Page 1

Medan 24-31 C 0

Berastagi 19-29 C 0

R. Prapat 24-320C

Parapat 19-29 0C

P. Siantar 18-28 C

Sibolga 22-32 C



Hujan guntur


WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Sabtu

BMKG Polonia

SABTU, Wage, 5 Februari 2011/2 Rabiul Awal 1432 H

No: 23408 Tahun Ke-65

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: Rp2.500,-


PARA demonstran anti pemerintah ikut ambil bagian dalam shalat Jumat di Lapangan Tahrir di Kairo, Jumat (4/1). Mereka berdoa agar segera berakhirnya kekuasaan Presiden Hosni Mubarak.

MUBARAK: MUAK JADI PRESIDEN Kalau Mundur Sekarang Mesir Akan Chaos

WNI Jangan Pergi Ke Yaman! JAKARTA (Waspada): Pemerintah Indonesia memberikan peringatan kepada WNI (warga negara Indonesia) yang akan pergi keYaman. Hal ini sebagai upaya mengantisipasi efek domino kisruh politik di Mesir dan sudah mulai merembes ke Yaman. “Kita sudah memberikan travel advisory kepada warga negara kita di negara-negara kawasan seperti Yaman, yang kita ketahui situasinya juga penuh dinamika,” kata Menlu RI Marty Natalegawa di Kantor Presiden, Jumat (4/2). Bahkan, lanjutnya, KBRI diYaman sudah diminta mulai bekerja untuk mendata WNI di Yaman yang berjumlah sekitar tiga ribu orang. Marty mengatakan ini merupakan langkah antisipasi jika terjadi keadaan memburuk di sana. “Jika keadaan memburuk, kita sudah siap, seperti kita sikapi

Lanjut ke hal A2 kol. 6

Pengangguran Perkosa Seorang Siswi Di Galang

Waspada/Hotma Darwis Pasaribu

FA babak belur di bogem warga, Jumat (4/2).

BANGUN PURBA (Waspada): Seorang pria pengangguran, Fa, 21, warga DusunV, Desa Pisang Pala, Kec. Galang, babak belur dibogem warga, Jumat (4/2) sore.Setelah dibabakbelurkan, warga menyerahkan Fa ke polisi. Ulah warga Namorambe, Desa Batu Lokong, Galang ini dipicu rasa emosi terhadap Fa yang diketahui telah memperkosa “Melati” (bukan nama sebenarnya) sebanyak tiga kali. Bahkan dalam melakukan perbuatan mesumnya, Fa,

Kairo (Waspada): Presiden Mesir Hosni Mubarak mengatakan dia mau segera mundur, namun khawatir negerinya akan berubah kacau jika dia melakukan hal itu. Dalam wawancara pertamanya sejak dimulainya protes anti-pemerintah, dia mengatakan kepada ABC News dia ‘bosan’ dengan kekuasaan. Wawancara itu dilakukan ketika Kairo melihat lagi hari kekerasan lainnya ketika terjadi rangkaian bentrokan antara pemrotes anti-pemerintah dan kelompok pro-Mubarak. Mubarak memperingatkan bahwa partai Islam Persaudaraan Muslim akan mengisi kekosongan kekuasaan jika dia mengundurkan diri. Paul Adams dari BBC mengatakan ini merupakan satu versi naratif yang selalu dinyatakan presiden Mesir itu selama masa 30 tahun kekuasaannya ketika melakukan penindasan politik, yang ditujukan terutama pada Persaudaraan Muslim.


Wartawan dipukuli Puluhan ribu pemrotes masih berada di Kairo Pusat setelah gelap, di mana beberapa di antaranya terlibat dalam bentrokan dengan para pendukung pemerintah yang menyerang mereka. Batu beterbangan di antara kedua belah pihak dan sesekali terdengar suara tembakan. Tentara, yang berusaha memisahkan kedua belah pihak, nampaknya gagal untuk mengendalikan kerumunan massa. Menteri Kesehatan Mesir Ahmed Samih Farid mengatakan bahwa sepuluh orang tewas dalam bentrokan itu, yang dimulai Rabu lalu, dan 1.500 lainnya cedera, sembilan di antaranya berada dalam keadaan kritis. Lanjut ke hal A2 kol. 6

Rumah Adat Batak Berusia 400 Tahun Ada Di Humbahas

Lanjut ke hal A2 kol. 3


Pemimpin Mendusta Dan Korban Dusta Oleh H. P. Prameswara SUATU hari, sejumlah pemimpin negeri salju sibuk bertemu muka dengan beberapa pemimpin negeri padang pasir. Sebut saja negeri salju itu Rika dan Inggrid, masingmasing negeri berpengaruh bagi politik dan ekonomi, dipimpin Gorge Busyet dan Tony Blabla. Sedangkan negeri padang pasir itu termasuk Kasir, dipimpin Kusni Kubarak. Mereka saling bertemu, silih berganti, membicarakan tentang kejamnya pemimpin negeri abu mawas yang dipimpin diktator Soddom Husin. Kedua pemimpin negeri salju itu meyakinkan Kubarak bahwa Soddom memiliki

Lanjut ke hal A2 kol. 6

Waspada/Parlindungan Hutasoit

RUMAH adat Batak yang disebut rumah Bolon berusia 400 tahun ditemukan di perbukitan yang mengelilingi Danau Toba di Banjar Dolok, Desa Tipang, Kec Baktiraja, Kab Humbahas.

RUMAH adat Batak berusia 400 tahun dan diperkirakan tertua di dunia ditemukan di Desa Tipang, Kec. Baktiraja, Kab. Humbang Hasundutan (Humbahas). Bangunan masih utuh dan ditempati secara turun-temurun oleh Pomparan (Keturunan) Borsak Mangatasi (marga Nababan). Lokasi rumah adat Batak yang disebut rumah Bolon itu di Huta (kampung) Banjar Dolok, Desa Tipang. Jaraknya dari Doloksanggul 16 km. Dari Desa Tipang harus berjalan kaki lagi sekitar 1,5 km menuju Perbukitan tepian Danau Toba Baktiraja. Jika dari Istana Raja Sisingamangaraja XII, lokasinya dapat kelihatan di kaki perbukitan yang mengelilingi perairan Danau Toba – Baktiraja. Waspada menelusuri situs serta sejarah berdirinya rumah adat itu. Ternyata, selama ini tidak banyak diketahui orang Batak. Mungkin karena transportasi yang masih terbatas atau promosinya yang tidak ada, sementara penghuninya hanya warga desa yang hidupnya sangat sederhana. Kondisi rumah itu dengan lantai lebar mencapai 60 m, tebal 10 cm masih tampak sangat bagus. Tiang berukuran besar masih kokoh. Di dalamnya sangat luas dan tidak punya kamar tidur. Sebagai rumah Batak yang tua, ada sebuah tempat tidur orang Batak yang berukuran besar namanya Sondi.

Lanjut ke hal A2 kol. 2

Gubsu Copot Hasiholan Silaen Rachmatsyah Plt Sekdaprovsu MEDAN (Waspada): Hasiholan Silaen mendadak dicopot dari jabatannya selaku Plt Sekdaprovsu oleh Gubsu Syamsul Arifin. Posisinya digantikan Rachmatsyah yang selama ini menjabat Asisten Kesejahteraan dan Sosial Pemprovsu. Penggantian Hasiholan Silaen yang menjabat selama dua bulan, sejak 1 Desember 2010 di posisi puncak karier PNS tersebut, spontan memunculkan isu tak sedap di lingkungan PNS Kantor Gubsu.Isu itu

dikaitkan dengan tugas melantik tiga pejabat eselon II Pemprovsu yang sudah 1,5 bulan lamanya tertunda. Sebenarnya pelantikan itu menjadi kewajiban Hasiholan, namun dikabarkan dia menolak untuk melakukan pelantikan itu sehingga dia dianggap tidak loyal. Kepala Badan Kepegawaian Daerah Sumut Suherman yang dikonfirmasi Jumat (4/2) siang, membenarkan kalau Plt Sekdaprovsu sudah dipercayakan kepada Rachmatsyah.

“Penunjukan Pak Rachmatsyah sebagai Plt Sekdaprov yang baru sesuai SK Gubsu Nomor 821:3/447/2011/tanggal 1 Feburuari 2011,” ujar Suherman. Terkait isu bahwa penunjukkan Plt Sekdaprovsu terkesan mendadak. Suherman tidak berkomentar banyak. “Pagi tadi, Pak Hasiholan Silaen masih memimpin apel pagi di lingkungan Sekretariat Pemprovsu.

Lanjut ke hal A2 kol. 1

Mahasiswa Mesir Asal Sumut Pulkam


TIBA DI SUMUT: Hafizah Siregar, mahasiswa Universitas Al Azhar, Kairo, Mesir asal Sumut menangis memeluk sanak keluarganya setibanya di Bandara Polonia Medan, Jumat (4/2).

MEDAN (Waspada): 13 Orang warga asal Sumatera Utara termasuk mahasiswa yang belajar di Kairo, Mesir, pulang kampung (pulkam) melalui Bandara Polonia Medan. Kepulangan mereka disambut sanak saudara dan orang tua.Mereka sujud syukur sesaat setelah turun dari pesawat Citylink Garuda Indonesia, Jumat (4/2). Ratna Maula Lubis dan Deapari Siregar, orang tua Hafizah Siregar, 22, menyatakan gembira dan terima kasih kepada pemerintah yang telah membiayai anaknya balik ke Indonesia dan ke Sumatera Utara.

Lanjut ke hal A2 kol. 3

Pengantin Baru Terkena Imbas Demontrasi PESAWAT Citylink Garuda Indonesia dengan nomor penerbangan GA-0421, mendarat di Bandara Polonia Medan pukul 14:50, Jumat (4/2), membawa sejumlah mahasiswa asal

Sumatera Utara yang balik dari Kairo, Mesir. Sementara sejumlah wartawan media cetak dan elektronik menyerbu Bandara Polonia. Mereka ramai-ramai datang

ketika suasana udara cukup panas mencapai 33 derajat Celcius. Awalnya dikabarkan mahasiswa-mahasiswa itu dipulangkan dengan Garuda GA-188 dan bertolak dari Jakarta pukul 12:20, ternyata para mahasiswa dan anak-anak dari Kairo menumpang Citylink, anak perusahaan Garuda Indonesia.

Lanjut ke hal A2 kol. 1

Seramp ang erampang Waspada/Abdullah Dadeh

HABIBIE Rambe dan istrinya, mahasiswa Kairo Mesir sementara balik ke kampung halaman di Sumatera Utara.

- Muak karena kekenyangan - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017


Demo di Kedubes AS di Kuala Lumpur, Jumat (4/2), mendesak Presiden Husni Mubarak mundur.

SABTU, Wage, 5 Februari 2011/2 Rabiul Awal 1432 H  z No: 23408 * Tahun Ke-65

Terbit 24 Halaman (A1-12, B1-12)  z Harga Eceran: Rp 2.500,-


AS - Pejabat Mesir Berunding:

Usulkan Mubarak Mengundurkan Diri WASHINGTON (Antara/Reuters): Pemerintah Presiden Barack Obama sedang berunding dengan para pejabat Mesir mengenai satu usulan bagi pengunduran diri segera Presiden Hosni Mubarak, kata surat kabar The New York Times, Kamis waktu setempat atau Jumat (4/2) WIB. Berdasarkan usulan itu, Mubarak akan menyerahkan kekuasaan kepada satu pemerintah peralihan yang dipimpin Wakil Presiden Omar Suleiman dengan dukungan militer Mesir, kata surat kabar itu, mengutip para pejabat pemerintah dan diplomat Arab. Juga diusulkan pemerintah peralihan agar mengikut sertakan satu kelompok-kelompok oposisi termasuk Ikhwanul Muslimin yang terlarang, untuk mulai menyusun satu sistem pemilihan negara itu dalam usaha meyelenggarakan pemilu yang bebas dan jujur September, kata surat kabar itu. Mengomentari berita itu, juru biiara Departemen Luar Negeri AS P.J Crowley mengatakan,” Presiden, Menlu Hillary Clinton dan para pejabat lainnya telah mendorong pemerintah Mesir memulai satu transisi yang tertib. Para pejabat senior Obama mengatakan uusul itu adalah salah satu dari beberapa opsi yang sedang


SHALAT JUMAT DI TAHRIR: Para pemrotes anti-pemerintah ikut ambil bagian dalam shalat Jumat di Lapangan Tahrir di Kairo Jumat (4/2). Puluhan ribu warga Mesir melakukan shalat di Lapangan Tahrir Jumat dan berdoa agar segera berakhirnya kekuasaan Presiden Hosni Mubarak selama hampir 30 tahun.

KAIRO (Waspada): Seusai shalat Jumat, warga Kairo kembali membanjiri Lapangan Tahrir untuk menuntut Presiden Hosni Mubarak turun. Namun sampai berita ini diturunkan pukul 22:00 WIB Presiden Hosni Mubarak belum mau mundur. Sementera yang mendungkung Mubarak juga turun ke lapangan Tahrir, sedangkan tentara lengkap dengan peralatan tempur, sudah bersiaga di lokasi. Penjagaan itu dilakukan guna menghindari bentrokan massal seperti yang terjadi Kamis kemarin.

JAKARTA (Waspada): Gayus Tambunan buka-bukaan mengenai praktik mafia pajak di Direktorat Jenderal Pajak. Gayus juga membeberkan siapa saja oknum yang bermain dalam mafia pajak itu ke penyelidik Komisi Pemberantasan Korupsi (KPK). “Tadi ditanyain tentang bagaimana modus-modus di pajak, kira-kira siapa petugas pajak, perannya apa,” kata Gayus usai diperiksa, di Gedung KPK, Jakarta, Jumat (4/2). Siapa saja yang bermain di

Mubarak Harus Mundur Terhormat vivanews

KPK menahan satu tersangka dugaan suap cek pelawat, Hengky Baramuli, Jumat (4/2).

