Page 1

Irwandi KO Di MK JAKARTA (Waspada): Mahkamah Konstitusi (MK) menolak atau knock out (KO) gugatan perselisihan hasil pemilihan kepala daerah (Pilkada) Provinsi Aceh yang diajukan pasangan calon gubernur dan wakil gubernur Aceh Irwandi Yusuf-Muhyan Yunan. “Menolak permohonan pemohon untuk seluruhnya,” kata Ketua Lanjut ke hal A2 kol. 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

Irwandi Yusuf

SABTU, Wage, 5 Mei 2012/13 Jumadil Akhir 1433 H

No: 23855 Tahun Ke-66

Terbit 20 Halaman (A1-12, B1-8)

Harga Eceran: Rp2.500,-

Plt Gubsu Dukung Simalungun Mekar MEDAN (Waspada): Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho menegaskan dukungannya terhadap pemekaran Kabupaten Simalungun dan Simalungun Hataran yang diusulkan elemen masyarakat Simalungun. Surat Keputusan rekomendasi terhadap pemekaran Kabupaten Simalungun akan ditandatangani Gatot, apabila pertimbangan dari Dirjen Otda Kementerian Dalam Negeri memperbolehkannya. Hal tersebut ditegaskan Gatot saat menerima kehadiran panitia pemekaran Kabupaten Simalungun dan tokoh masyarakat serta pemerintah daerah antara lain Ketua DPRD Simalungun Binton Tindaon, anggota DPRD Sumut daerah pemilihan Simalungun Janter Sirait, Ketua Badan Pemekaran Simalungun Hataran Sadar Sinaga, Ketua KNPI DPD Simalungun Elkananda Shah, Asisten I Pemerintahan Kabupaten Simalungun Huberlun Hutagaol di Kantor Gubsu, Jumat (4/3). Hadir mendampingi Plt Gubsu, Sekda Provsu H Nurdin Lubis, SH, MM, Asisten Pemerintahan Setdaprovsu Hasiholan Silaen, Kepala Biro Pemerintahan Noval Akhyar, SH dan lainnya.

Lanjut ke hal A2 kol. 3

Waspada/Amir Syarifuddin

PLT Gubsu Gatot Pujo Nugroho foto bersama panitia pemekaran Kabupaten Simalungun, tokoh masyarakat, dan anggota DPRD yang datang ke Kantor Gubsu, Jumat (4/5).

Hukuman Syamsul 6 Tahun JAKARTA (Waspada): Mahkamah Agung (MA) memutuskan Gubsu (non aktif) Syamsul Arifin divonis 6 tahun penjara dalam kasus korupsi di Kabupaten Langkat saat menjabat menjabat sebagai bupati.

Sebelumnya, putusan Pengadilan Tinggi yang menghukumnya 4 tahun penjara saat JPU KPK mengajukan banding atas putusan pengadilan tingkat pertama di Pengadilan Tindak Pidana Korupsi (Tipikor) Jakarta

pada 15 Agustus 2011, di mana Syamsul Arifin divonis 2 tahun 6 bulan penjara. Putusan kasasi MA di atas tuntutan JPU KPK 5 tahun penjara itu diungkap Kepala Biro Humas MA Ridwan Mansur, di

Jakarta, Jumat (4/5). “Majelis hakim yang diketua hakim Artidjo Alkostar dengan hakim anggota Syamsul Raka Chaniago, Leopold Luhut Hutagalung, Krisna Harahap dan Suhadi telah memutuskan

82 Finalis Mulai Bersaing 10,20,30 juz, M2Q, 1 dan 5 juz Tilawah, cabang tafsir Quran, cabang anak-anak mujawat, tartil Quran dan cabang cacat netra. Jumat (4/5) dinihari di mimbar utama MTQ, Dewan Hakim mengumumkan para peserta yang masuk babak final golongan dewasa putra dan putri. Adapun ke 82 peserta yakni

untuk MTQ golongan anakanak putra, Nomor Panggil Peserta (NPP) 000.62, 000.64 dan 000.28, untuk anak-anak putri, NPP 0001.49, 0001.41, 000.43, Cabang Tartil Quran putra, NPP 0002.08, 0002.50,002.62 danTartil Quran putri NPP 003.23, 003.37, 003.67.

Lanjut ke hal A2 kol. 6



Ibra Dendam Inter STADION San Siro, 15 Januari 2012. AC Milan sebagai tuan rumah mendominasi permainan dalam derbi menghadapi Internazionale, tetapi mereka malah menjadi pecundang 0-1 lewat gol tunggal Diego Milito menit 54. “Kami menguasai jalannya laga, mengalirkan bola dari kaki ke kaki. Menurut saya, Inter datang hanya untuk mempertahankan diri agar tidak kalah,” sesal Zlatan Ibrahimovic, striker Milan, seusai laga yang disaksikan 80.000 penonton tersebut. Lanjut ke hal A11 kol. 1 Waspada/Edi Saputra

PERTANDINGAN final Cabang Fahmil Quran MTQ ke-33 tingkat Sumut di gedung replika Istana Sultan Serdang, Jumat (4/5). Tampak dari kiri ke kanan regu A Pemko Medan, regu B Kab. Sergai, regu C Kab. Tobasa dan regu D PT. PP. Lonsum.

Pegawai Lapas Tj. Gusta Gol Diduga Pemasok Sabu Bersama Istri MEDAN (Waspada): Pegawai Lembaga Pemasyarakatan (Lapas) Tanjung Gusta Medan berinisial AA, 45, ditangkap petugas Direktorat Reserse Narkoba Polda Sumut, Kamis (3/5) sekira pukul 22:30, diduga sebagai bandar narkoba. Dia ditangkap bersama istrinya berinisial BF, 24, dari kediaman mereka di Jln. Amaliun Gang Kampung Boyan, Kelurahan Matsum, Medan Area. Polisi juga mengamankan se-

jumlah barang bukti dari rumah tersangka, seperti alat isap (bong) sisa psikotropika jenis sabusabu, ratusan plastik paketan, dua alat pres plastik, senjata soft gun, serta mobil Avanza BK 1501 KF warna hitam. Direktur Reserse Narkoba Polda Sumut Kombes Pol. Andjar Dewanto kepada wartawan di Mapoldasu, Jumat (4/5) mengatakan, penggerebekan itu berdasarkan informasi masyarakat tentang perederan

narkotika jenis sabu-sabu. “Informasi mengatakan tersangka sebagai bandar narkoba, bukan pengedar. Tetapi petugas kita belum menemukan barang bukti di kediaman tersangka. Yang kita dapat hanya bong dan sisa sabu-sabu,” katanya. Mengenai BF, istri tersangka, sejauh ini masih dimintai keterangan sebagai saksi. “Istrinya belum ditetapkan sebagai

Lanjut ke hal A2 kol. 6

kepada Syamsul Arifin. Sedangkan pada 24 November 2011, majelis hakim Pengadilan Tinggi DKI Jakarta yang diketuai M.Yusran Thawab menjatuhkan vonis 4 tahun penjara atas Syamsul Arifin.

Puting Beliung Terjang 14 Rumah Di Deliserdang PATUMBAK (Waspada): 14 Rumah warga dan rumah toko (ruko) di Pasar IV, Dusun II dan Dusun IV, Desa Patumbak II, Patumbak, Deliserdang, rusak parah akibat diterjang angin puting beliung, Jumat (4/5) sore. Data diperoleh Waspada, Jumat (4/5) hingga pukul 18:00, di Pasar IV, Dusun II, Patumbak II, sebanyak 10 rumah rusak berat dan ringan, diantaranya dua rumah dan lima ruko rusak berat, tiga rumah lagi rusak ringan. Sedang, di Dusun IV, tiga rumah rusak berat dan satu rusak ringan. Pantauan , selain merusak rumah warga, angin puting beliung menumbangkan sejumlah pohon juga hampir menumbangkan tiang PLN menyebabkan kerusakan hingga listrik padam. Camat Khairul Saleh Siregar, SSos dan Sekcam Timur Tumanggor serta sejumlah staf bersama Kapolsek AKP Triyadi, SH, SiK dan Kanit Intel AKP Najaruddin Siregar serta beberapa personil dan Kades Patumbak II Saptono membantu warga memperbaiki beberapa rumah yang rusak. Informasi diperoleh, sebelum angin puting beliung, cuaca sudah tampak mendung ditandai dengan langit gelap dan embusan angin kencang, petir yang menggelegar. Selang beberapa saat hujan deras turun diiringi angin kencang dan petir. (c02)

MEDAN (Waspada): Tersangka DAN, yang membunuh Irwansyah Putra, warga Denai, mengaku senjata api revolver yang digunakannya berasal dari Aceh. “Senjata api yang aku gunakan itu milik Irwansyah Putra, diperolehnya dari Aceh dan pernah digunakan orang lain menembak polisi,” kata DAN kepada wartawan di Polresta Medan, Jumat (4/5). Menurut dia, waktu itu Senin 30 April 2012, dia mengantarkan uang Rp1.500.000 ke rumah korban di Kompleks Panggon, Pasar V Marelan. Dia melihat korban sedang membersihkan senjata di dalam kamar. “Waktu itu saya kembali bertanya kepada korban, kapan kepastian uang itu dikembalikan. Karena uang itu milik ibu angkat saya,” sebut tersangka. Sambil menunggu uang itu dikembalikan, DAN menginap di rumah korban selama tiga hari. Tapi, uang itu tidak juga dikembalikan oleh korban.

Selanjutnya tersangka mengajak korban ke rumah Ronal teman korban di Desa Bintang Meriah, Kec. Batangkuis, Deliserdang. Setelah sampai di rumah Ronal, korban menumpang mandi. Saat korban mandi, senjata api itu diambil tersangka dari jaket korban, Kamis (3/5) sekira

Lanjut ke hal A2 kol. 3

Waspada/Rudi Arman

12 Kader Golkar Sumut Didepak Hardi Mulyono Akan Gugat MEDAN (Waspada): Gonjang ganjing dalam kepengurusan DPD I Partai Golkar Sumut, terjawab. Jumat (4/5), DPD I Partai Golkar Sumut yang menggelar rapat di Hotel Aryaduta Medan melakukan revitalisasi kepengurusan. Rapat pleno yang dipimpin Plt Ketua DPD I Partai Golkar Sumut Andi Achmad Dara mengganti sejumlah pengurus teras partai tersebut. Sekretaris DPD I Hardi Mulyono beserta

10 pengurus didepak dari kepengurusan. Posisi Hardi digantikan Hanafiah Harahap. Sedangkan, Syamsul Qomar, Mahmuddin Lubis, Sabar Sitepu, Rajamin Sirait, Safrudin Basir, Tajudin Noor, Riza Fakhrumi Tahir, Iskandar Marpaung, Agustinus Lase, dan Syarir Siregar, tidak lagi masuk dalam susunan kepengurusan yang diputuskan dalam rapat pleno tersebut. Rapat dipimpin Andi Achmad Dara, Wakil Sekretaris DPP

PG Leo Nababan, Darus Siska, Wakil Bendahara DPP PG Anton Sihombing, dan Chairuman Harahap menguraikan SK DPP PG No 170/DPP/Golkar/V/ 2012, ditandatangani Ketua Umum DPP Partai Golkar Aburizal Bakrie dan Sekretaris Jenderal Idrus Marham yang mentetapkan kepengurusan baru DPD I Partai Golkar Sumut hasil revitalisasi.

Lanjut ke hal A2 kol. 6

Ada-ada Saja Pria Nikahi Satu Keluarga

Kaum Munafik Oleh: Tgk. H. Ameer Hamzah

TAK puas hanya dengan menikahi sepasang saudara kembar, pria ini juga menikahi sepupu dari istri kembarnya. Kini, pria asal AS tersebut dikaruniai 24 anak. Seperti dilansir Daily Mail belum lama ini, wanita yang terdiri satu keluarga ini mengaku tidak keberatan untuk berbagi suami.

Di antara manusia ada yang mengatakan: Kami beriman kepada Allah dan hari kemudian, padahal mereka itu sesungguhnya bukan orang-orang yang beriman. (QS. Albaqarah:8)

Lanjut ke hal A2 kol. 6

pukul 10:00. “Kami kemudian menuju Jl. Letda Sudjono dengan menaiki angkot dan turun di Lorong Seram, karena korban sering nongkrong di situ. “Korban mendekati saya dan meminta senjata api miliknya,” ujar tersangka.

KASAT Reskrim Polresta Medan Kompol Yoris Marzuki memegang senpi yang digunakan tersangka DAN (baju tahanan) didampingi Kanit Jahtanras dan Waka Sat Reskrim AKP Hendra.


Al Bayan

Manusia seperti yang digambarkan dalam ayat tersebut adalah munafik. Mulutnya mengaku beriman kepada Allah, dan hari akhirat, tetapi hati dan anggota badannya tidak. Lain di mulut, lain pula di hatinya. Katanya ia kiyai tapi menolak hukum Islam, katanya ia muslimah tapi tak berjilbab, katanya ia hakim, tapi tak mau menghukum dengan hukum syariah, katanya ia ekonom, tapi makan riba. Lanjut ke hal A2 kol. 6

Dalam amar putusan PT.DKI No. 38/PID/TPK/2011/PT.DKI, Majelis Hakim juga mengharuskan Syamsul Arifin membayar uang pengganti sebesar Rp. 8.512.900.231. Lanjut ke hal A2 kol. 1

Penembak Anak Denai Peroleh Senpi Dari Aceh

MTQ Ke-33 Sumut PEGAJAHAN (Waspada): Sebanyak 82 qari dan qariah peserta MTQ ke-33 tingkat Sumatera Utara di Kab. Serdang Bedagai dari tujuh cabang mulai bersaing untuk meraih predikat terbaik, Jumat(4/5). Cabang yang diperlombakan, cabang dewasa, remaja, qiraat saba’ah, fahmil Quran, syarhil Quran, hifzil Quran,

menghukum Syamsul Arifin 6 tahun penjara,” katanya. Namun dalam putusan kasasi MA bernomor 472 K/ PID.SUS/2012, Ridwan tidak menjelaskan berapa uang pengganti yang dibebankan

Lanjut ke hal A2 kol. 2

Waspada/Edi Saputra

JAMAIDIN Sitepu menunjukkan naskah kuno warisan turun temurun keluarganya di stan Harian Waspada.

Kitab Kuno Pustaha Laklak Nialam Di Stan Waspada PEGAJAHAN (Waspada): Stan Harian Waspada di Expo Sergai yang digelar di arena MTQ ke-33 tingkat Sumatera Utara di lokasi replika Istana Sultan Sulaiman, Kel.Melati Kebun, Kec. Pegajahan, Kab. Serdang Bedagai, menambah koleksi naskah kuno Pustaha Laklak Nialam. Lanjut ke hal A2 kol. 3

Waspada/Khairul K. Siregar

INILAH gudang pemeraman tembakau Deli yang dulu mendunia kini ‘membonsai’ di Kebun Helvetia. Foto diambil Kamis (27/4).

Tembakau Deli Riwayatmu Kini TEMBAKAU Deli. Bagi dunia usaha, khususnya di pasar tembakau di Bremen, Jerman, nama tembakau Deli sudah membumi karena sejak zaman kolonial, kualitas tembakau Deli tidak terkalahkan. Sejumlah maskapai dari Eropa dan

Belanda menginvasi wilayah perkebunan di republik ini. Mereka beramai-ramai menanamkan modalnya untuk tembakau Deli. Tanah Deli meliputi wilayah Sungai Wampu

Lanjut ke hal A2 kol. 2

Serampang - Mau kemana lagi ngadu... - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SABTU, Wage, 5 Mei 2012/13 Jumadil Akhir 1433 H

z No: 23855 * Tahun Ke-66

Terbit 20 Halaman (A1-12, B1-8)  z Harga Eceran: Rp 2.500,-

Sutan Bhatoegana Jenguk Angie

JAKARTA (Antara): Anggota Dewan Perwakilan Rakyat (DPR) dari Fraksi Partai Demokrat, Sutan Bhatoegana, Jumat (4/5) sekitar pukul 14.00, dating ke gedung Komisi Pemberantasan Korupsi (KPK) untuk menjenguk tersangka kasus suap pembangunan Wisma Atlet, Angelina Sondakh (Angie). “Saya hanya menjenguk seorang sahabat, dan ini merupakan kunjungan pribadi,” kata Sutan saat mendatangi gedung KPK. Sutan mengatakan bahwa meski dia datang bersama dengan dua orang pendiri Partai Demokrat namun kedatangannya tidak terkait dengan agenda partainya. “Ini merupakan kunjungan pribadi, karena saat Angie masuk ke Demokrat saya merupakan salah satu orang yang menerima dia,” tambah Sutan. Terkait proses hukum terhadap kasus korupsi yang membelit Angie (foto), Sutan mengatakan bahwa dia punya harapan dan keinginan yang sama dengan masyarakat Indonesia. KPK sudah menetapkan Angie sebagai tersangka kasus suap dalam proyek di Kementerian Pemuda dan Olahraga dan Kementerian Pendidikan dan Kebudayaan serta menahan di rumah tahanan Salemba Cabang KPK sejak Jumat (27/4).

Sipirok Terkendali

3 Tersangka, 17 Dipulangkan

Waspada/ Murizal Hamzah

P.SIDIMPUAN (Waspada): Situasi keamanan dan ketertiban umum di Kota Sipirok, Kec. Sipirok, Kab. Tapanuli Selatan, pasca aksi pemblokiran Jalan Lintas Sumatera (Jalinsum), pembakaran dua alat berat milik pemerintah daerah, dan perusakan rumah warga, mulai terkendali. “Sudah kondusif, dan aktivitas ekonomi di Pasar Sipirok yang kebetulan semalam merupakan hari pekan, sama sekali tidak terganggu,” ujar Kapolres Tapsel, AKBP Subandriya, didampingi Bupati Syahrul M Pasaribu pada konferensi pers bersama unsur Muspida Plus di Kantor Bupati, Jumat (4/5). Menurut Kapolres, situasi Kamtibmas mulai terkendali sejak Kamis (3/5) pagi. Utamanya setelah dilakukan pertemuan dan dialog bersama para tokoh masyarakat, agama, adat, dan pemuda di Masjid Sri Alam Dunia. Dalam pertemuan itu, disimpulkan bahwa aksi anarkis tidak serta merta berawal dari warga Sipirok. “Tolong teman-teman pers dalam pemberitaannya

BEBERAPA pendukung Partai Aceh berdiri senang usai hakim Mahkamah Konstitusi menolak gugatan calon Gubernur Aceh Irwandi Yusuf dan calon Wakil Gubernur Aceh Muhyan Yunan di gedung MK, Jumat (4/5).

Lanjut ke hal A2 kol 1

IRWANDI KALAH DI MK Diduga Pengedar Narkoba, Pegawai Lapas Tanjung Gusta Ditangkap MEDAN (Waspada): Pegawai Lembaga Pemasyarakatan (Lapas) Tanjung Gusta Medan berinisial AA, 45, ditangkap petugas Direktorat Reserse Narkoba Polda Sumut, Kamis (3/5) sekira pukul 22:30, diduga sebagai bandar narkoba. Dia ditangkap bersama istrinya berinisial BF, 24, dari kediaman mereka di Jln. Amaliun Gang Kampung Boyan, Kelurahan Maksum, Medan Area. Polisi juga mengamankan sejumlah barang bukti dari rumah tersangka, seperti alat isap (bong) sisa psikotropika jenis sabu-sabu, ratusan plastik paketan, dua alat pres plastik, senjata soft gun, serta mobil Avanza BK 1501 KF warna hitam. Direktur Reserse Narkoba Polda Sumut Kombes Pol. Andjar Dewanto kepada wartawan di Mapoldasu, Jumat

(4/5) mengatakan, penggerebekan itu berdasarkan informasi masyarakat tentang perederan narkotika jenis sabusabu. “Informasi mengatakan tersangka sebagai bandar narkoba, bukan pengedar. Tetapi petugas kita belum menemukan barang bukti di kediaman tersangka. Yang kita dapat hanya bong dan sisa sabusabu,” katanya. Mengenai BF, istri tersangka, sejauh ini masih dimintai keterangan sebagai saksi. “Istrinya belum ditetapkan sebagai tersangka, masih menunggu hasil laboratorium forensik untuk pengecekan tes urin,” sebutnya menjelaskan, tersangka pernah bertugas di Lapas Klas II Banda Aceh, kemudian pindah ke Lapas Tanjung Gusta Medan. Kata Andjar, pihaknya masih mengembangkan

Presiden Utus Djoko Dan Sudi Terkait Peringatan Pancasila JAKARTA(Antara): Presiden Susilo Bambang Yudhoyono mengutus Menteri Koordinator Politik Hukum dan Keamanan Djoko Suyanto dan Menteri Sekretaris Negara Sudi Silalahi menemui Ketua MPR RI Taufiq Kiemas terkait peringatan Pidato Bung Karno 1 Juni tentang Pancasila. “Saya dan Pak Sudi diutus Presiden SBY untuk menghadap Ketua MPR dan anggota MPR dalam rangka memperingati pidato Bung Karno 1 Juni tentang Pancasila,” kat Djoko usai menemui Ketua MPR RI Taufiq Kiemas di Gedung DPR RI di Jakarta, Jumat (4/5). Namun kata Djoko Suyanto, Presiden SBY sendiri tak

bisa hadir pada saat peringatan Pidato Bung Karno 1 Juni tentang Pancasila karena pada saat bersamaan, beliau menyampaikan pidato di Thailand. “Kita sudah sampaikan bahwa Presiden SBY akan menghadiri World Economic For um tanggal 31 Mei di Thailand. Pada tanggal 1 Juni, ada acara dialog yang harus dihadiri Presiden SBY. Pada kedua acara itu, Presiden SBY dijadwalkan memberikan speech atau pidato di komunitas global. Presiden SBY mendelegasikan Peringatan Pidato Bung Karno itu kepada Wakil Presiden Boediono,” kata Djoko yang didampingi oleh Sudi Silalahi.

Al Bayan

untuk mengungkap kasus peredaran narkoba yang dilakukan tersangka. “Dia kita curigai sebagai pemasok narkoba ke Lanjut ke hal A2 kol 1

JAKARTA (Waspada): Mahkamah Konstitusi (MK) menolak gugatan soal perselisihan hasil pemilihan kepala daerah (Pilkada) Provinsi Aceh yang diajukan pasangan calon gubernur dan wakil gubernur Aceh Irwandi Yusuf-Muhyan Yunan. “Menolak permohonan pemohon untuk seluruhnya,” kata Ketua Majelis Hakim yang juga Ketua MK Mahfud MD saat membacakan putusan atas gugatan tersebut di Jakarta, Jumat (4/5).

Mahfud yang didampingi delapan hakim konstitusi lain menyatakan pokok permohonan yang diajukan pasangan Irwandi-Muhyan tidak Lanjut ke hal A2 kol 6

Penembak Anak Denai Ngaku Senpi Dari Aceh MEDAN (Waspada): Tersangka DAN, yang membunuh Irwansyah Putra, warga Denai, mengaku senjata api revolver yang digunakannya berasal dari Aceh.

Waspada/Amir Syarifuddin

PLT Gubsu Gatot Pujo Nugroho foto bersama panitia pemekaran Kabupaten Simalungun, tokoh masyarakat, dan anggota DPRD yang datang ke Kantor Gubsu, Jumat (4/5).

Plt Gubsu Dukung Pemekaran Simalungun SK Rekomendasi Tunggu Penjelasan Dirjen Otda

MEDAN (Waspada): Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho menegaskan dukungannya terhadap pemekaran Kabupaten Simalungun dan Simalungun Hataran yang diusulkan elemen masyarakat Simalungun. Surat Keputusan rekomendasi terhadap pemekaran Kabupaten Simalungun akan ditandatangani Gatot, apabila pertimbangan dari Dirjen Otda Kementerian Dalam Negeri memperbolehkannya.

Hal tersebut ditegaskan Gatot saat menerima kehadiran panitia pemekaran Kabupaten Simalungun dan tokoh masyarakat serta pemerintah daerah antara lain Ketua DPRD Simalungun Binton Tindaon, anggota DPRD Sumut daerah pemilihan Simalungun Janter Sirait, Ketua Badan Pemekaran Simalungun Hataran Sadar Sinaga, Lanjut ke hal A2 kol 6

Belasan Rumah Diterjang Puting Beliung Deliserdang PATUMBAK (Waspada): 14 Rumah warga dan rumah toko (ruko) di Pasar IV, Dusun II dan Dusun IV, Desa Patumbak II, Patumbak, Deliserdang, rusak parah akibat diterjang angin puting beliung, Jumat (4/5)


sore. Data diperoleh Waspada, Jumat (4/5) hingga pukul 18:00, di Pasar IV, Dusun II, Patumbak II, sebanyak 10 rumah rusak berat dan ringan, diantaranya dua rumah dan lima ruko rusak berat, tiga rumah

lagi rusak ringan. Sedang, di Dusun IV, tiga rumah rusak berat dan satu rusak ringan. Pantauan Waspada, selain merusak rumah warga, angin puting beliung menumbangkan sejumlah pohon, diantaranya satu batang pohon kelapa

tumbang ke badan jalan hingga menutupi setengah badan jalan. Juga hampir menumbangkan tiang PLN menyebabkan kerusakan hingga listrik padam. Sementara atap Lanjut ke hal A2 kol 4

“Senjata api yang aku gunakan itu milik Irwansyah Putra, diperolehnya dari Aceh dan pernah digunakan orang lain menembak polisi,” kata DAN kepada wartawan di Polresta Medan, Jumat (4/5). Menurut dia, waktu itu Senin 30 April 2012, dia mengantarkan uang Rp1.500.000 ke rumah korban di Kompleks Panggon, Pasar V Marelan. Dia melihat korban sedang membersihkan senjata di dalam kamar. “Waktu itu saya kembali bertanya kepada korban, kapan kepastian uang itu dikembalikan. Karena uang itu milik ibu angkat saya,” sebut tersangka. Sambil menunggu uang itu dikembalikan, DAN menginap di rumah korban selama tiga hari. Tapi, uang itu tidak juga dikembalikan oleh

PA Resmi Dukung Pasangan Hasanuddin/Ali Basrah BANDA ACEH (Waspada): Partai Aceh secara resmi mendukung pasangan Ir Hasanuddin Breuh MM (foto) dan Ali Basrah untuk memenangkan Pilkada di Kabupaten Aceh Tenggara yang akan dilaksanakan 2 Juli 2012 mendatang. “DPP Partai Aceh mulai malam ini member ikan dukungan untuk Hasanuddin Breuh dan Ali Basrah, bukan calon atau pasangan lain”, tegas Sekretaris Jenderal DPP Partai Aceh Tgk Yahya Muad kepada Waspada, Jumat (4/5) petang, di kantor DPP PA di Banda Aceh. Kata dia, pasangan Hasa-

nuddin/Ali Basrah memiliki visi dan misi yang sama dengan Partai Aceh dalam membangun Aceh lebih baik. Sedangkan soal kemampuan Bupati Hasanuddin yang akrab disapa Sanu, menurut dia sudah teruji dalam memimpin Aceh Tenggara yang patut didukung sehinggga daerah itu lebih maju dan masyarakatnya sejahtera. “Kita punya pemikiran yang sama dengan pasangan Sanu/ Ali Basrah,” ujarnya. Hasanuddin Breuh yang kini masih menjawab sebagai Lanjut ke hal A2 kol 6

Ada-ada Saja

Nikahi Sekeluarga Punya 24 Anak

Oleh: H. Ameer Hamzah Di antara manusia ada yang mengatakan: Kami beriman kepada Allah dan hari kemudian, padahal mereka itu sesungguhnya bukan orang-orang yang beriman. (QS. Albaqarah:8)

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 7

Pilkada Agara

Kaum Munafik

MANUSIA seperti yang digambarkan dalam ayat tersebut adalah munafik. Mulutnya mengaku beriman kepada Allah, dan hari akhirat, tetapi hati dan anggota badannya tidak. Lain di mulut, lain pula di hatinya. Katanya ia kiyai tapi menolak hukum Islam, katanya ia

korban. Selanjutnya tersangka mengajak korban ke rumah Ronal teman korban di Desa Bintang Meriah, Kec. Batangkuis, Deliserdang. Setelah sampai di rumah Ronal, korban menumpang mandi. Saat korban mandi, senjata api itu diambil tersangka dari jaket korban, Kamis (3/5) sekira pukul 10:00. “Kami kemudian menuju Jl. Letda Sudjono dengan menaiki angkot dan turun di Lorong Seram, karena korban sering nongkrong di situ. “Korban mendekati saya dan meminta senjata api miliknya,” ujar tersangka. Namun, tersangka DAN tidak mau mengembalikan sebelum uang yang dipinjam korban dikembalikan. Keduanya bertengkar. “Karena

Waspada/Khairul K. Siregar

INILAH gudang pemeraman tembakau Deli yang dulu mendunia kini ‘membonsai’ di Kebun Helvetia. Foto dijepret Kamis (27/4).

Tembakau Deli Riwayatmu Kini

Waspada/Edi Saputra

PERTANDINGAN final Cabang Fahmil Quran MTQN ke 33 tingkat Sumut di gedung replika Istana Sultan Serdang, Jumat (4/5).Tampak dari kiri ke kanan regu A Pemko Medan, regu B, Kab.Sergai, regu C, Kab. Tobasa dan regu D, PT.PP.Lonsum.

MTQ Ke-33 Sumut

82 Finalis Mulai Bersaing

TEMBAKAU Deli. Bagi dunia usaha, khususnya di pasar tembakau di Bremen, Jerman, nama tembakau Deli sudah membumi karena sejak zaman kolonial, kualitas tembakau Deli tidak terkalahkan. Sejumlah maskapai dari Eropa dan Belanda menginvasi wilayah perkebunan di republik ini. Mereka beramai-ramai menanamkan

PEGAJAHAN (Waspada): Sebanyak 82 qari dan qariah peserta MTQN ke-33 tingkat Sumatra Utara di Kab. Serdang Bedagai dari tujuh cabang mulai bersaing untuk meraih predikat terbaik, Jumat(4/5). Cabang yang diperlombakan, cabang dewasa, remaja, qiraat saba’ah,

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 3

TAK puas hanya dengan menikahi sepasang saudara kembar, pria ini juga menikahi sepupu dari istri kembarnya. Kini, pria asal AS tersebut dikaruniai 24 anak. Seperti dilansir Daily Mail belum lama ini, kedua saudara kembar ini mengaku tidak keberatan untuk berbagi

Lanjut ke hal A2 kol 5

Serampang - Mau kemana lagi ngadu ... - He.... he....he....

Berita Utama


Kitab Kuno Pustaha Laklak Nialam Di Stand Waspada PEGAJAHAN (Waspada): Stand Harian Waspada di Expo Sergai yang digelar di arena MTQN ke 33 tingkat Sumatera Utara di lokasi replika Istana Sultan Sulaiman, Kel.Melati Kebun, Kec. Pegajahan, Kab. Serdang Bedagai, menambah koleksi naskah kuno Pustaha Laklak Nialam. Naskah kuno itu milik Jarmaidin Sitepu,74, warga Dusun I, Desa Dolok Manampang, Kec.Dolok Masihul, Kab.Serdang Bedagai yang dipinjamkan kepada penjaga stand Waspada untuk dipajangkan.Tujuannya, agar pengunjung mengetahui bahwa di Kab.Sergai masih ada naskah kuno berusia ratusan

tahun. Menurut Jarmaidin, naskah kuno itu diwariskan oleh orang tuanya, dengan nama Pustaha Laklak Nialam, yang sebelumnya dirawat oleh empat keturunan keluarga hingga terakhir sampai di tangannya atau lima keturunan. Naskah kuno itu berasal dari Tanah Karo. “Saya sendiri tidak bisa membaca bahasanya karena memakai bahasa kuno.Seingat saya sewaktu kecil menjelang tidur orang tua selalu menceritakan naskah itu, yang katanya, berisikan berbagai petuah-petuah, termasuk cara pengobatan tradisional,” terang Jarmaidin didampingi

Diduga Pengedar ....

pakaian tidur. Untuk memastikan keterlibatan tersangka dalam peredaran narkoba, petugas Subdit II, Jumat sore mengecek kembali mobil tersangka. Saat itu ditemukan timbangan elektrik tersembunyi di bawah jok kursi sopir. Namun tersangka berdalih lagi. “Bukan punya saya, punya teman,” katanya saat menyaksikan penggeledahan itu. Sedangkan Kombes Andjar mengatakan, akan kembali menggeledah kediaman tersangka. “Semalam belum maksimal,” tuturnya. (m27)

Lapas Tanjung Gusta dan terkait jaringan bandar narkoba yang di DPO berinisial IC,” ujarnya. Sementara tersangka ditanyai wartawan tidak banyak berkomentar. Setiap pertanyaan selalu dijawab tidak ada. “Tidak ada itu bang,” kata dia sambil menunduk. Tersangka juga membantah sebagai bandar narkoba, hanya pengguna. “Pakeknya juga baru,” sebut pria berbadan tegap itu. Istrinya yang turut dihadirkan juga tidak mau berkomentar. Wanita itu terlihat masih mengenakan

Sipirok ....

tidak men-justifikasi aksi tersebut merupakan sikap warga Sipirok secara keseluruhan. Karena warga Sipirok itu santun dan berbudaya,” pintanya. Dalam kasus tersebut, kata Kapolres, dari 20 warga yang diamankan Kamis (4/5) dini hari, tiga orang ditetapkan sebagai tersangka, yakni AP alias Kocu, tersangka pembakaran alat berat. SS dan HN, ditetapkan sebagai tersangka perusakan rumah. Sementara 17 orang lainnya dipulangkan dan telah diserahkan ke keluarganya, disaksikan unsur Muspika Sipirok pada Kamis (3/5). Jangan Terprovokasi Sementara Bupati bersama Wakil Bupati Tapsel, Syahrul M Pasaribu dan Aldinz Rapolo Siregar, meminta kepada seluruh masyarakat di 14 kecamatan agar tidak terprovokasi dengan kejadian ini. Mengenai dua alat berat jenis eskavator yang dibakar massa, Bupati Tapsel menyerahkan sepenuhnya kepada aparat penegak hukum. Sementara, Wakil bupati Tapsel, Aldinz Rapolo Siregar, yang ditanya berapa kerugian yang dialami Pemkab Tapsel atas terbakarnya dua eskavator tersebut, menurut dia, belum diketahui, karena belum ada laporand ari Kadis Pekerjaan Umum (PU). “ Tetapi, Pemkab Tapsel mengalami kerugian pada pos pemasukan keuangan daerah hampir Rp.500 juta dari alat berat itu,” katanya. Untuk diketahui, siang hari setelah aksi anarkis di Sipirok, Bupati dan Wakil Bu-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mxh7+, Rf8. 2. Mh6+, Rf7. 3. Gh5+, Kg6. 4. MxK+, Rf8. 5. Kh7+, Re7. 6. Me8+mat.

Jawaban TTS: TTS Topik

Musik & Filem




Jawaban Sudoku: 8 7 1 9 5 0 6 4 2 3

0 6 4 7 9 3 2 8 1 5

2 1 3 5 8 4 0 9 7 6

4 5 0 2 7 6 3 1 8 9

9 3 6 8 2 1 5 7 0 4

3 8 5 6 4 7 1 0 9 2

6 0 7 4 1 2 9 3 5 8

7 2 9 3 0 8 4 5 6 1

1 9 2 0 3 5 8 6 4 7

5 4 8 1 6 9 7 2 3 0

pati Tapsel bersama Muspida Plus sudah melakukan tinjauan langsung ke lokasi, Kamis (3/5) pagi sampai sore. Jumat (4/5), Muspida Plus menggelar rapat di Kantor Bupati Tapsel, dihadiri Bupati dan Wakil Bupati, Ketua DPRD, Rahmat Nasution, Wakil Ketua, Abdul Rasyid dan Hasbin Sitompul, Ketua Komisi I, Haris Yani, Ketua Komisi II, dan Ketua Komisi III, Mahmud Lubis,Kapolres Tapsel, AKBP Subandriya, Dandim 0212/TS, Letkol Inf Edi Hartono, Danki Bantuan Yonif 123/RW, Lettu P Sitompul, Wakaden C Brimobdasu, Kompol Yengki, Kajari Padangsidimpuan, Freddi Ashari Siregar, Ketua Pengadilan Negeri, Syahlan, Ketua Pengadilan Agama, H Aspan Pulungan, dan sejumlah pimpinan SKPD di Pemkab Tapsel. (a27)

History ....

modalnya untuk tembakau Deli. Tanah Deli meliputi wilayah Sungai Wampu hingga Sungai Ular merupakan lahan yang subur untuk tanaman tembakau, yang kemudian disebut Deli. Sayang, kini khususnya di Medan maupun Deliserdang, para generasi muda kurang mengetahui historis tembakau Deli yang sudah mendunia tersebut, karena keberadaannya sudah “membonsai” . Seperti dikatakan Ibrahim Effendi Siregar, pegiat perkebunan di Deliserdang kepada Waspada, pekan ini, bahwa historis tembakau Deli kini tinggal lagenda. Pernyataan Ibrahim banyak benarnya. Betapa tidak, tembakau Deli pada awal abad ke-19, merupakan primadona hasil perkebunan di wilayah Hindia Belanda, sehingga mengangkat nama Tanah Deli di kancah perdagangan dunia. Namun, kian tahun jumlah kebun tembakau Deli kian menurun, hingga tergeser dengan komoditas lainnya, seperti kelapa sawit dan kakao. Pantauan Waspada di lokasi Kebun Helvetia PTPN II Tanjungmorawa, pekan ini terungkap, kebun tembakau Deli yang dulu ditanam ratusan hektare, kini hanya tinggal tiga kebun saja. Yakni, Kebun Helvetia, Buloh Cina dan Klumpang. Masing-masing ladang seluas 0,8 Ha. Bahkan, pemasarannya di Bremen tidak terdengar lagi. Tembakau yang menurut penikmatnya memiliki cita rasa dan aroma yang khas ini, belum dapat disamai oleh tembakau dari pelosok dunia lainnya. Data dari PT. Perkebunan Nusantara II, penjualan tem-

Al Bayan ....

muslimah tapi tak berjilbab, katanya ia hakim, tapi tak mau menghukum dengan hukum syariah, katanya ia ekonom, tapi makan riba. Munafik memang sangat berbahaya, mereka musuh dalam selimut, menggunting dalam lipatan. Allah menggambarkan mereka sebagai penipu dirinya sendiri yang tidak sadar. “Mereka menipu Allah dan orang-orang yang beriman, padahal mereka menipu dirinya sendiri, sedangkan mereka tidak sadar. Dalam hati mereka ada penyakit, lalu ditambah Allah penyakitnya dan bagi mereka siksa yang pedih, disebabkan mereka berdusta, (QS.2:9—10). Kaum munafik sangat

putri bungsunya, Bima Ayu Sitepu kepada Waspada di lokasi stand. Seperti untuk menjaga kondisi mata, menurut kakek pensiunan guru SDN 106226 Padangbaru,Dolokmasihul tahun 1998, itu sejak kecil orang tuanya selalu menganjurkan untuk makan buah kecipir atau daunnya, sedangkan untuk penyakit malaria cukup dengan kayu Raja Panawar ( Bruto Wali) yang dicampur dengan kapur, dioleskan ke bagian atas perut. “Makanya walaupun sudah memasuki usia 74 tahun, saya masih bisa membaca tanpa kaca mata dan tetap berkendaraan sepeda motor dengan tetap mengamalkan makan buah kecipir itu,” kata Jamaidin sembari membaca koran Harian Waspada untuk membuktikannya. Dahulu, lanjutnya, saat dibentangkan naskah kuno ini mencapai panjang 8 meter, tetapi sekarang hanya tinggal dua meter lebih saja,” Sisanya

hilang dimakan usia, bahkan ada bahagian yang hilang begitu saja tanpa tahu kemana raibnya,” kata kakek 21 cucu itu. Bahkan, kata dia, naskah kuno itu sempat ditawar oleh warga Tebingtinggi dan Medan untuk koleksi.Tetapi ditolak karena warisan keluarga. “ Saya jadi lebih teringat dengan naskah kuno ini, setelah anak saya menceritakan

ada kitab suci Alquran tulisan tangan berusia ratusan tahun dikoleksi di stand Waspada, sehingga saya datang kemari dan menitipkan beberapa malam hingga acara selesai.Saya berharap pengunjung bisa melihat, siapa tahu masih ada yang bisa membaca dan mempelajarinya sehingga bisa bermanfaat,” harap Jamaidin Sitepu. (c03)

Belasan Rumah ....

rumah warga tampak rusak. Camat Khairul Saleh Siregar, SSos dan Sekcam Timur Tumanggor serta sejumlah staf bersama Kapolsek AKP Triyadi, SH, SiK dan Kanit Intel AKP Najaruddin Siregar serta beberapa personil dan Kades Patumbak II Saptono tampak turut membantu warga memperbaiki beberapa rumah yang rusak ringan. Informasi diperoleh, sebelum angin puting beliung, cuaca sudah tampak mendung

ditandai dengan langit gelap dan embusan angin kencang, petir yang menggelegar. Selang beberapa saat hujan deras turun diiringi angin kencang dan petir. Tak lama, angin menerbangkan atap-atap rumah warga. Sementara, Camat Khairul Saleh Siregar, SSos didampingi Sekcam Timur Tumanggor dan Kapolsek AKP Triyadi, SH, SiK mengatakan, sebanyak 14 rumah dan ruko rusak berat dan ringan disebabkan angin puting beliung. (c02)

82 Finalis ....

fahmil Quran, syarhil Quran, hifzil Quran, 10,20,30 juz, M2Q, 1 dan 5 juz Tilawah, cabang tafsir Quran, cabang anak-anak mujawat, tartil Quran dan cabang cacat netra. Jumat (4/5) dinihari di mimbar utama MTQ, Dewan Hakim mengumumkan para peserta yang masuk babak final golongan dewasa putra dan putri. Adapun ke 82 peserta yakni untuk MTQ golongan anak-anak putra, Nomor Panggil Peserta (NPP) 000.62, 000.64 dan 000.28, untuk anakanak putri, NPP 0001.49, 0001.41, 000.43, Cabang Tartil Quran putra, NPP 0002.08, 0002.50,002.62 dan Tartil Quran putri NPP 003.23, 003.37, 003.67. Untuk golongan remaja putri NPP 005.65, 005.55, 005.43, remaja putra NPP 004.12, 004.70, 004.38, dewasa putri, NPP 007.03, 007.21, 003.59, dewasa putra, 006.32, 006.04, 006.50. Finalis 1 juz golongan putraNPP 012.38, 012.24, 012.16, 1 juz putri NPP 013.71, 013.33, 013.67, 5 juz putra NPP 014.36, 014.26, 014.06 dan 5 juz putri NPP

015.33, 015.25, 015.45. 10 juz golongan putra NPP 016.02, 016.22, 016.14, 10 juz putri 017.25, 017.11, 017.29, 20 juz putra NPP 018.02, 018.30, 018.14, 20 juz putri NPP 019.27, 019.13, 019.19, 30 juz putra NPP 020.18, 020.10, 020.14, dan 30 juz putri NPP 021.15, 021.17, 021.19. Cabang tafsir Alquran, golongan Bahasa Indonesia putra, NPP 022.06, 022.12, 022.22, Bahasa Inggris putra NPP 026.12, 026.12, 026.06, Bahasa Inggris putri, NPP 027.21, 027.15, 027.13. Sementara cabang fahmil Quran NPP 028.08, 028.12, 028.23, 028.23, 028.17, cabang syarhil Quran NPP 029.19, 029.19, 029.20 , cabang M2IQ, NPP 036.06, 036.08, 036.12, 036.14, 036.18 dan NPP 036.20. Cabang qiraat sab’ah putra, NPP 010.34, 010.20, 010.40, qiraat Saba’ah putri, NPP 011.27, 011.21 dan NPP 011.15. Perlombaan final digelar di 6 arena di Kec.Pegajahan dan Kec.Perbaungan.Peserta yang masuk final diantaranya tuan rumah, Kab.Serdang Bedagai 16 finalis, Pemko Medan, 18 finalis Kab.Samosir satu grup finalis, Pemko Pematang

Siantar, 2 finalis serta dari PTPN 8 finalis diberbagai cabang perlombaan. Pantauan Waspada, sejak Jumat pagi Bupati Sergai, H.T Erry Nuradi, Wakil Bupati Sergai, H.Soekirman, Ketua Panitia MTQ, Drs.Haris Fadillah, serta sejumlah Kepala SKPD Pemkab Sergai meninjau di lokasi pelaksanaan final. Fahmil Quran Sementara pada pertandingan final untuk cabang Fahmil Quran dengan Ketua Dewan Hakim, Drs.H.Palit Muda Harahap dan Panitera Drs.H.Romsil Harahap yang dilaksanakan di gedung replika Sultan Serdang, Jumat (4/5) utusan Kab.Samosir atas nama Fuad Ahmadi Lubis,18, Hilmiyah Humaidi Damanik,12, dan Muhammad Nizar Handa Nasution,12, dengan total nilai 1050. Disusul Kab.Serdang Bedagai atas nama Anwar Syukri Harahap, Ihyaur Rahmi dan Ni d a u l H u s n a K a h i r i a h dengan nilai 1010, sedangkan juara III ditempati utusan Pemko Medan, atas nama Bayu Muhammad, Zainuddin dan Hanifan Izza. (c03)

bakau Deli di Pasar Bremen pada 2007, senilai Rp56,277 miliar (, 18 Juli 2007). Pendapatan ini dianggap cukup bagus dibanding tahun sebelumnya (Rp56,116 miliar), meskipun volumenya lebih menurun. Pada 2006 mencapai 4.371 bal, sedangkan 2007 hanya 3.770 bal. Peningkatan pendapatan ini disinyalir karena peningkatan kualitas tembakau Deli, setelah dilakukan pemangkasan jumlah kebun, yang awalnya 12 menjadi 6 pada 2007. Perlu diketahui, kebun tembakau pada 1889 berjumlah 170 kebun. Referensi Waspada, setelah Perang Dunia II kebun tembakau Deli masih tersisa 30 kebun (1949). Tiga tahun berikutnya tinggal 25 kebun, hingga 2007, tersisa enam kebun saja. Keenam kebun yang masih tersisa itu antara lain Kebun Sampali (1.584 Ha), Helvetia (1.008 Ha), Buluh Cina (1.200 Ha), Tandem (720 Ha), Klambir Lima (720 Ha), dan Klumpang (1.728 Ha). Hasil diskusi Tim Ekspedisi Geografi Indonesia VI tahun 2099, mencatat bergesernya komoditi perkebunan yang terjadi di Sumatera Utara, akibat kelatahan secara emosional yang dilakukan oleh pemilik perkebunan. Akibatnya, perwilayahan komoditi sesuai dengan kondisi lingkungannya akan susah dilakukan. Kondisi inilah yang dialami tembakau Deli, yang lambat laun semakin terdesak oleh kelapa sawit karena memiliki nilai ekonomi lebih tinggi di pasar dunia. Jika tanpa suatu usaha yang maksimal dari pemerintah dan perguruan tinggi untuk meningkatkan kualitas dan kuantitas

tembakau Deli, bahan cerutu tipe Eropa ini hanya menyisakan legenda, seperti bangsalbangsal yang ditemui Tim EGI VI di sepanjang jalan raya Stabat-Pangkalanbrandan, yaitu Kebun Kuala Begumit. Bangsal yang berdiri sejak zaman Kolonial Belanda itu, kini nampak kusam. Sebuah alat berangka tahun 1886 teronggok berdiri tanpa fungsi apapun. Di sebelahnya terlihat tumpukan tembakau yang telah berujud tanah coklat, hancur dan hanya terlihat serat-seratnya saja. Padahal, tembakau Deli adalah simbol kejayaan Kerajaan Deli. Melalui komoditas inilah Kerajaan Deli tersohor di dunia pada awal abad ke19. Namun, seiring menurunnya kekuasaan Deli akibat campur tangan penjajah, menurunkan pula produksi komoditas tembakau di Tanah Deli. Cuaca Ekstrem Saat Waspada menemui Kepala Divisi Tanaman (dulu Asisten Kepala-red) Kebun Helvetia, C. Silalahi, tanaman tembakau Deli yang dia kuasai seluas 200 ladang (0,8 ha/ ladang) hanya menghadapi cuaca ekstrem. “Jadi kita harus pandaipandai membaca alam. Jika meleset jelas akan menghadapi masalah kualitas tanaman yang paling diminati warga Bremen ini. Kita hanya menghadapi pesaing dari negara Amerika Latin saja, sementara Kamerun sudah tutup,” ujarnya, Kamis (26/4). Soal sistem pengelolaan kebun menurut Silalahi, masih tetap seperti dulu yakni sistem keluarga internal perusahaan Badan Usaha Milik Negara (BUMN). Perlu diketahui, sistem ini kemudian disadur

pandai bersilat lidah, menanam tebu dibibir.: Dan bila dikatakan kepada mereka, “Dan janganlah kamu membuat kerusakan di muka bumi”. Mereka menjawab: “Sesungguhnya kami orang-orang yang mengadakan perbaikan. Ingatlah sesungguhnya mereka itulah orang-orang yang membuat kerusakan, tetapi mreka tidak sadar. (QS.2:11—12). Zaman Rasulullah SAW, kaum munafiq dipimpin oleh Abdullah bin Ubay. Sebenarnya dia salah seorang tokoh Negeri Yasrib (Madinah) yang paling didengar oleh berbagai kelompok (kabilah) yang ada pada masa itu. Tetapi ketika Rasulullah tiba di Yasrib, tokoh ini langsung memudar. Masyarakat berbondong-bon-

dong masuk Islam, dan membaiat Nabi sebagai pemimpin. Abdullah bin Ubay merasa ditinggalkan oleh kaumnya. Lalu ia berpura-pura masuk Islam. Cuma yang Islam zahirnya saja, hatinya tidak Islam. Kaum munafik ada setiap zaman dan setiap tempat. Hendaklah orang-orang beriman mengawasi mereka, jangan memberi kepercayaan kepada mereka. Bila mereka dapat berkuasa di mana saja, mereka pasti menolak hukum Islam dan mengambil hukum taghut sebagai pedomannya. Mereka benci kepada Islam dan cinta kepada kekafiran. Mereka bisa bersahabat mesra dengan kaum kafir, tetapi bermusuhan sesama Islam. Nauzubillahi min zalik.

di pemerintahan. Silalahi juga menjelaskan keunggulan tembakau Deli terdiri atas tiga daun. Pertama daun pasir, kaki satu dan kaki dua. Tercatat pada 2009, komoditi tembakau Deli tetap mejadi primadona di Pasar Bremen, Jerman. Semester I 2009 saja, hasil lelang tembakau deli PTPN II di Jerman itu mencapai 1.036 bal atau sekitar 76.890 kg. Hingga per 25 juni 2009, pihak PTPN II melelang tembakau jenis daun pasir senilai 49.045 Euro. Dengan rata-rata lelang mencapai 30.000 Euro. Selama periode lelang itu, selain jenis daun pasir juga terjual tembakau jenis kaki satu senilai 34.426 Euro dan jenis kaki dua senilai 8.010 Euro. Bal di pasar lelang dunia itu, mencapai rata-rata 30.000 Euro. Semua komoditi tersebut, merupakan hasil produksi dari Kebun Tandem Hilir, Helvetia, dan Klambir Lima. Ekspor tembakau Deli ke pasaran dunia selama tiga tahun terakhir ini menunjukkan kecenderungan meningkat, walau pun lahan untuk komoditi andalan Sumut itu setiap tahun terus berkurang akibat penyerobotan oleh berbagai kalangan. Memang, tembakau Deli sangat terkenal karena kualitasnya sangat baik untuk cerutu yaitu sebagai pembalut (deg blad). Pusat pasar tembakau cerutu Deli masa lalu di Bremen Jerman. Dengan demikian tembakau Deli adalah potensi lokal yang khas untuk Kab. Deliserdang. Potensi itu adalah potensi kesesuaian lahan di daerah ini yang dapat menghasilkan kualitas tembakau yang sangat baik. Tetapi, mampukah tembakau Deli mengukir riwayat seperti dulu?. Carlah jawabannya. * Rizaldi Anwar/ Khairul K Siregar

Ada-ada Saja ....

suami termasuk dengan sepupunya sendiri. Wanita kembar ini mengaku bahwa sejak remaja mereka sudah terbiasa tertarik dengan pria yang sama, dan sebelumnya pernah terpikir kalau mereka akan menikahi orang yang sama pula. Pria ini menikah dengan salah satu wanita kembar dan sepupunya di tahun 1990. Pria ‘beruntung’ ini kemudian menikahi kembaran lainnya di tahun 2000 dan hidup damai di Salt Lake City, Utah. Poligami merupakan hal yang diperbolehkan di sebagian besar negara Amerika. (rzl)

WASPADA Sabtu 5 Mei 2012

Konferensi Perempuan HKBP 2012 Dibuka TARUTUNG (Waspada): Konferensi perempuan HKBP (Huria Kristen Batak Protestan) tahun 2012, diikuti ribuan peserta dari berbagai distrik, dibuka Ehorus HKBP Pdt DR Bonar Napitupulu di Seminarium Sipoholon,Kab. Tapanuli Utara,Jumat (4/5). Ketua Umum Panitia konferensi Perempuan HKBP 2012, Ny Maddin Sihombing boru Napitupulu BBA mengatakan, konferensi dilaksanakan selama tiga hari (3 – 6 Mei 2012) diikuti dua utusan dari setiap resort sebanyak 1400 orang.

Disebutkan, konferensi bukan sekedar program rutin HKBP, melainkan perwujudan tugas dan panggilan kepada kaum perempuan HKBP untuk dapat memberikan peran yang lebih bermakna. Konferensi perempuan HKBP 2012 mengambil tema “ Hiduplah dalam kebenaran dan kekudusan yang sesungguhnya” Sub tema “ Dengan konferensi dan peretemuan raya kaun perempuan HKBP memantapkan hidup dan persekutuannya didalam kebenaran dan kekudusan Allah”.

Anny boru Napitupulu BBA menyebut, kegiatan tersebut diisi ceramah menampilkan Pdt. DR Bonar Napitupulu ( Ephorus HKBP) bertopik “ Ina soripada yang hidup dalam kebenaran dan kekudusan Allah. Pdt DR Jamilin Sirait ( K a d e p Ko i n o n i a H K B P ) dengan materi “Perem-puan dan persekutuan”. Anny Napitupulu ( Ny. Drs Maddin Sihombing, Bupati Humbang Hasundutan) ber topik “ Perempuan bijak, ahli pengeloloa keuangan keluarga”. (a21)

PA Resmi Dukung....

depan akan jauh lebih baik dan kita akan memberikan dukungan penuh karena visi dan misi kita sama. Dan inilah yang membedakan pemerintahan Aceh dulu dan ke depan yang dipimpin oleh petinggi Partai Aceh,” terangnya. Dalam deklarasi yang memberikan dukungan penuh kepada pasangan Hasanuddin Breuh/Ali Basrah untuk memenangkan Pilkada

di Agara Jumat malam, dihadiri oleh Fahrul H Yusuf, Wakil Sekretaris Jenderal DPP Partai Aceh, Ketua DPW Partai Aceh Tenggara, Ardiansyah dan sejumlah pengurus lain, sedangkan dari kandidat Bupati Aceh Tenggara priode 2012-2017, langsung dihadiri oleh Hasanuddin Breuh alias Sanu dan berlangsung di kantor DPP Partai Aceh (PA) di Banda Aceh. (b01)

Penembak ....

berang, lalu saya tembak bagian paha sebelah kanan agar korban tidak mengikuti saya lagi.Tapi tembakan itu tidak mengenainya. Lalu saya tembak lagi dan mengenai bagian rusuk sebelah kiri. Setelah terkapar, saya melarikan diri ke Klambir V Lorong Tower, Medan Sunggal, tempat tinggal ibu angkat saya bernama Eti Hartati,” jelasnya. Sementara itu, Kasat Reskrim Kompol M Yoris Marzuki mengatakan, senjati api jenis revolver yang digunakan tersangka didapat dari Aceh milik Herman yang sudah tewas

dalam penembakan. “Tapi kami akan terus melakukan penyelidikan dan masih mengejar seorang berinisial R yang menyaksikan penembakan itu. Untuk saksi, kita sudah memeriksa enam orang dari warga sekitar dan keluarga korban,” katanya. Dia menyebutkan, tersangka DAN juga residivis yang sudah empat kali keluar masuk penjara. “Dia terlibat dalam kasus pembunuhan tahun 2000, kasus sabu 2007, dan kasus penggelapan sepedamotor 2008 dan 2009,” ujar Yoris. (m39)

Plt Gubsu ....

berstatus Pelaksana Tugas terkait Peraturan Pemerintah Nomor 49 tahun 2008 dan perubahan ketiga atas Peraturan Pemerintah No 6 Tahun 2005 tentang Pemilihan, Pengesahan Pengangkatan dan Pemberhentian Kepala Daerah dan Wakil Kepala Daerah. Di mana Pasal 132 disebutkan, pejabat yang diangkat dari wakil kepala daerah yang menggantikan kepala daerah dilarang melakukan berbagai hal termasuk membuat kebijakan tentang pemekaran daerah. Dengan demikian Gatot yang berstatus Pelaksana Tugas berdasarkan PP tersebut tidak berwenang memberi rekomendasi. Untuk menegaskan hal tersebut, Gatot meminta pertimbangan dari Kementerian Dalam Negeri cq Dirjen Otda perihal wewenang dirinya, apakah diperbolehkan menandatangani rekomedasi. Asisten I Pemerintahan Setdaprovsu Hasiholan Silaen menambahkan, draft surat

keputusan Plt Gubsu sudah disiapkan menunggu hasil pertimbangan dari Dirjen Otda. Di hadapan para tokoh Simalungun, Gatot menelefon Dirjen Otda Kementerian Dalam Negeri Djohermansyah, meminta segera memberikan jawaban atas surat permohonan pertimbangan yang dikirimkannya. Sementara itu, Ketua KNPI Simalungan Elkananda Shah menjelaskan, niat kedatangan berbagai tokoh masyarakat ke hadapan Plt Gubsu ingin mempertanyakan keseriusan pemerintah provinsi terhadap usulan pemekaran yang sudah diajukan. Anggota DPRD Sumut Janter Sirait dalam kesempatan itu menjelaskan, usulan pemekaran Pemekaran Kabupaten Simalungun sudah pernah diajukan dan telah mendapatkan rekomendasi Gubernur Sumut M Rudolf Pardede pada 2007. (m28)

Irwandi Kalah ....

menggerakkan struktur untuk mempengaruhi pemilih supaya memilih pihak terkait. Hakim Konstitusi Hamdan Zoelfa pada kesempatan itu meny ebutkan bahwa pidana yang dituduhkan pihak Irwandi-Muhyan tidak terbukti dapat mempengaruhi pilihan pemilih. “Dan tidak terbukti dilakukan dengan kerja sama sistematis antara pelaku kekerasan dengan termohon (KIP Aceh), pihak terkait, maupun aparat penegak hukum, baik dalam bentuk aktif maupun

pasif (pembiaran),” kata Hamdan. Hamdan mengatakan tuduhan Partai Aceh menggerakkan atau memerintahkan strukturnya memengaruhi pemilih dengan tindakan intimidasi ataupun teror juga tidak terbukti. Pasangan Irwandi-Muhyan mengajukan gugatan terkait pilkada Aceh 2012 ke MK karena menganggap telah terjadi praktik intimidasi, teror, dan pelanggaran oleh Komite Independen Pemilu (KIP) saat Pilkada. (j07/ant)

Bupati Aceh Tenggara tidak lupa menyampaikan terima kasih karena Partai Aceh telah memberikan dukungan penuh kepada dia dan pasangannya. “Mulai dari pengurus DPP PA, DPW PA Aceh Tenggara sampai kepada pendukung dan simpatisan PA kita memberikan apresiasi atas kepercayaan dan kita siap memajukan Aceh, khususnya di Aceh Tenggara,” kata Sanu, yang juga Ketua DPD II Golkar Aceh Tenggara itu. Dia juga menyampaikan bahwa dirinya sudah membuat perjanjian dengan Pemerintah Aceh untuk mensinergikan dan sinkronisasi semua kegiatan pembangunan yang diaplikasikan melalui Rencana Pembangunan Jangka Menengan (RPJM) dengan Gubernur dan Wakil Gubernur terpilih. Artinya, RPJM yang dibuat dan dirancang oleh pemerintah Aceh juga akan dilaksanakan sepenuhnya di tingkat kabupaten kota, tidak kecuali Aceh Tenggara. “Saya melihat semangat dan tekad Pemerintah Aceh ke Ketua KNPI DPD Simalungun Elkananda Shah, Asisten I Pemerintahan Kabupaten Simalungun Huberlun Hutagaol di Kantor Gubsu, Jumat (4/3). Hadir mendampingi Plt Gubsu, Sekda Provsu H Nurdin Lubis, SH, MM, Asisten Pemerintahan Setdaprovsu Hasiholan Silaen, Kepala Biro Pemerintahan Noval Akhyar, SH dan lainnya. Kehadiran elemen masyarakat Simalungun meminta dukungan dan rekomendasi Gatot terhadap usulan pemekaran yang disampaikan Pemkab Simalungun pada 2 Maret silam yang melampirkan hasil kajian kebutuhan pemekaran dan rekomendasi Bupati dan DPRD Simalungun. Gatot mengatakan, pada dasarnya mendukung aspirasi yang disampaikan.Namun, pihaknya belum dapat menerbitkan SK rekomendasi karena masih menunggu fatwa dari Dirjen Otda perihal kewenangan seorang Gubernur beralasan dan tidak terbukti menurut hukum. Fakta yang terungkap di persidangan, kata dia, pelanggaran dalam pemilihan kepala daerah tersebut terjadi secara sporadis dan tidak melalui suatu perencanaan yang matang. Pertimbangan majelis hakim tersebut, menurut dia, berdasarkan fakta bahwa kapasitas pihak terkait (pasangan Zaini Abdullah-Muzakir Manaf-red) bukan sebagai pejabat pemerintahan yang dapat

WASPADA Sabtu 5 Mei 2012

Medan Metropolitan


Refleksi 1 Tahun Penghancuran Masjid Al Ikhlas MEDAN (Waspada): Ketua Badan Kenaziran Masjid Al Ikhlas Jalan Timor Medan Ustaz Sudirman Timsar Zubil menyatakan, Insya Allah Masjid Al Ikhlas akan segera dibangun dalam waktu dekat ini. Ini kabar gembira bagi seluruh umat Islam dan anugerah dari Allah SWT dan sudah ada titik terangnya. Hal tersebut ditegaskan Sudirman Timsar Zubir pada seribuan umat Islam yang memadati sepanjang Jalan Timor. “Masjid Al Ikhlas, Insya Allah, akan dibangun kembali. Mari kita husnudzon. Kita sudah melihat titiktitik positif dalam perjuangan ini. Kita harus menjalin silaturahim dan ukhuwah dengan seluruh pihak. Sudah ada itikad baik dalam per-

juangan ini,” ujarnya pada acara tabliq akbar dan refleksi 1 tahun penghancuran Masjid Al Ikhlas di Jln Timor Medan, Jumat (4/5). Menurut dia, sudah ada titik terangnya. “Tim negosiasi telah bertemu dengan instansi terkait dan Masjid Al Ikhlas akan segera dibangun dalam waktu dekat ini,” sebut Timsar yang disambut dengan ucapan hamdallah dan pekikan takbir oleh jamaah Shalat Jumat. Timsar Zubil menambahkan, walau Masjid Al Ikhlas direncanakan akan dibangun kembali, namun perjuangan membela masjid di Kota Medan, tidak akan berhenti. Sekarang ini, ada beberapa masjid yang terancam akan dihancurkan oleh pihak pengembang. Pembelaan terhadap masjidmasjid tersebut terus dilakukan

dengan jalan perjuangan maupun diplomasi. Akhirnya, yang memutuskan keberhasilan perjuangan hanyalah Allah semata. Sementara itu, Ketua Aliansi Ormas Islam Pembela Masjid Sumatera Utara H Leo Imsar Adnan mengatakan, Allah merahmati perjuangan umat Islam selama ini. “Sudah setahun kita shalat Jumat di reruntuhan Masjid Al-Ikhlas, tapi tidak sekali pun turun hujan. Ini merupakan perlindungan dan rahmat Allah kepada kita semua. Alhamdulillah, kita akan berjuang terus. Aliansi terus membangun kekompakan, ukhuwah dan silaturahim dengan seluruh organisasi Islam,” kata dia. Acara refleksi dan tabligh akbar yang digelar sejak Kamis malam dan Jumat siang, dibuka

dengan pembacaan ayat suci Alquran dan disambung dengan laporan Ketua Panitia Drs Anwar Bakti. Anwar menyampaikan permohonan maaf kepada jamaah atas ketidakhadiranWakil Ketua MUI Pusat yang sebelumnya sudah direncanakan. “Bagaimanapun, kami berterimakasih kepada seluruh pihak yang telah mendukung acara ini. Semuanya karena Allah, karena itu hanya Allah-lah yang dapat membalasnya. Refleksi ini merupakan momentum untuk memperjuangkan masjidmasjid yang lain. Ini merupakan bukti dari kekuatan jamaah,” katanya. Jamaah yang hadir pada refleksi tersebut mendengarkan tausiyah dari Ustadz Ir Heriansyah yang menekankan soal

keikhlasan perjuangan Islam dari sejak zaman Rasulullah. “Umat Islam harus memegang prinsip keikhlasan, karena ikhlas merupakan harga mati dalam setiap perbuatan atau melaksanakan sesuatu perbuatan. Keikhlasan juga membuat kita berbuat dan bersikap objektif,” ujarnya. Selain itu, tambah Heriansyah, umat Islam jangan cepat berburuk sangka kepada siapapun, apa yang dilakukan Pangdam I/BB merupakan anugerah dari Allah bagi kita semuanya. Refleksi pada Kamis malam ditutup doa oleh Wakil Ketua MUI Medan sekaligus Sekretaris Dewan Masjid Indonesia (DMI) Sumut Dr H Hasan Mansur Nasution MA, dan pasca tabligh akbar doa oleh Ustadz H Romaulis. (h04)

Waspada/Surya Efendi

SEJUMLAH jamaah bersantap siang bersama usai menunaikan shalat Jumat di ruas Jln. Timor Medan, Jumat (4/5). Peringatan satu tahun perubuhan Masjid Al Ikhlas di Jl. Timor tersebut ditandai dengan pelaksanaan tabligh akbar.

