya,sebutSiregar,timPolresMadinajugatelahmelakukan penggerebekan.Tapi pasukan dipimpin Kabag Ops dan Kasat Sabhara itu tak berhasil menemukan para pelaku. Dalam penggerebekan pagi itu, aparat menemukan sekitar 1 ons biji ganja yang akan dipergunakan untuk bibit dari tangan seorang ibu rumah tangga, Dan, 34, penduduk Desa Hutabangun dan kini ibu rumah tangga tersebut sudah diamanakan di Mapolres Madina. Dijelaskan, menyangkut ketiga korban yakni Maksum, 31, terkena tembakan, Bahri, 30, dan Denin, 37, korban pembacokan, sudah kembali dari rumah sakit ke kampung halaman dengan kondisi berobat jalan. “Tadi siang, ke tiga korban sudah dibawa Camat Panyabungan Timur ke Gunung Baringin, masih lemah, dan sepakat untuk diminta keterangan pada Kamis (15/9) sekira pukul 10:00,” jelasnya.(a28)

DID Dan DAU Di Diknas P. Sidimpuan Rp 24 M P.SIDIMPUAN (Waspada): Dana Intensif Daerah (DID) dan Dana Alokasi Umum (DAU) TA 2011/2012 mencapai Rp 24 miliar padapengumuman 78 paket proyek di Dinas Pendidikan (Diknas)Kota Padangsidimpuan, kemarin. Uang kewajiban setiap paket proyek mencapai 25 persen yang disetor oleh beberapa pemborong kepada seseorang pemegang daftar proyek suruhan orang tertentu yang ditakuti oleh kepala dinas. Permainan tersebut dilakukan di warung kopi, kafe-kafe dan tempattertutuplainnya.DemikiandikatakansumberkepadaWaspada. Diakuinya, hal demikian dilakukan oleh mafia-mafia proyek di Dinas tersebut, maka kwalitas bangunan gedung sekolah dan rehabilitasi fisik bangunan akan dibawah standar yang direncanakan oleh tenaga teknis rancangan bangunan, ungkap sumber, Senin (12/9) Diketahui pada 2009, kewajiban proyek Dana Alokasi Khusus (DAK) sekira Rp 1.8 Miliar di Dinas Pendidikan Kota Padangsidimpuan menjadi ajang pesta korupsi yang melibatkan kepala dinas Panongonan Muda Hasibuan hingga dijatuhi hukuman penjara bersama kepala seksi sarana dan prasarana, Maskur Hasibuan. Sementara, pada proses hukum kasus DAK tersebut, seluruh Kepala Sekolah setingkat Sekolah Dasar (SD) yang mendapat dana DAK menjadi saksi didalam proses hukum hingga ke Pengadilan Negeri Padangsidimpuan. Kedua tersangka terbukti melakukan tindak pidana korupsi hingga dijatuhi oleh majelis hakim dengan mendapat hukuman penjara di Lembaga Pemasyarakatan (LP) Salambue, Kota Padangsidimpuan. Maraknya kabar kewajiban proyek yang melangit di Disdik Kota Padangsidimpuan menjadikan para kontraktor mengeluh. Kepala Dinas (Kadis), Drs Abdul Rosad Lubis ketika dihubungi tidak berada di kantornya, sementara diakui sekretarisnya, Drs Masuddin Lubis, kewajiban proyek tersebut tidak diketahuinya. ‘’Saya tidak tau masalah uang kewajiban proyek yang berjumlah puluhan paket itu. Saat ini kadis lagi di Jakarta, yang lebih tau masalah tentang proyek itu bagian teknis’’, ujar Masuddin.(c13)

Sumatera Utara Panitia PUD Tapsel Kutip Biaya Dokumen Lelang MEDAN (Waspada):Panitia lelang Pekerjaan Umum Daerah (PUD) Tapanuli Selatan (Tapsel) mengutip biaya dokumen lelang kepada sejumlah rekanan yang mengikuti tender proyek jalan dan drainase bernilai miliaran rupiah di dinas tersebut. “Kami dimintai uang Rp570 ribu oleh panitia PUD Tapsel denganalasanuntukpembayaran pengambilan dokumen lelang (biayacetakpeta)padaDinasPUD Tapsel 2011 (APBD Perubahan),” jelas kuasa Direktur CV. Serdang Indah Ramadhan Siregar, Sabtu (10/9) di Medan. Ramadhan juga menun-

jukkan kwitansi pembayaran pengambilan dokumen lelang yang sudah diterima CV Serdang Indah, tertanggal 9 September 2011 ditandatangani penerima Sekretaris Panitia A. Dahlan Nasution.DijelaskanRamadhan, selain CV Serdang Indah, panitia juga mengutip uang dari CV. Cinta Nuria, CV Batugana City dan lainnya. “Perbuatan panitia lelang ini melanggar Pepres 54/2010 dan sangat memberatkan rekanan. Ketua Panitia dan Sekretaris Lelang tidak boleh mengutip biaya apapundarirekananyangmengikuti tender. Tapi dalam masalah tender ini mereka seperti memperkaya diri sendiri,”

jelasnya. Bahkanlanjutnya,saatpanitia lelang ditanya uang yang diminta untuk apa, mereka menjawab untuk cetak peta. “Ini instruksi dari atasan, jika tidak percaya boleh tanya Kabag Hukum Pemkab Tapsel,” jelas Ramadhan Siregar. Kami, lanjutnya, sebagai rekanan akan mengadu ke polisi maupun kejaksaan atas sikap panitia lelang yang telah mengutip uang rekanan. Sedangkan Lembaga Aspirasi Suara Rakyat (Laras) Sumatera Utara akan mengawal proses lelang di PUD Tapsel yang telah ada indikasi pengutipan biaya pekerjaan di Dinas PUD Tapsel 2011. (m39)

Tunggakan Cicilan Pedagang Di Madina Miliaran Rupiah PANYABUNGAN(Waspada): Kepala Dinas Perindag Koperasi DanUKMKabupatenMandailing Natal (Madina), Drs. Ansari melalui Kabid Pasar, Ir. Mangagatas Tua Nasution, mengakui tunggakan cicilan pedagang hingga Mei 2011 lebih kurang Rp12 miliar. Itu disamapaikannyasaatdikonfirmasi Waspada, Senin (12/9) via seluler. Katanya,hampir5bulaniabertugas di Dinas Pasar sudah sering ia melakukan pendekatan persuasif kepada pedagang terkait cicilan. Di akuinya, pihaknya secara

resmi telah membuat teguran kepada pedagang terkait cicilan. Bahkansosialisasijugadilakukan melalui Satpol PP dan media elektronik supaya ada kesadaran pedagang. Namun, meski berbagai hal dilakukan tetap saja kesannya para pedagang anggap enteng. Dan setelah diselidiki, pedagang anggap enteng di duga karena memang tidak ada ikatan yang jelas terkait cicilan kios antara pedagangdenganPemkabMadina. Dijelaskan, saat ia baru menjabat

Megawati Hutagalung Masih Anggota DPRD Kota Sibolga SIBOLGA (Waspada): Badan Kehormatan Dewan DPRD Kota Sibolga Muchtar Nababan menegaskan, Megawati Hutagalung merupakan anggota PDI- P Kota Sibolga masih diakui dan tetap menerima haknya meskipun tengah menjalani hukuman di LP Kelas II A Sibolga atas kasus penyimpanan minyak tanah bersubsidi. “Megawati masih anggota DPRD Kota Sibolga dan berhak menerima gaji, meski menjalani hukuman, karena belum ada surat keputusan mengenai hal itu,” jelas Muchtar Nababan, Sabtu (10/9). Menurut Muchtar, dalam hal ini tidak ikut campur, kendati diakuinya pihaknya akan menyerahkan masalah tersebut kepada pimpinan mengenai keputusan melalui rapat DPRD Kota Sibolga terkait status Megawati, dan selanjutnya juga akan mempertanyakan kepada partai bersangkutan. ‘’Pasalnya yang berhak memberi sanksi atau tindakan adalah pihak partai politik yang mendukungnya. Kita akan membuat surat rekomendasi kepada pimpinan DPRD Kota Sibolga, dan melalui rapat DPRD dan keputusan dari paratai politik pendukungnya barulah diambil keputusan,”katanya.(a23)

sebagai Kabid Pasar Mei 2011, ia sudah pernah menyurati Pj Bupati Madina, Aspan Batubara terkait masalah tersebut namun tidak ada perintah yang tegas dan jelas. Mengenai temuan Jaringan Aktifis Sumatera Utara (JAMSU) tentang adanya dugaan permainan ajang bisnis lokasi berjualan di bawah tangga dan K5, ia mengakuiadabenarnya.Tapiitutelah terjadi sebelum ia menjabat sebagai Kabid Pasar. “Saya bukan membela diri, tapi itu sudah ada dan saya belum tahu sejak kapan itu di mulai. Saya juga sudah pernah menegur pedagang terkait, dan kata pedagang mereka telah membayar lokasi tempat mereka berjualan. Makanyakitakesulitanuntukmelakukan penertiban karena pedagang merasa telah membayar kewajibannya,” ucap Mangatas. Ketua JAMSU, Iswadi Batubara mengatakan, kalaupun PemdaMadinaakanmembentuk SK TimVerifikasi terkait masalah pasar itu sangat baik. Tapi harus di catat oleh pihak terkait, JAMSU tidak akan diam dan akan terus memantau persoalan pasar.(c14)

WASPADA Selasa 13 September 2011

Lagi, 15 Anggota DPRD P. Sidimpuan Boikot Paripurna P. SIDIMPUAN (Waspada): 15 Anggota dewan melakukan aksi boikot yang keempat kalinya terhadap rapat paripurna yang dipimpin Ketua DPRD Padangsidimpuan, Aswar Syamsi, Senin (12/9). Aksi boikot ini bukti kuat atas komitmenmerekaterhadapsurat mosi tak percaya yang sebelumnya mereka layangkan terhadap kepemimpinan Ketua DPRD Padangsidimpuan, Aswar Syamsi. Anehnya, aksi boikot seolah didukung anggota dewan yang lain. Dibuktikan dengan hanya 6 dari 25 orang anggota dewan yang menghadiri paripurna Nota Pengantar Keuangan Perubahan APBD 2011, dipimpin Aswar Syamsi. Rapat dibuka sekitar pukul 10:00, dan 35 menit kemudian terpaksa diskor karena rapat paripurna tidak memenuhi korum. Pada rapat itu Ketua Fraksi Gabungan Karya Bersatu sebagai yang

mewakili 15 anggota dewan yang meneken surat mosi tidak percaya,ErwinNasution,membacakan pernyataan keberatan. Pasalnya, hingga saat ini pimpinan dewan belum juga menindaklanjuti surat mosi tidak percaya mereka terhadap kepemimpinan Aswar Syamsi kepada Badan Kehormatan Dewan (BKD). Usai Erwin menyampaikan keberatannya, pimpinan dewan menskor paripurna tersebut. Kemudian membukanya kembali padapukul11:30danlagi-lagidilakukan penundaan karena anggota dewan yang hadir cuma 6 orang. Pukul 14:40, paripurna kembali dibuka. Tapi sekitar 15 menit kemudian diskor kembali, karena anggota dewan yang hadir jumlahnya semakin berkurang, yakni 5 orang saja. Paripurna diskor hingga Selasa (13/9), hari ini. Secara terpisah, 15 anggota dewan mengatakan, aksi boikot

ini akan terus dilakukan selagai pimpinanrapatnyaAswarSyamsi. Ke-15anggotaDPRDyangmengajukan mosi tak percaya dan melakukan aksi boikot Erwin Nasution dan Syahrun Harahap dari PAN, Sopian Harahap dari Partai Republikan, Soritaon Siregar dari PSI, Siti Hawani Harahap dari PKPB,HennyHerlinadanAriyanto Harahap dari Partai Hanura. Hj. Hamidah Batubara dan Anwar Panjaitan dari Partai Golkar, Ashari Harahap dari PDP, Hamdani Nasution dari PBR, M Isnandar Nasution dari PKB, Anggara Muda Sakti dari PPP, Rika Hannum Nasution dan Darwin Harahap dari Partai Demokrat. “Kita akan terus memboikot rapat-rapat maupun paripurna yang dipimpin oleh orang yang sudah kita tidak percayai kepemimpinannya. Kita semua komit terhadap apa yang kita perjuangkan di dewan,” kata Erwin Nasution.(a27)

‘Kami Merindukan Penerangan Listrik’ PANYABUNGAN(Waspada): “ Pak Dayat kami butuh listrik untuk menerangi desa kami yang sudah puluhan tahun merindukan penerangan. Kami 99 persen adalahpendukungmusaatpilkada lalu.”Demikianharapanyangbisa di tafsirkan penulis saat men-dengar keluhan perwakilan masyarakat Desa Hadangkahan, Kec. Batang Natal, Kab. Mandailing Natal (Madina), Johan Harahap, Senin (12/9) via seluler. Katanya,selainmasalahjalan, penerangan listrik merupakan prioritas yang diinginkan masyarakat setempat, yang selama ini hanya mengandalkan lampu petromak dan genset. Katanya, tiang-tiang listrik lengkap dengan kabel ke desa mereka sudah ada di pasang sekitar 10 tahun lalu. Namun tanpa ada alasan yang jelas, pembangunannya tidak di lanjutkan, sehingga kabel listriknya hilang satu demi satu. Akibat tidak ada-

nya listrik selain sering membuat masyarakat ketinggalan informasi, juga mengakibatkan anakanak didik mereka kesusahan saat belajar di malam hari. Menurut Johan Harahap, yang juga pengurus BPD Hadangkahan ini, sebenarnya mereka sudah memiliki peluang untuk mendapatkan pembangunan listrik melalui program PNPM Mandiri Pedesaan. Katanya, secara peraturan dan kesepakatan bersama saat rapat Badan Pemberdayaan Masyarakat (PMD) Madina dengan pihakPNPMdiKec.Natalbeberapabulanlalu,DesaHadangkahan sudah berhak mendapat jatah pembangunan listrik oleh PNPM tersebut. Namun entah bagaimana, belakangan ini katanya ada kesan dugaan upaya pihak tertentu untukmenggagalkanpembangunan listrik ke desa mereka, dan di pindahkankedesayanglain.“Karena

itu saya atas nama masyarakat Desa Hadangkahan berharap dengan posisi Pak Dayat sebagai Bupati Madina, minimal bisa membantudengankekuasannya sehingga pembangunan listrik ke desa kami tahun 2011 ini tetap lanjut,” ucap Johan. Menurut Johan, adanya upaya untuk menggagalkan proyek pembangunan listrik ke desa meraka sudah di sampaikan ke tingkat kecamatan. Namun hingga sekarang tidak ada penyelesaian yang jelas. Karena itu rencananya masyarakat Desa Hadangkahan akan mendatangi DPRD dan Bupati Madina dalam waktu dekat jika tidak ada solusi. Yang jelas, saat ini masyarakat Hadangkahan hanya mengharapkan perhatian serius dari Bupati Madina, Hidayat Batubara, sebagai bentuk tanggung jawabnya kepada rakyat. (c14)

Ekonomi & Bisnis

B5 FTA Rugikan Indonesia

WASPADA Selasa 13 September 2011

JAKARTA (Waspada): Kementerian Keuangan menilai perjanjian Free Trade Agreement (FTA) merugikan Indonesia, karenanya perlu adanya pengkajian ulang dalam perjanjian bilateral maupun multilateral ini.


Waspada/Edi Saputra

Sejumlah pekerja tampak menurunkan TBS sawit milik para pengepul digudang Firdaus Jaya di Desa Firdaus, Kec.Sei Rampah, akibat meningkatnya produksi sawit di masyarakat yang berimbas semakin menurunnya harga di pekebun, foto direkam, Senin (12/9)

Pekebun, Pengepul Sawit Sergai Risau SEIRAMPAH (Waspada): Pekebun dan Pengepul (agen) sawit Kab.Serdang Bedagai (Sergai) kian risau dengan terus menurunnya harga tandan buah segar (TBS) dalam kurun waktu sebulan terakhir. Mic Benteng, 42, pekebun sawit dengan 1 hektar lahan, warga Desa Mangga Dua, Kec. Tanjung Beringin menuturkan sebelum lebaran harga sawit hampir Rp1.200 perkilogram, namun setelah lebaran harganya sudah dibawah Rp.1000 dan ironisnya agen belum bisa memanen sawit karena sedang banjir buah, akibatnya buah banyak yang rontok (berondol) dipohon, terangnya ketika dihubungi Waspada, Senin (12/9). Hal yang sama juga dikeluhkan Mahyudin Purba, 41, pekebun sawit warga Desa Marubun, Kec.Sipispis yang juga Ketua Komisi B DPRD Sergai yang mengelola kebun

keluarga seluas 10 hektar mengatakan harga sawit terus mengalami penurunan hingga Rp930 perkilogramnya, selain itu saat menjual ke pabrik kelapa sawit (PKS) harus antri hingga 3 hari padahal biasanya hanya satu hari, akibatnya petani semakin merugi, jelasnya. “ Sepertinya sudah wajar jika di Kab. Sergai didirikan PKS swasta yang khusus menampung sawit masyarakat, terlebih saat terjadi masa penen raya atau lonjakan produksi seperti ini, kiranya Pemkab Sergai mulai berfikir kearah sana,” harap Mahyudin Purba. Kerisauan juga menyelimuti para agen (pengepul) dan pemilik gudang sawit seperti yang dialami Edy Muslih,39, agen sawit warga Dusun I, Desa Cempedak Lobang, Kec.Sei Rampah mengakui kondisi melimpahnya produksi sawit hingga mengakibatkan penu-

runan harga terparah dalam beberapa tahun terakhir, keluhnya kepada Waspada. “ Dari 700 ton ambilan dipetani saat ini meningkat 1000 ton setiap bulannya yang ketika menjualnya harus rela antri hingga berhari-hari di PKS dampaknya, rendemen (kandungan) buah menurun dan restan (sorteran buah) meningkat,” ugngkap Edy Muslih. Pengawas gudang sawit Firdaus Jaya,Toni,39, yang berlokasi di Desa Firdaus mengatakan peningkatan produksi sawit dari petani mencapai 30 persen dari 100 ton perhari menjadi 130 ton diperparah hrus antri berhari-hari di PKS, karena pabrik lebih mengutamakan mengolah produksi bauh miliknya, tuturnya. Diakui Toni, penurunan harga TBS dipetani dan di pabrik diakibatkan turunnya harga Crude Palm Oil (CPO) dipasaran

ditambah naiknya pajak eksport CPO, yang diperkirakan Toni kondisi ini bertahan hingga Desember mendatang yang merupakan kondisi terparah dalam beberapa tahun terakhir. Kadis Kehutanan dan Perkebunan Kab.Sergai, Ir.Mega Hadi juga mengakui penurunan harga diakibatkan melonjaknya produksi pekebun sawit diiringi meningkatnya luas areal milik masyarakat. “Untuk mengupayakan pendirian PKS baru pihaknya akan melakukan study kelayakan usaha (SKU) terlebih dahulu sebelum mengundang investor, khususnya terkait kepastian (jaminan) pasokan TBS sawit saat sulit buah ataupun panen raya dari masyarakat atau para pelaku usaha sawit dan itu merupakan kajian utama yang akan kita dalami lagi,” terang Mega Hadi, kepada Waspada. (c03)

Pasca Lebaran, Harga Sembako “Moratorium Tidak Akan Di Paluta Kembali Normal Menghemat Anggaran” PALUTA (Waspada): Dua belas hari pasca lebaran, pasaran sembako dan sayur mayur di sejumlah pasar tradisional di Kabupaten Padanglawas Utara (Paluta) stabil. Kecuali, harga telur ayam dan minyak goreng, sedangkan daging sapi dan ayam sudah kembali normal. Di Pasar Gunungtua, Kec. Padang bolak pasokan sayur-mayur melimpah dari berbagai daerah sehingga harganya murah. Seperti bayam dan kangkung seikat dijual Rp1.000 dari sebelumnya saat puasa Rp2 ribu di penjual sayur keliling. Sedangkan buncis dan wortel juga turun dari Rp4.500 per kg menjadi Rp3 ribu per kg. Kacang panjang per ikat Rp1.000 isi 15 lembar, sawi hijau Rp5 ribu per kg dan kembang kol Rp7 ribu per kg. “Harga sayuran makin murah,” ujar Lisna, pedagang, Senin, (12/9). Untuk pasaran sembako sudah stabil seperti gula pasir Rp11 ribu per kg dan terigu eceran Rp7 ribu per kg, kecuali minyak goreng curah masih Rp13 ribu per kg dari sebelumnya Rp10 ribu per kg dan telur ayam Rp16 ribu per kg. “Sudah hampir dua minggu setelah lebaran tapi pasaran telur ayam masih mahal,” keluh Lena Harahap, ibu rumah tangga. Adapun pasaran daging sapi kini Rp65 ribu per kg menjelang lebaran melonjak Rp85 ribu per kg dan ayam dari Rp30 ribu per ekor sekarang dijual Rp24 ribu untuk ukurang sedang. (a35)

JAKARTA (Waspada): Adanya moratorium penerimaan Pegawa Negeri Sipil (PNS) dipandang tidak akan menghemat anggaran, pasalnya besarnya anggaran PNS bukan dari jumlah pegawainya melainkan ongkos pegawai atau belanja pegawai yang besar adalah penyebab defisitnya anggaran. Hal ini diungkapkan Sekjen Forum Indonesia untuk Transparansi Anggaran (Fitra) Yuna Farhan dalam diskusi bersama komisi XI DPR RI, di Gedung DPR, Senayan, Jakarta, Senin (12/9) Yuna menambahkan, belanja pegawai besar juga diiringi dengan tidak adanya dana pada Taspen dari 2009, sehingga tidak ada lagi biaya pensiun. “Dan biaya pensiun

ini ikut naik kalau gaji pokok naik,” tambahnya Oleh karena itu, sambungnya, pemerintah harus memikirkan kebijakan untuk mengefisienkan struktur belanja pegawai ini, agar tidak terjadi defisit anggaran, bukannya malah melakukan moratorium yang dipandang kurang tepat dalam menghemat anggaran. “Ini yang harus diefiesien dari struktur belanja pegawai,” kata Yuna. Lebih jauh dia mengatakan, belanja pegawai terus naik ini disebabkan progran reformasi birokrasi yang dilakukan pemerintah tidak dipertimbangkan dengan matang, sehingga menurutnya belanja pegawai ini menjadi bom waktu yang seketika dapat meledak. (okz)

“Banyak komitmen yang dilakukan sejak lama, kalau tidak ditindaklanjuti dengan baik dalam program aksi kongkret dan jelas, membuat posisi Indonesia relatif lemah,” ungkap Menteri Keuangan (Menkeu) Agus DW Martowardojo kala di temui di Jakarta akhir pekan lalu. Adapun FTA saat ini dijalani oleh Indonesia antara lain, ASEAN FTA, ASEAN-China FTA, ASEAN-Korea FTA, ASEANIndia FTA, bilateral IndonesiaChina, dan tengah diratifikasi ASEAN-Selandia Baru-Australia. “Perjanjian itu, (FTA) tidak membuat Indonesia pada posisi terlalu sederhana. Jadi, saya ingin kita bisa melakukan kajian atas perjanjian FTA yg selama ini kita miliki,” tegas dia. Ke depannya, lanjut Agus, pihaknya akan mempertimbangkan dan mengkaji mengenai Asean New Zealend Australia FTA. Menurut Menkeu ini harus dilakukannya agar perjanjian ini hanya sedikit berpengaruh kepada Indonesia. Pengkajian FTA ini, tak lepas dari enggannya produsen BlackBerry, Research In Motion (RIM), membangun basis industrinya di Indonesia. Padahal BlackBerry merupakan salah

satu perangkat dikonsumsi secara masif oleh masyarakat Indonesia. Namun, RIM lebih memilih untuk lebih memilih membangun pabrik di Malaysia. Karenanya, pemerintah menegaskan, Indonesia tidak ingin hanya dijadikan pasar bagi produkproduk negara lain. (okz) Sementara Menteri Perdagangan Mari Elka Pangestu meminta Atase Perdagangan (Atdag) dan Kepala/Wakil Kepala Indonesian Trade Promotion Center (ITPC) dapat membuka dan meningkatkan akses pasar ekspor nasional. “Saya meminta Atdag dan ITPC memperhatikan arah kebijakan Kemendag (Kementerian Perdagangan) terutama dalam menghadapi persaingan global,” ujar Mari di Jakarta, Senin (12/9). Mari menjelaskan, hal itu merupakan bagian dari pengembangan kebijakan dan diplomasi perdagangan internasional. Untuk itu dia berharap jajaran Atdag dan Kepala atau Wakil Kepala ITPC yang akan segera menempati posisi baru dalam waktu dekat senantias memperhatikan hal itu. “Perwakilan perdagangan

Mereka berharap kalau pun Konjend China hadir di Medan nantinya bisa member keuntungan bagi mereka. Tidak saja sekadar mempermudah pebisnis besar dan warga keturunan China yang ada di Medan. Namun juga menjangkau usaha kecil agar setidaknya tetap bisa mengakses pasar yang mampu menampung produk mereka dengan dukungan konsulat tersebut hanya akan menguntungkan segelintir orang saja.” Atau malah sebaliknya akan terus memberi peluang produk China berkuasa di sini, tandasnya. Secara politis kehadiran Konjend China di Medan memang akan menguntungkan warga dan pebisnis keturunan China di daerah ini. Bahkan kabarnya untuk mendorong pembukaan Konjend tersebut akan ada penerbangan langsung dari Medan ke China. Dengan begitu mobilitas orang dan barang bisa lebih tinggi. Padahal para pengusaha UKM sudah mengaku tertekan. N. Koto, perajin konveksi yang ada di Jl. Bromo Ujung pun mengakui tertekannya produk lokal. “Sebenarnya sudah sejak beberapa tahun lalu konveksi

lokal Sumut tertekan habis karena pakaian murah dari China. Itu belum lagi beredarnya pakaian bekas. Sehingga bisnis kita makin tertekan,” jelasnya. Hal senada juga sempat disampaikan Kepala Dinas Koperasi dan UKM Sumut Jonni Pasaribu saat dihubungi Waspada bar u-baru ini. Dia menyatakan tekanan terhadap usaha kecil terutama konveksi memang datang dari RRC. Itu sebabnya mereka terus mendorong usaha lokal agar bisa survive. Dia mengatakan ada banyak cara yang dilakukan terutama permodalan, keterampilan sumber daya manusia dan juga pemasaran. “Kita akan terus pacu usaha kecil di daerah ini mampu bersaing dengan barang dari luar yang berharga murah,” ungkap-

nya. Selain di bisnis konveksi, penguasaan barang dari China juga meliputi elektronik. A Guan, pedagang elektronik di Jl. B. Katamso mengatakan peredaran barang elektronik seperti TV, DVD player, televisi dan kipas angin bahkan Kulkas dan Air Conditioner (AC) asal China makin meningkat tajam setelah penerapan CAFTA (China ASEAN Free Trade Agreement). Menurutnya, sekarang konsumen bisa mendapatkan ponsel asal China seharga Rp199. 000 atau Rp300.000 per unit, berbeda dengan ponsel merek lain yang harga terendahnya Rp400.000 atau Rp500.000 per unit. Hal yang sama juga terjadi pada produk China lainnya. Kemudian, katanya lagi, penjualan elektronik seperti ponsel dan video game asal China kini melebihi pen-jualan barang elektronik lainnya. Secara umum kondisi ini memang terpantau di pasar termasuk pusat perbelanjaan modern. Berbagai barang yang didatangkan dari China dijual dengan harga murah. Namun pebisnis ritel di Medan tidak terlalu terpengaruh karena mereka hanya menjual yang diminati pasar. Pebisnis yang terimbas dengan maraknya barang China tentu saja pengusaha konveksi, tas, sepatu, perhiasan dan jenis usaha lain. Mereka berharap kalau pun Konjend China hadir di Medan nantinya bisa member keuntungan bagi mereka.