Giliran Hengky Baramuli Ditahan KPK Di Salemba

JAKARTA (Antara): Setelah beberapa kali tidak memenuhi panggilan, akhirnya Komisi Pemberantasan Korupsi (KPK) menahan tersangka Hengky Baramuli yang diduga menerima suap atas pemilihan Miranda Goeltom sebagai Deputi Gubernur Senior Bank Indonesia periode 2004. “Dibawa ke (rumah tahanan/rutan) Salemba,” kata penasehat hukum Hengky, Andi Kurniawan, di Jakarta, Jumat (4/2). Hengky Baramuli menjadi politisi terakhir yang ditahan KPK karena kasus dugaan penerimaan cek perjalanan atas pemilihan Miranda, sehingga saat ini 25 tersangka kasus tersebut telah tersebar di Rutan Salemba, Cipinang, Pondok Bambu dan Polda Metro Jaya.


Al Bayan

Pemimpin Mendusta & Korban Dusta

Lanjut ke hal A2 kol 3

Kantor Al-Jazeera Diserang DOHA(Antara/AFP) :Al-Jazeera, saluran televisi satelit Arab yang sejak akhir pekan lalu dilarang beroperasi di Mesir, mengatakan pada Jumat (4/2) kantor cabangnya di Kairo telah diserang. “Beberapa orang tidak dikenal datang ke kantor biro Al-Jazeera di Kairo dan merusak peralatan di dalam,” kata pernyataan stasiun televisi yang bermarkas di Doha itu, tanpa memberi rincian. Minggu lalu, kementerian informasi Mesir memerintahkan Al-Jazeera — yang memberikan peliputan mendalam akan unjuk rasa yang terjadi di Kairo — untuk berhenti beroperasi di Mesir, dan mencabut tanda pengenal pers wartawannya.

Saya Dan Teman-teman Semuanya Jahiliyah

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 7

sebagai “hari perpisahan” dan “hari keberangkatan. Kerumunan puluhan ribu orang telah terlihat di lapangan Tahrir sejak Jumat dinihari. Massa dari berbagai wilayah di ibukota negeri piramida itu, terus mengalir ke lapangan di pusat kota itu. Jumlah orang yang hadir jauh

Gayus Beberkan Mafia Pajak Ke KPK:

Mohamed ElBaradei:

KAIRO, Mesir (Waspada): Tokoh terkemuka pembaruan Mesir Mohamed ElBaradei (foto) mengatakan Presiden Hosni Mubarak harus mengundurkan diri secara terhormat sementara arus pemrotes terus memadati Lapangan Tahrir di Kairo Jumat (4/2). ElBaradei, seorang pemenang Hadiah Nobel Perdamaian dan pernah menjabat sebagai kepala IAEA, yang termasuk salah seorang pemimpin gerakan pemrotes Mesir, mengatakan bahwa Mubarak ‘harus mendengarkan dengan jelas suara yang muncul dari rakyat dan meninggalkan jabatannya secara bermartabat.’ Dia sampai sejauh menampik semua konsesi yang diberikan Mubarak dan menyebut semua itu “kecil” dan menambahkan “itu adalah masalah kepercayaan dan kini kepercayaan itu sudah pergi.”

Laman CNN melansir bahwa pasukan keamanan yang dilengkapi dengan persenjataan otomatis itu sudah berpatroli di sekitar Lapangan Tahrir sejak Jumat (4/2) pagi. Para demonstran bersumpah dan memastikan bahwa mereka akan akan sukses menjungkalkan Mubarak dari kursi Presiden, Jumat waktu setempat, yang mereka sebut

Ditjen Pajak? “Dari kelas teri, kakap, paus, semuanya diceritain,” ujar Gayus yang enggan menyebut siapa orang yang dimaksudnya itu. Selain itu, Gayus juga membeberkan kepada penyelidik KPK mengenai tugasnya di bagian keberatan dan banding pajak. “Pokoknya saya ceritakan apa yang saya ketahui tentang pajak,” ujarnya. Gayus pun kini menyerahkan sepenuhnya kepada KPK Lanjut ke hal A2 kol 7

Kantor Dan Rumah Ketua KPUD Madina Dijaga Ketat PANYABUNGAN (Waspada): Pasca aksi pembakaran yang dilakukan oleh orang tidak dikenal (OTK), rumah Ketua dan Kantor KPUD Madina di Panyabungan kini dijaga aparat Polres Madina berpakaian preman. Pantauan Waspada sejak Kamis malam – Jumat (3-4/2), beberapa personil Polres Madina terlihat berjaga-jaga di sekitar rumah dan Kantor KPUD. Pengamanan itu sendiri diakui Ketua KPUD. “Benar ada pengaman dari kepolisian dan itu memang

tanggungjawab mereka untuk mencegah terjadinya hal-hal tidak diinginkan,” ucap Jefri. Sedangkan jumlah personil polisi untuk pengamanan di rumah ketua KPUD 1 orang, dan 2 orang di Kantor KPUD. Sumber Waspada menyebutkan, Polres Madina masih terus melakukan pengembangan penyelidikan atas pembakaran rumah Ketua KPUD Madina. Sedangkan ciri-ciri tersangka yang beredar dari mulut ke mulut warga memiliki badan tinggi dan

Oleh: H. Prabudi Said

Lanjut ke hal A2 kol 2

Waspada/Parlindungan Hutasoit

BOLON: Rumah adat Batak yang disebut rumah Bolon berusia 400 tahun ditemukan di perbukitan yang mengelilingi Danau Toba di Banjar Dolok, Desa Tipang, Kec Baktiraja, Kab Humbahas.

Mahasiswa Mesir Asal Sumut Pulang Kampung MEDAN (Waspada): 13 Orang warga asal Sumatera Utara termasuk mahasiswa yang belajar di Kairo, Mesir, pulang kampung melalui Bandara Polonia Medan. Kepulangan mereka disambut sanak saudara dan orang tua.Mereka sujud syukur sesaat setelah turun dari pesawat Citylink Garuda Indonesia, Jumat (4/2). Ratna Maula Lubis dan Deapari Siregar, orang tua Hafizah Siregar, 22, menyatakan gembira dan terima kasih kepada pemerintah yang telah membiayai anaknya balik ke Indonesia dan ke Sumatera Utara. Lanjut ke hal A2 kol 7

Lanjut ke hal A2 kol 7

Rumah Adat Batak Berusia 400 Tahun Di Tipang-Humbahas

SUATU hari, sejumlah pemimpin negeri salju sibuk bertemu muka dengan beberapa pemimpin negeri padang pasir. Sebut saja negeri salju itu Rika dan Inggrid, masing-masing dua sejoli dipimpin Gorge Busyet dan Tony Blabla. Sedangkan negeri padang pasir itu termasuk Kasir, dipimpin Kusni Kubarak. Mereka saling bertemu, silih berganti, membicarakan tentang kejamnya pemimpin negeri abu mawas yang

Waspada/Abdullah Dadeh

Hafizah Siregar (tengah) didampingi kedua orang tuanya menyampaikan terima kasih kepada pemerintah saat mendarat di Bandara Polonia Medan, Jumat (4/2).

RUMAH adat Batak berusia 400 tahun dan diperkirakan tertua di dunia ditemukan di Desa Tipang, Kecamatan Baktiraja, Kabupaten Humbang Hasundutan (Humbahas). Bangunan masih utuh dan ditempati turun-temurun oleh Pomparan (Keturunan) Borsak Mangatasi (marga Nababan). Lokasi rumah adat Batak yang disebut rumah Bolon itu di Huta (kampung) Banjar Dolok, Desa Tipang. Jaraknya dari Doloksanggul 16 km. Dari Desa Tipang harus berjalan kaki lagi sekitar 1,5 km menuju Perbukitan tepian Danau Toba Baktiraja. Jika dari Istana Raja Sisingamangaraja XII lokasinya dapat kelihatan di kaki perbukitan yang mengelilingi perairan Danau Toba – Baktiraja. Waspada menyelusuri situs serta sejarah berdirinya rumah adat itu. Ternyata, selama ini tidak banyak diketahui orang Batak. Mungkin karena transportasi yang masih terbatas atau promosinya yang tidak ada, sementara penghuninya hanya warga desa yang hidupnya sangat sederhana. Kondisi rumah itu dengan lantai lebar mencapai 60 m, tebal 10 cm masih tampak sangat bagus. Tiang berukuran besar masih kokoh. Di dalamnya sangat luas dan tidak punya kamar tidur. Sebagai rumah Batak yang tua ada sebuah tempat tidur orang Batak yang berukuran besar namanya Sondi. Lanjut ke hal A2 kol 3

Waspada/Gito Rolis

Istiqomah mahasiswi Mesir asal Aceh didampingi sang bunda sedang memberikan keterangan kepada wartawan saat tiba di Bandara SIM. Sebanyak 26 orang warga Aceh tiba di Bandara SIM, Jumat (4/2), sepuluh di antaranya mendarat di bandara Polonia Medan.

Mahasiswi Mesir Asal Aceh Tiba BANDA ACEH (Waspada): Sebanyak 26 mahasiswi asal Aceh yang melanjutkan pendidikan di Mesir tiba di Bandara Iskandar Muda, Jumat (4/2) pukul 11:01 wib, dengan menggunakan maskapai penerbangan Lion yang diberangkatkan dari Jakarta. Menurut Ketua Posko I k a t a n A l u m n i Ti m u r - Mubarak atau Tengah Muhammad Fadhillah, jumlah warga Aceh demonstran yang dipulangkan dari yang mundur? Pondok Gde Jakarta ke - He.... he....he.... Aceh sebanyak 26 orang


Lanjut ke hal A2 kol 1

Berita Utama


14 Tahun Buron, Pelaku Pembunuhan Di Sipaho Ditangkap GUNUNGTUA (Waspada): Setelah 14 tahun menjadi buronan, pelaku pembunuhan di Desa sipaho, Kecamatan Halongonan pada tahun 1997 ditangkap personil Polsek Padang Bolak bekerjasama dengan aparat Polres Mandailing Natal di Desa Gunung Godang, Kecamatan Ranto Baik, Kabupaten Mandailing Natal, Kamis, (3/2) malam. “RH kita tangkap di rumahnya di Desa Gunung Godang, Kecamatan Ranto Baik,” kata Kapolres Tapsel AKBP Subandria melalui Kapolsek Padang Bolak AKP Jony Ward Sibat, Jumat, (4/2). Menurut keterangan dari tersangka, dirinya membunuh BKH karena ada perselisihan tanah pada 1997 lalu. Dia mengatakan, ibunya, Banian Hasibuan sering diancam korban di kebun milik mereka. “Ibu saya sering diancam dengan parang, siapapun anaknya pasti akan emosi”, kata tersangka.

Waktu itu, korban baru turun dari bus pulang dari Gunungtua. Saat ditengah perjalanan yang berkisar 1 kilometer dari tempat turunnya korban, RH langsung mengejar korban dan menganiayanya dengan parang. “Pas saya tinggalkan, korban masih hidup, namun lehernya sudah berceceran darah,” ucap RH di depan petugas. Kemudian abang ipar RH, HS saat melintas dari tempat kejadian itu dan langsung menyuruh RH melarikan diri. RH lalu pergi dan menitipkan parangnya kepada HS. “HS pun sudah ditangkap pada tahun 1997 karena ikut terlibat turut membantu tersangka dan sudah keluar. Dia dihukum 5 tahun penjara”, sebut Kapolsek. Dijelaskan, RH merupakan tersangka pembunuh BKH yang waktu itu masih berumur 60 tahun di Dusun Pardomuan, Desa Sipaho, Kecamatan Halongonan. RH melaku-

Waspada/Sori Farlah Harahap

PERIKSA: Juru periksa Polsek Padang Bolak Bripka M Hutabarat sedang memeriksa pelaku pembunuhan yang selama 14 tahun menjadi buron.

16 Camat Di Pemkab Madina Sertijab

PANYABUNGAN (Waspada): Sekdakab Madina Gozali Pulungan didampingi Asisten Tapem M.Sahnan Pasaribu, Sekretaris BKD Abdul Hamid menjadi saksi acara serah terima jabatan bagi 16 camat di lingkungan Pemkab Mandailing Natal di aula kantor bupati di Payaloting Panyabungan, Jumat (4/2). Adapun 16 camat yang diserahterimakan yakni Syahnan Batubara menjadi Camat Panyabungan, M Arif Adnan menjadi Camat Batahan, Mukhlis menjadi Camat Siabu, Awaluddin Lubis menjadi Camat Kotanopan, HM Yunus Lubis menjadi Camat Muarasipongi, Azhar Lubis menjadi Camat Batang Natal, Partahian Pohan menjadi Camat Muara Batang Gadis, Liliana Asaliah Lubis menjadi Pj.Camat Panyabungan Selatan. Kemudian Suandi Usman Nasution menjadi Pj.Camat Bukit Malintang, Murnady Pasaribu menjadi Pj Camat Huta Bargot, Parlin Lubis menjadi Pj Camat Tambangan, Khairul Anwar menjadi Pj Camat Lembah Sorik Marapi, Kamal Khan menjadi Pj Camat Lingga Bayu, Abdul Halim Hasibuan menjadi Pj Camat Ranto Baek, Sarwedi menjadi Pj Camat Natal dan Safril menjadi Pj Camat Panyabungan Barat. (a28)

Mahasiswi Mesir ....

khusus wanita, 16 orang mendarat di Bandara Sultan Iskandar Muda (SIM) dan sepuluh orang mendarat di Bandara Polonia Medan. Sedangkan kloter kedua yang dijadwalkan Jumat (4/2) pagi, diberangkatkan dari Mesir sebanyak 47 orang, lalu mereka akan dipulangkan kembali ke Aceh melalui bandara Soekarto-Hatta. Kepulangan warga Aceh itu disambut suasana haru pihak keluarga dan Asisten III Setda Aceh Ridwan Hasan dan Kepala Biro Isra Setda Aceh. Penyambutan diwarnai isak tangis dari keluarga yang me-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Kf2+. 2. Rh2, Ge5+. 3. f4, Gxf4+. 4. g3, Mxh3+mat.