Jamaah Curigai Yayasan Masjid Agung Hasil Infaq Jumat Rp8,3 Juta MEDAN (Waspada): Hasil infaq Shalat Jumat, 4 Mei 2012, kembali dihitung secara terbuka oleh pihak Yayasan Masjid Agung disaksikan sejumlah jamaah. Proses penghitungan yang berlangsung di ruang te-

ngah masjid tersebut, disaksikan Ketua Yayasan Masjid Agung Bachtiar Fanani Lubis dan sejumlah jamaah diantaranya H. Martius Latuperissa, H. Donald Sidabalok dan lainlain.

Hasilnya, terkumpul uang senilai Rp8.381.000 dan 18 Ringgit Malaysia. Jumlah infaq Shalat Jumat yang dinilai cukup besar itu, mengundang kecurigaan jamaah terhadap pengurus Yayasan Masjid Agung.

Pasalnya, sejak dilakukan penghitungan secara terbuka dan disaksikan para jamaah, ternyata hasil infaq Shalat Jumat dinilai sangat besar. Jumlah ini berbeda jauh ketika hasil infaq Shalat Jumat tersebut dihitung sendiri oleh pihak pengelola Masjid Agung. Penghitungan hasil infaq Shalat Jumat secara terbuka ini

mulai dilakukan pada 27 April 2012 dan uang yang terhimpun sebesar Rp7,8 juta serta 20 Ringgit Malaysia. Sedangkan Jumat sebelumnya (20 April 2012), uang infaq yang terhimpun hanya berkisar Rp3,5 juta. Jumlah tersebut merupakan hasil penghitungan sendiri yang dilakukan pihak pengelola Masjid Agung.

Waspada/Amir Syarifuddin

PULUHAN jamaah Shalat Jumat Masjid Agung Medan, Jumat (4/5) menyaksikan pihak Yayasan Masjid Agung Medan saat menghitung uang hasil infaq yang mencapai Rp8,3 juta.

Prihatin, Masalah Masjid Agung MEDAN (Waspada): Permasalahan yang terjadi di Masjid Agung mengundang keprihatinan banyak pihak, termasuk anggota DPRDSU yang beragama Islam. Ke depan, anggota dewan dari lintas fraksi akan menjembatani untuk menyelesaikan berbagai masalah yang terjadi. Tiga anggota DPRDSU berbicara kepada Waspada, di gedung dewan, Jumat (4/1). Mereka adalah Enda Mora Lubis, Amsal Nasution dan Marahalim Harahap. Ketiganya mengaku sangat prihatin atas masalah Masjid Agung yang kini sudah menjadi konsumsi umat Islam. Secara informal, kata Enda

Mora, sejumlah anggota DPRDSU dari lintas fraksi mulai mendiskusikan masalah ini. Dalam bincang-bincang sesama rekan di legislatif pada beberapa kesempatan, permasalahan di Masjid Agung selalu muncul. ‘’Intinya, kami merasa prihatin atas kejadian-kejadian di sana (Masjid Agung),’’ ujarnya. Menindaklanjuti bincangbincang informal tersebut, mereka membuat gagasan untuk mengumpulkan rekan-rekan dewan yang beragama Islam dan mendiskusikan masalah ini. Namun belum diketahui peran apa yang dapat dilakukan dewan masuk dalam masalah tersebut.

Secara pribadi, Enda Mora berharap dewan dapat menjadi mediator dari berbagai pihak untuk menyelesaikan masalah yang terjadi. ‘’Tapi nanti kita diskusikan dulu. Mungkin minggu depan, kita (anggota dewan lintas fraksi) akan berkumpul untuk membahas masalah ini,’’ katanya. Enda Mora dan Marahalim, juga meminta masukan dari Waspada sebagai media yang aktif memberitakan masalah Masjid Agung. Dari kejadian dan komentar berbagai pihak yang diberitakan Waspada, kesannya jamaah sudah tidak percaya lagi kepada pengelola Masjid Agung. Puncak ketidakpercayaan itu,

yakni para jamaah minta pengelola melakukan penghitungan secara terbuka terhadap hasil infaq yang diperoleh dari pelaksanaan Shalat Jumat pada 27 April dan 4 Mei 2012, Waspada sudah memberitakan permasalahan di Masjid Agung sejak pengelola mengizinkan halaman masjid dijadikan areal parkir kendaraan pengunjung Sun Plaza. Setelah itu masalahnya berkembang sampai saat ini. Komisi E DPRDSU juga sudah memberikan komentar akan mengundang pengelola Masjid Agung, tapi belum pernah terwujud. Anggota dewan Amsal Nasution berpendapat, pihakYaya-

san Masjid Agung harusnya berbesar hati untuk mendiskusikan masalah ini. Artinya, mereka jangan bertahan dengan pendapat mereka, sementara umat sudah banyak yang protes. DPRDSU sendiri, katanya, merasa ‘terganggu’ dengan berbagai permasalahan yang kemudian diangkat ke publik oleh media massa. Harusnya pengelola Masjid Agung segera menyelesaikan masalah yang terjadi sebelum menjadi konsumsi publik lebih luas. Katanya, pengelola harus menyadari bahwa Masjid Agung merupakan satu dari beberapa masjid kebanggaan umat Islam Kota Medan. Terlebih letak Masjid Agung sangat berdekatan dengan pusat pemerintahaan Sumatera Utara. (m12)

Berdasarkan pengamatan Waspada, proses penghitungan infaq Shalat Jumat tersebut sempat memanas. Sejumlah jamaah sempat melontarkan katakata bernada negatif terhadap pengelola Masjid Agung. “10 Tahun lebih infaq Shalat Jumat di Masjid Agung ini tidak pernah lebih dari Rp3 juta. Di bulan Ramadhan, hasil infaq Shalat Jumat mencapai Rp4 juta. Makanya waktu pembongkaran kotak infaq Jumat lalu, saya terkejut hasilnya bisa mencapai hampir Rp7,8 juta,” ujar Syahrul, seorang PNS Kantor Gubsu yang ikut menyaksikan penghitungan tersebut. Seorang jamaah lainnya langsung meminta pengurus Yayasan Masjid Agung segera mengundurkan diri setelah mengetahui infaq Shalat Jumat yang dihitung secara terbuka itu memperoleh hasil sangat besar. “Sebaiknya pengurus Yayasan Masjid Agung mengundurkan diri saja karena tidak mampu mempertanggungjawabkan pengelolaan keuangan terutama hasil infaq Shalat Jumat. Lihat saja, ketika penghitungan dilakukan sendiri oleh pihak pengelola Masjid Agung, hasilnya selalu tidak lebih dari Rp3 juta. Tapi ketika dilakukan penghitungan secara terbuka, hasilnya bisa lebih dari Rp7 juta,” ujarnya dengan nada tinggi. Saat dilakukan penghitungan hasil infaq, pada beberapa kotak terselip selebaran yang mendiskreditkan nama H. Martius Latuperissa. Tak urung, selebaran negatif itu mengundang komentar tokoh masyarakat yang juga jamaah Masjid Agung Medan, Donald Sidabalok. Dia mengaku sangat menyayangkan adanya selebaran dalam kotak infaq yang mengintimidasi dan mendiskreditkan nama salah seorang jamaah tersebut. “Ini bentuk provokasi yang dilakukan pihak tidak bertanggungjawab. Padahal, saya yakin tujuan H Martius Latuperissa melakukan hal tersebut tak lain untuk perbaikan pengelolaan Masjid Agung Medan ke depannya,” ucap Donald. Menolak Mengenai desakan mundur dari sejumlah jamaah, Ketua Yayasan Masjid Agung Medan Bachtiar Fanani Lubis dengan tegas menolaknya. “Tidak bisa dibubarkan begitu saja. Kan ada prosedurnya,” ujarnya. Sebelumnya sempat terjadi dialog antara sejumlah jamaah dengan Bachtiar Fanani dan pengurus lainnya. Jamaah meminta pengurusYayasan Masjid Agung membubarkan diri untuk sementara sembari membentuk pengurus yang baru atau membentuk Badan Kenaziran Masjid (BKM) Agung Medan. “Apakah Pak Nani mau mundur selangkah untuk maju

seribu langkah?,” tanya seorang jamaah. Namun Fanani menjawab, untuk membubarkan yayasan ada aturannya. Jawaban Fanani itu ditimpali jamaah dengan mengatakan, pembubaran itu akan dilakukan dengan memakai aturan. Bahkan Fanani dengan suara sedikit serak sambil dibantu penjelasan Yusuf Pardamean menerangkan, dalam mingguminggu ini pihak Yayasan Masjid Agung Medan akan melakukan rapat internal. “Kita akan rapat untuk evaluasi dulu dalam minggu ini,” jawab Fanani. Sikap Fanani ini tak urung membuat emosi para jamaah. Bahkan seorang wanita yang kerap melakukan shalat lima

waktu di masjid terbesar di Kota Medan itu sempat melontarkan kata-kata bernada negatif. Ditanya apa ada rencana untuk menstanvaskan kepengurusan yayasan seperti yang banyak disuarakan para jamaah? Fanani menjawab, “no comment dululah.” Menurutnya, untuk menyikapi permasalahan yang terjadi tidak bisa dilakukan secara spontan, harus ada rencana yang terprogram. Apakah selama ini Fanani tidak mengetahui hasil infaq jamaah Shalat Jumat tanpa dilakukan audit dan tanpa ada pembukuan? Fanani spontan meninggalkan jamaah yang bertanya tanpa memberi penjelasan atas pertanyaan yang dilontarkan kepada dirinya.(m28/m36/m48)


Berita Utama

Sipirok Kundusif P.SIDIMPUAN (Waspada): Situasi keamanan dan ketertiban umum di Kota Sipirok, Kec. Sipirok, Kab. Tapanuli Selatan, pasca aksi pemblokiran Jalan Lintas Sumatera (Jalinsum), pembakaran dua alat berat milik pemerintah daerah, dan perusakan perusakan rumah warga, mulai terkendali. “Sudah kondusif, dan aktivitas ekonomi di Pasar Sipirok yang kebetulan semalam merupakan hari pekan, sama sekali tidak terganggu,” ujar Kapolres Tapsel, AKBP Subandriya, didampingi Bupati Syahrul M Pasaribu pada konferensi pers bersama unsur Muspida Plus di Kantor Bupati, Jumat (4/5). Menurut Kapolres, situasi Kamtibmas mulai terkendali sejak Kamis (3/5) pagi. Utamanya setelah dilakukan pertemuan dan dialog bersama para tokoh masyarakat, agama, adat, dan pemuda di Masjid Sri Alam Dunia. Dalam pertemuan itu, disimpulkan aksi anarkis tidak serta merta berawal dari warga Sipirok. “Tolong teman-teman pers dalam pemberitaannya tidak menjustifikasi aksi tersebut merupakan sikap warga Sipirok secara keseluruhan. Karena warga Sipirok itu santun dan berbudaya,” pintanya. Dalam kasus tersebut, kata Kapolres, dari 20 warga yang diamankan Kamis (4/5) dini hari, tiga orang ditetapkan sebagai tersangka, yakni AP alias Kocu, tersangka pembakaran alat berat. SS dan HN, ditetapkan sebagai tersangka perusakan rumah. Sementara 17 orang lainnya dipulangkan dan telah diserahkan ke keluarganya, disaksikan unsur Muspika Sipirok pada Kamis (3/5). Jangan Terprovokasi Sementara Bupati bersama Wakil Bupati Tapsel, Syahrul M Pasaribu dan Aldinz Rapolo Siregar, meminta kepada seluruh masyarakat di 14 kecamatan agar tidak terprovokasi dengan kejadian ini. Mengenai dua alat berat jenis eskavator yang dibakar massa, Bupati Tapsel menyerahkan sepenuhnya kepada aparat penegak hukum. Sementara, Wakil bupati Tapsel, Aldinz Rapolo Siregar, yang ditanya berapa kerugian yang dialami Pemkab Tapsel atas terbakarnya dua eskavator tersebut, menurut dia, belum diketahui, karena belum ada laporand ari Kadis Pekerjaan Umum (PU). “ Tetapi, Pemkab Tapsel mengalami kerugian pada pos pemasukan keuangan daerah hampir Rp.500 juta dari alat berat itu,” katanya. (a27)

Hukuman Syamsul ... Pada putusan tingkat banding itu, Syamsul Arifin melalui kuasa hukumnya mengajukan kasasi ke Mahkamah Agung. Belum Terima Sementara itu, kuasa hukum Syamsul Arifin, Abdul Hakim Siagian, yang dikonfirmasiWaspada, Jumat (4/5) malam, mengatakan, secara formal putusan kasasi MA tersebut belum diterima. Menurut Siagian, apakah putusan MA tersebut sudah mempertimbangkan buktibukti maupun keberatan yang diajukan dalam kasasi. “Intinya apakah bukti dan keberatan kuasa hukum sudah dipertimbangkan MA?,” kata Hakim Siagian. Dikatakannya, bila formal

Irwandi KO ... Majelis Hakim yang juga Ketua MK Mahfud MD saat membacakan putusan atas gugatan tersebut di Jakarta, Jumat (4/5). Mahfud yang didampingi delapan hakim konstitusi lain menyatakan pokok permohonan yang diajukan pasangan Irwandi-Muhyantidakberalasandan tidak terbukti menurut hukum. Fakta yang terungkap di persidangan, kata dia, pelanggaran dalam pemilihan kepala daerah tersebut terjadi secara sporadis dan tidak melalui suatu perencanaan yang matang. Pertimbangan majelis hakim tersebut, menurut dia, berdasarkan fakta bahwa kapasitas pihak terkait (pasangan Zaini Abdullah-Muzakir Manaf-red) bukan sebagai pejabat pemerintahan yang dapat menggerakkan struktur untuk mempengaruhi pemilih supaya memilih pihak terkait. Hakim Konstitusi Hamdan Zoelfa pada kesempatan itu menyebutkan bahwa pidana yang dituduhkan pihak Irwandi-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mxh7+, Rf8. 3. Gh5+, Kg6. 4. MxK+, Rf8. 5. Kh7+, Re7. 6. Me8+mat.

Jawaban TTS: Musik & Filem




Jawaban Sudoku: 8 7 1 9 5 0 6 4 2 3

0 6 4 7 9 3 2 8 1 5

2 1 3 5 8 4 0 9 7 6

4 5 0 2 7 6 3 1 8 9

9 3 6 8 2 1 5 7 0 4

3 8 5 6 4 7 1 0 9 2

6 0 7 4 1 2 9 3 5 8

Muhyan tidak terbukti dapat mempengaruhi pilihan pemilih. “Dan tidak terbukti dilakukan dengan kerja sama sistematis antara pelaku kekerasan dengan termohon (KIP Aceh), pihak terkait, maupun aparat penegak hukum, baik dalam bentuk aktif maupun pasif (pembiaran),” kata Hamdan. Hamdan mengatakan tuduhan Partai Aceh menggerakkan atau memerintahkan strukturnya memengaruhi pemilih dengan tindakan intimidasi ataupun teror juga tidak terbukti. Pasangan Irwandi-Muhyan mengajukan gugatan terkait pilkada Aceh 2012 ke MK karena menganggap telah terjadi praktik intimidasi, teror, dan pelanggaran oleh Komite Independen Pemilu (KIP) saat Pilkada. (j07/ant)

Ada-ada Saja ... Wanita kembar ini mengaku bahwa sejak remaja mereka sudah terbiasa tertarik dengan pria yang sama, dan sebelumnya pernah terpikir kalau mereka akan menikahi orang yang sama pula. Pria ini menikah dengan salah satu wanita kembar dan sepupunya di tahun 1990. Pria ‘beruntung’ ini kemudian menikahi kembaran lainnya di tahun 2000 dan hidup damai di Salt Lake City, Utah. Poligami merupakan hal yang diperbolehkan di sebagian besar negara Amerika. (rzl)

7 2 9 3 0 8 4 5 6 1

1 9 2 0 3 5 8 6 4 7

5 4 8 1 6 9 7 2 3 0

12 Kader Golkar ...

PA Dukung Hasanuddin-Ali Basrah BANDA ACEH (Waspada): Partai Aceh secara resmi mendukung pasangan Ir Hasanuddin Breuh MM dan Ali Basrah untuk memenangkan Pilkada di Kabupaten Aceh Tenggara yang akan dilaksanakan 2 Juli 2012 mendatang. “DPP Partai Aceh mulai malam ini memberikan dukungan untuk Hasanuddin Breuh dan Ali Basrah, bukan calon atau pasangan lain”, tegas Sekretaris Jenderal DPP Partai Aceh Tgk Yahya Muad kepada Waspada, Jumat (4/5) petang, di kantor DPP PA di Banda Aceh. Kata dia, pasangan Hasanuddin/Ali Basrah memiliki visi dan misi yang sama dengan Partai Aceh dalam membangun Aceh lebih baik. Sedangkan soal kemampuan Bupati Hasanuddin yang akrab disapa Sanu, menurut dia sudah teruji dalam memimpin Aceh Tenggara yang patut didukung sehinggga daerah itu lebih maju dan masyarakatnya sejahtera. “Kita punya pe-

mikiran yang sama dengan pasanganSanu/AliBasrah,”ujarnya. Hasanuddin Breuh yang kini masih menjawab sebagai Bupati Aceh Tenggara tidak lupa menyampaikan terima kasih karena Partai Aceh telah memberikan dukungan penuh kepada dia dan pasangannya. “ Mulai dari pengurus DPP PA, DPW PA Aceh Tenggara sampai kepada pendukung dan simpatisan PA kita memberikan apresiasi atas kepercayaan dan kita siap memajukan Aceh, khususnya di Aceh Tenggara,” kata Sanu, yang juga Ketua DPD II Golkar Aceh Tenggara itu. Dia juga menyampaikan bahwa dirinya sudah membuat perjanjian dengan Pemerintah Aceh untuk mensinergikan dan sinkronisasi semua kegiatan pembangunan yang diaplikasikan melalui Rencana Pembangunan Jangka Menengan (RPJM) dengan Gubernur dan Wakil Gubernur terpilih. Artinya, RPJM yang dibuat dan di-

rancang oleh pemerintah Aceh juga akan dilaksanakan sepenuhnya di tingkat kabupaten kota, tidak kecuali Aceh Tenggara. “Saya melihat semangat dan tekad Pemerintah Aceh ke depan akan jauh lebih baik dan kita akan memberikan dukungan penuh karena visi dan misi kita sama. Dan inilah yang membedakan pemerintahan Aceh dulu dan ke depan yang dipimpin oleh petinggi Partai Aceh,” terangnya. Dalam deklarasi yang memberikan dukungan penuh kepadapasangan HasanuddinBreuh/ Ali Basrah untuk memenangkan Pilkada di Agara Jumat malam, dihadiri oleh Fahrul H Yusuf, Wakil Sekretaris Jenderal DPP Partai Aceh, Ketua DPW Partai Aceh Tenggara, Ardiansyah dan sejumlah pengurus lain, sedangkan dari kandidat Bupati Aceh Tenggara priode 2012-2017, langsung dihadiri oleh Hasanuddin Breuh alias Sanu dan berlangsung di kantor DPP Partai Aceh (PA) di Banda Aceh. (b01)

Plt Gubsu ...

Otda perihal kewenangan seorang Gubernur berstatus Pelaksana Tugas terkait Peraturan Pemerintah Nomor 49 tahun 2008 dan perubahan ketiga atas Peraturan Pemerintah No 6 Tahun 2005 tentang Pemilihan, Pengesahan Pengangkatan dan Pemberhentian Kepala Daerah danWakil Kepala Daerah.Di mana Pasal 132 disebutkan, pejabat yang diangkat dari wakil kepala daerah yang menggantikan kepala daerah dilarang melakukan berbagai hal termasuk membuat kebijakan tentang pemekaran daerah. Dengan demikian Gatot yang berstatus Pelaksana mengatakan, senjati api jenis revolver yang digunakan tersangka didapat dari Aceh milik Herman yang sudah tewas dalam penembakan. “Tapi kami akan terus melakukan penyelidikan dan masih mengejar seorang berinisial R yang menyaksikan penembakan itu. Untuk saksi, kita sudah memeriksa enam orang dari warga sekitar dan keluarga korban,” katanya. Dia menyebutkan, tersangka DAN juga residivis yang sudah empat kali keluar masuk penjara. “Dia terlibat dalam kasus pembunuhan tahun 2000, kasus sabu 2007, dan kasus penggelapan sepedamotor 2008 dan 2009,” ujar Yoris. (m39)

Tugas berdasarkan PP tersebut tidak berwenang memberi rekomendasi. Untuk menegaskan hal tersebut, Gatot meminta pertimbangan dari Kementerian Dalam Negeri cq Dirjen Otda perihal wewenang dirinya, apakah diperbolehkan menandatangani rekomedasi. Asisten I Pemerintahan Setdaprovsu Hasiholan Silaen menambahkan, draft surat keputusan Plt Gubsu sudah disiapkan menunggu hasil pertimbangan dari Dirjen Otda. Di hadapan para tokoh Simalungun, Gatot menelefon Dirjen Otda Kementerian Dalam Negeri Djohermansyah, meminta segera memberikan jawaban atas surat permohonan pertimbangan yang dikirimkannya. Sementara itu, Ketua KNPI Simalungan Elkananda Shah menjelaskan, niat kedatangan berbagai tokoh masyarakat ke hadapan Plt Gubsu ingin mempertanyakan keseriusan pemerintah provinsi terhadap usulan pemekaran yang sudah diajukan. Anggota DPRD Sumut Janter Sirait dalam kesempatan itu menjelaskan, usulan pemekaran Pemekaran Kabupaten Simalungun sudah pernah diajukan dan telah mendapatkan rekomendasi Gubernur Sumut M Rudolf Pardede pada 2007. (m28)

berbagai petuah-petuah, termasuk cara pengobatan tradisional,” terang Jarmaidin didampingi putri bungsunya, Bima Ayu Sitepu kepada Waspada di lokasi. Seperti untuk menjaga kondisi mata, menurut kakek pensiunan guru SDN 106226 Padangbaru,Dolokmasihul tahun 1998, itu sejak kecil orang tuanya selalu menganjurkan untuk makan buah kecipir atau daunnya, sedangkan untuk penyakit malaria cukup dengan kayu Raja Panawar ( Bruto Wali) yang dicampur dengan kapur, dioleskan ke bagian atas perut. “Makanya walaupun sudah memasuki usia 74 tahun, saya masih bisa membaca tanpa kaca mata dan tetap berkendaraan sepeda motor dengan tetap mengamalkan makan buah kecipir itu,” kata Jamaidin sembari membaca koran Waspada untuk membuktikannya. Dahulu, lanjutnya, saat di-

bentangkan naskah kuno ini mencapai panjang 8 meter, tetapi sekarang hanya tinggal dua meter lebih saja,” Sisanya hilang dimakan usia, bahkan ada bahagian yang hilang begitu saja tanpa tahu kemana raibnya,” kata kakek 21 cucu itu. Bahkan, kata dia, naskah kuno itu sempat ditawar oleh warga Tebingtinggi dan Medan untuk koleksi.Tetapi ditolak karena warisan keluarga. “ Saya jadi lebih teringat dengan naskah kuno ini, setelah anak saya menceritakan ada kitab suci Alquran tulisan tangan berusia ratusan tahun dikoleksi di standWaspada, sehingga saya datang kemari dan menitipkan beberapa malam hingga acara selesai.Saya berharap pengunjung bisa melihat, siapa tahu masih ada yang bisa membaca dan mempelajarinya sehingga bisa bermanfaat,” harap Jamaidin Sitepu. (c03)

Kehadiran elemen masyarakat Simalungun meminta dukungan dan rekomendasi Gatot terhadap usulan pemekaran yang disampaikan Pemkab Simalungun pada 2 Maret silam yang melampirkan hasil kajian kebutuhan pemekaran dan rekomendasi Bupati dan DPRD Simalungun. Gatot mengatakan, pada dasarnya mendukung aspirasi yang disampaikan.Namun, pihaknya belum dapat menerbitkan SK rekomendasi karena masih menunggu fatwa dari Dirjen

Penembak Anak Denai ... Namun, tersangka DAN tidak mau mengembalikan sebelum uang yang dipinjam korban dikembalikan. Keduanya bertengkar. “Karena berang, lalu saya tembak bagian paha sebelah kanan agar korban tidak mengikuti saya lagi.Tapi tembakan itu tidak mengenainya. Lalu saya tembak lagi dan mengenai bagian rusuk sebelah kiri. Setelah terkapar, saya melarikan diri ke Klambir V Lorong Tower, Medan Sunggal, tempat tinggal ibu angkat saya bernama Eti Hartati,” jelasnya. Sementara itu, Kasat Reskrim Kompol M Yoris Marzuki

Kitab Kuno Pustaha ... Naskah kuno itu milik Jarmaidin Sitepu,74, warga Dusun I, Desa Dolok Manampang, Kec. Dolok Masihul, Kab.Serdang Bedagai yang dipinjamkan kepada penjaga stan Waspada untuk dipajangkan. Tujuannya, agar pengunjung mengetahui di Kab.Sergai masih ada naskah kuno berusia ratusan tahun. Menurut Jarmaidin, naskah kuno itu diwariskan oleh orang tuanya, dengan nama Pustaha Laklak Nialam, yang sebelumnya dirawat oleh empat keturunan keluarga hingga terakhir sampai di tangannya atau lima keturunan. Naskah kuno itu berasal dari Tanah Karo. “Saya sendiri tidak bisa membaca bahasanya karena memakai bahasa kuno.Seingat saya sewaktu kecil menjelang tidur orang tua selalu menceritakan naskah itu, yang katanya, berisikan


2. Mh6+, Rf7.

TTS Topik

putusan kasasi ini telah diterima Syamsul Arifin tentu tim kuasa hukum akan mempelajari putusan MA tersebut. “Nantinya kita akan lihat dulu, apakah dapat diterima, bila dapat diterima tentu saja persoalan hukum ini selesai dengan tunduk pada putusan kasasi itu,” katanya. Namun bila nantinya kita keberatan atas putusan kasasi itu, kata Hakim Siagian, masih ada upaya hukum lainnya. “Jika nanti kita keberatan atas putusan kasasi itu, kita akan tempuh upaya hukum luar biasa yakni peninjauan kembali (PK). Namun kita belum bisa menyatakan langkah berikutnya yang akan kita tempuh karena formalnya putusan kasasi itu belum kita terima,” ujarnya. (j02)

Pilkada Agara

hingga Sungai Ular merupakan lahan yang subur untuk tanaman tembakau, yang kemudian disebut Deli. Sayang, kini khususnya di Medan maupun Deliserdang, para generasi muda kurang mengetahui historis tembakau Deli yang sudah mendunia tersebut, karena keberadaannya sudah “membonsai”. Seperti dikatakan Ibrahim Effendi Siregar, pegiat perkebunan di Deliserdang kepada Waspada, pekan ini, bahwa historis tembakau Deli kini tinggal lagenda. Pernyataan Ibrahim banyak benarnya. Betapa tidak, tembakau Deli pada awal abad ke-19, merupakan primadona hasil perkebunan di wilayah Hindia Belanda, sehingga mengangkat nama Tanah Deli di kancah perdagangan dunia. Namun, kian tahun jumlah kebun tembakau Deli kian menurun, hingga tergeser dengan komoditas lainnya, seperti kelapa sawit dan kakao. Pantauan Waspada di lokasi Kebun Helvetia PTPN II Tanjungmorawa, pekan ini terungkap, kebun tembakau Deli yang dulu ditanam ratusan hektare, kini hanya tinggal tiga kebun saja. Yakni, Kebun Helvetia, Buloh Cina dan Klumpang. Masing-masing ladang seluas 0,8 Ha. Bahkan, pemasarannya di Bremen tidak terdengar lagi. Tembakau yang menurut penikmatnya memiliki cita rasa dan aroma yang khas ini, belum dapat disamai oleh tembakau dari pelosok dunia lainnya. Data dari PT. Perkebunan Nusantara II, penjualan tembakau Deli di Pasar Bremen pada 2007, senilai Rp56,277 miliar (, 18 Juli 2007). Pendapatan ini dianggap cukup bagus dibanding tahun sebelumnya (Rp56,116 miliar), meskipun volumenya lebih menurun. Pada 2006 mencapai 4.371 bal, sedangkan 2007 hanya 3.770 bal. Peningkatan pendapatan ini disinyalir karena peningkatan kualitas tembakau Deli, setelah dilakukan pemangkasan jumlah kebun, yang awalnya 12 menjadi 6 pada 2007. Perlu diketahui, kebun tembakau pada 1889 berjumlah 170 kebun. Referensi Waspada, setelah Perang Dunia II kebun tembakau Deli masih tersisa 30 kebun (1949). Tiga tahun berikutnya tinggal 25 kebun, hingga 2007, tersisa enam kebun saja. Keenam kebun yang masih tersisa itu antara lain Kebun Sampali (1.584 Ha), Helvetia (1.008 Ha), Buluh Cina (1.200 Ha), Tandem (720 Ha), Klambir Lima (720 Ha), dan Klumpang (1.728 Ha). Hasil diskusi Tim Ekspedisi Geografi Indonesia VI tahun 2099, mencatat bergesernya komoditi perkebunan yang terjadi di Sumatera Utara, akibat kelatahan secara emosional yang dilakukan oleh pemilik perkebunan. Akibatnya, perwilayahan komoditi sesuai dengan kondisi lingkungannya akan susah dilakukan. Kondisi inilah yang dialami tembakau Deli, yang lambat laun semakin terdesak oleh kelapa sawit karena memiliki nilai ekonomi lebih tinggi di pasar dunia. Jika tanpa suatu usaha yang maksimal dari pemerintah dan perguruan tinggi untuk meningkatkan kualitas

dan kuantitas tembakau Deli, bahan cerutu tipe Eropa ini hanya menyisakan legenda, seperti bangsal-bangsal yang ditemui Tim EGI VI di sepanjang jalan raya Stabat-Pangkalanbrandan, yaitu Kebun Kuala Begumit. Bangsal yang berdiri sejak zaman Kolonial Belanda itu, kini nampak kusam. Sebuah alat berangka tahun 1886 teronggok berdiri tanpa fungsi apapun. Di sebelahnya terlihat tumpukan tembakau yang telah berujud tanah coklat, hancur dan hanya terlihat serat-seratnya saja. Padahal, tembakau Deli adalah simbol kejayaan Kerajaan Deli. Melalui komoditas inilah Kerajaan Deli tersohor di dunia pada awal abad ke-19. Namun, seiring menurunnya kekuasaan Deli akibat campur tangan penjajah, menurunkan pula produksi komoditas tembakau di Tanah Deli. Cuaca Ekstrem Saat Waspada menemui Kepala Divisi Tanaman (dulu Asisten Kepala-red) Kebun Helvetia, C. Silalahi, tanaman tembakau Deli yang dia kuasai seluas 200 ladang (0,8 ha/ladang) hanya menghadapi cuaca ekstrem. “Jadi kita harus pandai-pandai membaca alam. Jika meleset jelas akan menghadapi masalah kualitas tanaman yang paling diminati warga Bremen ini. Kita hanya menghadapi pesaing dari negara Amerika Latin saja, sementara Kamerun sudah tutup,” ujarnya, Kamis (26/4). Soal sistem pengelolaan kebun menurut Silalahi, masih tetap seperti dulu yakni sistem keluarga internal perusahaan Badan Usaha Milik Negara (BUMN). Perlu diketahui, sistem ini kemudian disadur di pemerintahan. Silalahi juga menjelaskan keunggulan tembakau Deli terdiri atas tiga daun. Pertama daun pasir, kaki satu dan kaki dua. Tercatat pada 2009, komoditi tembakau Deli tetap mejadi primadona di Pasar Bremen, Jerman. Semester I 2009 saja, hasil lelang tembakau deli PTPN II di Jerman itu mencapai 1.036 bal atau sekitar 76.890 kg. Hingga per 25 juni 2009, pihak PTPN II melelang tembakau jenis daun pasir senilai 49.045 Euro. Dengan rata-rata lelang mencapai 30.000 Euro. Selama periode lelang itu, selain jenis daun pasir juga terjual tembakau jenis kaki satu senilai 34.426 Euro dan jenis kaki dua senilai 8.010 Euro. Bal di pasar lelang dunia itu, mencapai ratarata 30.000 Euro. Semua komoditi tersebut, merupakan hasil produksi dari Kebun Tandem Hilir, Helvetia, dan Klambir Lima. Memang, tembakau Deli sangat terkenal karena kualitasnya sangat baik untuk cerutu yaitu sebagai pembalut (deg blad). Pusat pasar tembakau cerutu Deli masa lalu di Bremen Jerman. Dengan demikian tembakau Deli adalah potensi lokal yang khas untuk Kab. Deliserdang. Potensi itu adalah potensi kesesuaian lahan di daerah ini yang dapat menghasilkan kualitas tembakau yang sangat baik. Tetapi, mampukah tembakau Deli mengukir riwayat seperti dulu? Carilah jawabannya. Rizaldi Anwar/Khairul K Siregar

Sementara Darus Siska mengatakan, revitalisasi ini merupakan perintah dari DPP. Di mana Plt Ketua DPD I PG Sumut diberikan kewenangan penuh untuk menyusun komposisi pengurus partai hasil revitalisasi. “Ada beberapa kriteria untuk pergantian ini. Keaktifan di organisasi, profesional dan proporsional, loyalitas, soliditas, dan domisili kader untuk optimalisasi. Jadi anggota yang pindah dari Sumut, perlu disesuaikan jabatannya,” kata Siska. Sementara itu, Andi Achmad Dara menambahkan, pergantian sejumlah pengurus bertujuan untuk meningkatkan kinerja Golkar Sumut. Meskipun, dia menyadari sebagian besar yang direvitalisasi itu adalah kader senior Golkar. “Saya kira tidak ada masalah. Semua sudah dilakukan dengan pertimbangan dan perhitungan yang terukur. Diharapkan Golkar Sumut bisa menjalankan kerja politik dengan baik,” kata Andi, dan menampik pergantian Hardi dkk ini adalah ekses dari permintaan mereka ke Ical untuk menetapkan Ketua DPD defenitif di Sumut dengan menggelar Musdalub atau yang disebut-sebut Kelompok 55. Namun yang jelas, menurut Andi, n komposisi

Pegawai Lapas ... tersangka, masih menunggu hasil laboratorium forensik untuk pengecekan tes urin,” sebutnya menjelaskan, tersangka pernah bertugas di Lapas Klas II Banda Aceh, kemudian pindah ke Lapas Tanjung Gusta Medan. Kata Andjar, pihaknya masih mengembangkan untuk mengungkap kasus peredaran narkoba yang dilakukan tersangka. “Dia kita curigai sebagai pemasok narkoba ke Lapas Tanjung Gusta dan terkait jaringan bandar narkoba yang di DPO berinisial IC,” ujarnya. Sementara tersangka ditanyai wartawan tidak banyak berkomentar. Setiap pertanyaan selalu dijawab tidak ada. “Tidak ada itu bang,” kata dia sambil menunduk.

82 Finalis ... Untuk golongan remaja putri NPP 005.65, 005.55, 005.43, remaja putra NPP 004.12, 004.70, 004.38, dewasa putri, NPP 007.03, 007.21, 003.59, dewasa putra, 006.32, 006.04, 006.50. Finalis 1 juz golongan putraNPP 012.38, 012.24, 012.16, 1 juz putri NPP 013.71, 013.33, 013.67, 5 juz putra NPP 014.36, 014.26, 014.06 dan 5 juz putri NPP 015.33, 015.25, 015.45. 10 juz golongan putra NPP 016.02, 016.22, 016.14, 10 juz putri 017.25, 017.11, 017.29, 20 juz putra NPP 018.02, 018.30, 018.14, 20 juz putri NPP 019.27, 019.13, 019.19, 30 juz putra NPP 020.18, 020.10, 020.14, dan 30 juz putri NPP 021.15, 021.17, 021.19. Cabang tafsir Alquran, golongan Bahasa Indonesia putra, NPP 022.06, 022.12, 022.22, Bahasa Inggris putra NPP 026.12, 026.12, 026.06, Bahasa Inggris

WASPADA Sabtu 5 Mei 2012

baru pengurus Golkar Sumut ini sudah sesuai arahan dari DPP. Dia mengaku ke depan, dia akan lebih sering berada di Medan. ”Perlu diketahui setahun terakhir kegiatan cukup padat. Kita lihat hasilnya hari ini. Soal Musdalub Golkar Sumut, belum adaarahandaripartai,”terangnya. Wakil Sekretaris DPP Partai Golkar Leo Nababan menambahkan, pergeseran dan pergantian pengurus merupakan hal biasa dan menjadi hak partai. ‘’Ini adalah upaya penyegaran agar kinerja partai lebih baik. Tidak ada masalah. Kader tenang. Dukung pejabat partai yang baru,” ungkapnya. Menurut Leo, nama-nama yang tidak lagi menjadi pengurus tidak berpengaruh pada jabatan mereka sebagai wakil rakyat di DPRD. Dia mengimbau, kader Golkar di DPRD Sumut yang tak lagi menjadi pengurus agar lebih fokus lagi menjalankan tugas kedewanannya. “Tapi kalau nanti melawan.Tentu akan adasanksidaripartai,”ancamLeo. Menanggapi itu, salah seorang pengurus yang dicopot, Reza Fakhrumi Tahir melihat ada aroma dendam dibalik pencopotan mereka. “Pencopotan itu sangat erat kaitannya dengan permintaan 55 pengurus untuk segera memilih Ketua DPD defenitif,” ujarnya. Tersangka juga membantah sebagai bandar narkoba, hanya pengguna. “Pakeknya juga baru,” sebut pria berbadan tegap itu. Istrinya yang turut dihadirkan juga tidak mau berkomentar. Wanita itu terlihat masih mengenakan pakaian tidur. Untuk memastikan keterlibatan tersangka dalam peredaran narkoba, petugas Subdit II, Jumat sore mengecek kembali mobil tersangka. Saat itu ditemukan timbangan elektrik tersembunyi di bawah jok kursi sopir. Namun tersangka berdalih lagi. “Bukan punya saya, punya teman,” katanya saat menyaksikan penggeledahan itu. Sedangkan Kombes Andjar mengatakan, akan kembali menggeledah kediaman tersangka. “Semalam belum maksimal,” tuturnya. (m27)

Reza yang sebelumnya menjabat Wakil Sekretaris me-nilai Andi Achmad Dara panik karena tidak bisa memberikan pertanggungjawaban soal ketidakberesan kepemimpinannya. Sehingga akhirnya mengganti para pengurus dengan standar pemberhentian yang tidak sesuai dengan peraturan organisasi. Karena menurut peraturan organisasi ada empat alasan pengurus boleh diganti. Yaitu karena meninggal dunia, tidak aktif, rangkap jabatan di partai dan pindah partai. “Tetapi kami ini semua pengurus aktif. Apa agenda partai selama ini yang kami tidak terlibat,” katanya. Reza malah melihat penunjukan Andi Achmad Dara yang sebenarnya menyalahi peraturan organisasi. Menurut peraturan, jabatan Plt paling lama dua bulan, dan bertugas untuk mengantarkan pelaksanaan Musdalub. Karena itu, menurut Reza mereka akan mengkaji SK pencopotan tersebut, dan segera mengirimkan surat keberatan ke DPP .”Ada yang salah dengan SK pencopotan kami,” katanya. Panik Sementara Hardi Mulyono mengaku ada mendengar dirinya bersama kader Partai Golkar yang lain terkena sanksi. Katanya, ini merupakan tanda-tanda kepanikan Plt Ketua DPD Golkar Sumut Andi Achmad Dara. Ini menunjukkan bahwa Andi tidak bisa memimpin partai politik. Dia seperti memimpin perusahaan karena tidak bisa menerima perbedaan pendapat. “Itulah kemudian dia membuat laporan kepada ketua umum dan langsung mengambil tindakan pemberhentian,” ujarnya seraya menambahkan padahal perbedaan pendapat itu biasa-biasa saja, tapi dia tidak bisa menerima itu. Selama setahun kepemimpinan Andi, menurut Hardi, telah memunculkan banyak perbedaan pendapat di antara pengurus. Begitu pun, kata Hardi, dia belum menerima surat pencopotan. Hardi mengatakan kalau hal seperti ini terus terjadi bentuk kehancuran Golkar. Hardi menegaskan, dia akan melakukan gugatan hukum atas pencopotan dirinya. (m48/m12)

putri, NPP 027.21, 027.15, 027.13. Sementara cabang fahmil Quran NPP 028.08, 028.12, 028.23, 028.23, 028.17, cabang syarhil Quran NPP 029.19, 029.19, 029.20 , cabang M2IQ, NPP 036.06, 036.08, 036.12, 036.14, 036.18 dan NPP 036.20. Cabang qiraat sab’ah putra, NPP 010.34, 010.20, 010.40, qiraat Saba’ah putri, NPP 011.27, 011.21 dan NPP 011.15. Perlombaan final digelar di 6 arena di Kec.Pegajahan dan Kec.Perbaungan.Peserta yang masuk final diantaranya tuan rumah, Kab.Serdang Bedagai 16 finalis, Pemko Medan, 18 finalis Kab.Samosir satu grup finalis, Pemko Pematang Siantar, 2 finalis serta dari PTPN 8 finalis di berbagai cabang perlombaan. Pantauan Waspada, sejak Jumat pagi Bupati Sergai, H.T Erry Nuradi, Wakil Bupati Sergai, H.Soekirman, Ketua Panitia

MTQ, Drs.Haris Fadillah, serta sejumlah Kepala SKPD Pemkab Sergai meninjau di lokasi pelaksanaan final. Fahmil Quran Sementara pada pertandingan final untuk cabang Fahmil Quran dengan Ketua Dewan Hakim, Drs.H.Palit Muda Harahap dan Panitera Drs.H.Romsil Harahap yang dilaksanakan di gedung replika Sultan Serdang, Jumat (4/5) utusan Tobsa atas nama Fuad Ahmadi Lubis,18, Hilmiyah Humaidi Damanik,12, dan Muhammad Nizar Handa Nasution,12, juara I dengan total nilai 1050. Disusul Kab.Serdang Bedagai atas nama Anwar Syukri Harahap, Ihyaur Rahmi dan Nidaul Husna Kahiriah dengan nilai 1010, sedangkan juara III ditempati utusan Pemko Medan, atas nama Bayu Muhammad, Zainuddin dan Hanifan Izza. (c03)

Al Bayan ... Munafik memang sangat berbahaya, mereka musuh dalam selimut, menggunting dalam lipatan. Allah menggambarkan mereka sebagai penipu dirinya sendiri yang tidak sadar. “Mereka menipu Allah dan orang-orang yang beriman, padahal mereka menipu dirinya sendiri, sedangkan mereka tidak sadar. Dalam hati mereka ada penyakit, lalu ditambah Allah penyakitnya dan bagi mereka siksa yang pedih, disebabkan mereka berdusta, (QS.2:9—10). Kaum munafik sangat pandai bersilat lidah, menanam tebu dibibir. :Dan bila dikatakan kepada mereka, “Dan janganlah kamu membuat kerusakan di muka bumi”. Mereka menjawab: “Sesungguhnya kami orang-orang yang mengadakan perbaikan. Ingatlah sesungguhnya mereka itulah orang-orang yang membuat kerusakan, tetapi mreka tidak sadar. (QS.2:11—12) Zaman Rasulullah SAW, kaum munafiq di-

pimpin oleh Abdullah bin Ubay. Sebenarnya dia salah seorang tokoh Negeri Yasrib (Madinah) yang paling didengar oleh berbagai kelompok (kabilah) yang ada pada masa itu. Tetapi ketika Rasulullah tiba di Yasrib, tokoh ini langsung memudar. Masyarakat berbondongbondong masuk Islam, dan membaiat Nabi sebagai pemimpin. Abdullah bin Ubay merasa ditinggalkan oleh kaumnya. Lalu ia berpurapura masuk Islam. Cuma yang Islam zahirnya saja, hatinya tidak Islam. Kaum munafik ada setiap zaman dan setiap tempat. Hendaklah orang-orang beriman mengawasi mereka, jangan memberi kepercayaan kepada mereka. Bila mereka dapat berkuasa di mana saja, mereka pasti menolak hukum Islam dan mengambil hukum taghut sebagai pedomannya. Mereka benci kepada Islam dan cinta kepada kekafiran. Mereka bisa bersahabat mesra dengan kaum kafir, tetapi bermusuhan sesama Islam. Nauzubillahi min zalik.

Medan Metropolitan


WASPADA Sabtu 5 Mei 2012

Tangkal Babyboom Plt Gubsu Lantik Kepala BKKBN Sumut MEDAN (Waspada): Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho berharap Badan Kependudukan dan Keluarga Berencana Nasional (BKKBN) Perwakilan Sumatera Utara bisa menangkal terjadinya Babyboom (ledakan kelahiran anak). Upaya tersebut dapat dilakukan dengan mensupervisi biro-biro pemberdayaan perempuan dan anak di kabupaten/kota se-Sumut. Sebab, sejumlah daerah sudah menyadari akan terjadinya ledakan jumlah penduduk di wilayah mereka. “Saya harapkan Kepala Perwakilan BKKBN Sumut yang baru bisa melakukan supervisi ke daerah untuk menangkal Babyboom tersebut,” kata Gatot usai melantik dan mengambil sumpah jabatan Kepala Perwakilan BKKBN Sumut yang baru Drg. Widwiono, MKes di Aula Martabe Kantor Gubsu, Jumat (4/5). Dalam pelantikan yang dihadiri anggota DPD RI asal Sumut Parlindungan Purba, unsur

DPRDSU, Sekdaprovsu Nurdin Lubis, para pimpinan SKPD Pemprovsu dan undangan lainnya itu, Gatot menjelaskan, upaya menangkal Babyboom itu terkait dengan sektor pendidikan, pengangguran dan persoalan lahan tempat tinggal. “Berbagai persoalan terkait Babyboom ini menjadi tanggungjawab kabupaten/kota bersama pemerintah provinsi untuk bersama-sama menguatkan spirit pemberhasilan program Keluarga Berencana,” tegasnya. Ga t o t m e n e ra n g k a n , BKKBN harus menjadi inspirator, fasilitator dan penggerak program kependudukan dan KB Nasional, sehingga seluruh keluarga di Sumut dapat menerima ide keluarga kecil, sehat, bahagia dan sejahtera. “Kiranya, harapan akan hal tersebut sesuai dengan misi baru BKKBN yakni penduduk tumbuh seimbang tahun 2015,” jelasnya. Gatot mendesak agar program kependudukan dan KB Nasional ini dilaksanakan secara optimal. Bila tidak, konsekuensinya berupa ledakan jumlah penduduk yang akan terjadi dalam lima tahun ke depan. “Saat ini dunia telah dihuni kurang lebih tujuh miliar penduduk dan 240 juta jiwa di anta-

ranya berada di Indonesia dengan laju pertumbuhan sekitar 1,49 persen per tahun. Di Sumut sebanyak 12,9 juta jiwa dengan laju pertumbuhan 1,1 persen,” tambah Gatot. Menurut Gatot, persoalan yang lebih mendasar saat ini adalah proyeksi penduduk Indonesia akan berjumlah 250 juta pada 2015. Dengan kata lain, hingga tahun 2014 diperkirakan jumlah penduduk Indonesia akan bertambah 14 juta. Pertambahan yang begitu cepat ini akan mengancam ketahanan

pangan nasional, memunculkan masalah pada tenaga kerja, pendidikan, kesehatan dan berbagai persoalan sosial lainnya. Karena itu, Gatot meyakinkan, perwujudan penduduk tumbuh seimbang dan berkualitas harus disikapi dengan menyukseskan program KB Nasional. Dimana, melalui program tersebut pasangan suami istri akan dibantu untuk mengambil keputusan dan mewujudkan hak reproduksi secara bertanggungjawab, terutama menyangkut usia ideal perkawinan dan

Aweng Terima Penghargaan Pendidikan MEDAN (Waspada): Ketua Majelis Pimpinan Wilayah Pemuda Pancasila Sumatera Utara (MPW PP Sumut) Anuar Shah, SE menerima penghargaan Pendidikan di Hari Pendidikan Nasional. Penghargaan tersebut diberikan Wali Kota Medan Rahudman Harahap pada peringatan Hari Pendidikan Nasional yang digelardiSMAN3MedanJln.Budi Kemasyarakatan, Rabu (2/5).

Anuar Shah yang akrab disapa Aweng mengatakan, pendidikan merupakan aset penting bagi kemajuan sebuah bangsa. Karena itu, setiap warga negara harus dan wajib mengikuti jenjang pendidikan, baik jenjang pendidikan anak usia dini, pendidikan dasar, pendidikan menengah maupun perguruan tinggi. ”Jadi, sejak usia dini seorang anak harus mendapat pendidi-

Cuaca Sumut Berfluktuasi Akibat Pembelokan Arus Angin MEDAN (Waspada): Akibat pembelokan arus angin yang berada disekitar wilayah Sumatera Bagian Utara (Sumbagut), kondisi cuaca di kawasan Medan dan Sumatera Utara pada umumnya selalu berfluktuasi atau tidak menentu. “Dengan cuaca tak menentu atau fluktuasi antara panas dan hujan menyebabkan kondisi cuaca selalu berubah-ubah, seperti cuaca panas gerah tiba-tiba hujan baik siang, sore, dan malam. Hal ini juga sudah terjadi beberapa minggu sebelumnya,” kata Kepala Bidang Data dan Informasi (Datin) Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I Stasiun Bandara Polonia Medan Hartanto ST, MM, Rabu (2/5). Menurut dia, cuaca tidak menentu tersebut diperparah lagi dengan kondisi petir dan potensi angin kencang lokal. “Hingga beberapa hari ke depan, masyarakat diminta mewaspadai cuaca yang tidak menentu ini,” sebutnya. Begitupun, lanjutnya, hingga saat ini belum terjadi gangguan pada pergerakan penerbangan di Bandara Polonia Medan. Namun, BMKG meminta operator penerbangan agar selalu waspada terutama saat pesawat mendarat pada sore menjelang malam. “Seperti Rabu, hampir sepanjang hari terjadi cuaca mendung, namun belum terjadi gangguan pada pergerakan penerbangan, jarak tembus pandang 3 hingga 4 Km,” ujarnya. BMKG Wilayah I sebelumnya juga menyatakan, kondisi cuaca beberapa minggu ke depan masih perlu diwaspadai, baik dipesisir barat maupun pesisir timur seperti Tanah Karo, Dairi karena potensi tanah longsor masih besar. Demikian juga di pesisir barat seperti Madina dan Sibolga, ancaman longsor masih berpeluang ke depan, jika intensitas curah hujan meningkat di kawasan itu. (m32)

M-Radio UMSU Terbakar Kerugian Ratusan Juta Rupiah MEDAN (Waspada): Ruang produksi dan pemancar Muhammadiyah Radio (M-Radio) milik UMSU di Jalan Ampera X, Kel. Glugur Darat II, Kec. Medan Timur, Jum’at (4/5) sekira pukul 11:45 WIB, hangus terbakar. Kebakaran tersebut diduga karena arus pendek dari ruang produksi M-Radio. Akibatnya, peralatan seperti tiga unit komputer, satu unit Mixer dan alat pemancar terbakar, kerugian mencapai ratusan juta rupiah. Direktur M-Radio M Natsir Isfa, 50, mengatakan, dirinya mengetahui kebakaran itu dari seorang staf M-Radio. Dia kemudian bersama pihak keamanan Kampus UMSU melakukan pemadaman menggunakan tabung racun api yang berada di lokasi. Melihat api semakin membesar dan tidak bisa dikendalikan, pihaknya melaporkan kejadian kebakaran tersebut ke Dinas Pencegah dan Pemadaman Kebakaran (DP2K) Kota Medan. Enam unit mobil pemadam turun ke lokasi untuk memadamkan api. “Setelah petugas pemadam kebakaran datang, akhirnya api bisa dipadamkan,” sebut Natsir. Usai api padam, sejumlah staf M-Radio dan security UMSU melakukan evakuasi barang di dalam ruangan produksi M-Radio, sementara kerugian yang dialami akibat kebakaran ini, mencapai ratusan juta rupiah. “Kerugian ya besar lah, untuk pemancar saja harganya Rp300 juta, Mixer lagi dan computer,” ujarnya. Kata dia, akibat kebakaran itu juga, M-Radio kini tidak bisa siaran (on air) karena pemancar yang dimiliki terbakar. Peristiwa kebakaran tersebut sempat menjadi pusat perhatian warga sekitar dan mahasiswa yang melintas di lokasi kejadian. Kini kasus kebakaran tersebut ditangani oleh petugas Polsek Medan Timur dengan memasang police line di lokasi. Kanit Reskrim Polsek Medan Timur AKP Ridwan menegaskan, tidak ada korban jiwa dalam peristiwa itu dan asal api masih dalam penyelidikan. (h04)

Tewas Tergilas Truk MEDAN (Waspada): Wagini, 60, warga Jalan Medan-Binjai Km 13,5, tewas tergilas roda depan truk saat menyeberang Jalan Medan-Binjai Km 13,5, Jumat (4/5). Setelah kejadian sopir dump truk BK 8937 LR melarikan diri. Informasi yang diperoleh di kepolisian, sekira pukul 07:30, korban beranjak dari rumahnya dan keluar dari gang hendak menyebarang jalan. Diduga, korban tidak melihat ada mobil dump truk yang datang dari arah Binjai menuju Medan dengan kecepatan tinggi. Begitu melihat pejalan kaki hendak menyeberang, sopir dump truk berupaya menghindar hingga mengambil jalur ke kanan, namun upaya tersebut sia-sia sehingga ibu rumahtangga tersebut tewas tergilas ban depan truk dan tubuhnya ‘remuk’. Sementara sopir truk yang mengetahui korban telah tergilas ban depan langsung kabur melarikan diri meninggalkan korban dan truk bermuatan sirtu tersebut. Petugas Satlantas Polresta Medan Aiptu Kaspul Nasution dan Aiptu Sianturi yang turun ke lokasi kejadian, segera mengamankan dump truk dan membawanya ke Pergudangan Pemko Medan di Jalan Kayu Putih. Sedangkan mayat Wagini dibawa warga setempat ke Rumah Sakit Bangkatan, Binjai. “Sopir dump truk melarikan diri sedangkan truknya sudah diamankan di Pergudangan Jalan Kayu Putih,” kata Aiptu Kaspul Nasution usai mengambil surat visum kematian korban di RS Bangkatan, Binjai. (h04)

melahirkan, jumlah ideal anak, jarak ideal kelahiran anak dan penyuluhan kesehatan bereproduksi. “Mengacu pada semua hal tersebut, saya mengimbau seluruh jajaran instansi Pemprovsu dan masyarakat Sumut umumnya, agar mengajak para keluarga atau pasangan usia subur untuk menjadi peserta KB yang setia, lestari hingga dapat menata diri sebagai teladan dan contoh bagi masyarakat/keluarga dalam pelaksanaan program KB Nasional,” katanya.(m28)


ANUAR Shah menerima penghargaan pendidikan dari Wali Kota Medan pada peringatan Hari Pendidikan Nasional, Rabu (2/5).

kan, karena usia dini merupakan periode emas bagi perkembangan anak untuk memperoleh proses pendidikan selanjutnya,” ujar Aweng. Pendidikan, menurut Anuar Shah, berfungsi untuk mengembangkan kemampuan dan membentuk watak serta peradaban bangsa yang bermartabat dalam rangka mencerdaskan kehidupan bangsa. “Tujuannya untuk mengembangkan potensi peserta didik agar menjadi manusia yang beriman dan bertakwa kepada Tuhan Yang Maha Esa, berakhlak mulia, sehat, berilmu, cakap, kreatif, mandiri dan menjadi warga negara yang demokratis serta bertanggungjawab,” lanjut Aweng. Ditambahkannya, MPW PP Sumut terus mendukung program-program pendidikan Pemko Medan dalam rangka peningkatkan mutu dalam mencapai tujuan pendidikan. “Terutama program beasiswa agar siswa mempunyai kesempatan yang lebih besar untuk terus sekolah dan melanjutkan pendidikan ke jenjang selanjutnya,” tegas Aweng. (m08)

Pemprovsu-BNI Fasilitasi Kredit Perumahan Guru Disdik Sumut Terima Rp100 Juta MEDAN (Waspada): CEO PT. Bank Negara Indonesia (Persero) Tbk Kantor Wilayah Medan Achmad Santosa Miad dan Sekdaprovsu Nurdin Lubis menandatangani nota kesepahaman atau MoU (Memorandum of Understanding) untuk pembiayaan fasilitas kredit perumahan guru PNS dan non PNS se Sumut, di Aula Martabe Kantor Gubsu, Kamis (3/5). Fasilitas kredit yang digelontorkan BNI Wilayah Medan ini merupakan implementasi program “Rumah Untuk Guru Ku”. Achmad Santosa Miad menjelaskan, kerjasama ini sebagai komitmen BNI bersama Pemprovsu untuk pengentasan backlog (kekurangan rumah) yang diamanatkan Kementerian Perumahan Negara RI yang saat ini berjumlah antara 13 14 juta unit. “Melalui kerjasama dengan sejumlah Pemda, salah satunya dengan Pemprovsu, BNI menargetkan pengentasan backlog untuk tahun 2012 sebanyak 32.000 unit,” ucap Miad. Menurut Miad, program “Rumah Untuk Guru Ku” ini menjadi komitmen seluruh kantor wilayah BNI di Indonesia. Program ini sebagai apresiasi atas tugas mulia para guru dalam dunia pendidikan. “BNI melalui Kantor Wilayah Medan mencoba membantu meningkatkan kesejahteraan para guru se-Sumut mulai tingkat pra sekolah (TK) hingga SMA/SMK yang jumlahnya mencapai 194.121 orang,” tambahnya. Keinginan BNI memfasilitasi kepemilikan rumah untuk para guru PNS dan non PNS seSumut itu tidak saja disiapkan melalui produk BNI Griya Ko-

mersil (non subsidi), tetapi juga melalui BNI Griya Bunga Subsidi. “Dengan dua skema itu, para guru dapat memilih produk BNI Griya yang lebih variatif dan kompetitif,” ujar Miad. Sementara itu, Sekdaprovsu Nurdin Lubis berharap, melalui kerja sama ini program pemerintah untuk pengentasan backlog di Sumut bisa lebih cepat terwujud. Karena, hingga saat ini jumlah penduduk miskin di Sumut sekitar 1,6 juta jiwa atau 7,3 persen dari 13.042.317 penduduk. “Penduduk yang kurang beruntung itu membutuhkan pemukiman yang layak. Karena itu, Pemprovsu sangat mengapresiasi kerjasama seperti ini, terutama untuk menekan angka backlog di Sumut yang kira-kira mencapai 100.000 unit rumah,” ungkap Nurdin. Terima Rp100 Juta Pada kesempatan itu, BNI juga menyerahkan bantuan program CSR (Corporate Social Responsibility) kepada Dinas Pendidikan Sumut senilai Rp100.000.000 yang diterima Kepala Dinas Pendidikan Sumut Syaiful Syafri. Kemudian, Nurdin Lubis, Achmad Santoso Miad dan Syaiful Syafri secara simbolis menyerahkan kunci rumah untuk para guru, tunjangan profesi guru, rintisan BOS dan BKM kepada siswa. “Penyerahan bantuan tersebut sebagai bentuk sumbangsih BNI kepada para guru dan pelajar se Sumut. Ini sangat kita apresiasi, karena bantuan tersebut sangat menstimulan untuk kemajuan pendidikan Sumut ke depan,” ungkap Syaiful. Disamping MoU, lanjut

Syaiful, Plt Gubsu diwakili Sekdaprovsu Nurdin Lubis juga menyerahkan secara simbolis dana BOS triwulan II untuk 11.604 sekolah tingkat SD dan SMP (2.429.312 siswa) dengan jumlah dana Rp372.505.312.500 dari Rp1,577 triliun yang sudah diluncurkan. “Dana BOS triwulan II ini sudah disalurkan pada 10 April lalu. Sedangkan dana BOS triwulan I sebesar Rp382 miliar lebih sudah disalurkan pada 10 Januari 2012 dan dana BOS triwulan III akan disalurkan pada Juli 2012,” ujar Syaiful. Syaiful melaporkan, anggaran untuk Rintisan Bantuan Operasional Sekolah untuk SMA dan SMK sebanyak 599.216 siswa dari 1.797 sekolah dengan jumlah dana sebesar Rp71.905. 920.000 telah disalurkan kepada masing-masing sekolah. Demikian juga Bantuan Kesejahteraan Murid (BKM) kepada 48.664 orang dengan anggaran Rp37.957.920.000 (Rp780.000 per siswa), sudah disalurkan. Sedangkan tunjangan profesi guru non PNS tingkat SD dan SMP untuk 5.415 orang dengan anggaran Rp125.651. 142.800 (setiap guru mendapat Rp1.500.000 per bulan) serta tunjangan profesi guru non PNS tingkat SMA dan SMK untuk 3.346 orang dengan dana Rp65.173.388.000 juga sudah disalurkan. “Anggaran Rp800 miliar lainnya digunakan untuk tunjangan profesi guru dan tunjangan fungsional guru. Dana ini sudah disalurkan ke kabupaten/kota se Sumut untuk diserahkan kepada masing-masing guru yang berhak,” katanya.(m28)

Waspada/Amir Syarifuddin

SEKDAPROVSU Nurdin Lubis dan COE BNI Wilayah Medan Achmad Santoso Miad didampingi Kadisdik Sumut Syaiful Syafri menandatangani MoU untuk fasilitas kredit perumahan guru PNS dan non PNS se-Sumut di Aula Martabe Kantor Gubsu Medan, Kamis (3/5).

Waspada/Amir Syarifuddin

PLT. Gubsu H. Gatot Pujo Nugroho memimpin pengambilan sumpah jabatan Drg Widwiono yang dilantik sebagai Kepala Perwakilan BKKBN Sumut yang baru, di Lantai VIII Kantor Gubsu, Jumat (4/5).