Selain itu, Bachtiar Pangaribuan menjadi Atdag Roma, Italia, Ida Rustini (Atdag Bangkok, Thailand), Sumber Sinabutar (Kepala ITPC Milan, Italia), Pontas Parsaoran Tobing (Kepala ITPC Lagos, Nigeria), Rosiana Christina Frederick (Kepala ITPC Osaka, Jepang), Eko Priyantoro (Wakil Kepala ITPC Osaka, Jepang), Rusmin Amin (Kepala ITPC Budhapest, Hongaria), Franciska Simanjuntak ( Wakil Kepala ITPC Budhapest, Hongaria), Rita Tri Mutiawati (Wakil Kepala ITPC Johanesburg, Afrika Selatan), Dewi Rokhayati (Wakil Kepala ITPC Dubai, Persatuan Emirat Arab), dan Faried W. Rachman ( Wakil Kepala ITPC Busan, Korea). Mendag juga mengingatkan agar para Atdag dan perwakilan ITPC untuk senantiasa memperkuat mekanisme koordinasi antarperwakilan perdagangan luar negeri, memperbaiki sistem pelaporan, penguatan sistem informasi terutama database yang dibutuhkan oleh para pemangku kepentingan, dan menjaga kinerja masing-masing perwakilan. Khusus ITPC yang lokasinya cukup jauh dari KBRI, dia menyatakan selain melaksanakan tupoksinya juga harus ikut aktif mempromosikan Indonesia sebagai tujuan investasi yang baik serta mempromosikan Indonesia sebagai tujuan wisata yang begitu indah dengan beragam kebudayaannya, dalam rangka ikut mensukseskan Trade,Tourism and Investment (TTI).

Harga Sembako Fluktuatif Tanggung Jawab Siapa? BORU Pakpahan tengah asyik menata dagangannya. Dia sibuk memilah cabai merah yang tidak bagus. Begitu pula dengan tomat dan bawang merah, tangannya sangat terampil memisahkan tomat-tomat yang sudah busuk. Sesekali mulutnya ramah menyambut pembeli yang singgah ke tempat dagangannya. Ketika itu Senin, (12/9) pagi. Pembeli tidak begitu ramai singgah ke tempatnya, namun Boru Pakpahan, 61, tetap setia menunggu pelanggan hingga dagangannya habis terjual. Menurutnya, harga sejumlah komoditi di Pusat Pasar belum normal seperti biasanya. Sehingga banyak pelanggannya yang terkejut mendengar harga kembali naik, padahal beberapa hari sebelumnya harga cabai merah misalnya, sudah turun pasca lebaran. “Cabai merah, cabai rawit, cabai hijau dan bawang merah harga beli dari pemasok naik, belum normal harganya. Tapi kalau yang lainnya tidak, seperti bawang putih dan tomat harganya sudah normal,” tutur Boru Pakpahan kepada Waspada. Pakpahan mengungkapkan terdapat sejumlah harga komoditi yang belum normal. Seperti, cabai merah, cabai rawit, cabai hijau dan bawang merah harga

komoditi itu masih naik turun. Saat ini saja cabai merah mencapai Rp24.000 per kg sedangkan empat hari sesudah lebaran harganya turun menjadi Rp20.000. Harga cabai merah jauh lebih murah saat bulan puasa yang berada pada kisaran Rp10.000 per kg nya. Sementara itu, cabai rawit yang paling drastis kenaikannya mencapai Rp25.000 per kg dan sempat turun seharga Rp 20.000 per kg. Bahkan yang lebih parah harga cabai rawit mencapai Rp30.000 per kg di Pasar Simpang Limun. Begitu pula dengan cabai hijau naik menjadi Rp25.000 per kg, padahal awalnya cabai hijau seharga Rp15.000 per kg pasca seminggu lebaran. Tak jauh berbeda dengan bawang merah. Salah satu bumbu dapur ini harganya naik turun di pasaran. Saat ini saja bawang merah naik menjadi Rp12.000 per kg sedangkan sebelumnya seharga Rp 10.000 per kg. Sementara itu harga sembako seperti beras jenis Kuku Balam, Ramos, minyak curah, gula dan kacang tanah masih bertahan dengan harga sebelum lebaran. Menurut Acun pedagang beras, saat ini beras Kuku Balam dan Ramos masing-masing harganya Rp9.200 per kg dan Rp8.800 per kg. Sedangkan saat bulan puasa harga beras Kuku Balam Rp 8.500 per kg dan beras Ramos Rp8.000 per kg. Untuk harga minyak curah bertahan di posisi Rp10.000 per kg padahal sebelumnya harga

UKM Tak Yakin Konjend China Di Medan Bantu Mereka HADIRNYA konsulat jenderal China di Medan sebenarnya diharapkan para pejabat yang hadir pada peresmian kantor perwakilannya di JW Marriot Kamis lalu bisa membantu pengusaha Sumut. Baik Plt Gubsu Gatot Pudjo Nugroho maupun Wali Kota Medan Rahudman Harahap punya harapan yang sama. Intinya dengan adanya perwakilan China di Medan atau yang akrab mereka sebut Tiongkok, setidaknya ikut mendorong berkembangnya usaha kecil di daerah ini. Syafrizal, pengusaha sepatu di Jl. Pelajar Medan, kemarin, menilai kehadiran konsulat tersebut setidaknya bisa mendorong penetrasi pasar UKM lokal bisa bersaing dengan produk China. Artinya strategi dagang China pantas dipelajari. “Jangan kemudian kehadiran konsulat jenderal China di Medan hanya menguntungkan orang China yang ada di sini. Sudahlah mereka menguasai perdagangan dan bisnis, dengan kehadiran konsulat itu malah kemudian hanya mempermudah urusan warga keturunan China yang ada di Medan,” katanya. Menurut dia, setidaknya Konjend China yang ada di Medan juga memperhatikan bagaimana agar potensi usaha kecil yang ada di daerah ini bisa meramaikan pasar internasional. “Artinya mau bersama-sama. Karena kalau saya melihat, mungkin kehadiran Konjend itu

di luar negeri memiliki peran sebagai ujung tombak dan kunci penetrasi pasar melalui fungsi diplomasi perdagangan, fungsi pemasaran dan promosi, serta fungsi pengembangan citra,” papar dia. Dalam melaksanakan fungsi tersebut, dia menyatakan, perwakilan perdagangan harus melakukan market intelligence dan mencari prospek pasar baru, menjalin networking dengan pelaku usaha, memahami culture buyers, dan mengubah persepsi mengenai Indonesia, termasuk isu baru seperti lingkungan. Selain itu, Mari menyatakan, perwakilan perdagangan juga harus memiliki jiwa kewirausahaan sehingga dapat membantu dunia usaha menawarkan produk Indonesia di negara mitra. Berdasarkan Surat Keputusan Mendag tanggal 23 Maret 2011 dan Surat Keputusan Menteri Luar Negeri 24 Agustus 2011 sebanyak 18 orang pejabat Kementerian Perdagangan diangkat menjadi Atdag dan Kepala/Wakil Kepala ITPC. Mereka adalah Ni Made Ayu Marthini (Atdag Washington DC, AS), Lulu Husein (Atdag Riyadh, Saudi Arabia), Iriana Trimurty Ryacudu (Atdag Copenhagen, Denmark), R. Sulistya Widayanta (Atdag Ottawa, Kanada), Syamsul Bahri Siregar (Atdag Jenewa, Swiss), Vivianto Tampubolon (Atdag Manila, Filipina), Daniel A. Mewengkang (Atdag Madrid, Spanyol).

Waspada/Armin Nasution

MAINAN anak made in China pun menguasai pasar di Medan. Seorang ibu terlihat sedang tawar menawar dengan pedagang mainan di Pasar Petisan Medan, kemarin. Tidak saja sekadar mempermudah pebisnis besar dan warga keturunan China yang ada di Medan. Namun juga menjangkau usaha kecil agar

setidaknya tetap bisa mengakses pasar yang mampu menampung produk mereka dengan dukungan konsulat tersebut. ● Armin Nasution

minyak curah Rp9.000 per kg. Begitu pula gula pasir, saat ini bertahan dengan harga Rp11.000 per kg sedangkan sebelumnya hanya Rp10.000 per kg. Kacang tanah sepertinya ikut-ikutan bertahan di posisi Rp16.000 per kg, padahal sebelumnya harga kacang tanah Rp14.000 per kg. Berbeda dengan harga daging sapi. Pasca lima hari lebaran harga daging sudah kembali normal. Menurut pedagang daging sapi di Pasar Sentral Ismo, 42, harga daging saat ini kembali seperti harga biasanya yakni Rp70.000 per kg. Sedangkan saat menjelang lebaran harga daging sapi mencapai Rp85.000 per kg. Lanjut Ismo kestabilan harga daging dipengaruhi oleh cukupnya pasokan daging dan pembeli tidak memburu daging untuk dikonsumsi setiap hari. Namun, keluhan atas ketidaknormalan harga sembako itu datang dari kalangan ibu rumah tangga. Ibu rumah tangga merupakan makhluk yang paling resah akibat melonjaknya harga-harga kebutuhan pokok.

Merlin, 37 misalnya, ibu tiga orang anak ini mengeluhkan harga bahan pokok yang naik turun. Dia harus mengatur ulang pengeluaran untuk belanja sehari-harinya. “Pusing saya dek, harga-harga pada naik. Entah kapan turunnya. Belanja bawa uang seratus ribu yang dapet segini doang (sedikit),” keluh Merlin. Tidak hanya Merlin, salah seorang pengusaha rumah makan pun ikut dibikin pusing. Pasalnya mereka bingung memilih menaikkan harga atau tidak. Jika harga dinaikkan ia khawatir pelanggan akan lari, bila tidak maka ia rugi. “Kalau pembeli ramai ya nggak masalah harga nasi tetap, belakangan ini pembeli sepi. Ditambah lagi harga sembako naik, “ terang Adi pengusaha rumah makan di Pasar III Krakatau. Jadi, harga keperluan pokok di pasaran yang naik-turun bahkan cenderung naik sehingga menyebabkan ibu -ibu rumah tangga mengeluh lantaran langsung terkena imbasnya, tanggung jawab siapakah ini? (cag)

XL Buka Pre-Order BlackBerry Bold 9900 Smartphone Smartphone generasi baru terus bermunculan di pasar seiring dengan kebutuhan masyarakat atas ponsel pintar yang multiguna. Salah satunya adalah BlackBerry Bold 9900 Smartphone. Untuk memenuhi harapan pelanggan dan masyarakat untuk bisa segera memiliki ponsel pintar tersebut, PT XL Axiata Tbk (XL) telah membuka sistem pemesanan on-line (preorder) untuk pembelian BlackBerry Bold 9900 Smartphone. sejak 26 Agustus hingga 16 September 2011 melalui Dengan demikian, XL menjadi operator pertama di Indonesia yang membuka program pre-order ini. Direktur Marketing XL, Joy Wahjudi mengatakan: “Pre-order yang kami buka ini sekaligus menunjukkan komitmen XL untuk selalu menjadi yang terdepan dalam merespon kebutuhan pelanggan dan masyarakat atas trend yang berkembang dalam teknologi seluler. Tidak lupa, XL juga menyiapkan berbagai keuntungan untuk setiap pelanggan yang melakukan pre-order.” Joy melanjutkan, Berbagai keuntungan akan didapat antara lain gratis BlackBerry Paket Spesial dari XL ,serta gratis voucher asesoris untuk 500 pemesan pertama (first come first serve), serta cicilan nol persen bila pembayaran dilakukan lewat bank yang bekerja sama dalam program ini. Keuntungan lainnya yang didapat berupa kesempatan mengikuti undian berhadiah dan mendapatkan jalur antrian yang lebih cepat. XL juga akan memberikan kejutan paket special BlackBerry service yang merupakan bundling dengan BlackBerry Bold 9900 bagi pelanggan pre order maupun yang akan membeli pada saat peluncuran smartphone dalam waktu dekat ini Bagi pelanggan dan masyarakat yang akan melakukan pre-order, caranya cukup mudah, yaitu dengan mengisi formulir pendaftaran yang ada di website Pre-order yang ditawarkan oleh pihak XL ini terbuka untuk umum, sehingga siapapun yang berminat dapat berpartisipasi. Untuk penyerahan handset BlackBerry Bold 9900 Smartphone akan diinformasikan lebih lanjut melalui email konfirmasi khusus pre-order. Untuk penyediaan handheld terbaru BlackBerry Bold 9900 Smartphone bagi pelanggan, XL bekerjasama dengan distributor TAM serta didukung sepenuhnya oleh RIM (Research In Motion). Dengan handheld terbaru ini, pelanggan akan dimanjakan dengan berbagai fitur yang ada yaitu keyboard QWERTY, Touch-sensitive controls, trackpad optik, kamera 5 megapixel dengan perekam video HD, flash, dan image stabilization, kapasitas 4GB, 768MB of RAM, dan dioperasikan dengan BlackBerry OS 7 Hingga saat ini, jumlah pelanggan XL BlackBerry telah mencapai lebih dari 1,3 juta pelanggan. Dan untuk menjamin kenyamanan dan kualitas layanan, saat ini XL juga telah meningkatkan besaran kapasitas bandwidth BlackBerry secara langsung ke RIM sebesar 2 Gbps, melalui dua penyedia layanan infrastruktur yang berbeda, sehingga menjamin jaringan XL untuk semakin handal. Hal ini menjadikan XL sebagai satu-satunya operator di Indonesia yang terkoneksi ke Research in Motion (RIM) dengan dual carrier partner, serta menjadi yang terdepan dalam layanan BlackBerry di Indonesia. Layanan XL BlackBerry juga didukung oleh 24.971 BTS (2G/3G) per akhir Juni 2011. Sementara itu, untuk mendukung pelayanan terbaik bagi pelanggan XL BlackBerry, hingga kini telah tersedia 24 pusat layanan XL BlackBerry yakni XL Xperience Land di 14 kota, antara lain di Jakarta, Surabaya, Bandung, Semarang, Yogyakarta, Makassar, Denpasar, Medan, Pekanbaru, Lampung, Pelembang, dan Jambi.

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive : Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 318i, Thn. 91. Wrn hitam, BK Asli Medan. AC, TP, VR 17”, PS, Mulus terawat, hub. 0853 7303 8068 BMW 320i Limited Edition Thn ‘95 Biru Met, Sgt mewah, Mesin sehat, Asli Medan, Orisinil, Hrg 63 Jt/nego Hub. (061) 6967.9753


M e r e k D a i h a t s u Te r i o s T X Adventure Thn 2009, Warna Hitam Hub. 0852.9643.2710 DAIHATSU Taft GT 2003, BK Mdn, AC Dingin, TP, VR, BR, Hitam met, Body mulus, mesin sehat, Gardan senyap, tidak kecewa dijamin!. Hub. 0877 6812 5571


Xenia DP mulai 14Jtan, Terios DP 23Jtan Pick Up DP 7 Jt-an & Luxio, Minibus, Sirion ada. Segera Hub. IQBAL 0813 6100 7907 “Ready Stock”

DAIHATSU Grand Max D Thn. 2008. AC, Tape, VR, PS, CL, Jok kulit, Biru met BK Mdn Rp. 83 Jt. Hub. 9132 7433 DAIHATSU PAKET RINGAN

- Xenia Li............................DP 15 Jt-an/100% - Gran Max Pick Up.............DP 10 Jt-an/Baru Hub. TEDDY CAPELLA 0812 6325 656 / 7788 4663

DAIHATSU Grand Max PU 2009 Hitam. 1,5 Hub. 0812 63763619 TP.

5 CM 6 CM

Rp. 65.000 Rp. 78.000



HONDA CRV A/T Thn. 2003 Coklat met BK Mdn Rp. 145Jt Nego. Hub. 7786 3981 HONDA MAESTRO INJECTION THN ‘92 Manual, Wrn Merah Met, Asli Medan, Mbl ctk, Rp. 45 Jt/ B.U KEMBAR PONSEL Jl. SM. Raja No. 200 (depan UISU) 0857.6097.8888 / 785.1402

TOYOTA Innova V Matic Bensin Thn. 05 Hitam met, BK Mdn Rp. 160Jt. Nego. Hub. 0852 7538 3218 TOYOTA Kijang LX 1.8 Bensin Thn. 2004 AC, Tape, VR, PS, CL, jok kulit, silver met, plat BM, Rp. 112Jt. . Hub. 0812 6594 2789 TOYOTA BARU


PURBA : 0813 9736 0333

TOYOTA Avanza G Thn 2006 Biru Metalik, BK Medan, Harga Rp. 125 Jt Hub. (061) 6648.5682



READY STOCK, PROSES CEPAT AVANZA, YARIS, INNOVA 0813.8513.9900 (061) 7500.5003


Toyota Soluna Thn 2001, W. Hijau Met, Lengkap, Balik DP 20 Jt, 34x2.301.000 Hub. 0812.6500.505, TP

7 CM 8 CM

Rp. 91.000 Rp. 104.000

TOYOTA Avanza G Over Kredit, Silver Ex dokter Thn 2011, Spt baru, Jarang dipakai, Sudah 8 X bayar kredit 3 thn, Sisa 28x Rp. 4.691.000 Hub. 0812.6477.7088, Balik DP 60 Jt


Ready All Type, Bunga Terkecil, Avanza, Innova, Fortuner Data Dijemput. PURBA Hub. 0852 7068 6991

TOYOTA FORTUNER DIESEL THN ‘08 Bln 12, New, Manual, W. Hitam Metalik, Model baru, Kayu, Velg racing, Km., Mbl ctk sekali, Rp. 323 Jt Kembar Ponsel jl. SM. Raja No. 200 (depan UISU) 0812.6038.5555 - 785.1402


BK 1717 II, Warna Hijau Metalik, Mobil rawat, Harga 190 Jt/bisa nego, Jl. Mariendal I Psr. 3 Hub. 0819.3324.3785


Bensin Thn 2001, Model sudah 2004, Warna Biru, AC double blower, Elektrik miror, Power window, Cat & Interior, Rapi, Velg recing, Plat BB, Harga 98 Jt HP. 0815.313.6101 Flexi (061) 7740.2356


Warna Hijau Metalik Perawatan Baik Hub. 0812.6011.7284 NISSAN LIVINA XR M/T Thn. 2008. Biru met, BK Rp. 130Jt Net. Hub. 0812 6477 3715

Xenia, Kijang, LGX, PIcanto, Kuda, Panther Royal/ Hi Grade, TP (No. Agen) Serius Hub/ SMS: 0831.9965.6829


TOYOTA Corolla Twincam 1.6 Thn ‘88 BK Mdn, Silver, Lengkap, Sangat mulus sekali, Ban baru, Tinggal pakai Jl. Jermal IV Ujung No. 84 Medan Denai HP. 0811.637.063

DAIHATSU Hiline GTL 4x4 Jeep, Th. 02, BK Asli Hitam, AC, TP, BR, 31. H. 132Jt. Hub. 0853 7377 3999, No sms.

TOYOTA Kijang Kapsul SGX New Thn 2003, 1.8 Efi Bensin, Tangan pertama, BK Mdn, AC double, Tape, CD, DVD, TV, PS, CL, Km sedikit mulus, Original, B.U Hub HP. 0812.6021.2106 Mdn

Grand Livina, March, Juke, New XTrill, Serena, DP Rendah, Cicilan ringan Hub. Rkt 0852.7776.1507


TOYOTA Kijang Commando Thn ‘88 Abu-abu Metalik, 5 Speed, Pelak Racing, AC, Tape, Rp. 39 Jt/nego Hub. 0812.6344.5757, TP


DAIHATSU Taft GT 4x4 Thn ‘88 Hitam, Kondisi mulus, Lengkap, AC, Tape, Pelak Baru, Rp. 49 Jt/nego Hub. 0812.6344.5757, TP

TOYOTA Kijang Grend Extra Thn ‘93, 1.5 Shock, Bener² sehat dan terawat Warna Abu-abu Metalik, Jok kulit, H. 71 Jt, BK asli Medan Hub. 0813.6126.5117

HONDA TERMURAH Ready: Jazz, CRV, FREED, CITY Honda IDK HP. 0852 6134 7557

TOYOTA Kijang Kapsul Model LGX New Bensin 1.8 Thn 2002 Hitam Met, Asli Medan, Sgt orisinil, VR, BR, PS, PW, CL, Rmt, E. Miror, AC double, Full sound system, Pake TV, Hrg 128 Jt/nego Hub. 0821.6811.9388


BK Medan, Terawat, Siap pakai 0852.6134.0601

SUZUKI Escudo 2.0 A/ T. Silver, Thn. 03, Km. 50rb. Jarang pakai, Plat B, atas nama sendiri. Hrg. 115Jt. Hub. 0816 314 5311

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli TI-HA TI apabila anda ingin produk anda, dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih

SUZUKI Carry Alexander Thn ‘86 W. Merah, Pintu belakang, M. sehat, PR Medan, Pajak hidup Hub. 0812.6496.881


1 (satu) buah BPKB asli, BK 2950 GK, Thn 2002, Sepeda motor Yamaha A/n. Darsoni, Jl. Paku Gg. Famili Lk. III Kel. Tanah 600 Medan


BPKB No. F. 1915035 B. No. Rangka: MH33VC0028J071793 No. mesin: 30C071643 An. SUTOPO No. Pol. BB 4795 RE




TV LCD 42” P. Sonic = 6.5Jt. 32”LCD/Samsung =2,8 jt 42” LCD Samsung=4,5Jt,34 Sony = 2 Jt, 29” Flat Baru LG =2 Jt, 29” Bekas 900rb - 1,7 Jt. 14 - 21=300rb - 650rb, 17” LCD Monitor 1Jt, 22”=1,5jt. PS1=400rb, PS 2=800rb, DVD 200rb, Portable = 700rb. Ampli Gitar=700rb, Sansui Technics-SU 7600 TV M = 600rb


Handicam Sony Hi-8=1Jt, Mini DV=2Jt, DVD/ HDD=3Jt, Camera 5 Mp - 12 Mp 500rb - 1,2Jt.. LCD Projector Optima Toshiba @ 3 Jt. Fax: 600rb



Cat mulus & Interior rapi, AC, Tape Velg Racing, Harga 40 Jt HP: (061) 7740.2356



Tas kulit berwarna Coklat di sekitar Jl. Marelan Raya - Jl. Karya berisi STNK, SIM C, Kartu Mahasiswa, A/n. INDRI LESTARI Hub. 0853.7074.0140 - 0813.9729.1430, Tidak akan dituntut dan diberikan hadiah sepantasnya



HUB: 0813.9615.0088


KHUSUS REPARASI /SERVICE Kulkas, M. Cuci, Sanyo Air, Dispenser, Bongkar Pasang AC Hub. PRATAMA ELECTRIC GARANSI Telp. 7343789


Jual AC Baru/Bekas, 1/2, 3/4, 1,1 1/2, 2Pk1,3Jt-2 Jt. AC Window 1 Pk = 800rb, Kulkas 1 Pt - 2 Pt- 600rb- 1,2Jt. Freezer Soces. Box=2Jt. M. Cuci 1 Tb- 2 Tb= 600rb- 1,2 Jt. M. Cuci Baru= 1,2 Jt (2 tb 9 kg). Genset 3000 w. 2Jt. 8.000w= 4jt, Pompa Air. Sanyo - P. Cliner


Hub. 4517509 - 69677449 Jl. Sekip 67 A (Jual/Beli/T.T. Baru/Bekas)




BPKB No. F. 1914987 B. No. Ragka MH3570048K392661 No. Mesin: 157393056 No. Pol. BB 4745 RE. An. Zainul Rosyid Nasution.