Pemimpin ....

Jawaban TTS: TTS Topik





Jawaban Sudoku: 2 5 7 9 8 1 6 0 3 4

1 8 2 6 7 0 3 4 9 5

9 7 8 0 4 3 5 1 6 2

0 4 3 5 2 6 7 9 8 1

3 6 4 1 9 5 8 2 0 7

4 1 5 2 0 8 9 3 7 6

8 9 6 3 5 4 1 7 2 0

5 0 9 4 6 7 2 8 1 3

nunggu di bandara sejak pagi. Salah seorang mahasiswi asal Aceh yang tiba di Banda SIM, Istiqomah misalnya, ia bersyukur bisa kembali ke tempat asal, meskipun dengan perasaan sedih meninggalkan kota Mesir, tapi situasi di Mesir mencekam, membuat warga yang menetap di sana menjadi panik. “Kami ketakutan dan kebutuhan pokok untuk dikonsumsi sehari-hari mulai menipis karena tidak ada orang yang berani berdagang,” ujarnya kepada Waspada. Muhammad Fadhillah menambahkan, meski makanan menipis, namun secara umum keadaan mereka baikbaik saja di Mesir, karena warga Aceh di sana sudah didata dan akan segera dievakuasi oleh KBRI di sana. Kepala Biro Hukum dan Humas Pemerintah Aceh Makmur Ibrahim mengatakan, informasi yang didapat dari KBRI dari total mahasiswa Aceh di Mesir sebanyak 369 orang yang sudah dipulangkan sebanyak 34 orang yang terdiri atas wanita dan anak-anak. (gto)

6 2 1 7 3 9 0 5 4 8

7 3 0 8 1 2 4 6 5 9

dipimpin diktator Soddom Husin. Kedua pemimpin negeri salju itu meyakinkan Kubarak bahwa Soddom memiliki senjata pemusnah massal (WMD) yang membahayakan perdamaian dunia. Karena itu dia harus ditangkap, bukan dengan cara menarik rambut dari tepung, tapi mengobokoboknya sampai berantakan. Kubarak, menyusul koleganya di negeri padang pasir lainnya menelan saja bulatbulat ucapan Gorge Busyet dan Tony Blabla, bahwa WMD ada di negeri abu mawas. Seperti orang kena hipnotis untuk dimintai pulsa hp atau memang syur dia berkawan dengan pemimpin negeri harta karun, entahlah, tapi yang jelas Kubarak dkk mengikuti saja kemauan Busyet dkk. Mereka bersubahat membunuh seekor nyamuk negeri abu mawas itu dengan ribuan bom. Soddom berikut para stafnya berhasil ditangkap di tengah banjir darah rakyatnya yang tidak berdosa. Menyusul diangkatnya boneka penjilat negeri-negeri Rika dan seku-

Warga Tangkap Phyton 100 Kg

Phyton Besar: Terlihat seekor ular jenis phyton dalam krangkeng yang amankan seorang warga di Kampung Lemah, Bebesen. Aceh Tengah.

AKENGEN (Waspada): Seekor ular phyton besar diperkirakan memiliki bobot 100 kilogram dengan diameter 30 cm dan panjangnya mencapai 6,20 meter ditangkap warga Pamar, Kecamatan Rusip, Aceh Tengah. Ular itu setelah ditangkap warga di kemukiman yang masih tergolong terisolir untuk Aceh Tengah ini, tidak tahu mau dibawa kemana dan diapakan. Jangankan mengurus hewan berbisa ini, untuk apa hewan itu ditangkap, warga di sana juga tidak mengetahui. Karena takut hewan ini mengganggu dan memakan

pendukung Mubarak menyerang para wartawan dan aktivis HAM di seluruh Kairo Kamis, sementara yang lainnya ditahan oleh tentara. Bentrok Kembali Pecah Ribuan pendukung Presiden Mesir Hosni Mubarak berusaha menguasai jalan-jalan menuju ke Bundaran Tahrir, pusat kota Kairo — tempat terkonsenstrasinya pengunjuk rasa oposisi anti-Mubarak, namun dihalau tentara agar menjauh dari Tahrir. Kelompok pro-Mubarak mulai tampak dari Jalan Qasrul Aini, arah sebelah barat Tahrir. “Hidup Mesir, hidup pahlawan kami Mubarak,” teriak pendukung orang nomor satu di negeri Piramida itu. Pada Jumat (4/2) pagi, jalan-jalan menuju ke Tahrir tampak sepi, namun sekitar pukul 08:30 waktu setempat atau setengah jam setelah berlalunya pemberlakuan jam malam, para pendukung Mubarak mulai terlihat. Pendukung Mubarak juga datang dari Jalan Cornesh Nil dan dari sisi kanan gedung Museum Nasional. Saling lempar batu dan bom molotov pun kembali pecah, setelah beberapa jam tenang. Sejumlah tentara bersenjata lengkap berusaha membuat barikade untuk memisahkan kedua kelompok berseberangan tersebut, namun kewalahan menahan saling lempar batu dan bom molotov dari kedua pihak. Seorang tentara terlihat lari terbirit-birit sambil memegang kepalanya yang berdarah

terkena lemparan batu. Rentetan tembakan sporadis terdengar dari Cornesh Nil, namun belum jelas siapa yang menembak. Seorang wartawan foto dari Syria yang sedang mengambil gambar didorong oleh beberapa tentara untuk menjauh. Sejumlah wartawan asing bergerombol di Jalan Talat Harb, sisi sebelah timur Tahrir karena dilarang masuk bundaran tersebut. Beberapa wartawan mengatakan mereka telah mencoba masuk ke Tahrir dari sisi Jalan Qasrul Aini melewati jalan belakang kampus Universitas Amerika, namun dihalau keluar oleh tentara. “Waduh, gawat ini,” teriak seorang wartawati Prancis sambil menenteng kameranya. Semua wartawan yang mendekati Tahrir diperiksa identitas kartu wartawannya. Begitu pula setiap orang yang memasuki kawasan Bundaran Tahrir diperiksa identitasnya oleh tentara. Beberapa wartawan termasuk dari Israel dan Belgia ditangkap karena dianggap melanggar jam malam, yang diberlakukan mulai pukul 15:00 hingga pukul 08:00 waktu setempat sejak Jumat pekan lalu. Mubarak Siap Lengser Namun Takut Kekacauan Sementara Presiden Mesir Hosni Mubarak mengatakan dalam wawancara dengan televisi ABC, Kamis (3/2) waktu setempat, ia ingin meninggalkan kekuasaan namun kha-

watir akan terjadi kekacauan jika ia pergi. Pemimpin Mesir itu menyatakan “telah bosan menjadi presiden dan ingin pergi sekarang, namun tidak bisa, karena khawatir negara akan tenggelam ke dalam kekacauan,’ kata wartawan ABC Christiane Amanpour setelah wawancara mereka selama 20 menit di Kairo. “Saya tidak peduli apa kata orang tentang saya. Saat ini yang saya pedulikan adalah negara saya, saya peduli Mesir,” kata Mubarak. Mubarak menambahkan, “Saya sangat tidak senang dengan yang terjadi kemarin. Saya tidak ingin melihat orang Mesir berperang satu sama lain.” Kamis kemarin, massa demonstran anti Mubarak bentrok hebat dengan massa pro Mubarak di taman itu. Terlihat kerumunan massa yang terbagi menjadi dua kubu saling lempar. Yang tertangkap langsung menjadi bulan-bulanan massa lawan. Beberapa pendukung Mubarak menggunakan Unta menerobos ke kerumunan, sembari memukul lawan. Dilaporkan sedikitnya delapan orang tewas dan sekitar 1200 orang terluka. Wartawan asing juga menjadi korban kekerasan massa pro Mubarak. Diduga massa pro Mubarak ini adalah para preman maupun polisi yang dibayar oleh pemerintah guna menandingi massa anti Mubarak. (cnn/ant/rtr/afp/abc/m10)

“Semua bahan rumah Batak itu terbuat dari kayu satu. Dulu atap rumah ini terbuat dari ijuk dan telah diganti dengan seng 60 tahun yang lalu (1949). Hingga sekarang belum pernah kami ganti sengnya. Lihatlah sengnya sangat tebal. Bukan seperti seng sekarang”ujar Ompu Andrian Nababan, 69, didampingi anaknya Ama Rizal Nababan, 38, di Banjar Nagodang, Kecamatan Baktiraja kepada Waspada. Ompu Andrian ( Jisman Nababan) dan Ama Rizal menuturkan sejarah berdirinya rumah Bolon itu di Bonapasogit marga Nababan. Dulu, yang membangun rumah Batak itu Ompu Sabar Dihuta Nababan dan istrinya boru Purba hingga sekarang ditempati keturunannya secara turun temurun. Menurut Ompu Andrian, anak dari Ompu Sabar Dihuta ada tiga yaitu Ompu Habinsaran, Ompu Jaurung dan Ompu Tolu. Karena menurut adat Batak yang mewarisi rumah Parsaktian adalah anak paling bungsu maka pewarisnya Ompu Tolu. Setelah menempati rumah itu, Ompu Tolu mempunyai dua anak yaitu Ompu Appanibit dan Ompu Anggiat sebagai pewaris rumah bolon. Selanjutnya Ompu Anggiat Nababan mempunyai anak delapan orang yakni Wilater,

Konstan, Oskar, Johan, Jisman, Jupiter dan Herbet. Semua anaknya pergi merantau meninggalkan tanah Tipang. “Saya kembali ke Bonapasogit , dan menempati rumah ini karena orangtua sudah meninggal. Sebenarnya pewarisnya adalah Herbet sebagai anak paling kecil,” ujar Jisman Nababan (Ompu Andrian). Dituturkan, dulunya tanah Tipang, Kecamatan Baktiraja sudah ditinggalkan marga Nababan (Borsak Mangatasi) dan membuat perkampungan di Humbang. Keturunan ke enam dari Sandar Nagodang dan Tuan Sirumonggur sudah merantau dan akhirnya pulang kampung. Selanjutnya punya keturunan yakni Ompu Godang. Ompu Godang punya banyak keturunan, salah satunya Ompu Huta Mas yang mempunyai anak tunggal yaitu Ompu Raja Ugan. Hidup sebagai petani dan nelayan di Danau Toba, Ompu Raja Ugan mempunyai anak tujuh orang di antaranya Ompu Sabar Dihuta, tutur Jisman Nababan (Ompu Andrian). Jadi, sebut Ompu Andrian, rumah Batak tersebut tidak pernah kosong. Terus dihuni keturunan Ompu Sabar Dihuta hingga sekarang. Sudah enam keturunan. Saya saja sudah berumur 69 tahun. Ini kenyataan. Kondisi rumah batak ini masih utuh,ujarnya.

Dia menyebut, sebagai pertanda bahwa Banjar Dolok merupakan bonapasogit (kampung halaman) borsak Mangatasi (marga Nababan) ada makam nenek moyang di kampung itu. Jadi dari daerah inilah menyebar marga Nababan keberbagai daerah, katanya. Ama Rizal Nababan, 38, didampingi Istrinya L Sianturi dan enam anaknya menambahkan, Desa Tipang juga sebagai Bonapasogitnya Toga (marga) Sihombing) dan Toga (marga Simamora). Toga Sihombing ada empat yakni Borsak Junjungan (marga Silaban), Borsak Sirumonggur (Lumbantoruan), Borsak Mangatasi (marga Nababan)dan Borsak Binbinan (marga Hutasoit). Tipang sebagai bonapasogitnya Toga Sihombing dan Toga Simamora ada pertanda dua pulau di tengah Danau Toba yang merupakan pemberian Siraja Lottung. Kedua Pulau itu yaitu Pulau Simamora dan Pulau Sirukkungon. “Jadi tujuh marga Batak mendiami tanah Tipang ini”terangnya. Sekdakab Humbahas Martuaman Silalahi, SH didampingi Kepala Bappeda Ir JW Purba kepada Waspada mengatakan, lokasi ke dua pulau di tengah Danau Toba itu sangat indah dan dapat dijadikan sebagai objek wisata alam.