Sistem Pembangunan Negara Berkembang Belum Mengandung Nilai Etika Dan Moral MEDAN (Waspada): Pembangunan di negara-negara berkembang masih mengabaikan nilai etika dan moral. Pembangunan ini lebih mengutamakan sistem asing sehingga tujuannya tidak lagi untuk kepentingan masyarakat, tapi untuk memperoleh keuntungan. Demikian disampaikan pakar pembangunan dari Pusat Kajian Pembangunan Islam USM Abdul Aziz Yusof dalam seminar “The First International Converence on Religiusity in Developmen (RIDEV I)” di Hotel Madani Medan, Kamis (26/4). Seminar yang dilaksanakan Pascasarjana (PPs) UMA bekerjasama dengan ASEAN Muslim Research Organizaton Network (AMRON) Thailand dan Islamic Development Management Project (ISDEV) University Sains Malaysia itu, dibuka Plt Gubsu diwakili Sekdaprov H. Nurdin Lubis, SH, MM. Tampil sebagai keynote speaker Guru Besar IAIN-SU, Prof Dr. H. Nur Ahmad Fadhil Lubis dan pembicara yakni Prof. M. Syukri Saleh dari ISDEV USM Malaysia, Chairat Siripatana (ISWU Walaikat University), Phutsa A. Muhammad (Songkhla University Thailand), Mohd. Shukri Hanapi (USM Malaysia). Menurut Abdul Aziz Yusof, pembangunan perlu memikir-

kan nilai kemanusiaan dan jangan berorientasi pada keuntungan saja. Sebab, jika turut mengutamakan nilai etika moral serta nilai sosial maka tujuan pembangunan akan tercapai dan berkelanjutan. Selain itu, dalam melaksanakan pembangunan, harus memiliki pemikiran atau analisis yang mendalam serta perancangan sistematik tentang visi misi yang akan dibangun. Hal senada juga dikatakan pakar pembangunan asal USM Malaysia Mohd. Shukri Hanapi. Menurutnya, pelaksanaan pembangunan harus diselaraskan dengan prinsip yang telah ditetapkan dalam Islam yakni mengacu pada penerapan nilai keadilan serta ketauhidan kepada Allah. “Nilai ketauhidan dalam konteks pembangunan akan mampu menjadikan tumpuan penciptaan pembangunan yang berkeadilan,” katanya. Sebelumnya, KetuaYayasan Pendidikan H. Agus Salim (YPHAS) Drs. M. Erwin Siregar, MBA menyatakan prihatin atas terjadinya dekadensi moral dan akhlak dalam proses pembangunan. Karena itu, semua pihak harus melaksanakan kegiatan bernuansa keilmuan dan keagamaan secara berkesinambungan, guna mewujudkan masyarakat yang harmonis,

serta menciptakan sumber daya manusia berkualitas, beriman dan bertaqwa (Imtaq). “Konferensi hasil kerjasama UMA, USM dan Universitas Islamic Centre Walailak, Thailand ini akan digelar secara berkelanjutan. Konferensi berikutnya kemungkinan diadakan di Thailand, “ ujarnya. Sedangkan Rektor UMA Prof Dr. H. AliYakub Matondang mengatakan, ada tiga aspek pembangunan sektor agama yang perlu terus menerus dikembangkan antara lain pembinaan aspek moral, ibadah dan akhlak/moral. “Semua ini diperlukanuntukpengembangannilainilai kemanusiaan serta pengembangan sumber daya manusia yang bermartabat dan taqarrub atau selalu mendekatkan diri kepada Allah SWT,” ujar ProfYakub. Ketua Panitia Warjio, MA, PhD mengatakan, peran agama, nilai sosial pembangunan dan pendidikan dalam pembangunan mulai terabaikan sehingga muncul ketimpangan pembangunan yang menyebabkan terjadi ketidakadilan dalam pembangunan dan di tengah masyarakat.”Jadi seminar ini untuk mencari solusi dan alternatif penyelesaian pembangunan dengan pendekatan nilainilai keagamaan yang lebih luas,” ungkap Warjio . (m49)

PPP Rangkul FUUI Galakkan Maghrib Mengaji MEDAN (Waspada): Ketua Fraksi PPP DPR RI Drs H Harus Azwar MM, menggelar reses dengan sejumlah ustadz dan ustadzah yang tergabung di Forum Ustadz Ustadzah Indonesia (FUUI) Sumut. Dalam pertemuan itu, FUUI diajak menggalakkan Maghrib Mengaji dan ikut mengawalsetiapkebijakanpemerintah mengenai syariat Islam. “Selama ini, setiap habis shalat Maghrib biasanya anakanak langsung berjalan-jalan. Hal inilah yang perlu dirubah, kita semua umat muslim harus menggalakkan Maghrib Mengaji,” ujarnya saat menggelar reses bersama puluhan ustadz dan ustadzah di Asrama Haji Medan, akhir pekan lalu. Dia menyebutkan, dengan digalakkannya Maghrib Mengaji diharapkan akan menjadi pendidikan moral bagi anak-anak dan generasi muda sebagai penerus bangsa. Kemudian, menggalakkan Maghrib Mengaji ini sebagai bagian untuk

menjalankan syariat Islam di negara ini. Mantan Ketua Komisi VIII DPR RI ini juga membeberkan, kondisi bangsa sekarang ini membutuhkan sentuhan Islami. Maka, sangat dibutuhkannya peran para ustadz dan ustadzah dalam membimbing masyarakat. Pola pendekatan seperti inilah yang semestinya terus diperluas hingga ke pelosok tanah air, khususnya Sumut. “Bukan setelah memimpin melupakan pendidikan Islami, tapi harus terus mendukung dan terus maju hingga ke lapisan terbawah, umat Islam mendapatkan pengajaran pendidikan Islami yang setara,” sebutnya. Selain itu, dia menyampaikan, PPP berkomitmen tetap menjadi partai Islam, dan terbuka ketika ada umat Islam yang hendak bergabung. “PPP tetap partai Islam, dan tetap berjuang untuk umat Islam. Kami terbuka jika ada umat Islam hendak bergabung ke PPP. Jadi di seluruh

Indonesia seluruh anggota DPR dan DPRD-nya yang berasal dari PPP adalah beragama Islam. Inilah bukti konsisten kami sebagai partai Islam,” ujarnya. Sementara itu, Ketua DPP FUUI Yulnaidi Tanjung menyampaikan, sebagai wadah berkumpulnya para ustadz dan ustadzah di Indonesia, FUUI tetap konsisten mendukung perjuangan untuk umat Islam. Bila sekarang PPP sebagai satusatunya partai Islam di Indonesia, maka FUUI selalu berada di dekat PPP dan membangun kolaborasi dalam sistem penguatan syariah Islam. Hadir dalam kesempatan itu sejumlah pengurus PPP, seperti Wakil Sekjend DPP PPP Husein Husairi, Ketua DPW PP P Sumut H Fadly Nurzal SAg, Ketua DPC PPP Kota Medan Aja Syahri, Sekretaris DPC PPP Kota Medan H Irzal Fikri, dan Ketua DPC PPP Deliserdang Ir H Waluyo Hadi, sertai para pengurus PPP se-Kota Medan. (m48)

Minim, Pelanggan Listrik Miliki SLO MEDAN (Waspada): Pelanggan listrik di Sumatera Utara sangat minim yang memiliki Sertifikasi Laik Operasi (SLO) dalam pemasangan instalasi listrik sesuai standar nasional. Bahkan pada 2012 ini, baru 2.953 pelanggan yang memiliki SLO dari target pertumbuhan pelanggan baru 150.000-an pelanggan tahun ini. “Pemasangan instalasi listrik yang tidak sesuai dengan standar, dikhawatirkan akan mengganggu keselamatan dan kenyamanan pelanggan karena pemasangannya tidak profesional. Apalagi banyak kasus kebakaran yang disebabkan hubungan arus pendek atau korsleting listrik disebabkan kabel pada instalasi tidak sesuai standar dan sudah tidak laik lagi,” kata Ketua Wilayah Komite Nasional Keselamatan untuk Instalasi Listrik (Konsuil) Sumut B Ricson Si-marmata, di Medan, baru-baru ini. Ricson Simarmata mengatakan, target pertambahan pelanggan listrik di PLN tahun ini berkisar 150.000-an, tapi hingga Maret 2012 baru 2.953 pelanggan yang mengurus SLO.

Angka ini menurun dibanding tahun lalu yang mencapai 38 ribu pelanggan telah memiliki SLO pada pemasangan instalasi listrik baru. “Minimnya kesadaran masyarakat akan SLO pada pemasangan instalasi ini banyak terjadi pada pelanggan umum. Karena tidak ada sosialisasi dari pihak PT. PLN kepada pelanggan baru yang akan memasang listrik. Seharusnya PLN sebelum memasukkan arus listrik ke pelanggan, terlebih dahulu bekerjasama dengan Konsuil untuk memeriksa instalasinya sesuai Standar Nasional Indonesia (SNI) untuk mendapatkan SLO,” jelas Ricson didampingi Kabag Mutu dan Sertifikasi Konsuil Sumut Panangian Siregar. Ricson menegaskan, SLO wajib diberlakukan dalam pemasangan instalasi listrik di rumah pelanggan untuk menjamin keselamatan dalam menggunakan energi listrik, sebagaimana diatur dalam UU No. 30 tahun 2009 tentang Ketenagalistrikan. Pada pasal 44 ayat 4 diatur setiap instalasi tenaga listrik yang beroperasi wajib memiliki

sertifikat laik operasi dan pasal 45 Bab XV diatur setiap orang yang mengoperasikan instalasi tenaga listrik tanpa sertifikat laik oeprasi akan dikenakan pidana penjara paling lama 5 tahun dan denda paling banyak Rp500 juta. “Jadi ini jelas diatur undangundang, tapi kenyataannya di lapangan banyak yang tidak mengikuti SLO. Parahnya, PLN tidak mensyaratkannya kepada masyarakat saat mengajukan permohonan menjadi pelanggan baru,” ujarnya. Sementara itu, Deputi Manager Komunikasi dan Bina Lingkungan PT PLN (Persero) Wilayah Sumut Raidir Galingging mengatakan, persyaratan SLO itu memang harus ada dan dalam melakukan uji kelayakan instalasi menjadi tanggung jawab pelanggan. Sedangkan PLN hanya bertugas menyambung sampai meteran saja. “Pemasangan instalasi ini memang perlu SLO agar lebih terjamin instalasi dan material yang sesuai SNI serta dipasang secara profesional. Kalau mau aman, ya harus pakai SLO,” ujar Raidir. (m41)

WASPADA Sabtu 5 Mei 2012

Deli TV Audisi Presenter Di Univa Medan

Medan Metropolitan A5 Institusi Kepolisian Gagal Bina Anggota

MEDAN (Waspada): Dengan adanya audisi presenter melalui program goes to campus oleh Deli TV, semakin meningkatkan wawasan para mahasiswa Universitas AlWashliyah (Univa) Medan, terutama yang berkaitan dengan Ilmu Jurnalistik. Demikian dikatakan Rektor Univa Medan Ir H Aliman Saragih MSi, ketika menerima laporan acara audisi presenter Deli TV yang dikoordinir Kepala Bagian Akademik dan Kemahasiswaan Amir Makhmud Zain Nasution SE, di Biro Rektor Univa Medan, Kamis (3/5). Sementara itu, Kepala Bagian Administrasi Umum dan Rumah Tangga Agusman Damanik MA, yang mewakili Wakil Rektor III mengatakan, audisi presenter Deli TV ini merupakan salah satu media untuk menggali potensi para peserta yang notabenenya tidak kuliah di bidang jurnalistik, tetapi memiliki potensi yang sangat luar biasa. “Guru saya pernah berkata jadikan dirimu berkualitas orang akan melamarmu,” sebutnya. Sedangkan Produser Program Erte-Erwe Deli TV Immanuel P Ginting, M.Hum didampingi Marcom Deli TV Amirul Mukmin Nasution menjelasakan, di antara hal terpenting dimiliki seseorang, terutama bagi peserta audisi Deli TV adalah percaya diri dan penguasaan bahan. Kabag Akademik dan Kemahasiswaan Amir Makhmud Zain Nasution mengutarakan, para peserta sangat antusias, hal tersebut terbukti dengan banyaknya peserta yang mendaftar sebanyak 46 orang. Menurut salah seorang peserta audisi Asmaul Husna, sebagai mahasiswa pihaknya sangat berterima kasih dengan diadakannya audisi tersebut, sehingga mengetahui seluk beluk menjadi presenter di televisi, khususnya Deli TV. (cwan)

Ulul Albab Gelar Zikir Bersama Di Masjid Raya

Perlu Pemeriksaan Urine Secara Rutin MEDAN (Waspada): Institusi Kepolisian dinilai gagal membina anggotanya untuk menjadi pelindung dan pengayom masyarakat. Hal ini disebabkan lemahnya pengawasan dari institusi kepolisian terhadap anggotanya, sehingga sekarang banyak polisi melakukan berbagai kejahatan. “Lemahnyapengawasandari institusi kepolisian terhadap anggotanya menjadi penyebab semuanya. Selain itu, memang bersumber dari diri sendiri polisinyaitu,”kataKriminologdari UMSU Nursariani Simatupang SH, M.Hum kepada Waspada, Jumat (4/5), saat menanggapi

banyaknya aparat kepolisian menjadi pelaku kejahatan. Selain lemahnya pengawasan dari institusi kepolisian, lanjutnya, lemahnya proses penegakan hukum di Indonesia, menjadikan semuanya ikut andil untuk melakukan kejahatan. “Disaat proses penegakan hukum lemah, maka semuanya akan ikut andil untuk melakukan kejahatan,” ujarnya. Dia mencontohkan, pemberantasan narkoba yang dilakukan aparat kepolisian dari Indonesia ini tidak akan pernah selesai, jika aparat kepolisian itu sendiri belum mampu membersihkan dirinya dari narkoba. “Tidak akan pernah selesai pemberantasan narkoba, jika orang-orang yang membersihkah narkoba itu sendiri belum bersih atau terlibat dari narkoba,” jelasnya. Untuk itu, lanjutnya lagi,

perlu pengawasan yang ekstra ketat dari institusi kepolisian melihat kinerja anggotaanggotanya. “Dalam proses rekrutmen perlu dikawal ketat sehingga yang terpilih adalah orang-orang yang benar-benar melindungi dan mengayomi masyarakat,” tuturnya. Hukuman maksimal Sementara itu, Ketua Polri Watch Ikhwaluddin Simatupang SH, dan Sekretaris Gerakan Anti Narkotika (GAN) Indonesia Drs Zulkarnain Nasution menjelaskan,cukupbanyakkasus peredaran gelap narkoba melibatkan oknum aparat pangkat rendah maupun perwira, oleh karenaitupengadilanharusmenjatuhkan hukuman maksimal. Kata Ikhwaluddin, sudah banyak kasus narkoba termasuk peredarannya melibatkan oknum Polri, bahkan yang berpangkat perwira. Ini berarti ditu-

MEDAN ( Waspada): Ulul Albab Sumatera Utara pimpinan Al Ustadz HM Nasir Lc, MA (foto) akan menggelar zikir akbar di Masjid Raya AlMashun Jln. SM Raja Medan, Minggu (6/5) pukul 08.00 sampai selesai. “Acara tersebut dimulai dari shalat Dhuha, shalat Tasbih bersama, zikir bersama, tausiyah oleh Al Ustadz Drs Asbat AF S.PdI. dan diakhiri dialog interaktif. Sedangkan lantunan pembacaan Alquran Al Karim oleh Ustadz Hansar Sinaga SHI, SPdI,” kata Panitia Pelaksana Al Ustadz Syahril Basyrah SHI, SPdI didampingi Sekretaris Umum Samsul Rizal, dan Humas Majelis Zikir Ulul Albab Agusman Damanik, MA. Menurut Syahril, zikir bersama itu digelar Majelis Zikir Ulul Albab Sumut bekerjasama dengan Bank Mega Syariah (BMS) dan Gema Madinah Makkah (GADIKA). “Kami mengajak seluruh kaum muslim dan muslimat untuk menghadiri acara zikir berjamaah ini,” ujarnya, seraya mengatakan, setelah tausiyah akan digelar dialog interaktif agama Islam bersama pimpinan Majelis Zikir Ulul Albab Sumut. (cwan)

Perhari 240 Bayi Meninggal Di Indonesia MEDAN (Waspada): Diperkirakan ada 240 sampai 250 jiwa bayi di Indonesia meninggal perharinya. Paling besar kematian disebabkan karena adanya gangguan pernafasan. Hal ini diungkapkan UKK Perinatologi Ikatan Dokter Anak Indonesia (IDAI) DR dr Rinawati Rohsiswatmo SpA, Minggu (29/ 4). “Angka kematian bayi ini sebenarnya dapat ditanggulangi dengan penggunaan alat-alat medis untuk membantu pernafasan dengan alat bantu pernafasan bubble cpap. Saat ini kita dapat memproduksinya sendiri,”ujarnya. Menurutnya, selama ini masyarakat masih dibebani biaya yang terlalu tinggi untuk menyelamatkan bayinya dari gangguan pernafasan. Padahal potensi kita untuk memproduksi alat-alat medis yang lebih murah sangat besar sekali. “Kita juga belajar dari negaraVietnam. Mengapa negara mereka dalam tahun-tahun belakangan ini dapat menekan angka kematian bayi. Mereka punya alat bantu pernafasan dengan biaya yang lebih murah,” katanya. Walaupun saat ini kita masih butuh standarisasi dari negara luar dalam memproduksi alat medis tersebut, tapi potensi untuk memproduksi alat-alat medis yang lebih murah harus kita manfaatkan. Selain untuk mengurangi angka kematian pada bayi juga untuk menekan anggaran pemerintah dan pasien, supaya masyarakat juga tidak dikenakan beban biaya yang tinggi untuk menyelamatkan bayi mereka. Sementara itu, Sales and Marketing Manager Fyrom Sonny Firdaus mengatakan, espiro cpap sebagai alat bantu pernafasan bagi bayi ini lebih ekonomis dan efisien. Kalau bubble cpap yang diimpor dari luar negeri bisa mencapai Rp2,5 juta dan digunakan sekali pakai saja. Bubble cpap dari espiro cpap ini lebih terjangkau sekitar Rp500 ribu dan bisa di pakai untuk beberapa kali pemakaian selama setahun. “Tujuan kita adalah untuk menciptakan cpap yang murah agar terjangkau dan dapat mengurangi angka kematian bayi di Indonesia,” jelasnya. Dia juga berharap espiro cpap ini dapat diterima di pasaran dan membantu kerjasama dengan para dokter anak di Indonesia, untuk mengurangi angka kematian pada bayi. (rel/h02)

Sepedamotor Disikat Maling Dari PT Azizi Kencana Travel MEDAN (Waspada): Sepedamotor Mio Sporty Biru BK 6602 VAL yang diparkirkan di depan kantor PT Azizi Kencana Travel yang bergerak di bidang pelayanan jamaah haji plus di Jalan Sutomo Ujung, Kel. Durian, Kec. Medan Timur, Kamis (3/4) sekira pukul 17:00, hilang disikat maling. Akibatnya, pemilik sepedamotor Sri Widadi, 28, warga Jalan Kapten Mukhtar Basri, Kelurahan Glugur Darat I, Kecamatan Medan Timur, mengalami kerugian Rp10 juta. Dalam pengaduannya ke Polsek Medan Timur, Jumat (4/5) sekira pukul16:00, korban Sri Widadi menjelaskan, sekira pukul 15:00, dia datang ke kantor perusahaan pelayanan jamaah haji plus karena hendak melamar kerja dan akan diinterview oleh pemilik perusahaan tersebut. Selanjutnya, korban memarkirkan sepedamotornya persis di depan pintu masuk perusahaan tersebut. Setelah beberapa menit duduk di lantai dasar, Sri Widadi bergegas ke lantai II untuk diinterview. Beberapa menit kemudian, usai diinterview, korban turun ke lantai dasar karena akan menjalani tes menggunakan perangkat komputer dan menjalankan programprogram komputer tersebut. Namun, usai menjalani tes, korban yang hendak pulang tidak melihat lagi sepedamotor Mio yang masih kredit tersebut yang diparkirkan. Ironisnya, di depan kantor tersebut terlihat sejumlah pria duduk-duduk dan seolah-olah tidak mengetahui kejadian. “Saat aku parkirkan keretaku, banyak lelaki yang duduk di samping kantor tersebut. Setelah aku keluar, mereka masih tetap ramai namun ironisnya tak ada yang mengaku telah melihat pelaku pencurian,” ujarnya. Tiga Minggu sebelumnya, Sri Widadi juga dirampok di depan kantor perusahaan pelayanan jamaah haji plus tersebut dan kejadiannya pada malam hari. Saat itu, korban baru saja pulang dari Macan Yaohan menumpang beca bermotor. Begitu melintas di Jalan Sutomo simpang Jalan Bambu I tersebut, tiba-tiba satu dari dua pria yang mengendarai sepedamotor merampas handphone yang berada di genggamannya. Korban sempat mempertahankan HP-nya namun gagal dan terjatuh dari atas betor tersebut, bahkan wajah korban luka-luka akibat jatuh ke aspal jalan. Kedua perampok selanjutnya kabur membawa HP Blackberry milik korban. (h04)

buh Polri sudah ada pengedar narkoba. “Namun, terkadang dijustifikasi atau menjadi alasan untuk menangkap serta mengungkap jaringan pengedar narkoba,” katanya. Dia juga menyebutkan, banyak pula yang salah tangkap, akan tetapi dijebloskan juga, termasuk orang-orang yang sudah bertobat dari melibatkan diri dalam narkotika. “Justru itu kita mendesak Mabes Polri untuk segera bertindak sekaligus merubah sistem, dari lebih banyak memburu pengguna beralih memburu sebanyak-banyaknya pengedar,” ujarnya sembari menambahkan, bukanlah prestasi bagi Polri kalau lebih banyak berhasil meringkus pengguna. Menyinggung masalah hukuman, Ikhwaluddin meminta aparat penegak hukum agar memproses oknum Polri termasuk perwira Polri terlibat peredaran narkoba dengan hukuman maksimal. Kemudian, mulailah Polri mengejar untuk

mengungkap distributornya. Sedangkan mengenai barang-barang bukti hasil tangkapan, menurut dia, harus ada lembaga tersendiri sebagai tempat penyimpanannya. Jangan lagi disimpan di jajaran kepolisian mapun kejaksaan. Selaku Polri Watch, Ikhwaluddin juga menyarakan agar kepada setiap anggota Polri dilakukanpemeriksaanurinedan darah secara rutin, terlebih-lebih yang terkait dengan penugasan pemberantasannarkoba.Diajuga meminta agar Propam Polri lebih pro aktif mengawasi serta memeriksa para anggota Polri yang bertugas di bagian narkotika. Sekretaris GAN Indonesia Zulkarnain Nasution menambahkan, secara teori peredaran gelap narkotika adalah kejahatan trans nasional kriminal. Hal itu berlangsung baik dan mulus, apabila ada aparat hukum terlibat di dalamnya. Teori ini berdasarkan fakta-fakta di lapangan. Artinya, apa yang terjadi di lapangan memang ril atau bukti

ril, dan ini umumnya di hampir semua negara. “Dengan kata lain, peredaran gelap narkotika, pasti ada oknum aparat terlibat di dalamnya. Sudah banyak buktinya,” kata dia. Zulkarnain yang juga Direktur Pusat Informasi Masyarakat Anti Narkotika Sumatera Utara (Pimansu) ini juga meminta agar Kapoldasu melakukan penyelidikan-penyelidikan terhadap oknum-oknum Polri yang terlibat dalamperedarangelap narkotika. ‘’Hal sangat perlu dilakukan jika Polri ingin pulih namanya serta kembalinya kepercayaan masyarakat terhadap polisi. Apalagi realitanya beredar rumor, polisi saja terlibat. Ini artinya masyarakat pesimis dan apatis terhadap kelakuan oknum-oknum polisi itu sendiri,” sebutnya. Menyikapi keterlibatan oknum-oknum Polri dalam kasus narkotika, Zulkarnain menyatakan, hal ini merupakan gejala serta fenomena moralitas dan komitmen tidak dipelihara baik oleh institusinya. (h02/m34)

FPTRABK Bantah Lakukan Penyerangan

Waspada/ Rustam Effendi

DIREKTUR Utama Bank Sumut H Gus Irawan Pasaribu foto bersama dengan tokoh agama dan masyarakat usai mengadakan sosialisasi mikro usaha Sumut Sejahtera (SS) I dan II Bank Sumut di Masjid Al Hikmah.

Sosialisasi Mikro Usaha SS I, II Bank Sumut BELAWAN (Waspada): Direktur Utama Bank Sumut H Gus Irawan Pasaribu mengatakan, jika umat Islam bersatu dan melaksanakan Islam secara kaffah, maka tidak pantas umat Islam menjadi pengemis di pinggir jalan. Hal itu dikatakan Gus saat mengadakan sosialisasi mikro usaha Sumut Sejahtera (SS) I dan II Bank Sumut di Masjid Al Hikmah Jln. Rahmad Budin, Kel. Terjun, Kec. Medan Marelan, Rabu (2/5). Dikatakan Gus, jumlah zakat umat Islam di Indonesia, jika dikumpulkan bisa mencapai Rp215,7 triliunan dalam satu tahun. Zakat itu jika diberikan kepada orang yang berhak sebagai modal usaha, maka tiap tahun pula akan muncul pengusaha atau orang kaya baru yang nantinya bisa membantu orang miskin. “Sayangnya masih banyak zakat yang tidak terdaftar dan diberikan langsung. Sehingga zakat yang terkumpul sedikit dan sedikit pulalah umat Islam yang terbantu,” katanya. Sebagai contoh, sebut dia, gaji seluruh karyawan Bank Sumut dipotong zakat, hasilnya terkumpul zakat sebanyak Rp2 miliar per tahun. Selanjutnya zakat itu disalurkan kepada warga yang membutuhkan dalam bentuk dana bergulir dan sekarang telah dimanfaatkan oleh

sekitar 7000 orang. “Jadi kalau satu perusahaan seperti Bank Sumut bisa membantu7000orangbagaimanapula dengan perusahaan lain yang lebih besar. Maka dalam dua tahun 1,4 juta masyarakatmiskinSumut bisa terselesaikan,” ujar Gus. Gus mencontohkan, umat Budha di Sumut, jumlahnya tidak banyak. Namun karena bersatu dan kompak, maka mereka memiliki 12 ribu orang donatur tetap, ribuan sukarelawanm dan mampu mengumpulkan dana sosial sebesar Rp800 juta per bulan. “Nah, jikalah umat Islam di Sumut ini bisa demikian, maka akan lebih besarlah dana sosial yang terkumpul,” sebutnya. Menyinggung tentang mikro usaha Sumut Sejahtera I dan II Bank Sumut yang sedang gencar-gencarnya dilakukan Bank Sumut, Gus mengatakan, bantuan berupa pinjaman lunak itu sangat mudah didapat karena syaratnya tidak banyak. Untuk stimulus Sumut Sejahtera I (SS I), pinjaman yang diberikan sebesar Rp500 ribu hingga Rp5 juta kepada ibu-ibu yang memiliki usaha dan tanpa agunan. “Syaratnya mudah, ibuibu harus memiliki usaha dan berkelompok minimal 20 orang perkelompok,” jelasnya. Sedangkan, untuk stimulus SS II, pinjaman yang diberikan

sebesar Rp5 juta hingga Rp50 juta, kepada usahawan yang membutuhkan modal dengan agunan berupa surat tanah. Surat tanah itu tidak mesti bersertifikat, sudah cukup dengan surat dari lurah atau kepala desa, bahkan surat tanah yang masih menggunakan bahasa Arab atau Gran Sultan, bisa dijadikan agunan. “Jadi cukup mudahkan. Namun kunci suksesnya adalah kejujuran dan niat membayar cicilan tanpa tunggakan,” katanya disambut tepuk tangan ibuibu yang hadir dalam acara itu. Pertemuan sosialisasi dan silaturahimi yang dimulai usai shalat Zuhur itu, berlangsung bersahaja dan harmonis. Ibuibu dari sejumlah pengajian Kelurahan Sei Mati, Kec. Medan Labuhan, Kel. Terjun, Kec. Medan Marelan, dan Hamparan Perak yang hadir dalam acara itu terlihat saling tukar informasi dengan Gus. Selain mengadakan sosialisasi, pada kesempatan itu Gus Irawan Pasaribu menyerahkan bantuan kepada BKM Masjid Al Hikmah. Tampak hadir dalam acara itu Kepala Kantor Cabang Pembantu (KCP) Bank Sumut Marelan Sujendi, Wakil Khairul Akmal dan staf, serta sejumlah tokoh masyarakat, tokoh agama Kecamatan Medan Marelan. Acara ditutup dengan doa dan shalat Ashar berjamaah. (h03)

Tangkap Perambah Hutan Bakau Di Belawan, Langkat MEDAN (Waspada): Perambahan hutan bakau di kawasan perairan Belawan dan Kabupaten Langkat, untuk bahan arang masih berlangsung. Karena itu, Ketua Asosiasi Eksportir Kayu Arang Indonesia (AEKAI) H Syahrial meminta polisi menangkap pelakunya. Kepada wartawan di Medan, Kamis (3/5) dia mengatakan, pelaku perambah hutan bakau pernah dilaporkan AEKAI ke Polda Sumut tetapi belum ditanggapi. “Laporan kita sampaikan akhir Februari 2012, lengkap dengan data dan nama perambah,” kata dia. Ditanya siapa yang dilaporkan ke Polda, Syahrial mengatakan Lahanas Makmur alias Asiong, pemilik PT Niaga Makmur Kekal Lestari (NMKL) yang berlindung pada Koperasi Serba Usaha Flora Potensi (KSUFP). “Gudang dan pengolahan kayu

arangnya berada di Jalan Tanjungbalai, Kelurahan Sei Mencirim, Sunggal,” sebutnya. Bersama pengurus lainnya, Ali, Rusli dan Zaki, dia mengatakan, semula LM alias Asiong terdaftar sebagai anggota AEKAI, tetapi karena kayu arangnya selalu ditangkap Polres Binjai dan Polresta Medan, termasuk Poldasu karena tidak memiliki dokumen lengkap, akhirnya menarik diri dari keanggotaan dan bergabung dengan KSUFP. “Dia menarik diri karena tidak ada pembelaan dari AEKAI,” ujarnya. TetapidisesalkanSyahrial,LM alias Asiong kemudian memberi informasi tidak benar kepada polisi tentang rekan-rekan bisnisnya dengan maksud bisnis arang dapat dimonopolinya. Sementara PT KSUFP yang dipimpin Agus Riadi, anggota Komisi III DPR RI, diduga menguasai HPKM (Hutan Pemanfaa-

tan Kayu Masyarakat) seluas 8.000 Ha di Aceh Timur secara ilegal dengan memalsukan dokumen. “Kasus itu sudah dilaporkan warga Dusun BTN, Desa Sungai Pauh, Langsa Barat ke Polres Langsa dengan bukti lapor No. TBL/10/I/2012/Aceh/Res Langsa 20 Mei 2010, dengan terlapor Agus Riadi dan Sayed Abdullah. Hanya saja pihak kepolisian tidak menindak lanjutinya,” kata Syahrial mewakili masyarakat dan pedagang arang di Aceh meminta Dephut dan Disperindag menutup PT KSUFP. Namun LM alias Asiong membantah tuduhan itu. Dia mengatakan, pihaknya memperoleh kayu arang secara legal. Dia juga mengatakan tidak lagi berbisnis arang. “Saya minta agar tuduhan itu dibuktikan, sebab sudah lama saya tidak menekuni bisnis arang,” katanya.(m27)

MEDAN (Waspada): Ketua Forum Perjuangan Tanah Rakyat Asli Batang Kilat (FPTRABK) Al-Ustadz KH Zulkarnain mengatakan, tidak pernah mengganggu atau melakukan penyerangan kepada karyawan PT Makmur Mandiri Lestarti (MML), apalagi membakar alat berat PT MML. Justru kata dia, orang luar diduga suruhan PT MML yang melakukan penyerangan terhadap warga Batang Kilat. Al-Ustadz Zulkarnain mengatakan itu sebagai hak jawab atas berita Waspada, 2 Juni 2012 berjudul “Polisi Didesak Tangkap Pelaku Penyerangan Pekerja PT MML” yang menyebutkan penyerangan dan penganiayaan dialami 60 karyawan PT MML serta pembakaran alat-alat berat PT MML dilakukan ratusan massa FPTRABK. “Tidak mungkin masyarakat melakukan penyerangan, pembakaran rumah warga di daerahnya sendiri, justru orang-orang luar yang secara tiba-tiba dan brutal mendatangi pemukiman warga membawa tombak sepanjang 1,80 meter, parang panjang, golok dan senjata api melakukan penyerangan dan pembakaran rumah warga Batang Kilat,” kata Zulkarnain melalui surat bantahannya, kemarin, yang juga ditandatangani Sekretaris Sumarno. Dia juga mengatakan, barang bukti sudah diserahkan kepada Kapolsek Medan Labuhan disaksikan ratusan orang warga Batang Kilat. Berkaitan berita, Penyerangan terhadap 60 karyawan PT MML dilakukan saat karyawan mematok lahan sebagai pembatas, sekaligus membersihkan lahan milik PT MML seluas 315 Ha di Desa Batang Kilat Lingk II, Kel. Sei Mati, Medan Labuhan, juga dibantah Ustadz Zulkarnain. Kata dia, jika mereka (PT MML) mau mematok dan membersihkan lahan yang diakui sebagai miliknya pada 12 April 2012, tidak mungkin dilakukan pukul 17:30 (menjelang maghrib). Dia menegaskan, tidak ada lahan PT MML di tanah terlantar/tanah negara yang

dulunya hutan belantara dan menjadi sebab terjadinyabanjirdipemukimanwarga,yangsudahdikelola dan diusahai rakyat Batang Kilat sejak 1998 untuk memenuhi kebutuhan dan menyambung hidup. Sesuai pernyataanWali Kota Medan Rahudman Harahap, Rabu 18 April 2012 ketika sidak di Kec. Medan Marelan, menyatakan PT MML tidak punya izin prinsip di Lingk. II, Kel. Sei Mati, Kec. Medan Labuhan, sehingga dianggap merampas tanah negara dari anggota FPTRABK. “Wali Kota juga mengingatkan kalau PT MML tidak punya izin prinsip jangan melakukan penimbunan di area atau membuat usaha apapun di lokasi itu, karena semua usaha harus sesuai prosedur,” kata Zulkarnain. Dia juga mengatakan, PT MML melalui Humas Robin dan pengacara Budi Darma berkali-kali meminta maaf serta menyatakan, kalau terjadi hal-hal yang tidak diinginkan siap bertanggung jawab. Bahkan setelah rapat koordinasi di Polres Pelabuhan Belawan (13 Maret 2012) memutuskan PT MML dilarang melakukan dan/atau terlibat dalam kegiatan yang mengganggu ketentraman dan keamanan serta aktivitas rakyat Batang Kilat, Kel. Sei Mati, Medan Labuhan. “Namun mereka tidak mengindahkan,” kata Zulkarnain. Kemudian kutipan berita.. “Sehingga lewat pendekatan persuasif, 40 orang bersedia meninggalkan lahan yang selama ini diduduki dengan memberikan ganti rugi yang telah disepakati.. “ melalui hak jawab ini, kata Zulkarnain, kami luruskan bahwa 40 orang itu bukan anggota FPTRABK, mereka mengerjakan/menumpang di lahan milik PT Lamhotma (bukan tanah terlantar/negara), dan sudah membuat perjanjian dengan PT Lam-hotma kalau suatu saat bersedia meninggalkan lahan. Tentang pihak BPN yang ingin melakukan pengukuran ulang, kemudian dihalangi warga, menurut Zulkarnain tidak benar dan bertolak belakang dengan fakta. Karena sebenarnya pihak BPN (Mahyu Danil) mengaku mau melakukan pengukuran kadastral-sporadik (pengukuran karena ada pendaftaran pertama kali) atas registrasi yang dimohon PT MML pada 2012. Pengukuran kadastral-sporadik ini salah satu bukti bahwa PT MML belum mempunyai legalitas terhadap tanah tersebut (sesuai pasal 13 (1) PP No. 24/1997. (h04)

MABMI Dukung Kejatisu Berantas Korupsi MEDAN (Waspada): Masyarakat Melayu yang tergabung dalam Majelis Adat Budaya Melayu Indonesia (MABMI) Kota Medan, mendukung program Kejaksaan Tinggi Sumatera Utara (Kejatisu) dalam menegakkan hukum dan upaya pemberantasan korupsi. Dukungan tersebut disampaikan Ketua MABMI Medan Drs Safwan Khayat MHum, didampingi unsur pengurus di hadapan Kajatisu DR. Noor Rochmat saat melakukan audiensi di Kejatisu, Rabu (2/5). Safwan Khayat yang juga Wakapolres Langkat tersebut memaparkan, orang Melayu adalah sahabat semua suku yang tergambar dalam Rukun Melayu yang tertera pada pantun, awal pertama orang berbangsa, kedua banyak beribu laksa, ketiga majelis bermanis muka, dan keempat berbudi bahasa. “Dalam dunia hukum orang Melayu taat terhadap hukum dan undang-undang,” ujarnya. Hal tersebut diperkuat lagi pemaparan Shafwan Hadi Umry yang turut hadir sebagai pengurus, bahwa Melayu mengenal peribahasa ‘tahu dilihat cermin orang, tahu dikias gunjing orang’. “Ini menunjukkan manusia

Melayu harus memelihara sikap dan perbuatan dan mematuhi suruh dan larang dalam bernegara dan berbangsa,” katanya. Sementara itu, Kajatisu DR. Noor Rochmat mengajak masyarakat Sumut dan khususnya masyarakat Melayu agar memelihara dan ikut serta menegakkan hukum dan keadilan. Kajatisu didampingi Wakajatisu serta Asisten Intel Raja Hafrizal SH, mempersilakan MABMI sebagai mitra yang kuat dalam upaya penegakan hukum dan pemberantasan korupsi di daerah ini. Pada kesempatan itu, Wakil Ketua MABMI Drs Abdul Rahim mengundang Kajatisu untuk hadir pada malam silaturahmi warga MABMI Medan bersama tokoh dan pejabat tinggi Sumut pada minggu mendatang. Dalam acara tersebut, nantinya Kajatisu akan menerima anugerah ‘Warga Utama Melayu’ yang bakal dihadiri tokoh-tokoh adat Melayu Sumut. Dalam audiensi tersebut MABMI menyerahkan seperangkat buku dan pakaian kebesaran Melayu kepada DR. Noor Rochmat yang disampaikan Drs Shafwan Hadi Umry didampingi unsur pengurus lainnya yakni Sekretaris Abdul Gafur dan Rochim dan disaksikan seluruh peserta audiensi. (rel/m41)


KAJATISU DR Noor Rochmat (4 kanan) diapit Ketua MABMI Safwan Khayat (4 kiri) bersama Shafwan Hadi Umry (3 kanan), Wakajatisu Mangihut Sinaga (3 kiri) serta Abdul Rahim, Abdul Gafur, Rohanim, dan Asisten Intel Kejatisu Raja Hafrizal.

Luar Negeri


Rusia Terlibat Ketegangan Dengan AS Dan NATO Ancam Hancurkan Perisai Misil Sekutu Di Eropa Tengah MOSKOW (Waspada): Rusia kembali terlibat ketegangan dengan Amerika Serikat dan NATO, yang dipicu rencana penempatan pertahanan rudal di negara-negara Eropa Tengah oleh AS dan NATO. Pejabat militer Rusia menegaskan, negaranya siap melakukan serangan untuk menghancurkan sistem pertahanan misil Eropa, bila Amerika Serikat (AS) menolak untuk melanjutkan perundingan. AS selama ini bersikeras akan membangun sistem pertahanan itu meski Rusia menolaknya. “Sistem pertahanan misil yang dibentuk oleh AS akan menciptakan instabilitas di kawasan. Tidak menutup kemungkinan, kami akan melakukan serangan ke instalasi misil itu bila masalah ini kian mengalami kebuntuan,” ujarKepalaStafMiliterRusiaJend.

Nikolay Makarov, seperti dikutip Russia Today, Jumat (4/5). Sebelumnya,Rusiasudahberencana akan mengerahkan misil Iskander di wilayah Kaliningrad apabila kesepakatan antara Rusia North Atlantic Treaty Organization (NATO) tidak tercapai. Rusia tak henti-hentinya mengecam penempatan senjata anti-misil yang ditempatkan AS di Polandia dan Rumania. Pihak Polandia pun mengatakan, kekacauan akan muncul bila Rusia benar-benar melakukan serangan ke intalasi sistem pertahanan misil NATO yang ada di Polandia. Polandia menilai,

kesepakatan Rusia dan AS terkait sistem pertahanan anti-misil tersebut adalah hal yang sangat penting dalam menjaga keamanan Polandia. Hingga saat ini, Rusia merasa terancam karena sistem pertahanan tersebut diarahkan ke fasilitas nuklir milik Negeri Beruang Merah. AS sendiri tidak bersedia untuk memberikan jaminan keamanan tertulis kepada Rusia bila misil-misil itu tidak ditujukan ke Rusia. Sebenarnya, Rusia, AS, dan NATO telah menggelar pertemuan untuk membicarakan ma-

salah ini sejak Kamis kemarin. Namun, Rusia mengklaim pertemuan itu hampir buntu. Sehingga, negara pewaris Uni Soviet itu memberikan peringatan keras kepada AS dan NATO. Ancam keamanan Rusia Rusia menyebut rencana AS dan NATO itu mengancam keamanan negaranya. Makarov menambahkan, jika rudal pertahanan Eropa itu tetap dibangun, maka Rusia siap memperkuat hulu ledak pada rudal-rudal balistiknya. Namun, AS dan NATO menyatakan rencana penempatan

pertahananrudaldiEropaTengah ini untuk perlindungan dari kemungkinan serangan Iran dan Korea Utara. NATO juga tetap optimis pembicaraan yang digelar di Moskow itu akan memperoleh kesepakatan. Bahkan, perwakilan NATO, Jend. Alexander Vershbow, mengatakan kekhawatiran Rusia itu tidak berdasar. Menurutnya, sistem rudal pertahanan yang akan dibangun AS dan NATO itu tidak bisa menandingi kekuatan nuklir Rusia. Rusia dan AS telah bersitegang soal rudal pertahanan sejak

2000—sejak ide ini pertama kali dimunculkan pada masa pemerintahan George W.Bush. Pada 2008, Barack Obama yang menggantikan Bush membatalkan rencana perluasan pertahanan rudal di Polandia dan Republik Ceko. Namun pada 2010, AS menandatangani perjanjian dengan Polandia untuk menggunakan pangkalan tua di Redzikow, wilayah dekat Pantai Baltik, sebagai basis pertahanan rudal. Rusia sendiri dimasukkan ke dalam komisi sistem radar di wilayah Baltik.(bbc/rt/m10)

2 Ledakan Bom Di Dagestan, Menewaskan 20 Orang MOSKOW (Antara/Reuters): Sebanyak 20 orang tewas dan 30 orang lagi cedera, ketika dua ledakan kuat terjadi di satu pos polisi di luar ibu kota wilayah yang dilanda kerusuhan di Rusia, Dagestan, demikian laporan media Rusia, Jumat (4/5). Ledakan pertama terjadi ketika polisi menghentikan satu kendaraan untuk memeriksa surat-surat, kata kantor berita RIA, dengan mengutip pernyataan oleh Komite Nasional Anti-Teroris. Ledakan kedua terjadi ketika petugas pemadam dan ambuland tiba, sehingga merenggut korban lain. Satusumberpenegakhukumyangdikutipolehkantorberitatersebut mengatakansebanyak20orangtewasdan30oranglagicedera,sementara jejaring Lifenews, dengan mengutip seorang pejabat polisi lokal, melaporkan 17 orang tewas dan 68 orang lagi cedera. “Potongantubuhberserakandipostersebut,”kataseorangpenegak hukum yang dikutip Interfax, demikian laporan Reuters. Jejaring tak resmi kelompok Islam menyatakan kantor polisi itu hampir hancur. Satu pipa saluran saluran gas di dekatnya juga rusak dalam serangan tersebut, kata RIA. Dagestan, yang hampir setiap hari menghadapi penembakan dan pemboman, telah terperosok ke dalam aksi perlawanan di seluruhwilayahKaukasusUtara,yangkebanyakanwarganyapemeluk Islam, setelah dua perang separatis di Chechnya. Gerilyawan ingin mendirikan negara Islam di wilayah itu — yang berada di dekat Sochi, tempat Rusia menjadi tuan rumah Olimpiade Musim Dingin pada 2014.

Ledakan Bom Bunuhdiri Di Pakistan, 20 Orang Tewas KHAR, Pakistan (Reuters): Seorang pengebom bunuhdiri menewaskan 20 orang dan mencederai puluhan lainnya Jumat (4/5) dalam serangan terhadap satu pos pemeriksaan polisi di bagian baratlaut Pakistan, sehingga menimbulkan keraguan pada pernyataan pejabat bahwa serangan pasukan keamanan telah melemahkan kelompok militan. Pelakumenyerangkerumunanparamiliterdanmeledakkandirinya, kataIslamZeb,seorangpejabatpentingpemerintahdariBajaurAgency. Tentara paramiliter itu sedang berkumpul dan menunggu untuk dipindahkan ke lokasi lagi guna melakukan patroli rutin. Insiden itu berlangsung di Khar, satu kota besar di Bajaur Agency, danmenewaskanempattentaradan16wargasipil,kataZeb.Diantara 20 korban tewas termasuk di dalamnya enam anak-anak. Polisi dan pasukan keamanan menutup tempat kejadian perkara.(m23)

Pemungutan Suara Pemilu Parlemen Iran Dimulai TEHERAN (Waspada): Pemilu putaran kedua dari anggota Parlemen Iran dimulai hari ini dengan melakukan pemungutan suara atau voting. Hasil dari pemungutan suara ini akan menentukan komposisi jumlah anggota Parlemen Iran. Televisi setempat memperlihatkan tempat pemungutan suara yang terletak di 33 konstituen, termasuk Teheran sudah dibuka. Diperkirakan lokasi pemungutan suara akan ditutup pada sore hari waktu setempat, kata laporan Reuters, Jumat (4/5). Pemilu kali ini akan memperebutkan 65 kursi dari 290 kursi parlemen yang tersedia saat ini. Sebelumnya, loyalis Pemimpin Tertinggi Iran Ayatullah Ali Khamenei memenangkan sebagian besar suara dalam pemilu putaran pertama. Pihak pendukung Presiden Mahmoud Ahmadinejad tentunya akan berupaya keras untuk memenangkan pemilu kali ini. Mereka tidak ingin pendukung Ayatullah Khamenei menguasai sepenuhnya parlemen. Ahmadinejad diperkirakan akan dihadapkan pada tantangan menjelang berakhirnya kekuasaannya sebagai Presiden Iran. Hal ini tidak terlepas dari kekalahan sekutunya dapat pemilu Maret lalu. Hasil pemilu kali ini akan berakibat besar dalam Pemilu Presiden Iran 2013.(ok)

anak-anak dan perempuan. “Bin Laden terganggu oleh tidak becusnya para pengikut alQaida, seperti gagal meraih dukungan publik, kampanye media yang tidak beres, dan perencanaan operasi yang buruk sehingga menimbulkan korban ribuan umat Muslim,” kata Letnan Kolonel Liam Collins, direktur Combatting Terorrism Center yangturutmenelitidanmem-buat laporan mengenai doku-men Osama,sepertidikutipolehReuters. “Salah satu temuan menakjubkan dari surat-surat itu adalah frustrasinya Osama atas kelompok-kelompok Jihad regional. Dia tampak kesulitan menerapkan kendali atas aksi para pengikutnya dan juga atas pernyataan publik yang mereka buat,” Collins melanjutkan. Dalam suatu surat tak tertanggal tahun 2010, Osama meminta disiapkan dua tim. Satu di Pakistan dan lainnya di sekitar Bagram, wilayah di Afganistan yang menjadi pangkalan militer AS dan NATO. Osama menugaskan mereka mengintai dan menyerang pe-

Sabtu 5 Mei 2012

Seputar ASEAN 31 Orang Tewas Dalam Bentrokan Baru Myanmar Dengan Kachin YANGON (AP): Suratkabar pemerintah di Myanmar melaporkan Jumat (4/5) bahwa serangkaian peperangan di Myanmar baru-baru ini antara pasukan pemerintah dan pemberontak suku Kachin telah menewaskan 31 orang, ketika pertempuran yang sedang berlangsung itu mengancam pembaruan dan proses rekonsiliasi di negara itu. Suratkabar The New Light of Myanmar melaporkan 11 bentrokan terjadi pada pekan akhir April lalu, termasuk apa yang dikatakan satu serangan oleh pemberontak AD Kemerdekaan Kachin atas satupangkalanpengawalperbatasan.Suratkabartersebutmenuduh kelompok pemberontak berusaha menguasai satu pangkalan ‘untuk menyelamatkan wajahnya karena menurunnya prestise militer mereka.’ Akibat kejadian itu, 29 anggota pemberontak dilaporkan tewas. Sementara dua pasukan pemerintah dilaporkan tewas dan 15 lainnya terluka. Pihak Kachin tidak memberikan penjelasan mengenai pertempuran ini. Pemerintah Myanmar dengan pihak Kachin menyepakati perjanjian gencatan senjata selama beberapa bulan.Tetapi negosiasi damai dengan Kachin gagal berakhir dengan kegagalan. Kamis,pasukanMyanmardikabarkanakanmelakukanserangan besar ke markas pemberontak Kachin. Sebanyak 2 ribu pasukan dikerahkan oleh Pemerintah Myanmar ke Kota Laiza, yang merupakan basis pemberontak. Sekjen Perserikatan Bangsa-Bangsa (Sekjen PBB) Ban Ki-moon mendesakMyanmaragarsegeramengakhirikekerasandanperseteruan denganwargaetnisminoritasdinegaranya.Namunfraksipemberontak dariKachin,PasukanPembebasanKachin(KIA)menuduhPemerintah Myanmar hendak menggelar operasi militer. Perseteruan antara Myanmar dan Kachin sudah terjadi sejak dulu, komunitas internasional juga melontarkan kecamannya setelah puluhan ribu warga kehilangan tempat tinggal dan hidup sengsara karena peperangan itu.(m10)

Filipina Minta Warga Kaji Perundingan Dengan MILF

Reuters SATU pemandangan di lokasi di mana terjadi serangkaian ledakan bom di Makhachkala, Dagestan, Rusia, Jumat (4/5). Sebanyak 20 orang terbunuh dan 30 lainnya cedera ketika dua ledakan keras mengenai satu kantor polisi di luar ibukota Dagestan yang bergolak, demikian menurut laporan media Rusia Jumat.

Jajak Pendapat Prediksi Sarkozy Kalah Dalam Pemilu Prancis PARIS (Waspada): Dua calon presiden Prancis yang akan memasuki pemilihan tahap kedua Nicholas Sarkozy dan Francois Hollande mengakhiri kampanye mereka sebelum dilakukan pemungutansuaradalampemilihan presiden Prancis Minggu (06/5). Jajak pendapat terbaru menunjukkan Hollande unggul sekitar 6 persen atas Sarkozy. Pengamat menilai Sarkozy membutuhkan upaya yang besar agarbisakembalimenjabatuntuk kedua kalinya. Popularitas Presiden Sarkozy melambat dibandingkan pesaingnya dalam beberapa hari terakhir dan sejumlah laporan menyebutkan bahwa pemilihan Prancis belum pernah begitu ‘ragu-ragu’ seperti saat ini. Jumat ini, kandidat Sosialis, Hollande akan berkampanye di Moselle, dilanjutkan ke Perigueux di wilayah Dodogne untuk kampanye terakhir. Sedangkan Nicholas Sarkozy akan memilih Sables d’Olonne di barat Prancis sebagai kawasan akhir kampanyenya. Hollande mendapat dukungan kuat dari pemimpin tengah

Francois Bayrou yang mengatakanKamisdiaakanmendukung kandidat Sosialis. Bayrou sendiri berada di peringkat ke lima saat pemilu putaran pertama berlangsung dengan perolehan 9,1 persen suara. Jika pendukungnya bergabung mendukung Hollande, makaituakanmenjadiangkayang signifikan untuk membuyarkan kesempatan Sarkozy terpilih kembali. Dukungan Bayrou ini diluar perkiraan karena sebelumnya dia sempat menjadi pejabatdalampemerintahanSarkozy,

sawat yang membawa Presiden AS, Barack Obama, maupun Jend. David Petraeus, yang saat itu jadi panglima militer AS dan NATO di Afganistan. Rencana itu akhirnya gagal terlaksana. Al-Qaida sengaja tidak mengincar Wakil Presiden AS, Joe Biden. Perhitungan Osama, bila Obama dihabisi, Biden tidak akan sepenuhnya siap menggantikan dia sehingga membawa AS kepada krisis. Namun, bila berhasil membunuh Jenderal Petraeus, maka akan mengubah situasi perang. “Jika Obama terbunuh, maka secara otomatis Wakil Presiden Joe Bidden akan mengambil alih kepemimpinan. Bidden kurang terlatih, sehingga AS akan krisis di bawah kepemimpinannya,”tulis bin Laden dalam salah satu dokumen yang ditemukan di persembunyiannya di Pakistan, setelah dia terbunuh dalam razia Mei 2011. Menurut CBS , bin Laden ternyata juga menarget kepala CIA, Jend. David Petraeus. Alasannya, kematian Petraeus akan mengubah kondisi peperangan yang

tetapi dia memberi alasan bahwa Sarkozy sekarang lebih condong terlalu jauh ke kanan. Diamengatakan‘’tidakmembuat rekomendasi pemungutan suara’’, tetapi menuduh Sarkozy meninggalkan nilai-nilai Eropa dan mendekatkan diri ke posisi kanan terkait isu imigrasi. Wartawan BBC di Paris melaporkan kemungkinan besar Sarkozy akan menjadi presiden Prancis pertama sejak Valery Giscard d’Estaing di tahun 1981 yang tidak memenangkan masa jabatan kedua, kecuali jajak pen-

dapat saat ini salah. Sarkozy sebenarnya mengharapkan suara tambahan dari para pendukung kanan jauh Marine Le Pen, tetapi Le Pen telah mengakumemilihuntukmengosongkan surat suaranya daripada harus mendukung Sarkozy atau pesaingnya. Le Pen, yang menarik dukungan sebanyak 6,4 juta suara di putaran pertama mengatakan bahwa pemilu telah berakhir mengingat Sarkozy sudah ‘terpukul sejak lama.’ (bbc/m10)

Clinton: AS Bersedia Kerjasama Jika Korut Mau Berubah BEIJING (Reuters): Menteri Luar Negeri AS Hillary Clinton Jumat (4/5) mengatakan, AS bersedia bekerjasama dengan Korea Utara (Korut) jika negara itu berubahdanjugamengatakantekanan lebih keras akan dilakukan pada Sudan dan Syria. Berbicara di Beijing pada akhir pertemuan tingkat tinggi

AS Mulai Ungkap Surat-surat Bin Laden SETAHUN setelah Osama bin Laden tewas dihabisi oleh peluru pasukan khusus AS, Navy SEAL, di Pakistan, para pejabat keamanan dan pakar terorisme AS masih menyelidiki seluk beluk kehidupan pimpinan jaringan al-Qaida itu. Stasiun berita BBC menyatakan militer AS baru saja mempublikasikan 17 dokumen milik Osama. Dokumen itu disita saat aksi penyerangan rumah Osama di Kota Abbottabad 2 Mei 2011. Rangkaian dokumen itu berupa email dan surat biasa dengan total 175 halaman ditulis dengan bahasa Arab dari September 2006 hingga April 2011, sebulan sebelum dia tewas. Tidak semua dokumen mengungkapkan siapa penulis dan penerimanya. Di antara surat-surat yang dipublikasikan itu terungkap betapagusarnyaOsamaatasulah para anak buahnya yang menewaskan sesama Muslim dalam sejumlahseranganteror.Diamengingatkan agar serangan merekatetapterfokuskepadaASdan jangan sampai membunuh


terjadi di Afganistan. Bin Laden berpindah rumah empat kali dalam pelariannya dari kejaran AS paska runtuhnya gedung WTC, 11 September 2001. Dalam pelariannya selama sembilan tahun, istri Osama sempat melahirkan empat kali. Hal ini disampaikan oleh salah satu janda Osama, Amal Ahmad Abdul Fateh, kepada CNN, beberapa waktu lalu. Fateh yang diamankan pemerintah Pakistan bersama dua istri Osama lainnya, mengisahkan awal mula pertemuannya dengan buronan nomor satu AS tersebut. Fateh mengatakan, adalah cita-citanya untuk menikahi seorang mujahid seperti Osama. Maka dari itu, dia langsung mengiyakan ketika hendak dijodohkan dengan Osama pada 2000 silam. Dia lalu menempuh jalan panjang, terbang ke Pakistan, mengambil jalan darat menembus perbatasan Afganistan dan menuju Kandahar, untuk menikah. (ap/bbc/ok/mujo)

selama dua hari yang diwarnai krisis terkait seorang pembangkang China yang meminta suaka di kedutaan AS, Clinton mencoba menggarisbawahi bahwa Washington dan Beijing masih bisa bekerjasama masalah penting internasional. “Kita sekarang melihat dua negara yang tidak bisa tidak memang saling bergantung satu sama lainnya,” kata Clinton dalam pidato pada pertemuan tertutup itu. Terhadap Korut, di mana AS menginginkan China memberi tekanan lebih terhadap pemimpin negara terkucil itu agar menghentikanambisinuklirnya,Clinton mengatakanWashington masih bersedia bekerjasama dengan Pyongyangjikanegaraitumengubah sikapnya. “Pemimpin baru Pyongyang masih punya kesempatan untuk berubah dan mendahulukan kepentingan rakyatnya. Jika mereka fokus pada menghormati komitmen dan bergabung denganmasyarakatinternasional, dan bisa member pangan dan pendidikan kepada warganya, AS akan menerima mereka dengan tangan terbuka dan mau bekerjasama dengan mereka,” katanya. Clinton juga menggarisbawahi bahwa AS dan China – keduanya anggota tetap Dewan Keamanan PBB – bisa bekerjasama untukmemberitekananterhadap Iran soal program nuklirnya dan mengambil tindakan tegas terhadap Presiden Syria Bashar alAssad yang terus menindas aksi unjukrasa anti pemerintah. Sementara itu, Korut mengatakan bahwa tidak ada satupun pihak yang bisa mencegah

negaranyadariupayamenjelajahi luar angkasa dan peluncuran satelit-satelit lagi. Teknologi ruang angkasa telah menjadi simbol kemakmuran suatu negara dan upaya Korut untuk menaklukkan tujuan ruang angkasa untuk mengembangkan ekonomi dan mempertahankan kedaulatannya, kata satu artikel yang dimuat oleh kantor berita resmi KCNA. Korut meluncurkan satelit observasi Kwangmyongsong-3 pada 13 April untuk memperingati ulangtahun ke-100 pendiri negara itu mendiang Kim Il-sung. (m23/m10)

MANILA (Antara/Xinhua-OANA): Pemerintah Filipina mendesak warganya agar mempelajari masalah-masalah seputar proses perdamaian antara pemerintah Filipina dan Front Pembebasan Islam Moro (MILF) untuk memberikan kontribusi bagi tercapainya perjanjian perdamaian akhir. “Baca dan pelajari. Anda akan melihat bagaimana luas dan mendalam proses perdamaian pemerintah Filipina-MILF itu. Anda akan memahami betapa ada yang perlu dibahas di meja perdamaian.” “Tanyakan apakah ada hal-hal yang perlu dijelaskan lebih lanjut dan membantu dalam penyusunan kesepakatan yang dapat diterima oleh mayoritas,” kata Penasehat Presiden tentang Proses Perdamaian, Teresita Deles. Deles menggarisbawahi nilai partisipasi warga dalam proses perdamaian. “Warga biasa harus mengambil bagian dalam mendukung dan menjaga pembicaraan damai,” katanya setelah pemerintah dan MILF melakukan pembicaraan resmi penjajakan ke27 yang diselenggarakan pada 24 April di Kuala Lumpur di mana kedua pihak menandatangani Pasal-Pasal Keputusan tentang Prinsip-prinsip yang berfungsi sebagai panduan dalam diskusi agenda substantif dari perundingan.

Pasukan Syria Serang Universitas Aleppo, 7 Orang Tewas ALEPPO, Syria (CNN): Pasukan keamanan Syria melancarkan serangan atas satu universitas ternama untuk meredakan aksi unjukrasa kalangan pelajar, kata pihak oposisi. Kekerasan bergolak di Universitas Aleppo, perguruan tinggi terkenal di kota terbesar negara itu. Universitas tersebut merupakan satu dari beberapa sekolah di negara itu di mana para demonstran memprotes kebijakan pemerintah dalam beberapa hari terakhir. Tujuhorang,termasukenampelajar,tewasdikawasanperguruan tinggi itu, kata kelompok oposis Komite Koordinasi Lokal (LCC) Syria. Mereka termasuk di antara 32 warga Syria yang tewas di tangan pasukan keamanan, kata LCC. Kelompok oposisi lain, Pengamat HAM Syria, mengatakan sedikitnya 28 orang cidera dan sekitar 200 pelajar ditangkap. Tentara juga melepaskan tembakan ke arah rumahsakit di mana para korban cidera dibawa, sehingga jumlah korban bertambah, kata Mohammad Hareitan (25), seorang pelajar perguruan tinggi. Tidak jelas berapa banyak lagi orang yang cidera dalam serangan itu. Situs Internet kampus itu mengatakan, perguruan tinggi tersebut ditutup sampai ujian akhir dimulai tanggal 13 Mei ‘dikarenakan situasi saat ini’. Kerusuhan berlangsung di saat PBB terus mencoba menetapkan gencatan senjata di Syria dan membentuk satu kelompok pengamat untuk mengawasi ketaatan rejim dan oposisi. Rekaman video amatir yang diposting di Internet memperlihatkan para demonstran dan ruang kampus yang terbakar di Universitas Aleppo. Para pelajar juga berdemonstrasi di Universitas Deir Ezzor, Universitas Damaskus di Daraa dan kota lain. Rafif Jouejati, jubir LCC, mengatakan gejolak tersebut merupakan tanda rejim sedang mengalihkan perhatian pada penentang dari kampus. “Mereka sudah berhasil membungkam para petani dan penduduk desa. Mereka sudah mengincar banyak kalangan professional,”katanyatentangrejim.“Merekasekarangtengahmengalihkan perhatian.” Jouejati mengatakan, para pelajar sudah melancarkan aksi unjukrasa sejak pemberontakan muncul Maret 2011 lalu namun sekarang ‘semakin banyak pelajar perguruan tinggi yang bermunculan karena rasa takut sudah hilang.” Selama ini rejim hanya mengepung kampus di mana mereka berunjukrasa, menangkapi beberapa pelajar dan memukuli mereka, katanya. Sekarang, mereka ‘meningkatkan kebrutalan’ dengan menembakkan gas air mata dan peluru, katanya. Di Aleppo, satu orang tewas setelah pihak keamanan melemparkannya dari jendela, kata Jouejati. Dia mengatakan, para pelajar yang ikut serta dalam aksi unjukrasa berasal dari semua bidang pelajar. “Bukan hanya dari fakultas sastra, mereka juga dari fakultas teknologi, pelajar hukum dan mereka datang untuk menuntut kebebasan.”(m23)


PARA pemrotes meneriakkan slogan anti-Pakistan dalam satu protes di Kabul Jumat (4/5). Para pemrotes menyalahkan Pakistan sebagai penyebab terjadinya pembantaian kelompok sekte di Pakistan.