ELEKTRONIK 1 Pk + Pipa + Kabel Rp. 1.990.000 100% Baru / Garansi 2 Tahun Specialis AC/Cuci AC 25.000/ Isi Obat/Bongkar Pasang NB: Tukarkan AC Rusak anda dan AC Baru kami Hub. TOKO SUMATERA JAYA Jl. Gatot Subroto 401 Telp. 6963 8880 / 77555550 / 0614143670

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda





Warna Hitam, Mobil, Siap pakai 1 Tangan dari baru Hub. 0813.6089.4043



Hilang BPKB asli No. 1515114, BK 1346 IA, A/n. Salvendran, SE alamat Jl. Ibus Raya No. 12 Kel. Petisah Tengah Medan

TV LED, LCD, Kulkas, M. Cuci, Handycam DSLR, Laptop, LCD, Projector, PS 1, 2, & 3 H. Theater, Sound System, dll. Hub. CV. MARKET. Tel. 7632 4682 - 0812 6539 3000, S. Budi Tj. Sari No. 424 B, Psr IV dkt BNI


BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


1 Buah BPKB dan STNK Sp. Motor BK 6520 GV, A/n. Magdalena Sirait, alamat Jl. Turi No. 64 Medan, No. Rangka: MH8FD110X3J205359 Hub. 0812.6356.828


Carry PU 1.5 FD, Rp. 8 Jt-an Angs. 2.672.000,APV Arena Rp. 11 Jt-an Angs. 4.073.000,Splash GL Rp. 13 Jt-an Angs. 4.069.000,Hub: 0812 654 0809 / 77722121






Selasa, 13 September 2011


WC 0812 642 71725






0812 60444275




0813 6147 0812 Jl. Gatot Subroto Medan Ada Garansi

Ingin Promosikan Produk Anda



Media yang Tepat untuk Iklan Anda




Selasa 13 September 2011

07.00 Larva 07.15 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14.30 Cek & Ricek 15.30 Idolaku 16.45 Larva 17.00 Seputar Indonesia 17.30 Silet 18.15 Mega Sinetron Putri Yang Ditukar 20.30 Mega Sinetron : Anugerah 22.30 Mega Sinema


07:00 Inbox 09:00 Liputan 6 Terkini 09:03 Halo Selebriti 10.00 SCTV FTV 11:00 SL Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12.30 SCTV FTV 14:00 SL Liputan 6 Terkini 14:30 Status Selebriti 15.00 Uya Emang Kuya 16.00 Cinta Juga Kuya 17.00 Liputan 6 Petang 17.00 Islam KTP 18.30 Kupinang Kau Dnegan Bismillah 20.00 Perempuan Pembawa Berkah 21.30 Calon Bini 22.30 SCTV FTV UTama

07:00 Tom & Jerry 07:30 Upin & Ipin 09:00 Layar Spesial 10:30 Diantara Kita 11:00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 14:30 Cerita Siang 15.30 Lintas Petang 16:00 Animasi Spesial 17:00 Zona Juara 18:00 Animasi Spesial : Shaun The Sheep 19.00 Animasi Spesial :Oscar Oasis 20.00 Sampeyan Muslim? 21:00 Ranum 22.00 Cerita Malam 01:30 Lintas Malam

07.00 Curious George 07.30 Dokumenter 09.30 SInema Pagi 11.30 Topik Siang 12.00 Klik! 13.00 Mantap (live) 14.00 Bukan Rayuan Gombal 15.00 Topik Petang 18.30 Super Deal 2 Milyar 20.00 Kuis Siapa Paling Berani 21.00 Penghuni Terakhir Season 22.00 Ekspedisi Merah 23.00 World Most Amazing Video 00.00 Topik Malam

07:00 KISS Pagi 08:00 FTV Pagi 09:30 FTV Drama: 11:30 Patroli 12:00 Drama Asia (Korea): The Great Queen Seondeok 13:30 Drama Asia (Korea) 14:30 KISS Ramadhan 15:00 Fokus 16:00 Drama Asia (Korea) 17:00 Arti Sahabat 18:00 Khadijah dan Khalifah 21:00 2 Dewi 22:00 Mega Asia:

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.05 Eleven Show 11.30 Metro Siang 13.05 Archipelago 13.30 Jakarta Jakarta 14.30 Metro Sore 15.05 Bisnis Hari Ini 16.30 Metro Realitas 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Metro 10 21.05 Top Nine News 22.05 Today’s Dialogue 22:30 Auto Zone 23.05 Newsmaker 23.30 Metro Sports

B7 06.30 Apa Kabar Indonesia 09.30 Kabar Pasar Pagi 10.00 Coffe Break 11.30 Kabar Keadilan 12.00 Kabar Siang 13.30 Mutumanikam 14.00 Yang Terlupakan 14:30 Jendela Usaha 15.00 Kabar Pasar 16.00 Kabar & Wanita 16.30 Tahukah Anda 17.00 Kabar Petang 19.30 Jakarta Lawyers’Club 21.00 Apa Kabar Indonesia Malam 22.30 Highlight Powercross 23.00 Motoriderz 23.30 Kabar Arena

07.30 Rangking 1 08.30 Dering s 10.00 Fun Games 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Kamu Pasti Bisa 14.30 Keluarga Minus 15.30 Reportase Sore 16.00 Bukan Puasa Biasa 16.30 Pintu Surga 17.30 Jika Aku Menjadi 19.00 Big Brother 20.00 Super Trap 21.00 Bioskop Indonesia 23.00 Bioskop TRANS TV 01.00 Reportase Malam

08.00 Naruto 09.30 Obsesi 10.30 Abdel & Temon 11.30 Hot Spot 12.00 Awas Ada Sule 13.00 Main Kata 14.00 Petualangan Panji 14.30 Deny Manusia Ikan 15.00 Handmade 15.30 Berita Global 16.00 Top Banget 16.30 Fokus Selebriti 17.00 Penguin Of The Madagascar 17.30 Spongebob 19:30 Awas Ada Sule 20.00 Big Movies 23.00 Big Movies

07:30 Selebrita Pagi 08:30 Rahasia Sunnah 09:30 Ups Salah 11:00 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-citaku 14:30 Anak Emas 15:30 Asal Usul Fauna 16:30 Redaksi Sore 17:30 Orang Pinggiran 18:00 Beritawa 18:30 Hitam Putih 19:30 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Berburu 00:00 Jejak - Jejak Misteri 00:30 Sport7 Malam 01:00 Redaksi Malam **m31/G

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Keira Knightley/

Keira Knightley akan berbicara dalam aksen orang Inggris manakala dia memerankan karakter klasik Rusia, Anna Karenina, kata sang aktris saat berada di Festival Film Toronto. Aktris Inggris berada di Toronto untuk mempromosikan filmnya “A Dangerous Method” di mana dia juga memerankan karakter Rusia di film ini, berkata pada Reuters, bahwa untuk peran terbesarnya dalam Anna Karenina, sutradara Joe Wright telah menyuruhnya berbicara dalam logat orang Inggris ketimbang menggunakan aksen Rusia. “Logatnya akan beraksen orang Inggris. Selalu amat pelik manakala Anda melakukan sesuatu yang sangat berarti dalam bahasa lain. Karena anda seperti aksen yang seharusnya, mestikah anda menggunakannya? Jadi, jika anda memakai aksen Rusia, mengapa tak sekalian saja ngomong Bahasa Rusia? Ini film berbahasa Inggris lho. Jadinya kami mengambil keputusan bahwa film ini memakai aksen orang Inggris,” katanya. Film diadopsi dari novel karya Leo

Tolstoy disebut karya salah satu karya sastra terbesar sepanjang masa, akan memulai syuting pekan ini. Kasting sudah diselesaikan dalam tiga pekan, kata Knightley. “Kini saya sedang mempelajari buku, untuk selama dua bulan, tiga bulan, meneliti melaluinya, mencoba memilahnya, melukiskannya. Dan kemudian setumpuk buku sejarah era itu di Rusia, yang menakjubkan,” kata aktris berusia 26 tahun tersebut. Knightley membintangi film arahan David Cronenberg, A Dangerous Method yang tayang perdana di Toronto, Sabtu pekan lalu. Di film ini dia memerankan perempuan Rusia bernama Sabina Spielrein menjadi pasien psikoanalis Carl Jung dan Sigmund Freud. Di film itu Knightley berbicara dalam aksen Rusia. Kini dia akan memerankan tokoh kelas atas Rusia di akhir abad 19, Anna Karenina, juga pernah diperankan pendahulunya, aktris Greta Garbo. “Peran ini sangat menantang, amat sangat mengasyikan...semoga semuanya lancar,” kata Knightley. (ant)

Andy Whitfield/

Keira Knightley Perankan Anna Karenina

Pemeran Spartacus Tutup Usia AKTOR Andy Whitfield, mantan bintang serial televisi Spartacus: Blood and Sand, meninggal dunia, Minggu, karena kanker lymphoma di Sydney, Australia, pada usia 39, demikian wali mendiang seperti dikutip Reuters. Whitfield memerankan sosok hero tak terkalahkan Spartacus di jaringan Starz itu yang diluncurkan tahun lalu. Sang aktor juga membintangi film produksi tahun 2010 The Clinic dan Gabriel diproduksi pada 2007 harus menyingkir



LOWONGAN BLUE BIRD Taksi, mmbthkn Pngmudi Lk/ Pr, usia 23-50thn, Tdk ada tato/bekas tato, SIM & KTP, Fas. komisi, bonus, insentif, GPS, Mess, Mobil baru, dll Sgr dtgn/ krm lmr ke Jl. Kapt. Muslim No. 92 Telp. (061) 7637.5840



Segera Wanita Tamatan SD, SMP, SMU. Mjd: Jaga anak, Prwt orang sakit Gaji Rp. 750-1,5Jt/bln. Hub. Cahaya. G. Subroto/Jl. Ayahanda 44 Mdn. 0812 6514 3676

HARGA Rp. 35.000,-




U/ Bkrj di Maskapai/ Travel, Min. Lls SMU/ sdrj Hub. Diklat Airlines Hub. Jl. KH. Wahid Hasyim 92 Ph. 7623.5314 - 9158.3487 4533.875 - 456.9269 Medan

Yang Berpengalaman Untuk ditempatkan di Bali Hub. Bpk. M. Ali Imran 0813.9676.6924


Beberapa orang tenaga ditempatkan: 1. TENAGA PERCETAKAN 2. TENAGA PASANG GYPSUM 3. TENAGA SERVICE AC Syarat: Berpengalaman dibidangnya Lamaran diantar langsung ke:


Jl. Kapt. Muslim No. 79 Medan Telp. (061) 845.1812 Lamaran paling lambat 7 hari setelah iklan terbit



Dicari bebarapa tukang las, berpengalaman di bidang: - 1 Pembuatan pintu Plat besi - 2 pembuatan pintu Folding gate - 3 pembuatan pintu Press - 4 las struktur besi Lamaran selambatnya 10 hari, diantarkan ke Harian Waspada dengan Kode “LAS”


10 ORANG SALESMAN/ GIRL Untuk memasarkan buku-buku Refrensi dari luar dan dalam negeri Income bisa 10 Juta/ bulan Pendidikan SLTA uang transport 500.000/bulan Diutamakan yang punya kendaraan sendiri Juga 1 orang Sekretaris, dengan syarat dapat mengoperasikan computer Wawancara/ Seleksi hari Rabu Sabtu Tgl. 14-17 September 2011. Jam 11-12 Wib Yang berminat bawa CV ke: PT. LENTERA ABADI Jl. Sei Tuan No. 3 Medan

Ingin Promosikan Produk Anda Harian


BARU BUKA Butuh tenaga kerja P/W usia (17-35 thn) untuk di posisi kan di perusahaan, swasta cab. Medan, syarat: - Pendidikan min. SMU/ sederajat - Bawa KTP + Guntingan iklan ini untuk interview Penghasilan: 1.800.000/bln HUB: IBU HELENA/ BPK NASIBTA HP: 0812.6388.5458 / 0853.6240.6323 Alamat kantor: Jl. Gatot Subroto (Komplek Merbau Mas No. 12A) belakang Carrefour Medan NB: Terbuka bagi mahasiswa/i, interview pkl. 10.00 s/d 16.00 Wib


DIBUTUHKAN SEGERA Yayasan yang sedang berkembang, bergerak dibidang pendidikan dan Rumah Sakit, membutuhkan segera beberapa orang sebagai: 1. CHIEF ACCOUNTING (a, b, c, h, i, j, k, l) 2. STAFF ACCOUNTING (a, b, c, i, k, l) 3. MARKETING (a, b, g, h, l, m) 4. PEMBELIAN (a, b, e, h, j, k, l) 5. APOTEKER (a, d, k) 6. SUPERVISOR RUMAH SAKIT (a, b, f, h, l)

Dengan syarat-syarat sbb: a. Wanita b. Pria c. Pendidikan min. D3/ S1 Ekonomi d. Pendidikan min. S1 Apoteker e. Pendidikan min. D3/ S1 semua jurusan f. Pendidikan min. D3 Perawat g. Pendidikan min. SMA h. Pengalaman kerja min. 1 tahun i. Mengerti sistem akuntansi j. Diutamakan dapat menyusun laporan keuangan k. Dapat mengoperasikan komputer Word, Excel, dll l. Jujur, bertanggung jawab dan loyal terhadap perusahaan m. Mempunyai sepeda motor Surat lamaran lengkap dan nomor telepon yang dapat dihubungi dialamatkan ke: Harian WASPADA kode: “RUMAH SAKIT” paling lambat 2 (dua) minggu setelah iklan ini terbit




Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik


: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH DIJUAL Jl. Rahmadsyah, P. 10,30m, L: 8,64m, Sertifikat, Dapur, R. Tamu, Grasi, Bertingkat, Listrik, PDAM, 5 Kamar tidur, Cocok buat kost²an, Harga 200 Jt/nego Hub. 0813.6238.6998


Comp. Tasbih Blok G, LT. 10x18m, SHM, 5 KM, 3 Km. Mandi, Nego 0812.6425.0283


Rumah dan Tanah LT. 10,15x45m, SHM, Pinggir jalan, Lokasi dekat Unimed di Jl. Durung No. 119 Medan Hub. Ibu Sri, Srg HP. 0813.9684.5234, TP


Uk. Tanah 14x16m, Sertifikat Notaris Alamat Jl. M. Nawi Hrp/ Seksama G g . S u k a N o . 1 2 / 2 3 , Ta n p a perantara Hub. 0852.6157.4170


Jual cepat sekelilingnya, Sgt bernuansa alam, Hrg 250 Jt/nego Jl. Eka Rasmi msk Eka Mulya (Rmh Ujung) samping tanah Bank Sumut Hub. 0853.7376.0213


Ruko 1,5 Tkt, Uk. 5x36, 5 Km. Tdr, Air PAM, Full keramik, Lokasi depan Psr. Inpres di Jl. AR. Hakim No. 232 Medan Hub. 0813.7137.0503 0852.6117.1152 Harga Rp. 1,3 M (Nego)


Luas ±3 Rante di Desa Kp. Banten Bt. Kuis diatasnya terdapat 4 rumah kontrakan tempat strategis dekat kantor Camat (SK Camat), Harga 350 Jt/nego Hub. 0813.9624.2300 - 734.8155 (TP)


Jl. Pertiwi Baru No. 36, SHM, 10x35, Rumah permanen, 3 Kmr tidur, 2 Kamar mandi, PAM, Sumur, PLN, Telkom, Ada Garasi U/ 2 mobil Hub. 0813.7031.3704 Harga bisa nego






KORG PA.800, PA.500, KN.2400 KN.6500, SOUND SYSTEM HUB. 0812.6368.4777 - 0853.6231.4777

Uk. 15x30m, Surat Hak Milik Jl. Flamboyan Gg. Musyawarah HP. 0853.6082.8822 - (061) 786.0930

MENERIMA Pelatihan Budidaya Jamur Tiram dan Jual bibit jamur Hub. 0852.7570.9993

Media yang Tepat untuk Iklan Anda

Ingin Promosikan Produk Anda Harian


Kampus Akademi Akuntansi YPK Jl. Sakti Lubis/ Pegawai No. 8 Telp. (061) 787.9585 Sp. Limun Medan

Setiap hari kerja: 08.00-17.00 Wib Perkuliahan Pagi/ Sore dimulai Tanggal 19 September 2011






Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188




Media yang Tepat untuk Iklan Anda



Dari Pelabuhan Ratu Banten Selatan Ijin Kejaksaan: No. B 271/DSP.5/07/2011 Solusi Penyembuhan Anda Asli, Alami, Paten & Permanen

Alat Vital Pria & Wanita Spektakuler KHUSUS PRIA: MENAMBAH UKURAN YANG BISA DIPILIH - Panjang 14, 15, 16, 17, 18, 19, 20 Cm - Besar 3.5, 4.5, 5.5, 6 dm - Memperkeras dan Tahan Lama - Ejakulasi Dini, Mani Encer - Impotensi, Lemah Syahwat - Diabetes, Kencing Manis, dll.

KHUSUS KEBHATINAN: - Cepat dapat Jodoh, Buka Aura, Buang Sial, Pasang Susuk, Pemanis Usaha, Pemanis Wajah, Menjauhkan Gangguan Ghaib Juga Menangani Penyakit: Asam Urat, Reumatik, Totok Syaraf, Darah Tinggi/rendah, Kolesterol Tinggi, Stroke, Lumpuh, Hilang Ingatan (Amnesia) Asam Lambung Akut, dll Alamat: Jl. Jamin Ginting Simp. Pos Pasar VII (100M dari Lampu Merah Simp. Pos Ke Arah Citra Garden)

HP: 0821 6323 2899 0857 6100 2317






Dengan 3 Konsentrasi: 1. Komputer Akuntansi 2. Akuntansi Perpajakan 3. Akuntansi Perkantoran Tempat pendaftaran:








Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866


Door to Door Domestik & Int’l. SRT-MOVING Tel. (061) 7711.8811 Jl. B. Katamso 557 Medan - Ritra Group

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188







Tukang masak utk ditempatkan di Restoran di Silalahi Pinggiran Danau Toba Kab. Dairi Hub. 0821.6844.7333 - 0812.6512.012

bisa kerja bareng dengan Andy dalam ‘Spartacus’ dan tahu bahwa orang yang berperan sebagai juara di layar kaca adalah juga juara di kehidupan pribadinya,” kata Albrecht. “Andy adalah inspirasi untuk kita semua saat dia menghadapi pertarungan paling personalnya dengan keberanian, kekuatan dan keanggunan.” Whitfield dilahirkan di Wales dan kemudian pindah ke Australia. Karena sakitnya itu, perannya dalam Spartacus digantikan aktor Australia, Liam McIntyre. (ant)


PERSAK 50 KG HUB HP: 0813.9615.0088

Tenaga kerja wanita usia 17 - 40 thn dengan posisi sebagai: BABY SITTER, PRWT JOMPO, PRWT PRIBADI, PRT. Syarat: FC. Ijazah, KTP, KK, Gaji bersih 700 Rb s/d 1.300 rb/ bln + U. cuti + Bonus + THR. Makan, Asrama, dijemput loket gratis. HUB: YYS. MAREL MANDIRI Jl. Cengkeh Raya No. 18C Medan HP. 0813.6199.9211 - 0813.9664.5507


dari perannya dalam Spartacus karena sakit lymphoma. “Di satu pagi yang indah di Sidney, dikelilingi keluarganya, dalam pangkuan istri tercintanya, pahlawan muda nan tampan kami Andy Whitfield kalah dalam pertarungan selama 18 bulan melawan kanker lymphoma,” kata Vashti Whitfield, istrinya, dalam satu pernyataan tertulis. Presiden Starz dan CEO Chris Albrecht mengatakan dia sangat berduka atas meninggalnyaWhitfield. “Kami beruntung







Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat



Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu


Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari














Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA





Berikan Informasi Lengkap Seputar Kerusuhan SARA


edia massa dalam dan luar negeri memberitakan kerusuhan atau bentrok massal di Ambon yang katanya berawal dari kecelakaan lalu lintas berupa tabrakan seorang tukang ojek. Kecelakaan tunggal itu sebenarnya berita kecil saja, apalagi di saat lebaran yang memakan korban jiwa ribuan orang di tanah air malah dianggap wajar saja oleh pemerintah. Pertanyaannya: Mengapa tabrakan tukang ojek saja bisa mencuat dan membakar kemarahan masyarakat di Ambon? Pastilah karena ada yang ditutup-tutupi sehingga memunculkan banyak pendapat, tuduhan dan beragam isu miring di masyarakat, khususnya kota Ambon, sehingga kembali mengusik situasi keberagaman masyarakat di sana. Jika, banyak pihak menuding aparat keamanan khususnya polisi tidak tanggap atau kurang cepat bergerak turun ke lapangan menengahi kerusuhan Ambon, yang pasti awalnya kecil tapi karena polisi lamban bergerak akhirnya meluas, sehingga menimbulkan banyak korban tewas dan luka-luka beserta kerugian moril dan material. Justru itu, aparat keamanan wajib bertanggung jawab. Jangan mengecilkan masalah, apalagi terkait masalah suku, agama, rasial, dan antargolongan (SARA). Pemerintah perlu berhati-hati agar tidak salah jalan. Sebab, jika salah dalam penanganan akibatnya bisa fatal, seperti meletusnya kerusuhan massal di masa lalu. Kita tidak ingin kerusuhan berbau SARA di Ambon menjalar ke daerah lain. Bisa saja maksudnya baik, menutupi atau membuat propaganda positif agar tidak menimbulkan kepanikan di masyarakat. Tapi, yang namanya masalah sepatutnya ditangani dengan cara profesional. Artinya, siapa pun yang terlibat wajib bertanggung jawab. Oleh karena itu polisi perlu segera turun tangan ke tempat kejadian perkara untuk melakukan pengusutan sehingga hasilnya konprehensif. Kelambanan polisi ke TKP membuat massa berkelompok setelah mendengarkan beragam isu miring di masyarakat sehingga memuncak terjadi tindak kriminalitas main hakim sendiri. Andai polisi sigap, kerumunan massa dan aksi massa melakukan balas dendam bisa diatasi segera dengan memberikan penjelasan-penjelasan. Intisari Hemat kita, menuduh media massa melakukan liputan tidak berimbang, bahkan menuding sebagai faktor yang menyulut Perlu hati-hati dalam kerusuhan di Ambon, tentunya tidak benar. menangani kerusuhan Bagaimanapun media massa punya kode jurnalistik sehingga wajib mematuhinya, berbau SARA di Ambon etik memberitakan peristiwa secara berimbang. agar tidak menjalar ke Apalagi terkait bentrok yang melibatkan SARA, media massa sudah tahu apa yang daerah lain harus dilakukannya. Boleh saja Ketua Komisi Pertahanan dan Informasi DPR Mahfudz Siddiq meminta media massa menyajikan berita secara berimbang tanpa dibumbui kalimat-kalimat kontroversial yang dapat memicu meluasnya bentrokan sebagai mengingatkan. Tapi, sesungguhnya faktor penyebabnya bukan karena pemberitaan media massa. Akar masalahnya bisa karena dendam lama dan polisi lambat ke TKP. Perlunya informasi lengkap sangat diperlukan untuk menutup munculnya isu negatif berbau SARA. Sayang informasi lengkap itu pula yang gagal disampaikan pemerintah. Berapa jumlah korban tewas terkena peluru nyasar aparat keamanan masih belum jelas. Ada yang menyatakan satu orang, tiga orang, lima orang. Ada yang menyebut 65 korban luka tembak dll dirawat di RS Alfatah, sedangkan 18 korban lainnya menjalani perawatan medis di RSUD dr Haulussy. Sekalipun media massa mengalami kesulitan untuk mendapatkan informasi yang lengkap dan utuh dari berbagai pihak yang terlibat, termasuk dari polisi dan instansi terkait lainnya, namun secara umum liputan pers masih dalam kategori proporsional. Sebenarnya, konflik antarkelompok masyarakat yang terjadi di Ambon, Minggu (11/9), bisa meletus dan kemudian meluas itu bisa dicegah jika aparat keamanan cepat turun tangan dan pemerintah daerah, provinsi, maupun pusat memberikan keterangan yang lengkap ke masyarakat via media massa (pers). Tidak berusaha menutupi, mulai dari awal kejadian tabrakan tukang ojek dengan siapa korbannya, mengapa terjadi aksi balas dendam dan pemukulan pada korban (tukang ojek), kemudian meledak saat usai pemakaman korban, terjadi pengrusakan dan pembakaran fasilitas umum, bangunan, kendaraan dll. Setelah kerusuhan meluas polisi baru proaktif, turun tangan, malah melakukan tindakan represif sehingga jatuh korban jiwa di pihak masyarakat, rakyat sipil yang seharusnya dihindari. Apalagi senjata dan peluru yang menembus tubuh korban dibeli dari uang rakyat. Tak pelak lagi, berapa jumlah pasti korban yang tewas, luka-,luka pun sampai kini belum terungkap secara transparan. Apalagi kronologis jalan ceritanya sehingga menyulut berbagai isu negatif dan sensitif. Sampai-sampai Presiden Susilo Bambang Yudhoyono memerintahkan para pembantunya untuk segera menuntaskan dan memberi laporan lengkap, jangan setengah-setengah, kepadanya. Kesan kuat dari meletusnya kerusuhan massal di Ambon bukan karena faktor SARA. Murni kecelakaan lalu lintas, tapi karena pemerintah terlambat menanganinya, baru berimbas pada masalah sensitif (SARA).+


Faks 061 4510025


+628216759xxx Membaca berita di media khawatir jadinya bagi kami kami yang mempunyai anakanak remaja apalagi anak kami sudah terlanjur diberikan fasilitas kereta atau sepeda motor untuknya sekolah. Lhawatir kalau anak menjadi ikut-ikutan terlibat dengan geng kereta yang semakin menjadi-jadi di Kota Medan ini. Mohonlah dengan sangat kepada Pimpinan pimpinan di Kota Medan ini agar leboh focus lagi mencarikan jalan keluarnya pak, generasi ini semakin mengerikan akhlaknya, Bapak-bapak kaum cendikiawan, pemuka agama, dan akademisi kaum intelektual tolonglah berikan sumbangan pemikiran agar masalah geng kereta ini bisa diatasi, kalau dibiarkan terus, bagaimana generasi ini kedepannya.? 0812604xxxx Melihat kondisi masyarakat kita semakin hari sepertinya semakin miris saja. Seperti sudah tidak ada lagi saling tenggang rasa, saling hormat menghormati dan saling sayang menyayangi. Di tingkat sekolah anak-anak SD rajin pergi ke Warnet cuma untuk main game perang-perangan yang membiasakan kekerasan. Mereka sepertinya dengan sangat leluasa belajar kekerasan dari media game di internet itu. Perang-perangan yang memuncratkan darah, sudah menjadi sangat biasa bagi anak-anak ingusan tersebut. Mulutnya pun rata-rata sudah sangat kotor-kotor. Kemaluan ayah ibunya disebutnya dengan sangat lancar bahkan ketika dia sedang asik bermain game. Mohon-lah ditertibkan semua ini. Sangat mengerikan. 061912xxxxx Ramadhan baru usai, Lebaran masih tersisa. MAri sama-sama kita pertahankan ketakwaan yang telah kita raih selama Ramadhan. Menjadi manusia yang bertenggangrasa, manusia yang peduli sesaama, manusia yang takut melukai orang lain, mengambil harta yang bukan milik kita. Jika jiwa dan semangat takwa ini bisa sama-sama kita resapi maka negeri ini akan bangkit berdiri menjadi negeri yang makmur baldatun toyyibatun warrabul ghafur. 0812635xxxxx Interpelasi menanyakan kebijakan gubernur? Weleh-weleh, minta THR aja bilang. Pake interpelasi segala macam. Tolonglah wahai para anggotqa dewan jangan gunakan fasilitas negara seperti interpelasi itu sebagai sarana kepentingan perut sendiri. Sarana itu bukan dibuat untuk kepentingan kalian, tapi untuk kepentingan rakyat banyak. Gunakan segala macam fasilitas kekuasaan yang diberikan negara itu untuk rakyat jangan untuk kepentingan sendiri, sebab nanti kalian akan mempertanggungjawabkan semua itu. 0813567xxxxx Lebaran udah berbeda hari, jangan sampai Idul Adha pun beda hari juga. Lihatlah Ikhwanul Muslimin di Mesir sana, mereka terus ditindas oleh pemerintah di sana, tapi soal penetapann Idul Fitri mereka ikut pemerintahnya. Demikian juga PAS di Malaysia, terus menerus beroposisi menentang pemerintahnya, tapi soal penetapan Idul Fitri mereka juga ikut pemerintahnya. Mungkin bagi mereka soal penetapan itu tak perlu dipertentangkan ya.