Pulau Simamora memiliki luas 10 hektare berada pada 1.494,91 ha luasan Danau Toba. Kondisi pulau masih kosong dan tidak ada penghuninya. Bila melihat potensi pulau itu akan dapat dijadikan perencanaannya sebagai destinasi dan transit kegiatan olahraga wisata air seperti jet ski, sampan/perahu dan speedboat. “Juga dapat digunakan sebagai landasan kegiatan olahraga paralayang yang meluncur dari ketinggian 1.500 meter puncak Bukit Batu Maranak,”ujar Sekdakab Martuaman Silalahi. Bupati Humbahas Drs Maddin Sihombing, MSi dan Sekdakab Martuaman Silalahi, SH juga berupaya keras menggali potensi alam yang dimiliki Humbahas, khususnya potensi wisata Danau Toba, Baktiraja. “Ke depan kita akan upayakan mendongkrak berbagai potensi yang ada. Termasuk peninggalan–peninggalan sejarah nenek moyang suku Batak di Baktiraja. Apalagi, misalnya rumah adat Batak yang sudah berusia 400 tahun di Tipang, juga perlu dilestarikan. Kalau anak rantau marga Nababan memberdayakannya, akan dapat menjadi perhatian orang Batak,” ujar Bupati kepada Waspada barubaru ini.

tunya. Sebagian dunia senang dengan kejatuhan Soddom, seterusnya menanti dengan antusias tentang WMD. Tak lama kemudian, para wartawan negeri Rika tak sabar mempertanyakan kepada Me n t e r i Pe r t a h a n a n n y a tentang kebenaran WMD. Apa jawabnya? Dengan entengnya, sang Menhan mengatakan, untuk apa lagi membicarakan WMD, kita kan sudah berhasil menegakkan demokrasi di negeri abu mawas. Wah... Ya, memang itu saja katanya. WMD memang tidak ada. Tak lebih cuma sekedar tipu muslihat Busyet dkk untuk meyakinkan negeri-negeri padang pasir yang tentu ditakut-takuti akan diserang bala tentara negeri abu mawas. Busyet dkk adalah pemimpin pendusta. Sementara Kubarak dkk yang menjadi pemimpin korban dusta, mungkin cuma bisa elus dada sambil mengucap, dasar busyet. Seiring perjalanan waktu, dunia pun malas mempermasalahkan lagi alasan utama membantai negeri abu ma-

was, pemerintahan Kubarak mendapat cobaan tahun ini. Sejumlah besar rakyatnya mulai muak dengan kepemimpinan Kubarak selama 30 tahun ini, ditambah isu bahwa dia mengocokkan anaknya sebagai pengganti. Aksi rakyat mulai meledak di jalanan menuntut Kubarak mundur. Aksi heroisme ribuan orang menentang pemimpinnya yang berwajah beringas dan bertangan besi sedang berlangsung. Tapi bukan itu yang menarik, namun reaksi dari negeri Rika dan Inggrid. Mereka malah menuntut Kubarak mundur. Begitu saja mereka lupakan “jasa” Kubarak membantu pembantaian negeri abu mawas. Si Tony Blabla, berkoar balik gagang menentang Kubarak, begitu juga negeri Rika yang tadinya dipresideni Busyet, kini dipimpin oleh Balak Olama. Kubarak kena batunya. Dulu negeri harta karun menjadi kawan, sekarang lawan, ibarat tersangka kriminal yang dibiarkan digimbal massa, ibarat orang ditinggal setan setelah kena tipu mentah-

mentah. Kasihan juga si Kubarak, tapi itulah politik, memang kejam, masak dia nggak tahu itu. Alasan pemimpin negerinegeri salju itu adalah menegakkan demokrasi, sebagaimana dipaksakan secara tersirat terhadap negeri abu mawas lewat peperangan. Secara sepintas, demokrasi itu memang bagus. Presiden dan wakilnya harus melalui pemilihan umum dan lain sebagainya yang tampak indah, dengan catatan “tapi”. Tapi kelemahannya adalah sebaliknya buruk, yakni kebebasan bersuara yang kebablasan. Fitnah, kebencian, vested interest bermunculan menumpang demokrasi tanpa moral dan akhlak, sebagaimana dicontohkan di negeri Bondonesia. Jika itu model demokrasi yang disenangi oleh negerinegeri salju, maka penulis pun bisa melempar kebencian ke negeri-negeri salju bahwa demokrasi yang mereka paksakan itu cuma sekedar untuk memecah belah penduduknya yang mayoritas seagama.

Sedap nontonnya ya? Pendek kata, jadikanlah pengalaman di atas pelajaran bagi Kubarak dan pemimpin padang pasir lainnya ke depan. Hikmahnya adalah berhatihatilah memilih kawan dari negeri salju, apalagi untuk membantu menghancurkan negeri seagama. Insyaflah. Belum terlambat menjadikan diri pemimpin yang terbaik berdasarkan hadis sbb: “Sebaik-baik manusia adalah yang paling baik Aquran-nya diantara mereka, orang yang paling memahami agama Allah diantara mereka, orang yang paling bertakwa kepada Allah diantara mereka, orang yang paling sadar menyuruh orang kepada kebaikan, orang yang paling sadar mencegah orang dari kemungkaran dan orang yang paling baik hubungan silaturahminya diantara mereka.”(HR Achmad, Al Baihaqi dan Thabrani). Dekatkan diri kepada Allah dan memohon pertolonganNya agar menjadi pemimpin yang terbaik. ** ** **

kan pembunuhan sadis kepada BKH. Korban dibunuh dengan kondisi mengenaskan. Bagian kepala korban bocor dan mengeluarkan darah sedangkan jari tangannya sebelah kanan habis terpoton, ucapnya. Kapolres Tapsel AKBP Subandria yang dikonfirmasi melalui Kapolsek Padang Bolak AKP Jony Ward Sijabat membenarkan. Tersangka dikenakan pasal 340 Jo 338 KUHP dengan ancaman seumur hidup atau 20 tahun penjara (a35)

Mubarak Belum ....

lebih banyak dari jumlah demonstran yang hadir pada demonstrasi sejuta orang pada Selasa (1/2). Menteri Pertahanan Mesir Hussein Tantawi dan sejumlah pejabat senior tentara yang berkunjung ke Lapangan Tahrir Jumat pagi bersama sejumlah prajurit melakukan pemeriksaan kartu tanda pengenal dan melakukan penggeledahan badan bagi siapa saja yang masuk ke lapangan tersebut. Tindakan itu merupakan pertanda bahwa lembaga paling berkuasa Mesir itu menerapkan sanksi pada demonstrasi. Suasana tenang setelah dua hari bentrok pro dan antiMubarak ‘perang batu’ di jalanan dan berlindung di bawah perisai yang mereka ambil dari lembaran seng atau logam yang mereka ambil dari lokasi pembangunan. Geng-geng

Usulkan Mubarak ....

Para pejabat senior Obama mengatakan uusul itu adalah salah satu dari beberapa opsi yang sedang dibicarakan dengan para pejabat tinggi Mesir pemerintah Mubarak, kendatipun tidak secara langsung dengan dia, dalam usaha untuk meyakinkan dia mengundurkan diri sekarang, kata surat kabar itu. Kendatipun Mubarak sejauh ini menolak mundur segera, para pejabat dari kedua pemerintah itu terus melakukan perundingan menyangkut rencana itu, kata the Times. (m10)

Rumah Adat ....

WASPADA Sabtu 5 Februari 2011

Waspada/Irwandi MN

* Parlindungan Hutasoit

ternak, makanya enam warga Pamar menangkapnya. Namun setelah ditangkap, ular itu menjadi masalah. Dari pada ular itu dibunuh sia-sia, mereka menyerahkan kepada Ali Kre’ok, salah seorang penarik beca mesin di Aceh Tengah. “Saya juga bingung ular ini mau dikemanakan. Saya bukan pawang ular dan ahlinya. Namun karena bila dibiarkan ular ini akan membahayakan, makanya saya buat kandangnya. Apalagi ular ini masih terlihat ganas,” sebut Ali Kre’ok, 59, penduduk Lemah, Kec. Bebesen, Aceh Tengah, menjawab Waspada Jumat (4/2). “Ka l a u a d a y a n g a h l i mengurusnya seperti pawang ular, atau mereka yang berasal dari petugas kebun binatang, atau pihak lain yang lebih mengerti tentang ular, saya akan menyerahkan ular ini untuk dirawat. Apalagi ular ini terlihat kurus, karena bukan habitatnya,” sebut Ali sambil menunjuk si belang, dengan membandingkan kondisi tubuhnya sebelum dikerangkeng. Untuk merawat ular ini, Ali terpaksa mengambil inisiatif menyediakan kandang ular yang terbuat dari jaring kawat. Ular itu ditempatkan di depan rumahnya. Untuk biaya perawatan itu Ali yang hanya meng-

hidupi diri dan keluarga bersumber dari beca, sudah menghabiskan biaya Rp 500 ribu. Ular ini sudah 15 hari di kediamannya. Karena ular tersebut juga membutuhkan makanan. Abang beca ini memberikan ayam. Untuk merawat ular ini, Ali mengambil inisiatif membuat pengumuman agar membantu biaya bagi mereka yang melihatnya. “Memang kita tulis Rp3000 untuk melihat ular ini, namun kami tidak memaksa siapa yang datang harus bayar. Kalau tidak silakan saja melihat ular ini. Semuanya ini saya lakukan demi menyelamatkan ular karena saya hanya tukang beca,” sebutnya. Ketika ular itu mulai didengar warga seputar kota Takengen, minat masyarakat melihat ular ini mulai tampak. Hampir setiap hari ada saja masyarakat yang berkunjung ke sana walau tidak banyak. Kedatangan warga ini, senantiasa ditemani Ali karena dia takut ada yang usil mengganggu ular, sehingga membuat hewan melata ini marah. “Saya bukan pawang ular, namun sejak ada ular ini, saya mulai memperhatikan bagaimana kebiasaan ular. Setiap hari saya ikuti perkembangan ular ini,” sebutnya. (cir/b18)

Mubarak Harus ....

pucuk kekuasaan karena dia masih merasa didukung AS. Nah, Washinton hendaknya mendengar aspirasi masyarakat Mesir yang menuntut hengkangnya Mubarak,” katanya. Dia menilai Washington terlalu berlebihan mempertahankan rezim Mubarak dengan alasan yang terkesan dibuat-buat seperti kekhawatiran berkuasanya Ikhwanul Muslimin. “Aksi unjuk rasa saat ini bukan semata didalangi oleh Ikhwanul Muslimin, tapi hampir semua komponen masyarakat,” katanya. Sebelumnya, Omar Sharif, bintang film kesohor Mesir juga mendesak AS dan Uni E ro p a u n t u k m e m b u j u k Mubarak mundur. “30 tahun sudah AS dan Uni Eropa mendukung rezim Mubarak, kini sudah saat meminta dia mundur,” kata Omar kepada jaringan televisi Al Arabiya, Kamis. Penuntutan Mubarak mundur semakin meluas di Mesir termasuk Asosiasi Dokter Mesir dan Perhimpunan Artis Mesir. Prof. Rashad menyambut baik inisiatif AS berunding dengan pemerintah Mesir mengenai pengalihan kekuasaan. (m10)

Mahasiswa Mesir ....

latan yang turut dipulangkan melalui Bandara Polonia menyatakan kondisi Kairo Mesir, saat ini benar-benar mencekam. Banyak masyarakat terkurung di tempat tinggal masing-masing. Warga masyarakat dan mahasiswa tidak bebas keluar rumah akibat meningkatnya aksi kerusuhan menentang Presiden Hosni Mubarrak. Hal yang sama dibenarkan Habibie Rambe asal Labusel, mahasiswa Al Azhar, Kairo, Mesir.Mahasiswa semester 4 ini menyatakan gembira dapat balik ke Tanah Air, walaupun dalam suasana menegangkan. Kata Habibie, lebih kurang 13 mahasiswa dan anak-anak bersama orang tua mereka pulang ke Sumut, antara lain Hafizah Siregar, Taudi Rambe, Habibie Rambe, Siti Maisarah, Riswan, Nurbaiti, Dahniarti Drg. Pisna dan sejumlah anakanak. (m32)

Saya Dan Teman ....

itu. “Saya tidak akan sebutkan nama orangnya dan kedudukannya saat itu,” ujar Hotma. Pada saat membacakan pembelaan, Gayus sudah pernah mengungkap sejumlah cara yang biasa digunakan mafia pajak di lingkungan Direktorat Jenderal Pajak. Ada tiga modus yang kerap dilakukan Gayus. (vivanews)

Kantor Dan Rumah ....

dengan pejabat Bupati Madina, dan sejumlah alasan lainnya. Bendahara Badko HMI Sumut, Iswadi Batubara pada Waspada, Jumat (4/2) mengatakan, terbakar atau dibakarnya rumah Ketua KPUD Madina jangan terlalu didramatisir, dan dipolitisir untuk membingungkan sekaligus mengalihkan perhatian masyarakat Madina dari coblos ulang. Katanya, semua elemen di Madina sudah saatnya berbicara dan mengutamakan kepentingan mayoritas Madina. Karena, ketidakstabilan pemerintahan saat ini menjadikan kinerja dan kehadiran PNS sebagai pelayan masyarakat relatif berkurang. Dan ini berimbas pada kepentingan masyarakat banyak di Madina. (c14)

Dia mengatakan kepada para wartawan Jumat bahwa seharusnya ada waktu transisi selama setahun menuju ke demokrasi sesuai dengan konstitusi sementara di bawah dewan kepresidenan yang beranggota beberapa orang, ter masuk seorang wakil militer. Dilanda prahara Kalangan akademisi di Mesir sepakat bahwa kekuatan Presiden Mubarak yang sedang dilanda prahara saat ini berada di tangan pemerintah AS pimpinan Presiden Barack Obama. “Tak bisa dipungkiri, AS memiliki peranan penting dalam krisis politik di Mesir. Oleh karena itu bila AS meminta Mubarak mundur, ia akan mendengar,” kata akademisi Mesir, Prof. Dr. Adly Rashad, dalam perbincangan di Kairo, Jumat. Pakar kebudayaan dari Universitas Al-Azhar Kairo itu mendesak Washington untuk berpikir ulang mengenai dukungannya kepada rezim Mubarak. Pernyataan senada diutarakan analis politik dari Universitas Kairo, Prof.Dr. Mohammed Ezzat. “Bertahannya Mubarak di Ratna warga Jalan Genteng, Gang Keluarga, Deliserdang berharap kondisi di Mesir cepat pulih dan anaknya bisa kembali kuliah. Namun, Ratna masih cemas karena seorang putranya Abuzar Adgifari Siregar, 20, yang juga belajar di University Al Azhar Cairo belum balik ke Tanah Air. Dia yakin putranya akan kembali ke Tanah Air dengan warga Indonesia gelombang kedua. Sementara itu, Hafizah saat bertemu kedua orang tuanya di terminal dalam negeri Bandara Polonia Medan sujud syukur. Gadis berperawakan sedang berkulit mulus itu kelihatan mendapat ciuman berulang ulang kedua orang tuanya, saudara lainnya yang m e n y a m b u t d i Ba n d a ra Polonia Medan. Sementara itu, Tauhid Rambe, 24, asal Tapanuli Seapakah ingin menindaklanjuti kasusnya itu atau tidak. “Tinggal KPK saja mau tidak menindaklanjuti ini. Kalau yang di pajak, saya dan teman-teman yang 2007 ke bawah semuanya jahiliyah,” ujarnya. Pengacara Gayus, Hotma Sitompul, juga enggan menyebutkan siapa saja petugas pajak yang dimaksud Gayus tegap, serta menggunakan sepeda motor bebek. Sementara Polres Madina hingga saat ini belum ada mengumumkan ciri-ciri yang mengarah pada pelaku pembakaran. Anehnya, pasca kebakaran rumah Ketua KPUD Madina, para aktifis dan juga politisi yang biasa mangkal di sejumlah tempat-tempat umum di Panyabungan mendadak sepi. Bahkan pro dan kontra motif dibakarnya rumah Ketua KPUD menjadi perdebatan di Kota Panyabungan. Asumsi masyarakat Madina secara global, pembakaran itu dilatari kepentingan percepatan pilkada ulang di daerah iru, kemudian ada upaya membenturkan sesama pasangan calon bupati. Upaya membenturkan pasangan calon bupati, para politisi,