WASPADA Sabtu 5 Mei 2012


DPR Minta KPK Ungkap ‘Ketua Besar’ Hambalang JAKARTA (Waspada): Kalangan DPR termasuk dari Demokrat terus mendesak agar kasus dugaan korupsi Wisma Atlet, Kemendikbud dan Hambalang yang disebutsebut pelaku utamanya adalah ‘bos besar dan ketua besar’ harus diungkap oleh Komisi Pemberantasan Korupsi (KPU) agar tidak membingungkan sekaligus tidak menyandera Partai Demokrat (PD) yang tertuduh selama ini. Waspada/Ramadhan Usman

MENTERI ESDM Jero Wacik memperlihatkan buku 7 Tahun Membangun Budaya kepada Marzuki Daud (kiri) dan Pemangku Wali Nanggroe Malek Mahmud dan Gubernur Aceh Terpilih dr Zaini Abdullah.

Kepala Daerah Terpilih Dan Legislatif Aceh Harus Bersatu JAKARTA (Waspada): Menteri Energi dan Sumber Daya Mineral Jero Wacik meminta Gubernur Aceh terpilih Dr Zaini Abdullah dan para bupati/wali kota Aceh terpilih serta para anggota DPRD di Aceh bersatu dan satu suara untuk untuk membangun Aceh agar pemerintah pusat mudah untuk menindaklanjuti membangun Aceh menuju sejahtera. “Political will dari presiden jelas, beliau (presiden SBY) ingin rakyat Aceh sejahtera. Apalagi 94 persen orang Aceh memilih SBY dalam Pemilu Presiden lalu. Jadi tidak ada cara lain, Presiden SBY ingin mensejahterakan Aceh,” ujar Menteri ESDM Jero Wacik saat menerima Wakil Ketua Tim Pemantau DPR RI Aceh Marzuki Daud bersama Gubernur Aceh terpilih, dr Zaini Abdullah, Pemangku Wali Nanggroe Malek Mahmud, Ketua DPR Aceh Hasbi dan Tim Migas Aceh Iskandar di kantor Kementerian ESDM di Jakarta, pekan lalu. Kunjungan Tim Pemantau Aceh DPR RI yang membawa gubernur Aceh terpilih dan rombongan kepada menteri ESDM dalam rangka silaturrahmi sekaligus membicarakan pengupayaan sumber daya alam Aceh ke depan dan juga meminta jaminan pemerintah agar LNG Arun dengan 14 tangki besarnya tidak menjadi besi tua di Aceh. Acara itu dihadiri juga oleh Dirut PT Arun Fauzi dan para pejabat Pertamina dan Direktur bidang Energi di kementerian ESDM. Dalam kesempatan itu Jero Wacik menegaskan, kebijakan pemerintah pusat untuk Aceh sangat tinggi. Bahkan tidak ada keraguan sedikitpun pemerintah pusat untuk Aceh. “Kita tunggu beliau dilantik (maksudnya Zaini Abdullah). Setelah itu kita lanjutkan pembangunan semuanya termasuk masalah receiving terminal gas Arun dan Belawan Sumut dan masalah lainnya. Yang penting rakyat Aceh bersatu dan jangan masing-masing membawa bendera,” tandas Jero Wacik. Wakil Ketua Tim Pemantau DPR untuk Aceh Marzuki Daud mengatakan, silaturahmi bersama gubernur Aceh terpilih merupakan program gubernur Aceh terpilih dan Pemangku Wali Nanggroe. Sebelumnya delegasi Aceh diterima oleh Ketua MPR RI Taufiq Kiemas dan menteri kabinet lainnya. Marzuki Daud atas nama Tim Pemantau mengatakan, pihaknya perlu melaporkan kepada Menteri ESDM karena kekayaan alam Aceh sebagai sumber daya alam Aceh harus diupayakan untuk Aceh masa depan. “Aceh

perlu dibangun dan sampai hari ini kesenjangan di Aceh belum diselesaikan. Masalah receiving terminal gas Arun sudah menjadi agenda agar Arun tidak akan menjadi besi tua. 14 tangki raksasa gas yang ada di Arun mampu mengalirkan gas ke Sumut. Pembangunan pipa yang direncanakan selesai dalam 18 bulan sudah masuk tender. “Saya perlu menjelaskan hal ini kepada pemerintah, agar tidak berseberangan dengan rencana pembangunan di Belawan Sumatera Utara,” ujar Marzuki Daud. Menteri ESDM mengungkapkan selama ini pihaknya banyak menampung aspirasi dari berbagai pihak di Aceh dengan bendera gubernur, bendera bupati, bendera legislatif dengan versi masing-masing. Tanpa menjelaskan lebih jauh aspirasi yang dimaksud, Menteri ESDM mengatakan lagi, legislatif dan eksekutif harus bersatu dan mau berbagi, karena dimanapun bukan saja di Aceh, kalau tidak mau berbagi bisa terjadi rusuh lagi. “Kita tunggu saja hasil dari Mahkamah Konstitusi (MK). Biar semua yang keberatan juga puas. Setelah itu kita menjalankan program Aceh supaya jalan terus,” tukas Menteri ESDM. Dalam kesempatan itu JeroWacik mengungkapkan dirinya sangat erat sekali dengan Aceh. Dia ditugaskan untuk Aceh sejak peristiwa tsunami oleh presiden yang kala itu dia Menteri Budaya dan Pariwisata agar membangun Aceh tidak tercerabut dari akar budayanya. “Saya mengambil langkah-langkah, membuat film Serambi, menampilkan tari Saman dalam setiap acara di dalam negeri dan sampai ke luar negeri. Saya sudah mendaftarkan Tari Saman ke Unesco sebagai warisan dunia dan sebentar lagi akan keluar sertifikatnya. Saya tidak lupa dengan makanan khas Aceh yakni Ikan Kemama dan Ayam Tangkap. Saya terbitkan buku 7 Tahun membangun Kebudayaan isinya termasuk kebudayaan Aceh,” ungkap Jero Wacik yang menambahkan dirinya menikmati budaya Aceh dan senang memakai busana Aceh. Karena itu Menteri ESDM mengingatkan lagi, urusan Arun dan Belawan kita bicarakan nanti dan kita cari formula yang paling mudah dan rakyat mendapat hasilnya. Gubernur Aceh terpilih dan Malek Mahmud menyatakan puas mendapat jaminan dari Menteri ESDM tentang pembangunan di Aceh. “Kami terharu dan baru tau bahwa yang membawa tari Saman ke luar negeri adalah Menteri Jero Wacik,” kata Malek Mahmud. (j07)

Ada roh Jahat Di DPR Melibatkan Rektor Universitas JAKARTA (Waspada): Anggota Komisi III DPR RI DPR RI Martin Hutabarat menyatakan, ada roh jahat di DPR RI melibatkan rektor-rektor universitas yang terkait dengan kasus Angelina Sondakh. Yang pasti menurut Martin dalam diskusi Setelah Angie Siapa Lagi di Jakarta, Kamis (3/ 5), kinerja KPK selama ini tergantung tekanan publik. “Kalau media dan rakyat berteriak baru berani. Kalau tidak, KPK tak akan bergerak. Sama halnya dengan kasus Hambalang ini, KPK tak akan langsung masuk ke Anas. Tapi, akan berputar dulu ke Komisi X DPR, Banggar DPR, dan rektor-rektor Universitas yang terkait dengan Angie. Kasihan para rektor yang menjadi tokoh dan teladan di kampus-kampus ternyata terlibat atau dilibatkan dalam korupsi dana pendidikan oleh roh jahat yang ada di Banggar DPR,” ungkap Martin dalam diskusi bersama Ruhut Sitompul dan pengacara Neneng Nazaruddin. Bahkan menurut Martin, setelah kasus Angie tersangkut pula para rektor tersebut, ada rektor yang mencari bantuan ke Jakarta, agar bisa mem-bantu kasusnya tersebut. “Rektor itu ke Jakarta mencari bantuan untuk menghadapi kasusnya itu. Kasihan mereka ini sebagai tokoh akademis dan menjadi teladan pendidikan, malah terlibat korupsi dana pendidikan. Para rektor itu ternyata menjadi korban roh jahat DPR,” katanya prihatin. Pernyataan yang pertama kali dikatakan Martin ini merujuk dugaan kasus suap yang melibatkan Angelina Sondakh (Angie), Wa Ode Nurhayati, dan termasuk M Nazaruddin yang sudah divonis. Lalu, ada juga Anas Urbaningrum yang banyak disebut terlibat dalam sejumlah proyek. “Dalam kasus korupsi di Dikbud kini sudah membuat panik rektor-rektor. Jadi akan banyak nanti rektor yang masuk penjara. Ini karena DPR juga mereka terlibat. Di DPR ini ada roh jahat yang menarik-narik orang untuk terlibat. Dulu Anas itu orang baik. Tapi ternyata kena roh jahat juga dia,” tambahnya. Sementara, Ruhut pun membenarkan pernyataan Martin soal adanya roh jahat di DPR. “Roh jahat itu betul. Banggar kena roh jahat, BURT kena roh jahat. Ngeri di sini,” kata Ruhut. Kembali ke Martin, Penasihat Fraksi Partai Gerindra itu menganalisis, setelah Angie, KPK tidak akan membidik individu. KPK, sambung Martin, akan lebih mengutamakan untuk mengusut korupsi di Komisi X. “Karena menghindari fokus pada partai tertentu saja. Sesudah Komisi X baru ke Banggar,” kata Martin.

Kata Martin, Demokrat tentu ingin kasus korupsi yang membelit kadernya cepat tuntas. “Demokrat ingin cepat selesaikan karena mereka tersandera. Sementara partai lain biarkanlah agar sampai 2014. Karenanya Demokrat harus mendorong Angie bicara sejujurnya, jangan cuma katakan tidak pada korupsi,” ujar Martin. Sementara itu, Ruhut Sitompul mengatakan, siapapun yang terlibat dan jika terbukti secara hukum, baik Angelina Sondakh, Anas Urbaningrum dan lainnya Demokrat tak akan melindungi. “Bahkan saya tidak akan menjenguk, membesuk Angie, karena selama menjadi pengacara, saya tak pernah membela koruptor. Jadikan, kita minta KPK bertindak cepat,” ujarnya. Langkah itu lanjut Ruhut, menunjukkan jika PD merupakan satu-satunya partai yang berani tunjuk hidung kadernya yang terbukti salah melakukan korupsi. Dia meyakinkan jika hal itu sesuai dengan misi dan visi Presiden SBY yang sejak awal berkomitmen untuk memberantas korupsi dan menjadikan PD sebagai partai yang bersih. “Jadi, mau Angie, Anas dan siapapun tak akan dilindungi. Bahwa Pak SBY tak main-main memberantas korupsi. Padahal khusus Anas itu, sejak dulu ketika kasus Nazar muncul ke permukaan, saya sudah bilang kalau kamu me-mang bersih, kamu harus katakan siap ditem-bak di kepala. Bukan saja digantung di Monas,” kenang Ruhut. Selain itu lanjut Ruhut, dirinya sejak awal juga sudah mendorong agar Anas mundur sementara kalau sayang dengan Demokrat. “Saya ingin badai ini cepat berlalu. Sebab, kadang orang itu jatuh bukan karena karang yang kokoh, melainkan akibat kerikil. Untuk itu, saya bangga dengan Pak SBY, karena mendorong setiap kader yang terbukti melakukan korupsi harus secepatnya dijadikan tersangka. Jadi, KPK jangan hanya berwacana, tapi harus bertindak cepat. Itu lebih baik untuk Demokrat,” ujarnya. Junimart Girsang mengakui jika dalam kasus Nazaruddin termasuk Hambalang adalah atas perintah Anas. Selain sebagai pemilik perusahaan, yang memerintahkan pengiriman uang sebesar Rp50 miliar ke Kongres Demokrat di Bandung juga atas perintah Anas, karena membutuhkan uang yang banyak. Sedangkan perusahaan tidak mampu menyediakan uang sebesar itu. “Nazarud-din lari ke Singapura juga atas perintah Anas. Istri Nazar yang dituding selama ini malah tidak tahu apa-apa. Bahwa yang dituduhkan kepadanya itu semuanya fitnah,” tutur Junimar. (j07)

Bahkan PD berjanji tidak akan intervensi KPK yang menyeret kadernya jika memang terbukti melakukan korupsi. “PD mendukung upaya KPK menuntaskan kasus korupsi Wisma Atlet, Kemendikbud maupun Hambalang, yang menyeret sejumlah politisi PD. Pak SBY pun tidak akan mengintervensi proses penegakan hukum bahkan terhadap Ketua Umum PD Anas Urbaningrum, jika yang disebut ‘bos besar atau ketua besar’ itu sudah dikan-

tongi KPK merujuk kepada Anas. Kita percayakan pada KPK untuk mengungkap itu semua, untuk membuktikan itu semua. PD tidak akan mengintervensi proses hukum,” tandasWasekjen DPP PD Saan Mustapa pada wartawan di Jakarta Jumat (4/5). Sebelumnya Wakil Ketua KPK Zulkarnaen mengakui jika KPK telah mengantongi nama yang dimaksud sebagai ‘ketua besar’ itu. Namun dia enggan menyebut nama yang dimaksud. “Tentu kami sudah mengan-

Kematian Ongen Dicurigai Ongen Saksi Kunci Kematian Munir JAKARTA (Waspada): Penyanyi Glenn Fredly mengaku curiga dengan kematian pamannya, Raymond J Latuihamallo alias Ongen. Alasannya, selain sebagai saksi kunci atas kematian aktivis Munir, Ongen juga tidak memiliki riwayat penyakit berat seperti jantung. “Secara teologis mungkin ini jalan Tuhan. Tapi melihat beliau sebagai sosok penting dalam kasus Munir, asumsi itu mungkin saja bisa mengarah ke situ (kematian direkayasa),” kata Glenn saat ditemui di pemakaman, Tanah Kusir, Jakarta Selatan, Jumat (4/5). Dia menegaskan, itu adalah pendapat pribadinya. Bukan mengatasnamakan keluarga. Sejauh ini, keluarga memilih untuk mengikhlaskan kematian Ongen. “Sampai saat ini keluarga tidak memiliki asumsi apa-apa. Kami belum bicara jauh dengan pihak keluarga tentang itu. Keluarga belum ada keputusan apapun,” katanya. Mantan suami Dewi Sandra ini berharap, keluarga mengkaji lebih dalam tentang meninggalnya Ongen. Terkait kemungkinan adanya outopsi ulang, lanjutnya, sebaiknya dibicarakan secara intens lagi. “Menurut saya, (keterangan) istri dan anak almarhum yang ada saat meninggalnya beliau bisa menjadi catatan penting,” ucapnya. Glenn sendiri mengaku sangat kaget dan terpukul atas meninggalnya Ongen. Padahal beberapa waktu sebelumnya mereka sempat bertemu dan saling berbincang. Selain itu, Ongen juga masih melakukan kegiatan normal bersama keluarga. “Ini sangat tiba-tiba sekali, ini mengejutkan pihak keluarga,” katanya. Dia mengaku sangat mengagumi sosok pamannya ini. Menurutnya, Ongen adalah orang yang tidak banyak bicara, tapi memiliki integritas dalam mengambil setiap keputusan. Ongen diakui Glenn, adalah sosok yang sangat penting di dalam perjalanan hidup dan kariernya selama ini. “Saya sangat dekat sekali, beliau salah satu orang penting buat saya. Beliau yang bawa saya ke dunia musik pertama kali. Saya masih SMA, dia yang membawa saya untuk bertemu dengan panggung musik, dalam industri musik. Beliau sangat tahu saya dan saya sangat mengenal beliau,” urainya. (vvn)

Anggota DPR Apresiasi Mobil Horas JAKARTA (Waspada): Alumni Fakultas Teknik Mesin Universitas Sumatera Utara (FT-USU) yang juga Anggota DPR RI dari daerah pemilihan Sumut 1 Ir Nurdin Tampubolon mengapresiasi mobil Horas hasil rakitan mahasiswa Fakultas Teknik USU yang akan berkompetisi di Shell Eco-Marathon (SEM) Asia 2012 di Sepang, Malaysia, Juli mendatang. “Saya sebagai alumni tentu bangga dan kreativitas Fakultas Teknik USU pantas kita apresiasi,” ujar Nurdin Tampubolon menjawab Waspada di Gedung DPR RI Jakarta, Rabu (2/5). Ketua DPP Partai Hati Nurani Rakyat (Hanura) ini berharap, mobil Horas ini bukan hanya ikut berkompetisi di SEM Asia 2012, tapi diharapkan terus dikembangkan hingga mampu menjadi mobil nasional yang dihasilkan anak bangsa. Untuk itu Nurdin berharap agar pembuatan mobil Horas FT USU ini didukung sepenuhnya oleh Pemerintah Provinsi Sumut dan Pemerintah Kota Medan, serta perlu didukung pula para pengusaha. Anggota DPR Komisi XI ini optimis dengan pengembangan mobil Horas, juga akan mendorong tumbuh dan berkembangnya industri lain. “Dengan tumbuh dan berkembangnya industri otomotif tentu akan mendorong berkembangnya industri lain di sekitarnya,” ujar Nurdin sembari menekankan agar mobil Horas terus dikembangkan dan dilakukan penyempurnaan. Yang penting, menurut Nurdin, peran pemerintah dan USU menjadi sangat besar untuk melakukan asistensi mulai dari proses desain, analisa kekuatan dan struktur, produksi, pengujian sesuai standar. Mobil hemat bahan bakar yang diberi nama “Horas”, hasil rancangan mahasiswa FT USU ini rencananya akan berkompetisi dalam kelas kendaraan Urban Concept berbahan bakar bensin. (aya)

Mega Ingatkan Buruh Kompak Suarakan Tuntutan JAKARTA (Waspada): Ketua Umum PDI Perjuangan Megawati Soekarnoputri mengingatkan kaum buruh untuk kompak dan solid dalam menyuarakan tuntutannya. Menurut Megawati, kaum buruh juga harus realistis dan suatu saat siap jika harus berjuang sendirian. Hal itu disampaikan Megawati ketika berpidato pada acara peringatan hari buruh sekaligus peresmian Posko Pengaduan Buruh dan Kesehatan di lapangan DPP PDIP Lenteng Agung, Jakarta, Kamis (3/5). “Kemarin saya lihat tuntutan buruh agar upah naik Rp2 juta. Itu memang layak apalagi situasi dan kondisinya seperti ini. Tapi implementasinya bagaimana, jangan hanya berjuang berdasar emosi tetapi juga pikiran yang orisinil,” kata Megawati. Di hadapan 1.500 undangan yang terdiri dari kelompok serikat buruh, pekerja medis, mahasiswa dan kelompok tani itu Megawati juga mengatakan, karena PDIP bukan partai penguasa maka pihaknya tidak bisa mengambil kebijakan langsung bagi buruh. Namun, Presiden RI kelima ini menjanjikan bahwa kader-kader PDI-P di parlemen akan memperjuangkan suara buruh. “Selaku ketua umum partai politik saya mendorong perjuangan buruh, ya membantu lewat DPR. Meski terkadang PDI-P harus ditinggal sendirian saat ada hal yang harus diperjuangkan. Nasibnya (PDIP) sama dengan buruh. Tapi kami tak gentar, karena ada prinsip ekonomi kerakyatan, ekonomi Pancasila yang harus diterapkan,” ucap Mega yang ditimpali tepuk tangan hadirin, termasuk Dirut PT Jamsostek Hotbonar Sinaga yang juga hadir pada acara itu. Pada bagian lain pidatonya Megawati juga memberikan apresiasi atas aksi kelompok buruh pada May Day, Selasa (1/5) lalu yang berlangsung tertib. Meski awalnya Megawati khawatir aksi buruh saat May Day akan berakhir ricuh. “Kemarin itu sudah lumayan. Tidak terprovokasi. Saya sempat deg-degan juga. Tapi memang begitulah perjuangan, kelompok buruh harus bisa mengorganisir dirinya,” harap putri Bung Karno itu. (aya)

tongi siapa ketua besar itu). Tapi, harus didalami perannya seperti apa ketua besar ini,” katanya. Terpidana kasus suap wisma atlet, Mindo Rosalina Manulang menyebut sosok ‘ketua besar’ adalah Mirwan Amir sedangkan ‘bos besar’ adalah Anas Urbaningrum. Julukan itu muncul dalam percakapannya dengan Angie via BlackBerry Messenger. Hal sama juga diungkap oleh mantan Bendahara Umum DPP PD M Nazaruddin. Tapi, menurut Nazaruddin yang dimaksud ‘ketua besar’ adalah Anas Urbaningrum. Sedangkan ‘bos besar’ yaitu Mirwan Amir. Istilah ketua besar terungkap dalam pembicaraan BlackBerry Messenger (BBM) antara Rosa dan Angelina Sondakh. Angelina mengatakan kepada Rosa bahwa ketua besar menginginkan “Apel Malang” yang diakui Rosa adalah uang. Sebelumnya Ketua DPP PD Ruhut Sitompul menyatakan kalau PD meminta agar KPK bekerja secara profesionalisme. “KPK kita hormati yang sudah menemukan berkaitan dengan apa yang dikatakan Yulianis, Nazar, ataupun Rosa, bahwa KPK sudah mengetahui siapa yang dimaksud ‘ketua besar’ atau ‘bos besar’ itu. Silakan saja,” ujar Ruhut Sitompul. Menurut Ruhut justru ma-

kin cepat ‘ketua besar’ itu terungkap dan diproses, akan lebih baik bagi PD. Dia menegaskan jika PD tidak akan mengintervensi selama ada fakta dan bukti hukum yang kuat, dan selama ada dua alat bukti untuk menjadikan ‘ketua besar’ atau ‘bos besar’ tersebut sebagai tersangka. “Kami ingin badai cepat berlalu. Karena pesan Bapak Presiden, siapapun itu kalau ada yang sudah cukup bukti, kita tidak akan lindungi,” katanya optimis. Hal yang sama diungkapkan olehWakil Ketua Komisi III DPR, Nasir Djamil agar KPK segera mengungkap apa yang dimaksud ‘bos besar atau ketua besar’ dalam kasus Nazaruddin tersebut. “Identitas ketua besar yang saat ini sudah dikantongi oleh pimpinan KPK sangat membantu untuk membuktikan ada atau tidaknya keterlibatan ‘ketua besar dan bos besar’ itu dalam kasus Wisma Atlet, Kemendikbud, dan Hambalang itu. Saya pikir, identitas itu cepat atau lambat akan dibuka ke publik,” ujar Nasir. Politisi PKS itu meyakini jika KPK sudah mempunyai bukti yang kuat. Sehingga tak ragu mengungkap siapa identitas ‘ketua dan bos besar’ itu ke publik. “KPK sudah mengantongi identitas siapa yang disebut

sebagai ‘Ketua Besar’ dalam kasus suap wisma atlet. KPK saat ini tengah menelusuri peranan Ketua Besar yang disebut mendapat‘apel washington’ dan‘apel malang’ ini,” tambah Nasir. Angie Sementara itu mengenai Angelina Sondakh yang digadang-gadang sebagai justice collaborator atau pengungkap pelaku ‘pembuka aib’ untuk kasus korupsi yang melilitnya. Namun hal itu tidak akan bisa terwujud jika Angie tak mau mengakui perbuatannya. “Dalam SEMA (Surat Edaran Mahkamah Agung) disebut bahwa justice collaborator yaitu yang bersangkutan adalah pelaku tindak pidana tertentu, harus mengaku, dan bukan pelaku utama. Nah masalahnya Angie kan belum mau mengaku,” kata Koordinator Koalisi Masyarakat Sipil Antikorupsi (KOMPAK), Fadjroel Rachman. Sebab, berdasarkan SEMA, untuk jadi justice collaborator, Angie harus mengakui tindak kejahatannya. Selain itu, harus dibuktikan Angie bukanlah pelaku utama dalam kasus wisma atlet dan pengadaan peralatan pendidikan. “KPK harus membuktikan dulu kalau Angie bukanlah pelaku utama. Tapi saya juga nggak yakin dia pelaku utama,” kata Fadjroel.(j07)

Pemerintah Pusat Mestinya Dorong Daerah Miliki Saham Newmont J A K A RTA ( Wa s p a d a ) : Pimpinan Komisi XI DPR Harry AzharAzis mengatakan, daerah penghasil kekayaan alam seperti Nusa Tenggara Barat (NTB) harus mendapat porsi pembagian hasil yang besar. Karena itu, Pemerintah Pusat mestinya mendorong agar daerah dapat memiliki saham, yang juga lebih besar di PT Newmont Nusa Tenggara (NTT). Jadi, sisa saham divestasi yang tinggal 7 persen sebaiknya diserahkan pada daerah saja. Harry mengingatkan perlunya rasa keadilan ditegakkan dalam pembelian saham ini. Mengapa daerah mesti diberi kesempatan membeli sisa saham? Gunanya untuk meningkatkan penghasilan daerah dan untuk masyarakat setempat, ujarnya Kamis (3/5), terkait masih pro-kontranya pembelian sisa divestasi 7 persen

saham Newmont. Bahwa ada kerjasama dengan swasta, menurutnya itu wajar saja mengingat kemampuan keuangan daerah juga terbatas. “Saya melihat rasa keadilan daerah penghasil mesti diutamakan. Bahwa daerah lain juga perlu mendapat bagian, silakan pemerintah pusat yang mengatur. Dalam era otonomi daerah saat ini, maka sudah sewajarnya, pemerintah memberi keleluasaan yang lebih, kepada daerah,” katanya. Masalah pembelian sisa divestasi saham NTT kini dibawa ke Mahkamah Konstitusi, (MK), karena pemerintah menganggap ada sengketa kewenangan antara pemerintah dan DPR serta BPK. Pasalnya, Pemerintah tidak mau meminta izin DPR, padahal DPR yang mempunyai hak bujet. Dalam hubungan ini, Harry berharap MK mema-

hami dan bersikap adil. Sebelumnya Gubernur NTB Zainul Majdi berulangkali menegaskan bahwa daerah berkepentingan memiliki saham lebih besar di NTT dengan harapan, hasil dari kepemilikan yang lebih besar itu akan dapat digunakan untuk kepentingan bersama masyarakat. Pekan lalu, Zainul Majdi juga memberi kesaksian di MK dan memaparkan bagaimana urgensi kepemilikan sisa saham divestasi NTT itu bagi daerah NTB. Jadi, kata guernur termuda itu, daerah sangat siap untuk membeli saham NTT. “Sudah saatnya, kita diberi kesempatan untuk bisa menikmati hasil alam daerah, untuk kepentingan daerah, dan juga kepentingannasional,”kataZainul sambil menambahkan sudah saatnya daerah diberdayakan dan diberi kesempatan. (aya)

Mau Bobol Bank Mandiri, WN Malaysia Ditangkap JAKARTA (Waspada) : Seorang Warga Negara Malaysia bersama tiga kawanannya warga negara Indonesia dibekuk aparat Subdit Fismondev Direktorat Reserse Kriminal Khusus Polda Metro Jaya, saat hendak membobol uang milik Bank Mandiri Cabang Pangeran Jaya, Jakarta Pusat, sebesar Rp 610 miliar dengan cara memalsukan deposito berjangka milik orang lain. Ketiga rekan MRT yang warga Negara Indonesia berinisial YP, R alias HS dan PWR juga digelandang ke Mapolda Metro Jaya. “Modusnya dengan cara memalsukan dokumen deposito berjangka milik YOP alias Ongko yang hanya punya uang di Bank Mandiri Rp15 juta. Uang 15 juta itu telah diambil oleh pemiliknya pada 2007,” kata Kasubdit Fismondev AKBP Edy Suwandono, yang didamping oleh Kabid Humas Kombes Pol Rikwanto, di Mapolda Metro Jaya, Jumat (4/5). Menurut Edy, saat tersangka MRT datang ke Bank Mandiri

Cabanng Pangeran Jakarta Pusat pada 27 April 2012 dengan maksud mencairkan surat deposito berjangka atas nama YP. “Pihak Bank Mandiri menolak untuk mencairkan dikarenakan yang berhak mencairkan adalah pemilik deposito. Saat itu MRT meninggalkan bank. Dan disarankan agar pemiliknya ikut serta,” katanya. Kemudian tiga hari kemudian, pada Senin 30 April 2012, MRT kembali mendatangi Bank tersebut, tanpa pemilik deposito berjangka tersebut dengan alasan pesawat yang ditumpanggi dari Yogyakarta menuju Jakarta delay. Tetapi, pihak bank tetap menolak permintaan MRT untuk mencairkan deposito berjangka tersebut. Tidak mau menyerah, keesokan harinya Selasa (1/5), MRT datang lagi ke bank tersebut seorang diri, dan pihak bank tetap menolak pencairan dana tersebut. Kemudian, MRT pun kembali nekat mendatangi Bank Mandiri tersebut dengan membawa KTP asli milik YP. Saat itu,

pihak bank melakukan verikasi terhadap deposito berjangka dengan nomor seri AB027359 dengan nomor rekening 115020427628-3 atas nama YP. Ternyata, deposito berjangka tersebut bukan milik YP, namun milik YOP. “Melihat upaya kejahatan ini, akhirnya pihak bank melapor ke Polda Metro Jaya, dan polisi langsung menangkap YP. Kemudian, setelah dilakukan penyelidikan dan penyidikan, polisi juga mengamankan tiga anggota kawanannya yang lain yakni YP, R alias HS dan PWR,” kata Edy. Polisi berhasil menyita satu lembar surat deposito dari MRT dengan nomor seri AB 027359 No rek 115020427628-3 atas nama YP tertanggal 11 juli, satu lebar surat kuasa dariYP kepada MRT tertanggal 20 April 2012. “Dan satu lembar formulir aplikasi umum atas naman MRT, satu lembar KTP milik YP. Para tersangka itu dikenakan Pasal 263 KUHP tentang pemalsuan dengan ancaman diata lima tahun penjara,” terang Edy.(j02)

WN Malaysia Pasok Narkoba Rp160 M JAKARTA (Waspada): Gembong narkoba internasional dari Malaysia dan China pemasok 379 ribu butir ekstasi dan 30 kilogram sabu senilai Rp160 miliar melalui jalur laut Sumatera dibekuk aparat kepolisian Polda Metro Jaya. Empat warga negara (WN) Malaysia pemasok narkoba ke Indonesia melalui pantai Timur Sumatera yang ditangkap Satuan Direktorat Narkoba Polda Metro Jaya adalah berinisial GBK, 40, NGK, 38, TWF alias AFG, 50 dan TWF alias AFI, 51. Bersama empat gembong narkoba internasional itu, polisi juga menangkap satu orangWN China berinisial ZXW, 41. “Selain 4 WN Malaysia dan WN China, polisi juga membekuk WN Indonesia, HS alias AH, 44, IVN, 23, HSN, 52, YSP, 28, YNT alias ALG, 52, dan BNY, 35. Mereka ini semua satu

kelompok jaringan narkoba internasional,” kata Wakil Direktur Narkoba Polda Metro Jaya, AKBP Rachmad Wibowo kepada wartawan di Mapolda Metro Jaya, Kamis (3/5). Menurut Rachmad, gembong narkoba ini ditangkap secara terpisah 29 dan 30 Maret 2012 dan 16 April 2012 di parkiran motor Apartemen Puri Casablanca, Jakarta Selatan, di Apartemen Ambasador, Jakarta Selatan, dan di Pool Bus IMI, Rajabasa Raya, Bandar Lampung. “Mereka semua ditangkap dengan barang bukti keseluruhan sebanyak 379 ribu butir ekstasi dan sabu seberat 30 kilogram yang dikemas ke dalam koper tanpa kamuflase apapun, kemudian dikirim melalui jalur laut pantai Timur Sumatera. “Untuk narkoba jenis sabu merupakan hasil produksi di Asia Utara dan ekstasi dipro-

duksi di Malaysia. Kemudian mereka bawa ke Indonesia dengan menggunakan kapal nelayan dan ditangkap di Lampung,” terang Rachmad. Dikatakannya, sindikat narkoba jaringan internasional ini terungkap berawal ditangkapnya HS dan IVN di parkiran motor apartemen Puri Casablanca pada 20 Maret 2012. Dari pengembangan kedua tersangkap itu, polisi kemudian menangkap GBK, ZXW dan MGK di Apartemen Ambassador pada 30 Maret. “Kemudian didalami dan didapat informasi akan ada pengiriman narkoba dari Malaysia melalui jalur laut Sumatera,” ujar Rachmad. Dari barang bukti narkoba yang disita polisi, bila dikonversi ke rupiah nilai ekstasi tersebut mencapai Rp114,6 miliar dan sabu senilai Rp45,75 miliar. (j02)

A8 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU Taft GT 4x4 Thn ‘91 W. Hitam, Hrg 58 Jt/nego Hub. 0853.7389.0555 SUPER PROMO DAIHATSU BARU

All New Xenia, Terios, Pick Up, Luxio, Sirion, Full Disc, Ready Stock, Data dijemput. Hub: IRNANDA 0813 75802895 / 0821 6761 2659 # DAIHATSU 100% BARU #

New Gran Max Pick Up Angsuran Rp.2.300.000 (47 Bln)

New Xenia Angs. Rp. 3.400.000 (47 Bln) Proses Cepat. Bunga Ringan, Data Dijemput Hub. Segera Ahmad Nasution Astra HP. 0812 6005 2465, Siap Membantu Anda.


Xenia DP 20 Juta, Terios DP 26/Jt-an Pick Up 7 Jt-an, Luxio, Sirion (full diskon) Hub. 0813 6100 7907 (Proses Cepat). ALL NEW XENIA AC DOUBLE BLOWER, Sensor Parking, Single Din (CD, MP3, USB) Alarm (Central Lock) Angs. Hanya 2.333.100,-. Terios Angs. 2.747.000, Pick Up Angs. 2.420.000. Hub. ADEK ASTRA 0812 6340055 PIN. 274CA61C

DIJUAL OVER KREDIT DAIHATSU Terios TS Extra Hitam Des 2010. Balik DP 48Jt. Sisa Angs. 32x4.310.000. Nego. Berminat Hub. 0821 6884 5709

DAIHATSU Zebra Prima 21 Thn. 1995. Warna hitam met, mulus, siap pakai. Jl. Mustafa Gg. 7 No. 21. HP. 0813 6179 0291

DAIHATSU Espass Thn. 96 1.3. AC, Tape, V. Racing, BK Medan. Hub. 0813 617 612 39 KHUSUS BUAT PEMAKAI D. Taft GT 4x4 1993. W. Hitam BK Baru, Ban Baru, Velg Cobra, AC, DVD, Jok baru, body kaleng semua. NB: Lihat Mobil dijamin tdk kecewa. Serius Hub. 0812 6025 8795

DAIHATSU Xenia Th. 2009. 1300cc XI Family Wrn Silver Bisa Kredit DP Murah. HP. 0813 6212 2339 DAIHATSU Xenia LI. 2007. 1.0 W. Hitam lengkap. H. 115Jt. Nego. S. Mulus, Avanza G. 2005. W. Merah met. S. Mulus. H. 125Jt. Nego. Hub. 0852 7750 1207. Bisa Bantu Kredit.

OVER KREDIT HONDA FERIO THN. 97/98 Mulus, original, TV, DVD, Ban Baru, Siap pakai, Hitam, kembali DP 325Jt/Nego. Ang. 2,5Jt. 34x lagi. Hub: 061-66477734, 0852 9616 6601 maaf TP.

JAZZ NEW HONDA FREED KREDIT TANPA BUNGA (0%) C R - V SELAMA 3 TAHUN ATAU DP 29 JT-AN. TERIMA C I T Y Tukar Tambah 081.370.999.998 / 77.388.33 HONDA Jazz V. Tec. Th. 08, Type S, manual, warna hitam, 1 tangan dari baru, mobil mulus Rp. 169Jt. Jl. SM. Raja Samping ILP. 0821 6767 7000 / 7851402 ISUZU Panther Hi Sporty Thn. 1998. BK Medan, asli W. Abu2 met. Lengkap/mulus, siap pakai. Rp. 76Juta Nego. Hub. 0813 6227 1115 Jl. Amaliun Depan SD Kartini No. 146 Toko ULGA

ISUZU Panther Hi Grade Thn. 95. Hijau met. Kondisi sangat mulus, terawat, komplit, jarang pakai, Harga 62 Juta Net. Hub. 0853 6230 0613

ISUZU Panther Turbo LM. Th. 2008. Warna silver I tangan dari baru. BK Asli Medan. Harga Rp. 165Jt. Telp. 061-76257888 - 0812 63432888, 087869510888

ISUZU ELF Mikrobus Kursi 15 warna Silver/

Mulus Th. 2008, AC Datting, BR/Tangan pertama. Hub. RAWAT 0812 6542 8688 / TP DIJUAL SALAH SATU 1.ISUZU Panther Miyabi Long. Thn. 93/94. PS, P. Window, C. Lock, Remot, Jok kulit. H. 43Jt. 2.Isuzu Panther Challenger Thn. 95. PS, AC, DB, PW, Remot, Alarm. H. 45Jt. Mobil mulus, cantik rapi.Hub. Ibu Dewi H. 061.77572509 - 0812 6596 4197 (maaf sms TP)

* KIA Travelo 2010, Silver, dari baru, bisa over kredit. Hub. 0853 7009 1688 NISSAN LIVINA XR 1500cc Manual Thn. 2008, Biru met, BK Rp. 132Jt. Hub. 0853 6161 5977 SUZUKIVitaraJLX4x4Thn.93.W.Abu2 met, BK Medan asli, komplit. Peminat Hub. 0812 6004 3002 - (061) 77919728 SUZUKI Sidekick Thn. 95 (Kepala Kodi) Original warna biru satu tangan, dokter punya. Rp. 69Juta. HP. 0813 6156 0500 SUZUKI APV Type L: Thn. 2004/05. W. Silver, AC, RT, VRac, PW, PS, BK Medan Mulus. Hub. 0821 6717 6723 - (061) 77967599


Ertiga, Carry Pick Up, APV Arena DP Rendah, Angsuran Ringan. Proses Cepat. Terima tkr tmbh & Banjir Hadiah Menarik. Hub. 0852 6111 7724

5 CM 6 CM

Rp. 65.000 Rp. 78.000

SUZUKI Baleno Thn. 2002. Warna hitam, satu tangan, Velg Racing. Harga 90 Jt. 0813 7034 5552 TOYOTA YARIS TAHUN 2006 Type S. Matic. W. Biru Met. BK Medan Asli. Telp. 0853 7272 7251 TOYOTA Kijang Commando 1992 Dijual. Hijau metalik, mobil lengkap, Power Steering, AC Dingin, Remote. Luar biasa cantik & terawat. Hub. 0813 7066 7070

TOYOTA Kijang LGX 2002 Rp. 112Jt/ Nego. Biru tua, Bensin, mulus, plat BL. 0812 6056 6356 / 80021050 “TOYOTA BARU 2012” Dapatkan New Toyota dengan Bunga 3,85%. Proses Cepat & Data Dijemput. Hub. PREDY SIMATUPANG. 0813 6165 1801 - 0853 6207 2000

RUSH Thn. ‘08, Type S Warna hitam, tangan pertama Km. 60.000. Harga Rp. 175Jt. TP Hub. (061) 76875192

TOYOTA Kijang Krista Diesel Thn. 2003. Hitam, BK Rp. 152 Jt. Hub. 0852 7538 3218 TOYOTA Innova V Matic Bensin. Thn. 2005. Hitam, BK Mdn Rp. 153Jt. Hub. 0853 7089 9893 TOYOTA Kijang LX 1.8 Bensinhj. Thn. 2004. AC, VR, PS, CL, Jok kulit, Silver, plat BM Rp. 105Jt. Hub. 0812 6594 2789 PROMO TOYOTA New Avanza, Innova, Fortuner, Yaris, dll. Dapatkan Bunga & Discount menarik. Hub. 0853 1098 8164

TOYOTA Avanza Thn. 2008, Type G Hitam, Hrg. 135Jt. Hub. 0811 6000 83 TOYOTA Avanza Type G Th. 09. Plat BL. Wrn silver, mobil cantik Rp. 133Jt. Kembar Ponsel Jl. SM. Raja No. 200. 0815 337 33688 / 7851402

TOYOTA Kijang Krista Diesel Dijual. Th. 2001 Rp. 120.000.000. Nego Hub. 0811497736. Atau langsung Jl. B. Labuhan No. 55. Tj. Morawa. TOYOTA Rush Type G Th. 07. Bln 12. Warna hitam Rp. 159,5Jt. Depan Kampus UISU No. 200. 0811 613107/7851402 TOYOTA Starlet Capsul Thn. 90. 1.3. AC, Tape, V. Racing. Hub. 0821 6407 4413


SEPEDA MOTOR HONDA Supra-X 100 Th. 2004. Warna hitam - Silver. Kondisi mulus. Mesin standart ok, siap pakai. Hrg. 6,25Jt/ damai. Hub. 0878 6882 6865

BURSA BUTUH DANA BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807



Promo Paket Sound System. Karaoke Design In USA. Harga Bersaing Super Memuaskan. Dapatkan Harga Khusus Distributor. Berkualitas dan Ready Stock. Show Room. Jl. Biduk 63 Medan. Tel. (061) 69997692. HP. 0811 631570



ELEKTRONIK REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757 Siap Ketempat


KOMPUTER SERVICE LAPTOP LCD gelap, Rusak, Engsel patah, Keyboard, Battery, HDD, Hank, Virus dan Lain TERIMA LAPTOP & KOMPUTER Mau JUAL, BELI, Tukar Tambah, Keadaan RUSAK PARAH pun kami TAMPUNG jg luar kota. KAMI SOLUSINYA CV.RBC Boleh Tes! Jujur & Di Percaya Jl. Sena No. 47/4 Tel. 4553359, 77700887

7 CM 8 CM

Rp. 91.000 Rp. 104.000

9 CM Rp. 126.000 10 CM Rp. 140.000

Pelanggan Yang Terhormat HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000


Izin Depnaker No. 560/368/DTKTR/2012 Dibimbing Master Mekanik Lulusan Jepang (Bangsawan Siregar) Menerima peserta baru periode Mei - Juli 2012 Teknik Pengapian & Mesin, Bersertifikat, membantu penyaluran kerja bengkel bagi lulusan.Syarat: P/W semua usia, membayar biaya pelatihan Lokasi: Jl. Mesjid Desa Kolam, P. Seituan DS Bagi peserta luar daerah, dibantu carikan kamar kost. daftarkan sebelum 21 Mei 2012, informasi hub. 0877.6853.0709

1. 2. 3. 4. 5. 6.

DAFTARKAN SEGERA KE: KANTORPUSATMULTAZAMMEDAN Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6495.8456


DIBUTUHKAN; Gadis/ Janda Muslim untuk Jaga anak, Gaji 900 Rb - 1,5 Jt/ bln Hub. Bpk. Jovli 0812.6553.5559 di Medan ataupun luar kota


DIBUTUHKAN Karyawan/ti minimal D3/ Mahasiswi, Gaji tetap dan komisi Hubungi Eva 0878.6895.7678 (061) 7638.3848


Untuk Membangun: Promosikan 1. Perumahan, Ruko. Produk 2. Rumah Sakit Swasta / Gedung Anda Pendidikan 3. Perhotelan Harian Perusahaan kami menyediakan WASPADA dana dalam bentuk Kerjasama/ Media Bagi hasil. Syarat: Menyediakan lahan dan yang Tepat bersertifikat bebas Sengketa. untuk Hubungi kami: ONES: 0823 682 30085, Iklan Anda RUSLAN: 0813 704 78615 Dana cpt - Jual - beli - Latop-DII? 0812-636-1967 - Jl. Rantang 20s



KONSTRUKSI TUMPAT/ SEDOT SETIA BUDI HP. 8442246 0812 631 6631 Ada Garansi



0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi




Manasik Haji Multazam: Setiap hr Sabtu Pkl. 14.00-16.00 Wib hr Minggu pkl. 09.00-11.00 WIb Tempat manasik Mesjid Agung Medan Jl. P. Diponegoro


TOSHIBA 14” Dvd&hp = 3,3Jt-Diskon 50%=1,7Jt. berlaku 6hr. LAPTOP-Coi5acer +VGA (3x)-(acerCoi3?/Co2-Mulai (1xjt) -Kamera-Sony -casio - Kodak - nikon DLSR=nego -CCTV - Mulai 195Rb PC-hdd40-500Gb?Ddr3(99rb)Spk-aktif(39)adaptr(78rb)LCD(4xx)P4-2.8 (299)

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


Jamaah luar kota dapat penginapan/ Hotel, makan dan transportasi ke Bandara Gratis !!!

Apabila anda mencurigai sesuatu, silahkan hubungi kami di





Sabtu, 5 Mei 2012

BMJ = Jl. Serdang Gg. Belimbing No. 2D Mdn, butuh karyawan Tamatan SMA (Baru Tamat), SKU/ Ijazah Boleh menyusul C.P: 0852.9711.9056 - 7784.1353 / 0812.6094.2580


Wanita umur 18 - 35 thn, Penampilan menarik, jujur, Serius antar lamaran, langsung interview Jl. Rantang 20s 0853.6262.4640


Telah hilang BPKB Mobil Kijang Innova Tahun 2008 dengan BK 78 KD. Bila ada yang menemukan harap menghubungi Ibu Dahlia Brahmana di No. HP 0812.6555.1994


1 Satu Buah BPKB Sepeda motor merek Type Honda Supra X 125 BK 3928 OY. An. U N I WAT I D J AWA N G N o . Rangka. MH IJB9117 BK 37 6778 No. Mesin JB 91E1376966 1 Satu Buah STNK Sepeda Motor Type Honda Supra X125 BK 3928 OY. atas nama. UNIWATI DJAWANA No. Rangka MH IJB 9117 BK 37677B. No. Mesin. JB91E1376 966


6 Sertifikat Hak Milik - No. 3 - No.5 -No. 7 - No. 4 - No.6 -No.15

A/n. HUSNI yg terletak di Desa Lalang Kec. Medan Deras. Tanjung Balai. Tercecer disekitar Jl. Raya Kisaran Tanjung Balai

Penerbangan Via Singapore *Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis DAFTAR SEGERA

Kantor: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4/18 Medan

Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488 Website:


Uki. Tanah 9,20x21,50m, Uk. Tanah 7x12m, Jl. Tembung Pasr 8/9 Gg. Al-Ridho Desa Bdr. Klipa, ±150m dari Jln besar Tembung, Harga 190 Jt/nego Hub. 0852.7301.1715 - 0878.6839.1096


Jl. Binjai Km. 15 Diski, Type 45, 75 & 85, DP Mulai 16 Jt, Cicilan 1 Jtan/ bulan, Ready Stock, Bisa langsing di huni unit terbatas Hub segera 0821.6810.1872 - 0853.5867.3675






LEBAR 70 CM (6 DAUN........ RP. 103.000/ SET LEBAR 130 CM (4 DAUN).....RP. 165.000/SET LEBAR 190CM (17 DAUN)....RP. 250.000/SET HUB HP: 0812.6012.783 TELP: (061) 452.6012 ATAP & DINDING EURODEK



1. Rumah Ukuran Tanah 8x21m depan Kantor Lurah Muliorejo Sunggal (Jl. Balai Desa), Harga Rp. 175 Jt 2. Tanah Jl. Binjai/ Setia I Km. 12,8 Luas 1000m², Harga Rp. 375.000/m² Telp. (061) 7625.7888 - 0812.6343.2888 0878.6951.0888


TERCECER 1 Buah BPKB Dan STNK BK 3987 UK. A/n. JOUMAN HAMONANGAN SILALAHI. Barang Siapa yang menemukan Hub. 0812 6321263 - 0852 7045 7300. Tercecer diseputar P. Hijau.



Ukr Tnh: 161m², Uk. Bangunan 6,5x17mtr, Full keramik, Plafon Gypsum, 3 Kmr Tdr, Hlmn depan & belakang Hrg 220 Jt di Jl. Sari Marindal Hub segera: 0853.7077.7707

HILANG/TERCECER TERCECER Surat Tanah No. 24512/A/III/2. Surat Bupati Kepala Daerah Kab. Deli Serdang. Surat Tanah a/n. Suang Ginting Warga Kampung Mangga Lorong II Kec. Deli Tua. Tercecer disekitar rumah Kepling V. Kel. Mangga Medan Tuntungan dan Kantor Lurah Kel. Mangga





Informasi Pembaca Bursa Property




Diberikan ongkos Angkot + Upah borong HP: 0812.601.2783 Tel. 452.6012 YAYASAN SINAR BUNDA

Lowongan kerja, Dibutuhkan wanita tamatan SD, SMP, SMA, Akper, Akbid utk dididik diperkajakan sbb: Baby Sitter, P. Jompo, K. Asuh, Honor 900 Rb s/d 1,6 Jt. Hub: Yayasan Sinar Bunda, Jl. Ngumban Surbakti No. 23 Simp. Pos Pd. Bulan Medan HP. 0821.6064.4428


2 (dua) orang Sekretaris di Perusahaan Penerbit, 1 Laki-laki dan 1 Perempuan Mempunyai Gaji Tetap dan Bonus: Persyaratan: Dapatmengoperasikankomputerdandapat mengendarai sepeda motor, diutamakan yang mempunyai SIM C Yang berminat harap membawa CV ke: PT. LENTERA ABADI Jl. Sei Tuan No. 3 Telp. 415.3511 Medan

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik RUKO 2 Lt 385 Jt/ nego JL. Besar Denai (samping Mesjid Al Quba), Cocok buka usaha apa saja Hub. 0813.9627.9192 / 0821.6603.3261 HANYA 185 JT Krakatau Rumah Baru Khusus Muslim, 2 KT, 2 KM Jl. Purwosari Krakatau Hub. 0813.9627.9192 0821.6603.3261

RUMAH Dijual di Jl. Mandor Krakatau, LT. 640m², LB. 300m², SHM Hub. 0853.7009.1688 RUMAH DIJUAL

Jl. Sejahtera No. 25 Helvetia Timur (Ponsur), Luas Tanah 20x30m, Bangunan 10x26m, Kamar 6, Kamar pembantu 1, Kamar mandi , Ruang tamu 2, Harga berdamai Hub. 0819.2045.983


Lantai 2 Nya saja, Fasilitas AC, Sekat kantor, PLN, Air Dapur, Ruko di Jl. Setia Budi Ada Jalan Dari Samping Hub. 0813.7083.0826


Rumah Permanen, Luas Tanah 17x11 M2. Luas Bangunan 14x11 M2. 3 kmr tidur, 2 kmr mandi, garasi, ruang shalat, ruang tamu dan ruang tengah, 2 dapur, listrik PLN, air jet PAM (sumur bor). Lokasi Jln. Danau Poso, Gang Cokro No.3 Binjai Timur. Harga nego, tanpa perantara. Hub. 085260601978 / 081360632809


Di Jl. Menteng VII Komp. Citra Menteng Blok D No. 5, 3 KT, 1 Paviliun, Harga nego, Maaf TP Hub. 0812.6024.9959 0812.6071.2666



Di Jl. Klambir V depan Sekolah PAB, 2 Tingkat, 2 KM, SHM Strategis utk usaha Bebas banjir, Harga nego


Di Jl. Menteng VII Komp. Citra Menteng No. D6, 2 KT, 2 KM, Lokasi sangat aman, Security 24 jam, Bebas banjir, Harga 300 Jt/nego, Khusus Muslim Hub. 0813.9680.3777 (TP)




Jl. Setia Budi Komplek Business Point Blok CC No. 5 Medan, Fasilitas: PAM, Listrik, AC, Kamar Kerja, Perabotan kantor Bagi yang berminat hubungi: 0819.6026.103 atau (061) 451.3443 (Putra) TANAH TANAH Dijual di Pondok Surya Jl. Sinumba II (dkt Jl. Karya Sei Agul), Uk. 15x29mtr, Harga 1,1 Jt/mtr, Hub. 0813.7695.5180 - 0813.9627.9192

TANAH Dijual Uk. 25c31m, di Jl. Psr 3 Gg. Melati Krakatau Rp. 700 Rb/mtr Hub. 0853.7308.6785 - 0821.6603.3261 TANAH Dijual di Jl. Yos Sudarso Km. 10 Kota Bangun, dekat Pintu KIM, Luas Tanah 2800m², SHM Hub. 0853.7009.1688


Siap bangun/ B.U, Siap 6 Kapling lsg, Uk. 4x19m, RP. 16,8 Jt, SK Camat di Marinda III, Patumbak Hub. 0812.6302.5577 0813.1994.4145 - 0878.8196.6218



Hub. 0813.9680.3777 (TP)






Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.7194 Fax. (061) 415.7504 SUMUT - INDONESIA




TERIMA PANGGILAN 0812.2822.4745/ 061-75053711






1 Jam tuntaskan lemas BERGARANSI syahwat 100% ALAMI - Cepat keluar - Impotensi, diabetes - Tambah ukuran - Ramuan vagina perawan, kembali, hasil bisa cek dr metode : Biotheraphy dan Ramuan Herbal Office: Mesjid Raya Mdn 600m lurus di Jl. Amaliun No. 125 Bpk. Kosim S. Ag HP. 0812.63700.234 Izin Dinkes: 448/347/2004


Di Jl. Perjuangan Tg. Rejo, Medan Sunggal di samping Komp. Setia Budi Indah, Uk. 17,5x80m, SHM, ±300 mtr dari Ringroad (disebelah Rumah No. 72) Hub. 0812.602.4390, TP Nego


1. Uk. Luas 8236m² (SHM) di pinggir jalan rencana Ringroad di Ds. Leuge antara Lampeunurut dan Batalion di Banda Aceh 2. Tanah di Panyabungan/ Kab. Madina - Uk. luas 7212m² (SK Camat) di pinggir jalan ke Sabajior - Uk. 16,5x40m² di Pinggir jalan (dalam Lidang) - Uk. 18x26m² dipinggir jalan (Aek Galoga) Harga bisa nego Hub. 0812.6432.006 KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama



Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR

DIJAMIN 100% Hanya Tempat

Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333





Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat


Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari



Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222


WASPADA Sabtu 5 Mei 2012

07:30 - Dahsyat 11:00 – Infotainment Intens 12:00 - Seputar Indonesia Siang 12:30 - Sinema Siang 14:30 - Kabar-Kabari 15:30 - Jodohku 16:00 - Silet 17:00 - Seputar Indonesia 17:30 - FYI : For Your Information 18:00 - Mega Sinetron : Yusra Dan Yumna 20:30 - Mega Sinetron : Karunia 22:30 - Sportacular UEFA Euro 2012 00.30 Seputar Indonesia Malam


07:00 Inbox 09.05 Halo Selebriti 10:00 SCTV FTV Pagi 11.03 SCTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14.30 Status Selebriti 15.00 Uya Emang Kuya 16.00 Liputan 6 Petang 16.03 Jebakan Betmen 17.00 Liputan 6 Petang 17.30 FTV Cinta Istimewa 19.30 Serial Istimewa Putih Abu-Abu 20.00 Liputan 6 Terkini 20.30 SCTV Sinetron : Cinta Salsabilla 22.30 Liputan 6 Terkini 22.33 SCTV FTV Utama

07.00 - Disney Club 08:00 - Serial Pilihan 09:00 - Kisah Unggulan 10:30 - Diantara Kita 11:00 - Sidik 11:30 - Lintas Siang 12:00 - Layar Kemilau 13:30 - I Drama 15:00 - Starlite 15:30 - Lintas Petang 16:00 - Zona Juara : Tv Champion 17:00 - Animasi Spesial 18:00 - Animasi Spesial : Shaun The Sheep 19:00 - Fathiyah 20:00 - Tendangan Si Madun 21:00 - Segalanya Cinta 22:00 - Si Miskin & Si Kaya 23:00 - Tarung Dangdut 24:00 - Sport Mania 24:30 - Lintas Malam

07:30 - Fenomania 08:00 - Friends 09:00 - Fresh And Fun 09:30 - Gowes 10:00 - My Sassy Girl 11:00 - Topik Siang 12:00 - Klik ! 13:00 - Tom & Jerry 13:30 - Tom & Jerry 14:00 - Woody Wood Pecker 14:30 - Woody Wood Pecker 15:00 - Indonesia Super League 2011-2012 17:30 - Topik Petang 18:00 - Pesbukers 19:00 - Siapa Takut 20:00 - Full House 21:00 - Pilih-pilih Mantu 22:00 - Dokumenter : Great Migrations 00.30 Topik Malam

07:00 - KISS Pagi 08:00 - FTV Pagi: Melodi Cinta 10:00 - Hitzteria 11:30 - Patroli 12:00 - Drama Asia (Korea): Twinkle Twinkle 13:30 - Drama Asia (korea): Baby Faced Beauty 15:00 - KISS Sore 16:00 - Fokus 16:30 - Drama Asia (Korea): Lie To Me 18:00 - Drama Asia (Mandarin): To Liong To 19:00 - Sinetron Unggulan: Kisah Rama Shinta 20:00 - Tutur Tinular 22:00 - Srimulat 23:30 - Mega Asia

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.00 Headline News 10.05 Eleven Show 11.05 The Spring & Latern Festival 12.05 Metro Siang 13.05 Oasis 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Suara Anda 19.05 Suara Anda 19.30 The Beauty Of Harmony 20.30 Genta Demokrasi 21.05 Top Nine News 21.30 The Destroyed In Seconds 22.05 Provocative Proactive 23.05 Inside 23:30 Metro Sports


07:30 Ranking 1 08:30 Semangat Pagi 09:30 Fun Cooking 10:00 Wisata Terapi 10:30 Insert 11:30 Jelang Siang 12:00 Reportase Siang 12:30 Jika Aku Menjadi 13:15 Bukan Prime Time 14:00 Magic Comedy 14:30 Digital Clip 15:00 Sketsa 16:00 Show Imah 17:00 Reportase Sore 17:30 Inside 18:15 Comedy Project 19:15 Teater Komedi 20:15 Bioskop TRANSTV Spesial 22:15 Bioskop TransTV 00:15 Kakek-Kakek Narsis 01:15 Reportase Malam 01:45 Bioskop TransTV

06:30 Apa Kabar Indonesia 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break Live 11:30 Mutumanikam 12:00 Live News 13:30 Live News Kabar Arena Siang 14.00 Zona Merah 15.00 Live News Kabar Pasar 15:30 Ujung Negeri 16:00 Live News Kabar Petang 19.00 Kabar Utama 19:30 ApaKabarIndonesia Malam 21.00 Live News Kabar Malam 22.00 Live News Kabar Arena 22.30 Radio Show

06:00 Spongebob Squarepants 08:00 Naruto Shippuden II 09:00 Buku Harian Nayla 10:00 Obsesi 11:00 Kungfu Chef 11:30 Hot Spot 12:00 Berita Global 12:30 Awas Ada Sule 13:30 Sketsa Tawa 14:00 Steve Ewon Sang Pemburu 14:30 Profesor X 15:00 OB (Office Boy) 15:30 Fokus Selebriti 16:00 100% Ampuh 17:30 Spongebob Squarepants 19:00 Awas Ada Sule 2 20:30 Sketsa Tawa 20:30 Superhero Movie 22:00 Kill Bill 2

07:30 Selebrita Pagi 08:00 Ups Salah 08:30 Karaoke Keliling 09:00 Pelangi 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-Citaku 14:00 Dunia Binatang 14:30 Koki Cilik 15:00 Kuas Ajaib 15:30 Asal Usul Cari Tahu. . . 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Jejak Petualang: S ur. .. 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 (Masih) Dunia Lain 00:30 Sport7 Malam 01:00 Redaksi Malam


Ello, Musik Adalah Totalitas WAJAR jika orang mengerjitkan dahi ketika mendengar judul album Ello terbaru berjudul Taub Mumu. Kalau dibacanya dibalik artinya Buat Umum. Yang artinya, album ini diperuntukan untuk siapa saja baik Joni n Cindysebutan para penggemar Ello ataupun siapapun yang menyukai musik Ello. Begitu kata Marcello Tahitoe akrab dipanggil Ello, saat berbincang santai denganWaspada di Hermes Hotel Medan Senin (30/4) malam. Alasannya menggukan bahasa terbalik, karena dulunya bahasa gaul ini sempat popular di kalangannya dan gengnya semasa di sekolah. Berangkat dari kerinduan masa-masa sekolah, diapun ingin mengangkat kembali bahasa gaul di jalan sekarang. Awal lahirnya album terbarunya ini menurutnya, sekitar April 2011 lalu ia merilis single berjudul Yang Ku Nanti. Single dengan beat up tempo ini sukses menjadi top airplay di banyak radio. Dan kesuksesan ini ternyata berbuntut panjang, para penggemarnya meminta



Anda perlu rantangan U/ dikantor & dirumah menu berganti setiap hari (masakan Muslim) dapat dilayani utk kec. Medan Denai, Medan Tembung, Percut Sei Tuan & Bag. Kuis Hub. Bu Dina HP. 0821.6062.3002


Kesempatan terbuka menjadi Agen Rokok Mild di Kabupaten Sergai - Batu bara - Asahan & Simalungun Dengan modal seadanya Mmulai dari Rp. 100.000 s/d Rp. 500.000 Sudah bisa jadi agen Gratis: Seragam, Spanduk Agen, dll Cocok bagi kanvas Freelance

Hub ungi: PPak ak Adi HP Hubungi: HP.. 0813.9744.5941

Ello saat berbincang santai dengan Waspada di Hermes Hotel Senin (30/4) malam sehubungan dilirisnya album terbarunya berjudul Taub Mumu supaya dirilis album baru dan memang layak dipenuhi, maklum katanya, dia sendiri terakhir kali merilis album pada 2009. Setelah pergulatan berbulan-bulan di studio, album ditunggu-tunggu itupun rampung sudah. Pada 1 Maret 2012, ia resmi merilis album barunya berjudul Taub Mumu sekilas orang mungkin dibuat bingung dengan nama judul album tidak



MELAYANI GROSIR & ECERAN Lagu² Indonesia - Daerah - Dll. Kaset, CD, VCD original Jl. Sutomo 118A (simp. Yose Rizal) Mdn Telp. 7334.825 HP. 0852.7772.2021


PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?


Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.3334 HP. 0813.7580.8866

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

Harian WASPADA Media yang Tepat untuk Iklan Anda

umum ini. Kalau menyimak musik Ello pada tiga album sebelumnya, maka akan terasa berbeda manakala mendengar album terbarunya ini. Kalau dulu Ello banyak memainkan elemen musik sampling dengan dominasi permainan keyboard, maka sekarang dia lebih banyak bermain dengan gitar. Semua elemen musik dikonsep lebih simple, memanfaatkan instrumen mu-

sik yang ada, tanpa ada penambahan sound di sana sini, atau istilahnya musik yang organik. “Saya selalu mempunyai konsep berbeda pada setiap album, dan kali ini memang ingin lebih santai, simple dan tidak berjarak. Less is More, makanya saya juga memilih gitar sebagai elemen utama karena ibaratnya dengan sekali genjreng saja, keakraban dan chemistry bisa terjalin”, jelasnya. Album Taub Mumu ini

berisi 11 lagu dengan mengusung single baru berjudul Ga Kayak Mantanmu, lagu berirama middle tempo dibawakan dengan petikan gitar yang ringan namun semakin lama ketukannya semakin instens. Cerita lagu ini sangat unik, istilah jaman sekarang liriknya langsung membuat kena siapapun yang mendengarkan. “Lagu ini mewakili jeritan para pria dimanapun bahwa ternyata enggak enak banget kalau pacar selalu membanding-bandingkan dengan mantannya. Biar bagaimanapun ia ingin dihargai sebagai pacarnya yang sekarang”, ungkap Ello mengaku banyak mengambil pengalaman teman-teman di sekitarnya sebagai inspirasi dalam menciptakan lagu. Bagi Ello, musik adalah totalitas, ini sangat terlihat pada setiap penampilan panggungnya. All out dimana pun dan event apapun, ia selalu berusaha memberikan penampilan terbaik dan memang keluar sebagai bentuk ekspresi dirinya paling jujur. “Manggung enggak seru kalau urat enggak sampai keluar, energi meluap-luap hingga keringat bertetesan”, katanya sambil tertawa. “Bermusik itu mengolah energi, apapun energi yang kita hasilkan, pasti akan tersambung dengan penonton. Untuk itu saya harus fokus dan konsisten dengan hal-hal positif pada saat bermusik, karena penonton tidak bisa dikelabui”, katanya lagi.