WASPADA Selasa 13 September 2011

Perubahan Gaya Hidup Oleh Bachtiar Hassan Miraza Menjamurnya restoran atau warung ditengah kota adalah sebuah gambaran terjadinya perubahan gaya hidup yang lebih bersifat praktis dan efisien.


ecara perlahan masyarakat Indonesia, khususnya yang tinggal di perkotaan, telah mengalami perubahan gaya hidup. Perilaku dan cara berpikir ataupun hubungan sosial berubah mengikuti perkembangan keberhasilan (ekonomi) dan pergaulan yang berjalan. Perubahan ini terlihat pada perilaku mereka sehari hari. Namun perubahan itu terlihat jelas saat tiba hari raya, tahun baru, cuti bersama dan libur anak sekolah. Dilihat dari sudut aktifitas ekonomi perubahan yang terjadi cukup signifikan untuk mendorong gerak perekonomian masyarakat. Gaya hidup selalu mendorong kegiatan ekonomi berkembang sejak dari kegiatan produksi sampai kepada kegiatan konsumsi maupun perdagangan. Artinya jika gaya hidup tidak berubah maka perkembangan ekonomi akan berjalan lambat atau mungkin tidak berubah sama sekali. Perubahan gaya hidup menciptakan pertambahan permintaan akan barang dan jasa. Pertambahan permintaan ini mendorong aktifitas ekonomi menjadi lebih hidup dan luas. Perubahan gaya hidup memang dibutuhkan bagi mengembangkan perekonomian. Pihak pengusaha selalu “mengintip” perubahan gaya hidup yang berjalan ditengah masyarakat. Perubahan ini dijadikan peluang usaha baru, baik untuk kegiatan produksi maupun penjualan. Jika perubahan gaya hidup dikaitkan dengan fungsi badan usaha kelihatannya tak ditemukan masalah karena antara kebutuhan perubahan gaya hidup dengan kegiatan usaha berjalan seiring. Pengusaha tetap dapat memenuhi kebutuhan perubahan gaya hidup yang cenderung menambah permintaan akan jumlah barang. Disinilah peluang usaha yang bisa mendatangkan penghasilan bagi pengusaha. Namun berbeda jika perubahan gaya hidup dikaitkan dengan fungsi pemerintah. Disini selalu ditemukan kendala karena pemerintah tidak siap menghadapi perubahan gaya hidup itu. Pertambahan permintaan yang disebabkan oleh perubahan gaya hidup tidak mampu dipenuhi pemerintah. Ini bisa terlihat pada masa masa tertentu seperti lebaran dimana pemerintah tidak siap menampung keinginan masyarakat dalam penyediaan jasa transportasi, infrastruktur, jasa kesehatan, ataupun jasa pelayanan lainnya. Padahal permintaan akan jasa itu mengalami kenaikan. Maka yang timbul adalah rasa ketidak puasan

masyarakat. Ada keterkaitan yang erat antara peradaban dan gaya hidup dengan kebutuhan masyarakat yang gaya hidupnya berubah. Perubahan gaya hidup diartikan sebagai perubahan sikap berpikir dan bertindak dan perubahan mengambil keputusan serta perubahan perilaku seseorang, yang muncul dari kemajuan dan perubahan peradaban, yang biasanya menyangkut pada perubahan pola konsumsi dan keinginan untuk bersikap lebih effisien. Perubahan ini diawali dengan adanya kemajuan peradaban yang membikin seseorang berpikir praktis dan pragmatis, yang didasarkan pada sikap rasional. Bahkan kemajuan peradaban ini bisa mengikis habis perilkaku yang dianutnya selama ini. Disamping itu perubahan gaya hidup juga didorong oleh meningkatnya kesejahteraan (pendapatan) seseorang atas keberhasilannya berkarya. Keberhasilan berkarya menciptakan pendapatan yang bertambah. Meningkatnya pendapatan berarti adanya pertambahan keinginan dan permintaan (needs and demand) akan barang barang ataupun jasa yang selama ini belum menjadi kebutuhannya. Semuanya akan mendinamiskan pasar dimana dunia usaha mendapatkan nikmat (keuntungan) daripadanya. Menjamurnya restoran atau warung ditengah kota adalah sebuah gambaran terjadinya perubahan gaya hidup yang lebih bersifat praktis dan efisien. Ibu rumah tangga tidak merasa perlu memasak karena lebih praktis dan efisien jika membeli makanan jadi di restoran ataupun warung dibandingkan dengan memasak di rumah. Di samping biaya yang lebih besar mereka pun perlu menghemat waktu ditengah kesibukan mereka beraktifitas. Cara berpikir seperti ini menciptakan sikap dan perilaku baru dan meninggalkan sikap dan perilaku yang berlaku selama ini. Saat inipun, melihat kecenderungan yang berjalan, adakalanya hubungan antar anggota keluarga tidak lagi diciptakan di meja makan rumah tapi diciptakan di meja makan restoran, khususnya pada malam hari. Pada malam hari atau pada hari hari libur restoran penuh dengan pengunjung keluarga. Memang tidak dapat dibantah bahwa perubahan gaya hidup mampu menciptakan kegiatan ekonomi baru namun perubahan ini pun mengandung sisi sisi yang memerlukan pembahasan. Pulang mudik adalah sebuah peru-bahan gaya hidup dari produktif

ke konsumtif. Inipun menggambarkan keberhasilan ekonomi masyarakat kota yang ingin dipertunjukan di tempat asal mereka diperdesaan. Mudik seperti ini juga mendorong kegiatan ekonomi diperdesaan seperti berkembangnya usaha makanan tradisional yang sudah tidak terlihat lagi di perkotaan. Di diperdesaan, industri makanan tradisional, pasar desa, hotel melati, objek wisata desa, transportasi menjadi tumbuh. Rakyat di perdesaan juga banyak menerima informasi pengetahuan dan teknologi yang dibawa oleh para pemudik yang secara perlahan juga akan merubah cara berpikir dan produktifitas serta gaya hidup masyarakat desa. Semuanya akan berdampak positif bagi kehidupan selanjutnya. Di daerah perkotaan sendiri, dengan gaya hidup metropolitannya, banyak keluarga yang menghabiskan hari libur lebarannya di hotel hotel berbintang. Mereka ini adalah kelompok masyarakat individualis yang tidak mau repot dengan datangnya tamu di rumah. Mereka menerima tamu di restoran mall yang berdampingan dengan hotel atau yang ada pada hotel tersebut. Ini adalah kelompok metropolis yang berpenghasilan tinggi dengan sifat individualistik yang tinggi pula. Namun mereka juga menjadi pendu-

kung dari usaha perhotelan dikala tamu hotel sedang kosong. Kecenderungan keluarga yang menghabiskan masa libur lebarannya di hotel terus meningkat. Pemesanan kamar dilakukan jauh sebelumnya terutama untuk hotel hotel berbintang yang ada di kota kota besar maupun hotel berbintang daerah pariwisata (resort). Biasanya mereka menghabiskan masa liburnya selama lima atau enam hari dengan pengeluaran biaya puluhan juta rupiah. Bagi hotel ini adalah kesempatan meraup keuntungan dari sewa kamar dan restoran atau jasa lainnya yang disediakan hotel. Namun dibalik mendorong kegiatan ekonomi, perubahan gaya hidup juga menciptakan sifat individualistik, rapuhnya hubungan sosial dan rapuhnya rasa kemandirian. Mereka sudah tidak memiliki rasa percaya diri yang kokoh dan hanya mengandalkan kekuatan ekonomi sebagai penopang kehidupan. Ini merupakan pembahasan tersendiri dari para ahli ilmu sosial dan keagamaan karena perubahan gaya hidup akan terus berlanjut, yang dapat mengurangi nilai nilai kehidupan sebagaimana tuntutan budaya dan agama. Penulis adalah Guru Besar Emiritus USU, Pemerhati Ekonomi.

Rencana Kerja Pemerintah & Kebocorannya Oleh Emir Rizal Lubis Di hadapan kita disuguhi persoalan baru lagi yaitu terjadinya dimana ada permainan anggaran sehingga apa yang direncanakan pupus tak memenuhi target.


encana Kerja Pemerintah merupakan kegiatan pemerintah yang tertuang dalam Anggaran Negara pada satu tahun yang memiliki dua sisi antara lain sisi penerimaan dan sisi pengeluaran. Tujuan disusunnya Anggran Pendapat Belanja Negara (APBN) adalah meningkat produksi nasional dan pertumbuhan ekonomi, meningkatkan kesempatan kerja dan mengurangi pengangguran serta menstabilkan harga barang-barang. Satu langkah dan satu gerak segenap komponen masyarakat diperlukan dalam upaya membangun sinergi untuk mencapai apa yang akan dikerjakan pemerintah sebagaimana ditetapkan dalam APBN tahun 2012. Perhatian hendaknya fokus terarah kepada satu tujuan yang akan dicapai dan ini harus di komandoi pemimpin dan elit bangsa. Karena rakyat banyak hanya menunggu dan melaksanakan apa yang akan dijalankan dan dikejakan pemimpin. Sebagai masyarakat biasa ke depan hendaknya kita tidak lagi melihat lagi pemimpin dan elit bangsa ini yang hanya tau meratap, curhat, saling menuding, membangun citra, membuka aib, mengkritik tapi tanpa solusi. Tapi marilah pemimpin ini bekerja sesuai apa yang direncanakan yang telah ditetapkan sejalan antara pemikiran, ucapan dan perbuatan. Sehingga masyarakat dapat mempedomaninya dan tidak terpecah belah akibat lain yang diucapkan, lain pula yang diperbuat. Menjadi persoalan saat ini yang kita perhatikan adalah begitu banyak problem yang kita hadapi saat ini. Sehingga fokus pembangunan ekonomi nasional terasa semakin tak terarah akibat tersitanya energi pemerintah untuk pelaksanaan pembangunan yang senantiasa ditunggu-tunggu masyarakat lapisan bawah guna memperbaiki tingkat kehidupannya. Seperti salah satu permasalahan

dihadapi yang merusak image negara. Seperti kasus Gayus Tambunan merusak citra terhadap masukan negara dari pajak ditambah kasus Nazaruddin yang disangka merugikan negara dari beberapa proyek yang dibiayai negara. Sehingga lengkaplah sudah bila ditinjau dari APBN dimana pendapatan dan pengeluarannya sudah digerogoti orang yang tidak bertanggungjawab dan mereka bukanlah datang dari masyarakat biasa, tapi orang yang bekerja dan penghasilannyapun dibiaya APBN. Sungguh sangat ironis memang, tapi itulah kenyataan, masyarakat menjadi korban yang senantiasa taat pajak dan mendambakan kesejahteraan. Di hadapan kita disuguhi persoalan baru lagi yaitu terjadinya dimana ada permainan anggaran sehingga apa yang direncanakan pupus tak memenuhi target. Patut disimak apa yang menjadi keresahan anggota Komisi III DPR RI Martin Hutabarat yang mengatakan terkuaknya kasus dugaan suap di Kementerian Tenaga Kerja dan Transmigrasi jangan melalaikan akan permainan anggaran. Tapi, kasus ini harus bisa menyadarkan bahwa perilaku korupsi ini meluas karena ada permainan anggaran di eksekutif dan legislatif (Waspada 6/9). Betapapun permasalahan yang kita hadapi terus menerpa, Setidaknya kita tidak pula ikut-ikutan meratapinya apalagi ambil bagian. Selain pengawasan dan solusi terbaik perlu kita berikan agar kemelut dapat kita jalani untuk keluar dari permasalahan. Sehingga masa depan dapat kita raih dengan penuh tekad agar hari ini lebih baik dari hari sebelumnya dan masa akan datang harus lebih baih dari hari ini. Oleh karenanya perlu kita membangun komitmen bersama menyatukan gerak langkah berjuang sekeras mungkin mencapai target yang dite-

tapkan. Segenap komponen bangsa ini dapat ikut berrpartisipasi sebagaimana menjadi tema rencana kerja pemerintah 2012, —menjadikan 11 prioritas nasional yaitu : (1) reformasi birokrasi dan tata kelola; (2) pendidikan; (3) Kesehatan; (4) penanggulangan kemiskinan; (5) ketahanan pangan; (6) infrastruktur; (7) iklim investasi dan iklim usaha; (8) energi; (9) lingkungan hidup dan pengelolaan bencana; (10) daerah tertinggal, terdepan, dan pasca konflik; serta (11) kebudayaan, kreativitas, dan inovasi teknologi. Banyak pengamat mengkhawatirkan bahwa program yang akan dilaksanakan pemerintah tidak fokus dapat berakibat tidak berjalannya program. Dengan demikian patutlah secara dini presiden mengingatkan menteri untuk memperbaiki kinerja. Untuk evaluasi kinerja kabinet, termasuk pemerintah daerah, senantiasa dilakukan. Menyoroti Rencana Kerja Kerja Pemerintah 2012, kita memiliki optimisme yaitu dengan dibenahinya kinerja pemerintah yang sedang berjalan—sesuai anggaran 2011 yang tinggal beberapa bulan lagi—serta dihindari kebocoran anggaran baik dari dari sisi pendapatan (pajak) dan pengeluaran akan menyumbang keberhasilan capaian target sesuai tema rencana kerja pemerintah 2012. Untuk mengawal dan mendorong pelaksanaan kerja dan rencana kerja pemerintah agar memenuhi sasaran adalah Kementerian Perekonomian adalah sebagai lokomotifnya. Intinya adalah bagaimana tujuan disusunnya APBN dapat direalisir serta pengawasannya juga dapat dilakukan dengan cermat agar secara pengawasan intern dapat secara dini dideteksi terjadinya kebocoran ini ditugasi BPKP. Sebagaimana tugasnya sesuai pasal 52, 53 dan 54 Keputusan Presiden Republik Indonesi Nomor 103 Tahun 2001 yaitu sebagai pemantau, pemberian bimbingan dan pembinaan terhadap kegiatan pengawasan keuangan dan pembangunan. Sebagai masyarakat biasa kita tak tau persis adanya kebocoran anggaran di pemerintahan apakah karena Badan Pegawas Keuangan dan Pembanguan

(BPKP) tidak berfungsi atau belum secara optimal melaksanakan tugasnya. Memang sulit untuk diketahui jika ada permaianan melakukakan tindakan korupsi. Karena walaupun sistem pengawasan sudah baik, tapi bila pelaksananya bekerjasama satu dengan yang lain memang akan susah untuk dideteksi terkecuali yang sala satu yang berkerjasama itu bernyanyi atau tertangkap basah seperti yang dilakukan hKPK. Penulis adalah Pemerharti Sosial/ Ekonomi Masyarakat.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Indonesia belum berdaulat secara politik - Makanya banyak korban politik * PLN didesak bubarkan tim razia listrik - Apalagi kalau razianya pilih kasih * DPRDSU minta anggaran BKKBN diaudit - Anggaran besar, penduduk pun besar, he...he...he


D Wak


WASPADA Selasa 13 September 2011

Mengatasi Dan Mencegah Kenakalan Remaja Perilaku menyimpang yang diperlihatkan para remaja,seoerti tawuran,menyalahgunakan narkoba dan seks bebas,adalah perilaku yang melanggar norma-norma hokum pidana.AKobat dari perilaku menyimpang itu akan merugikan dirinya dan orang orang disekitarnya. Para ahli pendidikan sependapat bahwa remaja adalah mereka yang berusia antara 13-18 tahun. Pada usia tersebut,seseorang sudah melampui masa kanak-kanak,namun masih belum cukup matang untuk dapat dikatakan dewasa,dia berada pada masa transisi.Menurut sosiolog Kartono, kenakalan remaja atau dalam Bahasa Inggris dikenal dengan istilah juvenile delinquency merupakan gejala patologis sosial pada remaja yang disebabkan oleh satu bentuk pengabdian sosial. Akobatnya, mereka mengembangkan bentuk perilaku yang menyimpang,“ Kenakalan remaja merupakan kumpulan dari berbagai perilaku remaja yang tidak dapat diterima secara sosial hongga terjadi tindakan criminal”. Masalah kenakalan remaja mulai mendapat perhatian masyarakat secara khusus sejak terbentuknya peradilan untuk anak-anak nakal. Jenis jenis kenakalan remaja diantaranya penyalahgunaan narkoba, seks bebas dan tawuran. Terjadinya kenakalan remaja bisa disebabkan oleh factor dari remaja itu sendiri dan juga dari lingkungannya. Perubahan biologis dan sosiologis pada diri remaja memungkinkan terjadinya dua bentuk integrasi, yakni terbentuknya perasaan akan konsistensi dalam kehidupannya dan tercapainya identitas peran, biasa kenakalan remaja terjadi karena remaja gagal mencapai masa integrasi kedua tersebut. Remaja yang tidak bisa mempelajari dan membedakan tingkah laku yang dapat diterima dengan yang tidak dapat diterima akan terseret pada perilaku “nakal”. Begitupun bagi mereka yang telah mengetahui perbedaan dua tingkah laku tersebit, namun tidak bisa mengembangkan kntrol diri untuk bertingkah laku sesuai dengan pengetahuannya. Perceraian orangtua, tidak adanya komunikasi antar anggota keluarga, atau perselisihan antar anggota keluarga bisa memicu perilkau negative remaja. Pendidikan yang salah dikeluargapun, seperti terlalu memanjakan anak, tiodak memberikan pendidikan agama, atau oenolakan terhadap eksistensi anak, bisa menjadi penyebab terjadinya kenakalan remaja, termasuk juga teman sebaya yang kurang baik. Hal-hal yang bisa dilakukan untuk mengatasi kenakalan remaja : - Kegagalan mencapai identitas peran dan lemahnya kontrol diri bisa dicegah prinsip keteladanan. Remaja harus bisa mendapatlan sebanyak mungkin figure orang dewasa yang telah melampaui masa remajanya dengan baik, juga figure mereka yang berhasil memperbaiki diri setelah sebelumnya gagal pada tahap ini. - Adanya motivasi dari keluarga, guru, teman sebaya untuk melakukan hal-hal yang positif - Kemauan orangtua imtik membenahi kondisi keluarga sehingga tercipta keluarga harmonis, komunikatif dan nyaman bagi remaja - Arahan orangtua untuk memilih teman dan komunitas bagi remaja - Remaja membentuk ketahanan diri agar tidak mudah terpengaruh jika ternyata teman sebaya atau komunitas yang ada tidak sesuai dengan harapan Untuk mengatasi dan mencegah kenakalan remaja yang bisa terherumus kedalam penyalahgunaan narkoba, Pusat Pencegahan Pelaksana Harian Badan Narkotika Nasional (PUSCEGAHLAKHAR BNN) telah melakukan program dilingkungan sekplah dan kampus dengan mendirikan usaha kesehatan sekolah (UKS) dan unit kegiatan mahasiswa anti narkoba. Dengan mengetahui bahaya penyalahgunaan narkoba, para mahasiswa dan pelajar diharapkan semakin sadar dan berpolor lagi sebelum menggunakan narkoba yang dapat membahayakan nyawanya. Puji Agustina Patumbak

Gudang Besi Di Jl. Letda Sujono Meresahkan Masyarakat Masyarakat di sekitar Gudang Besi Sempurna di Jl. Letda Sujono No.170 Kelurahan Tembung, Kecamatan Medan Tembung, merasa sangat terganggu dan tidak nyaman dengan aktivitas yang berlangsung di gudang tersebut. Masyarakat terganggu dengan suara besi berbenturan dan suara mesin yang hidup seharian, selain curahan air hujan dari atap gudang yang masuk ke pekarangan rumah warga yang berbatasan langsung dengan gudang tanpa plank dan tak jelas bentuk badan usahanya tersebut. Wakil masyarakat sekitar gudang sudah mengadukan masalahnya ke Camat Medan Tembung pada 12 April 2011 dan setelah lima bulan berlalu pengaduan tersebut terkesan tidak ditindaklanjuti. Pada 25 Agustus 2011 beberapa warga mewakili masyarakat di Jl. Kapten M. Jamil Lubis berusaha menemui pemiliknya, untuk meminta agar mengatur aktivitas usahanya sehingga tidak menimbulkan keresahan di kalangan masyarakat. Namun, kedatangan wakil masyarakat itu tidak mendapat sambutan sebagaimana mestinya. Pemilik gudang yang disebut-sebut bernama Edi Gunawan, malah menantang, menyilakan masyarakat mengadukan masalahnya ke mana pun karena menurutnya tidak akan ditanggapi. Pada 7 September, masyarakat mengirimkan surat pengaduan ke Kapolsek Percut Sei Tuan. Kini menunggu dengan penuh harapan bahwa masih ada tempat masyarakat untuk mengadu di republik ini. Mewakili Masyarakat Jl. Kapten M. Jamil Lubis, Lingkungan VI, Kel. Tembung

Kibarkan Sang Garuda Di Dada Anak Bangsa Garuda pancasila akulah pendukungmu Patriot proklamasi sedia berkorban untuk mu Pancasila dasar Negara, rakyat adil makmur sentosa Pribadi bangsaku….. Kita semua sebagai warga Negara Indonesia pasti sudah tidak asing lagi dengan kutipan lagu diatas,namun sepertinya lagu tersebut hanyalah selentingan semata.Faktanya Pancasila sebagai dasar Negara belum tumbuh dan berkembang dalam hati kita khususnya di hati para penerus bangsa. Hal inilah yang tampaknya mulai disadari oleh pemerintah kita, khususnya DPR sesuai dengan keputusan komisiVIII dan X DPRD RI maka pada tahun ajaran ini akan ada pelajaran wajib pancasila. Selama ini hampir 80% dari pelajaran yang diperoleh di sekolah hanya berfokus pada aspekpengembangankognitif(mengenaiilmupengetahuandanteknologi)sedangkanpendidikan karakter yang tertuang dalam pelajaran seperti agama dan pendidikan kewarganegaraan(PKN) sangat minim. Hal ini memicu kurangnya sikap nasionalisme dalam diri kaum muda kita. Maraknya sikap radikalisme yang sering terjadi belakangan ini merupakan buah dari perbuatan kita sendiri yang mulai melupakan nilai-nilai luhur dalam Pancasila. Salah satu bentuk radiklaisme ini adalah munculnyanya gerakan-gerakan separatism seperti Negara Islam Indonesia (NII) yang berusaha memecah belah Negara Kesatuan Republik Indonesia (NKRI) yang kita cintai ini.Tampaknya bangsa kita ini memang telah lalai dalam mengabaikan Pancasila sebagai ideologi bangsa. Selama ini kita sibuk dengan hiruk pikuk reformasi, sibuk dengan kasus suap Gayus atau Miranda Gultom, sibuk dengan kasus penggelapan Malinda Dee, sibuk dengan rencana pembangunan gedung baru DPR RI, sibuk dengan PSSI dan FIFA, sibuk dengan korupsi di sana-sini, sibuk dengan diri kita sendiri. Keputusan komisiVIII dan X DPR RI ini rasanya cukup tepat dan akurat sebagai bentuk pencegahan terhadap radikalisme. Pengadaan pelajaran Pancasila sebagai pelajaran wajib sudah seharusnya diberlakukan pada semua jenjang pendidikan mulai dari pendidikan anak usia dini PAUD, SD, SMP, SMA bahkan termasuk jenjang pendidikan perguruan tinggi. Selain lembaga pendidikan formal atau sekolah orangtua atau keluarga sebagai lembaga pembentukan kepribadian dini juga diharapkan ikut berperan dalam menumbuhkan sikap cinta tanah air pada diri anak-anak bangsa sejak dini.Keluarga hendaknya mampu menciptakan satu lingkungan yang kondusif dan harmonis sehingga dapat mendidik mental dan membentengi anak-anak bangsa dari segala bentuk radikalisasi. Selain adanya kesepakatan antara komisiVIII dan Komisi X DPR RI mengenai diajarkannya pendidikan Pancasila sebagai pelajaran wajib pemerintah juga mendukung pendirian pusat kajian pemuda atau Youth Studies Centre yang berada di Kampus Universitas Gajah Mada Jogyakarta ini yang diresmikan langsung oleh Menpora. Pusat kajian ini diharapkan mampu mendeteksi secara dini (EarlyWarning) masalah radikalisme dikalangan anak-anak bangsa. Dengan demikian anak-anak bangsa dapat membentengi diri sendiri dari segala bentuk pengkaburan jati diri. Mahkamah Konstitusi sendiri telah mengadakan pertem,uan antara lembaga-lembaga Negara dalam rapat koordinasi Pancasila untuk membahas langkah-langkah selanjutnya menghidupkan kembali nilai-nilai luhur Pancasila.Karena memang sudah seharusnya lembaga pemerintahan mulai dari tingkat tertinggi sampai tingkat terendah mampu menyadari dan melaksanakan nilai luhur ideology Pancasila dalam pemenuhan tanggungjawabnya sebagai wakil rakyat bukannya saling berperang argument dalam rapat.Para wakil rakyat ini harusnya dapat memberikan citra yang baik bagi rakyat. Maka dapat disimpulkan bahwa untuk memerangi radikalisme dibutuhkan kerjasama antara lembaga pendidikan formal, masyarakat umum dan lembaga pemerintahan. Ketiga elemen ini harus mampu saling mendukung dan menopang dari segala sisi agar kaum muda yang sedang dalam proses pencarian jati diri tersebut tidak salah jalan atau bahkan tersesat dalam perangkap perangkap terorisme Yeni Capri Nainggolan Tanjung Morawa