Berita Utama

A2 Kantor Dan Rumah Ketua KPUD Madina Dijaga Ketat

KPK Genap Tahan 24 Politisi

PANYABUNGAN (Waspada): Pasca terjadinya pembakaran oleh orang tidak dikenal (OTK), rumah ketua dan kantor KPUD Madina dijaga aparat Polres Madina berpakaian preman. Pantauan Waspada sejak Kamis malam – Jumat sore (34/2), beberapa personil Polres Madina terlihat berjaga-jaga di sekitar rumah dan Kantor KPUD. Pengamanan itu diakui Ketua KPUD. “Benar ada pengaman dari kepolisian dan itu memang tanggungjawab mereka untuk mencegah terjadinya hal-hal tidak diinginkan,” ucap Jefri. Sedangkan jumlah personil polisi untuk pengamanan di rumah ketua KPUD 1 orang, dan 2 orang di Kantor KPUD. Sumber Waspada menyebutkan, Polres Madina masih terus melakukan pengembangan penyelidikan. Sedangkan ciri-ciri tersangka yang beredar dari mulut ke mulut memiliki badan tinggi dan tegap, serta menggunakan sepeda motor bebek. Sementara Polres Madina hingga saat ini belum ada mengumumkan ciri-ciri yang mengarah pada tersangka pelaku pembakaran. Anehnya, pasca kebakaran rumah Ketua KPUD Madina, para aktifis dan juga

politisi yang biasa mangkal di sejumlah tempat-tempat umum di Panyabungan mendadak sepi. Bahkan pro dan kontra motif dibakarnya rumah Ketua KPUD menjadi perdebatan di Kota Panyabungan. Asumsi masyarakat Madina secara gelobal, pembakaran itu dilatari kepentingan percepatan pilkada, kemudian ada upaya membenturkan sesama pasangan calon bupati. Upaya membenturkan pasangan calon bupati, para politisi, dengan pejabat Bupati Madina, dan sejumlah alasan lainnya. Bendahara Badko HMI Sumut, Iswadi Batubara pada Waspada, Jumat (4/2) mengatakan, terbakar atau dibakarnya rumah Ketua KPUD Madina jangan terlalu di deramatisir, dan di politisir untuk membingungkan sekaligus mengalihkan perhatian masyarakat Madina dari coblos ulang. Katanya, semua elemen di Madina sudah saatnya berbicara dan mengutamakan kepentingan mayoritas Madina. Karena, ketidak stabilan pemerintahan saat ini menjadikan kinerja dan kehadiran PNS sebagai pelayan masyarakat relatif berkurang. Dan ini berimbas pada kepentingan masyarakat banyak di Madina.(c14)

JAKARTA (Waspada): Komisi Pemberantasan Korupsi (KPK) genap menahan 24 tersangka kasus Traveller Cheque Deputi Gubernur Senior Bank Indonesia Miranda S Goeltom. Jumlah tersangka awalnya terdiri dari 26 orang, namun dua diantaranya Alm. Jeffrey Tongas Lumban (Fraksi PDI Perjuangan) telah meninggal dunia. Sedangkan tersangka lainnya, Antony Zeidra Abidin (Fraksi Golkar) telah masuk tahanan. Anthony merupakan terpidana kasus aliran dana BI ke DPR senilai Rp 31,5 miliar. Ia divonis berperan aktif dalam aliran dana tersebut. Ia juga terbukti menerima masing-masing Rp 500 juta. “Ini sudah lengkap 24 yang dipanggil dan ditahan. Jadinya 25 ditambah Antony (Antony Zeidra Abidin) tapi kan sudah di penjara lebih dulu,” ungkap

Gubsu Copot ...

tutan tiga pejabat eselon II yang dilantik itu?” ujar seorang PNS yang minta namanya tidak dipublikasikan. Sementara itu, tiga pejabat eselon II yang dilantik tampak biasa-biasa saja menyikapi pelantikan mereka yang sebenarnya sudah tertunda selama 1,5 bulan. “Tak ada masalah dengan pelantikan saya sebagai Sekwan DPRD Sumut definitif yang sempat tertunda. Ini hal yang biasa dalam sistem birokrasi pemerintahan,” ucap Randiman Tarigan yang dilantik menggantikan pejabat lama Ridwan Bustan yang pensiun. Selain Tarigan, dua pejabat eselon II yang dilantik, masingmasing Khairul Anwar sebagai Kepala Dinas Penataan Ruang dan Permukiman Sumut menggantikan pejabat lama Syarifuddin Siregar yang pensiun dan Zulkarnain, SH, MSi sebagai Kepala Dinas Kelautan dan Perikanan Sumut, menggantikan pejabat lama Ir Yosep Siswanto yang pensiun.(m28)

Namun menjelang siang, justru Pak Rachmatsyat yang memimpin pelantikan tiga pejabat eselon II itu,” jelasnya. Suherman mengakui surat penunjukan Rachmatsyah sebagai Plt Sekdaprovsu, baru diterimanya pagi tadi. Sementara, SK penunjukkan Plt Sekdaprovsu yang baru sudah diteken Gubsu Syamsul Arifin sejak 1 Februari 2011. Informasi lain yang dirangkum di Kantor Gubsu, penunjukan Plt Sekdaprov Sumut yang baru ini mengundang keganjilan dalam sejarah birokrasi di pemerintahan. “Bagaimana ini, kok Plt Sekdaprovsu dicopot, justru yang ditunjuk Plt lagi. Lantas, Plt yang baru langsung memimpin tugas pelantikan atas nama Gubsu. Sekarang yang menjadi pertanyaan lagi, Baperjakat (Badan Pertimbangan Jabatan dan Kepangkatan) yang mana yang menguji kelayakan dan kepa-

Pengantin Baru ... Saat belasan penumpang turun termasuk sejumlah mahasiswa asal Sumut yang belajar asal Kairo, Mesir, ternyata ada sepasang pengantin baru yang saat ini sedang menimba ilmu pengetahuan di University Al Azhar Cairo Mesir. “Kami baru menikah sebulan lalu tepatnya 19 Desember 2010 di Madura ,” kata Habibie Rambe, 22 sambil memperkenalkan istrinya Siti Maisarah, 23. Setelah menikah dan pesta di tempat pengantin perempuan di Jawa Timur, dia balik lagi ke Mesir pada 16 Januari 2011 untuk belajar lagi di sana. “Namun kemudian meletus demontrasi mahasiswa dan masyarakat menentang Presiden Husni Mubarak,” kata mahasiswa sementer empat penduduk Labuhan Batu Selatan itu. Begitupun Habibie menyatakan akan menggantung citacita harapan masa depan pada

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Kf2+. 3. f4, Gxf4+. 4. g3, Mxh3+mat.

Jawaban TTS: TTS Topik






Jawaban Sudoku: 3 7 1 0 9 5 6 8 2 4

8 9 2 7 6 3 4 5 0 1

1 4 3 6 0 8 2 7 9 5

5 0 8 4 2 1 9 3 7 6

6 2 9 5 4 7 1 0 8 3

4 8 5 1 7 9 3 2 6 0

7 3 6 8 5 4 0 9 1 2

2 1 7 9 3 0 5 6 4 8

0 5 4 2 8 6 7 1 3 9

9 6 0 3 1 2 8 4 5 7

thin Bria Seran dan Ahmad Hafiz Zawawi. Di rumah tahanan Pondok Bambu, KPK menahan tersangka diantaranya Ni Luh Mariani, Engelina Pattiasina, dan Budhiningsih. Terakhir tersangka sekaligus whistle blower kasus ini, Agus Condro ditahan terpisah di rumah tahanan Polda Metro Jaya. Sementara itu, KPK berencana akan mengembangkan kasus ini ke tahap yang lebih signifikan dengan menelusuri si pemberi suap. “Kasus ini belum berhenti ya, kita juga fokus terhadap pemberi cek mungkin dalam waktu sepekan dua pekan ini kamia akan ada langkah-langkah signifikan. Jika dalam pengembangan ini ada informasi atau alat bukti baru dan mengaitkan pada seseorang, siapapun orang itu akan kita proses secara hukum,” tegas Johan Budi. (kps)

Gayus Beberkan Modus Mafia Pajak Ke KPK

JAKARTA(Antara): Sebuah ledakan keras terjadi di Pusat Laboratorium Forensik Mabes Polri di Jakarta,Jumat (4/2). Kepala Biro Penerangan Masyarakat (Karo Penmas) Polri, Brigjen Pol I Ketut Untung Yoga Ana membenarkan ledakan di gedung tersebut. ‘’ Ledakan di Pusat Laboratorium Forensik Mabes Polri berasal dari tabung Nitrogen di lantai tiga,” katanya di Jakarta, Jumat.

Ledakan yang terjadi menyebabkan adanya korban anggota Polri bernama Iptu Syarifudin. “Syarifudin langsung dibawa ke Rumah Sakit Polri Kramat Jati,” kata Yoga. Ledakan yang terjadi di lantai tiga ruang tempat penyimpanan bahan kimia, Jumat pada pukul 13.30. Ledakan tersebut mengeluarkan asap putih yang ke luar dari jendela dan aroma bau terbakar tercium.

beberkan kepada penyelidik KPK mengenai tugasnya di bagian keberatan dan banding pajak. “Pokoknyasayaceritakanapayangsayaketahuitentangpajak,”ujarnya. Gayus pun kini menyerahkan sepenuhnya kepada KPK apakah ingin menindaklanjuti kasusnya itu atau tidak. “Tinggal KPK saja mau tidak menindaklanjuti ini. Kalau yang di pajak, saya dan teman-teman yang 2007 ke bawah semuanya jahiliyah,” ujarnya. Pengacara Gayus, Hotma Sitompul, juga enggan menyebutkan siapa saja petugas pajak yang dimaksud Gayus itu. “Saya tidak akan sebutkan nama orangnya dan kedudukannya saat itu,” ujar Hotma. Pada saat membacakan pembelaan, Gayus sudah pernah mengungkap sejumlah cara yang biasa digunakan mafia pajak di lingkungan Direktorat Jenderal Pajak. Ada tiga modus yang kerap dilakukan Gayus. ( VIVAnews)

Pengangguran Perkosa ...

num, Fa kembali membonceng Melati.Namun di tengah perjalanan, Fa, membelokkan kenderaannya ke arah sebuah gedung bekas sekolah persisnya di simpang rumah sakit Petumbukan. Fa, terus merayu dan mengajak Melati untuk melakukan perbuatan layaknya suami istri. Melati meronta untuk segera diantar pulang ke rumahnya, sebagaimana janji Fa sebelumnya. Tetapi Fa beringas dan mengeluarkan sebilah pisau, lalu mengancam Melati. Melati yang sudah ketakutan dapat digauli Fa. Tak Cuma sekali tetapi tiga kali. Usai mewujudkan niat jahatnya, Fa bergegas mengantar Melati pulang ke rumahnya. Tanpa disadari Fa, kalau pria

yang disuruh Fa untuk memanggil Melati tadi, ternyata memberitahukan hal itu kepada orang tua Melati, yang setelah menerima laporan tersebut, terus saja mencari dimana keberadaan putrinya, Melati. Hal ini juga diketahui beberapa warga lainnya. Tak pelak, saat Fa dilihat warga berboncengan dengan Melati, di Desa Batu Lokong, Fa pun menjadi amukan warga. Fa babak belur, lalu diserahkan ke Polres Deliserdang. Dihadapan polisi, Fa, mengakui perbuatannya telah memperkosa Melati sampai tiga kali di gedung bekas sekolah. Dia juga mengakui sebelum melakukan perbuatannya, dia mengancam Melati dengan sebilah pisau. (a07)

disi sehat-sehat saja sejak balik dari Kairo ke Jakarta hingga ke Medan,” kata Hafizah Siregar. Dia mengakui sulitnya berkomunikasi dengan keluarga berkaitan jaringan telefon di negara kaya minyak itu terputus. Sedangkan pihak keamanan terus menerus berjaga-jaga di setiap sudut kota, menyebabkan masyarakat tidak bisa keluar dari tempat tinggal. Penjagaan ketat Sementara itu, Tauhid Rambe, 24, asalTapanuli Selatan yang turut dipulangkan melalui Bandara Polonia menyatakan kondisi Kairo Mesir, saat ini benarbenar mencekam. Banyak masyarakat terkurung di tempat tinggal masing-masing. Warga masyarakat dan mahasiswa tidak bebas keluar rumah akibat meningkatnya aksi kerusuhan menentang Presiden Hosni Mubarrak.