Ello juga mengaku selalu menempatkan dirinya sebagai seorang pengamen, karena antara dirinya dengan pengamen di jalanan sama posisinya. Sama-sama mencintai musik dan hidup dari musik. Yang membedakan adalah dari segi fasilitas saja. Tetapi yang penting adalah bagaimana dengan musik ia bisa berekpresi, melahirkan ide-ide baru dan diharapkan dapat menginspirsi orang lain. Upaya Ello ini bisa disimak dari pemilihan beberapa lagu didedikasikannya sebagai penyemangat untuk para pendengarnya. Misalnya pada lagu berjudul Hadapi Dengan Senyuman, ia menulis liriknya seperti ini “...Mungkin kenyataan tak seindah impian, Tapi hadapilah semua dengan senyuman”. Ello juga bercerita bahwa proses penciptaan lagu ini didapat saat ia melakukan perjalanan ke suatu daerah yang sepi di Jawa Barat. Kesejukan udara dan keheningan menginspirasinya menciptakan lagu dengan balutan musik rock dikemasan musik country dan sentuhan folk. Pada lagu Inilah Aku, Ello menciptakan campuran musik rock alternatif dan rock n roll, dengan lantang ia meneriakan lirik “Inilah aku, inilah hidupku, tak perduli yang kau bilang”, sebuah afirmasi ampuh akan pentingnya setiap orang mempunyai kepercayaan diri dan yakin dengan apa yang ia jalani. � t.junaidi

Bobby Brown Dituduh Punya Kaitan Dengan Kematian Whitney Houston Bobby Brown angkat bicara setelah mendapat tudingan bahwa dirinya adalah salah satu penyebab penyanyi Whitney Houston meninggal dunia. Orang menyebut-nyebut dia mengenalkan mantan istrinya pada dunia narkotika. Pada sebuah wawancara dengan Matt Lauer dari The Today Show, Brown pun mengatakan bahwa bukan dirinya mengenalkan Houston pada narkotika. “Sebelum mengenal Whitney, saya tidak mengenal narkotika. Saya memang merokok, minum bir dan menghisap ganja. Namun bukan saya mengenalkan dia pada narkotika,” ujar Brown seperti dikutip dari IBTimes. Selama bertahun-tahun Brown memang dituduh keluarga dan para pengge-

mar Houston, karena dianggap telah mengubah Houston yang “anak baik-baik” menjadi pecandu obat terlarang, termasuk alkohol dan kokain. Pada wawancara tersebut, penyanyi R&B berusia 43 tahun itu, menyatakan bahwa obat terlarang sudah menjadi bagian dari hidup Whitney, jauh sebelum Brown mengenalnya. “Bagaimana mungkin hanya seorang saya mampu membuat Whitney terjebak pada dunia narkotika. Bukan saya menyebabkan dia meninggal dunia,” ujarnya.Brown mengaku sudah bersih dari narkoba, mengatakan bahwa dia sangat bersedih atas kematian Whitney. “Saya sangat sedih, karena saya sendiri sudah berhenti dan bersih dari narkoba sejak tujuh tahun lalu. Saya

Bobby Brown,Whitney Houston dan putri mereka Bobbi Kristina/ sungguh tidak tahu kalau saat itu, Whitney masih berjuang melawan narkoba,” katanya. Brown dan Houston menikah pada tahun 1993 dan mengalami guncangan hebat dalam

kehidupan rumah tangga mereka. Hal itu diduga akibat pengaruh alkohol dan narkoba, serta kekerasan dalam rumah tangga. Pada 2007, mereka akhirnya bercerai. (ant)

Tulisa Contostavlos/

Tulisa Contostavlos Perempuan Terseksi PENYANYI sekaligus aktris asal Inggris, Tulisa Contostavlos, dinobatkan sebagai Sexiest Woman in the World, versi majalah FHM sebagaimana diberitakan Dailymail. Tulisa bahkan mengalahkan Cheryl Cole dan Mollie King untuk gelar perempuan terseksi sedunia tersebut. FHM menampilkan pelantun N-DUbz dengan penghargaan diberikan untuknya pada sebuah gala diselenggarakan di Proud Cabaret Club, London. Perempuan berusia 23 tahun ini mengatakan bahwa hal tersebut merupakan penghargaan paling membanggakan dari seluruh penghargaan pernah diraihnya. “Terima kasih untuk semua telah memilih saya. Ini merupakan sebuah penghargaan dan hal paling indah untuk meningkatkan kepercayaan diri saya,” ujar Tulisa. Kepada Dailymail, Tulisa juga mengatakan bahwa dia bangga menjadi dirinya sendiri tanpa harus mengurangi atau menambah sesuatu yang ada pada dirinya. Cheryl Cole juga merupakan juri dari acara X Factor mendapat posisi runner-up untuk World’s sexiest Woman. Penyanyi Rihanna berada di posisi ketiga. Katy Perry sebelumnya menduduki posisi kedua, kini merosot ke posisi enam. Mila Kunis mendapatkan posisi tujuh. FHM pun menobatkan adik dari Duchess Of Cambridge, Pippa Middleton berada di posisi 11, sementara sang kakak Kate Middleton menduduki posisi 32. Namun, dari seluruh daftar perempuan terseksi di dunia, yang paling mengejutkan adalah posisi aktris Jennifer Aniston berada di angka 79. (ant)



WASPADA Sabtu 5 Mei 2012

Arena Spesial Wembley LONDON (Waspada): Final Piala FA 2012 dapat menjadi arena spesial bagi ‘orang-orang canggung’ di Stadion Wembley, ketika Andy Carroll dan Fernando Torres mengincar penebusan setelah musim yang berat di Liverpool dan Chelsea. Carroll dan Torres terlibat transfer paling dramatis sepanjang sejarah Liga Inggris, Januari 2011 lalu. Saat Torres dibeli The Blues dengan bandrol 50 juta pound dari Liverpool, Carroll menggantikan posisinya dengan harga 35 juta pounds dari Newcastle United. Torres, salah satu penyerang terbaik di dunia dalam beberapa tahun terakhir, sempat menderita di Stamford Bridge. Striker Spanyol itu menghabiskan 1.541 menit bermain tanpa torehan satu gol pun, sampai kemudian mencetak dua gol saat Si Biru menang 5-2 atas Leicester City

di perempatfinal Piala FA. Carroll juga tidak mampu membuktikan kelayakan sebagai pemain Inggris termahal sepanjang sejarah. Bahkan, banyak pihak menilai The Kop membuang-buang uang dengan mendatangkan bomber berumur 23 tahun tahun tersebut. Namun dia mencetak gol penentu kemenangan saat The Reds menyingkirkan Everton 2-1 di semifinal. Kenny Dalglish, manajer Liverpool, pun tak kenal lelah mendukung kebangkitan penyerang jangkung itu. “Semua orang berhak ber-


MU Tanpa Welbeck LONDON (Antara/Reuters): Manchester United tidak bisa dibela striker Danny Welbeck (foto) saat menjamu Swansea City pada matchday 37 Liga Premier, Minggu (6/5). Welbeck mesti istirahat, setelah mengalami cedera pergelangan kaki ketika MU ditaklukkan saingan beratnya Manchester City 1-0 di Etihad Stadium, Senin lalu. Manajer MU Sir Alex Ferguson juga mengumumkan, bek Jonny Evans belum pulih setelah absen di markas Citizens. Namun Ferguson tetap gembira menyambut kedatangan Swansea, yang menghuni peringkat 12 di klasemen sementara. “Swansea bermain musim ini dengan menakjubkan. Pelatih (Brendan Rodgers) amat kuat dengan prinsipnya dan mereka tampil secara fantastis,” ucap Sir Fergie.

Distribusi Juara Piala FA 11 Manchester United 10 Arsenal 8 Tottenham Hotspur 7 Aston Villa, Liverpool (1964–1965, 1973–1974, 1985–1986, 1988–1989, 1991–1992, 2000–2001, 2005–2006) 6 Newcastle United, Blackburn Rovers, Chelsea (1969–1970, 1996–1997, 1999–1900, 2006–2007, 2008–2009, 2009–2010) 5 Manchester City, Everton, West Bromwich Albion, Wanderers 4 Bolton Wanderers, Sheffield United, Wolverhampton Wanderers 3 Sheffield Wednesday, West Ham United 2 Bury, Nottingham Forrest, Old Etonians, Preston North End, Sunderland, Portsmouth 1 Barnsley, Blackburn Olympic, Blackpool, Bradford City, Burnley, Cardiff City, Charlton Athletic, Clapham Rovers, Coventry City, Derby County, Huddersfield Town, Ipswich Town, Leeds United, Notts County, Old Carthusians, Oxford University, Royal Engineers, Southampton, dan Wimbledon. opini, tapi jika Anda ingin menjadi pemain hebat, Anda mesti melalui masa-masa penuh emosi dalam karir sepakbola Anda. Bagian tersebut adalah saat Anda harus bangkit dari kritikan,” jelas Dalglish, seperti dilansir Reuters, Jumat (4/5). Hanya saja, Dalglish tentu riskan menjadikan Carroll sebagai starter melawan The Blues malam nanti di Wembley. Luis Suarez masih menjadi prioritasnya, sehingga King Kenny menyimpan striker Uruguay itu beserta kapten Steven Gerrard saat Si Merah dipecundangi Fulham 0-1 pada laga Liga Premier di Anfield, Selasa lalu. Begitu pula halnya Torres. Roberto Di Matteo, caretaker manajer Chelsea, sudah memainkan full time mantan striker Atletico Madrid itu ketika Si Biru dipermalukan Newcastle 0-2 di Stamford Bridge, Rabu lalu. Dengan formasi 1-4-2-3-1 yang sangat digemari pelatih asal Italia tersebut, jatah striker tunggal di garis serang London Blues kemungkinan menjadi milik Didier Drogba. Aksi penyerang Pantai Gading itu, sepertinya bakal kembali didukung Frank Lampard dan Juan Mata. Mereka bertiga

sengaja disimpan Di Matteo saat menjajal The Magpies, supaya prima melawan Merseyside Merah. Sedangkan lini belakang, komandonya tak akan lari dari bek John Terry. “Selalu luar biasa untuk menjadi kapten dan mengangkat trofi diWembley. Kami sangat menyukainya, kami tentunya akan bermain dengan penuh semangat di Wembley,” tekad Terry. Selama membela Chelsea, kapten Terry beserta Lampard, Drogba, Michael Essien, Ashley Cole dan kiper Petr Cech, sudah tiga kali mengangkat trofi FA Cup pada 2006–2007, 2008–2009, 2009–2010. “Kami mempunyai dua hari untuk menjernihkan pikiran, melupakan tentang partai Newcastle dan mempersiapkan diri kami untuk duel spesial,” ucap Cech, kiper utama Chelsea asal Ceko. “Chelsea dan Wembley punya hubungan spesial. Kami memiliki hampir selalu meraih kemenangan (di Wembley) dan saya harap itu akan berlanjut. Liverpool pernah mengalahkan kami dua kali musim ini, semoga itu tidak akan terjadi untuk ketiga kalinya,” tambah Cech. (m15/ant/rtr/uefa)

Magpies Penentuan Silva Cs LONDON ( Wa s p a d a ) : David Silva, winger lincah Manchester City, menegaskan kemenangan atas Newcastle United pada matchday 37 Liga Premier, Minggu (6/5), menjadi ‘harga mati’ bagi The City. “Kami tahu kami mesti menang (di Newcastle). Secara mental, kami siap memenangkannya, kami melakukan itu dan kini kami harus terus berkonsentrasi dengan pekerjaan,” klaim Silva melalui Dominion Post, Jumat (4/5). Kemenangan atas The Magpies di St James Park, otomatis akan melempangkan jalan Citizens untuk merebut gelar liga musim ini. Silva cs kini memimpin klasemen, hanya dengan keunggulan selisih gol di atas Manchester United. “Kami juga harus memenangkan kompetisi, sehingga kemenangan atas Newcastle

menjadi berarti,” tambah Silva, yang menjadi pemain pengganti ketika City menekuk Newcastle 3-1 pada jumpa pertama musim ini di Etihad Stadium. Laga lawan Toon Army memang bagaikan partai penentuan gelar bagi pasukan Roberto Mancini, sebab setelah itu mereka akan bertindak sebagai tuan rumah bagi tim papan bawah Queens Park Rangers. Sadar akan vitalnya lawatan The Eastlands di St James Park, manajer MU Sir Alex Ferguson pun ikut-ikutan memompa semangat anak-anak Magpies. “Mereka (City) mesti menang di kandang Newcastle, laga akhir pekan ini akan menjadi tantangan terberat mereka. Anda tahu sendiri, Newcastle selalu sulit ditundukkan di kandang dan perjalanan mereka musim ini terbilang bagus,” papar Sir Fergie. “Secara mengejutkan mereka kalah dari Wigan dengan empat gol tanpa balas, tapi mereka mampu bangkit dan


WINGER City David Silva menargetkan kemenangan di Newcastle. menang 2-0 di kandang Chelsea,” tambah pelatih asal Skotlandia itu dalam Daily Mail. MichaelWilliamson dan kawan-kawan diyakini Ferguson bakal meneruskan tren kemena-

Podolski Vital Lawan Bayern BERLIN (Antara/AFP): Lukas Podolski (foto), yang musim depan akan membela Arsenal, berharap bugar untuk membantu FC Koeln memenangkan laga melawan mantan klubnya, Bayern Munich. Kemenangan pada partai pamungkas Bundesliga, Sabtu (5/5) ini, sangat vital bagi Koeln, karena bakal memberi nafas untuk bertahan di divisi teratas Liga Jerman tersebut.


Klasemen Liga Premier Man City Man United Arsenal Tottenham Newcastle Chelsea Everton Liverpool Fulham West Brom Sunderland Swansea Stoke City Norwich Aston Villa Wigan QPR Bolton Blackburn Wolves

36 26 5 5 88-27 36 26 5 5 86-33 36 20 6 10 68-44 36 19 8 9 63-40 36 19 8 9 55-46 36 17 10 9 62-41 36 14 10 12 47-39 36 13 10 13 43-38 36 13 10 13 46-48 36 13 7 16 41-47 36 11 12 13 44-43 36 11 11 14 43-49 36 11 11 14 34-50 36 11 10 15 47-63 36 7 16 13 36-50 36 9 10 17 38-60 36 9 7 20 40-63 36 10 4 22 42-73 36 8 7 21 47-75 36 5 9 22 38-79

83 83 66 65 65 61 52 49 49 46 45 44 44 43 37 37 34 34 31 24

Podolski tidak ikut berlatih karena sakit perut, kemarin, namun pelatih Frank Schaefer yakin penyerang Timnas Jerman itu dapat dimainkan. Peran Podolski sangat vital, sebab FC Hollywood tak akan melepas laga ini kendati sudah tak berpengaruh lagi bagi mereka. “Bayern tidak akan memberi kami sesuatu secara gratis. Mereka akan memainkan tim terbaiknya, kami mesti memberikan segalanya,” papar Podolski. “Kami harus mempertahankan penguasaan (bola) dan berjuang keras. Kami harus ingat bagaimana kami mengalahkan mereka 3-2 pada musim lalu di kandang,” kenang bomber berumur 26 tahun tersebut. Koeln tidak dapat finish lebih tinggi dari peringkat 16. Namun skuad Schaefer wajib mempertahankan posisi tersebut, supaya bisa memainkan dua partai playoff melawan tim peringkat ketiga divisi dua, taruhannya satu jatah di Bundesliga.

Sabtu, 5 Mei


Minggu, 6 Mei


Arsenal vs Norwich City 11:45 *Global TV mulai pkl 18:45 WIB

Newcastle vs Man City 12:30 Aston Villa vs Tottenham 13:00 *Global TV mulai pkl 20:00 WIB Bolton vs West Bromwich 13:00 Fulham vs Sunderland 13:00 QPR vs Stoke City 13:00 Wolves vs Everton 13:00 Man United vs Swansea 15:00 *MNCTV mulai pkl 22:00 WIB

Senin, 7 Mei

Blackburn vs Wigan

(GMT) 19:00

Pencetak Gol Terbanyak 28 Robin van Persie (Arsenal) 26 Wayne Rooney (MU) 22 Sergio Aguero (Man City) 16 Ayegbeni Yakubu (Blackburn) 16 Demba Ba (Newcastle) 16 Clint Dempsey (Fulham)

Klasemen La Liga Real Madrid Barcelona Valencia Malaga Levante Atletico Mallorca Bilbao Osasuna Sevilla Real Betis Getafe Espanyol Sociedad Granada Villarreal Vallecano Zaragoza Gijon Santander

36 30 4 2 115-30 94 36 27 6 3 108-27 87 36 16 10 10 58-43 58 36 16 7 13 52-51 55 36 15 7 14 51-49 52 36 13 11 12 50-45 50 36 13 10 13 40-42 49 36 12 12 12 49-49 48 36 11 15 10 39-59 48 36 12 10 14 42-44 46 36 13 7 16 44-52 46 36 12 10 14 40-49 46 36 12 9 15 45-51 45 36 11 11 14 45-51 44 36 12 6 18 34-53 42 36 9 14 13 39-51 41 36 12 4 20 50-68 40 36 10 7 19 32-60 37 36 9 7 20 40-67 34 36 4 15 17 25-57 27

ngannya. Terutama karena faktor ketajaman striker Papiss Demba Cisse, yang memborong dua gol kemenangan Magpies atas The Blues di Stamford Bridge. “Jika punya striker seperti Cisse, tim Anda akan mudah memenangi laga. Jadi performa Newcastle patut diwaspadai,” pungkas Ferguson. (m15/okz/dm)


KAPTEN Liverpool Steven Gerrard, bentrok lagi dengan punggawa Chelsea Frank Lampard (kanan) dan John Terry (kiri), rekannya di Timnas Inggris.

“Saikua Tabang Saikua Lapeh” FRANK Lampard dan Meireles menit 78. Juga Didier Drogba dan Steven Gerrard, sengaja diJuan Mata untuk menggan-tikan posisi Florent simpan pada laga pertengahan Malouda dan Daniel Sturridge di babak kedua. pekan kemarin di Liga PreTetapi, bak syair “saikua tabang saikua mier. Akibatnya fatal, Chellapeh”, pengorbanan Chelsea ternyata siasea dan Liverpool, menjadi sia. Mereka pecundang, tiket Liga Champions pecundang di kandang senpun ‘terbang’ dari jangkauan. Fernando Torres diri. cs sekarang empat angka di bawah Tottenham Di Stamford Bridge, London, Rabu (2/ dan Newcastle, yang menghuni peringkat 5), Lampard baru diturunkan menit 78 mengempat dan lima, padahal Liga Premier hanya gantikan Raul Meireles saat Si Biru dipermamenyisakan dua matchday. lukan Newcastle 0-2 lewat gol yang diborong Fokus bercabang sebagaimana dimaksud Papiss Demba Cisse. Nurseha, Si Perkutut Minang, lewat lagunya Di Stadion Anfield, Liverpool, Selasa (1/ berjudul “Ayam Den Lapeh” tersebut, bisa 5), Gerrard bahkan sama sekali tak masuk berdampak pula pada lepasnya kemenangan line-up ketika Si Merah menyerah 0-1 dari di partai berikutnya. Catatan Fulham melalui gol bunuh diri Martin Skrtel. “Saikua tabang saikua lapeh” makin rawan Jonny Ramadhan Silalahi Sasarannya jelas dan tegas. Dua gelandang mendera The Blues, sebab The Reds justru top Inggris itu diharapkan mencapai performa (Redaktur Olahraga Waspada) sangat tegas sekaligus fokus dalam urusan puncak dalam duel Chelsea versus Liverpool rotasi dan mutasi. Pasca menggunduli tuan di final Piala FA, yang ikut ditayangkan langsung MNCTV malam rumah Norwich City 3-0 lewat hatrik Luis Suarez pada 28 April, ini mulai pkl 23:15 WIB. Si Merah menyimpan sebagian besar punggawa andalannya Tiada kemenangan tanpa pengorbanan, begitulah prinsip ketika disambangi Fulham. dasar olahraga terutama sepakbola. Suatu tim tak akan mungkin Line-up The Kop melawan The Cottagers, sama sekali tanpa memaksakan 11 pemain terbaiknya untuk terus bertarung Gerrard, Suarez, Craig Bellamy, Jamie Carragher, Daniel Agger, maksimal, setiap kali dibenturkan dengan jadwal padat dan bahkan kiper Pepe Reina. Manager Kenny Dalglish juga hanya vital. memainkan Stewart Downing dan Jose Enrique sebagai Barcelona dan Real Madrid, contoh terbaik dari kebenaran pengganti di babak kedua bagi Jordan Henderson dan Fabio hipotesa dimaksud. Kedua klub raksasa Spanyol itu out dari Aurelio. Liga Champions, karena tak sudi menghemat energi amunisi King Kenny memang bisa sesukanya, mengingat Andy terbaiknya saat semifinal home and away menjepit agenda Carroll cs tidak punya target di Liga Premier. Zona Liga Chamlaga el clasico. pions tak mungkin ditembus, sedangkan tiket Liga Europa Roberto Di Matteo (caretaker manajer Chelsea) dan Jupp sudah dikantongi setelah sukses menjuarai Piala Liga Inggris. Heynckes (pelatih Bayern Munich), sukses memaksimalkan FA Cup pun menjadi sasaran utama Merseyside Merah ketakutan serta kentalnya rivalitas Barca-Real. Rotasi delapan musim ini, beda dengan London Biru yang masih terbelenggu pemain di liga domestik dalam jepitan semifinal dua leg Liga kemilau UEFA Champions League. Anfield Gank sudah Champions, menghasilkan tiket final bagi London Blues dan mematangkan segala persiapan dan lebih dahulu pula berjaya The Bavarians di Allianz Arena, 19 Mei mendatang. di kompetisi sepakbola tertua sejagad raya, yang digelar sejak Kini, Di Matteo yang terjebak dilema. Rotasi dan mutasi 1871-1872 tersebut. memang telah dia lakukan jelang melawan The Pool diWembley, Didirikan pada 15 Maret 1892, Liverpool pertama kali namun terkesan masih ‘malu-malu kucing’. merajai Piala FA musim 1964-1965. The Kop kini sudah Hanya bek Ashley Cole yang menikmati istirahat total saat mengoleksi tujuh trofi, dan yang terakhir pada 2005-2006 saat menjamu Newcastle, setelah bek kiri Inggris itu tampil penuh ditangani pelatih Gerard Houllier. ketika Chelsea menggasak QPR 6-1 di Stamford Bridge, 29 Biru yang berdiri tahun 1905, baru mampu menjuarainya April lalu. musim 1969-1970, lima tahun setelah sukses Merah. Koleksi Pilar Biru lainnya, semua merasakan minute play. Kans trofi Blues sejauh ini masih enam, namun perjuangan untuk yang masih terbuka untuk menembus zona Liga Champi- menambahnya ibaratkan nyanyian “Sikua capang sikua capeh... ons, sepertinya membuat Di Matteo merasa sayang ‘merelakan’ Saikua tabang saikua lapeh... Tabanglah juo nan karimbo... tiga angka kepada The Magpies. Ai lah malang juo....” Dia pun memaksakan Lampard masuk menggantikan Raul *****

Granada Beruntung Jamu Real


TOP skor Real Madrid, Cristiano Ronaldo, memburu gol di Estadio Los Carmenes.

Sabtu, 5 Mei

Ath Bilbao vs Getafe Atl Madrid vs Malaga Barcelona vs Espanyol Mallorca vs Levante Osasuna vs Sociedad Zaragoza vs Santander Sevilla vs Vallecano Gijon vs Real Betis Valencia vs Villarreal Granada vs Real Madrid *tvOne live pkl 02:00 WIB

(GMT) 19:00 19:00 19:00 19:00 19:00 19:00 19:00 19:00 19:00 19:00

Pencetak Gol Terbanyak 46 44 23 22 20 17 17

Lionel Messi (Barcelona) Cristiano Ronaldo (Madrid) Radamel Falcao (Atletico) Gonzalo Higuain (Madrid) Karim Benzema (Madrid) Fernando Llorente (Bilbao) Roberto Soldado (Valencia)

Klasemen Liga Seri A Juventus AC Milan Napoli Udinese Lazio Inter Milan AS Roma Parma Bologna Catania Atalanta* Chievo Siena Palermo Cagliari Fiorentina Genoa Lecce Novara Cesena

36 21 15 0 63-19 36 23 8 5 70-28 36 15 13 8 64-43 36 16 10 10 48-35 36 16 8 12 51-46 36 16 7 13 53-50 36 15 7 14 55-50 36 13 11 12 51-53 36 12 12 12 39-42 36 11 14 11 45-48 36 13 13 10 40-38 36 11 12 13 30-41 36 11 11 14 44-41 36 11 9 16 48-56 36 10 12 14 37-44 36 10 12 14 36-43 36 10 9 17 48-67 36 8 12 16 40-54 36 6 11 19 31-63 36 4 10 22 22-54

78 77 58 58 56 55 52 50 48 47 46 45 44 42 42 42 39 36 29 22

MADRID (Waspda): Granada beruntung saat menjamu Real Madrid dinihariWIB nanti, karena tim tamu berkunjung dalam suasana penuh suka cita setelah memastikan trofi ke-32 La Liga Primera. El Real akibatnya diragukan bermain ngotot, karena duel di Estadio Los Carmenes sudah tidak menentukan lagi bagi pasukan Jose Mourinho. Pasca memukul Athletic Bilbao 3-0 di San Mames, Rabu lalu, Los Blancos otomatis memu-tus dominasiBarcelona,yangdalamtigamusimterakhir selalu menjadi jawara bersama Pep Guardiola. “Sudah gila (mengingat) berapa banyak poin yang mampu kami raih. Kami telah bermain sepakbola berkualitas sangat tinggi, sekarang kami dapat menikmati apa yang kami capai,” ucap Mourinho, yang tiba di Santiago Bernabeuu pada 2010 dari Inter Milan. “Saya tahu seperti apa perayaan-perayaan nanti akan berlangsung, sebab saya telah memenangi tujuh kejuaraan liga,” tambah mantan

Sabtu, 5 Mei


Minggu, 6 Mei


Lecce vs Fiorentina 16:00 AS Roma vs Catania 18:45 *Indosiar live pkl 01:45 WIB Siena vs AC Parma Atalanta vs Lazio Bologna vs Napoli Cagliari vs Juventus Novara vs Cesena Palermo vs Chievo Udinese vs Genoa Inter vs AC Milan *Indosiar live pkl 01:45 WIB

10:30 13:00 13:00 13:00 13:00 13:00 13:00 18:45

Pencetak Gol Terbanyak 26 23 21 20 19 16

Zlatan Ibrahimovic (Milan) Edinson Cavani (Napoli) Antonio Di Natale (Udinese) Diego Milito (Inter Milan) Rodrigo Palacio (Genoa) German Denis (Atalanta)

pelatih Chelsea dan FC Porto tersebut. Dengan demikian, Granada yang belum aman dari perangkap degradasi, sangat memungkinkan ‘meminta’ setidaknya satu poin dari Iker Casillas cs. Namun rivalitas superstar Madrid Cristiano Ronaldo dengan mesin gol Barca Lionel Messi dalam perburuan gelar El Pichichi, bisa saja membuat keberuntungan Odion Ighalo cs jadi menguap begitu saja. Ronaldo kini mengoleksi 44 gol, dua bola di bawah kemasan Messi, yang dibantu penuh oleh rekan-rekannya untuk mencetak hatrik ketika El Catalan menggasak tamunya Malaga 4-1. Kini, bukan mustahil giliran Ronaldo yang dimanjakan Karim Benzema cs untuk membombardir gawang kiper Granada, Julio Cesar. Begitu pula kemungkinan yang berlaku di Camp Nou, saat El Blaugrana terlibat derbi melawan Espanyol. (m15/rtr/afp)

Klasemen Ligue 1 Montpellier Paris SG Lille Lyon Rennes St-Etienne Toulouse Bordeaux Evian TG Marseille AS Nancy Valencs Lorient SM Caen OGC Nice Ajaccio Stade Brest Dijon Sochaux Auxerre

35 22 7 6 63-33 35 20 10 5 66-37 35 19 11 5 65-37 34 18 5 11 56-44 35 16 9 10 48-39 35 16 8 11 45-39 35 15 9 11 36-31 35 13 13 9 45-37 34 12 10 12 50-49 35 11 11 13 42-40 35 10 12 13 34-41 35 11 7 17 34-44 35 9 11 15 34-46 35 9 11 15 37-50 35 9 10 16 34-42 35 8 13 14 36-58 35 6 16 13 28-37 34 9 7 18 37-55 35 8 9 18 35-59 34 6 13 15 41-48

73 70 68 59 57 56 54 52 46 44 42 40 38 38 37 37 34 34 33 31

Minggu, 6 Mei


Senin, 7 Mei


Evian vs AC Ajaccio Lyon vs Stade Brest Valenciennes vs PSG Auxerre vs Bordeaux LOSC Lille vs Caen Lorient vs Dijon FCO Sochaux vs AS Nancy St Etienne vs Marseille Toulouse vs Nice Rennes vs Montpellier

15:00 15:00 19:15

17:00 17:00 17:00 17:00 17:00 17:00 19:00

Pencetak Gol Terbanyak 21 Olivier Giroud (Montpellier) 17 Anderson Nene (PSG) 17 Eden Hazard (Lille) 15 Lisandro Lopez (Lyon) 14 Pierre Aubameyang (Etienne) 13 Bafetimbi Gomis (Lyon) (jonny/espn/uefa)

Sport A11 Ayam Kinantan Gagal Lagi

WASPADA Sabtu 5 Mei 2012

BALIKPAPAN (Waspada): Kebobolan lebih dulu, tuan rumah Persiba Balikpapan justru berbalik unggul atas PSMS Medan dalam lanjutan Indonesian Super League (ISL) di Stadion Persiba, Jumat (4/5).

Waspada/Austin Antariksa

PENYERANG muda PSMS Medan, Yoseph Nico Malau (19), tertunduk lesu setelah timnya kalah dari Persiba Balikpapan dalam lanjutan ISL di Stadion Persiba, Jumat (4/5).

Pelatih Persiba, Peter Butler, tampaknya memberikan kesempatan kepada tim tamu untuk mengambil inisiatif serangan. Hal ini langsung dimanfaatkan PSMS yang dibesut Suharto AD. Peluang dibuat Ayam Kinantan sebelum laga menginjak menit 10 lewat penyerang mudanya, Yoseph Nico Malau. Sembilan menit kemudian, gol pembuka dicetak PSMS lewat tendangan bebas Nastja Ceh. Dalam satu skema serangan kiper Made Wirawan terkecoh oleh pergerakan Osas Saha yang

Indonesia Loloskan Empat Semifinalis JOHOR BAHRU, Malaysia (Waspada): Dua ganda campuran Indonesia melangkah ke semifinal Malaysia Terbuka GP Gold di Stadion Bandaraya Johor Bahru, Jumat (4/5). Setelah RikyWidianto/Puspita Richi Dili, kini giliran Fadhilah Irfan/Anggraini Weni menyusul. Pada perempatfinal turnamen berhadiah 120 ribu dolar AS tersebut, Irfan/Weni menang 22-20, 17-21, 21-16 atas pasangan tuan rumah Abdul Latif Mohd Razif/Anscelly Amelia Alicia.

Di semifinal, Irfan/Weni akan menantang unggulan kedua Danny Bawa Chrisnanta/ Neo YuYan Vanessa (Singapura) yang mengungguli Kang Ji Wook/Lee So Hee (Korsel) 21-18, 21-8. Sebelumnya, Riky/Puspita memastikan tiket semifinal dengan mengandaskan Dae Eun Kim/A Ra Ko (Korsel) 21-19, 2113. Untuk lolos ke partai puncak, Riky/Puspita harus mampu melewati hadangan unggulan pertama asal Malaysia, Peng Soon Chan/Liu Ying Goh.

Selain dua ganda campuran tersebut, Indonesia meloloskan dua wakilnya di sektor tunggal putra. Kedua tunggal itu adalah Tommy Sugiarto dan Sony Dwi Kuncoro. Tommy mengawali sukses dengan mengalahkan unggulan ketujuh Sourabh Varma (India) 21-17, 21-14. Sementara itu, Sony melewati rintangan berat di perempatfinal. Dalam pertandingan berdurasi 1 jam 16 menit, Sony menang rubber set 21-16, 22-24, 21-15 atas unggulan kelima Takuma Ueda (Jepang).

TC Timnas U-22 Pindah Ke Medan JAKARTA (Waspada): Kabar gembira mengembus pesepakbola muda berbakat di Sumut menyusul keputusan PSSI di bawah kendali Ketua Umum Djohar Arifin Husin, memindah pemusatan latihan (TC) Timnas U-22 dari Yogyakarta ke Kota Medan. Menurut Djohar, setidaknya ada tiga alasan pemusatan latihan timnas yang diproyeksikan tampil di Pra Piala Asia di Pekanbaru, 23 Juni mendatang, serta SEA Games 2013 di Myanmar, dipindahkan ke Medan.

“Pertama, ada banyak fasilitas lapangan yang bisa digunakan untuk berlatih. Kedua, untuk melakoni ujicoba tidak begitu sulit, karena banyak tim yang bisa dijadikan lawan tanding, dan terakhir biaya dan akses ke luar negeri relatif lebih murah,” kata Djohar kepada Waspada di ruang kerjanya, Jumat (4/5). Ditambahkan, karena untuk proyeksi jangka panjang, sudah semestinya persiapan anak asuh duet pelatih Aji Santoso dan Widodo Cahyono Putra itu

Ibra Dendam Inter.... (Lanjutan dari hal.1)

Ingatan akan kekalahan menyakitkan itu, kembali mengusik ingatan Ibra jelang Derby Della Madonnina edisi 291 pada giornata 37 Liga Seri A besok malam di Giuseppe Meazza, nama lain San Siro saat I Nerazzurri yang berstatus tim kandang. “Tidak ada tim yang bermain dengan performa terbaik setiap pekan. Kami kalah karena Inter waktu itu hanya bisa bertahan dan bertahan,” kenang Ibra, seperti dikutip dari Tribal Football, Jumat (4/5). Dendam pun akan dia lampiaskan, kali ini malah menjadi ‘harga mati’ bagi I Rossoneri. Sebab hanya dengan kemenangan atas La Beneamata, anak asuh alenatorre Massimiliano Allegri bisa bersaing terus dengan Juventus dalam perebutan Lo Scudetto 2011/2012. Milan dengan koleksi nilai 77, kini hanya minus satu angka di bawah Bianconeri, setelah hasil mengejutkan pada giornata 36, Rabu lalu. Skuad Allegri mengatasi Atalanta 2-0, sebaliknya Super Juve ditahan tim papan bawah Lecce 1-1 di Juventus Stadium. Sulley Muntari, gelandang Milan yang mencetak satu gol ke gawang Atalanta, optimis mampu merilis ambisi balas dendam striker asal Swedia itu. Tetapi gelandang Ghana ini tidak berani menyinggung langsung Wesley Sneijder cs, karena dirinya masih berstatus pemain pinjaman dari Inter. “Kami tim hebat dan kami akan mendapatkan tempat teratas (scudetto), karena kami yakin untuk melakukannya. Kami punya dua partai sisa dan saya berdoa untuk mengambil-alih tempat mereka (Juve) di klasemen,” tutur Muntari. Namun hasrat Ibra dan Muntari, terbentur dengan kepentingan lain dari La Beneamata. Jika Milan ngotot untuk mempertahankan gelar, Inter justru nafsu memburu tiket Liga Champions musim depan dengan menduduki posisi ketika di klasemen akhir Seri A. “Kami tidak bisa menunggu untuk kembali ke jalur kemenangan. Kami ingin melakukan itu secepatnya, dimulai pada pertandingan Minggu melawan Milan,” ujar Andrea Stramaccioni, caretaker pelatih Si Biru Hitam. Kebutuhan untuk membungkam Si Merah Hitam bahkan makin vital bagi Javier Zanetti cs, setelah mereka dipecundangi Parma 3-1, Rabu lalu di Ennio Tardini. “Ini merupakan pertandingan akbar bagi saya. Kami telah mempersiapkan untuk derbi, Anda bisa melihat kebangkitan itu di mata para pemain saya,” tegas Strama. *Jonny Ramadhan Silalahi

Problem Catur


Putih melangkah, mematikan lawannya enam langkah.

Jawaban di halaman A2 8







1 A





harus lebih baik. Apalagi, event terdekat yang dihadapi di Pekanbaru akan diikuti Australia, Jepang, Singapura, Timor Leste, Makau, dan Indonesia sebagai tuan rumah. “Karena itu, Kota Medan sangat tepat untuk menggelar pemusatan latihan. Ini pun sudah mendapat persetujuan dari Komite Eksekutif (Exco) PSSI. Sehingga paling lambat usai melakoni beberapa kali ujicoba di Yogyakarta, TC Timnas U-22 sudahkitapindahkan,”sebutDjohar. Dengan berpindahnya tempat TC ke Medan, Djohar berharap bisa dimanfaatkan dengan baik oleh pemain di Sumut maupun sekitarnya seperti Aceh. Dikatakan, tidak tertutup kemungkinan ada pemain dari daerah setempat yang dipanggil bergabung seusai menjajal kekuatan timnas U-22 di laga ujicoba. “Harapan saya, dengan berpindahnya pemusatan latihan Timnas U-22 ke Medan, ada pemain Sumut maupun sekitarnya yang terpantau. Jadi, kesempatan besar tentunya bagi pemain Sumut untuk memperkuat timnas. Pasalnya, dalam setiap ujicoba yang akan dilakoni selama di Sumut sekaligus menjadi ajang mencari bibit pemain potensi yang ada,” pungkas Djohar. (yuslan)




Di babak empat besar pada Sabtu (5/5) ini, Sony akan bertemu unggulan keenam dan favorit tuan rumah, Muhammad Hafiz Hashim. Tampil selama 33 menit, Prannoy HS (India) dikalahkan 14-21, 20-22. Satu-satunya wakil Indonesia yang gagal lolos terjadi di tunggal putri. Pasalnya, unggulan keempat Aprilla Yuswandari kesulitan mengimbangi permainan pemain Thailand, Ongbumrungpan Busanan. Aprilla pun kalah 11-21, 14-21. (m33/tsw)

berusaha menyundul bola. Namun, Osas melepas bola untuk melapangkan laju eksekusi Ceh. PSMS nyaris menggandakan keunggulan pada menit 35. Lolos dari jebakan offside, Saha gagal memaksimalkan peluang emas karena terlalu berkon-

sentrasi menaklukkan kiper. Hal ini menjadikan striker asal Nigeria itu tidak melihat bek lawan yang menyusul sekaligus sukses menyapu bola. Tak lama kemudian, PSMS harus membayar peluang yang terbuang percuma. Lewat serangan balik, Shohe Matsunaga mencetak gol pertama bagi Persiba lewat tendangan keras di dalam kotak terlarang hasil menyambut umpan silang Supriyadi.

Tempo permainan meninggi hingga memasuki menit-menit akhir babak pertama. PSMS tetap agresif menekan pertahanan skuad Beruang Madu, tapi sebaliknya justru kebobolan untuk kedua kali. Di masa injury time, terobosan Ahmad Sembiring mampu dikonversi menjadi gol oleh Kenji Adachihara lewat tendangannya yang menaklukkan kiper Edi Kurnia. Usaha PSMS mencetak gol

penyama kian terpuruk setelah Kenji memperbesar keunggulan Persiba saat babak kedua baru berjalan lima menit. Unggul dua gol pun membuat Persiba tampil lepas hingga mengakhiri laga dengan poin penuh. Tambahan tiga poin membawa Persiba naik dua peringkat ke posisi keempat dengan 36 poin dari 22 laga, sementara PSMS tetap berada di posisi 13 dengan koleksi 25 angka hasil 23 pertandingan. (m33)

HRC Medan Tampilkan Pebalap Nasional MEDAN (Waspada): Honda Racing Championship (HRC) 2012 di Kota Medan, Minggu (6/5) besok, menampilkan aksi pebalap nasional Honda Owie Nurhuda (foto). Kehadiran pebalap asal Sumedang yang merajai kelas MP2 Seeded dan MP1 Seeded pada Seri II HRC 2012 di Kemayoran Jakarta pada 14-15 April 2012 tersebut, dipastikan menjadikan gelaran di Sirkuit IMI Sumut JlnPancing Medan, semakin menantang. Owie Nurhuda, akrab disapa Iwo, gabung tim Honda MS Nissin Top-1 KYT FDR Denso TDR, setelah sukses pada Seri I HRC 2012 di Kota Cimahi 24-25 Maret lalu. Menurut Min Hian, Technical Service Departement Manager CV Indako Trading

Co selaku main dealer Honda di wilayah Sumatera Utara, pihaknya sangat menyambut baik keikutsertaan Owie Nurhuda karena akan memacu semangat pebalap Sumut untuk unjuk kemampuan terbaik. “Kepiawaian Owie Nurhuda di lintasan balap memang sudah terbukti saat HRC 2012 di Jakarta. Tapi kami optimis, pebalap-pebalap andalan Sumut akan dapat mengimbanginya dengan tampil lebih maksimal,” klaim Min Hian di Medan, Jumat (4/5). Ajang HRC di Jl Pancing Medan, mempertandingkan tujuh kelas, yakni MP1-Honda Bebek 125 cc Tune Up Seeded, MP2-Honda Bebek 110 cc Tune Up Seeded, MP3-Honda Bebek 125 cc Tune Up Pemula, MP4Honda Blade 110 cc Tune Up

Pemula, Honda Supra X 125 cc Standar Pemula, Honda Blade 110 cc Standar Pemula, dan Honda Matik 130 cc Standar Terbuka. Medan merupakan kota ketiga dari rangkaian HRC 2012 yang menggebrak sembilan kota besar di Indonesia. Setelah Bandung, Jakarta, dan Medan, selanjutnya HRC dilanjutkan ke Kota Pati, Purwokerto, Kediri, Banjarbaru, Makassar, dan Denpasar. Leo Wijaya, Marketing Manager CV Indako Trading Co, mengungkapkan Honda Racing Championship pastinya menjadi ajang balap kebanggaan bagi masyarakat Sumatera Utara. “Lewat HRC, Honda berniat mengembangkan bakat dan kemampuan pebalap lokal agar

dapat berprestasi di tingkat nasional bahkan internasional. Ajang HRC juga akan menjadi ajang pembuktian bagi performa dan ketangguhan sepeda motor Honda di lintasan balap,” pungkas Leo Wijaya. (adv)

Kuda Laut Tatap Kejurda Tinju P. BRANDAN (Waspada): Sasana Kuda Laut Pangkalanbrandan terus menempa atletnya untuk diterjunkan pada Kejuaraan Daerah (Kejurda) Pertina Sumut di Samosir pada Juni mendatang. “Kami berharap nantinya petinju Kuda Laut dapat mengukir prestasi membanggakan di Kejurda. Kami terus memantapkan persiapan atlet dengan latihan rutin,” ujar Pelatih Tinju Kuda Laut, Anto Chanas, Jumat (4/5). Sebelumnya, lanjut Anto, pada Kejuaraan Piala Ketua Pertina Medan bulan April lalu, tiga petinju Kuda Laut berhasil meraih 2 medali emas, dan 1 perak. Medali emas dipersembahkan Eddy Santoso dan M Ramadhan, sedangkan perak oleh Eddy Syahputra. “Kita berharap prestasi tinju di Langkat kembali bangkit seperti di era tahun 1970-an, di mana saat itu Langkat banyak melahirkan petinju kelas nasional dan internasional seperti Krismanto dan RM Syahri,” katanya. (c01)

KONI Asahan Ungguli PS Seikopas KISARAN (Waspada): PS KONI Asahan berhasil menaklukkan tuan rumah PS Seikopas PTPN IV Kecamatan BP Mandoge 1-0 pada laga


ASKEP PTPN IV Sekopas, Ir Ketut Yana (kiri), memberi panel PS Seikopas kepada Ketua Umum KONI Asahan, Nurkarim Nehe, didampingi Sekretaris KONI Asahan Efi Irwansyah Pane sebelum laga eksibisi, Jumat (4/5).



eksibisi di Lapangan Mandoge, Jumat (4/5) Meski pertandingan diguyur hujan lebat, kedua tim tetap tampil ngotot. Namun hingga babak pertama berakhir, tak satu gol pun mampu dihasilkan kedua kubu. Keadaan itu membuat Pelatih PS KONI Asahan, Haris ST, mengubah strategi dengan menurunkan Ketua Pengkab PSSI Asahan, Wahyudi, untuk mempertajam lini depan bersama Ketua KONI Asahan Nurkarim Nehe dan Efi Irwansyah Pene. Sebaliknya, Askep PTPN IV Seikopas, Ir Ketut Yana, bersama Ketua SP Bun Raya Sitepu terus memompa semangat pemainnya dari pinggir lapangan. Perjuangan PS KONI Asahan akhirnya membuahkan hasil ketika tendangan indah Rio pada menit 58 bersarang di gawang PS Seikopas. “Pertandingan ini sangat seru. Kami berjanji akan membalas kekalahan ini pada laga eksibisi selanjutnya. Kegiatan ini sangat positif dalam membangkitkan semangat olahraga di Asahan dan para pekerja kebun,” ujar Raya Sitepu. (a15)

1. Orang yang ahli dalam bidang musik, seperti komponis, konduktor dsb. 4. Nama tenar penyanyi AS, wanita tercantik versi majalah People baru-baru ini. 7. Tape untuk memperbanyak rekaman. 8. Komposisi untuk permainan instrumen solo diiringi orkes atau piano. 10. Alat musik mirip piano. 12. Nyanyian untuk paduan suara. 15. ____Hermansyah, penyanyi. 16. Uji. 17. Cinta berahi (berasal dari nama dewa asmara Yunani), jadi lirik lagu latin. 18. Singkatan pornografi. 20. Tangga nada diatonik setelah do. 21. Singkatan Super Junior (grup penyanyi Korea). 22. Nada ke-4 tangga nada diatonik. 23. Polisi rahasia; Status inspektur dalam filem. 24. Alat musik sepasang gendang kecil. 26. Nama grup musik duo Mulan dan Maia. 28. Tunggal (menyanyi, main musik). 29. Perusahaan filem AS berlogo gunung dengan bulatan bintang.

Waspada/Riswan Rika

WALI KOTA Binjai HM Idaham SH dan Kapolres Binjai AKBP Musa Tampubolon senam bersama anggota TNI, Polri, dan Korpri di Lapangan Arhanudse II/BS, Jumat (4/5).

Muspida Binjai OR Bersama BINJAI (Waspada): Jajaran Muspida Kota Binjai melakukan olahraga senam bersama anggota TNI, Polri, dan Korpri di Lapangan Arhanudse II/BS, Jumat (4/5). Turut serta dalam kegiatan itu di antaranya Wali Kota Binjai HM Idaham SH MSi, Dandim 0203 Langkat Letkol (Arh) YP Girsang, dan Kapolres Binjai AKBP Musa Tampubolon. “Kegiatan olahraga harus ditingkatkan di Kota Binjai. Selain menjaga kebugaran tubuh, manfaat lain yang diperoleh adalah terciptanya silaturahim antara pimpinan instansi dan anggotanya, sehingga komunikasi terjalin dengan baik,” ujar Idaham. Seperti diketahui, olahraga senam bersama Muspida Binjai sudah dimulai sejak tiga tahun lalu, dengan tuan rumah ditunjuk secara bergantian. Selain senam, acara juga dirangkai dengan olahraga tenis dan bola voli. Danyon Arhanudse II/BS, Letkol Syaepul Mukti Ginanjar SIP, didampingi Pasi Intel, Kapten Arh Rimba Anwar, menyambut tamunya dengan berbagai kemeriahan. Tak ketinggalan grup band Arhanudse II/BS tampil menghibur. (a04)

Sudoku 10x10


1. Irama musik dan tarian dari Kuba; Nama es lilin. 2. Pengarah dalam pembuatan filem. 3. Nama bulan fiksi dalam filem Star Wars. 4. Cokelat (Inggris): Bobby_____, penyanyi mantan suami Whitney Houston. 5. Ya (Inggris), nama grup band Inggris show di Jakarta baru-baru ini. 6. Kucing (Inggris): ____Stevens, penyanyi Inggris kini bernama Yusuf. 9. Kelompok memainkan alat-alat musik secara bersama. 11. Irama. 12. Pemimpin pergelaran musik dengan isyarat tangan dan tubuh. 13. Tiga pemain/penyanyi. 14. Penyanyi bersuara antara sopran dan tenor. 17. Pergelaran musik menggunakan alat musik bambu dalam rak. 18. Pemuda penentang masyarakat mapan lewat musik dan bergaya rambut yang khas. 19. Media menyiarkan musik. 22. Penuh (Inggris). 23. Nada ke-1 tangga nada diatonik. 25. Kelompok. 27. Singkatan universitas di Medan pelajari etnomusikologi. 28. Tata; Atur.

Isi kotak kosong dengan angka 0 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 5x2 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu kurang dari 15 menit. Jawaban di halaman A2 kolom 1.


9 0 1 3 3 0 9 7 8 6 3 7 1 6 2 0 3 5 1 0 8 9 3 5 2 8 9 6 5 2




2 3 6 8


3 ****30




Desain Baru F2012 Belum Pas MUGELLO, Italia (Waspada): Setelah lama tertunda, niat Ferrari melakukan upgrade mobil F2012 akhirnya tuntas juga. Pada tes F1 tengah musim terakhir di Sirkuit Mugello, Kamis (3/5) malam, saluran pembuangan dan bodi belakang mesin direvisi. Ini merupakan langkah pertama dari perubahan besarbesaran yang direncanakan Ferrari. Setelah di Mugello, perubahan Ferrari berikut rencananya bakal dilakukan di Sirkuit Catalunya pada GP Spanyol, 13 Mei mendatang. Sepanjang tes di Mugello, Felipe Massa menguji baling-baling pemutar baru di bawah hidung F2012. Setelah itu, giliran struktur bodi belakang mesin baru diuji oleh Fernando Alonso. Sayangnya, desain terkini F2012 tersebut belum sempurna karena Alonso sempat mengalami kecelakaan di hari ketiga. Alonso mengatakan desain ulang mobil F2012 harus memberikan perkembangan signifikan saat balapan di GP Spanyol pekan depan. Mobil juara dunia F1 dua kali ini didesain ulang di bagian belakang setelah dianggap tidak mampu bersaing dalam beberapa balapan terakhir. “Kami berada di kisaran 0,8-0,9 detik di belakang pebalap top dalam empat balapan terakhir. Karena itu, kami harus mengurangi ini secepatnya jika masih ingin bersaing merebut gelar musim ini,’’ katanya, Jumat (4/5).’ Sejauh ini, Alonso dinilai berhasil memanaskan kompetisi berkat keterampilannya mengendarai mobil sekalipun mobilnya dianggap tidak kompetitif. Untuk sementara, pebalap asal Spanyol ini bercokol di peringkat lima klasemen atau hanya 10 angka tertinggal dari juara bertahan andalan Red Bull, SebastianVettel. Dalam empat balapan terakhir, Ferarri lolos kualifikasi dengan posisitidakpernahtinggidariperingkatsembilandanselaluberjuang keras untuk lolos kualifikasi 10 pebalap terakhir saat lomba. Ferrari masih boleh bangga karena Alonso mencuri kemenangan di GP Malaysia ketika hujan mengguyur Sirkuit Sepang. (m33/auto)

COLORADO SPRINGS, AS (Waspada): Tim bola basket putra Amerika Serikat (AS) menambahkan Anthony Davis dan James Harden dalam daftar anggota tim Olimpiade 2012, setelah Derrick Rose (Chicago Bulls) dan Dwight Howard (Orlando Magic) cedera. Davis adalah pemain terbaik alias MVP tingkat perguruan tinggi di AS tahun ini dan diharapkan memuncaki draft pick rookie NBA pada Juni mendatang, setelah memimpin Universitas Kentucky lolos ke Kejuaraan NCCA pada April lalu di tahun pertamanya. Sementara itu, Harden adalah guard yang bermain untuk OklahomaCityThunderdanmenjadi unggulan di Wilayah Barat. Di musim regular atau ketiganya di NBA, Harden rata-rata mencetak 16,8 poin dan 4,1 rebound sepanjang 62 pertandingan. Penambahan Davis dan Harden membuat tim bola basket putra AS saat ini telah memiliki 18 kandidat pemain untuk Olimpiade 2012 di London. Awalnya, Rose dan Howard merupakan andalan tim Negeri Paman Sam merebut medali emas Olimpiade. Namun, Rose menderita cedera ligamen lutut pada laga pem-buka playoff dan harus operasi. Sedangkan Howard atau lebih dikenal dengan julukan Superman menepi dari persaingan musim ini diakibatkan mengalami cedera punggung. (m33/ap)

Sabtu 5 Mei 2012

Dallas Menanti Mukjizat

MOBIL Ferrari F2012 milik Fernando Alonso mengalami kerusakan dan terpaksa diangkut petugas Sirkuit Mugello dalam ujicoba F1 tengah musim, Kamis (3/5 malam.

Bintang NCAA Seleksi Dream Team


DALLAS, AS (Waspada): Meraih kekalahan ketiga dari rencana tujuh game yang dipertandingkan, juara bertahan Dallas Mavericks tinggal menanti mukjizat untuk bisa memperpanjang napas sekaligus mempertahankan gelar musim ini. Di game ketiga NBA Playoff, Jumat (4/5), Dallas tumbang 7995 dari Oklahoma City Thunder yang juga unggulan kedua Wilayah Barat. Kevin Durant kembali menjadi aktor kehancuran Dallas ketika sukses mem-

bukukan 31 angka dari Thunder. Hebatnya, Thunder tidak pernah tertinggal dari Dallas dari tiga laga yang sudah dilakoni. Kini, Dirk Nowitzki cs harus bekerja keras untuk dapat mengungguli Thunder pada game keempat di kandang, Minggu (6/5) besok. Selain Durant, Thunder juga dibantu oleh kontribusi trio RussellWestbrook, Serge Ibaka, dan James Harden. Westbrook total mencetak 20 angka, Ibaka menyumbang 10 poin 11 rebound dan Harden menambah 10 angka plus empat steal.

Nowitzki mendulang 17 angka dan sembilan rebound untuk menjadi top skor Dallas, sedangkan Jason Kidd mengoleksi 12 poin dan empat assist. Khusus Kidd, kekalahan timnya di ronde awal dapat memperkuat indikasi dirinya akan segera pensiun. Bila gagal merebut kemenangan nanti, Mavericks akan menyamai capaian Miami Heat kala menjadijuarabertahanyanglangsung tersingkir di babak pertama playoff. Kala itu, Miami kalah 0-4 dari Chicago Bulls di ronde awal padamusim2007setelahmengalahkan Dallas di NBA Final 2006.

Di Madison Square Garden, Miami Heat tinggal selangkah lagi lolos ke semifinal Wilayah Timur. Berkat aksi gemilang LeBronJames,Heatberhasilmengandaskan New York Knicks 87-70 untuk memperlebar keunggulan menjadi 3-0. Tampil di markas Knicks tidak memengaruhi performa LeBron sebagai bintang Heat. Selama 36 menit, LeBron mencatat 32 poin, delapan rebound, dan lima assist. Dalam laga ini, LeBron tidak bekerja sendirian karena didukung DwyaneWade dan Mario Chalmers. Bila Wade

mengemas 20 angka, maka Chalmers menorah 19 poin. Carmelo Anthony bermain cukup gemilang dengan membuat 22 angka buat Knicks. Pemain cadangan JR Smith meng-

hasilkan 12 poin dan Tyson Chandler yang baru saja menerima penghargaan “Pemain Bertahan Terbaik” musim ini menyumbang 10 poin 15 rebound. (m33/ap)

Sinyal Ancaman Dari Grosjean MUGELLO, Italia (Waspada): Juara bertahan F1, Sebastian Vettel, gagal memuncaki ujicoba tengah musim di Sirkuit Mugello, Kamis (3/5) malam. Sempat memimpin di sesi pagi,Vettel harus

rela terkena ‘asap’ Romain Grosjean yang menutup hari terakhir di puncak. PebalapLotus,RomainGrosjean (foto), melanjutkan penampilan gemilangnya, setelah mem-

bukukan waktu 1 menit 21.035 detik.Dilainpihak,Vettelyangjuga andalan Red Bull Racing hanya mencatat 1 menit 21.267 detik. Tepat di belakang driver asal Jerman itu ada Fernando Alonso. Pebalap Ferrari asal Spanyol ini meraih waktu 1:21.363. Tempat keempat diduduki Kamui Kobayashi (Sauber) disusul Daniel Ricciardo (Toro Rosso-Ferrari) untuk melengkapi top five. Sementara itu, MarkWebber (RedBull)mencuriposisikeenam. Di atas mobil RBR8, pebalap Australia itu mencatat 1:21.997 sekaligusberadadidepanSergioPerez (Sauber) dan Felipe Massa (Ferrari). Pelengkap peringkat 10 pesert terbaik adalah Nico Hulkenberg (Force India-Mercedes)

Hasil Akhir Tes Mugello AP

Romain Grosjean Sebastian Vettel Fernando Alonso Kamui Kobayashi Daniel Ricciardo Mark Webber Sergio Perez Felipe Massa Nico Hulkenberg Jean-Eric Vergne Pastor Maldonado Nico Rosberg Oliver Turvey Paul di Resta

dan driver Toro Rosso asal Prancis, Jean-Eric Vergne. Hasil buruk diraih duet Mercedes GP asal Jerman, Nico Rosberg dan Michael Schumacher. Bila Rosberg menempati posisi 12, maka Schumi harus puas merebut peringkat ke-16. Sementara itu,peringkatpalingakhirmenjadi milik driver Williams asal Brazil, Bruno Senna. Yang menarik pada tes hari terakhir ini adalah konsistennya performa mobil Lotus E20 yang dikemudi Grosjean dan perubahan Ferrari yang pertama kalinya melakukan upgrade pada mobil F2012.Upgradetersebutdilakukan timmekanikKudaJingkrakdengan harapanmampumengubahmusimFerrarimusimini. (m33/auto)

(Prancis/Lotus-Renault) (Jermany/Red Bull-Renault) (Spanyol/Ferrari) (Jepang/Sauber-Ferrari) (Australia Toro Rosso-Ferrari) (Australia/Red Bull-Renault) (Mexico Sauber-Ferrari) (Brazil/Ferrari) (Jerman/Force India-Mercedes) (Prancis/Toro Rosso-Ferrari) (Venezuela/Williams-Renault) (Jerman/Mercedes GP) (Inggris/McLaren-Mercedes) (Inggris/Force India-Mercedes)

1:21.035 1:21.267 1:21.363 1:21.603 1:21.604 1:21.997 1:22.229 1:22.257 1:22.325 1:22.422 1:22.497 1:22.579 1:22.662 1:23.002


HADANGAN dua pemain bertahan Dallas Mavericks berhasil diantisipasi oleh bintang Oklahoma City Thunder, Kevin Durant (tengah), dalam game ketiga NBA Playoff Wilayah Barat di Dallas, Jumat (4/5).