Tantangan Bagi Negeri Merdeka Oleh Aldwin Surya Warisan perkara korupsi di Indonesia menjadi pembelajaran berarti bagi generasi muda Indonesia. Hikmahnya tercermin dari keinginan kuat generasi muda untuk menolak dan tidak mencontoh praktik korupsi.


i usia 66 tahun kemerdekaan Indonesia, keprihatinan terhadap kehidupan bernegara semakin meningkat. Sebagai negara berdaulat dengan dengan pemilikan sumber daya manusia dan sumber daya alam dan mineral yang memadai, tantangan terhadap kemampuan untuk menjadi negara maju justru berasal dari dalam negeri. Tantangan itu bersumber dari karakter diri yang cenderung lemah dalam penerapan sistem kerja berbasis pengawasan dan konsistensi terhadap regulasi. Intinya, bermuara kepada banyaknya peyimpangan dan pelanggaran regulasi oleh individu dan kelompok seperti tindak korupsi. Keadaan ini telah menempatkan Indonesia sebagai salah satu negera terkorup. Mengutip Political & Economic Risk Consultancy (PERC) tahun 2010, skor korupsi Indonesia cenderung meningkat. Tahun 2010 skornya adalah 9,07 dari skor 10, tahun 2009 (8,32) dan tahun 2008 (7,98). Secara detail, peringkat negara terkorup, korup, bersih dan terbersih adalah Indonesia (terkorup), Kambodja (korup), Vietnam (korup), Filipina (korup), Amerika Serikat (bersih), Hongkong (bersih), Australia (bersih), dan Singapura (terbersih). Masih tentang korupsi, Rabu 10 Agustus 2011, mengutip data Transparency International Ranking 2010 yang disampaikan pada Asia Forum for Human Rights and Development menyebutkan Indonesia berada di peringkat 110 Indeks Persepsi Korupsi (IPK) dari 200 negara di seluruh dunia. Ironisnya, praktik korupsi di Indonesia cenderung melibatkan lembaga pemerintah dan birokrat yang berwenang di dalamnya baik di pusat, provinsi dan kota/kabupaten. Kecenderungan praktik korupsi itu bukan hanya sebatas disinyalir, tetapi fakta yang telah ditindaklanjuti dengan putusan pengadilan. Berita di media cetak dan elektronik tentang dugaan kasus dan

penyidikan perkara korupsi hampir tiap hari dapat dibaca dan didengar. Pelakunya pun beragam, dari pejabat dan pegawai tingkat rendahan hingga ke pejabat tinggi negara. Bahkan praktik korupsi pun ikut singgah dan menyeret anggota dewan perwakilan rakyat. Keadaan ini semakin ironis bila dikaitkan dengan keinginan Presiden SBY yang bertekad berada di depan dalam memberantas korupsi. Tekad itu memang sepatutnya diwujudkan karena akan mencerminkan citra Indonesia di mata masyarakat dunia. Praktik korupsi juga membingungkan investor asing, mengingat beragam pungutan, iuran dan biaya yang harus dikeluarkan agar bisnisnya berjalan lancar. Namun, tekad kuat pemberantasan korupsi cenderung belum berjalan efektif. Pasalnya, tantangan besar justru berasal dari instansi yang berkompeten dalam penegakan hukum. Dalam hal sumber penerimaan devisa negara, praktik korupsi juga menyentuh penerimaan sektor pajak. Oleh karena itu, pemerintah melalui direktorat jenderal pajak mestinya mengawal secara ketat penerimaan sektor pajak. Apalagi, setelah minyak/gas dan pariwisata tidak lagi jadi pemasok bagi devisa negara, pemerintah justru berharap banyak dari penerimaan pajak. Praktik korupsi agaknya sudah menjadi satu sistem sendiri sejalan dengan sistem pemerintahan yang berlaku. Pasca pemekaran daerah, praktik korupsi cenderung marak di kota/kabupaten. Bentuknya adalah penyalahgunaan wewenang dan jabatan resmi untuk kepentingan pribadi atau kelompok. Oleh karena itu, disadari atau tidak, praktik korupsi berpeluang dilakukan oleh para pejabat di tingkat pusat, provinsi dan kota/ kabupaten. Peluang untuk melaksanakannya tergantung dari keinginan untuk penerapan regulasi dan penggunaan hati nurani. Itu sebabnya, godaan untuk

praktik korupsi tidak hanya dimungkinkan oleh oknum dan kelompok itu saja, tetapi juga berasal dari godaan eksternal dalam bentuk pemberian suap untuk melancarkan urusan masing-masing. Padahal semua praktik korupsi dan suap itu memang terbukti merusak kepercayaan pihak lain kepada pemerintah. Semangat merdeka Praktik korupsi saat ini di Indonesia sepertinya sudah mencederai semangat merdeka bangsa Indonesia. Sejak kebangkitan nasional tahun 1908 lalu, semangat merdeka dan semangat untuk menjadi bangsa mandiri, sudah dirintis oleh kaum terpelajar Indonesia masa itu. Semangat merdeka dari organisasi pemuda tempo dulu, terus berkembang hingga Indonesia memproklamirkan kemerdekaannya. Seiring waktu, perubahan dan kemajuan terus dialami oleh bangsa Indonesia. Namun, bukan kemajuan yang memungkinkan menjadi negara maju yang diperoleh. Sejumlah kasus korupsi malah menyeret bangsa Indonesia kepada persepsi sebagai negara korup. Warisan perkara korupsi di Indonesia menjadi pembelajaran berarti bagi generasi muda Indonesia. Hikmahnya tercermin dari keinginan kuat generasi muda untuk menolak dan tidak mencontoh praktik korupsi. Pasalnya, sudah banyak anak muda Indonesia yang sehat, brilian dan inovatif justru terjebak dengan sistem kerja yang “diwariskan” oleh para pendahulunya setelah mereka bekerja. Keadaan ini bertolak belakang saat mereka berada di lingkungan kampus. Di lingkungan ini, perilaku santun, idealis dan disiplin diajarkan sebagai bekal saat mereka memasuki dunia kerja. Tapi dunia kerja ternyata memiliki sistem sendiri, sehingga menggerus sikap santun, idealisme dan disiplin yang telah dimiliki. Inkonsistensi antara perilaku di dalam kampus dengan di dunia kerja inilah yang menjadi tantangan berat bagi generasi muda Indonesia. Persoalan ini menjadi satu dari substansi persoalan di dalam negeri yang patut menjadi perhatian pemerintah di semua jenjang kepemimpinan nasional. Dalam banyak kasus demosntrasi oleh mahasiswa dan anak seusia mereka, cenderung bermuara kepada ketidak-

puasan atas kinerja aparat pemerintah dalam perlakuan keadilan, keberpihakan kepada kaum kapitalis dan ketidakberdayaan rakyat kecil memperjuangkan hak-hak mereka. Persoalan ini menjadi penting karena generasi muda Indonesia akan melanjutkan kepemimpinan nasional dan harus menghadapi persoalan besar skala makro. Di bidang ekonomi, persoalan besar yang dihadapi adalah menyelamatkan ekonomi Indonesia dari krisis ekonomi global dan hutang luar negeri. Kepiawaian ekonom Indonesia menghadapi dua persoalan ekonomi ini akan mencerminkan kepercayaan negara di dunia terhadap ekonomi Indonesia, khususnya saat para inverstor memutuskan untuk menanamkan modalnya pada beragam bisnis. Efek dari krisis ekonomi global dan hutang luar negeri nampak pada bilangan penduduk miskin yang terus meningkat sejalan dengan banyaknya pengangguran. Dalam skala makro, pengangguran dan penduduk miskin memiliki korelasi berarti terhadap pembangunan bangsa. Wujud dari pembangunan bangsa yang ideal adalah terselenggaranya proses pendidikan di semua jenjang. Ini berarti, terwujudnya proses pendidikan memungkinkan rakyat Indonesia mendapat pendidikan hingga ke jenjang pendidikan tinggi. Oleh karena itu, kebijakan pemerintah untuk mengalokasikan dana pendidikan sebesar 20% dari anggaran pendapatan dan belanja negara (APBN), mesti disikapi secara baik dan dijalankan dengan tanggung jawab. Bukan sebaliknya, dijadikan peluang untuk menggerusnya melalui praktik korupsi guna kepentingan individu dan kelompok. Lihatlah pada banyak negara maju yang memberi perhatian besar kepada pendidikan. Pemilikan generasi muda yang berpendidikan dan konsistensi dalam penerapan regulasi di semua sendi kehidupan telah terbukti mampu menggerus niat dan upaya melakukan praktik korupsi. Oleh karena itu, di usia 66 tahun kemerdekaan Indonesia, mari wujudkan tekad memberantas korupsi dalam tindakan nyata. Jadikan jabatan yang diemban sebagai amanah, bekerja optimal, laksanakan regulasi dan gunakannuranisebagaibentengpraktikkorupsi. Penulis adalah Pemerhati Perkotaan

Memberantas Flu Burung Oleh Azhar AP Mengubah perilaku masyarakat dalam memelihara unggas dan pola hidup sehat yang telah berlangsung dari generasi ke generasi adalah suatu tantangan yang besar.


epanjang 2011 kasus flu burung semakin meningkat di beberapa wilayah Indonesia, termasuk di Provinsi Aceh dan Sumatera Utara. Dari berbagai berita yang dilansir harian terbitan di Medan dan Aceh, penyakit ini terus menunjukkan eksistensinya di berbagai daerah. Flu burung atau Avian Influenza (AI) adalah penyakit menular yang disebabkan virus influenza yang umumnya ditemukan pada burung dan unggas, seperti itik, ayam, entok, burung puyuh, angsa, burung liar dan beberapa binatang lainnya. Namun virus ini dapat juga menyerang manusia hingga menyebabkan kematian. AI bukanlah penyakit baru. Penyakit ini telah dilaporkan sejak tahun 1878 di Italia dan telah menjadi pandemi di beberapa belahan dunia. Pada tahun 30an AI sudah ditemukan di Timur Tengah dan selanjutnya juga dilaporkan telah berjangkit di Australia (1975 dan 1985), Inggris (1979), Irlandia (1983-1984) dan di Amerika untuk pertama kalinya terjadi tahun 1924-1925, kemudian terulang lagi tahun 1929 dan 1983-1984. Tahun 1997, wabah flu burung melanda Hongkong. Dilaporkan wabah ini merenggut 6 jiwa dari 18 kasus pada manusia. Strian virus yang menyerang adalah H5N1 yang dapat menular ke manusia dan bersifat mematikan. Mulanya H5N1 bersifat jinak, tapi ketika mewabah di Hongkong 1997 virus telah mengganas akibat terjadinya mutasi gen. H5N1, sampai sekarang menjadi satu-satunya galur yang sangat patogen. Mulanya H5N1 ini hanya ditemukan di Hongkong, namun dalam perkembangannya sejak 2003 H5N1 telah menyebar ke negara lainnya termasuk Indonesia. Data Kementerian Kesehatan RI, kasus positif flu burung pada manusia di Indonesia sejak tahun 2005 sampai akhir 2010 adalah 171 kasus, 141 kasus di antaranya meninggal dunia (mencapai 83 %). Penularan Penularan pada hewan dapat terjadi melalui kontak langsung antara hewan sakit dengan hewan yang peka. Penularan secara tidak langsung dapat terjadi melalui udara yang tercemar oleh muntahan (droplet) hewan sakit. Di samping itu unggas yang sering bermigrasi bisa menjadi reservoir (perantara) alami virus AI. Pasar unggas atau pasar burung juga berperan dalam penyebaran flu burung. Virus AI dapat hidup dan berkembang biak dengan cepat pada pH 5 hingga 7. Karenanya kotoran unggas, jaringan tubuh, air dan cairan saluran pernafasan

merupakan media yang baik untuk pertumbuhan virus. Pencemaran bisa berlangsung cepat jika material tinja/ kotoran unggas tercemar ke dalam air minum, pakan, kandang, burung liar, pakaian, sepatu, peralatan, serangga, dan kendaraan pengangkut. Penularan pada manusia, sampai saat ini para ahli masih berkesimpulan transmisi penyakit flu burung terjadi dari hewan ke manusia, bukan dari manusia ke manusia. Penularan bisa terjadi melalui makanan yang tidak dimasak, udara atau kontak langsung dengan unggas sakit. Ayam atau unggas sakit mengeluarkan virus melalui kotoran atau cairan tubuh yang kemudian mengering dan hancur menjadi bubuk. Salah satu hipotesis menyatakan bubuk inilah yang diduga terhirup manusia atau hewan sehingga bisa tertular flu burung.Virus AI akan sangat berbahaya bila menempel atau melakukan assortan pada bebek dan babi. Penularan kepada manusia akan lebih cepat bila melalui babi karena ketika virus AI masuk ke tubuh babi, ia akan berubah semakin ganas. Babi dikenal sebagai mediator mutasi silang virus influenza, karena babi mudah terkena infeksi baik oleh virus flu pada unggas maupun virus yang menjangkiti manusia. Pencegahan dan pengendalian Biarpun laju mutasi virus flu burung berlangsung cepat dan serangannya mematikan, masyarakat tidak perlu panik menghadapi wabah penyakit ini. Pasalnya, pencegahan terhadap penularan penyakit flu burung bisa dilakukan dengan cara yang mudah dan sederhana. Menjaga kondisi badan agar selalu sehat dan fit akan mempersulit serangan virus flu burung, disamping menjaga kebersihan untuk mencegah kontaminasi dengan virus. Selama ini virus AI terkesan sulit diberantas karena perilaku hidup masyarakat yang belum berubah untuk menjunjung tinggi prinsip-prinsip hidup

sehat dan bersih. Usaha yang dapat dilakukan untuk mengatasi virus AI, diantaranya: pertama, menerapkan manajemen beternak yang baik. Penyebab utama serangan flu burung saat ini biasanya bermula dari peternak sektor 4 atau peternak unggas pekarangan. Hampir sebagian besar peternak ayam masih beternak secara tradisional dengan melepas bebas ayamayamnya untuk mencari makan sendiri. Ayam masih dibiarkan tidur di pohonpohon. Bila ada kandang, masih dibuat dekat dengan rumah dan dicampur dalam satu kandang antara ayam dan itik. Kandang pun jorok dan tidak pernah didesinfeksi (disucihamakan). Untuk mencegah flu burung pola beternak harus diubah lebih baik dan melaksanakan biosekuriti dengan ketat. Kedua, pengawasan lalulintas ternak. Pengawasan harus dilakukan dengan ketat mulai di daerah perbatasan dengan provinsi tetangga hingga ke desa-desa. Selama ini masih sering kita jumpai pedagang yang membawa ayam secara terbuka dengan sepeda motor atau mobil bak terbuka yang berseliweran di jalan-jalan utama yang ramai tanpa ada keraguan sedikitpun akan penyebaran terhadap flu burung. Pedagang pengumpul (penggalas) masih bebas keluar masuk desa dari satu kandang ke kandang lainnya untuk membeli ayam atau itik. Mengatasi hal ini sangat dibutuhkan peran dan tindakan tegas dari semua pihak mulai aparat desa hingga pemerintah provinsi. Ketiga, menata pasar unggas. Hampir semua pasar unggas masih merupakan pasar becek (tradisional) yang bersifat multifungsi. Maksudnya dalam satu pasar dijual berbagai komoditi, mulai dari sayur-sayuran, rempah-rempah hingga daging sapi atau ayam. Di lokasi yang sama juga terdapat tempat penampungan unggas, tempat pemotongan, dan sekaligus tempat penjualan produk unggas. Situasi ini diperparah lagi dengan pembeli yang bebas membeli dan memilih sendiri ayam hidup untuk dipotong didepannya atau dibawa pulang kerumah. Karenanya selain aktifitas sosial dan ekonomi, pasar juga berpotensi sebagai tempat penyebaran penyakit flu burung. Untuk ke depan, pemerintah daerah

harus berpikir untuk mengadakan pasar unggas yang bersih dan sehat. Konsep pembangunannya harus melingkupi poin: keberadaan pasar, penerapan biosekuriti, hygiene dan sanitasi, zoning antara tempat penanganan unggas dan produknya (tempat penampungan, pemotongan dan penjualan produk unggas) dengan komoditi lain. Keempat, menerapkan Pola Hidup Bersih dan Sehat (PHBS). Misalnya dengan menerapkan 3 pesan kunci tanggap flu burung,yaitu:janganbermaindenganunggas yang sakit/mati, cuci tangan pakai sabun, dan laporkan kasus kepada RT/RW atau kepala desa. Sejak 2006, di Indonesia telah dibentuk tim Participatory Disease Surveillance and Response (PDSR) yang berada dibawah koordinasi Local Disease Control Centre (LDCC) yang merupakan unit pengendali penyakit AI di daerah yang dibentuk atas kerjasama Pemerintah RI dengan Badan PBB, Food and Agriculture Organization (FAO). Saat ini telah dibentuk 33 LDCC di 29 provinsi. Petugas PDSR yang tersebar di seluruh kabupaten/kota bekerja secara aktif dengan mengutamakan prinsip early detection (deteksi cepat),early response(respon cepat) dan early reporting (pelaporan cepat). Di samping itu PDSR yang saat ini berjumlah 2.388 orang, juga bertugas untuk meningkatan pengetahuan dan pemahaman masyarakat tentang AI, disamping melacak dan melakukan investigasi penyakit melalui kegiatan mencari informasi dari setiap desa dan melakukan surveilans yang diikuti dengan pencegahan, monitoring danpengendalianpenyakit. Timinilahyang terjun langsung ke lokasi wabah bila menerima laporan dari masyarakat. Mengubah perilaku masyarakat dalam memelihara unggas dan pola hidup sehat yang telah berlangsung dari generasi ke generasi adalah suatu tantangan yang besar. Untuk itu dibutuhkan keterlibatan semua lapisan masyarakat mulai dari pemerintah, tokoh masyarakat, pekerja kesehatan, dan peternak unggas, semuanya harus ikut berpartisipasi. Keberhasilan dari suatu program sangat tergantung dari peran serta dan dukungan masyarakat luas, termasuk juga dalam program pencegahan dan penanggulangan penyakit flu burung. Sebaik apapun strategi dan upaya yang telah diprogramkan tidak akan membuahkan hasil maksimal tanpa adanya partisipasi dan peran aktif dari seluruh elemen masyarakat. Sebenarnya flu burung mudah untuk diberantas dan dikendalikan, bila kita mau memahami flu burung dengan menerapkan PHBS serta melakukan program pemberantasannya dengan serius. Jika tidak, penyakit yang mematikan ini tidak akan pernah enyah dari daerah kita. Maka bersiap-siaplah untuk hidup berdampingan dengan flu burung. Penulis adalah Dokter Hewan, Alumni FKH Universitas Syiah Kuala Banda Aceh.



WASPADA Selasa 13 September 2011

Digusur, Pedagang Pasar Geudong Ngadu Ke PB-HAM

Bangunan Laboratorium Lingkungan Hidup Mubazir BIREUEN (Waspada) : Bangunan Laboratorium (Lab) Lingkungan Hidup Kabupaten Bireuen di Desa Paya Meuneng, Kecamatan Peusangan, terkesan mubazir. Hal ini dikarenakan, fasilitas tersebut belum dapat dimanfaatkan. Kepala Kantor Kebersihan, Pertamanan dan Lingkungan Hidup setempat, Edwar Jufri, Senin (12/9) mengatakan, hingga kini lab tersebut belum memiliki tenaga ahlinya serta tidak tersedianya peralatan laboratorium. “Untuk apa kita buka, kalau alat dan tenaganya tidak ada,” ucap Edwar seraya mengatakan, padahal jika memliki tenaga dan peralatan yang cukup, lab ini dapat digunakan untuk meneliti stuktur tanah, kualitas air minum isi ulang di depot. Ini boleh juga sebagai pilot projek,” katanya. Wakil Ketua DPRK Bireuen Syafruddin terkait masalh tersebut meminta pihak eksekutif untuk dapat memfungsikan Lab. Lingkungan Hidup sesuai dengan peruntukannya. (cb03)

Avanza Kontra Jufiter, 2 PNS Kritis TAPAKTUAN (Waspada) : Dua pegawai Kantor Camat Sawang Kabupaten Aceh Selatan dilaporkan kritis akibat kecelakaan lalulintas yang terjadi di kawasan jalan raya Tapaktuan-Banda Aceh, persis di Desa Gunung Cut, Kecamatan Samadua, 15 kilometer dari Tapaktuan, Senin (12/9). Kedua PNS tersebut Misbah, 40, warga Gampong Sawang I dan Syamsul Bahri, 51, warga Gampong Meuligoe, Kecamatan Sawang. Keduanya kini dirawat intensif di Rumah Sakit Umum Daerah (RSUD) Yulidin Away Tapaktuan. Kapolres Aceh Selatan AKBP Bambang Safrianto melalui Kasat Lantas Polres Aceh Selatan Iptu Syabirin kepada wartawan menyebutkan, kecelakaan itu terjadi sekira pukul 09:00, ketika mobil Avanza bernomor polisi BK 1107 TV dari arah Tapaktuan dikemudikan Ali Asri, 40, warga Binjai, Sumut, mengalami pecah ban depan sebelah kanan, sehingga hilang kendali.(b19)

Pasutri Aniaya Bocah Terbelakang Mental Di Pidie SIGLI (Waspada) : Satuan Reserse Kriminal (Satreskrim) Polres Pidie, Senin (12/9) telah memanggil pasangan suami istri, warga Desa Rumia, Kecamatan Indrajaya, Kabupaten Pidie, tersangka penganiayaan bocah mental terbelakang yang terjadi, Kamis (4/ 8). Kapolres Pidie melalui Kasatreskrim AKP Jatmiko mengungkapkan, kedua tersangka itu adalah ALF, 45 dan EN, 27. Keduanya ditetapkan sebagai tersangka karena melakukan penganiayaan terhadap Syawalulbismi, 14, bocah bermental terbelakang dengan cara menyiram bubur kanji rumbi mendidih ke badan bocah tersebut hingga menyebabkan kulit bocah tesebut melepuh. Terlambatnya proses hukum terhadap kasus ini, karena pihak keluarga korban terlambat melapor. “Kita terima laporan dari orang tua korban pada Selasa (6/9). Dan kita langsung memproses kasus ini. Sekarang kita sudah memanggil kedua tersangka,” kata Jatmiko. (b20)

Wakapolres Aceh Utara Diganti, 3 Kapolsek Ikut Dimutasi LHOKSUKON (Waspada) : Kepolisian Daerah Aceh mengganti Wakapolres Aceh Utara Kompol Ali Sigit Ismanto. Sigit dipromosikan menjadi Kabag Bin Ops Ditreskrim Umum Polda Aceh. Sementara Wakapolres Aceh Utara yang baru dijabat oleh Kompol Siswoyo, mantan Wakapolres Aceh Singkil. Serah terima jabatan kedua perwira ini dilaksanakan dalam upacara khusus di halaman Mapolres Aceh Utara di Lhoksukon, Senin (12/9) pagi. Bersamaan dengan itu, juga diserahterimakan tiga jabatan Kapolsek di jajaran Polres Aceh Utara yang ikut dimutasi yakni Kapolsek Nibong, Kapolsek Tanah Jambo Aye dan Kapolsek Seunuddon. “Kapolsek Seunuddon Iptu Mukhtar dan Kapolsek Tanah Jambo Aye Iptu Mardan P diroker. Muktar dipindahkan ke Tanah Jambo Aye dan Mardan ke Seunuddon. Sementara Kapolsek Nibong Ipda Junaidi menempati jabatan baru sebagai Kasi Propam Polres Aceh Utara. Posisi lamanya digantikan mantan Kasi Propam sebelumnya Ipda M Jafar G Pase,” kata Kasubbag Humas Polres Aceh Utara Ipda Zamzami A. (cmus)

IRT Tewas Diseruduk Sepeda Motor PANTONLABU (Waspada) :Yusnida Lida, 49, seorang ibu rumah tangga asal Desa Rawang Iteik, Kecamatan Tanah Jambo Aye, Aceh Utara, tewas mengenaskan setelah sepeda motor yang ia tumpangi diseruduk sepedamotor Yamaha Vixion, Minggu (11/9) sekitar pukul 09:00. Kecelakaan lalulintas maut ini terjadi di jalan nasional kawasan Desa Rawang Iteik, sekitar 1,5 Kilometer dari Panton-labu. Begitu kejadian, sepeda motor yang menabrak korban langsung kabur dan sampai Senin (12/9) identitas dan keberadaannya belum diketahui. Kapolres Aceh Utara AKBP Farid BE melalui Kasat Lantas Iptu Andri Permana menjelaskan, korban menderita luka berat di bagian kepala. Dia meninggal di kawasan Jeunib saat dalam perjalanan rujukan dari RS TNI AD Lhokseumawe ke RS Banda Aceh. “Korban dibonceng Nurul Auli, 14, juga warga Rawang Iteik. Mereka melaju dari arah Medan menuju Lhokseumawe dengan Supra X 125 BL 3691 QC. Setiba di lokasi kejadian, mareka berbelok ke kanan dan pada saat bersamaan dari arah belakang tiba-tiba munculVixion berkecepatan tinggi dan menyenggol sepeda motor korban,” kata Iptu Andri. (cmus)

Pemuda Ngaku Intel Masih Diperiksa Intensif

Penerbangan Di Bandara SIM Banda Aceh Berangkat (flight, tujuan, waktu)

GA 146 Jakarta/Medan


GA 147 Medan/Jakarta


Y6 537 Medan


Y6 538 Medan


JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


AK 305 Kuala Lumpur *


AK 306 Kuala Lumpur*


FY 3401 Penang **


FY3400 Penang **


Batavia Air Lion Air

Sriwijaya Air Air Asia Fire Fly

* Setiap Senin, Rabu , Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

Telat Kerjaan PR

Siswa SD Seunuddon Dianiaya Guru PANTONLABU, Aceh Utara (Waspada) : Amartuna, 12, siswa kelas IV SD 6 Seunuddon, Senin (12/9) terpaksa dilarikan ke ruang UGD Puskesmas Alue Puteh, Baktiya, Aceh Utara, karena bocah ini mengaku dianiaya guru matematikanya, MJ pada Jumat (9/9).