Sedangkan para mahasiswa dan warga Indonesia yang akan dipulangkan ke Tanah Air terpaksa dijemput di tempattempat penampungan untuk dibawa ke Bandara. ‘’ Di sepanjang jalan beberapa kali dilakukan pemeriksaan petugas keamanan, ‘’kata Rambe, mahasiswa sementer terakhir. Hal yang sama dibenarkan Habibie Rambe asal Labusel, mahasiswa Al Azhar, Kairo, Mesir.Mahasiswa semester 4 ini menyatakan gembira dapat balik ke Tanah Air, walaupun dalam suasana menegangkan. Kata habibie, lebih kurang 13 mahasiswa dan anak-anak bersama orang tua mereka pulang ke Sumut, antara lain Hafizah Siregar, Taudi Rambe, Ha-bibie Rambe, Siti Maisarah, Ris-wan, Nurbaiti, Dahniarti Drg. Pisna dan sejumlah anak-anak. (m32)

JAKARTA (Waspada): Gayus Tambunan buka-bukaan mengenai praktik mafia pajak di Direktorat Jenderal Pajak. Gayus juga membeberkan siapa saja oknum yang bermain dalam mafia pajak itu ke penyelidik Komisi Pemberantasan Korupsi (KPK). “Tadi ditanyain tentang bagaimana modus-modus di pa-

jak, kira-kira siapa petugas pajak, perannya apa,” kata Gayus usai diperiksa, di Gedung KPK, Jakarta, Jumat (4/2). Siapa saja yang bermain di Ditjen Pajak? “Dari kelas teri, kakap, paus, semuanya diceritain,” ujar Gayus yang enggan menyebut siapa orang yang dimaksudnya itu. Selain itu, Gayus juga mem-

Ledakan Keras Di Puslabfor Polri

mengancam korban dengan sebilah pisau. Perkosaan ini berawal pada Jumat (4/2), saat korban pulang sekolah. Fa, menyuruh seorang siswa memanggil Melati. Melati yang belum tau tujuan panggilan itu, menemui Fa. Saat bertemu, Fa menawarkan kebaikan untuk mengantarkan Melati ke rumahnya. Melati pun menuruti tawaran Fa. Kemudian Fa membonceng Melati dengan sepedamotor. Namun Fa merayu Melati untuk berkenan jalan-jalan sebelum diantar ke rumah. Di Desa Petumbukan keduanya sempat mampir dan minum di sebuah warung. Usai mi-

Mahasiswa Mesir ... Ratna warga Jalan Genteng, Gang Keluarga, Deliserdang berharap kondisi di Mesir cepat pulih dan anaknya bisa kembali kuliah. Namun, Ratna masih cemas karena seorang putranya Abuzar Adgifari Siregar, 20, yang juga belajar di University Al Azhar Cairo belum balik ke Tanah Air. Dia yakin putranya akan kembali ke Tanah Air dengan warga Indonesia gelombang kedua. Sementara itu, Hafizah saat bertemu kedua orang tuanya di terminal dalam negeri Bandara Polonia Medan sujud syukur. Gadis berperawakan sedang berkulit mulus itu kelihatan mendapat ciuman berulang ulang kedua orang tuanya, saudara lainnya yang menyambut di Bandara Polonia Medan. “Saya berada dalam kon-

Rumah Adat Batak ...

2. Rh2, Ge5+.


perguruan tinggi terkenal dunia itu. “Saya menikah mudah-mudahan tidak menghalangi untuk belajar, apalagi pendamping saya baru selesai kuliah di universiti tersebut,” kata Habibie Rambe. Sementara istrinya yang berperawakan sedang berkulit mulus terlihat selalu mengubarkan senyum ceria disamping suaminya. “Ya, kami baru menikah dan masih tergolong pengantin baru,” kata Siti Maisarah sambil mengulur berjabat tangan. Pasangan pengantin baru tersebut untuk saat ini akan balik ke daerah orang tuanya di Labuhan Batu Selatan (Labusel) sambil memperkenalkan istrinya kepada kedua orang tuanya di sana, kata pemuda berbadan gempal itu. Dia berharap, kondisi di Mesir cepat berlalu karena banyak menggantungkan harapan masa depan masyarakat dunia. Universitas terkenal dunia itu menampung lebih kurang 500 ribu mahasiswa/mahasiswi seluruh dunia. “Jadi, sangat merugi kalau kami tidak balik lagi ke Mesir, apalagi pemerintah Indonesia menanggung biaya kembali ke Tanah Air dan balik lagi ke Mesir,” ujar Habibie . Abdullah Dadeh

Juru Bicara KPK, Johan Budi, di kantor KPK, Jumat, (4/2). 24 tersangka ini mendapat traveller cheque dalam jumlah yang berbeda, Politisi PDIP, Panda Nababan disinyalir mendapat paling banyak aliran dana itu sebesar Rp 1,45 miliar. Para tersangka ditahan di rumah tahanan yang berbeda. Di rutan Salemba KPK menahan Reza Kamarullah, TM Nurlif, Baharuddin Aritonang, Soewarno, dan Asep Ruchimat Sudjana, Max Moein, serta Panda Nababan dan terakhir Hengky Baramuli yang ditahan hari ini, Jumat. Sementara itu, di rumah tahan Cipinang, KPK menahan Rusman Lumbantoruan, Boby Suhardiman, Paskah Suzzeta, Willem Tutuarima, Daniel Tandjung, Sutanto Pranoto, Poltak Sitorus, Matheos Pormes, Sofyan Usman, M Iqbal, Mar-

“Semua bahan rumah Batak itu terbuat dari kayu satu. Dulu atap rumah ini terbuat dari ijuk dan telah diganti dengan seng sekira 60 tahun yang lalu (1949). Hingga sekarang belum pernah kami ganti sengnya. Lihatlah sengnya sangat tebal. Bukan seperti seng sekarang”ujar Ompu Andrian Nababan, 69, didampingi anaknya Ama Rizal Nababan, 38, di Banjar Nagodang, Kecamatan Baktiraja kepada Waspada. Ompu Andrian (Jisman Nababan) dan Ama Rizal menuturkan sejarah berdirinya rumah Bolon itu di Bonapasogit marga Nababan. Dulu, yang membangun rumah Batak itu Ompu Sabar Dihuta Nababan dan istrinya boru Purba hingga sekarang ditempati keturunannya secara turun temurun. Menurut Ompu Andrian, anak dari Ompu Sabar Dihuta ada tiga yaitu Ompu Habinsaran, Ompu Jaurung dan Ompu Tolu. Karena menurut adat Batak yang mewarisi rumah Parsaktian adalah anak paling bungsu, maka pewarisnya Ompu Tolu. Setelah menempati rumah itu, Ompu Tolu mempunyai dua anak yaitu Ompu Appanibit dan Ompu Anggiat sebagai pewaris rumah bolon. Selanjutnya Ompu Anggiat Nababan mempunyai anak delapan orang yakni Wilater, Konstan, Oskar, Johan, Jisman, Jupiter dan Herbet. Semua anaknya pergi merantau meninggalkan tanah Tipang. “Saya kembali ke Bonapasogit , dan menempati rumah ini karena orangtua sudah meninggal. Sebenarnya pewarisnya adalah Herbet sebagai anak paling kecil,” ujar Jisman Nababan (Ompu Andrian). Dituturkan, dulunya tanah Tipang, Kecamatan Baktiraja sudah ditinggalkan marga Nababan (Borsak Mangatasi) dan membuat perkampungan di Humbang. Keturunan ke enam dari Sandar Nagodang dan Tuan Sirumonggur sudah merantau, dan akhirnya pulang kampung. Selanjutnya punya keturunan yakni Ompu Godang. Ompu Godang punya banyak keturunan.Salah satunya Ompu Huta Mas yang mempunyai anak tunggal yaitu Ompu Raja Ugan. Hidup sebagai petani dan nelayan di Danau Toba, Ompu Raja Ugan mempunyai anak tujuh orang, di antaranya Ompu Sabar Dihuta, tutur Jisman Nababan (Ompu Andrian). Jadi, sebut Ompu Andrian, rumah Batak tersebut tidak pernah kosong. Terus dihuni keturunan Ompu Sabar Dihuta hingga

sekarang. Sudah enam keturunan. Saya saja sudah berumur 69 tahun. Ini kenyataan.‘’Kondisi rumah batak ini masih utuh,’’ujarnya. Dia menyebut, sebagai pertanda bahwa Banjar Dolok merupakan Bonapasogit (kampung halaman) borsak Mangatasi (marga Nababan), ada makam nenek moyang di kampung itu. Jadi dari daerah inilah menyebar marga Nababan ke berbagai daerah, katanya. Ama Rizal Nababan, 38, didampingi Istrinya L Sianturi dan enam anaknya menambahkan, Desa Tipang juga sebagai Bonapasogitnya Toga (marga) Sihombing) dan Toga (marga Simamora). Toga Sihombing ada empat yakni Borsak Junjungan (marga Silaban), Borsak Sirumonggur (Lumbantoruan), Borsak Mangatasi (marga Nababan)dan Borsak Binbinan (marga Hutasoit). Tipang sebagai Bonapasogitnya Toga Sihombing dan Toga Simamora ada pertanda dua pulau di tengah Danau Toba, merupakan pemberian Siraja Lottung. Kedua Pulau itu yaitu Pulau Simamora dan Pulau Sirukkungon. “Jadi tujuh marga Batak mendiami tanah Tipang ini”terangnya. Sekdakab Humbahas Martuaman Silalahi, SH didampingi Kepala Bappeda Ir JW Purba kepada Waspada mengatakan, lokasi ke dua pulau di tengah Danau Toba itu sangat indah dan dapat dijadikan sebagai objek wisata alam. Pulau Simamora memiliki luas 10 hektare berada pada 1.494,91 ha luasan Danau Toba. Kondisi pulau masih kosong dan tidak ada penghuninya. Bila melihat potensi pulau itu akan dapat dijadikan perencanaannya sebagai destinasi dan transit kegiatan olahraga wisata air seperti jet ski, sampan/perahu dan speedboat. “Juga dapat digunakan sebagai landasan kegiatan olahraga paralayang yang meluncur dari ketinggian 1.500 meter puncak Bukit Batu Maranak,”ujar Sekdakab Martuaman Silalahi. Bupati Humbahas Drs Maddin Sihombing, MSi dan Sekdakab Martuaman Silalahi, SH juga berupaya keras menggali potensi alam yang dimiliki Humbahas, khususnya potensi wisata Danau Toba, Baktiraja. “Ke depan kita akan upayakan mendongkrak berbagai potensi yang ada. Termasuk peninggalan–peninggalan sejarah nenek moyang suku Batak di Baktiraja. Apalagi, misalnya rumah adat Batak yang sudah berusia 400 tahun di Tipang, juga perlu dilestarikan. Kalau anak rantau marga Nababan memberdayakannya, akan dapat menjadi perhatian orang Batak,” ujar Bupati kepada Waspada baru-baru ini. Parlindungan Hutasoit

WASPADA Sabtu 5 Februari 2011

Tidak Boleh Laksanakan UN Picu Keresahan MEDAN (Waspada): Tidak dibolehkannya sekolah belum terakreditasi atau belum memperpanjang akreditasinya menjadi penyelenggara Ujian Nasional (UN) tahun ini, dinilai kalangan praktisi pendidikan sebagai sikap pemerintah yang tidak sportif dan menimbulkan keresahan di kalangan sekolah dan masyarakat. “Satu sisi masalah akreditasi itu adalah kewenangan pemerintah setelah sekolah mengajukan permohonan, tapi di sisi lain kesempatan untuk mendapatkan akreditasi itu sangat terbatas,” kata pengamat dan praktisi pendidikan di Medan, Emir Harahap dan Ali Nurdin secara terpisah, Jumat (4/2). Bahkan kata salah satu kepala SMP swasta di Medan yang mengaku akreditasi sekolahnya kategori C dan tahun ini harus mengusulkan perpanjangan ke Dinas Pendidikan Provinsi, sangat kewalahan dengan peraturan itu.hal ini dikarenakan pihaknya disibukkan memeriksa ulang nilai ujian semester siswa yang akan dikirim ke Dinas Pendidikan untuk menghadapi UN terkait peraturan baru tentang formulasi kelulusan UN 60:40. Diakui Ali Nurdin, akreditasi memiliki arti, manfaat dan fungsi penting bagi dunia pendidikan, yakni sekolah sebagai kegiatan penilaian secara sistematis dan komprehensif melalui kegiatan

evaluasi diri dan evaluasi eksternal untuk menentukan kelayakan dan kinerja sekolah. Tetapi, apakah pihak Badan Akreditasi Sekolah atau Badan Akreditasi Provinisi terus menerus memberikan sosialisasi tentang hal ini kepada sekolah? Jika sudah, lanjutnya, tentu ada hasil yang mereka capai. Artinya mereka mengetahui kenapa masih ada sekolah yang tidak terakreditasi dan kenapa ada yang ingin mengajukan akreditasi tapi belum mendapat kesempatan. Pihak Dinas Pendidikan, menurut Ali Nurdin, tentunya bisa menemukan jawabannya. Kemudian, sampaikan hal itu kepada pemerintah tentang problem dalam penyelesaian akreditasi sehingga ada jalan keluar dan tidak merugikan sekolah, baik yang belum terakreditasi atau belum memperpanjangnya. “Jangan langsung mengatakan sekolah itu tidak boleh menjadi penyelenggara UN di sekolahnya, ini sebuah ketidak adilan,” ujarnya. Apa yang disebutkan oleh Nurdin, dibenarkan oleh Kepala SMP Swasta Nadhlatul Ulama di Jalan Gaperta Medan, Hertin. Dia menyebutkan, akibat kesibukan kepala sekolah mempersiapkan siswa menjelang UN menjadi kelupaan mengurus atau memperpanjang akreditasi sekolah.