Sumatera Utara

WASPADA Sabtu 5 Mei 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:24 12:37 12:25 12:32 12:31 12:28 12:25 12:20 12:27 12:27

‘Ashar 15:43 15:55 15:44 15:50 15:50 15:49 15:44 15:40 15:47 15:45

Magrib 18:32 18:48 18:33 18:42 18:41 18:34 18:32 18:28 18:35 18:36



Shubuh Syuruq


19:43 19:59 19:44 19:53 19:52 19:44 19:43 19:39 19:46 19:47

04:46 05:57 04:47 04:52 04:52 04:53 04:47 04:43 04:49 04:47

04:56 05:07 04:57 05:02 05:02 05:03 04:57 04:53 04:59 04:57

L.Seumawe 12:30 L. Pakam 12:23 Sei Rampah12:22 Meulaboh 12:34 P.Sidimpuan12:22 P. Siantar 12:22 Balige 12:22 R. Prapat 12:19 Sabang 12:37 Pandan 12:23

06:14 06:25 06:14 06:19 06:20 06:20 06:15 06:11 06:17 06:15

Zhuhur ‘Ashar 15:48 15:43 15:42 15:53 15:42 15:42 15:42 15:39 15:55 15:44





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:40 18:31 18:31 18:43 18:27 18:30 18:29 18:26 18:48 18:30

19:51 19:42 19:42 19:54 19:38 19:41 19:40 19:36 19:59 19:40

04:50 04:45 04:44 04:55 04:46 04:45 04:46 04:43 04:56 04:48

05:00 04:55 04:54 05:05 04:56 04:55 04:56 04:53 05:06 04:58

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:23 12:25 12:35 12:27 12:24 12:31 12:20 12:30 12:23 12:22

18:30 18:32 18:45 18:34 18:33 18:40 18:27 18:38 18:29 18:30

19:40 19:43 19:56 19:45 19:44 19:52 19:38 19:49 19:40 19:41

04:48 04:48 04:54 04:51 04:46 04:52 04:42 04:52 04:47 04:44

05:58 05:58 05:04 05:01 04:56 05:02 04:52 05:02 04:57 04:54

Panyabungan 12:20 Teluk Dalam12:27 Salak 12:25 Limapuluh 12:21 Parapat 12:23 GunungTua 12:20 Sibuhuan 12:20 Lhoksukon 12:29 D.Sanggul 12:24 Kotapinang 12:18 AekKanopan 12:20

06:18 06:13 06:12 06:23 06:14 06:13 06:13 06:10 06:24 06:15

15:44 15:45 15:53 15:48 15:44 15:50 15:39 15:49 15:43 15:42

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:15 06:15 06:22 06:19 06:14 06:20 06:10 06:20 06:14 06:12

Zhuhur ‘Ashar 15:41 15:48 15:45 15:40 15:43 15:40 15:40 15:48 15:44 15:38 15:40




Shubuh Syuruq

18:25 18:32 18:32 18:29 18:30 18:26 18:25 18:39 18:30 18:24 18:27

19:36 19:43 19:43 19:40 19:41 19:37 19:36 19:51 19:41 19:35 19:38

04:46 04:53 04:49 04:43 04:46 04:45 04:45 04:49 04:47 04:42 04:43

04:56 05:03 04:59 04:53 04:56 04:55 04:55 04:59 04:57 04:52 04:53

06:13 06:20 06:16 06:11 06:13 06:12 06:12 06:17 06:15 06:10 06:11

Pemkab DS Tinjau Kembali KSO Dengan PDAM Tirtanadi Juli, Air PDAM Tirtadeli Mengucur Ke Bandara Kualanamu LUBUKPAKAM (Waspada): Pemkab Deliserdang akan meninjau kembali Kerjasama Operasional (KSO) dengan Perusahaan Daerah Air Minum (PDAM) Tirtanadi, demikian Wakil Bupati Deliserdang, H. Zainuddin Mars. Berbicara dengan wartawan, Kamis (3/5), Zainuddin Mars menyebutkan, peninjauan kembali KSO itu terkait air yang sempatkotordanberbaudikantor DPRD Deliserdang. “Salah seorang anggota dewan mempersoalkan tak layaknya air tersebut dan sudah menjadi pembahasan Pemkab Deliserdang,” sebut Zainuddin seraya tertawa dan geleng kepala. Zainuddin menegaskan, air yang mengalir itu adalah air dari PDAM Tirtanadi, bukan PDAM Tirtadeli.“Jadianehkalauanggota DPRD Deliserdang tidak mengetahui air yang dipakainya justru pasokan dari PDAM Tirtanadi, bukanTirtadeli.Terlebihlagi,Ketua F-PDIP dalam statemennya menyatakan agar Pemkab Deliserdang jangan memaksakan diri memasok air ke Bandara Kualanamu dan menyebutkan air ke gedung dewan merupakan pasokan PDAM Tirtadeli,” sebut Zainuddin. Begitu pun, Zainuddin mem-

benarkan adanya KSO antara Pemkab Deliserdang dengan PDAM Tirtanadi untuk beberapa kecamatan termasuk Lubukpakam, namun tidak termasuk Kec. Beringin yang menjadi lokasi Bandara Kualanamu. Zainuddin menegaskan, Pemkab Deliserdang dan PDAM Tirtadeli tidak memaksakan diri menjadi pemasok air ke Bandara Kualanamu, tapi sudah merupakan tanggungjawab. “Saat ini PDAM Tirtadeli sudah berbenah dengan mengganti direktur dan stafnya, bahkan akan lebih meningkatkanpelayanan.PDAM Tirtadeli di bawah pimpinan Wagito,sudahmelakukanlangkah positif bagi pemberdayaan. “Malahsekarangsiapmengambilalih pengelolaan air bersih di beberapa wilayah yang masuk dalamKSOdenganTirtanadidiKab. Deliserdang. Terkait pasokan air, sangatlebihdaricukup,jaditakada masalah,” paparnya. Ditanya soal utang Rp19 miliar ke Menteri Keuangan RI,

Giliran T. Amir Hamzah Binjai Dipadamkan BINJAI (Waspada): PLN Cabang Binjai terus melakukan perbaikan, sehingga di beberapa daerah dilakukan pemadaman. Humas PLN Binjai Safwan Wadjdi menjelaskan, Kamis (3/5), PLN Binjai melakukan pemasangsan konstruksi C5 dan konstruksi LBS, serta pergantian FCO yang rusak menjadi Plymer sebanyak 15 buah. Sebab itu, Sabtu (5/5) dilakukan pemadaman di rayon Binjai Kota Jalan T. Amir Hamzah mulai pukul 08:00 sampai 16:00. (a04)

Rekomendasi Izin Tak Diberi, Pengusaha Protes STABAT (Waspada): Salah seorang pemilik usaha tempat pengolahan kayu atau sawmill di Langkat menyesalkan kinerja Camat Bahorok yang tidak memberi rekomendasi izin HO atau segala sesuatu yang dapat menimbulkan gangguan alam sosial dan lingkungan, dalam kaitan perpindahan lokasi usaha tersebut. “Kita tidak paham apa maksud oknum camat tidak mengeluarkan rekomendasi, padahal seratusan warga di Bahorok telah membubuhkan tandatangan menyetujui sawmill tersebut. Ini hanya gara-gara satu orang yang keberatan dengan alasan yang tidak masuk akal,” kata Sri Wahna Kaban saat temu pers, Rabu (2/5). Adanya seorangyangtidaksetujumenurutWahnakarenadiasepertidiharuskan menyewa sebidang tanah milik orang tersebut. “Itu tidak mungkin karena saya juga memiliki lahan yang bersebelahan,’’ tuturnya. Menyikapi hal itu, secara terpisah Camat Bahorok Sekula Singarimbunyangdikonfirmasi,Kamis(3/5)mengatakan,rekomendasi belum diberikan karena ada seorang warga merasa keberatan. Permasalahan ini sebelumnya telah beberapa kali menempuh jalur musyawarah dibahas bersama Asisten Pemkab Langkat dan sejumlah aparatur terkait lainnya, namun belum ada hasil.(a03)

Enam Mesin Jackpot Disita STABAT (Waspada): Polres Langkat menyita enam mesin judi jackpot dari Kec. P. Brandan, Kec. Kuala dan dari salah satu rumah warga di Dusun III Kwala Bingai Stabat, Rabu (2/5) malam. Dikatakan Kasat Reskrim Polres Langkat AKP Aldi Subartono, tidak ada tersangka yang diamankan. Petugas turut menyita 380 koin sebagai barang bukti. Seorang ibu rumah tangga penerima mesin tersebut, SU, warga Kwala Bingai Stabat saat diperiksa polisi mengatakan mesin milik seorang pria warga Binjai. Di rumahnya hanya sebagai lokasi untuk bermain. Mengenai penghasilan yang diterima atas menyediakan tempat, SU enggan menjawab.(a03)

Pencuri Ranmor Diringkus TANJUNGMORAWA (Waspada): Mencuri sepedamotor yang sedang parkir di depan warung, seorang pemuda mocok-mocok, AS, 21, warga Dusun III, DesaTanjungmorawa B, Kec.Tanjungmorawa, Deliserdang, diringkus tim buser Polsek Tanjungmorawa, barubaru ini. Petugas juga mengamankan barang bukti sepedamotorYamaha Mio BK 6921 MAC. Tersangka diringkus berdasarkan pengaduan korban, Dina Anggriani, 20, warga Gang Ampi, Dusun III, Desa Tanjungmorawa B, yang melaporkan pencurian itu ke Mapolsek Tanjungmorawa. Kapolsek Tanjungmorawa AKP Telly Alvin, S.Ik bersama Kanit Reskrim Iptu Adi Alfian, Rabu (2/5), membenarkan dan AS sebagai tersangka curanmor dijerat pasal 363 KUHPidana, sedang tersangka lainnya E masih diburon.(c02)

Gadis 18 Tahun Tewas Ditabrak Truk PERBAUNGAN (Waspada): Gadis usia 18 tahun,Yoliana Pertiwi alias Ana, 18, warga Dusun II, Desa Kota Galuh, Kec. Perbaungan, Kab. Serdang Bedagai tewas akibat sepedamotornya ditabrak truk di Jalinsum Km 39-40, tepatnya di Lk.V, Kel. Tualang, Rabu (2/5) sekira pukul 11:30. Informasi dihimpun, siang itu korban dibonceng Dinda Nurul Iqlima, 17, mengendarai sepedamotor matic Honda Beat BK 2424 XAH sepulang jalan-jalan. Saat itu kondisi jalan macet, Dinda turun ke beram jalan.Tapi ketika bermaksud naik kembali, sepedamotornya ditabrak truk dari belakang. Akibatnya tubuh kedua gadis belia itu terhempas ke aspal, sedangkan Ana tewas di TKP dengan luka di tubuh dan bagian kepala, sedangkan Dinda mengalami luka ringan. Wargayangmengetahuiperistiwaitulangsungmelarikankeduanya ke RS. Melati, Perbaungan. Kasat lantas Polres Sergai, AKP Hasan Basri membenarkan peristiwa tersebut dan kasusnya masih lidik.(c03)

Zainuddin menegaskan, utang itu sudah termasuk dalam KSO dengan PDAM Tirtanadi. Artinya, PDAM Tirtanadi yang harus menyelesaikan utang itu karena sudah ada dalam KSO yang dibuat keduabelah pihak. Soaldukungandanabagipembangunan reservoir dan pemasanganberbagaifasilitaspendukung pengelolaanairolehPDAMTirtadeli, Wabup menyebutkan Pemkab DeliserdangdidukungdanaAPBN TA2012.“LebihjelasnyatanyaKadis Cipta Karya atau Kadis Infokom,” tegasnya. “Pokoknyapasokanairbersih ke Bandara Kualanamu tanggungjawab penuh PDAM Tirtadeli, terlebih lagi sudah ada MoU antara Pemkab Deliserdang dengan pihak PT Angkasa Pura II. Sementara lokasi Bandara Kuala-

namu yang ada di Kec. Beringin, di luar Kerjasama Operasional (KSO) dengan PDAM Tirtanadi,” tegas Wabup. Juli Mengalir Secara terpisah, Kadis Infokom Drs. Neken Ketaren menyatakan, saat ini Deliserdang sudah memiliki pasokan air yang cukup besar dan tidak akan kekurangan kalau memasok ke Bandara Kualanamu. Nekenmemastikan,pasokan air untuk Bandara Kualanamu hanya membutuhkan 15 liter/ detik, sementara pasokan di bak penampungan Karang Anyar melebihi karena memiliki debit 25 liter/detik. Bahkan, tahun ini PDAM Tirtadeli membangun bak penampungan air 20 liter/ detik, juga di wilayah Kec. Beringin. Selain itu di Gunung Meriah

akan digrativikasi dengan debit air 60 liter/detik. Masalah pendanaan, menurut Neken, sudah tersedia. Seperti di Gunung Meriah sudah disiapkanRp20miliardariAPBNditambah Rp5 miliar BDB dan Rp3 miliar APBD. Di tiga kecamatan lainnya, yakni Pantailabu, HamparanPerakdanTanjungmorawa, sudah disiapkan masing-masing dana Rp7,5 miliar dari APBN dan Rp1,5 miliar dari APBD. “Untuk perbaikan reservoir yang ada (up grade) disiapkan dana Rp600 juta. Jadi tidak ada alasan tidak sanggup,” sebutnya seraya menambahkan, Juli mendatang air akan mengucur di Bandara Kualanamu yang dipasok PDAM Tirtadeli, karena saat ini masih dalam proses pemasangan pipa.(a06/m16)

H. Fadly Nurzal Diusung PPP PERBAUNGAN (Waspada): Ketua DPW PPP Sumut, H. Fadly Nurzal, S.Ag diusung PPP untuk menjadi Calon Gubernur Sumatera Utara (Cagubsu) periode 2013-2018. Demikian dikatakan Ketua UmumDPPPPP,H.HasrulAzwar, MM yang juga Ketua Fraksi PPP di DPR RI, saat reses perorangan dihadiri sejumlah pengurus PPP di antaranya Ketua DPW PPP Sumut, H. FAdly Nurzal, S.Ag sendiri, Ketua DPC PPP Sergai, H. Usman Effendi Sitorus, S.Ag dan lainnya, di Perbaungan barubaru ini. Menurutnya,keputusanyang

diambil partai berbasis Islam itu, setelah melakukan konsolidasi secara internal melalui musyawarah kerja wilayah (Muskerwil) DPWSumutpadaJuni2011silam, di Asrama Haji Medan serta didukung Ketum DPP PPP H. Suryadharma Ali, yang memutuskan Fadly diusung sebagai Cagubsu periode 2013-2018. Di Tebingtinggi Dukungan terhadap pencalonan H. Fadly Nurzal, S.Ag sebagai calon Gubsu, juga mulai mengalir dari arus bawah. Seperti dilakukan sejumlah simpatisan di Kota Tebingtinggi, baru-baru ini, yang membentuk Pusat

Perjuangan Pemenangan Fadly Nurzal (PPP-FN). Menurut Ketua PPP-FN Kota Tebingtinggi,AhmadRifkan,salah satu penilaian mereka adalah, sudah saatnya Sumut dipimpin tokoh muda religius, cerdas, santun dan bersahaja. Jajaran kepengurusan PPPFN Kota Tebingtinggi, Ketua Ahmad Rifkan, Wakil Anwar Ibrahim Marpaung, Sekretaris Jamnas Arianto, Bendahara Rani Idris Lubis. Kepengurusan dilengkapi sejumlah direktur, di antaranya direktur program pemenangan M. Zakwan, S.Ag.(c03/a09)

Waspada/HM Husni Siregar

WABUP Deliserdang H. Zainuddin Mars sebagai Pembina Upacara, melakukan salam komando dengan pemimpin upacara Zaki Samsudin pada upacara peringatan Hari Pendidikan Nasional Tahun 2012, di Deliserdang.

Launching Mobil Pantai Meriahkan Hardiknas Di DS LUBUKPAKAM (Waspada): Launching 2 unit mobil pantai hasil karya siswa SMK Negeri I Lubukpakam menghiasi peringatan Hari Pendidikan Nasional (Hardiknas) tingkat Kab. Deliserdang 2012, di Lapangan Alun-Alun Pemkab Deliserdang di Lubukpakam, Rabu (2/5). Kegiatan juga dirangkai pemberian tropi, hadiah dan penghargaan kepada guru, kepala sekolah dan pengawas sekolah berprestasi, serta pembukaan pameran Gebyar Pendidikan oleh Wabup H. Zainuddin Mars. Pada peringatan Hardiknas, sebagai Pembina UpacaraWabup H. Zainuddin Mars, pemimpin upacara Zaki Samsudin, Pembaca UUD 1945 Feby Ayu Rahmadan, dihadiri Ketua DPRD Deliserdang Hj. Fatmawati Takrim, Wakil Ketua TP PKK Hj. Asdiana Zainuddin, Kapolres AKBP H.WawanMunawar,S.Ik,M.Si,KajariLubukpakam H. Khairil Aswan Harahap, SH, Ketua Pengadilan Agama Drs. H. Suyadi, Sekdakab Drs. H. Azwar S, M.Si, pimpinan SKPD, Ketua PMI H. Ismayadi, SH, pimpinan Ormas, Organisasi Wanita dan pejabatjajaranDisdikporaDeliserdang.Sedangkan peserta upacara terdiri dari barisan TNI, Polri, PNS, mahasiswa, pelajar SD, SMP dan SMA/SMK dan anggota Pramuka. MendikbudRIMohammadNuhdisampaikan Wabup H. Zainuddin Mars mengatakan bidang kebudayaan telah kembali ke ‘Rumah besar’ pendidikan setelah terpisah lebih dari sepuluh tahun Kementerian ini terhitung sejak 20 Oktober

2011, dan telah berubah menjadi Kementerian Pendidikan dan Kebudayaan (Kemendikbud), sebagaimana tertuang dalam Peraturan Presiden No. 91 Tahun 2011 tentang pembentukan dan organisasi Kementerian Negara. Sementara Kadis Pendidikan Pemuda dan Olahraga (Kadis Dikpora) Kabupaten Deliserdang Hj. Sa’adah Lubis, SPd, MAP selaku penyelenggara menjelaskan, pihaknya memberi hadiah tropi dan penghargaan kepada 32 guru, kepala sekolah dan pengawas sekolah berprestasi berdasarkan keputusan Bupati Deliserdang Drs. H. Amri Tambunan No. 415 Tahun 2012. Selain itu juga hadiah pemenang Lomba Inovasi Pembelajaran kepada 9 guru SD, SMP dan SMA serta beasiswa dari PT Jamsostek (Persero) kantor CabangTanjungmorawa kepada 23 orang murid SD, SMP, SMA dan mahasiswa. Sedangkan gebyar pendidikan yang digelar tiga hari di Lapangan Alun-Alun diikuti 35 stand menampilkan kreativitas murid termasuk hasil rakitan 2 unit mobil pantai hasil karya siswa SMK I Lubukpakam, rakitan laptop siswa SMK 1 Percut Seituan dan hasil karya dari sekolah lainnya serta stand donor darah PMI. Jugadigelarlombapidato bahasa Inggris, lomba tari kreasi nusantara, fasion showdankuisberhadiah.Acaradiawalipenampilan grupTarian Nusantara gabungan siswa SMA serta penampilanaksianakSDPasarVIBatangkuisbermain drum dan angklung, serta penampilan drumband Nusantara Tanjungmorawa.(a06)

Korban Penyiraman Soda Api Di Binjai Minta Keadilan

PN Stabat Luncurkan Program One Day Service

MEDAN (Waspada): Korban penyiraman soda api di Binjai berharap keadilan dan meminta Polres Binjai segera menangkap pelakunya. “Karena penyiraman soda api itu saya mengalami kebutaan, sedangkan teman saya Sani Sembiringmeninggaldunia.Kami minta Polres Binjai segera menangkap pelakunya,” kata Natangsa Ginting kepada wartawan di Medan, Jumat (4/5). Saat itu dia didampingi istrinya, serta istri Sani Sembiring. Diceritakannya, kasus penyiraman soda api terjadi akhir Maret 2012 di Desa Sei Bingei, Binjai. Ketika itu Sani Sembiring dan Natangsa Ginting pulang berboncengan sepedamotor usai menderes karet. Namun di perjalanan bertemu kedua pelaku, berinisial R dan M, yang juga berboncengan sepedamotor,dantanpadisangka

STABAT (Waspada): Ketua Pengadilan Negeri sekolah dan instansi terkait sehingga mereka (PN) Stabat Hj. Diah Sulastri Dewi mengemuka- mudah memperoleh akta kelahiran tersebut. Pada bagian lain Hj. Dewi Sulastri juga kan, pihaknya telah meluncurkan program pelayanan cepat satu hari siap (one day serv- mengemukakan terobosan baru yang mulai ice), dalam hal penetapan putusan untuk sidang dilaksanakan di wilayah yurisdiksi PN Stabat, yakni tentang perkara tindak pidana ringan (tipiring) di akta kelahiran. Kebijakan untuk sidang akte kelahiran bawah Rp2,5 juta sesuai PerMA No. 2 Tahun 2012. pelayanan masyarakat ini langsung ditetapkan Implementasi PerMA tersebut dalam Perspective putusan oleh hakim, bertujuan agar biaya murah RestorativeJusticedenganmengangkatkearifanlokal untukmenciptakankearifanmasyarakatyanghampir dapat membantu masyarakat. Tentunya bila pemohon sudah melengkapi punah dengan cara Mediasi Penal (Musyawarah), persyaratannya, hari itu juga, kata Hj. Diah Sulastri serta adanya monitoring dari Kepala Desa/Dusun kepada wartawan di kantor PWI Langkat di Stabat, atau tokoh masyarakat.(a01) Rabu (2/5). Menurutnya, integritate one day service memberikan pelayanan satu hari kepada warga pemohon akta lahir tertunda juga melalui sidang onetable,sedangkanbiayayang dikenakan sesuai ketentuan yang langsung dibayar oleh si pemohon melalui kantor Pos. Ketua PN Stabat Hj. Dewi SulastrididampingiBagianHumas, Darminto mengemukakan, terkait Hari Pendidikan Nasional (Hardiknas), muncul ide baru untuk mendatangi sekolah-sekolah guna menyidangkan putusan akta kelahiWaspada/Abdul Hakim ran bagi para pelajar dan siswa. KETUA PN Stabat Hj. Diah Sulastri Dewi didampingi Ketua Dalam waktu dekat akan kita PWI Langkat H. Ibnu Kasir dalam temu ramah bersama sejumlah bicarakan bersama pihak wartawan di aula Kantor PWI Langkat di Stabat.

kedua pelaku menyiramkan soda api.“Keduapelakutemansekampung, sehingga kami mengenal mereka,” kata Ginting. Setelah peristiwa itu kedua pelaku melarikan diri, sedangkan kedua korban sempat dibawa warga ke Puskesmas Namoukur. Tetapi, karena luka sangat parah keduanya dirujuk ke RS Materna Medan. Natangsa Ginting berhasil diselamatkan, meski mata kirinya mengalami kebutaan, sedangkan Sani Sembiring yang kemudian dirujuk ke RSU Dr Pirngadi Medan, seminggu kemudian meninggal dunia. Keluarga korban kemudianmengadukanperistiwa itu ke Polres Binjai, meski sampai saatinibelumjugaditindaklanjuti. “Kami tidak tahan tinggal di kampung, karena selalu di teror kedua pelaku, sementara Polres Binjai tidak juga melakukan penangkapan,” sebut Wati, istri

almarhum Sani Sembiring sedih. Sedangkan Natangsa Ginting mengatakan, pernah ketika mereka menemui juru periksa Polres Binjai untuk menanyakan hasilperkembanganpenyelidikan, malah diusir.“Bikin masalah saja kalian, jangan datang lagi ke sini,” kata Ginting menirukan ucapan juru periksa itu. Karena itu, mereka berharap Kapolda Sumut Irjen Wisjnu Amat Sastro turun tangan menangani kasus menimpa mereka. Kapolres Binjai AKBP Musa Tampubolon dikonfirmasi wartawan tentang penanganan kasus itu mengatakan belum bisa menahan R dan M karena tidak cukup bukti. Kata dia, R dan M sudah diperiksa, namun tidak dapat dilakukan penahanan karena berdasarkan keterangan anak Natangsa Ginting, saat kejadiandirinyabersamaRsedang minum tuak. (m27)

Pengelola PAUD T. Tinggi Keluhkan Kutipan Biaya TEBINGTINGGI (Waspada): Sejumlah pengelola pendidikan anak usia dini di Kota Tebingtinggi mengeluh. Pasalnya, pihak Dinas Pendidikan melalui Seksi PAUD/PLS melakukan pengutipan liar atas PAUD dengan alasan untuk biaya pelepasan siswa PAUD. Padahal, kegiatan itu sendiri tidak punya dasar hukum yang jelas. Sejumlah pengelola, Senin (30/4), mengatakan Seksi PAUD/ PLS melalui tenaga lapangan pendidikan masyarakat (TLD), minta setiap orangtua siswa membayar biaya pelepasan Rp40 ribu/siswa. Alasannya, dana itu akan digunakan untuk biaya kegiatan pelepasan siswa PAUD, sekira Mei 2012. “Kami merasa

tak enak sama orangtua anak kami, karena umumnya kan warga tidak mampu,” ujar pengelola PAUD dari Kec. Rambutan. Diakui, beberapa tahun belakangan kegiatan pelepasan itu dilaksanakan juga. Tapi baru tahun ini, biayanya membesar, dibanding tahun sebelumnya hanya Rp35 ribu/siswa. “Memang tambahannya cuma Rp5.000, tapi bagi yang tidak mampukan berat,” keluh pengelola PAUD lainnya. Pelepasan siswa PAUD se Kota Tebingtinggi, nantinya diperkirakan mencapai 1.200 siswa lebih dari 62 PAUD yang ada. Terkait itu, APBD TA 2012 telah menganggarkan dana Rp15 juta untuk biaya sertifikat dan

kegiatanpelepasanPAUD.Namun kegiatan pelepasan PAUD sama sekali tidak ada dasar hukumnya. Kadis Pendidikan melalui Kabid Dikdasmen Drs. Janner Sitinjak, mengakui kegiatan pelepasanPAUDsamasekalitidak adadalamperaturan.Diakuijuga, pengutipan yang dilakukan Seksi PAUD/PLS tidak mendapat legalitas Dinas Pendidikan. “Kegiatan itu cuma memberi semangat saja,” ujar dia. Bahkan, J Sitinjak tidak membantah jika pengutipan itu masuk kategori pungutan liar. Soalpengutipanliaritu,diakui tenaga lapangan Dikmas (TLD) Syahrialyangmengatakanpelaksanaan pengutipan telah dilakukan beberapapekanbelakangan.(a09)

Waspada/Abdul Khalik

ORANGTUA siswa PAUD dalam kegiatan di salah satu PAUD di Kec. Padang Hulu.

Dirut Bank Sumut:

Deliserdang Luar Biasa LUBUKPAKAM (Waspada): Dua dari sekira 8.000-an peserta gerak jalan massal peringatan Hari Pers Nasional (HPN) Tahun 2012 dan HUT Ke-66 PWI tingkat Sumut yang dipusatkan di Lapangan Alun-Alun Pemkab Deliserdang, menerima hadiah masing-masing 1 unit sepedamotor Honda Beat dari Dirut Bank Sumut H. Gus Irawan Pasaribu, SE, Ak, MM. Penyerahan berlangsung di kantor PWI Perwakilan Deliserdang di Lubukpakam, Rabu (2/5). Selain dihadiri Dirut Bank Sumut H. Gus Irawan berserta sejumlah staf dan dua penerima hadiah, juga hadir Ketua PWI Cabang Sumut Drs. Muhammad Syahrir, Ketua Panitia HPN dan HUT PWITingkatSumutDrs.KhairulMuslim,Sekretaris Panitia Zul Anwar Ali Marbun, Ketua PWI Perwakilan Deliserdang Drs. Henri Simon Matondang, Ketua Panitia Lokal HPN dan HUT PWI Tingkat Sumut di Deliserdang HM Husni Siregar sejumlah anggota PWI Perwakilan Deliserdang serta undangan. Dirut Bank Sumut H. Gus Irawan Pasaribu yang juga Ketua Umum Koni Sumut menyatakan salut serta bangga atas perhelatan yang dilaksanakanPWICabangSumutbersamaseluruh jajarannyakhususnyaPWIPerwakilanDeliserdang sebagaiPanitiaLokal,dalammenggelarperingatan HPN Tahun 2012 dan HUT ke-66 PWI Tingkat SumutdiKabupatenDeliserdangyangberlangsung

sukses, aman, tertib dan lancar dengan jumlah peserta sekira 8.000-an. Melihat jumlah peserta gerak jalan massal yang cukup mbludak, membuktikan minat masyarakat di Kabupaten Deliserdang terhadap olahraga cukup tinggi. “Deliserdang memang benar-benar luar biasa” aku Gus Irawan. Bahkan, Ketua Umum PWI Pusat H. Margiono yang hadir dan turut melepas peserta gerak jalan massal pagi itu (Sabtu 28/4) juga mengaku kalau “Deliserdang memang luar biasa”, ungkap Gus Irawan mengutip pengakuan Ketua Umum PWI Pusat H. Margiono. Syukur Nikmat Sedang kepada kedua pemenang lucky draw masing-masing Abdul Rasyid Lubis, 45, warga Desa Sena Batangkuis dan Haris Candra, 16, warga Desa Jati Sari Lubukpakam, Gus Irawan berharap agar hadiah sepedamotor yang diberikan dirawat sebaik-baiknya untuk kepentingan yang bermanfaat. Bersyukurlah kepada Allah SWT, karena hadiah yang diberikan secara tulus ikhlas dan diterima juga dengan penuh suka cita merupakan nikmat yang harus senantiasa disyukuri, ujar Gus Irawan seraya mengingatkan bersyukur kepada Allah SWT, dengan menambah dan meningkatkan prestasi kerja baik dalam melaksanakan tugas maupun beribadah.(a06)

Sumatera Utara


WASPADA Sabtu 5 Mei 2012

Soal Pelebaran Jalan Dan Pembangunan Drainase

Warga Tapsel Tantang Bupati P. SIDIMPUAN (Waspada): Informasi yang disampaikan Pemkab dan Bupati Tapanuli Selatan (Tapsel) Syahrul M Pasaribu tentang rencana pelebaran jalan dan pembangunan drainase, ternyata mendapat tantangan dari warga Tapsel. Informasi dihimpun Waspada, kemarin, warga menantang pemerintah agar pembangunan itu dimulai bulan ini, sehingga manfatnya benar-benar dirasakan masyarakat. Tidak hanya sebatas wacana dan rencana. Dikabarkan, tahun ini pemerintah pusat melalui Balai Besar PelaksanaJalanNasional(BBPJN) dan Pemprovsu melalui Dinas Tarukim, membangun saluran drainase dan pelebaran jalan di wilayah Kab. Tapanuli Selatan. “Tahun ini pemerintah pusat

melalui BBPJN Wilayah I akan membangun jalan mulai dari Pos Polisi Sitinjak sampai Kantor CamatAngkolaBarat.Badanjalan dilebarkan dari 4,5 meter menjadi 6 meter,” ujar BupatiTapsel, Syahrul M Pasaribu, baru-baru ini. Kemudian, katanya, pembangunan dan pelebaran jalan juga akan dilakukan sepanjang 350 meter di Desa Huta Baru, Kec. Angkola Barat, atau tepat pada jalan yang selama ini selalu bergelombang.SelanjutnyaSimpang Sipenggeng sampai Parsariran

FKUB Dairi Dikukuhkan SIDIKALANG (Waspada): Pengurus Forum Kerukunan Umat Beragama (FKUB) Dairi periode 2012-2017 dikukuhkan di Balai Budaya Sidikalang, Kamis (3/5). Pengukuhan dilakukan Bupati KRA Johnny Sitohang Adinegoro disaksikan unsur Muspida, tokoh agama Islam, Kristen, Katolik, Budha dan Hindu. Ketuapanitia,JM.Pasaribumelaporkanjumlahpengurusdananggota FKUB 17 orang terdiri dari agama Islam 5 orang, Kristen 8 orang, Katolik 2, Budha 1 dan agama Hindu 1 orang. Dikatakan, jumlah pengurus dankeanggotaanitumengacukepadasuratkeputusanKFKUBProvinsi Sumut No.01.0-6/FKUB-I/I/2012 tanggal 26 Januari 2012. Bupati mengatakan, peranan FKUB sangat dibutuhkan masyarakat Dairi, karena dapat menetralisir masalah yang identik dengan SARA. Saat ini ada masyarakat menciptakan SARA karena permintaannya ditolak pemerintah.“Watak seperti itu perlu dicuci,” ujarnya. Kerukunan umat beragama di Dairi selama ini berjalan cukup baik dan harus dipertahankan pemerintah termasuk semua pengurus dan anggota FKUB. Pengurus yang baru dikukuhkan antara lain, Ketua Pdt EJ. Solin, Wakil Pastor Bernard Teguh O Cam dan PDM Ario. Sekretaris, H. Sudiarman Manik dan Wakil, Pdt MJ. Pasaribu, sedangkan ketua dewan pembina, Wabup Irwansyah Pasi, SH. (a20)

Perguruan Alwashliyah Terima Bantuan Belajar KABANJAHE (Waspada): Perguruan Alwashliyah Kabanjahe menerima seperangkat bantuan belajar untuk siswa/i, terdiri 10 meja dan 20 bangku dari Musali, warga Kota Medan. Menurut kepala perguruan Alwashliyah MuhammadYajid kepada Waspada, Kamis (3/5), bantuan tersebut diterima Ketua Sosial Alwashliyah Kabupaten Karo Abdul Khaliq Sembiring didampingi Khairil Tanjung, Bambang Irawan dan Selamat Riady, Selasa lalu. Muhammad Yajid menyampaikan terima kasih atas bantuan sarana belajar tersebut. “Semoga batuan tersebut dapat dipergunakan sebaik-baiknya oleh anak didik di Alwashliyah,” ujarnya. Disebutkan, bantuan sarana belajar seperti bantuan dari bapak Musali masih sangat dibutuhkan di perguruan Alwashliyah Kabanjahe. (c09)

atau di depan pertapakan SMK Pertambangan. “Selain pembangunan dan pelebaran jalan, tahun ini Pemprovsu melalui Dinas Tarukim juga akan membangun saluran parit (drainase) sepanjang 1,7 kilometer dengan lebar 90 centimeter di Jalinsum sekitar Pasar Sitinjak,” ujarnya. BupatiTapsel juga menjelaskan, tahun depan BBPJN membangun sekaligus melebarkan jalan di Kec. Sipirok. Mulai Simpang Sitorbis ujung lokasi pertapakan perkantoran Pemkab Tapsel hingga Desa Simaninggir. Tahun ini diawali dengan pembangunan sebagian saluran drainase oleh Dinas Tarukim Pemprovsu. Kemudian pelebaran

jalan sepanjang 600 meter oleh DinasPUDTapseldandiaspaloleh BBPJN. “Ini merupakan bukti dari semangat kita untuk mempertemukan lokasi pertapakan perkantoran PemkabTapsel dengan Pasar Sipirok. Insya Allah, jika ruas jalan ini telah lebar dan mulus, maka pembangunan pemukimanan dan bangunan usaha di sisi kiri dan kanannya akan tumbuh cepat,” jelas Syahrul. Sementara sebelumnya, Kepala UPT BBPJN, Dachi, bersama Kepala UPTD Dinas Tarukim Pemprovsu Cabang Padangsidimpuan, Ir. Indra Siregar dan Kepala Bappeda Tapsel, serta Camat Angkola Barat telah melakukansosialisasipelebaranjalan

dan pembangunan drainase kepada masyarakat. Pada intinya, masyarakat sangat setuju dan mendukung pembangunan tersebut. Mereka tidak keberatan apabila selama proses pembangunannya nanti akan menimbulkan abu dan kemacetan lalulintas. Bahkan warga menantang pemerintah agar pembangunan itu dimulai bulan ini juga. Sosialisi serupa juga dilaksanakan Camat Sipirok dengan warganya. Pada intinya warga sangat setuju dan mengusulkan tiga permintaan.Yakni, agar pemerintah membantu memperbaiki pagar, teras, dan rumah yang terpaksa harus dibongkar akibat pelebaran jalan. (a27)

Tersangka Pembunuh Ditangkap PEMATANGSIANTAR (Waspada): Setelah bekerja ekstra keras, tersangka pembunuh ibu hamil diamankan Unit Jahtanras Sat Reskrim Polres Pematangsiantar dari tempat persembunyiannya. ES, 22, pria yang sehari-hari bekerja mocok-mocok warga Desa Silulu, Kec. Bandar Malela, Kab. Simalungun diduga membunuh ibu hamil enam bulan, Siti Nurcahaya Siagian, 36, warga Jalan SinarTani, Kel. Siopat Suhu, Kec. Siantar Timur, Kota Pematangsiantar di dalam rumah korban, Rabu (18/4) pukul 10:30. Motif pembunuhan ini masih simpang-siur, walaupun dugaan sementara perampokan. Penangkapan terhadap ES dilakukan di tempat persembunyiannya di satu perkebunan kelapa sawit milik masyarakat di Desa Duyun, Kec. Duyun, Kab. Siak, Provinsi Riau, Rabu (2/5) malamdandibawakePematangsiantar, Jumat (4/5). Sat Reskrim Polres dipimpin Kanit AiptuYuken Saragih bekerja ekstra keras menelusuri jejak tersangka pembunuhan tergolong sadis itu, karena korban tewas dengan luka bacokan di tengkuk hingga leher nyaris putus akibat tulang leher patah, perut sebelah kanan luka tusukan tembus sampai ke belakang dan luka bacok di lengan kiri. Tersangkasudahberulang-kali mendatangirumahkorban,dengan alasanhendakmencarirumahkos

pada saat suami korban, Ponijo, 37, sedang pergi bekerja sebagai sopirUSIdiJalanSisingamangaraja, Pematangsiantar. Berdasarkan kecurigaan terhadap tersangka, Unit Jahtanras akhirnya mendapat informasi, tersangka sering berkunjung ke satu rumah di Jalan Asahan, Desa Pantoan Maju, Kec. Siantar, Simalungun. Tersangka sering datang kerumahitudanpernahmenginap, untuk menemui pacarnya. Informasi diperoleh, tersangkasudahmerencanakanmenikah dengan pacarnya itu 15 Mei 2012 dan pihak keluarga tersangka sudah menemui keluarga pacar tersangka untuk meminang pada malam sesudah kejadian. Dan sesudah acara meminang itu, tersangka tidak pernah datang lagi ke rumah pacarnya. Dari pacar tersangka, pihak Unit Jahtanras menemukan sepasang pakaian Satpam dan ikat pinggang tersangka serta KTP suami korban dan kartu keluarga korban. Pacar tersangka yang mendengar tersangka terkait kasus pembunuhan korban, akhirnya mau bekerjasama dengan UnitJahtanrasdanmenghubungi tersangka melalui telepon selular. Pacar korban bertanya di mana tersangka berada dan mengapa pergitanpapermisi,padahalmereka akan menikah 15 Mei 2012. Tersangka tidak memberi alasan kepergiannya dan malah menyuruh pacarnya datang menemui dia di tempatnya bekerja

sebagai pembabat rumput. Akhirnya, Unit Jahtanras dipimpin KBO Sat Reskrim Iptu Asmon Bufitra bersama pacar tersangka berangkat ke tempat persembunyian tersangka dan akhirnya ditemukan dan ditangkap. Unit Jahtanras turut menyita satu gelang emas yang sempat digadaikan tersangka di tempat persembunyiannya, sebilah senjata tajam jenis golok, dan satu sepedamotor. Kapolres Pematangsiantar AKBPAlberdTBSianipar,S.Ik,MH saatdikonfirmasimelaluiKasubbag Humas AKP Altur Pasaribu, Kasat Reskrim AKP Azharuddin, SH didampingi KBO Iptu Asmon Bufitra dan Kanit Jahtanras Aiptu Yuken Saragih, Jumat (4/5) menyebutkan tersangka sudah mengakui perbuatannya dan ditetapkan sebagai tersangka. Menjawab pertanyaan, Kasat Reskrim menyebutkan tindak pidana yang diduga dilakukan tersangka yakni pembunuhan berencana, karena saat mendatangi rumah korban membawa senjata tajam jenis golok yang diambil secara diam-diam dari rumah pacarnya, sedang motifnyadidugaperampokan,karena gelang emas milik korban tidak adalagidipergelangantangannya saat ditemukan dalam keadaan meninggal. KasatReskrimmenyebutkan, pihaknya masih melakukan pemeriksaan terhadap suami korban sejak Kamis (3/5). (a30)

Waspada/Sarmin Harahap

BUPATI Madina HM Hidayat Batubara, Wakil Bupati Dahlan Hasan Nasution, dan Kadis Pendidikan Madina Imron Lubis, saat menyerahkan hadiah kepada pelajar berprestasi saat peringatan Hardiknas.

Hardiknas Di Madina, Tapsel Dan Paluta PANYABUNGAN (Waspada): Peringatan Hari Pendidikan Nasional (Hardiknas) di sejumlah kabupaten/kota di Sumut, sepeti di Kab. Mandailing Natal (Madina), Tapanuli Selatan (Tapsel) dan Padanglawas Utara (Paluta) mengandung motivasi untuk menciptakan dunia pendidikan yang lebih baik. Hardiknas di Madina diperingati di lapangan upacara Kantor Bupati lama, baru-baru ini. “Periode2010–2035,kitaharusmelakukaninvestasi besar-besaran dalam bidang pengembangan sumber daya manusia (SDM) sebagai upaya menyiapkan generasi 2045, yaitu 100 tahun Indonesia merdeka,” ujar Bupati Madina HM Hidayat Batubara membacakan pidato Menteri Pendidikan Dan Kebudayaan RI Muhammad Nuh. Karena itu,lanjut dia, kita harus menyiapkan akses seluas-luasnya kepada seluruh anak bangsa untuk memasuki dunia pendidikan mulai dari pendidikan anak usia dini (PAUD) sampai ke perguruan tinggi. Usai mengikuti upacara, Bupati Madina menyaksikan sejumlah perlombaan misalnya lomba tari oleh anak-anak TK, lomba tor-tor, drumb band, tarik tambang, dan lomba seni budaya serta perlombaan lainnya. Sebelumnya, dalam menyambut Hardiknas, Dinas pendidikan Madina sudah melakukan kegiatan perlombaan semisal cerdas cermat OlimpiadeSainsNasional(OSN)tingkatSDsampai SLTA, selain itu ada juga perlombaan keterampilan menggunakankomputerkhususuntukmuridtingkat SD.Bagipesertapemenanghadiahtropidanpembinan di serahkan usai upacara peringatan. Di Tapsel Bupati Tapanuli Selatan Syahrul M Pasaribu mengajak seluruh masyarakat dunia pendidikan di daerah itu untuk menggelorakan semangat

membangun generasi emas Indonesia, sebagaimana tema Hari Pendidikan Nasional (Hardiknas) 2012. “Semangat membangun generasi emas Indonesia harus kita gelorakan diTapanuli Selatan. Kita harus bisa menjadi contoh bagi daerah lainnya,” ajak BupatiTapsel pada upacara peringatan Hardiknas 2012 di Lapangan Kelurahan Pintu Padang, Kec. Batang Angkola, baru-baru ini. Syahrul juga mengajak seluruh elemen masyarakatpendidikandiTapseluntukmenjadikan momentum peringatan Hardiknas tahun 2012 ini sebagai motivasi meningkatkan pengabdian kepada masyarakat, nusa, dan bangsa. Usai menjalani upacara nasional peringatan Hardiknas tahun 2012, acara dilanjutkan dengan atraksi kebolehan murid SD, SMP, dan SMA di Tapsel. Mulai marching band, hingga berpidato danberpuisidenganmenggunakanbahasaInggris. Dinas Pendidikan dan Kebudayaan Daerah PemkabTapselmenyerahkanpenghargaankepada para guru teladan, pengawas teladan, kepala sekolah terbaik, dan pemerhati serta pembina Pendidikan Anak Usia Dini (PAUD) terbaik se-Tapsel. Di Paluta Peringatan Hardiknas 2012 di Padanglawas Utara (Paluta) dirangkai dengan Hari Kartini di Kab. Paluta dilaksanakan di Lapangan Merdeka, Kel. Pasar Gunungtua, Kec. Padangbolak. Bertindak selaku inspektur upacara Bupati Padanglawas Utara, Drs H Bachrum Harahap. Upacara ini diikuti ribuan pelajar dan mahasiswa serta PNS di lingkungan Pemkab Paluta. Turut juga hadir, Ketua DPRD Kabupaten PadanglawasUtaraMuchlisHarahap,SHi,Muspida Plus,PltSekretarisDaerahHusniAfganiHutasuhut, Kakan Kemenag Paluta, Drs H.Tohar Bayoangin. (c14/a27/a35)


KAMKA Sesalkan Pemkab Karo Tak Kirim Peserta MTQ PEGAJAHAN (Waspada): Keluarga Muslim Karo (KAMKA) gusar dan sangat menyesalkan Pimpinan Kantor Kementerian Agama (Kemenag) dan Pemkab Karo, atas ketidaksanggupannya mengirim kontingen mengikuti Musabaqah Tilawatil Quran (MTQ) Tingkat Provinsi Sumatera Utara, di Kab. Serdang Bedagai (Sergai) karena tak punya dana.

rangkatkan peserta asalkan dikomunikasikan sebelumnya,” kata Surbakti. Sementara Kepala Kantor Kementerian Agama Kab. Karo, Drs. MardinalTarigan, MA membenarkan Kab. Karo tidak mengirim peserta ke MTQ Sergai karena tidak ada dana. Menurut Mardinal, Kemenag telah membicarakan perihal keberangkatan

“Kita sangat menyesalkan Kementerian Agama dan Pemkab Karo yang tidak bisa mengirim peserta untuk mengikuti MTQ. Sebagai pemimpin harus bisa mencari solusi untuk mengakomodir kepentingan semua umat beragama,” tegas

Kerak Telor Semarakkan Kuliner Expo Sergai

Sekjen KAMKA, MA Siddik Surbakti melalui telefon selulernya, Jumat (4/5). Dikatakan Surbakti, sangat tidak rasional jika ketiadaan dana dijadikan alasan. “Jika Kemenag dan Pemkab memang tidak punya uang, KAMKA siap membe-

Lolos Babak Final Batubara Makin Optimis PEGAJAHAN (Waspada): Kabupaten Batubara merasa bangga atas prestasi peserta MTQ Provinsi ke-33 di Serdang Bedagai, karena sudah mendapatkan beberapa nama yang lolos final. Hal ini disampaikan official Sofiansyah dan Kepala Kantor Kementerian Agama Batubara, Drs. H. Sainik BR, Jumat (4/5). Sofiansyah menyebutkan peserta yang masuk babak final cabang lomba Syahril Quran dan Hifzil Quran. “Semoga masih ada yang menyusul dan harapan kami meraih kemenangan,” katanya. Drs. H. Sainik BR bersama Kasi Urusan dan Penerangan Agama Islam, Lahuddin Hasibuan membenarkan, utusan dari kabupaten itu sudah diberi pelatihan maksimal dan dibina secara khusus. “Harapan untuk menang tentu sangat besar, namanya juga ikut perlombaan,” kata Sainik. Keseriusan official yang mendampingi peserta lomba dari kabupaten ini terlihat kemarin, saat mereka mempersiapkan peserta lomba dengan pembinaan secara khusus kepada peserta di Skip, Lubukpakam.(m37)

PEGAJAHAN (Waspada): Bagi masyarakat Sumatera Utara khususnyaKab.SerdangBedagai, nama kerak telor cemilan khas asalBetawisepertinyamasihasing terdengar. Namun di lokasi Expo Sergai diarenaMTQke33tingkatSumut di lokasi replika Istana Sultan Serdang, Ke. Melati Kebun, Kec. Pegajahan, pengunjung bukan hanya sekedar dapat menyaksikan, tapi dapat langsung menikmatinya. Pasalnya selama pelaksanaan MTQ ke 33 Sumut, ada delapan pikulan dari Jakarta yang

kontingen Karo kepada Pemkab, namun Pemkab tidak bisa membantu dana. “Kita telah melakukan segala daya upaya supaya kontingen Karo bisa ikut MTQ, tapi tak membuahkan hasil,” kata Mrdinal. Mardinaljugamenyampaikan kekesalan dan kekecewaannya kepada Pemkab Karo. “Kita umat beragama se Tanah Karo kesal

menjajakan kerak telor dengan harga Rp10 ribu per porsi. Udin, 39, warga Kemayoran, Jakarta Pusat seorang pikulan kerak telor didampingi teman seprofesi,Yono,46,wargaMangga Besar, Jakarta Pusat, Erwin, 24, dan Dudung, 39, keduanya warga Kemayoran, mengisahkan sudah lima bulan hijrah ke Medan mengadu nasib berjualan kerak telor. Dia mengatakan berjualan kerak telor sejak 1999, sebagai mata pencaharian. “Untuk menyiapkan satu porsi kerak telor hanya butuh 3 menit terbuat dari

dan kecewa, kita harapkan ke depan dapat berubah ke arah lebih baik khususnya kepada seluruh umat beragama Karo,” kata Mardinal melalui SMSnya. Sebelumnya, pada saat pembukaan MTQ, panitia menyebutkankontingendarimasing-masing kab/kotaseSumateraUtarahadir, ternyata Kab. Karo tak mengirim utusan.(m37)

ketan (pulut), abon, udang, serta berbagai bumbu dapur dan untuk mempertahankan cita rasa khasnya, dimasak di atas bara arang. Harga per porsi Rp10 ribu, lebih murah dari di Jakarta, Rp15 ribu. Hitung-hitung harga promosi,” papar Udin yang baru menikah tiga bulan. Diabersamatemannyasudah lima bulan keliling Sumut, sebelumnya berkeliling Riau, Jambi dan Lampung. “Kami bertekad memperkenalkan kerak telor hingga ke penjuru tanah air,” tekadnya.(c03)

Sampah Di Lokasi MTQ Satu Kontainer Setiap Hari PEGAJAHAN (Waspada): Dengan luas 2,5 hektar selama pelaksanaan MTQ ke-33 tingkat Sumut di lokasi replika Istana Sultan Serdang di Kel. Melati Kebun, Kec. Pegajahan, Kab. Serdang Bedagai, setiap hari menghasilkan sampah sekitar satu peti kemas (Kontainer). Ketua Seksi Kebersihan MTQ, Drs Saparwin Siregar yang juga Kepala Kantor Lingkungan Hidup (KLH) Kab. Sergai didampingi Korlap, Sihite dan Ir. M. Sholi Nasution menerangkan, untuk menjaga kebersihan di seluruh lokasi MTQ, disiagakan 45 tenaga kebersihan yang setiap hari bertugas dari pukul 06:00 hingga pukul 18:00, terangnya kepada Waspada, Kamis (3/5) sore di arena MTQ. “Setiap hari dari lokasi MTQ menghasilkan bermacam sampah dari kotak nasi, bungkus makanan serta sampah lainnya sekitar satu

kontainer,” sebut Saparwin. Untuk mengantisipasi menumpuknya sampah, selain tenaga kebersihan seksi kebersihan juga menyiapkan dua truk pengangkut serta 6 becak sampah. Petugas kebersihan juga membersihkan 8 arena perlombaan di Kec. Pegajahan dan Perbaungan, membersihkan 154 rumah pemondokan kafilah. “Untuk menghindari penyebaran abu, seksi kebersihan menyiagakan dua truk Damkar, dan untuk memudahkan pengunjung, disiagakan satu mobil MCK,” imbuh Saparwin. Prinsipnya, lanjut Saparwin, kita menjaga agar seluruh arena MTQ tetap bersih, sehingga seluruh peserta dan pengunjung nyaman. “Lebih dari itu, kebersihan sebagian dari iman,” sebut Saparwin.(c03)

Binjai Siap Jadi Tuan Rumah MTQN Ke-34 BINJAI (Waspada): Binjai siap menjadi tuan rumah pelaksanaan MTQN Prov. Sumatera Utara ke-34. Ketua LPTQ Binjai Drs. H. Amir Hamzah, MAP didampingi Sekretaris Irfan Tangahu menegaskan, Jumat (4/5) sore, jika hasil musyawarah kafilah di Serdang Bedagai memutuskan Binjai tuan rumah, kita siap. Amir mengakui, tugas pelaksanaan MTQN sangat mulia dan jika pimpinan kafilah se Sumut menyetujui, MTQN ke-34 di Binjai, kita harus ikhlas menerimanya. Official Binjai Drs. H. Ahmadf Nasir menjelaskan, rapat pimpinan kafilah di gedung Replika Istana Sultan Serdang dalam menentukan tuan rumah MTQN ke-34, kafilah Binjai langsung dipimpin Sekdako Drs. H. Iqbal Pulungan didampingi Asisten II H.Wahyudi, SH. Menurut

Madina Yakin Raih Juara Pada MTQ Ke-33 Sergai PEGAJAHAN (Waspada): Kepala Kantor Kementerian Agama Kab. Madina, Drs. H. Muksin Batubara, M.Pd yakin qari dan qariahnya akan meraih juara pada MTQ Provinsi ke-33 di Serdang Bedagai. Hal itu disampaikannya, Jumat (4/5), saat bertemu qari dan qariah yang sudah diumumkan lolos ke final. “Sudah kami terima nama yang lolos final hafiz 10 juz putra atas nama Muhammad Ahyar, 20 juz putra atas nama Addad Alwi Nasution. 20 juz putra Masyanto,” katanya. Dia juga memperkirakan peserta lomba cabang Khatta Alquran bidang hiasan dekorasi putri bisa lolos final. “Semoga yang lainnya menyusul, saya sangat optimis dengan peserta yang ikut semua cabang lomba,” katanya sembari menyebutkan ada 35 peserta dan 10 official, di antaranya Ahmad Zainul Khobir Batubara, MM dan Subhansyah Arifin Nasution. Menurut Kakan Kemenag Muksin Batubara, semua cabang yang diperlombakan dikuti kecuali bahasa Inggris putra, dan tafsir bahasa Arab putra/putri. Ia berharap, pada semua peserta dari Kab. Madina bisa memberikan yang terbaik dan hasil maksimal.(m37)

Edi Saputra/Waspada

KETUA Seksi Kebersihan MTQ, Drs. Saparwin Siregar didampingi Asisten II Ekbang, Drs. Amirullah Damanik bersama sebagian petugas kebersihan.

Nasir, beberapa kafilah sangat berharap Binjai menjadi tuan rumah apalagi Binjai punya sejarah MTQ. Ahmad Nasir menjelaskan di final, Jumat (4/ 5) malam, Binjai menampilkan tilawah remaja putra M. Iqbal Syaiful,Tahfiz 30 jus putra M.Arifin. Mudah-mudahan qari Binjai ini bisa mencapai prestasi terbaik. Sedangkan Sabtu (5/5) kegiatan MTQN ke-33 Prov. Sumatera Utara siang hari kosong,dankafilahBinjaiakanberekreasikePantai Cermin. Selesai acara penutupan, Sabtu (5/5) malam, kafilah Binjai langsung pulang dan menurut Ketua LPTQ Amir Hamzah, mereka ditunggu di Pendopo Umar Baki. Setelah istrahat qari dan qariah serta official akan diantar pulang oleh camat ke rumah masing-masing.(a04)

Pensari Alquran Di Arena MTQ Ke-33 Waspada/Edi Saputra

PIKULAN makanan khas Betawi kerak telor. Udin, warga Kemayoran, Jakarta Pusat menyiapkan pesanan pengunjung di Expo Sergai pada arena MTQ ke 33 Sumut.

PEGAJAHAN (Waspada): Setiap malam saat kegiatan MTQ Cabang Tilawah berlangsung, ada 4 orang yang bertugas membacakan sari tilawah Alquran. Mereka adalah Dr. H. Azhar Sitompul, Hj. Murnisah Nasution, Maulida Hasanah, S.Pd, dan Nazlia Amanah. Demikian disampaikan Dra. Achiriyah, MH yang juga aktif sebagai dewan

hakim dalam MTQ ini, Jumat (4/5). “Sari Alquran itu membantu pendengar atau pemirsa yang hadir untuk memahami apa yang dibacakanqarimaupunqariah.Halinisangatperlu, karena dengan mengetahui sari Alquran semakin jelas makna kandungan ayat dan bisa diamalkan oleh yang mendengar,” kata Achiriyah.(m37)



Pemkab Atim-Pemko Langsa Teken MoU LANGSA (Waspada) : Pemko Langsa dalam waktu dekat berencana melakukan penandatanganan nota kesepahaman atau MoU dengan Pemkab Aceh Timur mengenai penertiban PNS yang berkeliaran saat jam kerja. Langkah dalam bentuk kerjasama itu dilakukan mengingat saat ini banyak PNS yang sudah tidak berada di ruang kerja ketika jam kerja berlangsung atau dengan kata lain tidak menjalankan tugasnya seperti biasanya, padahal PNS tersebut menggunakan seragam PNS. Menurut Pj Bupati Aceh Timur Nasrullah Muhammad MT bersama Sekda Syaifannur saat menerima kunjungan Pj Wali Kota Langsa, Rabu (3/5), kerjasama tersebut sudah selayaknya dilaksanakan secepatnya, mengingat hampir 70 persen PNS Aceh Timur melaksanakan aktivitasnya di Kota Langsa dan sudah barang tentu untuk menegakkan disiplin. “Bagi para PNS harus segera dilaksanakan dan kerjasama ini merupakan awal yang baik, jadi tidak saja PNS kota yang ditindak, akan tetapi PNS Aceh Timur juga akan ditindak apabila kedapatan pada jam-jam dinas berkeluyuran atau mangkal di warung-warung kopi,” katanya. Namun demikian, pada tahap pertama ini sasarannya adalah para PNS yang berada di warung-warung kopi atau di pusat perbelanjaan. (b24)

Jagung Dan Kacang Tanah Langka LHOKSEUMAWE (Waspada): Jagung dan kacang tanah kulit mulai langka dua bulan terakhir di Lhokseumawe. Di pasar tidak ada barang dan harganya pun mahal. Sebelumnya, satu bambu kacang tanah kulit mentah seharga Rp8 ribu. “Namun, kini harganya sekarang mencapai Rp10 ribu dengan kualitas lebih rendah. Itu pun sulit didapat,” kata Fitri, 26, seorang ibu rumah tangga di Cunda, Lhokseumawe, Jumat (4/5). Sejumlah pedagang yang berada di Pasar Cunda maupun Lhokseumawe mengaku tidak ada barang. Di saat musim kemarau, kedua jenis barang itu memang sulit didapat. “Kalau jagung, kadang-kadang barangnya bisa sangat banyak, sampai-sampai ada pedagang musiman yang menjualnya keliling dengan motor,” kata Udin, 46, pedagang di Cunda. Namun, jika tiba waktu langka, jagung memang susah sekali didapat. Kalaupun ada, mutunya sangat jelek. Banyak buah yang kecil dan ompong. Biasanya lebih sering dijadikan sebagai campuran sayur, agar kuah sayur menjadi manis. Dibanding kacang tanah, jagung manis masih mudah didapat. Sedikit sekali jumlah petani yang menanam kacang tanah di Lhokseumawe, dan panennya pun jarang. (b14)

Jalan Samudra Rawan Kecelakaan LHOKSEUMAWE (Waspada) : Pada hari kerja, kawasan Jalan Samudra Lhokseumawe rawan kecelakaan, dan terkenal sangat padat menjelang siang hari. Jalan tersebut tidak hanya dipadati para pelajar SD, SMP dan MTsN, tetapi juga masyarakat dan pekerja kantoran yang lalu-lalang.Wilayah itu juga berdampingan dengan kedai, apotek, perpustakaan, RS PMI, Kesrem, dan TK Pertiwi di samping sejumlah kedai makan, dan market lainnya. Kecelakaan kecil hampir setiap hari terjadi, baik bersing-gungan, tabrakan kecil sesama becak, sepeda motor, bahkan mobil. “Yang parahnya,padajampadatituadaorangsakityangdibawaambulans,” ucap Razali, tokoh masyarakat Lhokseumawe, Jumat (4/5). Di jalan situ juga banyak terdapat gerobak penjual jajanan, setidaknya ada sekitar sepuluh pedagang dengan jarak saling berdekatan. Sejauh ini belum ada upaya untuk mengatasi masalah itu karena keadaannya rumit dan serba salah. (b14)

30 CPNS Kemenag Bireuen Dilantik Jadi PNS BIREUEN (Waspada) : Kakan Kemenag Bireuen Zulhelmi A Rahman melantik 30 CPNS formasi 2011 menjadi PNS di aula Kemenag setempat Selasa lalu. Ke-30 CPNS yang dilantik itu terdiri dari staf Kankemenag, KUA, guru dan penyuluh. Dalam sambutan pengarahannya, Kakan Kemenag antara lain berharap agar seluruh PNS di jajaran Kemenag dapat menjadi panutan dan teladan masyarakat. Para CPNS yang baru dilantik jadi PNS dalam memberi pengabdian dapat menjadi idola di tengah masyarakat serta meningkatkan kinerja dan loyalitas yang baik kepada atasan. Analis Kepegawaian Kemenag Bireuen Munawir dalam laporannya menyampaikan pengambilan sumpah dan pelantikan CPNS formasi 2011 seluruhnya berjumlah 33 orang, hanya hadir 30 CPNS. (b12)

Pelaku Perampasan Motor Diburu INDRAMAKMUR (Waspada) : Terkait aksi perampasan sepedamotor milik Munawir asal Idi Cut di kawasan PTPN I Julok Rayeuk Utara, Kec.Indra Makmur—Alue Ie Mirah, Aceh Timur hingga kini jajaran Polsek setempat terus mengejar pelaku. Bahkan petugas sudah mendeteksi identitas pelaku. Kapolres Aceh Timur AKBP Iwan Eka Putra melalui Kapolsek Indra Makmur Iptu Simson Purba, Jumat (4/5) mengatakan, aksi perampasan sepeda motor dan uang Rp1 juta uang tunai milik korban diduga keras dilakukan oleh seorang pelaku yang nekat menunggu korban di kawasan kebun sawit, 6 kilometer ke arah selatan Mapolsek Indra Makmur. Meski setelah menerima laporan malam tersebut juga polisi terus melakukan pengejaran, lanjut Simson Purba, tetapi hingga kini petugas belum menangkap pelaku kriminal itu. (b24)

Tertib Lalulintas Untuk Anak TK BANDAACEH (Waspada) : Kepolisian Daerah Aceh melalui Direktorat Lalulintas (Dit Lantas) terus berupaya memperkenalkan tertib berlalulintas untuk siswa Taman Kanak-kanak (TK) di daerah itu. Kegiatan yang merupakan bagian dari program ‘Polisi Saweu Sikula’ itu digelar di halaman Markas Komando (Mako) Satuan Polisi Jalan Raya (Sat PJR) Ditlantas Polda Aceh di Jalan T Nyak Arief, Jeulingke, Banda Aceh, Kamis (3/5) dihadiri ratusan murid TK dari Kota Banda Aceh dan Aceh Besar. Dari halaman kantor yang berada satu komplek dengan Mapolda Aceh, para murid TK itu dibawa keliling Kota Banda Aceh untuk memperkenalkan rambu-rambu lalulintas seperti lampu merah, tempat penyeberangan dan tempat penantian angkutan umum atau halte. Usai jalan-jalan dengan sejumlah kendaraan yang disediakan panitia, para siswa TK itu kembali Makosat PJR Ditlantas Polda Aceh untuk mengikuti aneka lomba dengan memperebutkan berbagai hadiah uang disediakan. Acara tersebut juga dirangkai dengan peresmian Makosat PJR Ditlantas Polda Aceh.(b05)

Sabtu 5 Mei 2012

Polisi Amankan 50,3 Kg Ganja Kering

Bunuh Abang Kandung Divonis 4,5 Tahun LHOKSUKON (Waspada) : Yulinar, 17, terdakwa kasus pembunuhan terhadap abang kandungnya sendiri, divonis 4,5 tahun penjara oleh Majelis Hakim Pengadilan Negeri Lhoksukon, Aceh Utara, Kamis (3/5). Gadis asal Desa Teupin Banja, Kec. Muara Batu, Kab. Aceh Utara ini menyatakan menerima putusan Majelis Hakim. Sementara Jaksa Penuntut Umum (JPU) menyatakan pikir-pikir untuk melakukan banding. Majelis hakim diketuai Tohari Tapsirin dengan hakim anggota Zainal Hasan dan Saed Hamrizal menyatakan, terdakwa terbukti bersalah secara sah dan meyakinkan melanggar Pasal 338 KUHP tentang perbuatan menghilangkan nyawa orang lain. Amar putusan dibaca secara bergilir oleh Hakim Ketua dan hakim anggota di hadapan terdakwa Yulinar, JPU Dahnir dan penasihat hukum terdakwa, Taufik M Nur. Yulinar diadili karena menebas leher Azhari Muthaleb, 28, abangnya sendiri dengan parang hingga tewas. Mayat korban ditemukan bersimbah darah dalam kamar rumahnya, 9 Desember 2011 lalu. Yulinar mengaku kesal karena korban memperkosanya.(b19)


Waspada/ Jasvira Sautisa

KAPOLRES Gayo Lues AKPB Sofyan Tanjung didampingi Kasat Narkoba AKP Hendra Gunawan mengamankan ganja kering seberat 50,3 kg. Terlihat tersangka M Nasir (tangan terikat).

Ketua DPRK Aceh Tengah, Pilkada Cacat Hukum TAKENGEN (Waspada) : Ketua DPRK Aceh Tengah Zulkarnain akan memanggil Ketua KIP Aceh Tengah, karena kinerjanya merugikan rakyat Gayo dan DPRK. Pelaksanaan Pilkada di Gayo Lut, sudah cacat hukum. “ KIP sudah mengeluarkan surat yang melukai hati rakyat Aceh Tengah. Kami akan memanggil KIP, meminta tanggungjawabnya,” kata Zul, panggilan akrab ketua DPRK, saat dilangsungkan pertemuan dengan 10 kandidat Cabup, Jumat (4/5) di ruang kerja Ketua DPRK. Dalam pertemuan yang turut didampingi wakil ketua DPRK M Nazar dan Taqwa, serta komisi A Ikhwanussufa dan Zulkfili, ketua DPRK tersinggung dengan surat berita acara rapat pleno KIP Aceh Tengah no.17 tahun 2012 tertanggal 2 April 2012. Dalam surat yang ditandatangani seluruh komisioner KIP (Hamidah, Husin Canto, Hasbullah AR, Ivan Astavan M, Darmawan Putra dan sekretaris KIP Munawardi Rdiha), lembaga penyelenggara Pilkada ini terang-terangan menghina rakyat Aceh Tengah dan DPRK. Pada poin ketiga surat hasil rapat pleno KIP itu disebutkan, selama proses kampanye pihak KIP sudah berkoordinasi de-

ngan Radio Republik Indonesia dan pihak terkait lainnya membicarakan finalis dan moderator, untuk pelaksanaan debat kandidat Cabup Aceh Tengah. Untuk finalis dan moderator debat kandidat itu, KIP Aceh Tengah belum menemukan SDM yang tersedia di Aceh Tengah. Apabila harus didatangkan dari luar daerah, alokasi dana untuk debat kandidat tidak memadai. “Surat KIP ini sudah menghina seluruh rakyat Aceh Tengah yang menyatakan SDM Aceh Tengah tidak memadai. Ini penghinaan kepada rakyat, apalagi dikaitkan dengan persoalan dana. Kami DPRK Aceh Tengah tidak pernah memotong satu rupiah dana yang diusulkan KIP,” kata Zulkarnain. Karena tidak ada finalis dan moderator yang memiliki SDM di Aceh Tengah dan dana yang tidak memadai bila dihadirkan finalis dari luar, akhirnya KIP Aceh Tengah membatalkan pelaksanaan debat kandidat yang seharusnya dilaksanakan 5 April. “Ini pelanggaran berat yang dilakukan KIP selaku penyelenggara. Kami tidak mempersoalkan kesalahan para kandidat. Yang kami minta apa sikap dewan dengan ulah KIP yang sudah merugikan rakyat Aceh Tengah,” papar Iklil Ilyas Leube, kandidat bupati dalam pertemuan itu. Akhirnya pimpinan DPRK mengeluarkan sebuah surat “keramat”. Pimpinan DPRK

Zulkarnain, M Nazar dan Taqwa dalam surat pimpinan DPRK no.170/168/ DPRK, tertanggal 3 Mei 2012 mengeluarkan surat yang isinya menyebutkan, pelaksanaan Pilkada di Aceh Tengah cacat hukum. Cacat hukum disebabkan, ketidaksiapan penyelenggara di lapisan bawah dan terjadi pelanggaran kode etik yang dilakukan komisioner KIP Aceh Tengah. Untuk itu, DPRK meminta dewan kehormatan KIP Aceh segera mungkin meneliti dan memproses semua tindakan pelanggaran yang dilakukan KIP Aceh Tengah. Surat tersebut ditembuskan keseluruh intansi terkait. Di pihak lain, saat sekarang ini, Panwas Aceh Tengah Yunadi sudah melaporkan ke Panwas Provinsi Aceh, bahkan ke Bawaslu Pusat, tentang kesalahan KIP selaku penyelenggara Pilkada di Gayo Lut, dan sampai saat ini tahapan Pilkada 9 April lalu itu tidak dilanjutkan. Sementara itu Hamdiah, Ketua KIP Aceh Tengah juga sudah meminta petunjuk ke KPU pusat tentang mandeknya pelaksanaan tahapan pilkada di Aceh Tengah. Apa realisasi dari koordinasi KIP Aceh Tengah dengan KPU Pusat, serta bagaimana hasil laporan Panwas Aceh Tengah ke provinsi dan Bawaslu, belum ada jawaban pasti. Kini muncul surat DPRK Aceh Tengah yang menyebutkan pelaksanaan pilkada di daerah itu cacat hukum. (b32)

Kapolres Aceh Timur

Kesadaran Membasmi Narkoba Minim PEUDAWA (Waspada): Kasadaran masyarakat dalam membasmi narkoba, baik ganja ataupun sabu di wilayah Aceh Timur masih sangat minim. Kondisi tersebut dibuktikan dengan maraknya peredaran barang haram itu hingga mampu menembus ke kalangan bawah. “Kesadaran masyarakat membantu membasmi narkoba masih kurang. Jikapun ada masyarakat yang berani membantu polisi dalam memberikan informasi persentasenya baru 1 per 10. Artinya, jika ada 10 orang pengedar narkoba, maka 100 lainnya melindungi,” kata Kapolres Aceh Timur AKBP

Iwan Eka Putra, Jumat (4/5) di ruang kerjanya. Menurutnya, generasi Aceh sudah tergolong rusak dengan maraknya peredaran dan mengonsumsi narkoba. Padahal masyarakat mengetahui akibat memakai dan menggunakan barang haram itu dapat merusak otak dan tubuhnya sendiri. Jika masyarakat tidak mendukung tugas polisi dan bersamasama membasmi narkoba di Aceh Timur, maka suatu saat nanti tidak akan ada lagi generasi Aceh Timur yang pintar dan mampu membangun Aceh Timur ke arah yang lebih baik. “Narkoba sifatnya perusak.