“MJ marah-marah karena anak saya telat buat PR Matematika. Awalnya dijewer. Lalu ditempeleng dan ditinju. Bahkan anak saya juga sempat ditenteng sambil dicekik,” aku A Thaleb, 60, ayah korban saat ditemui Waspada di Puskesmas Alue Ie Puteh,Baktiya, kemarin petang. Warga Desa Tanjong Geu-

lumpang, Kecamatan Baktiya ini, menambahkan, Amartuna sudah sempat dibawa ke Puskesmas Baktiya pada hari kejadian. Namun, karena kondisinya ketika itu belum mengkhawatirkan, ia hanya divisum oleh dokter, lalu dibawa pulang lagi ke rumah. “Sehari setelah kejadian, Amartuna mulai mengeluh sulit mendengar dan sulit menelan makanan. Tenggorokannya sakit. Bahkan ia sempat pingsan. Makanya, dia langsung kami larikan ke Puskesmas,” ujar Juwairiyah, 45, istri A Thaleb. Keluarga Amartuna mengaku keberatan dengan prilaku MJ dan yang bersangkutan telah dilaporkan ke Mapolsek Seunuddon, Jumat (9/9) lalu. “Tapi sampai hari ini, MJ belum ditahan,” jelas A Thaleb. Kepala SDN 6 Seunuddon, Ibrahim, yang dikonfirmasi terpisah membenarkan salah

seorang gurunya berinisial MJ menganiaya Amartuna. Namun Ibrahim tidak tahu persis bagaimana kronologisnya karena saat kejadian ia sedang berada di luar sekolah. “Yang pasti kasus itu sudah kita selesaikan secara kekeluargaan. Pihaknya sudah sepakat berdamai dan semua biaya pengobatan ditanggung MJ,” katanya. Terkait pernyataan ini, A Thaleb, ketika dikonfirmasi ulang menegaskan, pihaknya sudah menganggap upaya damai itu batal karena MJ sendiri tidak menunjukkan itikad baik dan keseriusannya untuk berdamai. “Jangankan menitipkan biaya berobat, menjenguk saja tidak. Ketika upaya damai tersebut dilakukan, ia hanya diwakili oleh adiknya dan anak saya hanya diberi uang Rp50 ribu,” kata A Thaleb. (cmus)

Fraksi PA Pertanyakan Kas Bon Rp7,3 M BIREUEN (Waspada): Fraksi Partai Aceh (PA) DPRK Bireuen mempertanyakan kas bon yang belum dikembalikan oleh Kuasa Bendahara Umum Daerah (BUD) Rp7,3 miliar lebih. Demikian dikatakan Fadli M Yusuf pada Rapat Paripurna Penyampaian Pandangan umum Fraksi-fraksi terhadap Rancangan Qanun Pertanggungjawaban Pelaksanaan APBK Tahun 2008 dan APBK Tahun 2009, Senin (12/9). Dia menyebutkan, hingga 31 Desember 2009, Pemkab Bireuen belum menentapkan pembebanan atas kas bon tersebut dengan Surat Keterangan Tanggungjawab Mutlak (SKT JM). “Apa penyebabnya, dan bagaimana tindak lanjut yang sudah dilakukan,” ucap Fadli. Lebih lanjut pada sidang yang berlangsung di ruang sidang DPRK Bireuen itu, Fadli mempertanyakan saldo kas Rp78.196.594.640,32 kurang diyakini kebenarannya. Pasalnya, selisih kurang kas pada tahun 2008 yang tidak dapat dijelaskan Rp26.461.483,43.

Begitupun selisih pendapatan dalam APBK samnpai dengan 31 Desemnber 2009 sebesar Rp4.773.430.000 yang belum jelas sumbernya, sementara Dinas Pengelola Keuangan dan Kekayaan Daerah (DPPKD) belum memberikan keterangan secara rinci. Sementara Fraksi Demokrat

Amanat dalam pandangan umumnya yang dibacakan M Fauzi meminta eksekutif agar memberikan penjelasan tentang PAD dan penerimaan Dana Bagi Hasil Bukan Pajak yang tidak mencapai target, serta sisa kurang pembiayaan anggaran tahun 2008 sebesar Rp10.108.795.059,10. (cb03)

Puluhan Grup Band Ikut Festival Yamaha Di Kota Langsa LANGSA (Waspada) : Puluhan kelompok band dari Kota Langsa, Aceh Tamiang, Aceh Timur dan Kota Lhokseumawe ikut memeriahkan Yamaha Festival Band yang digelar di lapangan Kompi B, belakang pendopo Bupati Aceh Timur di Kota Langsa, Senin (12/9). Kegiatan yang diselenggarakan PT Alfa Scorpii, sebuah perusahan penyalur resmiYamaha dari Kota Medan mendapat sambutan antusias dari kalangan rtemaja Kota Langsa. Mereka selain mengikuti festival band juga menjadi peserta dalam pemilihan agam dan inong serta idol junior bagi anak-anak. Yang ikut festival band berjumlah 42 grub band, pemilihan agam dan inong diikuti 70 peserta dan idol junior 20 peserta. Menurut Promotion Dan Motorsports ManagerYamaha Medan Yong Ting Lee, bagi para pserta yang mendapat juara 1,2, dan 3 dalam festival di Kota Langsa akan diundang untuk ikut festival tingkat regional yang diadakan di Medan, 18 September mendatang. (b22)

Abang Nodai Adik Kandung Hingga Melahirkan Kasusnya Diselesaikan Secara Adat

LHOKSUKON (Waspada) : SKW, 22, pemuda asal Blang Reuma, Kecamatan Jungka Gajah, Aceh Utara, yang diciduk Sat reskrim Polres Aceh Utara gara-gara mengaku sebagai intel, sampai Senin (12/9) masih diperiksa intensif di Mapolres Aceh Utara, di Lhoksukon. “Catatan kriminal SKW belum jelas. Dia masih diperiksa ulang oleh penyidik. Yang pasti, meski tidak melakukan kejahatan lain, tindakan SKW yang mengaku diri sebagai intel, merupakan perbuatan melawan hukum dan bisa diproses,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kasat Reskrim AKP Suwalto. Seperti diberitakan, SKW diciduk anggota Sat Reskrim Polres Aceh Utara di sebuah bengkel di kawasan Simpang Ceubreik, Kecamatan Syamtalira Aron, Aceh Utara, Minggu (11/9). Dia ditangkap atas dasar informasi masyarakat dan darinya turut diamankan sebilah sangkur rakitan, mirip rencong. (cmus)

Tiba (flight, asal, waktu) Garuda Indonesia


AMARTUNA didampingi ibunya Juwairiyah dirawat di Puskesmas Alue Ie Puteh,Baktiya, Senin (12/9) karena dianiaya guru Matematikanya akibat tidak mengerjakan PR.

BLANGPIDIE (Waspada) : Kelakuan Nas, 38, terbilang cukup bejat dan sangat keterlaluan serta mencoreng nama kampong. Bagaimana tidak, Yus, 28, adik kandungnya sendiri dinodai hingga hamil dan melahirkan seorang bayi laki-laki dari hasil hubungan terlarang keduanya. Kasus yang menghebohkan warga Desa Kepala Bandar, Kecamatan Susoh, Aceh Barat Daya (Abdya) tersebut sempat ditutup-tutupi oleh aparatur di sana karena dinilai sebuah aib yang memalukan. “Kita menginginkan agar kasus tersebut tidak sampai dipetieskan begitu saja, karena kita khawatirkan bila hukum tidak ditegakkan tentu kedepan kasus-kasus seperti ini berpotensi muncul kembali, apalagi ini sebuah perbuatan amoral yang jelas harus diselesaikan secara tegas,” tutur Jakani, 44, tokoh pemuda Desa Kepala Bandar, Senin (12/9). Keucik Desa Kepala Bandar, Yasin Banta, terkait kasus tersebut membantah bila ingin menutupi kasus tersebut, namun pihaknya beralasan ingin menyelesaikan persoalan tersebut secara adat dan kelembagaan di tingkat desa, karena status

kedua pelaku masih sedarah. Walaupun demikian, menurut Keucik Yasin Banta, dirinya telah melakukan koordinasi dengan pihak Muspika kecamatan terkait penyelesaian kasus yang dinilai mencoreng nama baik desa tersebut. “Bukan menutupi pak, tapi kami masih mencari solusi terbaik dan kami juga sudah melakukan koordinasi dengan pihak Muspika seperti kapolsek serta danramil, kita menunggu bagaimana sebaiknya penyelesaian terhadap kasus tersebut,” ujar Keucik Kepala Bandar Yasin Banta. Kapolsek Susoh Ipda Darwis mengaku bahwa pihaknya sempat dititipkan oleh kepala desa pelaku yang berinisial Nas tersebut untuk menghindari sikap anarkis dari masyarakat, namun demikian kapolsek beranggapan kasus tersebut bukan lagi kewenangan pihak kepolisian karena tidak ada unsur pidananya, sehingga si pelaku sudah diserahkan ke pihak WH (Wilayatul Hisbah/Polisi Syariat) untuk penyidikan selanjutnya. “Pelaku bukan kami tahan, tapi dia titipan dari aparatur desa untuk menghindari terjadinya reaksi anarkis dari masyarakat, kita tidak dapat mem-

proses yang bersangkutan, jadi kemarin langsung kita serahkan kepihak WH untuk penyidikan kasus tersebut selanjutnya,” jelas Kapolsek Susoh Ipda Darwis. Kepala Satpol PP dan WH Abdya Mudatsir membenarkan pelaku telah diserahkan ke WH dan kini sedang dalam proses penyidikan. Pihak WH akan mengumpulkan keterangan lain terkait kasus tersebut, namun dirinya memastikan bahwa kedua pelaku memiliki hubungan keluarga berupa abang dan adik kandung. Informasi yang dihimpun dari sejumlah pihak, Nas dan Yus diketahui memiliki anak dari hasil hubungan gelap keduanya yang dilakukan di rumah mereka yang terletak di tengah persawahan. Informasi lain juga menyebutkan, bayi dari hasil hubungan mereka yangdilahirkan beberapa minggu lalu di salah satu bidan di Aceh Barat telah diadopsi oleh pihak tertentu karena ketiadaan biaya persalinan serta perawatan. “Anak dari hasil hubungan mereka diadopsi oleh seseorang, kita berharap kasus ini dapat diusut secara tuntas,” ungkap salah seorang warga. (csdp)

LHOKSEUMAWE (Waspada) : Sekitar 78 pedagang kaki lima dari Pasar Geudong, Kecamatan Samudera, Aceh Utara mengadu ke PBHAM karena mendapat intimidasi penggusuran. Didampingi aktivis PB-HAM, mereka mengadu ke DPRK agar mendapat jaminan untuk bisa berjualan kembali, Senin (12/9). Para pedagang didampingi aktivis PB-HAM, Zulfikar Muhammad diterima KomisB dan Komisi D DPRK Aceh Utara. Sebelum melakukan pertemuan dengan wakil rakyat, Zulfikar menjelaskan, para pedagang takut intimidasi dari pihak tertentu. “Mereka akan digusur bila tidak memindahkan lapak jualan mereka di depan Pasar Geudong,” jelas Zulfikar Muhammad. Sementara itu dalam pertemuan dengan Komisi B dan D terungkap, Pemerintah Aceh Utara telah mengadakan musyawarah dengan para pedagang di Samudera. Dalam pertemuan pertama 7 Mei 2011, pemerintah daerah akan menertibkan Pasar Geudong dengan memindahkan para pedagang. Pemkab menawarkan dua pilihan. Pertama, pindah ke pasar lantai dua, kedua pindah ke lokasi terminal. Pada pertemuan kedua, 27 Juli 2011, para pedagang setuju dipindah ke kawasan terminal dengan syarat mendapat lokasi yang layak. Namun dalam dalam rapat DPRK Aceh Utara yang dihadiri Wakil Ketua DPRK Aceh

Utara Misbahul Munir, para pedagang bersikeras tidak akan pindah dari depan toko, karena belum ada lokasi baru yang layak. “Kami harus mendapatkan kejelasan tempat yang layak,” tegas M Halim,36, dalam pertemuan yang ikut dihadiri Nudli (Kepala Dinas Kebersihan, Pasar dan Pertanaman Aceh Utara), Badli (Kadis Perhubungan dan Pariwisata, Mehrabsyah (Kadis Industri), dan Bahrum (Kepala Satpol PP). Setelah mendengarkan keluhan pedagang, anggotra DPRK Tgk Junaidi menegaskan, tidak boleh ada penggusuran sebelum disediakan tempat baru untuk padagang. Wakil Ketua DPRK Aceh Utara Misbahul meminta seluruh dinas yang berkaitan dengan masalah tersebut harus turun langsung ke lokasi untuk menyelesaikan masalah tersebut. “Bila membutuhkan anggaran mendesak, harus kita upayakan mendahului,” tegas Misbahul. Forum Komunikasi Saudagar Toko (Fokus Toko) Samudera sebelumnya juga mendatangi DPRK Aceh Utara untuk meminta penertiban Pasar Geudong. “Bahkan kita telah mengadakan rapat dengan Muspika Samudera,” tegas Ketua Fokus Toko Bachtiar. Dalam rapat terakhir dengan camat dan para kepala dinas terkait, Pemkab berjanji akan melakukan penertiban segera. “Bila tidak juga dilakukan penertiban, para pedagang akan mogok,” tambah Bachtiar. (b17)

Ketua BKPRMI Aceh Utara Minta Polisi Tangkap Pelaku Penganiaya Khatib ACEH UTARA (Waspada) : Yusuf Hamba, Ketua Badan Komunikasi Pemuda Remaja Masjid Indonesia (BKPRMI) Aceh Utara dan Lembaga Swadaya Masyarakat Tim Advokasi Masyarakat Pasee (TAMPA) meminta pihak kepolisian profesional dalam menyelesaikan kasus pemukulan khatib shalat Jumat di Masjid Keumala. Pasalnya, hingga saat ini, polisi belum menangkap semua pelaku pemukulan terhadap Tgk Saiful Bahri, khatib Jumat. Hingga kini, polisi masih melakukan pengumpulan barang bukti, termasuk salah seorang anggota DPRK Pidie yang hingga kini masih menunggu surat izin dari Gubernur Aceh. “Kami dari Tim Advokasi Masyarakat Pasee (TAMPA) mengharapkan Gubernur Aceh agar segera mengeluarkan surat izin untuk proses pemeriksaan terhadap Ilyas Abu Bakar, anggota DPRK Pidie dari Fraksi Partai Aceh (PA) yang terlibat aksi pemukulan terhadap Tgk Saiful Bahri. Kami juga berharap pihak kepolisian

dapat bekerja profesional tanpa intervensi pihak manapun, semua pelaku harus diberikan hukuman yang setimpal,” kata Eka Januar, Koordinator TAMPA dan Safaruddin, Ketua Badan Komunitas Budaya Negeri (BKN). Eka dan Safaruddin meminta partai politik khususnya di Aceh agar mengoreksi semua kadernya terutama yang duduk di kursi legeslatif. Mereka harus orang-orang yang mempunyai integritas moral dan ilmu pengetahuan yang memadai. Kalau tidak, dikhawatirkan marwah legislatif akan tercoreng oleh mereka yang bermental buruk. Yusuf Hamba, Ketua BKPRMI Aceh Utara mengatakan, aksi pemukulan yang dilakukan oleh anggota DPRK Pidie terhadap khatib jumat telah membuat umat Islam di seluruh dunia menangis. Kata dia, aksi pemukulan tersebut merupakan tindakan penistaan agama kepada ajaran AlQuran dan Hadist Rasulullah. Sakitnya lagi, peristiwa tersebut terjadi di Bumi Serambi Mekkah. (cmun)

Wali Kota Subulussalam Ancam Tunda Tandatangani SK CPNS SUBULUSSALAM (Waspada) : Wali Kota Subulussalam mengancam menunda menandatangani SK 100 persen 16 Calon Pegawai Negeri Sipil (CPNS) dalam lingkup Pemko Subulussalam. Sementara sejumlah CPNS yang belum mengikuti prajabatan ditunda mengikutinya. Ancaman itu disampaikan Wali Kota Sakti pada apel hasil isnpeksi mendadak (sidak), Senin (12/9) di halaman wali kota setempat, menyusul sidak yang dilakukan Wakil Wali Kota Affan Bintang di lingkungan Setdako, sejumlah dinas, badan kantor dan Setcam se-Pemko Subulussalam pada hari pertama kerja, Senin (5/9) silam. Menurut Sakti, ketidaksiplinan para PNS, CPNS maupun kontrak/honorer dengan mem-

perpanjang libur Idul Fitri tidak bisa ditolerir. Karenanya, kepala bagian kepegawaian Setdako diminta mencari aturan dan ketentuan yang bisa diberi sanksi terhadap pelanggaran itu. Namun Sakti memastikan menunda penandatanganan SK kenaikan 100 persen 16 CPNS dan memerintahkan kabag terkait menunda memberi kesempatan mengikutI prajabatan bagi para CPNS yang absen hari pertama aktif kerja. “Saudara Kabag, pastikan para CPNS yang absen pada tanggal lima lalu dan tunda mereka mengikuti prajabatan,” tegas Sakti. Sementara terhadap tenaga kontrak/honorer, Sakti minta para Kepala dinas, badan dan kantor terkait lebih proaktif melakukan pembinaan. (b33)

Kasus Laptop 2009

LSM Minta Kejari Blangkejeren Usut KPA Dan PPTK Dikpora BLANGKEJEREN (Waspada): Lembaga Swadaya Masyarakat Pemantau Korupsi dan Penyelamat Harta dan Negara (Perlahan) melalui Ketuanya Syukran meminta Kepala Kejaksaan Negeri Blangkejeren, menyeret Kuasa Pengguna Anggaran Syamsul Bahri, Pejabat Pelaksana Kegiatan Khalidin dan Kabid Bina Program M Noh terkait kasus pengadaan 150 unit notebook dengan Pagu Anggaran Rp2.250.000.000. Sesuai hasil penelitian di lapangan, Syukran menilai kasus ini hanya kontraktor saja yang dijadikan sebagai tumbal guna menutupi semua keterlibatan KPA, PPTK dan Tim 100 persen. “Logika hukumnya KPA selaku Pemberi Pekerjaan (Obligee) dan Hidayat sebagai Penyedia Jasa (Principal), jika memang kontraktor salah dalam membeli barang tidak sesuai dengan spesifikasi, mengapa Kuasa Pengguna Anggaran setuju menerima barang tersebut, bahkan berani membubuhkan tandatangan dalam Berita Acara Serah Terima Pekerjaan

No.642/32/Otsus-Dikpora/2009 tanggal 03 Desember 2009, apakah ini belum cukup sebagai bukti kalau KPA dan PPTK Dikpora Gayo Lues terbukti secara syah melawan hukum,” ungkap Syukran, Senin (12/9). Kasus ini bermula, akibat dari surat sanggahan yangditerima Kejari Blangkejeren dari PT. Alas Putra yang dipinjam pakaioleh Marzuki Bentara Mas dariWiwin TeddyVernando, karena PT Alas Putra Kalah dalam tender bebas ketika itu. Bahkan, kata sumber itu, Marzuki sempat mencabut kembali surat sanggahannya karena sudah menerima uang mundur dari pihak pemenang tender. Aktivis dua Lembaga, Syamsir BA, Pengurus inti GerakanNasional Pemberantasan Korupsi (GNPK) Gayo Lues dan Syamsudin Said dari LSM-PHP mengatakan, Hidayat (penyedia jasa) hanya salah satu dari rangkaian mata rantai hukum dalam kasus itu. (cjs)

Anggota DPRK Aceh Tamiang Tak Masuk Kerja, Gaji Tetap Dibayar KUALASIMPANG (Waspada) : Anggota DPRK Aceh Tamiang SA dari Partai Bintang Reformasi (PBR) sudah lama tidak masuk kerja, tetapi gajinya dan tunjangan lainnya sebagai anggota dewan tetap dibayar oleh pemerintah melalui Sekretariat DPRK setempat. Kasus itu sudah berlangsung lama, namun tidak ada pihak yang berani mengusutnya, bahkan terjadi praktik pembiaran yang mengangkangi peraturan hukum yang berlaku. Pantauan Waspada, anggota DPRK Aceh Tamiang ituyang sebelumnya bergabung dengan Fraksi Muda Sedia (Fraksi Gabungan) memang sudah lama tidak pernah hadir atau tidak terlihat menjalankan tugasnya sebagai anggota dewan. Bahkan hampir setiap sidang paripurna, pansus komisi-komisi ke lapangan serta kegiatan lain yang berhubungan dengan tugasnya tidak pernah hadir, namun gajinya serta tunjangan lainnya tetap saja dibayar. Modus permainan ini sudah berlangsung lama dan belum pernah sekalipun diusut oleh aparat hukum di daerah ini, bahkan diduga kuat semua pihak sudah tutup mata terhadap permainan. Ketua Badan Kehormatan Dewan (BKD) DPRK Aceh Tamiang Bukhari didampingi anggota BKD H Syaiful Sofyan, Senin (12/9)

mengakui anggota DPRK Aceh Tamiang SA sudah lama tidak pernah hadir untuk jalankan tugasnya sebagai anggota dewan. “Saya saja sudah lama sekali tidak pernah ketemu dengan dia di DPRK Aceh Tamiang ini, begitu juga pada sidang-sidang paripurna,” ungkap Bukhari yang diamini oleh Syaiful Syofian. Menyangkut tentang persoalan tersebut, kata Bukhari, pihaknya sudah pernah menyampaikan hal tersebut kepada Ketua Fraksi Partai Demokrat Jafar Ketong karena SA sudah pindah dari Fraksi Muda Sedia ke Fraksi Partai Demokrat. “Kalau soal absensinya dan kenapa gajinya masih juga dibayar, padahal dia tidak hadir menjalankan tugasnya sebagai anggota dewan tentu saja hal itu nanti akan saya tanya pada Sekretariat atau pada bagian keuangan,” kata Bukhari. Sedangkan menyangkut dengan apakah oknum anggota dewan itu sudah melanggar kode etik atau tidak, Bukhari menyatakan dirinya engan mengomentarinya. “Tetapi kami akan sikapi kasus ini dan melaporkannya kepada pihak terkait,” tegas Bukhari. Anggota DPRK Aceh Tamiang yang selama ini makan gaji buta itu ketika coba dicari Waspada untuk dimintai komentarnya ternyata tidak berhasil. (b24)


WASPADA Selasa 13 September 2011

Parlementaria DPR Kota Banda Aceh

Dewan Pertanyakan Status Sewa Tanah Eks Terminal Setui Dewan Perwakilan Rakyat Kota (DPRK) Banda Aceh mempertanyakan tentang status perjanjian sewa menyewa bekas terminal Setui antara Pemko Banda Aceh dengan PT Citra Karsa (PT CK) senilai Rp271.357.842,Pasalnya, perjanjian sewa menyewa antara Pemko dengan PT. CK dengan jangka waktu selama lima tahun, itu di nilai dewan bermasalah.”Walikota perlu memperjelas bagaimana status tanah itu, siapa dan bagaimana sistem pengelolanya,dan kompensasi apa yang diperoleh Pemko dari pihak ketiga tersebut,” ungkap Surya Mutiara, dalam pemandangan umumnya terhadap Raqan Pertanggungjawaban Pelaksanaan APBK Banda Aceh TA 2010, di gedung DPRK Banda Aceh, Jumat (9/9). Menurut politisi dari PKS, itu tanah bekas terminal Setui milik Pemko Banda Aceh seluas 8.169 M2, diserahkan pengelolaannya kepada PT.CK sesuai perjanjian sewa menyewa No.8/PJ/2010 tertanggal 10 Maret 2010, berlaku jangka waktu lima tahun. Namun, kata Surya, sesuai Laporan Hasil Pemeriksaan (LHP) BPK RI Perwakilan Aceh, pihak PT.CK selaku pengelola pada tahun 2010 baru membayar kontribusi sebesar Rp 50 juta, dari kewajibannya sebesar Rp 271.357.842,Selain itu, sebut Surya, PT.CK tidak mengasuransikan eks Terminal Setui dari bencana pada perusahaan asuransi yang dapat dipertanggungjawabkan sebagaimana disepakati dalam pasal 11 perjanjian sewa menyewa. Begitu juga, PT.CK belum membangun fasilitas pendukung sebagaimana yang diperjanjikan dalam klausul perjanjian senilai Rp 5.028.975.000,- terdiri Funland, Restoran, Kantor/ Gudang, Futsal station dan Entrance Gate. PT.CK baru membangun restoran dan belum memenuhi fasilitas lainnya seperti disyaratkan dalam perjanjian. Anehnya lagi, ungkap Surya, tanpa sepengetahuan Pemko pada 7 Januari 2011 objek perjanjian (eks terminal Setui), telah dialihkan kepada pihak lain berdasarkan perjanjian Kemitraan Kerjasama Operasional (KSO) No.01/KSO/2011 dan digunakan sebagai usaha restoran warung kopi “SKA”. Padahal,dalam perjanjian sewa menyewa No.08/PJ/2010 pasal 12, dengan tegas disebutkan bahwa pihak kedua (PT CK) Dilarang mengalihkan hak sewa atas objek sebagaimana dimaksud pada pasal 4 ayat (1) kepada pihak lain kecuali atas persetujuan pihak pertama (Pemko Banda Aceh). Akhirnya, Pemko berdasarkan surat Walikota No.030/0611 tertanggal 27 April 2011 telah melakukan pemutusan perjanjian kerjasama dengan PT CK. Namun, kata Surya, sampai saat ini PT. CK yang telah menikmati aset daerah itu belum melunasi setoran kontribusi sebagaimana disyaratkan. Akibatnya, status penggunaan eks Terminal Setui sampai saat ini tidak ada kejelasan. Begitu juga, belum diketahui bagaimana klausul perjanjian antara Pemko Banda Aceh dengan pengelola restoran/warkop “SKA”. “Karenanya, kami mendesak walikota agar pro aktif melakukan penagihan kepada PT.CK untuk melunasi sisa biaya sewa sebesar Rp221.357.824,lagi. Sebab, putusnya perjanjian kerjasama tidak menggugurkan kewajiban untuk membayar sewa tahun pertama kepada Pemko,” tutur anggota dewan yang vokal ini. Pada bagian lain, pemandangan umumnya, Surya juga menyoroti perjanjian kerjasama pengelolaan pabrik es kapasitas 30 ton perhari milik Pemko dengan PT AS serta kerjasama pengelolaan Gedung IT Learning Centre dengan PT SOH, yang berdasarkan hasil pemeriksaan BPK juga bermasalah. (adv)