“Apalagi bagi sekolah swasta yang semuanya serba terbatas, termasuk jumlah siswa dan biaya operasionalnya,” ujar Hertin. Jadi polemik Sementara praktisi pendidikan, Emir Harahap, mengatakan, sekolah yang tidak terakreditasi tidak dapat menyelenggarakan UN menimbulkan polemik di tengah-tengah masyarakat khususnya orang tua dan guru, karena itu berarti anakanak mereka harus menumpang ke sekolah yang ditetapkan oleh Diknas dalam rangka mengikuti UN. Kondisi ini, lanjutnya, sangat disesalkan, karena masalah akreditasi sekolah merupakan kewajiban pemerintah dalam hal ini Kementerian Pendidikan Nasional seperti tertuang dalam Permendiknas tentang standar isi dan standar proses. Dia menambahkan seharusnya Depdiknas lebih agresif untuk melakukan akreditasi sekolah-sekolah sebagai bentuk tanggung jawab publik terutama menyangkut mutu sekolah. “Jangan sampai akibat kelalaian dan kurangnya perhatian Diknas akhirnya apa yang menjadi tujuan pendidikan nasional seperti yang tertera dalam UU Sisdiknas No.20 tahun 2003 untuk peningkatan mutu pendidikan tidak tercapai,” ujarnya. (m37)


kutukan Sekjen PBB Ban Kimoon. “Biar saya jelaskan yang sesungguhnya: ini tindakan memalukan dan benar-benar tidak dapat diterima, harus dihentikan sekarang,” kata Ban. Malamnya, sejumlah aktivis politik ditangkap oleh polisi militer, demikian juga aktivis Human Rights Watch dan Amnesty International. Berbicara dengan Christiane Amanpour dari ABC, Mubarak membantah pemerintahnya berada di belakang aksi kekerasan selama dua hari, namun katanya kejadian itu menyulitkan dia. “Saya amat tidak gembira tentang kejadian kemarin. Saya tidak ingin melihat warga Mesir berkelahi satu sama lainnya,” katanya. Dia mengatakan Persaudaraan Muslim berada di belakang kerusuhan itu. Mubarak bersumpah tidak akan pernah meninggalkan Mesir, dan menegaskan “Saya tidak akan pernah menjauh dari negeri ini. Saya akan mati di tanah ini.” Mubarak juga mengatakan dia tidak pernah berkeinginan agar putranya Gamal mengikut jejaknya untuk menduduki jabatan kepresidenan. Ketika ditanya bagaimana perasaan dia

sendiri, dia mengatakan: “Perasaan saya kuat. Saya tidak akan pernah melarikan diri. Saya akan mati di tanah Mesir.” Sementara itu, jurubicara Departemen Luar Negeri AS Philip Crowley mendesak Mubarak agar bertindak ‘lebih jauh dan lebih cepat’ untuk melakukan transisi. Sebelumnya, Wapres Omar Suleiman, menyerukan untuk pertama kalinya agar dilakukan pembaruan politik sebelum pemilihan kepresidenan September. Dia memperingatkan akan ada satu kevakuman politik jika masa transisi yang tepat tidak diperbolehkan. Perpecahan dalam Dalam satu perkembangan lainnya, jaksa penuntut hukum mengeluarkan satu larangan perjalanan bagi tiga mantan menteri dan seorang anggota senior partai berkuasa, termasuk di antaranya mantan menteri dalam negeri yang tidak populer Habib al-Adly. Sejumlah koresponden mengatakan langkah hukum terhadap beberapa tokoh paling kuat di negeri itu merupakan penegasan terjadinya perpecahan yang dalam di dalam lingkungan elit dalam partai berkuasa. Pernyataan jaksa umum mengatakan para pejabat publik dikenakan larangan itu, yang akan berakhir ‘sampai keamanan nasional dipulihkan dan pihak berwenang serta badan pemantau telah melakukan penyelidikannya.” Kerusuhan itu telah mengambil korban 300 orang tewas di seluruh Mesir selama 10 hari terakhir, demikian menurut perkiraan PBB. Jika Mubarak tidak mengundurkan diri, para demonstran telah merencanakan untuk melakukan pawai ke Istana Kepresidenan Jumat. (bbc/abc/ap/m10)

Seorang lainnya kemudian dilaporkan terbunuh dalam bentrokan di Lapangan Abdel Monem Riyad, juga di Kairo Pusat. Banyak lagi korban cedera lainnya. Khaled Ezzelarab dari BBC di Kairo mengatakan peralihan fokus dari Lapangan Tahrir ke Lapangan Abdel Monem Riyad menunjukkan tercapainya satu kemajuan strategis bagi para pemrotes pro-Mubarak, yang telah berusaha menjadikan Lapangan Tahrir sebagai pusat konsentrasi dan mereka dapat bergerak kemana pun menghadapi bentrokan. Para wartawan asing yang melaporkan untuk beberapa kantor berita telah diserang. Mereka melaporkan para pendukung Mubarak telah menyerbu sejumlah hotel di Kairo. Beberapa wartawan dipukulik dengan tongkat dan peralatan mereka dirusak. The NewYork Times mengatakan bahwa dua wartawam telah dibebaskan setelah ditahan sepanjang malam Kamis. Serangan itu telah mengundang kutukan dari Inggris, Jerman, Italia dan Spanyol, di samping

WNI Jangan ... perkembangan di Tunisia dan di Mesir. Mudah-mudahan tidak sampai demikian,” tambahnya. Marty menambahkan, pemerintah terus mengantisipasi dengan mengamati perkembangan di Mesir, termasuk implikasinya. Menurut Marty, Mesir merupakan negara yang sangat berpengaruh di kawasan Timur Tengah, terutama atas peranannya yang besar di Liga Arab, Organisasi Konferensi Islam (OKI), dan percaturan pe-

rundingan Timur Tengah. Seperti diberitakan, angin perubahan yang berawal di Tunisia membuat kawasan Arab bergolak. Setelah Tunisia, aksi massa menuntut pemerintah yang berkuasa turun juga terjadi di Mesir dan Yaman. Puluhan ribu warga Yaman menggelar unjuk rasa di ibu kota Sana meminta Presiden Ali Abdullah Saleh, yang telah berkuasa dalam 30 tahun terakhir, mundur. Para pengunjuk rasa berkumpul di beberapa lokasi dan meneriakkan saatnya sekarang untuk perubahan. (m11/kps)

Pemimpin Mendusta ... senjata pemusnah massal (WMD) yang membahayakan perdamaian dunia. Karena itu dia harus ditangkap, bukan dengan cara menarik rambut dari tepung, tapi mengobok-oboknya, sekalian sama negerinya, sampai porak poranda. Kubarak, menyusul koleganya di negeri padang pasir lainnya menelan saja bulat-bulat ucapan Gorge Busyet dan Tony Blabla, bahwa WMD ada di negeri abu mawas. Seperti orang kena hipnotis untuk dimintai pulsa hp atau memang syur dia berkawan dengan pemimpin negeri harta karun, entahlah, tapi yang jelas Kubarak dkk mengikuti saja kemauan Busyet dkk. Mereka bersubahat membunuh seekor nyamuk negeri abu mawas itu dengan ribuan bom. Soddom berikut para stafnya berhasil ditangkap di tengah banjir darah rakyatnya yang tidak berdosa, menyusul diangkatnya boneka penjilat negeri-negeri Rika dan sekutunya. Sebagian dunia senang dengan kejatuhan Soddom, seterusnya menanti dengan antusias tentang WMD. Tak lama kemudian, para wartawan negeri Rika tak sabar mempertanyakan kepada Menteri Pertahanannya tentang kebenaran WMD. Apa jawabnya? Dengan entengnya, sang Menhan mengatakan, untuk apa lagi membicarakanWMD, kita kan sudah berhasil menegakkan demokrasi di negeri abu mawas. Wah... Ya, memang itu saja katanya. WMD memang tidak ada. Tak lebih cuma sekedar tipu muslihat Busyet dkk untuk meyakinkan negerinegeri padang pasir yang tentu ditakut-takuti akan diserang bala tentara negeri abu mawas. Busyet dkk adalah pemimpin pendusta. Sementara Kubarak dkk yang menjadi pemimpin korban dusta, mungkin cuma bisa elus dada sambil mengucap: busyet. Seiring perjalanan waktu, dunia pun malas mempermasalahkan lagi alasan utama membantai negeri abu mawas, dan memasuki tahun ini, pemerintahan Kubarak mendapat cobaan. Sejumlah besar rakyatnya mulai muak dengan kepemimpinan Kubarak selama 30 tahun ini, ditambah isu bahwa dia mengocokkan anaknya sebagai pengganti. Aksi rakyat mulai meledak di jalanan menuntut Kubarak mundur. Aksi heroisme ribuan orang menentang pemimpinnya yang berwajah beringas dan bertangan besi sedang berlangsung. Tapi bukan itu yang menarik, namun reaksi dari negeri Rika dan Inggrid. Mereka malah menuntut Kubarak mundur. Begitu saja mereka lupakan “jasa” Ku-

barak membantu pembantaian negeri abu mawas. Si Tony Blabla, berkoar balik gagang menentang Kubarak, begitu juga negeri Rika yang tadinya dipresideni Busyet, kini dipimpin oleh Balak Olama. Kubarak kena batunya. Dulu negeri harta karun menjadi kawan, sekarang lawan, ibarat tersangka kriminal yang dibiarkan digimbal massa, ibarat orang ditinggal setan setelah kena tipu mentah-mentah. Kasihan juga si Kubarak, tapi itulah politik, memang kejam. Alasan pemimpin negeri-negeri salju itu adalah menegakkan demokrasi, sebagaimana dipaksakan secara tersirat terhadap negeri abu mawas lewat peperangan. Secara sepintas, demokrasi itu memang bagus. Presiden dan wakilnya dipilih melalui pemilihan umum dan lain sebagainya yang tampak indah, dengan catatan “tapi”. Tapi kelemahannya adalah sebaliknya buruk, yakni kebebasan bersuara yang kebablasan. Fitnah, kebencian, vested interest bermunculan menunggangi demokrasi, sebagaimana dicontohkan di negeri Bondonesia. Jika itu model demokrasi yang disenangi oleh negeri-negeri salju, maka penulis pun bisa melempar kebencian ke negeri-negeri salju bahwa demokrasi yang mereka paksakan itu cuma sekedar untuk memecah belah penduduknya yang mayoritas seagama. Apa sedap mereka menonton perpecahan? Pendek kata, jadikanlah pengalaman di atas sebagai pelajaran bagi Kubarak dan pemimpin padang pasir lainnya yang sedang menunggu giliran demo rakyatnya. Hikmahnya adalah berhati-hatilah memilih kawan dari negeri salju, apalagi untuk membantu menghancurkan negeri seagama. Lihat pulalah negeri Gasaknistan, dijanjikan si Busyet uang berlimpah untuk pembangunan, apa terwujud? Sadarlah. Belum terlambat menjadikan diri pemimpin yang terbaik berdasarkan hadis sbb: “Sebaik-baik manusia adalah yang paling baik Alquran-nya diantara mereka, orang yang paling memahami agama Allah diantara mereka, orang yang paling bertakwa kepada Allah diantara mereka, orang yang paling sadar menyuruh orang kepada kebaikan, orang yang paling sadar mencegah orang dari kemungkaran dan orang yang paling baik hubungan silaturahminya diantara mereka.”(HR Achmad, Al Baihaqi dan Thabrani). Dekatkan diri kepada Allah dan memohon pertolonganNya agar menjadi pemimpin yang terbaik.

Medan Metropolitan

WASPADA Sabtu 5 Februari 2011


Umat Islam Diminta Doakan Mesir MEDAN (Waspada): Khatib Jumat di sejumlah masjid di Medan, kemarin, meminta agar umat Islam khusus di Sumatera Utara dan umumnya di Indonesia mendoakan situasi di Mesir agar segera pulih kembali dari kerusuhan, dimana rakyatnya saat ini menuntut Presiden Husni Mubarak tahta kekuasaan lebih dari 30 tahun. Misalnya, Ustadz Zulfiqar Hajar di Masjid Muslimin Telada Medan mengatakan, kondisi yang terjadi di Mesir akibat ulah dari para kaum nasoro yang memang selalu tidak senang kepada umat Islam. “Islam merupakan agama yang mengajarkan perdamaian dan ketentraman agar selamat dunia dan akhiratnya, apabila terjadi kekacauan terhadap umat Islam berarti penyebabnya adalah dari umat Islam sendiri, di antaranya dapat di adu domba. Allah menegaskan, sesungguhnya terjadinya kerusakan di muka bumi ini akibat ulah tangan manusia itu sendiri,” katanya. Di hadapan ratusan jamaah shalat Jumat, Zulfiqar mengatakan, kekacauan di Mesir saat ini sudah jelas merupakan hasil pecah belah dan adu domba pihak kafir, karena kita ketahui Mesir memiliki ulama-ulama besar dan di sana pula ada universitas besar, yakni Al Azhar. Kafir ingin menghancurkan Mesir, namun peran ulama dalam situasi ini hanya mampu memberikan nasehat dan doa karena tidak dapat mengangkat senjata. Dalam kutbahnya, dia juga menyesalkan peran Amerika Se-

rikat hanya mampu berbicara, namun tidak ingin mencegahnya. Demikian juga dengan peran PBB juga belum kelihatan. “Inilah satu bukti kalau orang-orang kafir itu tidak ingin umat Islam bersatu dan ini telah sesuai dengan Al Quran yang menyebutkan sesungguhnya orang orang kafir itu tidak akan senang hatinya apabila kamu belum berpaling dari agama Islam,” katanya. Ustadz kondang ini juga mengakui salah satu penyebab kerusuhan di Mesir ini karena pemimpinnya telah berbuat salah sehingga rakyat tidak tahan lagi, namun disayangkan hingga kini belum ada pihak Islam yang mendamaikan masalah ini. Ini menandakan negara-negara Islam memang terpecah belah akibat ulah kafir. Zulfiqar mengingatkan pertikaian yang terjadi di Mesir harus diselesaikan oleh kaum muslimin juga karena apabila kafir yang menyelesaikan sudah pasti ada udang dibalik batu,dia pasti mengambil keuntungan dari itu. Zulfiqar mengambil peringatan dari kisah masa nabi, di mana pada suatu waktu terjadi perkelahian antara biri biri dengan kambing. Perkelahian