Siapapun yang mendekatinya akan rusak. Tak hanya merusak dirinya sendiri, tapi juga merusak orang lain,” kata AKBP Iwan Eka Putra seraya menandaskan, jika masyarakat memiliki niat untuk membasmi narkoba, maka sejak dini masyarakat tidak lagi menutup-nutupi aksi peredaran dan pemakai narkoba sehingga generasi Aceh bersih dari narkoba. Di sisi lain, lanjut Kapolres Aceh Timur, pihaknya menduga kalangan yang mengonsumsi narkoba tak hanya dewasa, tetapi hingga ke kalangan pelajar diduga sudah mengonsumsi narkoba baik itu ganja ataupun sabu. (b24)

Armayaniar, Guru SMPN 18 Banda Aceh

Saya Ingin Berbuat Baik BANDA ACEH (Waspada): Seorang guru SMPN di Banda Aceh mengklarifikasi bahwa Kepala SMPN 18 menginstruksikan membagikan kunci jawaban UN kepada siswa di sekolah tersebut. “Saya tidak pernah melapor ke Kobar GB, bahwa kepala sekolah kami yang memerintahkan membagi kunci jawaban UN kepada siswa,” kata Armayaniar, yang datang ke kantor Waspada didampingi putranya, Jumat (4/5). Namun, dia membenarkan mendapat kunci jawaban via SMS dan ia kirim atau forwatkan ke sejumlah pihak terkait, seperti Pj Sekdako Banda Aceh Ramli rasyid, PjWali Kota Banda Aceh TM Syaifuddin, Kadis Pendidikan dan Olahraga Banda Aceh, pengawas UN serta diteruskan ke KoBar-GB. Maksudnya meneruskan kunci jawaban UN tingkat SMP melalui SMS itu agar pihak berkompeten bisa segera mengambil langkah antisipastif agar pelaksanaan UN di Banda Aceh bisa berjalan tanpa terjadi kecurangan. “Demi Allah saya ingin berbuat baik agar UN dilakukan secara jujur tanpa terjadi kecurangan,” kata Armayaniar.

Armayaniar Tapi niat baik Armayaniar, guru SMP Negeri 18 Banda Aceh ini tidak mendapat respon positif dari berbagai pihak yang dikirimi sms kunci jawaban. Lebih sakitnya lagi guru SMP ini dilaporkan ke Polda Aceh atas tuduhan kasus penyebaran kunci jawaban kepada siswa oleh KoBar-GB. “Saya tidak terlibat apa-apa dalam pelaksanaan UN di Banda Aceh, pengawas bukan dan panitia di sekolah juga bukan. Kunci jawaban yang saya kirim hanya kepada tujuh orang yang mempunyai kewenangan di bidang pendidikan di Banda Aceh hanya semata untuk memberitahukan dan mengantisipasi,” katanya.

Ketua Kobar-GB Aceh, Sayuti Aulia, membenarkan bahwa guru Armayaniar tidak diperintah Kepala SMPN 18 untuk membagi-bagikan kunci jawaban. “Bukan kepada sekolah SMPN 18, tapi salah satu kepala sekolah di Pidie jaya,“ katanya menanggapi penjelasan Armayaniar. Akibat berita di media tersebut, guru asal kota dingin Takengon itu mengaku mendapat perlakukan kurang simpatik dari guru dan kepala sekolah di tempatnya mengajar. “Saya akan memberikan advokasi kepada ibu Armayanir hingga tidak dimutasi atau haknya sebagai guru tidak dihilangkan,” papar Sayhuti didampingi Sekretarisnya Husniati Bantasyam. Di pihak lain, Kobar GB menyebutkan tentang adanya ancaman dan intimidasi bagi sanksi pelapor kecurangan UN yang bisa menimbulkan trauma bagi guru pelapor dan keluarga, hingga ia harus menarik kembali pengaduan tentang kecurangan UN di Aceh itu ke Polda Aceh. “Pencabutan kembali laporan kita murni untuk membantu guru yang tidak kuat menerima ancaman dari kepala sekolah dan guru-guru di sekolahnya,” ujarnya. (cb01/b01)

BLANGKEJEREN (Waspada) : M Nasir, 35, warga Lawe Serkei, Kec. Lawe Segala-gala, Aceh Tenggara, ditangkap aparat kepolisian di perbatasan Umah buner, karena membawa ganja kering sebanyak 50,3 kg, Jumat (4/5). Menurut Kapolres Gayo Lues AKBP Sofyan Tanjung melalui Kasat Narkoba AKP Hendra Gunawan, tersangka ditangkap di perbatasan Umah Buner, saat pihak kepolisian sedang melakukan razia rutin sekira pukul 01:00. Karena gerak-gerik tersangka mencurigakan, akhirnya kesatuan anggota Polres yang diperbantukan di perbatasan tersebut, menggeledah kendaraan yang ditumpangi tersangka, mobil kijang grand jantan BL 639 HZ. Ternyata, pihak kepolisian menemukan

ganja kering masing-masing di kabin mesin mobil, di dalam jok dinding kiri kanan mobil dan sebagian lagi dalam tas bajunya. Dari pengakuan tersangka yang disaksikan Kasat Narkoba Hendra Gunawan, barang tersebut milik Mada, warga Desa Agusen. Ia hanya mendapat upah Rp100 ribu per kilogram. Dengan tujuan Kutacane, selanjutnya setelah barang sampai ditempat, ia dijanjikan mendapat uang tunai Rp5 juta. Sedangkan mobil yang dipakai untuk mengangkut ganja kering itu ia mengaku meminjam dari temannya. Tersangka nekat melakukan itu karena terdesak ingin menutupi kredit sepeda motornya yang sudah beberapa bulan menunggak. (cjs)

17 Imum Mukim Sepakat Pantai Ulee Lheu Ditutup BANDAACEH (Waspada) : Penjabat Wali Kota Banda Aceh T Saifuddin TA mengundang 17 Imum Mukim di Kota Banda Aceh, membahas persoalan pelanggaran syariat Islam, khusus perbuatan maksiat yang terjadi selama ini di kawasan Pantai Ulee Lheu dan kawasan wisata lain di seputar kota Banda Aceh. Pertemuan di ruang rapat wali kota, Jumat (4/5) dipimpin PjWali Kota Banda Aceh T Saifuddin TA didampingi TarmiziYahya, asisten bidang pemerintahan. Wali kota pada kesempatan itu menerima berbagai masukan dari para imam mukim tersebut, yang menyangkut berbagai pelanggaran syariat di wilayah kemukiman masing-masing. Yang menarik dalam pertemuan selama dua jam itu, para mukim di Kota Banda Aceh itu sepakat kawasan Pantai Ulee Lheu yang

selama ini dijadikan tempat maksiat mudamudi, untuk sementara malam hari ditutup bagi pengungjung. Wali Kota Banda Aceh T Saifuddin mendukung dan merespon apa yang dilakukan kaum ibu majelis taklim dan warga Meuraxa yang menutup kawasan wisata Pantai Ulee Lheue dari perbuatan maksiat, karena dinilai telah meresahkan masyarakat. “Sebenarnya Pantai Ulee lheue tidak kita tutup, tapi kita batasi pada pukul 18:00 dan malamnya kita tutup bagi pengunjung,” papar Saifuddin. Karenanya, untuk memberantas maksiat itu tidak mampu dilakukan oleh Pemko saja, tapi harus ada dukungan para ulama, Imum Mukim, ibu-ibu majelis taklim dan elemen masyarakat lainnya.(b02)

PNS Pertanyakan Rapel 10 Persen IDI (Waspada) : Kalangan PNS di Aceh Timur mempertanyakan rapel kenaikan gaji sebesar 10 persen berdasarkan Peraturan Pemerintah (PP) Nomor 15 Tahun 2012. Pasalnya, hingga Mei 2012 rapel tersebut belum diterima. Menurut Sekjend LSM Aceh Peduli Pendidikan (APP-NAD) Yusnil Amri, Kamis (3/5) di Idi. Menurutnya, rapel PNS termasuk guru di wilayah Aceh Timur hingga kini belum jelas pembayarannya. Bahkan pihaknya banyak menerima keluhan para PNS dan guru terkait gaji rapel itu. Kata Yusnil Amri, pihak guru dan PNS lain di Aceh Timur mengharapkan rapel tersebut segera dibayar, karena itu merupakan hak PNS dan guru, khususnya di Aceh Timur. “Anehnya, guru dan PNS di bawah Kementerian Agama Aceh Timur kabarnya sudah menikmatinya,” katanya. Selaku lembaga peduli lembaga pendi-

dikan, lanjutYusnil Amri, pihaknya mensinyalir sengaja diperlambat proses pembayaran rapel tersebut untuk PNS termasuk guru. “Kita berharap instansi terkait segera menyelesaikan persoalan ini, karena seluruh PNS di Aceh Timur belum menikmatinya,” kata Yusnil Amri. Kadis Pendidikan Aceh Timur Agussalim melalui Sekretaris Syawaluddin mengatakan, dana rapel guru dan PNS tersebut telah dilakukan pengaprahan ke Dinas Pengelola Kekayaan Keuangan Daerah (DPKKD) Aceh Timur, namun dana tersebut belum dapat ditarik karena belum siap SP2D,” katanya. Penjabat Bupati Aceh Timur Nasrullah Muhammad MT, Kamis (3/5) mengatakan, pihaknya akan melakukan pengecekan ke DPKKD, karena proses anggaran daerah berada di instansi tersebut. “Saya akan cek dulu, nanti kita kabari lagi,” tandasnya. (b24)

Pasien Di Puskesmas Langkahan Terlantar LANGKAHAN (Waspada) : Para pasien di Puskesmas Kec. Langkahan, Aceh Utara, sering diterlantarkan oleh ulah dokter PTT dan paramedis yang kinerjanya tidak disiplin. Menurut tokoh masyarakat setempat, Rusli Rasyid, Kamis (3/5), dia bertetangga dengan Puskesmas ini dan siap menjadi saksi, bahwa dokter PTT dan paramedis di puskesmas itu tidak disiplin. Pasien terlantar hampir setiap hari,” ujar tokoh masyarakat Langkahan seraya Waspada/M Jakfar Achmad menunjukkan ibu Nursiah, TOKOH masyarakat Langkahan, Rusli Rasyid (kanan), sedang 59, warga Desa Pante Gaki mengamati daftar hadir bersama kepala TU Puskesmas Langkahan, Balee (Langkahan) di ran- Fendi (kiri), Kamis (3/5). jang akibat korban kecelakaan lalulintas. personel yang masuk tugas, Kamis (3/5), namun “Pelayanan terhadap pasien tetap terlak- seluruhnya pulang setelah menandatangani sana, tapi setiap pukul 12:00 saban hari, para absen menjelang shalat zhuhur. “Kapus di sini pasien ditangani tenaga sukarela tamatan SMA. sangat kelabakan dalam menerapkan disiplin Sedang paramedis PNS, termasuk dua dokter kerja di Puskesmas ini, kendati mereka (dokter pegawai tidak tetap (PTT) sering datang terlam- PTT dan paramedis status PNS), tetap membanbat dan pulang lebih cepat,” jelas Kepala TU del,” ungkap kepala TU. dr Lukman, Jumat (4/5) membenarkan ia Puskesmas itu, Fendi. Rusli Rasyid selaku tokoh masyarakat tidak tinggal di rumah dinas Puskesmas dalam masa dua bulan terakhir ini. “Puskesmas Langmengajak kepala tata usaha (TU) untuk melihat kahan, belum ada ruang rawat inap sehingga absen. Atas izin Kepala Puskesmas (Kapus) Lang- dirasa tidak perlu tenaga dokter harus tinggal kahan,Muchtar,pihakTUmengajaktokohmasya- di Puskesmas,” katanya. rakat inidan para wartawan ke ruang kerja kepala Menyangkut disiplin, ia membantah datang TU. terlambat dan pulang lebih cepat. Malah, kataPada absen tersebut terungkap, dari dua nya, ia lebih cepat sampai ke tempat kerja setiap dokter PTT dan 43 paramedis PNS hanya 16 pagi. (b13)

Sengketa Lahan Warga, Sekdakab Aceh Timur Jangan Umbar Janji LANGSA (Waspada) : Lahan seluas 3.200 hektare di kawasan pedalaman Kecamatan Peudawa dan Banda Alam yang menjadi objek sengketa antara masyarakat dengan PT Bumi Flora dan PT Dewi Kencana Semesta sudah lima tahun belum ada penyelesaian. Perwakilan masyarakat yang mengaku sebagai pemilik lahan tersebut mengaku kecewa dengan sikap pemerintah setempat. Bahkan mereka menuding Sekdakab Aceh Timur Syaifannur hanya pandai mengumbar janji untuk menyelesaikan kasus tersebut. “Karena dalam pertemuan dengan perwakilan warga sekitar tiga minggu lalu, Syaifannur sudah berjanji akan menyelesaikan dalam waktu dua minggu. Namun kini sudah masuk minggu ketiga belum ada kabar apapun,” ungkap Abdullah AR kepada wartawan di Langsa, Kamis (3/5). Menurutnya, dari 3.200 hektare lahan tersebut, seluas 1.600 hektare berada di kawasan Desa Jambo Reuhat dan Seunebok Bayu, Kec.Banda Alam. Hingga sekarang belum diukur

oleh tim yang dibentuk pemerintah Aceh Timur. Demikian juga lahan 1. 600 hektare lain di Dusun Alue Minyek, Desa Buket Kuta, Kec.Peudawa. Sampai sekarang juga belum ada pengukuran sehingga proses penyelesaian semakin tidak jelas. Padahal Sekda Aceh Timur Syaifannur, kata Abdullah AR, kepada perwakilan masyarakat yang ketika itu diwakili oleh dirinya bersama M Jamil, Nasruddin dan M Jamil Pakek berjanji akan menyelesaikan kasus sengketa lahan ini pada April 2012. Akan tetapi janji itu hingga kini belum terealisasi lagi. Ketua LSM Forum Peduli Rakyat Miskin (FPRM) Nasruddin menyesalkan sikap Pemkab Aceh Timur atas lambannya penyelesaian sengketa lahan tersebut. “Sudah lima tahun berlangsung mengapa tidak tuntas,” katanya mempertanyakan. Seharusnya demi terciptanya suasana yang kondusif di masyarakat hendaknya Pemkab Aceh Timur lebih fokus menyelesaikan setiap kasus yang timbul di lingkungan masyarakat. (b20)

Sumatera Utara

WASPADA Sabtu 5 Mei 2012


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Kejari T. Balai Musnahkan Narkotika Senilai Rp5 M TANJUNGBALAI (Waspada): Barang bukti narkotika senilai Rp5 miliar dimusnahkan di halaman kantor Kejaksaan Negeri (Kejari) Kota Tanjungbalai, Jumat (4/5). Pemusnahan barang bukti dilakukan dengan cara dibakar dalamwadahtongsampah.Jenisjenis narkoba itu meliputi sabusabu seberat hampir 4 kilogram (3.938,45gram).Kemudian,daun, bijidanbatangganjakeringseberat 14.285,94 gram serta pil ekstasi sebanyak 225 butir dikalkulasikan senilai Rp5 miliar. Barangharamitumerupakan hasil sitaan dari 116 kasus yang telah memiliki kekuatan hukum tetap dari PN kurun waktu 2010 hingga 2011. Sedangkan para Jaksa Penuntut Umum yang

menanganinya ialah Kasi Intel Kifli Ramadhan Harahap, Rita S, Hentin Prb, dan lainnya. Kepala Kejari Kota TanjungbalaiWinartomengatakan,barang bukti itu merupakan sebagian kecil dari hasil sitaan Polres yang telah dimusnahkan di Mapolres beberapa waktu lalu. Dikatakan Kajari, yang didampingi Kasi Pidum Iwan S Ginting dan Kasi Intel Kifli R Harahap, sejak dulu pihaknya hanya meminta sampel dari barang bukti hasil tangkapan. “Kejaksaan hanya meminta

sampeldaribarangbuktinarkoba. Contoh, jika disita sabu seberat 1 kilogram, maka kami hanya minta sampelnya seberat 1 gram untuk menghindari hal-hal yang tidak diinginkan sebab jumlah masih minim,” kata Kajari, seraya menambahkan pemusnahan itu dilakukan untuk menyelesaikan tugas-tugas Jaksa sesuai ketentuan yang ada. SementaraSekdakotTanjungbalai Erwin S Pane mewakiliWali Kota,memberikanapresiasikepada aparatpenegakhukumKepolisian, Kejaksaan dan semua pihak atas upayauntukmencegahperedaran narkoba di kota kerang. Diaberharap,dihariberikutnya masyarakat Kota Tanjungbalai bersihdarinarkotikadanobat-obat terlarang. (a32)

Minat Pendidikan Di Asahan Masih Rendah KISARAN (Waspada): Minat pendidikan di Asahan masih tergolong rendah. Karena, selama UN 2012 SLTP dan SLTA ditemukan 285 siswa tidak ikut ujian disebabkan DO dan alasan yang tidak diketahui. Berdasarkan data dari Dinas Pendidikan Asahan, untuk SLTA ada ada 73 siswa yang tidak ikut UN dengan alasan yang belum diketahui, sedangkan untuk SLTP sedikitnya 212 yang tidak hadir, dari jumlah itu 198 siswa yang DO dan selebihnya tanpa keterangan. “Angka ini yang cukup tinggi di Asahan, karena hal ini sangat bertentangan dengan visi pembangunan di Asahan yang ingin mencerdaskan masyarakat. Namunkenyataannyamasihadanya ditemukan kasus seperti ini. Oleh sebab itu pihak Disdik, terutama pihak sekolah harus memperhatikan jumlah ini, sehingga tidak bertambah banyak,” ujar anggota DPRDAsahanIrwansyahSiagian, dikonfirmasi Waspada, Kamis (3/5). Permasalahan itu terjadi, me-

nurut Irwansyah, dikarenakan kurang dekatnya guru dengan murid, terlebih lagi dengan penempatan guru yang belum merata terutama bagi wilayah pelosok, akibatnya banyak siswa yangputussekolahdenganalasan tidak jelas. “Pemkab Asahan juga harus memahamipermasalahaninidan menanggulanginya, terutama dalam melengkapi sarana dan prasarana sekolah yang berada di pedalaman, sehingga menarik minat anak didik dalam belajar. Dengan demikian visi misi Kab. Asahan dapat terwujud dengan merata,”ujarIrwansyah,yangjuga berasal dari Fraksi Demokrat. Sekolah Pedalaman Namun, berbeda dengan dilema yang terjadi di SD Negeri 014649, Dusun X (Perdamaran), Desa Pulau Rakyat Tua, Kec. Pulau Rakyat, mulai dari 2008 hingga 2011 ujian UN tidak dilakukan karena tidak adanya siswa, dan pada 2012 baru diikutsertakan dengan jumlah siswa hanya sembilan orang. “Dari 2008- 2011 kami tidak

ada siswa mengikuti UN, karena mereka pindah ke sekolah lain. Dan kini, kami hanya mengajar 54 siswa mulai dari kelas I -VI, yang berteduh di tiga lokal yang barudibangun.Karenabangunan sebelumnyatelahrobohdimakan usia, sehingga tiga lokal itu dibagi enam demi melanjutkan aktivitas belajar mengajar,” ujar Kepala SD Negeri 014649, R Siregar dikonfirmasi Waspada. Minimnya siswa yang masuk ke SD itu, menurut Siregar, bermula disaat ruangan belajar tidak layak guna, karena sekolah yang dibangun pada 1977 lalu, sampai saat ini belum ada perbaikan. Sehingga, banyak bahan kayu yang lapuk dan sewaktu-waktu bisa roboh dan berakibat, wali murid memindahkan anaknya ke sekolah lain. Pada tahun 2009, tiga lokal runtuh dan tidak bisa digunakan. Namun hal yang memilukan hati itu, masih bisa terobati dengan dibangunnyatigaruanganbelajar, sehingga aktivitas sekolah tetap bisa berjalan, walaupun siswa harus berbagi lokal. (a15)

Pemko T. Balai Gulirkan Dana UKM Rp1,5 M TANJUNGBALAI (Waspada): Pemerintah Kota Tanjungbalai akan menggulirkan dana Usaha Kecil Menengah (UKM) kepada masyarakat, yang nilainya mencapai Rp1,5 miliar. Dana tersebut disalurkan untuk membantu meningkatkan perekonomian, khususnya masyarakat ekonomi menengah ke bawah. “Penyaluran dana bergulir iniuntukmeningkatkanekonomi kerakyatan dan kesejahteraan

masyarakat Tanjungbalai. Dan, hal ini merupakan salah satu visi misiWali Kota Thamrin Munthe dan Wakil Wali Kota Rolel Harahap,”kataWaliKotamelaluiKabag HumasDarulYanaSiregarkepada Waspada Kamis (3/5). Menurut Yana, sampai saat ini, sudah terdata 389 pelaku UKM. Dan, sebut Yana, jumlah alokasi anggaran hampir tidak seimbang dengan jumlah pendaftarataupemohon.“Danayang

tersedia Rp1,5 miliar, namun berdasarkan jumlah pemohon yang mendaftar, maka diperhitungkan dananya mencapai Rp2,3 miliar,” jelas Yana. Oleh sebab itu, lanjut Yana, Pemkotelahmembentuktimuntuk mensurveidanmenyeleksipelaku UKMyangberhakmenerimabantuandanabergulirtersebut.“Dalam waktu dekat ini survei dan seleksi, sebab saat ini masih tahap seleksi administrasi,” kataYana. (a14)

Polsek Rekonstruksi Kasus Abang Ipar Bunuh Adik INDRAPURA(Waspada): Kasus pembunuhan yang dilakukan oleh PM, 34, pada adik iparnya Sahala Tua Situmorang, 29, sebulan yang lalu, Kamis (3/ 5) dilakukan reka ulangnya oleh Polsek Indrapura. Acara reka ulang dilaksanakan di Mapolsek Indrapura, Kec. Airputih, Kab. Batubara, disaksikan langsung oleh Kapolsek Indrapura AKP. MA Ritonga, Kanit Reskrim Aiptu Tagam Simanjuntak, Jaksa Penuntut Umum B Sembiring, penasehat hukum tersangka, James Sihombing, kerabat korban dan warga, dibawah pengamanan petugas

Kepolisian dari Polres Asahan. Kepada Waspada AKP. MA Ritonga mengatakan, pelaksanaan reka ulang di Mapolsek ini untuk menghindari hal – hal yang tidak diinginkan jika dilakukan di TKP sebenarnya. Disela–selapelaksanaanreka ulang ini orang tua korban, Jabontar Situmorang mengatakan, sebenarnya tidak ada persoalan antara ia serta anak – anaknya dengan pelaku. “Tapi karena dia mencari anaknya yang pergi dari rumah ia mengamuk. Mengamuknya itu untuk menutupi aib, karenadiatelahmerusakanaknya itu,” beber Situmorang.

Dijelaskannya, selama ini menantunya itu telah dibantu secara ekonomi untuk membuka usaha,tapikarenadiamalasmodal yang diberikan habis. Untuk memenuhi kebutuhan keluarga istri dan anak pelaku mencari butut keliling kampong, tapi itupun sampai di rumah duitnya dimintai pelaku. Akhirnyaistripelakutaktahan dan pergi dari rumah, begitu juga anaknya yang diduga telah dinodai pelaku. Kasus penodaan anak kandung ini, kini tengah diproses di Polsek Pagurawan, Kec. Medang Deras karena TKPnya di sana. (c05)

Wisuda UNA Terbesar KISARAN (Waspada): Wisuda Universitas Asahan (UNA) merupakan terbesar di Kab. Asahan dengan jumlah peserta 1.230 orang, sehingga acara dilakukan selama dua hari, 2 dan 3 Mei 2012. Rektor UNA Dr. Zuriah Sitorus, M.Sc, dikonfirmasi Waspada melalui Ketua Panitia Wisuda 2012, Ir. Ramlan Tambunan, M.Sc, saat gladi bersih di Gedung Serbaguna, Jalan Akasia, Selasa (1/5) menuturkan, bahwa jumlah ini jumlah yang terbesar di Kab. Asahan, karena tahun wisuda digabungkan mulai 2009-2012, dengan angkatan dari 2005-2009, yang berasal dari Fakultas Tenik, Pertanian, Ekonomi, Hukum dan FKIP. “Acara ini dilakukan selama dua hari, dan akan dihadiri pejabat Pemkab Asahan, dan perwakilan Kopertis Wilayah I Sumut. Kita berharap acara ini berjalan dengan lancar,” ujar Ramlan. Menurut Ramlan kegiatan ini merupakan salah satu langkah kedewasaan bagi UNA untuk menjadi universitas yang lebih baik, serta menjadikan pusat ilmu pengetahuan di Asahan. “Oleh sebab itu perbaikan dan perubahan terus dilakukan, sehingga UNA bisa lebih maju di masa akan mendatang,” ujar Ramlan. (a15)

Waspada/Rasudin Sihotang

KAJARI Tanjungbalai Winarto (dua kiri) memimpin pembakaran narkoba senilai Rp5 miliar.

Pukat Trawl Dan Grandong Beroperasi Di Perairan Batubara TG. TIRAM (Waspada): Ratusan nelayan berskala bertangkahan di perairan Batubara merasa tidak aman melaut dan terjepit akibat pengoperasian pukat trawl sejenisnya maupun pukat grandong, sampai sekarang belum dapat diantasipasi. Sehingga berdampak terhadap merosotnya hasil tangkapan mereka. ‘’Pengoperasian pukat trawl secara terangterangan dan mengancam kehidupan mereka menangkap ikan di laut,’’ tukas beberapa nelayan berskala kecil yang bertangkahan di Sungai Batubara kiri dan kanan Desa Bagan Dalam, Bogak dan Masjid Lama, Kec. Tanjungtiram dan Talawi kepada Waspada, Jumat (4/5). Hal sama tegaskan Badrul, 55, nelayan asal Desa Perupuk Kec. Limapuluh keberadaan pukat trawl mengganggu mata pencarian di laut. Sebab dalam operasinya pukat ikan meresahkan ini menangguk pada kedalaman air hingga mencapai lumpur dasar tanah menyikat segala jenis ikan baik berukuran kecil maupun besar. ‘’Jika ini terus dibiarkan tanpa ditertibkan kita khawatir papolasi ikan terancam punah,’’ ujarnya, sembari mengatakan puluhan pukat trawl milik pengusaha kuat asal tempatan maupun Tanjungbalai setiap hari beroperasi menyapu populasiikansehinggamerosotnyahasiltangkapan. ‘’Inilah hasil tangkapan satu hari didapat paling

pun ada sekilo atau dua kilogram ikan,’’ tukas Ridwan menunjukkan hasil tangkapannya sepulang dari laut. Mohon penertiban Menyikapi keluhan nelayan atas pengoperasian pukat trawl dan sejenisnya Bupati Batubara H. OK Arya Zulkarnain, SH, MM lewat surat No:523/2666 ditujukan kepada Dan Lanal Tanjungbalai/Asahan perihal penertiban pukat grandong di perairan itu. Surat bupati tersebut sehubungan laporan dari masyarakat nelayan berskala kecil, di mana pengoperasianpukattrawl(grandong)mengganggu dan meresahkan. Kemudian disampaikan bahwa boat/kapal ikan trawl sebagian besar dari Tanjungbalai beroperasi di perairan laut Batubara atau dua mil dari pinggir pantai (jalur 1 A). Dinas Kelautan dan Perikanan Kab. Batubara berupaya melakukan kegiatan dan pengawasan sumber daya laut, karena keterbatasan personel dan sarana yang ada sehingga kurang maksimal. ‘’Berkenaan itu, kami mohon kepada Dan Lanal Tanjungbalai untuk membantu dan bekerja sama dalam rangka pengawasan dan penertiban pukat trawl,’’ tukas Bupati dalam surat tertanggal 2 Mei 2012, yang tembusannya disampaikan kepada Dan Pos-AL Tanjungtiram, HNSI Batubara dan Satker PSDKP Tanjungbalai. (a13)

Pemkab Asahan Capai Target e-KTP KISARAN (Waspada): Pelayanan Kartu Tanda Penduduk Elektronik (e-KTP) di Kab. Asahan telah berakhir, Senin (30/4) yang lalu. Pemkab Asahan mencapai target sesuai yang ditetapkan Mendagri Gamawan Fauzi. Kepala Disdukcapil Kab. Asahan Ismet, SH kepada Waspada, Jumat (4/5) menyatakan, jumlah wajib kartu tanda penduduk dari Dirjen Dukcapil adalah 511.419 penduduk, dan hasil dari pelaksanaan perekaman e-KTP sampai batas akhir telah mencapai 401.250 penduduk dari 25 kecamatan yang ada di Kab. Asahan. Ismet menambahkan, sebanyak 4.417 meninggal dunia, 13.863 pindah menetap, 49.926 memiliki data/NIK ganda, dan 41.963 tidak dikenal

atau tanpa alasan. “Jadi, dengan jumlah yang demikian, kita telah mencapai target yang ditentukan Dirjen Dukcapil Pusat,” ujar Ismet didampingi Kabid Pendaftaran Ali Mughofar, S.Sos, MAP. “Bupati Asahan melalui Disdukcapil Kab. Asahan telah menyurati Dirjen Dukcapil Pusat agar dapat segera mengirim e-KTP yang telah selesai untuk dapat didistribusikan kepada masyarakat,” ujar Ismet. Secara terpisah Camat Kota Kisaran Timur Rahmad Hidayat Siregar, S.Sos, MS.i kepada Waspada mengatakan, sesuai pemutakhiran data, terakhir pelayanan e-KTP di tempatnya mencapai target. (a31)

E-KTP Labusel Capai 91 Persen KOTAPINANG (Waspada):Target perekaman elektronik-KartuTanda Penduduk (e-KTP) di Kab. Labuhanbatu Selatan (Labusel) untuk gelombang pertama hingga kini mencapai 91 persen lebih. Diperkirakan, hingga akhir Mei target perekaman sudah selesai 100 persen. Hal itu diungkap Kepala Disdukcapil Labusel, Amran Utheh kepada Waspada, Kamis (3/5). Menurutnya, dari 169.355 orang warga target saat ini sudah 91 persen terekam datanya. “Kalau melihat jumlah ini, akhir Mei saya kira sudah selesai,” katanya. Utheh menyebutkan, meski waktu perekaman telah melampaui batas waktu 30 April 2012 pencapaian target nasional e-KTP masih terus dilakukan perekaman secara reguler. “Maksud program reguler adalah perekaman e-KTP yang melewati 30 April 2012. Perekaman reguler ini masih terus dilakukan sampai kuota terpenuhi,” katanya. Menurutnya,kecamatanpalingmenonjolyang

warganya mendatangi kantor kecamatan untuk melakukan pendataan adalah Kec. Torgamba. “Untuk Kec. Torgamba ini, animo masyarakat yang melakukan perekaman e-KTP masih cukup lumayan banyak. Seperti kemarin hampir 300 wargadalamsatuhariitusaja.Sedangkankecamatan lainnya sekitar 100 lebih per harinya,” katanya. Namun Utheh tidak yakin dapat mencapai target100persensecaramenyeluruh.Menurutnya, tidak tercapainya realisasi target e-KTP tersebut dipengaruhi beberapa fakor di antaranya, terjadinya perpindahan penduduk dan kemungkinan warga yang berusia diatas 60- an tahun enggan datang melakukan perekaman. Disinggung mengenai pencetakan KTP tersebut, Utheh mengaku belum tahu. Pada pencetakan tahap awal beberapa bulan lalu, kata dia, Kemendagri telah mengirim 100 KTP untuk setiap kecamatan di Labusel, namun terdapat kesalahan pada KTP tersebut, sehingga pihaknya mengembalikannya ke Pusat. (c18)

Persidangan Harus Hakim Tunggal TANJUNGBALAI (Waspada): Seorang kakek Ngat, 53, menjalani sidang kasus pencurian buah kelapa sawit dengan kerugian Rp50 ribu yang dituduhkan terhadapnya di Pengadilan Negeri (PN) Kota Tanjungbalai, Rabu (2/5). Sidang itu dipimpin langsung Ketua PN Kota Tanjungbalai Sugiyo Mulyoto dengan Hakim Anggota Rinto Leoni Manullang dan Tanti Helen ManaludenganPaniterPenggantiMaradenSilalahi. Kuasa Hukum terdakwa Musa Setiawan kepada Waspada mengatakan, sesuai Peraturan Mahkamah Agung No. 02 Tahun 2012 tentang Penyesuaian Batasan Tindak Pidana Ringan dan Jumlah Denda dalam KUHP Pasal (2) menyatakan, apabila nilai barang atau uang kerugian bernilai tidak lebih Rp2.500.000, Ketua Pengadilan segera

menetapkan Hakim Tunggal untuk memeriksa, mengadili dan memutus perkara tersebut. “Jadi, sesua dengan Per MA tersebut, seharusnya terdakwa hanya di sidang oleh hakim tunggal dan tidak ditahan, tapi kenyataannya dia harus disidang oleh tiga hakim. Selain itu, klien saya juga ditahan, dan ini bertentangan dengan Per MA. Saat ini saya telah mengajukan penangguhan penahan terhadap klien saya,” kata Musa. Sidangkaliitumerupakankeduadigelardengan menghadirkan pelapor Salamuddin Selian yang mengakupemiliksahlahansawit.Jugaturutdalam persidangan saksi bernama Zainal Abidin sebagai orang yang yang disuruh pelapor menanam sawitnya beberapa tahun lalu. (a32)

Kapolres Resmikan Mobil Sentral Pelayanan Di Desa Terpencil

Hardiknas Di Batubara LIMAPULUH (Waspada): Bupati H. OK Arya Zulkarnain, SH, MM bertindak sebagai pembina upacara pada peringatan Hari Pendidikan Nasional (Hardiknas) yang berlangsung di lapangan sepak bola, Kec. Limapuluh, Kab. Batubara, Rabu (2/5). Bupati OK Arya mengharapkan pendidikan semakin berkualitas dan terbuka bagi seluruh masyarakat. “Dalam dunia pendidikan kita sebagai pemeran utama baik subyek maupun obyek. Keilmuan sebagai media memanusiakan sebagaimana tujuan,” ujarnya. (a13)


Waspada/Agusdiansyah Hasibuan

TERSANGKA PM memperagakan penikaman yang dilakukannya kepada adik iparnya Sahala Tua Situmorang, diperankan anggota Polsek Indrapura, pada reka ulang.

RANTAUPRAPAT (Waspada): Kapolres Labuhanbatu AKBP HirbakWahyu Setiawan SIK meresmikan Mobil Keliling Sentral Pelayanan Kepolisian di Desa Batu Tunggal, Aek Buru, Ke. Na IX-X Labura, baru-baru ini Kapolres mengatakan, dengan keberadaan mobil keliling Sentral Pelayanan Kepolisian itu, masyarakat di pelosok terpencil pun sudah bisa lebihcepatmelakukanpengaduandanmelaporkan kejadian atau tindakan criminal, sehingga makin cepat polisi datang. “Jadi kalau ada kejadian atau pengaduan maupun urusan pelayanan berhubungan polisi, tidak perlu lagi ke Polres atau ke Polsek setempat , langsung ke Mobil Keliling Sentral Pelayanan,” kata Kapolres. “Bentuk pokok persoalan warga maupun

pengaduan masyarakat seperti : pencurian, penganiayaan, perkelahian, ninja getah, ninja sawit, narkoba ataupun pencurian kenderaan bermotor bahkan surat keterangan lapor diri misalnyakeberadaanorangasing,mengurusSKCK ataupunmengurusizinhiburan(keramaian)untuk acara pesta, sudah dapat ditampung oleh petugas di Mobil Keliling Sentral Pelayanan,” kata Hirbak. Kapolresmenjelaskan,khususkasuspermasalahan tanah atau bentuk konflik lahan tanah, tidak bisa ditampung oleh petugas di Mobil Keliling Sentral Pelayanan, karena proses pemeriksaan saksi-saksi harus selayaknya dilakukan di Polres. “KeterbatasanpelayanandiMobilSentraliniadalah tidak bisa menerima atau memproses kasus tanah atau sengketa lahan”, kata Hirbak Wahyu. (a17)


WASPADA Sabtu 5 Mei 2012

Irwandi Ucapkan Selamat Untuk Gubernur Aceh Terpilih

Rp3,7 Miliar Jerih Payah 609 Keuchiek Sudah Dibayar BIREUEN (Waspada) : Uang jerih payah 609 keuchiek dan perangkat gampong untuk 17 kecamatan di Bireuen triwulan pertama Januari–Maret 2012 sebesar Rp3,7 miliar sudah dibayar melalui bendarawan kecamatan, Rabu (2/5). Kadis Pengelola Keuangan Daerah Tarmisi mengemukakan hal itu di kantornya, Kamis (3/5). Selain jerih payah keuchiek, juga termasuk jerih payah perangkat gampong, Tuha Peuet, Tuha Lapan dan kepala dusun, tidak termauk sekretaris desa yang sudah diangkat jadi PNS. Sementara jerih payah 75 Imum Mukim dan Imum Chiek pmbayarannya melalui Dinas Syari’at Islam dan sudah dibayar Selasa (1/5). (b12)

Muspika Kuta Blang Gelar Sosialisasi Donor Darah KUTABLANG (Waspada) : Masyarakat Kecamatan Kuta Blang mengikuti sosialisasi tentang manfaat donor darah di balai pertemuan Kec. Kuta Blang, Rabu (2/5). Sosialisasi donor darah itu disponsori Muspika Kuta Blang bekerjasama Unit Transfusi Darah (UTD) RSUD Dr Fauziah dan PMI Cabang Bireuen. Dan Ramil Kuta Blang Kapten Inf Dito, Kamis (3/5) mengatakan, peserta sosialisasi donor darah diikuti para keuchiek beserta lima warga masing-masing desa dari 41 desa di Kuta Blang. Dikatakan, dalam rangkaian melaksanakan sosialisasi donor darah sebagian warga langsung mendonor darah dan terkumpul 54 kantong darah yang disumbangkan untuk kebutuhan pasien di RSUD Dr Fauziah Bireuen. Menurut Kapten Dito, kegiatan donor darah ini sudah dilaku-kan secara rutin terhadap masyarakat, anggota TNI/ Polri dan PNS di Bireuen sebagai kegiatan sosial kemanusiaan untuk membantu kebutuhan darah di rumah sakit. (b12)

Polisi Sosialisasi Hukum Lewat Mimbar Jumat LANGKAHAN (Waspada) : Jajaran Polsek Langkahan, Aceh Utara, mensosialisasi hukum dan tugas kepolisian lewat mimbar Jumat. “Program ini melibatkan seluruh khatib di Kecamatan Langka-han,” kata Kapolsek Langkahan Iptu M Jafaruddin, Kamis (3/5). Kapolsek menambahkan, program tersebut bertujuan meningkatkan kesadaran hukum masyarakat sekaligus mengurangi kasus pelanggaran hukum dan angka kriminal. “Kita senga-ja memilih khatib sebagai perantara supaya program ini efektif. Kalau khatib yang ngomong, pasti didengar masyarakat, “ tutur M Jafaruddin. (b19)

Guru Dan Murid MI Aceh Utara Ikrar UN Jujur LHOKSEUMAWE (Waspada) : 1.681 Murid Madrasah Ibtidaiyah (MI) di Aceh Utara bersama para guru berikrar untuk mengikuti Ujian Nasional (UN) secara jujur dan berprestasi. Untuk mengawasi kejujuran yang diikrarkan di sekolah masing-masing, Kandepag Aceh Utara telah membentuk tim monitoring. Kepala Kantor Kementerian Agama Aceh Utara melalui staf Mapenda mengakui, Kandepag telah menyebarkan ikrar bersama untuk UN jujur. “Kita telah menyampaikan ke MI melalui Koordinator Kelompok Kerja Kepala MI (K3MI),” jelas staf Mapenda, Maimun, Jumat (4/5). UN untuk murid Kelas VI MI dilaksanakan serentak selama tiga hari mulai Senin (7/5). Koordinator K3MI Aceh Utara, Muhammad Yunus mengakui telah menyampaikan surat edaran tersebut ke seluruh kepala MI. “Kita adakan upacara khusus untuk membacakan ikrar yang diikuti peserta didik, tenaga pendidik dan komite madrasah,” jelas MuhammadYunus. Selain itu di sekolah-sekolah juga dipasang spanduk tentang ikrar UN jujur. Dia juga telah berpesan dalam upacara itu, UN madrasah di lingkungan Kementerian Agama harus menjadi momen pembelajaran dalam menilai kemampuan murid. (b15)

Pasangan Mesum Diamankan Di Kantor Pol PP-WH SUBULUSSALAM (Waspada) : Pasangan mesum saat berada dalam satu rumah kost seorang wanita, Sabtu (28/ 4) malam, diamankan personil Satpol PP danWH Subulussalam ke kantor terkait. Wakil Komandan Satpol PP danWH Subulussalam, Rahmat Lubis, Rabu (2/5) di Subulussalam mengatakan, kronologis penangkapan berdasarkan laporan masyarakat. Dikatakan, rumah kost kediaman wanita di lorong SD III Desa Subulussalam Utara, Kec. Simpang Kiri, dilaporkan sering dikunjungi lelaki ER, 34, warga Desa Pasir Panjang, seorang tenaga honorer SDN. Sementara teman wanitanya, SP, 27, warga Desa Lipat Kajang, Kec. Simpang Kanan, Aceh Singkil, aktif di PNPM MP. Menurutnya, warga terkait sangat kesal dengan prilaku ER dan SP. Sebagai bentuk protes, mereka hanya melempari atap rumah kost SP agar keduanya tidak terlalu jauh malam berdua. (b28)

Timsus Polda Aceh Ciduk 3 Pelaku Demo Anarkis BLANGKEJEREN (Waspada) : Pihak kepolisian Gayo Lues yang bekerjasama dengan Polda Aceh, kembali menciduk tiga pelaku demo anarkis yang telah merusak fasilitas negara, pasca Pilkada lalu. Antara lain yang ditangkap Tim khusus Polda Aceh, Ran, 35, alias Rambo warga Desa Kutapanjang, Tarmihim, 42, warga Desa Blower (status masih dalam tahanan LP Blangkejeren), Nasarudin Lubis alias Acong, warga Desa Blangjerango. “Ketiga pendemo anarkis ini, ditangkap dan sekarang mereka telah dibawa ke Polda Aceh oleh Timsus Polda, guna dimintai keterangan lebih lanjut, kemungkinan pelaku bakal bertambah banyak,“ kata Kapolres AKBP Sofyan Tanjung, Jumat (4/5). Dikatakan Kapolres, Timsus dari Polda Aceh, jumlahnya tidak terbatas, tergantung kebutuhan di lapangan dan sebelum kasus ini tuntas, mereka masih tetap siaga di Gayo Lues. Kapolres menjawab, otak pelaku yang memprakarsai serta memfasilitasi pendemo anarkis tersebut, hingga kini belum terungkap, karena masih dalam penyelidikan dan pengembangan lebih lanjut. (cjs)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.



Waspada/Mustafa Kamal

DANREM 011/Lilawangsa Kolonel Inf A Rachim Siregar meletakkan karangan bunga di Tugu Taman Makam Pahlawan Gampong Blang Payang, Kec.Muara Dua, Lhokseumawe, Jumat (4/5).

Tim Mabes Polri-Polda Aceh Ke Rawa Tripa BANDAACEH (Waspada): Tim Mabes Polri dan Polda Aceh, Kamis (3/5) turun ke lokasi Rawa Tripa di Nagan Raya untuk mempelajari kasus pemberian izin perkebunan di lahan gambut Rawa Tripa.

Dalam laporan yang disampaikan ke Mabes Polri 23 November 2011 itu disebutkan, kebijakan Irwandi Yusuf mengeluarkan Izin Budi Daya Perkebunan tersebut melawan hukum, antara lain Instruksi Presiden No.10/2011 tentang Penundaan Izin Baru di kawasan Gambut. “Pasalnya, izin konsesi kelapa sawit yang diterbitkan lokasinya berada di dalam daerah gambut Rawa Tripa,” papar Walhi Aceh dalam laporan itu. Selain itu juga bertentangan dengan PP No. 26/2008 tentang Rencana Tata Ruang Nasional. Berdasarkan PP tersebut, Kawasan Ekosistem Leuser telah ditetapkan sebagai kawasan lindung dan berstatus sebagai kawasan strategis nasional.

Sebelum menurunkan tim, Mabes Polri sempat melimpahkan laporan itu ke Polda Aceh melalui surat No.B/4432/Ops/ XI/2011/Bareskrim, dengan alasan objek perkara yang dilaporklan dan para pihak terkait berdomisili di Aceh. Namun dalam surat No.B/ 4472/Ops/XI/2011/Bareskrim, tertanggal 25 November 2011, Kapolri melalui Kepala Bareskrim Polri Brigadir Jenderal Polisi Acmad Hidayat meminta Polda Aceh melaksanakan gelar perkara intern untuk menentukan apakah kasus yang dilaporkan lembaga peduli lingkungan itu dengan terlapor Irwandi Yusuf dan kawan-kawan, masuk dalam delik pidana atau bukan. (b05)

Kapolda Aceh Irjen Pol Iskandar Hasan yang ditanyai wartawan kemarin membenarkan dirinya sudah menerima laporan tentang rencana tim dari Mabes Polri turun ke lokasi. “Tetapi hasilnya belum dapat karena kemarin) mereka ke lokasi dibantu tim dari Polda Aceh,” jelas Kapolda Aceh. Menurut jenderal polisi bintang dua itu, pihaknya tetap melakukan penindakan hukum terkait lahan gambut tersebut. “Siapapun yang terlibat, baik perusahaan atau siapapun, tetap akan kita proses,” tuturnya. Kedatangan tim Mabes Polri ke Aceh terkait dengan laporan sebuah LSM soal penerbitan Izin Budi Daya Perkebunan seluas 1.605 hektare oleh Gubernur Aceh semasa Irwandi Yusuf, yang lokasinya berada di Kawasan Ekosistem Leuser, Nagan Raya.

LHOKSUKON (Waspada) : MN, 63, kakek tersangka kasus pencabulan terhadap bocah perempuan kelas 3 SD, dikenakan Pasal 82 Undang-Undang Nomor 23 Tahun 2002 tentang Perlindungan Anak, dengan ancaman hukuman maksimal 14 tahun penjara. “Kita sudah memeriksa sejumlah saksi, termasuk saksi korban. Mungkin dalam pekan ini, berkasnya sudah bisa kita limpahkan ke jaksa,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kasat Reskrim AKP Marzuki, Jumat (4/5). MN, warga Desa Tanjong Dalam, Kec. Langkahan, Aceh Utara, ditangkap setelah mencabuli seorang bocah kelas tiga SD, sebut saja Bunga, 9, juga warga Langkahan, Senin (30/4) malam. (b19)

MEUREUDU (Waspada) : Aliansi Mahasiswa Peduli Pidie Jaya (AMP2J) mendesak Bupati Pidie Jaya untuk mempertimbangkan pelaksanaan Pekan Kebudayaan Pidie Jaya (PKPJ) III yang dijadwalkan digelar pertengahan tahun ini. Pasalnya, menurut Aliansi Mahasiswa Peduli Pidie Jaya itu, PKPJ bukanlah kegiatan yang dapat mensejahterakan masyarakat setempat, tapi sebaliknya hanya untuk menghamburhamburkan uang rakyat. “Hendaknya Bupati Pidie Jaya lebih fokus pada pemberdayaan ekonomi kerakyatan,“ ungkap Ketua Umum AMP2J, Zikri, Kamis (3/5). Padahal bila dikaji ulang tentang visi misi Bupati Pidie Jaya HM Gade Salam fokusnya adalah peukong agama, peudong sikula, peusep nafakah

(maksudnya, perkuatkan agama, dirikan sekolah, cukupkan nafkah), tapi kenyataan yang terjadi melenceng dari visi misi tersebut. Sebagai bukti, pelaksanaan PKPJ yang digelar setiap tahun berefek (membuka peluang) terjadinya lumbung (perbuatan) maksiat di lokasi pelaksanaan PKPJ tersebut seperti yang terjadi tahun-tahun sebelumnya, khususnya pada malam hari. “Jika ini yang terjadi bukan memperkuat agama namanya. Di Pidie Jaya masih banyak lembaga pendidikan di bawah standar, semestinya bupati membuat perpustakaan di Pidie Jaya demi meningkatkan mutu pendidikan (peudong sikula), bukan mengalokasikan dana untuk PKPJ sebesar Rp820 juta melalui Peraturan Bupati (Perbub), se-

Kakek Cabul Terancam 14 Tahun

BANDAACEH (Waspada) : Mantan Gubernur Aceh Irwandi Yusuf mengucapkan selamat atas terpilihnya Zaini Abdullah dan Muzakir Manaf sebagai Gubernur dan Wakil Gubernur Aceh periode 2012-2017 dalam Pilkada 9 April lalu. “Saya mengucapkan selamat dan sukses kepada pasangan Zaini-Muzakir Manaf sebagai Gubernur dan Wagub terpilih periode 20122017 dengan keputusan yang dibacakan Hakim Ketua MK dengan berbagai pertimbangan meliputi pertimbangan politik, keamanan dan keuangan,” papar Irwandi. Menurut Irwandi, gugatan yang diajukan itu memang sudah diperkirakan hasilnya begitu bahkan sebelum gugatannya sendiri diajukan. “Tujuan gugatan itu bukan untuk menang-menangan, melainkan untuk pembelajaran politik kepada rakyat Aceh yang saya cintai agar agenda politik di masa depan dapat dilakukan secara santun dan beradab,” tuturnya.

Karena itu, dirinya mengucapkan terimakasih pada seluruh rakyat Aceh semasa kepemimpinannya sebagai gubernur sejak 2007 hingga 8 Februari lalu. “Saya mengucapkan terimakasih kepada seluruh rakyat Aceh yang telah menyertai kepemimpinan kami pada periode 2007-2012 dengan sukses, aman, dan damai, serta partisipasi mereka dalam pilkada 2012 yang berlangsung penuh dinamika. Ucapan selamat juga kami sampaikan kepada tim pemenangan ZIKIR yang bekerja gigih dengan cara-cara dan strategi jitu yang mengantarkan Zaini Abdullah dan Muzakir Manaf ke puncak kekuasaan Aceh,” kata Irwandi. Irwandi juga meminta maaf kepada korban kekerasan akibat pilkada 9 April lalu. “Atas nama Gubernur Aceh periode 2007-2012, saya meminta maaf kepada keluarga yang telah menjadi korban kekerasan politik selama proses pilkada Aceh,” katanya. (b08)

Warga Subulussalam Sambut MTQ Tingkat Provinsi SUBULUSSALAM (Waspada) : Ditetapkan seba-gai tuan rumah Musabaqah Tilawatil Quran (MTQ) ke-31 Tingkat Provinsi Aceh 2013, para Kepala SKPK, pimpinan perusahaan dan semua komponen masyarakat se-Kota Subulussalam diminta membuat spanduk. Wali Kota Subulussalam Merah Sakti pada sosialisasi MTQ tingkat Provinsi Aceh, Rabu (2/5) di aula Setdako Subulussalam mengatakan, terbitnya SK Pj Gubernur Aceh Tarmizi Karim per 19 April 2012 tentang penetapan Subulussalam sebagai tuan rumah MTQ ke-31 mengharuskan masyarakat Subulussalam menyambut gembira, sembari melakukan persiapan dalam semua aspek. “Setuju atau tidak setuju penetapan Subulussalam sebagai tuan rumah MTQ tahun 2013, saya minta semua pihak mulai memasang spanduk dukungan,” tegas Sakti sembari menawarkan spanduk bertuliskan ‘Mari Kita Sukses-

kan MTQ Tingkat Provinsi Aceh Tahun 2013 di Kota Subulussalam’. Dikatakan, ada salah satu kabupaten di Aceh yang masuk lima besar MTQ lalu dengan menghabiskan biaya Rp1,3 miliar. “Bagaimana Subulussalam 2013,” tandas Usni memastikan perlunya persiapan dini dalam semua aspek. Sementara MTQ ke-3 Kota Subulussalam yang dijadwalkan Oktober 2012 di Kec. Penanggalan hingga saat ini belum terlihat persiapan berarti. “Rapat-rapat juga belum ada,” kata Rahmat Lubis, Ketua LPTQ Kec. Penanggalan, Jumat (4/5) yang mengaku beberapa kali dikonfirmasi warga terkait MTQ di sana. Sementara Hermaini, Ketua LPTQ Kota Subulussalam mengemukakan, untuk sementara anggaran disetujui Rp800 juta, padahal pihaknya menganggarkan Rp1 miliar lebih. “Banyak fasilitas yang diperlukan, termasuk tribun utama,” kata Hermaini. (b28)

13 Rumah Ibadah Tanpa Izin Disegel SURO (Waspada) : Hari kedua turun ke lapangan, Tim Penertiban yang dibentuk Bupati Aceh Singkil kembali menyegel 13 rumah ibadah dan Undung – undung Tanpa Izin yang tersebar di tiga kecamatan di Aceh Singkil. Penyegelan tersebut sempat diwarnai tangis histeris dari para jamaat dan undung – undung yang tidak rela rumah ibadahnya disegel. Pantauan Waspada, Kamis (3/5) di lokasi menunjukkan penyegelan rumah ibadah non muslim itu berlangsung aman dan tidak ada perlawanan dari jemaat, kendati demikian upaya negosiasi dengan Bupati Aceh Singkil tetap diberikan kepada panitia pengurus rumah ibadah dan Undung – undung guna mencari solusi tidak terkendalanya para jemaat melakukan ibadah pasca penyegelan Tim Penertiban Pem-

kab Aceh Singkil yang diketuai Zainal Abidin, Asisten II Setdakab Aceh Singkil. Penjabat Bupati Aceh Singkil Razali AR mengatakan, tindakan dilakukan penyegelan terhadap rumah ibadah yang tidak memiliki izin mendirikan bangunan semata – mata mencegah agar tidak terjadi konflik antar umat beragama di Aceh Singkil. Karena sebelumnya sudah dilakukan kesepakatan antar umat beragama melalui FKUB Aeh Singkil yang hanya memberikan izin pendirian satu gereja dan empat Undung – undung bagi masyarakat non muslim di Aceh Singkil. Dan untuk menjaga keharmonisan antar umat beragama di Aceh Singkil, Pj Bupati Razali akan mengupayakan payung hukum melalui pembentukan Qanun setelah berkonsultasi dengan Pemerintah Aceh (cb02)

Lagi, 3 Pelaku Perusakan Bupati Pijay Diminta Stop PKPJ III Gedung DPRK Agara Jadi Tersangka mentara ekonomi masyarakat makin terpuruk dan angka kemiskinan serta pengangguran meningkat (peeusep nafkah). Dana Rp820 juta menjadi tanda tanya, sementara masih banyak kaum dhuafa yang belum mendapatkan bantuan rumah. Pihak AMP2J salut terhadap apa yang telah dilakukan lembaga DPRK Pidie Jaya yang tidak menyetujui pelaksanaan PKPJ dilakukan setiap tahun. “Karenanya kami dari kalangan OKP dan Ormas di Pidie Jaya mendukung keputusan DPRK setempat yang mengusulkan agar PKPJ itu diadakan dalam tiga tahun sekali saja. Dalam masalah ini segenap OKP dan Ormas merekomendasikan untuk penyetopan pelaksanaan PKPJ III digelar tahun ini. (b09

Pedalaman Sawang Butuh Jalan Layak S AWA N G ( Wa s p a d a ) : Sejumlah desa di pedalaman Kecamatan Sawang, Aceh Utara, saat ini membutuhkan jalan layak untuk dilalui kendaraan, paling tidak sepedamotor dan becak angkut hasil pertanian. Sementara kini kondisinya sangat tidak layak untuk kebutuhan manusia. Kondisi jalan ini memiliki panjang 13,5 km, lebar 8 meter dan tipe jalan berbatuan. Jalan tersebut melintasi empat desa pedalaman Kec. Sawang, mulai Gampong Kubu, Blang Cut, Lhok Cut dan Gunci. “Khusus desa kami, melintasi enam dusun, mulai Dusun Gunci, Alu Anoe, Paya Rubek Baroh, Paya Rubek Tunong dan Alu Meuh,” ucap Keuchik Gunci, Jamaluddin. Menurutnya, sepanjang itu, 8 km di antaranya merupakan pengerasan dari akhir 2009 bersumber anggaran Paket Multiyears (proyek tahun ganda) Aceh Utara. Namun kini kondisi batu-batu pengerasan itu sudah mulai timbul ke atas. Kondisi itu yang dikeluhkan masyarakat di kawasan ini. Karena, jangankan berkendaraan, berjalan kaki saja susah. Pantauan Waspada, jalan ini memiliki empat buah pendakian yang terjal, tentunya‘diwarnai’ batu-batuan yang timbul ke permukaan, dan sangat su-

KUTACANE (Waspada): Kapolres Aceh Tenggara AKBP Trisno Riyanto, Jumat (4/5) membenarkan telah menetapkan lagi tiga orang dari massa honorer sebagai tersangka terkait perusakan gedung DPRK Agara itu. “Ketiga honorer tersebut masing-masing MSaleh, honor sebagai Satpam di SMP 2 Kutacane, Afriansyah honorer Dinas Perhubungan dan Azhar, honorer pada instansi Sekdakab,” kata AKBP Trisno. Dengan berpedoman alat bukti, maka polisi telah menetapkan pada ketiga orang ini sebagai tersangka. Sebelumnya telah ditetapkan satu tersangka dalam kasus yang sama atas nama Kamisin, honorer pada

Dinas Perhubungan Agara. Dengan demikian telah 4 tersangka yang ditetapkan dalam kasus perusakan gedung dewan yang diobrak-abrik massa ketika lebih dari seratus orang menyambangi gedung dewan. Dari mereka yang mengatasnamakan tenaga honorer yang dizalimi sehubungan dikeluarkannya nama honorer nominatif 393 nama se-Agara, dua pekan lalu. Informasi dihimpun, Jumat (4/5), puluhan rekan honorer, usai shalat Jumat akan melakukan demo ke Mapolres terkait penetapan tersangka tiga teman mereka. Namun urung dilakukan, meski terpantau mereka telah berkumpul di halaman depan gedung DPRK Agara yang bersebelahan dengan Mapolres

Agara tersebut. Dibatalkannya unjuk rasa itu, ketika perwakilan mereka mendapat penjelasan dari Kapolres Agara Trisno bahwa permintaan mereka untuk dilakukan penangguhan penahanan bisa dilakukan apabila terpenuhi syarat, karena tidak mesti semua orang wajib ditahan. Fajri, perwakilan massa honorer menyebutkan, kegusaran tenaga honorer itu karena rekan seperjuangan mereka telah ditetapkan sebagai tersangka dan ditahan , sementara para peja-bat yangmelahirkanhonorersiluman belum ada dijadikan tersangka. Kapolres Trisno mengatakan, soal pejabat yang disebut itu, semua dalam proses kerja polisi, semua yang terlibat akan ditindak secara hukum. (b25)

Dokter Berhalangan, Polisi Belum Terima Hasil Visum LHOKSEUMAWE (Waspada) : Polsek Banda Sakti Lhokseumawe, hingga kini belum menerima hasil visum dari RSU Cut Mutia, terkait kematian Alimuddin, 60, petugas jaga malam di Gampong Tumpok Teungoh. Kapolsek Banda Sakti AKP, Endro Sudarsono kepada wartawan, Kamis (3/5) mengatakan, pihaknya belum menerima dan masih menunggu hasil visum jenazah Alimuddin dari RSU. “Kami telah berusaha meminta hasil visum tersebut saat jenazah korban dievakuasi ke rumah sakit sejak Minggu lalu,” katanya. Sementara menurut Koordinator LBH Banda Aceh Pos Lhokseumawe Zulfikar menilai

pihak RSU sangat lamban dalam penyerahkan hasil visum setelah beberapa hari di rumah sakit. “Itu bisa menghambat proses penyelidikan yang dilakukan polisi. Mestinya, pihak RSUCM bekerja ekstra, karena hasil visum dibutuhkan untuk mendapatkan titik terang penyebab kematian Alimuddin,” katanya. Direktur RSUCM, drg Anita melalui Kasi Pelayanan Medik, dr Abdul Mukti mengatakan bahwa polisi baru meminta hasil visum melalui surat pada Senin (30/4). “Selasa kemarin kebetulan dokter mengvisum sedang pergi ke luar kota. Visum sudah selesai dan segera diberikan kepada polisi,” katanya. (b14)

Anggota DPR-RI: Hardiknas Jangan Sebatas Seremonial Waspada/Mustafa Kamal

PENGENDARA mendorong sepeda motor karena tidak bisa mendaki bukit yang terjal. Pasalnya jalan itu terbengkalai setelah pengerasan dari dana Multiyears dan batu-batu timbul ke permukaan. sah dilalui. Kalau tidak hati-hati, bisa jatuh ke kaki bukit bersama dengan kendaraan. Pendakian bukit itu bernama Cot Gunci, Cot Peupoek dua buah dan Cot Gunong Pintoe, dan memiliki panjang rata-rata 50 meter. Selain itu, kondisi sepajang jalan tersebut terdapat delapan jembatan darurat yang terbuat dari ikatan pohon kelapa. Jembatan darurat ini, menurut pengakuan Keuchik Gunci, sering terperosok pengendara kenda-

raan. Karena bentuk jembatan hanya dibuat dari beberapa bilah pohon kelapa yang dirantai dengan kawat ikat. Anggota DPRK Aceh Utara Daerah Pemilihan Sawang, Muara Batu dan Dewantara, Tantawi Ishak mengatakan, jalan tersebut tetap diprioritaskan meski Paket Multiyears tidak lagi. Saat ini di Aceh Utara terdapat 11 paket dana Multiyears tidak jelas lagi di Kec. Sawang terdapat dua paket.(cmk)