Banyak Kasus ‘Menggantung’ Di Polres Abdya BLANGPIDIE (Waspada) : Beberapa kasus ‘besar’ yang diketahui publik yang ditangani Polres Aceh Barat Daya (Abdya) hingga saat ini belum diketahui perkembangan kelanjutannya. Kasus-kasus tersebut terkesan seperti ‘menggantung’ dan dipeti-eskan, sehingga membuat keraguan di masyarakat bila kasus-kasus tersebut akan tertangani secara tuntas dan jelas. Kasus-kasus besar seperti pemukulan Sumitro, Bendahara SIGAPP oleh anggota DPRK Abdya dari Partai Demokrat, kasus korupsi gudang sosial, kasus pemukulan warga oleh Sekda Abdya Yufrizal S Umar, kasus penipuan dan dugaan jual beli izin pertambangan biji besi yang melibatkan PT Waja Niaga, kasus DAK serta dana BOS yang melibatkan sejumlah kepala sekolah dan oknum pejabat di Dinas Pendidikan Abdya serta seabrek kasus lainnya yang menurut banyak pihak pernah dan sudah ditangani pihak Polres Abdya. Namun anehnya kasus-kasus tersebut seakan menghilang tanpa jejak dan tidak diketahui lagi perkembangannya. “Kasuskasus besar itu mungkin pernah kita dengar, kalo memang kasus tersebut sudah di-SP3 (diberhentikan) penyidik tentu ada alasan yang tepat, namun kasus tersebut terus disidik tetapi nggak jelas ujungnya. Sayai pernah mendengar beberapa kepala sekolah dan pejabat Disdik berulang kali diperiksa, namun kejaksaan memberi informasi kasus tersebut belum ada SPDP (laporan),” ungkap aktivis LSM di Abdya, Senin (12/9). Aktivis LSM Gerak Aceh Askhalani menyarankan agar Kapolres Abdya AKBP Subakti bersikap legowo dengan mengundurkan diri dari posisinya karena dinilai tidak mampu menjalankan instruksi Kapolri dengan menangani kasus-kasus secara tuntas, khususnya kasus tipikor. Kapolres Abdya AKBP Subakti beberapa kali hingga berita ini diturunkan tidak memberikan respon apapun, demikian juga dengan sejumlah pejabat lainnya. (csdp)

Pasien JKA RSUD Gayo Lues Dirugikan BLANGKEJEREN (Waspada): Sejumlah pasien Jaminan Kesehatan Aceh (JKA) merasa dirugikan ketika berobat ke Rumah Sakit Umum Daerah Sangir Kabupaten Gayo Lues. Pasalnya sebagian obat yang ditanggung JKA tidak disediakan rumah sakit yang bekerjasama dengan PT Askes. Akibatnya, pasien yang berobat harus mengeluarkan uang untuk membeli obat ke apotik lain. Demikian Ketua LSM (Lembaga Swadaya Masayarakat) Perlahan (Pemantau Korupsi dan Penyelamat Harta Negara) Syukran dan ketua LSM Gamuse (Gayo Lues Musara Ate) Mustafa Kamal Gayo. Hal itu berdasarkan pengaduan beberapa pasien yang pernah berobat ke RSUD Sangir, pekan lalu. “Ini sungguh konyol, seolah-olah pihak PT. Askes dan Apotik Taufik tidak menghargai Kartu Jaminan Kesehatan Aceh (JKA). Dengan dalih setelah pasien keluar dari RSUD akan diganti uangya, setelah kami telusuri, ternyata banyak sekali Pasien yang datang dari kecamatan tidak dikembalikan lagi uangya” kata Syukran dan M. Kamal Gayo. Kedua aktivis ini memperkirakan, masyarakat enggan mengambil uang ganti rugi pembelian obat-obatan dari RSUD itu, disebabkan antara jumlah uang dengan biaya pengambilan tidak sebanding, sehingga masyarakat membiarkan ganti rugi pembelian obatnya mengendap di Bendahara RSUD. Direktur RSUD Sangir dr.Taufik Ririansyah ketika hendak ditemui Waspada ke RSUD Sangir tidak berada di tempat. Saat dihubungi ke HPnya dikatakan istrinya sedang rapat di DPRK, sedangkan beberapa jam setelah itu untuk dimintai keteranganya, HP nya sudah tidak aktif. Sufrizal, Direktur PT Askes cabang Gayo Lues, mengatakan kalau masalah Apotik Taufik sudah dilaporkannya ke PT Askes cabang Langsa, “Tanggal 22 ini, Kepala PT Askes cabang Langsa akan menuju ke Gayo Lues, guna mencari solusi, apakah kerjasama dengan Apotik Taufik akan berakhir atau lanjut,” jelasnya . (cjs)


Pendidikan Aceh Jalan Di Tempat BANDAACEH (Waspada) : Gubernur Aceh Irwandi Yusuf mengatakan, pengalokasian anggaran untuk pendidikan yang cukup besar, belum memberikan dampak yang signifikan terhadap pembangunan pendidikan di Aceh. “Ketika dana untuk pendidikan kita luncurkan dalam jumlah yang cukup besar, ternyata pendidikan masih jalan di tempat,” ujar Irwandi pada peringatan Hari Pendidikan Daerah (Hardikda) ke-52, Senin (12/9) di Banda Aceh. Dalam sambutan yang dibacakan Sekda Aceh T Setia Budi, Irwandi menambahkan persoalan krusial ini perlu per-

hatian. “Sebab sebelum ini banyak pihak mengeluhkan pembangunan pendidikan tidak berjalan dengan baik karena terkendala dana yang terbatas,” katanya. Menurut Gubernur Aceh ini, salah satu yang harus dilakukan dalam peringatan Hardikda adalah menginstropeksi diri terhadap kesalahan yang telah dilakukan dalam membangun pendidikan di Aceh. Sehingga hasilnya sampai saat ini belum menggemberikan. Indikasinya adalah bidang pendidikan masih berkutat dengan beragam persoalan yang kompleks. Mulai rendahnya mutu, perilaku anak didik yang semakin tak sesuai dengan karakter bangsa dan kearifan Aceh, terbatasnya akses pendidikan bagi anak kurang mampu, sampai rendahnya masyarakat yang melek aksara di Aceh. Karena itu, gubernur me-

minta dalam memperingati Hardikda jangan berlebihan dan cenderung mengagungkan masa silam, sementara masa depan yang lebih penting terabaikan. “Kita sering terjebak dalam euforia kejayaan masa lalu, sementara masa depan yang kita idamkan tenggelam,” kata Irwandi. Pihkanya mengakui masa silam Aceh cukup jaya dibidang pendidikan sehingga Aceh dikenal sebagai tamaddun di kawasan serantau. Aceh memiliki puluhan ulama berkaliber dunia yang cukup produktif menulis, sehingga mewariskan ratusan kitab dan meninggalkan ribuan murid. Gubernur menegaskan semua pihak harus berani dan jujur melakukan refleksi. Karena momennya sangat tepat untuk melakukan evaluasi menyeluruh pembangunan pendidikan di Aceh yang telah diprogramkan. (b04)

Disdik Aceh Berupaya Bangun Sekolah Rusak Akibat Gempa BANDAACEH (Waspada): Dinas Pendidikan Aceh berupa membangun kembali secepatnya dua sekolah masing-masing satu unit di Kecamatan Rundeng dan Sultan Daulat, Subulussalam yang rusak berat akibat bencana gempa yang melanda kawasan itu pekan lalu. “Kita sedang mencari sumber dana apakah dana dari bencana alam atau yang bersumber dari APBA yang dari bantuan,” ujar H Bahktiar, Kepala Dinas Pendidikan Aceh usai upacara peringatan Hardikda ke-52, Senin (12/9) di Banda Aceh. Dikatakannya, pihak Dinas Pendidikan sedang menghitung

kembali berapa besar biaya yang dibutuhkan untuk membangun kembali sekolah tersebut. “Kita akan laporkan kepada gubernur nanti setelah kita hitung,” tandas Bahktiar. Menuutnya, dua sekolah dasar dan madrasah di Rundeng dan Sultan Daulat merupakan dua sekolah yang rusak berat akibat gempa. Dan sampai saat ini murid kedua sekolah itu harus belajar di tenda karena dikhawatirkan gempa susulan. Bagi sekolah-sekolah lain yang ikut mengalami kerusakan ringan akibat dampak bencana gempa 6,7 pada Scala Reichter, juga akan dilakukan rehabilitasi.

“Sekolah yang lain kita rehab saja, yang mendesak dua sekolah ini,” tandasnya. Bakhtiar mengatakan, tindakan cepat yang bisa dilakukan Dinas Pendidikan untuk kelancaran proses belajar di Subulussalam dan Singkil, adalah berkonsultasi dengan gubernur apakah bisa digunakan dana yang bersumber dari APBA. Sementara data sementara di Badan Penanggulangan Bencana Aceh (BPBA) berdasarkan laporan Pemko Subulussalam dan Pemkab Aceh Singkil sebanyak 47 unit bangunan sekolah rusak berat dan 38 unit rusak ringan. (b04)

Utamakan Sektor Pendidikan Demi Kemajuan Daerah TAKENGEN (Waspada): Untuk meningkat pembangunan menuju kesejahteraan rakyat, dibutuhkan manusiamanusia memiliki SDM yang berkualitas, khususnya di dataran tinggi Gayo, Aceh Tengah. Karena itu hendaknya para putra-putri daerah yang menempuh pendidikan sampai ke perguruan tinggi , diharapkan suatu saat dapat memberikan kontribusi besar, mengembangkan potensi daerah. Demikian terang Dewan Pembina Keluarga Alumni Yogyakarta (KAGAYO), M.Syarif, dalam kata sambutannya, ketika dilakukan pelantikan pengurus perdana KAGAYO di GOS, Takengen, Aceh Tengah, Sabtu (10/ 9). Acara bersamaan dengan kegiatan halal bil halal antar alumni mahasisiwa asal Gayo

yang pernah menempuh pendidikan di Yogyakarta. “Saya merupakan alumni pertama, putra asal Gayo yang menyelesaikan pendikan di Universitas Gajah Mada, Yogyakarta. Kala itu (di tahun 50an) situasi berbeda 180 derajat dengan sekarang. Saya menempuh bangku kuliah dalam kondisi ‘pergolakan’politik yang tidak menentu. Namun berkat izin Allah SWT saya dapat juga menyelesaikan kuliah,”papar M Syarif. . Kendati mengalami kesulitan dalam meraih ‘titel’ namun ia berhasil menjadi putra pertama daerah Gayo yang menyelesaikan studi di Gajah Mada. “Saya waktu itu bekerja membantu orang sambil kuliah. Saya berharap para generasi muda saat ini yang menempuh pen-

didikan di luar daerah dapat mengambil pelajaran dari kisah ini. Artinya jangan ‘cengeng’ bila ada yang menimba ilmu di luar daerah.” Ketua terpilih KAGAYO, Aulia Putra, ketika menjawab Waspada, Sabtu (10/9) sore menyebutkan, tujuan dibentuknya organisasi alumni Yogyakarta untuk membangun potinsi yang ada di Tanoh Gayo di setiap sektor yang ada. “Selain itu, kami juga memiliki tujuan lainya yakni berupaya memberdayakan ekonomi rakyat di Gayo seperti Aceh Tengah, Gayo Lues dan Bener Meriah. Dan Semoga acara ini juga akan menjadi ajang silaturahim bagi seluruh alumni KAGAYO dan seluruh masyarakat,”ungkapnya. (cir)

Tujuh Mahasiswa Unimus Berprestasi Bebas SPP Setahun PEUSANGAN (Waspada) : Rektor Universitas Al Muslim Peusangan Bireuen H Amiruddin Idris menyerahkan penghargaan kepada tujuh mahasiswa berprestasi ekstra kurikuler tingkat nasional dan internasional di aula HMA Jangka, Minggu (11/9). Selain menyerahkan penghargaan, mahasiswa berprestasi itu dibebaskan membayar SPP setahun untuk tahun akademik 2011-2012 . Penghargaan yang dianugerahkan kepada tujuh mahasiswa, kata Rektor, telah berhasil mengantarkan nama

baik dan pencitraan Unimus Peusangan Bireuen di tingkat nasional dan internasional. Ketujuh mahasiswa yang mendapat penghargaan itu, Ulil Akbar program studi Bahasa Inggris FKIP meraih juara harapan I Lomba Pidato Bahasa Melayu Piala Perdana Menteri Malaysia di Kuala Lumpur. Ramadhan, program studi Bahasa Inggris FKIP meraih juara III MTQNM XII di Makasar. T Munzir Affan Fikom, juara harapan III Tartil MTQM di Makasar. Nurul Hidayah program studi Pendidikan Geografi FKIP

jamaah ini akan selesai akhir Desember 2011. “Untuk lantai luar, teras dan tangga luar telah rampung pembangunannya. Namun kubah, pintu dan lantai dasar bagian dalam sedang dalam proses pengerjaan,” ujarnya. Dia merincikan dari dana bantuan Rp5 miliar, sebanyak Rp2,370 miliar biaya telah dikeluarkan untuk pembangunan kubah. Di mana bahan baku digunakan untuk kubah masjid itu berupa lapisan mozaik dari luar negeri. ”Ada dua lapis mozaik yang digunakan untuk kubah. Tujuannya selain menciptakan keindahan dan daya tahan kubah lebih kuat, juga bahan

Agenda Damai JK Di Aceh BANDA ACEH (Waspada) : Mantan wakil Presiden RI, Jusuf Kalla tiba -tiba hadir di Aceh, Agenda menghadiri HUT Unsyiah 50 tahun hanya menjadi agenda yang tampak di publik, diluar itu pelaku perdamaian Aceh itu ternyata memiliki agenda meredam kisruh politik yang kinimelanda Aceh. Jusuf kalla bertemu dengan Irwandi Yusuf, sosok mantan petinggi GAM yang kini menjadi Gubernur Aceh, bersama Jusuf Kalla tampak delegasi damai RI Dr Farid Husein saat perjanjian damai yang dijembatani oleh mantan Presiden Finlandia, Martti Ahtisaari. JK dan Farid di jamu makan siang di kediaman pribadi Irwandi di Jalan Salam kawasan Lampriet Banda Aceh, dua jam bersama Irwandi, JK kemudian bertemu sejumlah petinggi mantan GAM lain di Insititut Perdamaian Indonesia yang dipimpin oleh Juha Christensen, di Kawasan Kampung Ateuk, Masih wilayah Banda Aceh.

Dua pertemuan tersebut tertutup bagi warta-wan, Farid Husien yang ditanya Waspada saat keluar dari kediaman Irwandi hanya menyebut agenda Jusuf Kalla hanya makan siang saja. “Cuma makan siang,” kata Farid. Senada dengan Farid, Irwandi Yusuf pun mengaku kehadiran JK adalah silaturahmi biasa, “Biasalah sudah lama tidak bertemu,” ungkap Irwandi. Ditanya tentang apakah JK mendiskusikan tentang kisruh politik pemilukada di Aceh, sambil tersenyum Irwandi hanya menyebut diskusi tema itu hanya sambil lewat saja. Begitu pun dalam diskusi sambil makan siang Jusuf Kalla menyinggung tentang pertemuannya dengan Malik Mahmud yang di kalangan mantan kombatan dikenal sebagai Mentro Malek, selebihnya Irwandi memilih diam tidak ingin berkomentar lebih jauh tentang kunjungan ketua Palang Merah Indonesia itu.(b32)

MEDAN (Waspada) : Gubernur Aceh H. Irwandi Yusuf membenarkan, gempa yang mengoncang Aceh lima hari lalu, diperkirakan menelan kerugian akibat kerusakan infrastruktur mencapai Rp 50 miliar. “Ini baru data awal dan belum final penataan kerusakan sejumlah infrastruktur dan bangunan-bangunan di Aceh,” ujar Irwandi Yusuf menjawab wartawan saat mendarat di Bandara Polonia Medan dari Singkil bersama Menko Kesra Agung Laksono, Sabtu (9/9) malam. Sementara Menko Kesra dan rombongan ke Aceh membantu tanggap darurat bencana alam gempa 6,7 SR Selasa (6/9) dinihari. Menurut Gubernur Aceh, tahap tanggap darurat, Menko Kesra melalui Badan Penanggulangan Bencana Nasional (BPBN) memberikan bantuan lebih kurang Rp 300 juta dan

akan Menko menjanjikan Mensos melalui BPBN akan mengirim bantuan lanjutan setelah final evaluasi kerugian gempa. Namun kerusakan terparah akibat gempa tersebut berada di Kota Subussalam Aceh bahkan dalam bencana alam itu seorang meninggal dunia. Sementara Singkil dan Aceh Selatan tidak begitu parah. Dari kerusakan-kerusakan bangunan berat dan sedang, rumah ibadah, bangunan perkantoran dan infrastruktur lainnya seperti jalan dan jembatan serta rumah ibadah masjid, madrasah dan gereja, kerugian awal diperkirakan mencapai Rp 50 miliar bahkan lebih. Hingga Jumat belum final pendataannya, kata IrwandiYusuf didampingiWakil Ketua MPR RI H Farhan Hamid dan H. Fadillah Murphi serta Tgk Sofyan Daud. (m32)

Kerugian Gempa Di Aceh Rp 50 M

Awasi Pilkada Di Perbatasan Bener Meriah-Aceh Timur REDELONG (Waspada): Panitia Pemilihan Pengawasan Pemilu (Panwaslu) Kabupaten Bener Meriah akan melakukan pengawasan tahapan Pilkada di beberapa desa di perbatasan Kabupaten Bener Meriah dan Aceh Timur. Penegasan ini disebutkan karena munculnya SK Gubernur Aceh yang kontroversi mengesahkan sejumlah desa milik Bener Meriah agar memilih di Aceh Timur. Al Hukama, Ketua Panwaslu Kabupaten Bener Meriah, Senin (12/9) mengatakan, pihaknya akan tetap melakukan pengawasan di Kampung Sarah Gele, Sarah Reje, Rubik, Sejudo dan beberapa kampung lainnya yang masuk dalam wilayah Kecamatan Syiah Utama, Bener Meriah, lalu diklaim Aceh Timur masuk dalam

wilayah Kecamatan Pante Bidari. “Kami melakukan pengawasan pada wilayah tersebut sesuai dengan KTP yang mereka miliki, nah kartu penduduk mereka jelas-jelas warga Bener Meriah. Maka selama Pilkada berlangsung kami tetap melakukan pengawasan di wilayah tersebut. Apalagi pihak KIP telah mendata daerah tersebut masuk dalam wilayah Bener Meriah dalam mengikuti tahapan Pilkada,” ujar Al Hukama. Masalah Gubernur telah mengeluarkan SK terhadap warga di sana memilih di Aceh Timur, walau mereka memiliki KTP Bener Meriah, Hukaman mengatakan, seharunya Gubernur dan pejabat Aceh Timur memahami psikologis masyarakat. (cb04)

GeRAK Minta Sekda Aceh Usut PNS Gunakan Mobil Dinas Untuk Mudik BANDAACEH (Waspada) : Gerakan Anti Korupsi (GeRAK) Aceh meminta Sekda Aceh mengusut tuntas penggunaan kendaraan dinas yang dipakai saat mudik lebaran dan menindak tegas PNS yang ditemukan menggunakan kendaraan dinas pada saat mudik lebaran. Kepala Divisi Kebijakan Publik GeRAK Aceh Isra Safril menyebutkan, tindakan tegas tersebut merupakan jawaban terhadap penindakan terhadap PNS yang tidak menaati larangan penggunaan kendaraan dinas. Hal itu berdasarkan arahan Sekretaris Daerah Aceh menjelang Idul Fitri 1432 H yang mengeluarkan imbauan kepada seluruh PNS agar tidak mempergunakan kendaraan dinas untuk keperluan pribadi dan keluarga khususnya pada saat mudik lebaran. Oleh karena itu, GeRAK meminta Pemerintah Aceh dan seluruh Pemkab/Pemko khususnya untuk mengeluarkan surat keputusan penggunaan operasional dinas khususnya

meraih juara harapan III Qiraah Sabah MTQM di Makasar. Hopi Prabasta program studi Bahasa Inggris FKIP meraih juara harapan II debat Bahasa Inggris antar mahasiswa se-Indonesia di USDYogyakarta dan maju ke ajang internasional di Kuala Lumpur. Sementara Runi Virenika program studi biologi DKIP meraih juara II bidang pencak silat kelas E putri pra PON 2011 di Batam dan Khairul Azmi program studi Bahasa Inggris FKIP meraih juara III Kenpo (embu/seni beregu) pra PON 2011 di Makasar. (b16)

Bensin Bercampur Air

itu nantinya mengeluarkan cahaya seperti berembun bila dilihat dari dalam masjid,” terang Mahmud. Selanjutnya untuk biaya lantai, teras dan tangga luar, menghabiskan dana Rp1,9 miliar. Dan untuk bagian dalam masjid karena masih dalam proses belum dirincikan secara pasti. Masjid Agung Ruhama itu sendiri, terang Mahmud, telah mengalami beberapa kali pemugaran. Namun masih dalam bentuk renovasi standar. Artinya karena minimnya dana, sebelumnya perbaiakan masjid di beberapa titik saja, tidak menyeluruh. (cir/b18)

REDELONG (Waspada) : Sebagian masyarakat pengguna kendaraan roda empat dan dua protes karena bensin yang mereka isi bercampur air di stasiun pengisian bahan bakar umum (SPBU) Teritit, Kecamatan Wih Pesam. Menindaklanjuti itu, aparat kepolisian mulai melakukan penyidikan, setidaknya beberapa saksi korban telah diperiksa dan dimintai keterangan oleh pihak Polres Bener Meriah. Termasuk Dinas Perindustrian dan Perdagangan (Disperindag) setempat. Kapolres Bener Meriah AKBP Drs Hari Apriyono melalui Kasat Reskrim Iptu Hartana, Senin (12/9) mengatakan, beberapa orang yang merasa dirugikan telah membuat laporan. Untuk menindaklanjuti laporan tersebut, pihaknya melakukan olah Tempat Kejadian Perkara (TKP). Menurutnya, berdasarkan keterangan semen-tara, tercampurnya bensin dengan air di SPBU Teritit dipicu kelalaian pihak SPBU, sehingga mengakibatkan sejumlah konsumen dirugikan. Dampaknya, sejumlah kendaraan milik warga yang mengisi bahan bakar minyak (BBM) di SPBU itu menjadi rusak. Iptu Hartana menambahkan, akibat kela-

Pembangunan Masjid Agung Ruhama Takengen Capai 70 Persen TAKENGEN (Waspada) : Renovasi pemugaran fisik bangunan Masjid Agung Ruhama, Aceh Tengah, telah mencapai 70 persen. Sarana ibadah umat Islam yang berdiri megah di jantung Kute Takengen ini menggunakan dana bantuan pemerintah Provinsi Aceh sebesar Rp5 miliar. ”Kini, pembangunan fisik masjid ini hampir rampung, kami perkirakan perbaikannya tinggal 30 persen lagi,” jelas H Mahmud Ibarahim, Ketua Pengurus Masjid Agung Ruhama, Senin (12/9) di Baitul Mall Aceh Tengah. Menurutnya, target pembangunan fisik masjid yang mampu menampung 5.000

Waspada/Jaka Rasyid

GUBERNUR IrwandiYusuf menjamu mantanWapres RI, Jusuf Kalla di kediamannya Jalan Salam Lampriet Banda Aceh.

kendaraan dinas untuk tidak digunakan pada hari libur kantor dan hanya digunakan pada saat keperluan dinas. Ini merupakan salah satu langkah agar operasional dinas bisa efisiensi dan hemat anggaran. Penggunaan kendaraan dinas saat lebaran diketahui, setelah GeRAK Aceh bekerjasama dengan relawan yang tersebar di sejumlah kabupaten/kota di Aceh untuk memantau PNS yang menggunakan kendaraan dinas pada saat mudik. Ditemukan ada sejumlah PNS yang tidak mengindahkan larangan Sekda Aceh tetap menggunakan kendaraan dinas untuk mudik. Hasil temuan di lapangan oleh relawan GeRAK Aceh, kendaraan dinas yang ditemukan digunakan oleh oknum PNS pada saat mudik seperti yang terlihat di seputaran Kabupaten Aceh Utara dan Kotamadya Lhokseumawe, yaitu kendaraan dinas jenis minibus dengan Nopol BL 233 AT, BL 274 AT, BL 243 JA, BL 130 AT serta kendaraan dinas jenis pick up double cabin dengan Nopol BL 8092 AL.(cgto)

Polisi Periksa Saksi laian itu pengelola maupun petugas di SPBU itu dimungkinkan dikenakan sanksi hukum berkaitan dengan undang-undang perlindungan konsumen. Namun, katanya, untuk saat ini pihak pengelola SPBU itu belum dimintai keterangannya. Polisi Pasang Police Line Sejak awal kejadian aparat Polres Bener Meriah telah memasang garis pembatas polisi (police line) untuk menyegel SPBU Teritit yang dianggap bermasalah. Polisi menyegal satu mesin pompa bensin yang diduga bercampur air dan mengambil sampel untuk diperiksa. Polisi juga mengambil sampel dari beberapa kendaraan bermotor yang mogok. Hingga kini belum diketahui hasil penelitian sample bensin yang diambil oleh personel Reskrim Polres Bener Meriah. Sebelumnya dilaporkan, ratusan kendaraan bermotor yang mengisi bensin di SPBU Simpang Teritit, KecamatanWih Pesam, Kabupaten Bener Meriah mogok. Hal itu diduga telah berlangsung sejak, Jumat (9/9) malam hingga Sabtu (10/9). Imaduddin pemilik SPBU tersebut mengatakan akan membayar ganti rugi terhadap kendaraan yang rusak tersebut. (cb04)



WASPADA Selasa 13 September 2011

Angin Kencang Dan Ombak Besar Landa Selat Malaka IDI (Waspada): Sepekan setelah perayaan lebaran Idul Fitri 1432 hijriah, angin kencang dan ombak besar setinggi 2,3 meter kian mengancam perairan Selat Malaka, khususnya perairan Aceh Timur. Akibatnya, harga ikan basah disejumlah pasar tradisional kian melambung. “Dalam beberapa hari terakhir kondisi laut sedikit kacau. Artinya, berdasarkan pengakuan nelayan laut kini berombak dan angin kencang kian menjadi-jadi, sehingga banyak nelayan memilih tidak melaut,” ungkap Sekjen Panglima Laot Lhok Kuala Idi, Heriansyah kepada Waspada, senin (12/9) di Idi. Dikatakan, akibat kondisi laut yang tidak stabil mengakibatkan persediaan ikan basah di Tempat Pelelangan Ikan (TPI) di beberapa kecamatan pesisir kosong. Selain itu, akibat ombak besar dengan ketinggian mencapai 2,5 meter hingga 3 meter lebih puluhan Kapal Motor (KM) di Pelabuhan Pantai Perikanan (PPP) memilih tidak melaut sejak akhir pekan lalu. Saat disinggung perkiraan nelayan akan

kembali melaut? Heriansyah mengaku sebagaimana keterangan nelayan, kondisi laut yang tidak normal sulit diprediksi nelayan bakal melaut, apalagi seperti tahun-tahun sebelumnya memasuki September hingga Desember adalah tergolong musim penghujan yang dapat mengubah kondisi laut berombak hingga beberapa meter. Kapolres Aceh Timur, AKBP Drs Ridwan Usman melalui KBO Satpol Air, Aiptu Zainir kepada Waspada membenarkan nelayan di beberapa dermaga di Aceh Timur, memilih tidak melaut karena angin kencang dan ombak besar kian mengancam. Bahkan, kelangkaan ikan dalam beberapa hari terakhir kian menjadi-jadi. Meski beberapa kapal nelayan tetap memberanikan diri melaut, sambung Aiptu Zainir, diharapkan para nelayan Kapal Motor (KM) yang melakukan penangkapan ikan di laut lepas agar selalu mengutamakan keselamatan jiwa. “Kita harap nelayan tetap melengkapi dokumen kapal dan memakai baju pelampung sebagai pengaman badan di saat terjadinya kecelakaan di laut,” tandas Zainir. (cmad)

Waspada/Muhammad H. Ishak

BEBERAPA Kapal Motor (KM) bersandar di dermaga Kuala Ranto Selamat, Kabupaten Aceh Timur, karena tidak berani melaut akibat angin kencang dan ombak besar kian mengancam.