REDELONG (Waspada) : Peringatan Hari Pendidikan Nasional (Hardiknas) 2 Mei 2012 yang mengambil tema “Bangkitnya Generasi Emas Indonesia” seharusnya jangan sekadar perayaan yang bersifat seremonial. Peringatan yang berlangsung tiap tahun ini biasanya memang dihiasi berbagai upacara, resepsi, dan kegiatan pameran pendidikan. Anggota DPR-RI Raihan Iskandar, Selasa (1/5) mengatakan, peringatan Hardiknas tahun ini tetap dihiasi oleh pidato Menteri Pendidikan dan Kebudayaan yang berkomitmen melakukan investasi besar-besaran bidang SDM. Tak hanya itu, Pemerintah pun berjanji menyiapkan akses seluas-luasnya kepada seluruh anak bangsa untuk memasuki dunia pendidikan mulai dari pendidikan anak usia dini sampai perguruan tinggi, membangun dan merehabilitasi sekolah dan ruang kelas baru secara besar-besaran. Tak hanya itu, Pemerintah

berjanji menyiapkan pendidikan menengah universal mulai 2013. Disebutkan, sudah seharusnya, pidato dan komitmen pemerintah tersebut benar-benar terwujud secara nyata. Karena, sampai sekarang masih banyak anak bangsa yang belum menikmati akses seluas-luasnya untuk memasuki dunia pendidikan. “Masih sedikit anak bangsa yang menikmati pendidikan yang bermutu. Ironisnya, keterbatasan akses itu justru dihambat kebijakan pemerintah sendiri yang membuat sekat-sekat sosial melalui stratifikasi sekolah, misalnya sekolah RSBI dan Non-RSBI,” ungkap anggota Komisi X yang membidangi pendidikan dan pariwisata. Sementara menurut Raihan, masih banyak anak bangsa yang tidak bisa menikmati bangku kuliah. Biaya kuliah yang semakin mahal, semakin menutup peluang bagi masyarakat tidak mampu untuk duduk di bangku kuliah.(b33)



Daya Serap Anggaran Lemah, Sanksi Menunggu


INGGA memasuki pertengahan tahun ini daya serap anggaran di SKPD yang ada di provinsi Sumatera Utara masih sangat minim. Bahkan menurut berita yang disiarkan harian ini, daya serap anggaran ternyata di bawah 10 persen. Sedikit mengkilas balik tentang pengajuan anggaran Pemprovsu sebenarnya akhir tahun lalu APBD sudah disahkan anggota dewan. Dari angka-angka yang diajukan Pemprovsu dan disetujui dewan anggaran tahun ini Rp6,1 triliun dengan pendapatan Rp5,755 triliun. Pendapatan itu naik Rp1,274 triliun dari Rp4,48 triliun pada APBD 2011. Sementara belanja daerah Rp6,1 triliun terdiri dari belanja tidak langsung sekira Rp2,927 triliun dan belanja langsung senilai Rp3,173 triliun. Belanja tidak langsung naik Rp895,77 miliar dari APBD 2011 Rp2,031 triliun. Belanja langsung juga mengalami kenaikan Rp526,939 miliar dari APBD 2011 Rp2,646 triliun. Prioritas pembangunan daerah 2012 masih di sektor pendidikan, kesehatan, infrastruktur, pertanian terkait ketahanan pangan. Untuk sektor pendidikan direncanakan program pendidikan usia dini, pendidikasan dasar, pendidikan menengah cakupannya lintas kabupaten/kota, bantuan kesejahteraan guru negeri dan swasta, bantuan kepada siswa miskin berupa beasiswa SD-SMA dan lainnya. Walaupun ketok palu DPRD Sumut sudah dari akhir tahun lalu namun sampai kini SKPD mulai mengeluh. Mereka menceritakan tentang sulitnya merealisasikan anggaran APBD 2012. Pemprovsu belum bersedia mencairkan dana yang dibutuhkan SKPD. Akibatnya berbagai program yang telah disusun menjadi buyar. Para Kepala SKPD itu tidak tahu mengapa Pemprovsu belum juga mencairkan dana yang diajukan dinas terkait. Padahal seluruh persyaratan yang diminta sesuai aturan sudah dilaksanakan. Hampir dapat dipastikan, dinas-dinas di Intisari lingkungan Pemprovsu belum ada yang melaksanakan program kerjanya, karena teranggaran. Anggaran yang dikeluarMekanisme reward and sendatnya kan baru sebatas membiayai kegiatan rutin, punishment terhadap seperti gaji pegawai, bayar rekening listrik, telefon dan sejenisnya (Harian Waspada edisi pemerintah daerah yang Jumat 4/5). Tahun lalu serapan anggaran hingga akhir daya serap anggarannya periode juga rendah. Hingga menjelang tutup rendah diperlukan. Kalau tahun serapan belanja APBD 2011 59,36 persen. APBD per November 2011 itu untuk tidak seperti itu kita akan Serapan belanja langsung Rp1,323 triliun dari total melihat banyak daerah Rp2,646 triliun dan belanja tidak langsung triliun dari Rp2,031 triliun. yang anggarannya relatif Rp1,453 Pemprov pasti tidak mau mengakui kalau serapan anggarannya rendah. Sebab trend rendah serapan anggaran di tiga tahun terakhir hanya meningkat tajam di akhir tahun yaitu November sampai Desember. Memang bisa dilihat contoh ketika periode akhir November 2009 serapan APBD 2009 itu di angka 57,96 persen dan di APBD 2010 mencapai 61,22 persen. Artinya apa?Walaupun hingga saat ini daya serap APBD masih lemah terutama hingga Mei tidak perlu pesimis dulu. Sebab menjelang akhir tahun nanti Pemprov bisa menggenjotnya. Kita tidak tahu caranya bisa sedrastis itu dengan bagaimana. Namun sepertinya ada kiat untuk menekan belanja daerah agar maksimal di ujung tahun. Padahal APBD itu harusnya sudah digenjot sejak disahkan. Sebab memiliki peranan penting mempercepat gerak roda pembangunan di setiap daerah, terutama menggerakkan pertumbuhan ekonomi daerah. Untuk mewujudkan hal itu, pusat sebenarnya telah mengalokasikan dana besar ke seluruh Pemda di wilayah Indonesia. Sebagai buktinya semenjak diberlakukannya desentralisasi pemerintahan delapan tahun lalu, maka saat ini hampir sepertiga dari dana APBN telah dialokasikan ke daerah. Tujuannya tidak lain adalah dalam rangka meningkatkan pelayanan publik dan sekaligus mendorong pertumbuhan ekonomi di seluruh daerah. Kalau kemudian anggaran itu tidak terserah dan ada sisa anggaran harusnya menjadi tanggungjawab daerah. Mekanisme reward and punishment terhadap pemerintah daerah yang daya serap anggarannya rendah diperlukan. Kalau tidak seperti itu kita akan melihat banyak daerah yang anggarannya relatif rendah. Mekanisme pinalti dan sanksi kepada daerah yang penyerapan anggaran rendah sebenarnya sudah ada aturannya di Kemenkeu. Tinggal pelaksanaannya saja.*


Faks 061 4510025

Facebook Smswaspada

+6282160731505 Kapolres Langkat perlu menindak Kasat Lantas Polres Langkat AKP Makmur Sitorus,karena konfirmasiWaspada tentang ‘biaya perpanjangan SIM hampir tiga kali lipat’Waspada,Sabtu (21/4) merusak citra Polri Kita tak jelas apakah pakTorus ini keseleo atau memang biasa praktek demikian, kata orang ‘menangguk di air keruh’ Katanya, tidak ada biaya tambahan diluar dari biaya yang sudah ditetapkan Namun dari pada warga berurusan langsung ke Stabat kan memakan ongkos, lagi pula mereka belum tentu lulus jika dilakukan tes. Kalau gitu Kasat Lantas PakTorus ini membagi malu korp, seakan mendapat izin atasannya boleh kutip uang SIM 3 X lipat dijamin lulus tanpa tes,kalau warga mengurus ke Stabat payah lulus mungkin berulang kali Artinya harga SIM 3X lipat beres,kalau di Stabat langsung 3 X juga belum tentu beres. Wah....wah makin parah aja pelayanan Polri di Langkat ini, tak ada malunya, tak sadar memberi aib korp sendiri.Oke..oke selamat cari duit..uit..uit..yo +6285297013331 Syair yg tgk gubah hampir sama seperti syair Ar-raqasi, ketika kekuasaan JA’FAR IBNYAHYA Al-BARMAKI berhasil diambil oleh HARUN AL-RASYID. ada yg menyebutkan kala itu syair ABU NAWAS. Alangkah menyejukan hati ksh, RASUL,KÉLUARGA, SAHABAT, TABI’IN, SALAPULSALIH’para WALI. Pengagum rubrik (AL-BAYAN). +6285262118082 SMS BERANTAI. “Ma ne papa, tolong kirimi papa doa yang banyak,sekarang papa di ALAM BARZAKH.Mohon kirim sms ini banyak2 pada teman-teman parpol, supaya papa tidak disiksa karena makan uang rakyat. Harus dikirim ya, biar tidak kualat! Baik yang mendukung atau menghujat semasa papa kampanye menjadi wakil rakyat.Oya, jangan sms papa lagi, disini tidak ada sinyal..” Mungkin kita pernah mendapat sms berantai,dari teman,keluarga,bahkan orang salah kirim.Isinya beragam,tapi kita seakan dipaksa utk mengirim kembali ke orang lain agar tdk kualat, tdk lulus ujian atau tak dapat jodoh bagi yg belum nikah dll. “Sungguh pesan yang bodoh,kalau kita masih percaya hal yg demikian. Bukankah setiap pendengaran,penglihatan&hati akan dimintai pertanggung jawaban?” Nah jika ingin ke Syurga tentu harus beribadah, ingin LuLus ujian harus rajin belajar dll,lalu Lengkapi dgn doa. Selamat mencoba ya,semoga berhasil. +6285277850101 Pilkada Aceh usai sudah pemenangnyapun tlh diketahui, kini saatnya kita terutama para /KPPS/TPS/Panwaslu/ pemenang (Cagub/Cabup/Cawakot), TS,partai atau simpatisan merenung... Jika kemenangan ini murni dari ketulusan hati nurani rakyat aceh maka akan turun rahmat Allah Swt. Namun jika kemenangan ini dari hasil rekayasa, intimidasi, kecurangan2 dan ancaman serta teror maka kita ber-siap2 menerima segala bentuk teguran dari Allah Swt. Mari kita bercermin pada hasil pilkada 5 thn yg lalu dan sekaligus mengintropeksi diri dari teguran2 dari Allah Swt atas prilaku curang kita pada pilkada priode 5 thn yang lalu. (zAs). +6283199198076 rzakh • Kita tak dapat mengelak bersembunyi untuk tidak berjumpa dengan Mala’ika t Nukar dan Nakir • Kita harus mampu menjawab secara benar terhadap Pertanya-an Pertanyaan yang diajukan Mala’ikat Nukar dan Nakir • Ma Ro bbuka == SiapakahTuhan mu ? Wa Nabiyuka == D an Nabi mu ? Wa Kitabuk a == Dan Kitab suci keya qinan mu ? Wa Qiblatika == Dan Arah Sembah Sujud mu ? Jawaban yang benar sesuai kehendak Mala’ikat Nukar dan Nakir memperoleh ketenangan disana di ’Alam Barzakh • Jawaban yang salah yan g tidak sesuai dengan konsep Mala’ikat Nukar dan Nakir memperoleh kesaki tan karena penyiksa-an y ang merupakan execute == eksekusi oleh Mala’ikat Nukar & Nakir disana ’A lam Barzakh == ’Alam Pe nantian menunggu QIYA MAT tiba dan selanjutnya; Menuju ke ’Alam Akhir == AKHERAT # to reme mber Dato^MNSejok~T e pi Barat Medan City +6287891538999 Aku tidak habis fikir tentang pilkada di Kota Sidimpuan, seperti anaknya Walkot Medan dan anak Bupati Paluta, kalau akal sehat saya cukuplah orangtuanya saja yang jadi walkot dan bupati, kenapa kita harus ambisius berilah kesempatan ke orang lain yang legelitasnya layak memimpin, nabi Muhammad Saw pernah besabda:sebaik baik pemimpin harus berumur di atas 40 thn baru biar dapat pemimpin yang arif dan bijaksana.oleh dari itu saudaraku jalan masih panjang Perbanyaklah sabar sampai umur 40.karena orang sabar kasihan allah.amin.dari dr zulkarnaen pahlevi.

WASPADA Sabtu 5 Mei 2012

Belajar Memahami Efek Gempa Terdahulu Oleh M. Anwar Siregar Wilayah relaksasi tekanan gempa terdahulu harusnya sudah “melahirkan Aceh kedua” di kawasan timur Indonesia (KTI), ada beberapa fakta yang dapat membahayakan KTI.


ejarah selalu berulang, justru kita yang tidak pernah sadar dan malas belajar. Apakah yang dilakukan ketika terjadi gempa. Pemerintah berkewajiban menunjukkan kinerja pembangunan sistim manajemen darurat dan mitigasi yang lebih baik, sehingga gempa tidak menimbulkan permasalahan psikologis bagi masyarakat di daerah rawan gempa seperti Sumatera. Namun terjadi lagi hal tragis menimpa masyarakat. Padahal sejarah telah berulangkali mengingatkan agar bangsa ini mempersiapkan segalaya, tidak larut euforia golongan—terutama dalam etika para pemimpin di parlemen dan pemerintah memiliki tingkat kepekaan merenungkan suatu kehidupan yang baik bagi rakyatnya— bahwa bangsa Indonesia akan selalu terus hidup dan akrab dengan bencana. Penyebabnya, Indonesia berada di beberapa jalur patahan atau tumbukan antar landas kontinen. Antara lain lempeng benua Asia dengan IndoAustralia, yang bergerak dan memicu gempa tektonik di Aceh-MentawaiNias-Simeulue. Zona patahannya memanjang di Samudera Hindia, dari Aceh di barat hingga sekitar Laut Timor di timur. Pergerakan tektonik lempeng di kawasan ini, seringkali memicu gempa megatrusth. Jika kekuatan gempa di dasar laut mencapai tujuh pada Skala Richter atau lebih, dengan mekanisme sesar geser naik dapat dipastikan akan terjadi gelombang pasang tsunami. Efek Tsunami Aceh Kita refleksikan dua perbandingan kejadian tsunami dalam kurun 7 tahun, berlangsung di Benua Asia. Dan merupakan daerah terawan gempa bumi di dunia yaitu Indonesia dan Jepang. Refleksi pertama melalui relaksasi tsunami Aceh yang terjadi 26 Desember 2004 sebagai bahan “peringatan” bagi Bangsa Indonesia untuk mempersiapkan segalanya. Gempa 9,1 SR, saling memicu tiga pusat subduksi gempa di Pantai Barat Sumatera. Diawali guncangan kuat di zona subduksi Aceh di Utara Simeulue, lalu memberikan respons relaksasi ke subduksi Andaman dan Nikobar dan menerus ke pantai Maladewa, Phuket, Srilanka, India, Bangladesh dan menerjang hingga Pantai Timur Afrika sejauh 1000 km. Ketinggian tsunami Aceh ke daratan adalah 15 meter dan 2-10 meter berbagai kawasan Asia Selatan, Asia Tenggara dan Pantai Timur Afrika Kekuatan terjangan gempa Aceh telah memberi efek kerentanan bagi tata ruang pulau Sumatera. Akan selalu ada kehancuran infrastruktur disebabkan terjadinya pergeseran struktur lateral pada beberapa posisi intrus-

men dasar konstruksi. Kondisi anomali kemagnetan bumi telah mengubah posisi koordinat di beberapa pulau-pulau vulkanik di kawasan Pantai Barat Sumatera sejauh 5 derajat dan pengangkatan 2-4 meter dan penurunan permukaan batimetri kelautan menjadi 1 meter. Demikian juga pelengkungan Utara Sumatera ke arah 45 derajat harus dikajian lebih lanjut untuk menyelaraskan posisi seluruh pola tata ruang yang telah terbangunkan. Efek gempa Aceh 2004 juga mengubah deformasi siklus (waktu pelepasan energi gempa) menjadi singkat. Faktanya dapat dilihat pada kejadian gempa dalam rentangan tahunan, kejadian gempa di Bengkulu 2007, 2009, Sumatera Barat 2009, 2010, Aceh 2008, 2010, 2011, 2012 dan Nias 2005. Gempa Jepang Refleksi kedua relaksasi gempa tsunami di Jepang Jumat 11 Maret hampir mendekati kekuatan kedahsyatan gempa Aceh dengan magnitude 8,9 SR. Gempa menerjang ke pulau-pulau vulkanik di Pasifik Selatan membuat 20 negara waspada tsunami hari Jumat. Kekuatan tsunami Jepang mencapai ketinggian rata-rata 110 meter menyapu kawasan pelabuhan padat di Jepang Timur, mencapai kawasan Pasifik setinggi 0,1-2 meter. Tsunami Jepang tiba di wilayah Timur Indonesia di pantai Bitung setinggi 1 meter setelah menempuh hampir enam jam (BMKG). Laju terjang tsunami Jepang terus mencapai kawasan paling Timur Indonesia di Utara Papua Barat dengan waktu jarak tempuh hampir delapan jam dengan ketinggian puncak gelombang tsunami mencapai 2 meter. Deformasi efek relaksasi gempa tsunami Jepang terbentuk pergeseran sejauh 2,5 meter terhadap sumbu bumi. Berarti akan ada pendesakan kulit bumi untuk keseimbangan dan posisi koordinat pulau vulkanik mengalami perubahan karena pengangkatan, penurunan dan pergeseran daratan. Ini harus dianggap sebagai peringatan bagi Kawasan Timur Indonesia (KTI) yang belum memiliki sistim peringatan dini terhadap tsunami—dan termasuk daerah sangat rentan mengalami efek gempa Samurai 2011 berulang kembali. Sebab, efek penjalaran seismik dari kawasan Pasifik oleh pembalikan energi relaksasi bumi masih berlangsung disepanjang ring of fire. Terutama di busur pulau vulkanik di wilayah

subduksi Jepang dan Filipina dengan terjadi gempa kuat di Selatan Philipina, ada hubungan langsung dengan subduksi Lempeng Pasifik terhadap Lempeng Eurasia. Sebab lain, dua sub Lempeng Pasifik saling menekan dan melumat Lempeng Maluku yaitu Lempeng Sangihe dan Lempeng Halmahera sehingga melapangkan ruang subduksi jadi yang salah satu penyebab seringnya letusan gunungapi di kawasan Indonesia Timur—disertai pemekaran laut sehingga gerak penekanan Lempeng Filipina lebih leluasa. Wilayah pantai Jepang secara umum masih berada dalam Lempeng Filipina kini semakin mendekati pantai lingkar Amerika Serikat akibat bergeser 4 meter disebabkan pergerakan lempeng Jepang sejauh 3,5 inchi setiap tahun. Ini berinteraksi langsung dengan zona subduksi Lempeng Pasifik yang berada di bawah Lempeng Amerika Utara. Gempa Chili Dan KTI Gempa Chili termasuk gempa kuat yang memberikan indikasi pelajaran yang perlu dipahami bagi perencana tata ruang wilayah. Karena ada pengaruh terhadap poros bumi, gempa dengan kekuatan di atas 8,0 SR sudah sering berlangsung di Chili itu salah satu penyebab percepatan gerak rotasi lebih cepat untuk mendekati poros bumi. Lamanya waktu semakin pendek sekitar 1,8 juta detik disebabkan g e m p a Je p a n g maka gempa Chili yang terbaru pada tahun 2011 semakin menegaskan pergerakan lempeng di Benua Amerika dan lempeng Jepang. Serta lempeng Eurasia semakin mendekati suatu titik pertemuan mematikan oleh efek deformasi rebound. Ini disebabkan kondisi poros bumi yang bergeser sejauh 3 inchi, Gempa Chili mempersingkat waktu satu hari per 1,26 juta detik. Gempa Aceh 2004 mempersingkat satu hari per 6,8 juta detik dan ada sebagian kerak bumi ditarik untuk menutupi ruang yang terbuka dengan mempercepat rentang waktu di bumi. Sementara wilayah relaksasi tekanan gempa terdahulu harusnya sudah “melahirkan Aceh kedua” di kawasan timur Indonesia (KTI), ada beberapa fakta yang dapat membahayakan KTI. Pertama, berada pada patahan gempa di zona subduksi Maluku-Sulawesi merupakan tipe pertemuan subduksi interplate (penumbukan antar lempeng), pergerakan yang lebih aktif adalah Lempeng Pasifik ke titik hunjaman di Lempeng Halmahera, 12 cm/tahun, Lempeng Filipina menekan subduksi Sulawesi Utara bergerak 4-5 cm/tahun ke Lempeng Sangihe, Lempeng IndoAustralia ke Lempeng Sunda-Sahul disekitar Maluku Tenggara bergerak

6 cm/tahun. Sedang Lempeng Eurasia bergerak 2 cm/tahun, wilayah ini sebenarnya merupakan daerah “penarikan selimut”. Ada gerak rotasi lempeng sedang berlangsung di subduksi Laut Sulawesi, maka sering terjadi gempa kuat dan terbentuk sebuah gunung bawah laut yang membutuhkan tempat berpijak. Kedua, lajur tekanan tsunami pada patahan Sulawesi dilintasi beberapa patahan strategis yang mendapat desakan dari Lempeng Pasifik dan Lempeng Indo-Australia ditandai pendesakan Lempeng Sangihe ke subduksi Sulawesi Utara—sebagai batas tekanan pergeseran Lempeng Pasifik-Filipina yang berinteraksi secara vertikal dengan patahan Palu-Koro dan patahan Teluk Manado—memanjang 1.300 km dari Laut Sulawesi-Selat MakassarPulau Sebatik-Pegunungan Molenggraaf-Teluk Tolo hingga ke Laut Banda. Bila terjadi gempa di pantai Barat Amerika akan selalu “menerima” tsunami. Petikan Pelajaran Dari beberapa kejadian gempa terdahulu, memberikan suatu gambaran menyeluruh bagi bangsa Indonesia agar mengupayakan tata ruang berketahanan gempa bahwa gempa yang masih berlangsung di Aceh dengan gempa susulan yang kuat—memberikan petunjuk kepada pemerintah antara lain: 1. Faktanya, telah membuktikan berulangkali gambaran kehancuran infrastruktur kota dan jumlah korban yang mati sia-sia karena dua sebab. Pertama, infrastruktur tidak sesuai standar aturan bangunan (building code). Kedua, paradigama pembangunan tata ruang yang tidak berketahanan bencana lingkungan harus ditinjau ulang kembali dengan bertumpuk pada kajian geohazard dan georisk dengan menyusun penggunaan jenis peta seperti peta spasial, geologis dan klimatologis, batimetri dan oceanografis keruangan. 2. Perubahan titik koordinat keruangan akibat perubahan siklus gempa yang semakin tidak teratur, berarti harus ada penyesuaian kondisi topografi oleh tekanan gaya-gaya bumi yang bekerja menekan pola keruangan—agar diantisipasi penempatan ruang vital dan publik dengan tata ruang berketahanan bencana dengan kesatuan sistim teknologi. 3. Penataan lembaga riset, sistim teknologi dini, data informasi dan komunikasi, serta SOP belum seragam dan serasi. Sebab realitas kondisi lingkungan sekarang masih membahayakan masyarakat dan bahwa belum semua daerah di Indonesia memiliki tata ruang yang humanis dengan lingkungan serta belum semua kota dan wilayah pantai terpasang dan terintegrasi sistim kesatuan teknologi mitigasi peringatan dini secara real time, harus ada keserasian informasi dan kelembagaan yang menangani bencana dan penelitian tentang kebencanaan geologi. 4. Budayakan edukasi mitigasi keruangan secara kontinu, agar korban diminimalisasi, namun jarang dilakukan didaerah yang rawan bencana. Penulis adalah Geolog, Pemerhati Masalah Tata Ruang Lingkungan Dan Energi Geosfer.

Revitalisasi Strategis Di Lhokseumawe Oleh Arafat Nur Kemegahan masa lalu perlahan-lahan meredup seiring dengan meredupnya api pada cerobong kilang gas PT Arun akibat menipisnya cadangan.


ebuah fakta bahwa PT Arun Natural Gas Liquefaction atau yang lebih dikenal dengan PT Arun NGL adalah perusahaan penghasil gas alam cair terbesar di Indonesia. Pada tahun 1990, PT Arun yang merupakan anak perusahaan dari Pertamina ini telah menjadi perusahaan penghasil LNG terbesar di dunia. Perusahaan yang berlokasi di Blang Lancang, Muara Satu, Pemko Lhokseumawe ini memiliki enam unit pengolahan. Tetapi saat ini hanya dua unit saja yang beroperasi lantaran menipisnya cadangan gas alam yang diperkirakan semuanya akan segera berakhir pada 2014 mendatang. PT Arun merupakan salah satu penyumbang devisa terbesar bagi Indonesia dan berdampak pula bagi Kota Lhokseumawe dan sekitarnya, yang merupakan tempat perusahaan itu berada. Dengan sendirinya pula, keberadaan sejumlah proyek vital (provit) ini, banyak mempengaruhi berbagai segi kehidupan di Aceh, dari ekonomi, sosial, budaya, sampai munculnya gejolak politik. Malahan keberadaan sejumlah perusahaan itu, termasuk ExxonMobil, PT Asean Aceh Fertilizer (AAF), PT Kertas Kraft Aceh (KKA), kilang Humpus Aromatic, dan PT Pupuk Iskandar Muda (PIM), adalah sebagai pemantik bangkitnya gejolak politik di wilayah paling ujung Pulau Sumatera ini. Terlepas dari segala permasalahan tersebut, perkembangan perekonomian di wilayah sekitar berdirinya perusahaan, tumbuh lebih cepat. Hal ini dapat dilihat dari perputaran perekonomian di sejumlah wilayah walau masih jauh dari harapan. Begitu pula dengan perkembangan sejumlah pusat perbelanjaan di kota Lhokseumawe yang sekitar tujuh tahun lalu masih merupakan kota terbesar kedua di Aceh setelah Banda Aceh. Sampai-sampai Lhokseumawe dijuluki

sebagai Kota Petro Dolar. Beberapa kota kecil lainnya, seperti Kreung Geukueh, Batuphat, Lhoksukon, dan sejumlah wilayah terdekat, secara langsung maupun tidak langsung turut terpercik rezeki dari keberadaan sejumlah kilang perusahaan ini. Perekrutan tenaga lokal dan sejumlah tenaga dari luar Aceh untuk sejumlah proyek tersebut, terbilang begitu banyak. Para pekerja ini membutuhkan pusat perpelanjaan dan hiburan, maka sasaran yang terdekat adalah kota Lhokseumawe yang kemudian dibangun secara cepat untuk melengkapi berbagai kebutuhan. Maka terciptalah mata rantai perekonomian lain yang berada di luar sejumlah proyek. Banyaknya bangunan yang didirikan, tentu membutuhkan banyak buruh bangunan; banyak pedagang, sudah pasti membutuhkan banyak pekerja, dan begitulah seterusnya yang terjadi dari pusat pertokoan hingga ke pasar ikan dan pasar sayur. Begitulah pertumbuhan wilayah di seputar proyek ini sehingga membentuk kemegahan tersendiri dengan sejumlah properti, perumahan, pusat perbelanjaan, raungan mesin, lalu-lalang kenderaan umum dan kenderaan proyek, dan orang-orang berbaju seragam. Di mana pun yang terlihat adalah orang-orang yang bergerak, dari siang bahkan sampai malam hari. Kota yang demikian berdenyut menjanjikan banyak peluang dan tempat mengalirnya sejumlah rezeki. Selain mendatangkan devisa untuk daerah dan negara, sejumlah profit itu pula memiliki tanggung-jawab sosial, setidaknya bagi warga di lingkungan proyek. Dana Corporate Social Responsibility (CSR) adalah bentuk kepedulian sosial perusahaan, terlepas dari berbagai persoalan dan tudingan pengelolaan dana yang tidak transparan. Bukti nyata yang berupa bantuan rumah, bantuan pertanian, pengobatan gratis, dan ban-

tuan modal usaha kecil, tidaklah bisa dinafikan begitu saja. Memang segalanya telah berubah. Kemegahan masa lalu perlahan-lahan meredup seiring dengan meredupnya api pada cerobong kilang gas PT Arun akibat menipisnya cadangan. Selain dihantam konflik politik, denyut sejumlah kota yang ada di lingkungan profit sendiri sudah dalam keadaan sekarat. Jauh hari sebelum cadangan gas betulbetul menipis seperti sekarang, mesin kilang PT KKA, PT AAF, dan kilang Humpus Aromatic sudah tidak lagi bisa menyala. Sementara kilang PT PIM dalam keadaan tersenggal-senggal dan masih terus bernyawa sampai sekarang. Sejumlah pekerja dari tiga perusahaan itu pun jadi pengangguran, termasuk sebagiannya dari PT PIM karena terjadinya perampingan. Seiring dengan itu pula, terjadinya kemunduran di segala kehidupan masyarakatnya, termasuk kehidupan orang-orang di Lhokseumawe yang jauh sekali dengan gambaran sepuluh atau lima belas tahun silam. Kelak, bila cadangan gas habis dan PT Arun tidak beroperasi lagi, maka dapatlah dibayangkan bagaimana terusiknya denyut ekonomi di wilayah ini yang sekarang sedang tersenggal-senggal kepayahan. Sudah tentu, revitalisasi kilang PT Arun sangat penting, dan menjadi kebutuhan mendesak demi penyambung denyut kehidupan, yang tidak saja dari segi perekonomian, tetapi juga sosial, budaya, dan politik Aceh. Pengalihan PT Arun menjadi terminal gas bisa dikatakan sebagai tindakan paling tepat guna mengatasi berbagai persoalan dan untuk mengembalikan geliat ekonomi Aceh sebagaimana sebelumnya. Selain untuk penyelamatan instalasi kilang senilai Rp6,3 triliun itu sendiri yang bakal menjadi besi tua, juga untuk menyelamatkan kilang PT KKA, PT AAF, kilang Humpus Aromatic, dan juga untuk kemaksimalan operasional pabrik PT PIM. Tentunya ini juga tidak mudah, karena permasalahannya kembali lagi pada bahan baku gas. Untuk mempertahankan operasional kilang LNG ini perlu upaya untuk mencari sejumlah ladang gas baru, semisal yang sedang dilakukan

di Aceh Timur. Selain itu, perlu juga mempersiapkan alternatif lain seperti mendatangkan pasokan gas dari sejumlah ladang gas yang ada di Indonesia. Langkah-langkah untuk pengalihan, melalui usaha modifikasi kilang, haruslah dilakukan dari sekarang, sesegera mungkin, karena tahun 2014 segera menjelang. Penulis adalah Wartawan Waspada Liputan Wilayah Aceh.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Predikat Bandara Polonia terancam turun - Turun menjadi bandara antar kabupaten * Massa serakkan sampah di kantor Bupati Karo - Makanya jangan sepele sama sampah * Kinerja Pemprovsu semakin melemah - Mungkin sibuk tebar pesona, he...he...he


D Wak

Ekonomi & Bisnis

WASPADA Sabtu 5 Mei 2012



Armin Nasution Redaktur Ekonomi

Daya Serap Anggaran BEBERAPA waktu itu karena sumber daya manusia di pemelalu, Presiden Susilo rintahan juga kurang ‘pintar’. BambangYudhoyono Dekan Fakultas Ekonomi USU Jhon Tafbu meminta seluruh pejabat tidak memainkan Ritonga pernah mengkritisi rendahnya anggaran karena akan sangat merugikan negara. penyerapan anggaran. Wajar saja penyerapan Praktik penyalahgunaan anggaran negara–yang anggaran di berbagai daerah rendah termasuk sejatinya adalah uang di Sumut karena para rakyat–harus segera pejabatnya bukan dihentikan. lulusan sarjana yang Dari 516 LKPD 2010 yang Begitu pesan berkompeten. kepala negara walau Bagaimana mungdiperiksa BPK, hanya ada 34 kemudian respon kin, kata dia, pejabat pemda yang mendapatkan opini yang diterima mengpemerintahan yang anggap pernyataan ini Wajar Tanpa Pengecualian (WTP) memutus anggaran sudah terlambat. bisa mengerti kalau atau hanya tujuh persen dari Praktik penyalahgutidak pernah belajar naan keuangan nejumlah keseluruhan, tentu saja tak tentang ekonomi.Tidak gara (di pusat maupun pernah belajar mengetermasuk Sumut. di daerah) bisa dikatalola keuangan negara. kan sudah menjadi Berbeda misalnya kebudayaan. kalau kepala daerah Penyerapan angmemiliki latar belakang garan pada awal tahun keilmuan soal anggarhingga pertengahan an. Maka biasanya tahun selalu minim. akan bisa bertindak Penyerapan yang micepat. Sehingga kalau nim ini terutama dakepala daerahnya oralam pos belanja mong yang tidak mengerti dal (pos belanja yang anggaran wajar penyebiasanya disebut biaya rapan anggaran daepembangunan karena rahnya rendah. langsung terkait dengSebab kepala an kepentingan rakyat d a e ra h k e m u d i a n seperti pembangunan jalan, jembatan, sekomemutuskan dari usul bawahannya. Andai lah, dll). kepala daerah kita mengerti tentang anggaran Menjelang akhir tahun, biasanya terjadi pasti kelambanan penyerapan tidak akan lonjakan penyerapan luar biasa dan sangat terjadi. signifikan. Pos belanja modal dihabiskan Sebenarnya jika dalam bulan seperti secepat-cepatnya. Tapi, penyerapan alokasi sekarang realisasi penyerapan anggaran masih pos belanja modal ini rata-rata untuk belanja rendah itu sudah bisa dipertanyakan DPRD. barang, honor pegawai, dan sejenisnya. Apalagi sekarang hak rakyat mengetahui Pos untuk kepentingan langsung terkait segala perkembangan soal anggaran sudah hajat hidup rakyat tetap minim. Lonjakan transparan dengan adanya undang-undang penyerapan anggaran di akhir periode biasanya keterbukaan informasi publik. Hanya saja, tidak berhubungan positif dengan peningkatan menurut penelusuran yang dilakukan FITRA kesejahteraan rakyat. (Forum Indonesia Transparansi Anggaran) Kenapa penyerapan anggaran itu selalu beberapa waktu lalu hanya sedikit daerah yang rendah? Banyak faktor yang mempengaruhi. mau memberikan data-data detil soal Diantaranya, eksekutif maupun legislatif lambat anggaran. menyusun perencanaan dan penganggaran, Lemahnya kemampuan pemerintah sehingga ketuk palu pengesahan Perda APBD daerah mengelola anggaran memang harus terlambat. diakui. Bisa saja mereka ketakutan kalau Keterlambatan pengesahan sering terjadi kemudian ada lembaga swadaya masyarakat dan berulang-ulang pada beberapa daerah yang mempertanyakan tentang penggunaan tertentu. Walaupun sebenarnya Kementerian anggaran. Di Indonesia hasil audit Badan Keuangan sudah berkali-kali mengingatkan Pemeriksaan Keuangan (BPK) terhadap daerah dengan menyiapkan sanksi. Laporan Keuangan Pemerintah Daerah (LKPD) Keterlambatan tidak terjadi di Sumut. Sebab menunjukkan belum maksimalnya sistem anggaran sudah diketuk seiring masuknya pengelolaan dan tanggung jawab keuangan tahun 2012, tetapi penyerapannya yang ‘maha daerah. lambat’. Dari 516 LKPD 2010 yang diperiksa BPK, Kedua, munculnya ketakutan aparatur hanya ada 34 pemda yang mendapatkan opini Pemda menggunakan dana tersebut secara Wajar Tanpa Pengecualian (WTP) atau hanya cepat. Risiko kesalahan alokasi anggaran bisa tujuh persen dari jumlah keseluruhan, tentu saja berakhir di penjara. Kemudian faktor lain saja tak termasuk Sumut. yang mempengaruhi adalah aturan tentang Seperti lima tahun terakhir, opini Wajar pengelolaan keuangan daerah sering berubah. Dengan Pengecualian (WDP) masih menKeempat, relatif terbatasnya waktu yang dominasi di 2010. Bagaimana 2011, masih harus tersedia bagi eksekutif memberikan pelayanan kita tunggu. Sedangkan penilaian anggaran kepada publik. Sebenarnya semua kelemahan 2012 pun bisa dilihat tahun berikutnya.

Swasembada Daging Sumut Capai Target MEDAN (Waspada) : Untuk memenuhi target swasembada daging sapi 2014 sebesar 13 juta ton, Sumatera Utara sebagai provinsi peringkat sembilan produksi sapi nasional sudah mencapai 541.698 ekor. Secara keseluruhan, target swasembada daging sudah tercapai. Dinas Peternakan dan Kesehatan Hewan Sumatera Utara optimis target tersebut tercapai secara berkelanjutan. Hal tersebut dikatakan Kepala Bidang Sarana dan Prasarana Dinas Peternakan dan Kesehatan Hewan Sumatera Utara Parmohonan Lubis, Rabu lalu. Menurutnya, sesuai penghitungan pada Juni 2011, jumlah sapi secara keseluruhan sudah mencapai 13 juta ekor. Dia menjelasan di Sumut saat ini terdapat sebanyak 541.698 ekor sapi dan kerbau yang tersebar di beberapa kabupaten. Dari angka tersebut, yang diizinkan potong sebanyak 86.401 ekor. Bahkan, untuk target populasi sapi dan kerbau pertahun juga bisa dilampaui Sumatera

Utara. “Target nasional, 30.000 ekor per tahun, di Sumatera Utara sendiri bisa mencapai 40.000 ekor per tahun,” ujarnya. Sapi tersebut berada di masyarakat yang tersebar di sentra ternak di Langkat, Deliserdang, Serdang Bedagai, Simalungun, Asahan dan Batubara. Sementara kerbau paling banyak berada di Tapanuli Utara, Samosir, dan Humbang Hasundutan. Umumnya, peternakan masyarakat dalam skala kecil yang mana setiap peternakan mmiliki 3 - 4 ekor saja. Di satu sisi, lanjutnya, kepemilikan ternak dalam skala kecil tersebut tidak melulu menjadi kendala karena ternyata telah mampu dijadikan sebagai benteng ketahanan ekonomi masyarakat. Ekspor impor daging tidak begitu memengaruhi peternak. Di samping itu, karena daging impor kebanyakan hanya untuk pasar hotel dan restoran sementara pasar tradisional tetap didominasi oleh daging

dari peternak lokal. “Masing-masing memiliki pasarnya, jadi tidak memengaruhi,” katanya. Dia juga menambahkan, mengenai keputusan pemerintah RI yang memilih menghentikan impor daging sapi dari Amerika Serikat (AS) karena adanya penyakit sapi gila adalah sangat wajar. Menurutnya, sudah semestinya daging ataupun turunan produk dari ternak yang memiliki penyakit tidak boleh masuk ke pasar dalam negeri. Negara eksportir, dalam hal ini AS harus bisa memberikan konfirmasi dan keterangan berkaitan adanya penyakit sapi gila. “Mereka harus bisa menjamin bahwa daging dan produk turunannya bersih, bebas dari penyakit, baru bisa masuk lagi ke pasaran Indonesia,” ujarnya. Lagipula, lanjutnya, impor daging sapi dari AS tidaklah begitu besar. Daging sapi impor kebanyakan didatangkan dari Au s t r a l i a d a n Ne w Z e a land.(cdu)

30 Hektar Lahan Semangka Di Lau Baleng Terendam Banjir MEDAN (Waspada) : Petani semangka di Kecamatan Lau Baleng, Kabupaten Karo, mengalami kerugian yang tidak sedikit lantaran lahannya terkena banjir. Lahan semangka seluas 30 hektar tersebut terendam banjir pada periode 1 - 15 April. Hal tersebut dikemukakan oleh Kepala Unit Pelaksana Teknis (UPT) Balai Penelitian Tanaman Pangan Hortikultura (BPTPH) Sumatera Utara, Gunawan melalui sekretarisnya, Aisyah, Jumat (4/5) saat ditemui di ruangannya di Jalan AH. Nasution. Menurutnya, selama bulan

April hujan terjadi hampir setiap hari. Padahal, lanjutnya, biasanya sebelum terjadi hujan, cuaca cukup panas. “Cuaca semakin sulit diprediksi, sebentar panas, sebentar hujan, namun kebanyakan hujan yang sering muncul beberapa waktu lalu dan menyebabkan lahan semangka disana terendam banjir,” ujarnya. Dia menyatakan dengan cuaca tidak menentu membuat para petani kebingungan karena cuaca menjadi penentu produktivitas tanaman petani selain pupuk dan perlakuan lainnya. Gunawan melanjutkan,

petani mengalami kerugian besar karena panennya tidak bisa dilakukan. Padahal, umur tanaman sudah masa panen tapi akhirnya tidak jadi. Diakuinya, di Lau Baleng, tidak hanya komoditas semangka saja yang mengalami kebanjiran sejak awal hingga pertengahan April. Sebagaimana diberitakan sebelumnya, lahan jagung masyarakat seluas 897 hektar juga terendam banjir yang mengakibatkan petani gagal panen. Hal yang sama juga terjadi di Kecamatam Mardinding, Kabupaten Karo. (cdu)



Seorang warga tampak memetik biji kopi di lahan pertanian Kabupaten Karo beberapa waktu lalu. selain kopi asal Sumatera Utara merupakan salah satu penghasil biji kopi yang baik. Namun pada April 2012 harga kopi di dunia anjlok karena musim panen tinggi menurut data dari Organisasi Kopi Internasional (ICO) di London menunjukkan ekspor kopi global naik 4,3 persen dari Maret tahun lalu hingga Februari 2012, akibatnya produksi kopi melimpah sehingga di pasar harga turun.

Kinerja Pemprovsu Lemah, SKPD Tak Punya Kapasitas MEDAN (Waspada): Satuan Kerja Perangkat Daerah (SKPD) Pemerintah Provinsi Sumatera Utara (Pemprovsu) dinilai tidak memiliki kapasitas dan tidak punya kemampuan menyerap dana Anggaran Pendapatan Belanja Daerah (APBD) dalam melaksanakan programnya di masing-masing dinas. Apalagi memasuki triwulan II 2012 belum ada dana APBD yang dapat direalisasikan untuk pembangunan. “Ini jelas kapasitas para SKPD Pemprovsu kurang dan mungkin tidak punya kapasitas. Itu perlu dirombak sesegera mungkin karena timeline Gubsu dan Sekda sudah semakin sempit,” kata pengamat ekonomi dari Universitas Sumatera Utara (USU) Jhon Tafbu Ritonga kepada Waspada, Jumat (4/5),

menanggapi kinerja Pemprovsu yang lemah dengan serapan anggaran masih di bawah 10 persen. Kalau sampai saat ini belum ada dana APBD yang terserap untuk pembangunan di Sumut, kata Jhon Tafbu, berarti SKPD tidak mampu melaksanakan program kerja tahunan yang sudah direncanakan atau tidak tahu apa yang harus dikerjakan, sehingga program yang harus dilakukan menjadi terlambat.

Apalagi, biasanya rencana pembangunan untuk 2012 sudah dibahas pada 2010 bahkan ada yang dibahas 2009, sehingga tinggal melaksanakan saja pada 2012. “Seharusnya tiga tahun lagi mau membuat apa sudah tahu. Jadi kalau tak bisa jalan sekarang, nggak bisa dikatakan permasalahannya di Pemprovsu, padahal SKPD nya yang tak sanggup. Gubernur harus berani mengevaluasi itu,” katanya. Apalagi, lanjutnya, sekarang sudah ada sistem pengadaan barang secara elektronik dan itu sudah berjalan di Pemprovsu. “Kalau itu tidak berjalan berarti tidak benar SKPD-nya. Untuk pelaksanaannya, ada peraturan pemerintah No. 54 tahun 2010 yang sudah diperbaiki tahun 2012. Apakah SKPD nya sudah membaca? Apakah itu menghambat? Jadi SKPD

harus tahu itu,” katanya. Akibat lemahnya kinerja Pemprovsu tersebut, pemerintah daerah dinilai tidak memiliki peranan dalam memajukan perekonomian di Sumut dan itu sudah lama berlangsung. Bahkan 10 tahun terakhir, tidak ada peran pemerintah provinsi dalam kemajuan perekonomian di Sumut. Yang berperan adalah pengusahapengusaha yang membuka lapangan kerja. “Begitu juga pembangunan infrastruktur di Sumut juga belum ada, bahkan pembangunan bandara Kualanamu yang dibangun pemerintah pusat juga belum siap-siap, sehingga belum ada investor dari luar negeri yang mau mena-

namkan modalnya di Sumut dalam 10 tahun terakhir ini,” kata Dekan Fakultas Ekonomi USU tersebut. Menurutnya, Pemprovsu harus sadar diri dan semua SKPD harus ditinjau ulang dan ganti yang tidak mampu dalam bulan ini. Supaya mereka bisa bekerja di bulan depan. “Dalam pelaksanaannya Gubernur bisa panggil semua SKPD, tenderkan program untuk dijalankan di masingmasing SKPD, siapa yang bisa menjalankan tersebut sebelum bulan September sudah terealisasi semuanya. Bagi SKPD yang tidak mampu melaksanakannya, bisa dievaluasi untuk diganti dengan yang mampu,” ujarnya. (m41)

Harga BBM Batal Naik, Asumsi APBN Terlewati JAKARTA (Waspada): Akibat harga bahan bakar minyak (BBM) bersubsidi batal naik sebesar Rp1.500 per liter, maka besaran asumsi BBM bersubsidi Rp137,4 triliun yang dipatok dalam APBN-Perubahan 2012 akan terlewati. Asumsi pemerintah menaikkan harga BBM bersubsidi sebesar Rp1.500 per liternya. Maka patokan anggaran BBM bersubsidi yang ada dalam APBN-P 2012 sebesar Rp137,4 triliun akan terlewati,” kata Menteri Perekonomian Hatta Rajasa di Jakarta, Jumat (4/5). Selain karena asumsi yang melekat pada besaran subsidi tersebut, menurutnya, kuota volume konsumsi BBM bersubsidi tahun ini bakal terlampaui sebab kuota yang dipatok

Pemerintah dalam APBN-P 2012 hanya 40 juta kiloliter. Oleh sebab itu, lanjut Hatta, Pemerintah sekarang ini sedang berupaya melakukan pengendalian konsumsi BBM bersubsidi melalui lima kebijakan. Salah satunya adalah melakukan konversi dari BBM ke bahan bakar gas. Jika kebijakan tersebut dilakukan dibarengi upaya menggunakan teknologi ramah lingkungan dan pengawasan dengan teknologi dalam jangka panjang, maka pemerintah bisa menghemat banyak. “Jangan tanya dulu berapa besarannya tapi angka yang kita targetkan tidak lebih dari 42 juta kiloliter,” sebut Hatta. Pembengkakan besaran subsidi tetap akan terjadi dari

angka Rp137,4 triliun. Pasalnya, asumsi harga rata-rata minyak mentah (ICP) 119 dolar AS per barel dan volume BBM mencapai 42 juta kiloliter, maka subsidi BBM, LPG dan BBN akan melonjak menjadi Rp234,2 triliun. “Listriknya tetap Rp75 triliun tapi kita punya cadangan atau bantalan energi sebesar Rp23 triliun,” lanjut dia. Meski membengkak, pemerintah akan berusaha menjaga defisit APBN di angka 2,3 persen. “Nah ini semua sudah kita uraikan kalau itu terjadi maka kita masih tetap menjaga defisit 2,3 persen. Tapi, kebijakan tadi berjalan, di dalamnya termasuk penghematan dan semua APBN-P yang diputuskan kita jalankannya,” pungkas Hatta. (j03)

Banyak SPBU Di Medan Kehabisan Stok M E D A N ( Wa s p a d a ) : Banyak Stasiun Pengisian Bahan Bakar Umum (SPBU) di Kota Medan kehabisan stok premium dan solar, di antaranya SPBU di Jalan Juanda, Brigjen Katamso, SM Raja, Simpang Limun, kemarin siang. Kehabisan bahan bakar bersubsidi tersebut menyebabkan para pemilik kendaraan kesulitan mendapatkan BBM dan terpaksa mencari SPBU lain yang masih memiliki stok. Berdasarkan informasi yang Waspada peroleh di lapangan, pegawai SPBU yang tidak ingin disebutkan namanya mengatakan, dalam beberapa hari ini terjadi pengurangan jatah pasokan premium maupun solar. Selama ini, katanya, jatah pasokan premium sebanyak 40 kilo liter (kl), namun belakangan terjadi pengurangan. “Kadang-kadang dapat 36 kl, namun lebih sering mendapatkan jatah 32 kl, bahkan pernah di bawah 30 kl yaitu 24 atau 26 kl,” kata staf di SPBU Jl. B Katamso tersebut seraya mengatakan, akibat kehabisan stok tersebut banyak masyarakat yang kecewa dan harus balik

arah mencari SPBU yang masih menyediakan BBM. Sementara itu, Asisten Manager External Relation PT Pertamina Persero Regional I Fitri Erika saat dikonfirmasi menyebutkan pihaknya akan mengecek dan mencari permasalahan keberadaan SPBU yang kehabisan stok tersebut. Dia juga menyatakan tidak ada pengurangan pasokan dalam penyaluran ke SPBU. “Kita akan cari dulu apa permasalahannya, sebab Pertamina tidak melakukan pengurangan pasokan. Pertamina menyalurkan BBM sesuai jadwal dan kuota masing-masing SPBU,” kata Erika. Dia menyebutkan seperti penyataan VP Corp Communication bahwa untuk penyaluran BBM bersubsidi di beberapa wilayah mengalami kelebihan kuota. Untuk realisasi Januari-April 2012 di Sumut premium sudah melebihi 18 persen dan solar 11 persen dibandingkan kuota premium 1,3 juta kl dan solar 993 ribu kl. “Pertamina melakukan penyesuaian alokasi BBM bersubsidi sesuai dengan kuota masing-masing daerah agar pe-

nyalurannya tidak melampaui kuota yang ditetapkan APBN 2012,” ujarnya. Erika juga menyatakan di Medan ada 88 SPBU dan beberapa di antaranya habis, itu disebabkan karena peningkatan penjualan, sehingga pasokan cepat habis dan itu akan segera terisi dalam beberapa jam kemudian. “Dijadwalkan SPBU di Jl Juanda dan Jl Brigjen Katamso tersebut memang ada penyaluran (Kamis-red) dari terminal BBM. Kalau yang di Simpanglimun tepat di depan pajak memang sudah lama tutup karena masalah internal SPBU,” ujarnya. Mengenai jumlah stok BBM bersubsidi di Medan, Asisten Customer Relation Fuel Retail Marketing Pertamina Regional I Sumbagut Sonny Mirath mengatakan pasokan saat ini dalam kondisi aman dan masyarakat diminta untuk tidak panik terhadap kehabisan stok di beberapa SPBU. “Masyarakat diimbau untuk mencari SPBU terdekat jika terjadi kekosongan di salah satu SPBU,” ujarnya. (m41)


PESERTA melihat proses produksi mukena di usaha Ana Bordir, Jalan Bromo, Kecamatan Medan Denai. Sebanyak 10 pelaku usaha sektor menjahit asal Meulaboh, Aceh Barat, Propinsi Aceh, berkunjung ke Medan selama 3 hari, Rabu-Jumat (2-4/5), untuk melakukan studi banding dan pertemuan bisnis.

Pelaku UKM Meulaboh Studi Banding Ke Medan MEDAN (Waspada): Sejumlah pelaku usaha kecil dan menengah (UKM) di sektor menjahit asal Meulaboh, Aceh Barat melakukan studi banding ke Medan dalam kaitan peningkatan kapasitas produk, desain, merk dan strategi pasar. Kegiatan selama 3 hari, Rabu – Jumat (2-4/5) ini, difasilitasi oleh Pusat Informasi dan Pengembangan Bisnis (Pinbis) Medan. Caritas Switzerland dan Yayasan Pengembangan Kawasan (YPK). Manager Pinbis Medan, Maskur Abdullah, Kamis (3/5) mengatakan, kegiatan kunjungan dan pertemuan bisnis tersebut merupakan rangkaian kegiatan bagi pengembangan ekonomi masyarakat Aceh Barat, setelah sebelumnya melakukan gelaran workshop perbaikan produk, merk, dan strategi pemasaran.“Kami berharap kegiatan ini dapat menjadi jembatan yang saling menguntungkan antar pengusaha di dua daerah,” kata Maskur. Kegiatan yang mendapat dukungan dari Caritas Switzerland tersebut dimulai Selasa dengan mengunjungi pelaku usaha di sektor menjahit bordir, Yayasan Srikandi, di Kelurahan Kwala Bekala, Kecamatan Medan Johor. Di tempat ini, peserta diberi kesempatan melihat proses produksi dengan melakukan tanya-jawab kepada pengusaha, Herlina. Di hari kedua, peserta mengunjungi Pusat Industri Kerajinan (PIK) Menteng, Kecamatan Medan Denai, dimana

peserta berkesempatan bertandang dan berdiskusi dengan beberapa pengusaha, salahsatunya pengusaha kerajinan Batik Medan, Sri Wahyuni. Selain berkunjug ke beberapa tempat di PIK, peserta juga diajak berkunjung ke usaha bordir di Jalan Bromo, Kecamatan Medan Denai, yakni Ana Bordir. Peserta juga diberi kesempatan untuk melihat proses produksi dan membeli beberapa mukena dengan sulaman bordir yang khas. Pada hari kedua ini juga digelar pertemuan bisnis dengan pelaku usaha dari Medan di Hotel Garuda Citra. Pada kegiatan ini, peserta diberikan kesempatan untuk saling bertukar informasi sekaligus menjajaki kemungkinan melakukan kerjasama di sektor distribusi dan pemasaran. Sebanyak 15 pengusaha sektor menjahit dari Medan hadir pada pertemuan bisnis ini. Pada hari terakhir, peserta juga melakukan kunjungan ke beberapa usaha sektor menjahit. Caritas Switzerland Representatif Meulaboh, Juni Afrizal, mengatakan, kegiatan kunjungan dan pertemuan bisnis tersebut diharap berdampak positif bagi pengusaha menjahit asal Meulaboh, sebagai penerima manfaat dari Program Caritas Switzerland. “Kami berharap kegiatan ini memberi banyak manfaat, tidak hanya kepada kami, tapi juga kepada ibu-ibu,” katanya. (m05)



WASPADA Sabtu 5 Mei 2012

Lebih Baik Mencegah Daripada Mengobati Pemeriksaan Kesehatan STIK-P Medan PAGI itu, Kamis (3/5), sejumlah dosen, karyawan, dan mahasiswa Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan bersama-sama melakukan pemeriksaan kesehatan dalam rangka Dies Natalies ke-25 di Puskesmas Teladan Medan, Jl SM Raja. Tampak wajah penuh ceria dari para dosen, karyawan, dan mahasiswa mengikuti kegiatan ini. Hal itu terbukti dengan antusiasme mereka yang rela mengantri sekadar menunggu giliran pemeriksaan hasil kerja sama dengan Dinas Kesehatan Kota Medan itu. Di ruang pemeriksaan, dokter maupun perawat menanyakan keluhan sakit mereka. Mulai dari penyakit lambung (maag) karena telat makan atau memakan makanan yang terlalu pedas, darah tinggi karena sering begadang atau kepala pusing disertai muntah-muntah. Setelah diperiksa, pasien kemudian diberikan resep obat plus saran-saran menjaga kesehatan. Bagi pasien pria mayoritas diingatkan untuk mengurangi konsumsi rokok dan begadang karena kedua hal tersebut dapat mengganggu

kesehatan. Untuk pasien wanita, diimbau agar tidak sering jajan sembarangan karena banyak makanan yang sudah tidak sehat lagi, seperti makanan yang dicampur zat pewarna atau penyedap berlebihan. Kepala Puskesmas Teladan Medan, dr Refrini, mengatakan hasil pemeriksaan menarik kesimpulan bahwa mayoritas civitas akademika STIK-P yang memeriksa kesehatannya itu menderita penyakit lambung dan darah tinggi. “Penyakit maag sendiri terjadi karena si penderita sering makan tidak teratur, memakan makanan yang terlalu asam atau pedas,” ujarnya kepada Kreasi. Refrini juga menyarankan agar hati-hati memilih makanan dan lebih selektif mengkonsumsi makanan masuk dalam perut kita. Karena itu, lebih baik mencegah daripada mengobati. Tengku Febrina Qlaudyoula dan Diva Ayoe Veronica mengungkapkan bahwa kegiatan ini sangat positif bagi mahasiswa. Masalahnya, tambah kedua mahasiswa semester II ini, tingkat kesadaran mahasiswa untuk memeriksa kesehatannya masih rendah. “Alhamdulillah, STIK-P ngadain pemeriksaan kesehatan ini karena banyak manfaatnya ditambah lagi dapat menumbuhkan minat mahasiswa untuk rajin melakukan pemeriksaan kesehatan,” tutur Youla seraya mengaku dirinya sudah lama tidak memeriksa kesehatannya. *Arianda Tanjung

Waspada/Arianda Tanjung

KETUA STIK-P Hj Ida Tumengkol BComm MHum (8 kanan atas) dan Kadis Kesehatan Kota Medan dr. Edwin Effendi, MSc (5 kiri) foto bersama dengan sejumlah dokter, staf, dan mahasiswa STIK-P di sela-sela pelaksanaan pemeriksaan kesehatn di Puskesmas Teladan, Jl SM Raja Medan, Kamis (3/5).

Waspada/Arianda Tanjung

Waspada/Arianda Tanjung

TIM dokter Puskesmas Teladan memeriksa mahasiswa STIK-P.

KADIS Kesehatan Kota Medan dr. Edwin Effendi, MSc (kiri) berdialog dengan Ketua STIK-P Hj Ida Tumengkol BComm MHum (tengah) didampingi Puket III Austin Antariksa T, SSos M IKom.

Waspada/Arianda Tanjung

SEORANG mahasiwa sedang registrasi ulang untuk melakukan pemeriksaan kesehatan di Puskesmas Teladan.

Wujudkan Semangat Pendidikan Di Hardiknas TEPAT 2 Mei 2012, hampir setiap institusi yang berkait dengan dunia pendidikan bangsa merayakan Hari Pendidikan Nasional bertepatan hari lahirnya Ki Hajar Dewantara (2 Mei 1889). Pahlawan bernama asli Raden Mas Soewardi Soeryaningrat itu juga merupakan Bapak Pendidikan Nasional Indonesia. Beliau merupakan aktivis pergerakan kemerdekaan Indonesia, kolumnis, politisi, dan pelopor pendidikan bagi kaum pribumi indonesia dari zaman penjajahan Belanda sekaligus pendiri Perguruan Taman Siswa. Berkat kerja keras serta pengorbanannya di dunia pendidikan, tibalah surat keputusan Presiden RI No 305 Tahun 1959 tertanggal 28 November 1959 yang menyatakan Ki Hajar Dewantara dinobatkan sebagai Pahlawan Pergerakan Nasional dan Bapak Pendidikan Nasional. Sayangnya, pendidikan di Indonesia masih jauh dari harapan memasuki hari jadi ke-53 ini. Bahkan, jauh tertinggal dari negara-negara lain. Padahal sudah menjadi rahasia umum bahwa pendidikan merupakan kunci utama bagi bangsa yang ingin maju dan unggul dalam persaingan global. Dalam menyikapi Hari Pendidikan, Drs Emiruddin Harahap MM menyampaikan masih banyak kekurangan dalam kebijakan pendapat. Pengamat Pendidikan Kota Medan itu menambahkan dengan anggaran 20% dari APBN maupun APBD, seyogianya terjadi peningkatan mutu pendidikan. Tapi faktanya, sampai hari ini pendidikan di Indone-

sia masih jauh tertinggal dibandingkan negara ASEAN lainnya. Jadi, menurut Emir, semua pemangku kepentingan dalam dunia pendidikan harus berpikir cara memajukan pendidikan dengan anggaran 20% dari APBN yang termasuk dengan gaji pegawai. “Ini sungguh tidak benar, dana 20% ini tidak benarbenar untuk memaksimalkan pendidikan, tetapi juga banyak diarahkan kepada sifat non-pendidikan, termasuk gaji pegawai,” tutur Emir yang juga Wakasek Bidang Kesiswaan SMA Negeri 3 Medan. “Khusus di Kota Medan, saya melihat semangat dari bapak Wali Kota sangat baik dan eksis melakukan kunjungan ke sekolah-sekolah. Namun, di sisi lain, jerih payah Wali Kota Medan tidak diiringi semangat orangorang yang terkait pada bidang pendidikan. Kita masih banyak sekali melihat sekolah-sekolah yang masih belum memenuhi standar sarana prasarana. Untuk itu, mari kita bersama mewujudkan semangat Pak Rahudman,” lanjutnya. Selain itu, peran guru dalam memajukan bangsa dalam menciptakan sumber daya manusia berkualitas di berbagai bidang harus mendapat motivasi dan apresiasi dari pemerintah. Karena guru, selain orangtua, berperan dalam membina dan melahirkan siswa yang kelak tumbuh menjadi generasi muda yang cerdas dan intelektual. “Kepada sesama guru di Kota Medan, tetaplah konsisten mempertahankan semangat, jangan sampai mengendur optimisme mengajarkan berbagai disiplin ilmu kepada anak didik,” pesan Emir. *Hajrul Azhari Ritonga

Waspada/Arianda Tanjung

SEORANG siswa SMAN 8 Medan sedang memberi pemahaman kepada bocah SD yang mampir di stand sekolah tersebut pada Pameran Pendidikan dan Ajang Kreativitas Siswa 2012 di Tapian Daya/Pekan Raya Sumatera Utara (PRSU), Kamis (3/5).

Junjung Sportivitas PB SMANTig Cup SUKSES menggelar perlombaan bulutangkis pelajar se-Kota Medan, SMA Negeri 3 Medan kembali menggelar PB SMANTig Cup dengan mengusung tema “Mewujudkan Prestasi Olahraga dengan Menjunjung Tinggi Sportivitas”.

Kegiatan yang digelar untuk keempat kali ini resmi dibuka oleh Kepala SMAN 3 Medan, Drs Sahlan Daulay MPd, didampingi dan Wakasek Bidang Kesiswaan Drs Emiruddin Harahap MM di aula sekolah tersebut, Jl Budi

Kemuliaan, Kamis (3/5). Kali ini, PB SMANTig Cup ke IV diikuti oleh 14 tim dari tujuh sekolah, yakni SMAN 4, MAN 1, SMA Harapan 1, SMA Dharmawangsa, SMK Tritech, SMA Al-ulum, dan tuan rumah SMAN 3. Kejuaraan ini pun mempertandingkan kategori tunggal putra, tunggal putri, dan ganda putra. Selaku penanggung jawab kegiatan, Emiruddin Harahap mengatakan perlombaan ini merupakan agenda tahunan bidang kesiswaan SMANTig dan bertujuan mempererat tali silaturahim dan memotivasi siswa senang berolahraga, Selain itu, menunjukkan eksistensi SMANTig melakukan kegiatan positif untuk menghindari siswa dari kegiatan negatif. SISWI SMANtig (baju biru) sedang menjajal kemampuan siswi SMK Tritech dalam ajang PB SMANTig Cup ke IV di aula sekolah tersebut, Kamis (3/5). -Waspada/Arianda Tanjung-

“Perlombaan bulutangkis sengaja dijadikan agenda tahunan untuk mencari bibit-bibit baru di SMANTig yang berpotensial agar bisa diikutsertakan pada ajang olimpiade antardaerah maupun nasional serta ikut memajukan bulutangkis pelajar di Kota Medan,” tutur Emir. Emir menjelaskan China merupakan negara yang memiliki atlet bulutangkis terbesar dan rutin mencari bibit-bibit melalui sekolah-sekolah. Dikatakan, China yang telah melahirkan Lin Dan cs mendidik atlet sejak bangku Sekolah Dasar. “Untuk itu, saya berharap Kadispora dan dinas terkait dapat terus memberdayakan perlombaan bulutangkis ini agar kita dapat melahirkan atlet yang berpotensi,” harap Emir. Pada PB SMANTig sebelumnya, SMANTig di bawah bimbingan Erwin Effendi Polen SH selaku pelatih menyabet ketiga gelar juara alias sapu bersih. Kali ini, Erwin mengungkapkan lawan-lawannya cukup tangguh dari sebelumnya. “Namun, kami tetap optimis. Karena SMANTig memiliki tim C yang paling diunggulkan,” ujar Erwin. Di lain pihak, Teguh Pangestu mewakili anggota Tim C SMANTig juga mengakui ketangguhan pesaing-pesaing kejuaraan tahun ini. Kendati begitu, Teguh dan rekanrekannya juga optimis berhasil mengulangi sukses sebelumnya. “Untuk itu, saya mengimbau kepada seluruh anggota tim SMANTig harus semangat dan tidak lupa menjunjung tinggi sportivitas bertanding demi meraih prestasi,” pinta Teguh. Ok, semoga sukses dan selamat berjuang SMANTig! *Hajrul Azhari Ritonga

Waspada, Sabtu 5 Mei 2012  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you