Cuaca Buruk, Nelayan Tak Berani Melaut LHOKSEUMAWE (Waspada) : Akibat cuaca buruk dalam seminggu terakhir ini sejumlah nelayan tidak berani melaut. Selain angin kencang, hujan juga turun amat deras. Sejumlah nelayan di Ujong Blang Lhokseumawe, Senin (12/9) mengatakan, di darat saja angin sangat parah, apalagi di laut. Mereka menyatakan lebih baik tidak berangkat daripada menanggung resiko berat. “Kami melihat-lihat keadaan. Jika mungkin kami melaut, kami akan berangkat,” ucap Hamdani, seorang nelayan. Akibat hanya sedikit saja nelayan yang melaut, jumlah stok ikan di pasaran sangatsedikit dengan harga yang mahal. Bahkan harga ikan naik hampir mencapai dua kali lipat dari harga biasa. Ikan yang umumnya seharga Rp10 ribu – Rp15 ribu per tumpuk, sekarang mencapai Rp20 ribu-Rp25 ribu per tumpuknya, dengan berat sekitar setengah kilogram. Sementara itu peminat terhadap ikan kembali normal selepas lebaran, yang mereka telah jenuh menyantap daging. “Kalau ikan mahal, kami beralih pada telur untuk sementara waktu. Tidak seharusnya makan ikan melulu setiap hari,” ujar Karyati, salah seorang ibu rumah tangga. (b12)

Tindak Pemukul Khatib LANGSA (Waspada): Himpunan Ulama Dayah (Huda) Kota Langsa, Senin (12/9), mengeluarkan pernyataan sikap terhadap insiden pemukulan khatib Jumat di Sigli. Isi pernyataan itu antara lain mengecam keras tindakan itu, dan meminta pihak berwajib menindak tegas pelakunya sesuai aturan yang berlaku. Ketua Huda Kota Langsa, Tgk H Syech Muhajir, S.Ag, LLM didampingi Sekretarisnya, Tgk Mukhtarmidi, MA secara tertulis menyampaikan kepada Waspada, pemukulan terhadap khatib merupakan pelecehan simbol islam, yaitu mimbar jumat. Maka itu, Huda Kota Langsa mengecam keras dan berharap pihak berwajib segera menindak pelakunya sesuai ketentuan yang berlaku. Kemudian kepada seluruh khatib, Huda Kota Langsa juga menghimbau supaya selalu menyampaikan materi khutbah dengan mengedepankan kebenaran, kearifan dan uswatun hasanah. Selain itu, Huda Kota Langsa berharap, semoga peristiwa kekerasan terhadap khatib ini jangan sampai terulang lagi di kemudian hari. “Peristiwa ini kita harapkan merupakan yang pertama dan terakhir kali terjadi,” demikian pernyataan Sikap Huda Kota Langsa.(b22)

Ulama Harus Tetap Berani LANGSA (Waspada): Ketua Lumbung Informasi Rakyat (LIRA) Kota Langsa, Cut Lem, menyerukan kepada para ulama, terutama yang tinggal di Aceh, agar jangan ada yang patah semangat dengan insiden pemukulan khatib di Sigli.Walaupun nyawa taruhannya, ulama harus tetap berani menyeru umat berbuat benar dan mencegah mereka berbuat mungkar. Cut Lem menyampaikan seruan itu kepada Waspada di Langsa, Senin (12/9), menanggapi peristiwa memalukan yang terjadi di Masjid Keumala, Sigli, Jumat (9/9) lalu. Menurut Cut Lem, apa yang menimpa Tgk. Syaiful tersebut, bukanlah yang pertama terjadi dalam sejarah Islam. Bahkan cucu Nabi Muhammad SAW, Sayyidina Hussein, sampai dipenggal kepalanya di Padang Karbala, demikian juga imamimam mazhab, mereka juga ada yang dianaiya pihak-pihak yang berkuasa pada masanya. Maka itu, selaku Ketua LIRA Kota Langsa, Cut Lem menyama-kan peristiwa yang menimpa Tgk. Syaiful tersebut dilihat dari sudut kekejiannya lebih parah dari Zaman jahiliyah karena pelakunya adalah ummat islam itu sendiri. Tapi bila dilihat dari sudut perjuangan ulama menegakkan kebenaran itu belum apa-apa dibanding dengan perjuangan ulama pada masa lalu. Sikap LIRA Kota Langsa terhadap peristiwa itu, kata dia, mengecam keras dan meminta pihak berwajib supaya mengusut tuntas dan menindak pelakunya secara hukum. Karena perbuatan itu dalam islam sangat biadab, telah merusak kesucian rumah Allah dan sekaligus penghinaan terhadap agama Islam. (b22)

Ketua DPRK Langsa Kembali Didesak PAW LANGSA (Waspada): Sejumlah elemen sipil, para pegiat LSM dan pimpinan mahasiswa serta kader Komite Peralihan Aceh (KPA) dan Partai Aceh (PA) setempat, kembali melancarkan desakan terhadap Ketua DPRK Langsa Muhammad Zulfri untuk segera dilakukan Pergantian Antar Waktu (PAW), Senin (12/9). Dua gelombang desakan yang disalurkan lewat pernyataan sikap bersama, masingmasing ditandatangani Ketua Umum Kaukus Pemuda Pantai Timur Teuku Faisal, SH, Direktur LSM Komunitas Rumoh Aceh Putra Zulfirman, Ketua Umum Badan Eksekutif Mahasiswa STIM Pase Langsa T Syahril, Pemerintah Mahasiswa Universitas Samudra Langsa Mahyuddin, dan Koordinator Front Mahasiswa Peduli Keadilan Dan Demokrasi T Raja Syahrul. Sedangkan pernyataan sikap kedua itu datangnya dari Komite Peralihan Aceh (KPA)

Daerah-III Langsa Abudar dan kader Partai Aceh (PA) Langsa Zakaria AB. Desakan ini merupakan tindak lanjut dari aksi dan sorotan sebelumnya yang dilancarkan Kaukus Pemuda Pantai Timur beberapa waktu, atas keberadaan Muhammad Zulfri yang telah berkekuatan hukum tetap dari Mahkamah Agung (MA) RI. Muhammad Zulfri menjadi terpidana dan telah menjalani hukuman satu tahun penjara atas kasus keterangan palsu terkait uji mampu baca Alquran calon Walikota Langsa pada Pilkada tahun 2006 lalu. Berdasarkan instrumen hukum yang ada Muhammad Zulfri dinilai telah gugur haknya selaku anggota dewan, begitupun yang bersangkutan dinyatakan menjadi terpidana sehingga tidak bisa mencalonkan dirinya lagi. Atas keberadaan itu, Dewan Perwakilan Rakyat Kota (DPRK) Langsa telah mengambil langkah konkrit. Bahkan, hasil rapat paripurna dewan itu juga menyalurkan ke Gubernur Aceh dan Mendagri RI guna proses PAW. Namun, PA selaku partai yang mengusung Muhammad Zulfri tidak berkenan memrosesnya, sehingga bersang-

kutan tidak bisa secara sertamerta dipecat dari keanggotaan dewan itu. Kekisruhan itu kian memuncak, menyusul rapat paripurna tentang perubahan APBK 2011 selama tiga kali digelar selalu menemui jalan buntu karena ikut hadirnya Muhammad Zulfri dalam sidang-sidang yang turut dihadiri unsur Muspida plus di sana. Muhammad Zulfri juga sempat diseret keluar pada rapat paripurna kali kedua, bahkan sidang yang ketiga kembali deadlock. “Ini sangat merugikan Kota Langsa, mengapa PA harus menanggung dosa dan beban saudara M Zulfri,” tulis Abudar dari KPA D-III Langsa dan Zakaria AB yang mengklaim diri sebagai kader PA Langsa. Di luar teks pernyataan sikap hal hampir senada juga dilontarkan para pimpinan mahasiswa dan pegiat LSM di Langsa. Mereka menilai sikap tak terpuji itu merupakan arogansi kekuasaan, yang seyogyanya PA bersikap arif dan bijaksana. “Bukan malah mempertontonkan arogansi kekuasaan, karena itu sangat merugikan daerah ini,” sergah Teuku Faisal, SH. (b26)

Terkait Penculikan Bocah Idi Cut Pelaku Penculikan Adalah Ibu Kandung IDI CUT (Waspada): Soal penculikan seorang bocah perempuan di pedalaman Idi Cut, Kabupaten Aceh Timur, ternyata salah seorang pelaku penculikan adalah ibu kandungnya sendiri. Hal tersebut dibuktikan dalam penyelidikan pihak kepolisian yang sudah mengetahui keberadaan korban di kawasan Jiem-Jiem, Kabupaten Pidie Jaya. “Korban sudah diketahui keberadaannya, yakni setelah diculik dibawa ke Alue Ie Puteh, Aceh Utara. Namun tak lama kemudian dilarikan ke Jiem-Jiem bersama orangtuanya di rumah familinya,” ungkap Kapolres Aceh Timur, AKBP Drs Ridwan Usman melalui Kapolsek Darul Aman, AKP Sofyan kepada Waspada, Senin (12/9). Dijelaskan, setelah petugas dari Polsek Darul Aman melakukan pencarian korban ke kampung ibunya di kawasan Alue Ie Puteh, Kecamatan Baktia, Kabupaten Aceh Utara, kakak ibu korban mengaku Habibah diambil ibunya (Nursyidah) menjelang magrib saat mengaji di

Desa Buket Kulama, Kecamatan Darul Aman dengan menggunakan mobil Toyota Avanza berwarna hitam. “Hal itu diakui kakak dari ibu korban ketika anggota kita melakukan pencarian dan keberadaan korban di salah satu kampung dalam kawasan di Aceh Utara,” ujar Sofyan seraya menambahkan, ketika personil keamanan mendatangi rumah Nursyidah ternyata korban (Habibah) juga sedang tidak berada di sana, namun menurut pengakuan kakan ibu korban, Habibah telah dibawa ibu kandungnya ke kawasan Jiem-Jiem, Lueng Putu, Kab. Pidie Jaya. Meski demikian, lanjut AKP Sofyan, pihaknya juga meminta keluarga Habibah untuk membuat surat keterangan, Habibah sekarang telah berada bersama ibu kandungnya. “Beberapa bulan yang lalu ibu kandung korban pernah menjemput Habibah ke Idi Cut, namun anak itu bersikeras tidak mau ikut ibu kandungnya itu, maka oleh ibunya mengambilnya secara paksa,” sebutnya.

Hal itu dibenarkan, kakek tiri Habibah, Ilyas Usman. Dia sangat merasa kehilangan Habibah yang telah bersamanya selama dua tahun terakhir di Desa Trieng Gadeng, Kecamatan Darul Aman. Dia membenarkan Ibu kandung Habibah yang sudah pisah ranjang dalam beberapa tahun terakhir dengan suaminya sekitar 5 bulan lalu pernah ke rumahnya meminta Habibah untuk dibawa bersama. “Namun saat itu bukan saya tidak kasih, yang pertama Habibah sendiri menolak ikut ibunya, dan yang kedua sayapun tak berani menyerahkan Habibah, karena Habibah dititip ayahnya H Daud dan tidak dibolehkan untuk diberikan kepada siapapun,” ujar Ilyas. Sebagaimana diwartakan Waspada sebelumnya, Habibah Binti M Daud, 9, bocah kelas 2 SD dikabarkan diculik tiga wanita tak dikenal saat hendak mengaji di Desa Buket Kulam, Kecamatan Darul Aman, Kabupaten Aceh Timur, Sabtu (10/ 9) sekira pukul 18:30. (cmad)

Penganiayaan Tokoh Agama Pidie Berpotensi Dam Spiritual IDI (Waspada): Penganiayaan Tgk. Saiful Bahti, seorang tokoh agama yang sedang membaca Khutbah pada pelaksanaan ibadah shalat Jumatan di Masjid Raya Keumala, Kabupaten Pidie, berpotensi dam spiritual. “Dam (denda) spiritual itu bisa berbentuk macam-macam, apakah dalam bentuk bencana bagi si pelaku itu sendiri dan bencana buat daerah. Lazim terjadi, ketika grafitasi spiritual itu terganggu, ada saja malapetaka yang diturunkan Allah SWT,” kata tokoh masyarakat dan juga mantan anggota DPRK Aceh Utara, M. Jakfar Achmadkepada Waspada, Senin (12/9). Menurut wartawan Aceh

M. JAKFAR ACHMAD Mantan Anggota DPRK Aceh Utara,

Utara dan juga putra ulama kharismatik Pantonlabu itu, Tgk Achmad Langkat ini, keberadaan masjid di manapun merupakan tempat suci yang mengandung energi grafitasi spiritual yang sangat pantang untuk dinodai. Namun, di Masjid Raya Keumala, Pidie, Jumat (9/9) telah terjadi peristiwa dahsyat, yaitu penganiayaan berat terhadap ulama yang sedang berkhutbah di masjid ini, Tgk Saiful Bahri dengan tersangka pelakunya, oknum anggota DPRK Pidie, Tgk IA Cs dari fraksi Partai Aceh (PA). Kata M. Jakfar Achmad, melihat volume peristiwa yang sempat berceceran darah dalam rumah Allah itu, membuat tercengang semua pihak. “Ber-

cengkerama saja di dalam masjid sudah berdosa, konon berbuat sangar dan tindakan kekerasan yang tak kepalang tanggung, Masya Allah,” ujarnya dengan nada geram. Disebutkan, setiap masjid acap disebut jantung hati umat Islam, termasuk Masjid Raya Keumala, Pidie, merupakan jantung hati khususnya masyarakat setempat dan masyarakat Aceh pada umumnya, maka tidak heran bila sedikit saja terjadi hal yang menyayat perasaan di tempat itu, semua hati ‘qalbun salim’ menjerit, kecuali hati yang mati ‘qalbun mayyit’ yang tidak merasakan apa-apa, termasuk sipelaku yang kemungkinan besar pemilik dari ‘qalbun mayyit’ itu,”

papar M Jakfar Achmad. “Nah, inilah yang kita takuti, yaitu azab Allah terhadap ‘qalbun mayyit’ yang berimplikasi luas, baik terhadap masyarakat dan daerah. Bertindak mungkar dalam rumah Allah (masjid), sudah cukup menjadi indikasi seseorang itu memiliki ‘qalbun mayyit’,” ujarnya. Apa solusinya, tanya Waspada. “Tidak ada solusi lain, selain taubat nasuha bagi si pelaku, membayar dam, menepungtawari rumah ibadah dan meminta maaf kepada korban. Sementara dari sisi hukum, si pelaku pula perlu mendapat ganjaran hukuman penjara secara transparan agar diketahui publik,” demikian M Jakfar Achmad. (cmad)

Waspada/Mustafa Kamal

WARGA dan anak-anak sedang melihat boat yang tersangkut di pinggir pantai akibat dangkalnya TPI Kuala Krueng Mane, Kec. Muara Batu, Aceh Utara, Senin (12/9).

TPI Kuala Krueng Mane Dangkal

Boat Warga Rusak, Terancam Tak Bisa Masuk Kuala KRUENGMANE (Waspada) : Dangkalnya Kuala Krueng Mane sebagai pusat Tempat Penangkapan Ikan (TPI) di Kec. Muara Batu, Aceh Utara dan sekitarnya mengakibatkan dua unit boat warga yang tersangkut di pinggir pantai rusak diterjang ombak besar. Dangkalnya kuala pihak Panglima Laot sudah mencoba membuat pendekatan dengan pemerintah tapi belum membuahkan hasil. Dua boat tersebut masing-masing milik Fauzi, 35, satu lagi milik warga Idi, Kab. Aceh Timur. Tersangkutnya boat milik Fauzi pada saat membantu menarik boat besar milik warga Idi tersebut yang tersangkut di jalur masuk Kuala. Setelah berhasil dibantu, boat Fauzi ukuran sedang tersebut diterjang ombak sampai pinggir pantai, dan sejauhr 200 meter dari pintu kuala. Kondisi ini boat tersebut tidak bisa diselamatkan dan ditaksir kerugian sekitar Rp20 juta. Pantauan Waspada, Senin (12/9), meski boat itu tidak bisa dimanfaatkan lagi, warga sedang siap-siap menariknya ke darat. “Kejadiannya dua hari lalu, saat saya menyelamatkan boat besar, malah boat saya yang jadi korban.

Itu tidak masalah, karena kita saling membantu sesama rekan kerja. Namun itu, kuala dangkal ini yang membuat saya kecewa karena belum juga ditanganinya, saya dengar laporan sudah dibuat Panglima Laot ke pemerintah,” ujar Fauzi, pemilik boat yang tersangkut. Panglima Laot Kuala Krueng Mane, Dahlan Yusuf menyebutkan, dangkalnya Kuala Krueng Mane diperparah setelah bencana tsunami 2004 lalu, kondisi ini membuat bot-boat besar dari luar Aceh Utara seperti Idi, Aceh Timur, Peudada, Bireuen enggan masuk ke Kuala Krueng Mane, karena apabila air surut boat tersebut total tidak bisa masuk. Menurut panglima, pihaknya sudah membuat laporan ke Dinas Perikanan Aceh Utara, dan setelah itu sudah dilakukan pengecekan ke lapangan. Sementara waktu belum ada jawaban yang positif. Muklis, mantan Kepala Dinas Perikanan Aceh Utara mengatakan, permasalahan itu sudah pernah disampailkan pada saat dirinya menjabat beberapa bulan lalu. Dari beberapa kuala yang diupayakan hanya Kuala Bangka Jaya Kreung Geukue yang turun anggaran pembuatan jati tersebut. Untuk TPI Kuala Krueng Mane belum ada hasil. (cmk)

LIRA Pertanyakan Laporan Proyek Fiktif Pengadaan Mesin Coklat KUTACANE (Waspada) : Sekda LIRA M Saleh Selian, Senin (12/9) mempertanyakan laporan sebundel bukti hasil investigasi LIRA Agara kepada Kejari Agara soal indikasi korupsi proyek fiktif pengadaan mesin pembelah coklat fiktif di Disperindag Aceh Tenggara (Agara) tahun Anggaran 2008 dana APBK sekitar Rp1 miliar. Sebagaimana diberitakan Waspada beberapa waktu lalu, hasil investigasi LSM LIRA Aceh Tenggara, proyek bantuan mesin pembelah buah coklat tahun 2008 yang disalurkan Dinas Perindustrian Agara kepada petani coklat, senilai hampir Rp1 miliar terindikasi fiktif. Saleh Selian mengatakan, hasil investigasi LIRA Agara sejak Mei 2011 dari sejumlah 50 unit mesin pembelah coklat yg disalurkan Dinas Perindag Agara itu, terindikasi 20 unit diterima oleh penerima fiktif. “Nama penerima ada, namun ketika pihak LIRA turun ke lapangan di kecamatan, ternyata

nama tersebut tidak tahu menahu apalagi menerima mesin, bahkan sejumlah kepala desa tak mengetahui adanya pemberian bantuan mesin itu,” ungkap Saleh. Pihak LIRA berusaha kooperatif menyurati Dinas Perindustrian ditujukan kepada Kadis Syafruddin meminta secara resmi kontrak kerja, namun melalui sekretarisnya Sutan Syahrir menolak memberikan kontrak, meski telah dijelaskan adanya UU keterbukaan publik. Kajari Agara Taufik ketika konfirmasi mengatakan, laporan LIRA telah dipelajari dan telah didisposisi untuk ditindaklanjuti Kasi Pidsus Eddy Hidayat. “Laporan LIRA ini saya nilai layak ditindaklanjuti karena memenuhi unsure,” tegas Taufik. Taufik juga menyampaikan, terkait dugaan mark up kasus multy chanel yang dilakukan dalam pemasangan TV Agara yang menelan dana miliaran rupiah dan mengambang ditangani Kajari, kasus multy chanel ini juga akan ditindaklanjuti. (b28)

Kasus Bongkar Paksa Dua Unit BP Ke Polresta Lhokseumawe NISAMANTARA (Waspada) : Kasus bongkar paksa dua unit Balai Pengajian (BP) di Dusun Sp Rambong, Gampong Seumirah, Kec. Nisam Antara (Nistara) Aceh Utara dilaporkan ke Polresta Lhokseumawe. Peristiwa yang menggegerkan masyarakat di Nistara ini hampir bersamaan dengan insiden penganiayaan ulama, Jumat (9/9) di Kec. Keumala Pidie, Tgk Saiful Bahri yang kini menjadi perbincangan masyarakat Aceh. Nyaris sama, walau tak serupa pada hari Jumat (9/9) pekan lalu dialami pula oleh guru pengajian, pimpinanYayasan Ruhul Islam, Desa Seumirah, Kec Nistara, Aceh Utara, Tgk Abubakar, 41. “Kasus pelecehan terhadap aktivitas sarana agama tersebut, Sabtu (10/9) telah diadukan Tgk Abubakar ke Polresta Lhokseumawe, terhadap tiga pelaku yang diduga sebagai provokator, masing-masing N, 50, Z, 40 dan K, 30 (kesemuanya warga setempat) diterima Aiptu Bustamam,” jelas pimpinan yayasan tersebut kepada Waspada di Lhokseumawe, Senin (12/9). Pimpinan yayasan ini bersama pengurus yayasan lainnya yang minta namanya dirahasiakan, belum mengetahui apakah para pelaku sudah ditahan oleh Polresta Lhokseumawe, atau belum. Namun, guru ngaji/pimpinan yayasan berikut pengurus dan keluarganya, sampai Senin kemarin, belum berani pulang ke kampong di mana pusat kegiatan pengajian yang dikelola Yayasan Ruhul Islam tersebut.

Tgk Abubakar mengakui, banyak tersangka yang terlibat aksi bongkar paksa dua unit BP konstruksi kayu atap seng, masing-masing berukuran 8 x 8 meter dan 7 x 8 meter. Kejadiannya, Jumat (9/9). “Saat itu saya sempat menyingkir dari lokasi, sedang istri saya berserta anak kecil dari gendongannya yang tinggal di BP mencari perlindungan di bilik santri di salah satu pojok pekarangan seluas 3.200 meter, yaitu pekaranganYayasan Ruhul Islam,” lanjutnya. Ia tidak mengetahui latar belakang tindakan anarkis tersebut, seingatnya BP tipe B yang dikelola sejak 2000 tersebut tidak pernah bersengketa dengan orang lain. “Bangunan aset yayasan merupakan sumbangan para dermawan, sementara lahan pekarangan merupakan milik pribadi,” tandasnya. “Saya menduga aksi bongkar paksa dua unit BP tersebut kemungkinan beraroma politik, karena saya selama ini cenderung menghendaki adanya bakal calon (balon) atau calon pejabat dari jalur perorangan pada Pemilukada di Aceh,” katanya. Berdasarkan keterangan masyarakat, Tgk Abubakar mendapat informasi, bahan bangunan yang dibongkar paksa itu, sekarang dikumpulkan di kompleks meunasah (surau) Desa Seumirah. “Buat selanjutnya, entah mau dikemanakan bahan bangunan itu oleh para pelaku,” sebutnya. Geuchik Seumirah Mawardi mengatakan, pihaknya tidak tahu menahu terhadap aksi tersebut, karena baik korban maupun tersangka pelaku sama-sama belum melapor. (b10)

Waspada, Selasa 13 September 2011  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you