Letkol. Chb. Nurcahyo Utomo Jadi Kahubdam I/BB MEDAN (Waspada): Pangdam I/BB Mayjen TNI Leo Siegers melantik Letnan Kolonel Chb Nurcahyo Utomo sebagai Kepala Perhubungan Kodam I/BB yang baru di serambi kehormatan Makodam I/BB Jalan Gatot Subroto km 7.5 Medan, Jumat (4/2). Sebelumnya, jabatan Kahubdam I/BB dipegang Kolonel Chb Masri. Pangdam I/BB dalam sambutannya mengatakan, serah terima jabatan ini, merupakan realisasi dari kebijakan Pimpinan TNI AD dalam menyusun dan menata regenerasi serta aplikasi kebutuhan organisasi yang dapat mengoptimalkan kemampuan dalam mendukung tugas pokok Kodam. “Satuan Perhubungan Kodam I/Bukit Barisan memiliki tugas dan fungsi untuk menyelenggarakan komunikasi antar komando satuan di jajaran Kodam I/Bukit Barisan, dalam melaksanakan teknik perhubungan dan teknik elektronika, penciptakaryaan, pelaksanaan konstruksi, penginstalasian, pengujian, perbaikan dan pemeliharaan peralatan perhubungan,” kata Pangdam I/BB. Perhubungan Kodam I/Bukit Barisan, lanjutnya, dituntut kesiapsiagaan satuan, sehingga mampu melaksanakan tugas organisasi secara optimal. “Selain itu dituntut senantiasa memelihara profesionalitas dan kesiapan operasional yang tinggi agar setiap saat siap melaksanakan tugas menghadapi berbagai ancaman baik operasi militer untuk perang maupun operasi militer selain perang. (h02)

itu terjadi sangat seru hingga berdarah akibat dua pihak menyatakan yang terbaik, si biri biri menyebutkan keunggulan bulunya, sedangkan kambing dengan tanduknya akibatnya perkelahian ini tidak ada pemenangnya. Oleh karena itu pihak bertikai mencarikan hakim yang dinilai tepat memilih siapa pemenangnya, namun disayangkan dipilih hakim srigala yang ternyata mengambil keuntungan buatnya. Siasat layaknya hakim yang netral pun dilakukan. Srigala melakukan persidangan dengan cara memanggil satu persatu ke dalam kamarnya. Dalam persidangan ini akhirnya kedua binatang yang berseru ini menjadi santapan srigala karena keduanya telah berada dalam perangkap kamarnya. Menghakhiri kutbahnya,

Zulfiqar memberikan keyakinan kepada jamaah bahwa Allah itu Maha Kuasa. Dia pasti akan berpihak kepada kebenaran yang mungkar pasti akan kalah. Presiden Husni Mubarak yang telah memerintah 32 tahun pasti akan tumbang. Mubarrak pemimpin serakah Sementara itu, Ustadz Syahril Bashirah di Masjid Ash Sholihin Jalan Brigjen Katamso, Sei Mati Medan Maimun, menyatakan, Husni Mubarak tergolong kepala negara dan pemimpin serakah. Hal itu dilihat dari kekayaannya lebih dari Rp360 triliun yang dikumpul selama berkuasa 30 tahun, namun tidak memikirkan nasib rakyatnya. Rakyat Mesir yang selama ini cukup sabar terhadap Muba-

rak mulai berang dan menentang kepemimpinannya agar diganti orang-orang yang mampu memberikan kesejahteraan rakyat di negeri kaya itu. Kata dia, orang-orang Mesir yang menilai Presiden Mubarak tidak peduli lagi dengan nasib rakyat, mereka unjuk rasa menentang agar dia segera turun dari tahta kepemimpinannya. “Kenapa? karena warga Mesir semakin cemas kehidupan masa depan yang semakin tidak jelas dan bakal bahan makanan yang akan habis,” ujarnya. Padahal, kata Ustadz Syahril, Allah SWT mengharapkan pemimpin yang adil dan dapat melindungi warganya serta meningkatkan kesejahteraan, ternyata Husni Mubarak bertolak belakang dari pesan kitab suci Al Quran. (m35/m32)

Besok, 18 Titik Jalan Ditutup Untuk Kenderaan MEDAN (Waspada): Untuk melancarkan pelaksanaan jalan bebas kenderaan (car free day) ke-2 tahun ini, Minggu (6/2), Pemko Medan akan menutup 18 titik jalan di Kota Medan. Sedangkan untuk pelaksanaannya dilakukan di Jalan Jendral Sudirman Medan mulai dari simpang Jalan S.Parman sampai simpang Jalan Imam Bonjol (air mancur). Demikian dikatakan Kepala Badan Lingkungan Hidup Kota Medan Purnama Dewi seusai rapat persiapan pelaksanaan car free day, Jumat (4/2), di Balai Kota Medan. Dikatakan Purnama Dewi, latar belakang pemindahan lokasi kegiatan car free day dari Jalan Gatot Subroto ke Jalan S.

Parman karena adanya keluhan masyarakat kepada walikota. Karena penutupan jalan tersebut sangat mengganggu kenyamanan dan aktifitas perdagangan yang ada pada lokasi tersebut, yaitu Pasar Petisah dan Plaza Medan Fair. Oleh karena itu, Pemko mencari jalan alternatif dengan memindahkannya ke Jalan Sudirman. Adapun jalan yang ditutup besok, kata Purnama Dewi, yakni Jalan Suprapto-Multatuli, Jalan Haji Misbah-Saman Hudi, Jalan Sudirman – Imam Bonjol, Jalan Imam Bonjol – Cut Nyak Din, Jalan A.Rivai – Jalan Agus Salim, Jalan Agus Salim – Jalan Sam Ratulangi, Jalan Selamat Riadi – Jalan Haji Misbah, Jalan A.Rivai – Jalan Haji Misbah, Jalan

Linggar Jati – Jalan Suryo, Jalan Juanda – Jalan Walikota, Jalan Sudirman – JalanWalikota, Jalan Sudirman – S.Parman, Jalan Walikota– Jalan Uskup Agung, Jalan Walikota – Jalan DR. Cipto, Jalan Cit Dik Tiro – Jalan Hang Kesturi dan Jalan Uskup Agung – Hang Kesturi. Untuk mendukung kelancaran kegiatan Car Free Day ini, Pemko melibatkan Satlantas Polresta Medan, Polsek Medan Baru, Polsek Medan Polonia, Satpol PP Kota Medan, Dinas Perhubungan, Dinas Pertamanan, Dinas Kebersihan, Dinas Infokom dan Kepala BLH Kota Medan, Kecamatan dan lurah serta Kepala Lingkungan setempat. (m50)

Amelia Yani Digugat Rp2,5 M MEDAN (Waspada): Ketua Umum DPP Partai Peduli Rakyat Nasional (PPRN) Amelia A Yani dan Sekjen Maludin Sitorus digugat oleh Jumongkas Hutagaol dan Mangatur Tobing, selaku ketua dan sekretaris DPW PPRN Sumut. Amelia dan Maludin digugat bersama-sama dengan Jikson KP Manik, Irwanto Tampubolon (anggota DPRD Medan) dan Rinawati Sianturi (anggota DPRD Sumut). Gugatan tertanggal 26 Januari 2011 disampaikan melalui kuasa hukum penggugat, terdiri, Marthin Simagunsong, SH, MHum, Bukit Sitompul, SE, SH, Maslen Simangunsong, SH, Parluhutan Situmorang, SH, dan Herlita Rajagukguk, yang diterima PN Negeri Medan

tanggal 27 Januari 2011 dengan Register No. 37/pdt.a/2011/ pn.mdn. Kepada wartawan di Medan, Selasa (1/2), Jumongkas Hutagaol dan Mangatur Tobing didampingi kuasa hukumnya menjelaskan, dasar gugatan adalah ketidakmauan Amelia A Yani melantik kepengurusan DPW PPRN Sumut hasil Muswil I PPRN Sumut, 14 Desember 2010. Muswil itu secara aklamasi menetapkan Jumongkas Hutagaol sebagai ketua terpilih dan ketua formatur untuk menyusun kepengurusan DPW PPRN Sumut masa bakti 2010–2015. “Kita tidak tahu apa sebabnya Amelia Yani tidak mensahkan hasil muswil tersebut, meski sudah kita minta beberapa kali

dengan berbagai cara. Padahal muswil itu sebagaimana juga pernah disampaikan Ketua OKK DPP PPRN Made Rahman Marasabessy yang memimpin muswil, sah sesuai ketentuan AD/ART PPRN,” kata Jumongkas. Memang, kata dia, saat Muswil, Amelia sempat mengajukan calonnya (Jikson KP Manik) untuk ikut maju pemilihan ketua. Namun karena tidak mendapat dukungan DPDDPD peserta Muswil, calon dimaksud gagal maju. Demikian juga dengan permintaan Amelia agar para anggota legislatif dari PPRN ikut memiliki hak suara dimentahkan para peserta Muswil, karena bertentangan dengan AD/ART PPRN.(m27)

Jangan Tambah Lagi Penderita DBD TIADA hari tanpa penderita Demam Berdarah Dengue.Wabah inilah yang terus menghantui warga Medan. Pada awal 2011 ini saja, ditemukan sedikitnya 26 kasus DBD yang dirawat di RSU dr. Pirngadi Medan. Dari 26 penderita yang dirawat ini, satu orang di antaranya meninggal dunia. Sedangkan tahun 2010, dilaporkan 3.122 orang sakit karena DBD dan 22 penderita DBD meninggal. Merebaknya kembali kasus DBD ini menimbulkan reaksi dari berbagai kalangan. Ada yang beranggapan pemerintah tidak memiliki penanganan yang konkret memberantas penyakit mematikan ini. Pemerintah dinilai lambat mengantisipasi dan merespon kasus ini. Dan sebagian orang menganggap, hal ini terjadi karena kurangnya kesadaran

masyarakat akan kebersihan lingkungan. Namun, jika terbukti kurangnya kesadaran masyarakat akan kebersihan lingkungan sebagai penyebab DBD, pasti ada sebab musababnya. Mungkin, masyarakat sudah apatis kepada Pemko Medan. Mereka tak peduli lagi akan imbauan camat ataupun lurah untuk membersihkan lingkungan. Sikap apatis ini muncul akibat ketidakpercayaan masyarakat terhadap pemerintah. Salah seorang akademisi dari Fakultas Kesehatan Masyarakat USU Destanul Aulia mengatakan, saat ini pemerintah tidak memiliki program nyata dalam memberantas kasus DBD ini. Tugas memberantas DBD ini seolah-olah dibebankan kepada Dinas Kesehatan. Padahal, banyak

Satuan Kerja Perangkat Daerah yang terlibat, seperti Dinas Perkim Medan, Dinas Pendidikan, Bina Marga, Badan Lingkungan Hidup, Dinas Kebersihan dan Dinas Kesehatan. “SKPD inilah yang harus melakukan pencegahan dan promosi kepada masyarakat. Seperti Perkim, seharusnya mereka menerapkan konsepkonsep rumah sehat. Dinas Pendidikan mensosialisasikan hidup bersih kepada para siswa. Jadi penanganannya harus melibatkan lintas sektoral, SKPD ini harus duduk bersama,” ungkapnya. Aktifkan Puskesmas Dalam melakukan pencegahan DBD ini, Pemko juga harus mengaktifkan Puskesmas selama 24 jam sebagai pusat informasi kesehatan bagi masyarakat.

Waspada/Mursal AI

JALANI PERAWATAN: Penderita DBD Alfa Rizki, 7, menjalani perawatan di Ruang Anak Lantai III RSU dr. Pirngadi Medan, Selasa (1/2) siang. DBD hampir saja merenggut nyawanya.

Pihak kelurahan dan kecamatan harus respons dan membuat imbauan masyarakat tentang bahaya DBD. Pihak rumah sakit harus melaporkan secepatnya dengan dinas kesehatan jika ada kasus, sehingga dinas kesehatan turun dan memfogging wilayah sipenderita tinggal sampai radius seratus meter,” imbuhnya. Terus meningkat Sementara itu, dari hasil investigasi DPRD Medan Komisi B di lapangan, pada tahun 2010 sampai saat ini penderita DBD terus meningkat khususnya di daerah Medan Utara. Ternyata faktor utama penyebab ganasnya DBD tersebut karena lingkungan yang kumuh atau air yang tergenang di saluransaluran drainase. “Di Medan Utara itu banyak kali saluran parit tidak ada muaranya. Air tergenang begitu saja karena parit tersumbat maupun infrastruktur yang rusak. Jadi, untuk penanganan DBD ini bukan saja peran dari Dinas Kesehatan saja, namun harus ada dari dinas terkait seperti Dinas Bina Marga, Perkim, Badan Lingkungan Hidup,” kata Bahrumsyah anggota DPRD Kota Medan Komisi B yang membidangi masalah kesehatan. Bentuk tim terpadu Dalam hal tersebut, Walikota Medan hendaknya membentuk tim terpadu, yakni dinas yang bersangkutan. Hal ini merupakan langkah tepat untuk dalam waktu jangka pendek untuk mengurangi tingkat penderita DBD. “Fogging yang dilakukan Pemko khususnya Dinas Kesehatan memang sangat membantu mengurangi berjangkitnya penyakit DBD. Tapi, tidak cukup begitu saja tanpa membenahi infrastruktur. Kalau saluran parit tidak mengalir, maka

sudah pasti muncul sarangsarang nyamuk tersebut. Jadi, langkah awal yang harus dilakukan Pemko membangun infrastruktur seperti jalan dan saluran drainase,” ujar Bahrum. Buruknya infrastruktur Mungkin ungkapan dari salah seorang warga Kel. Bagan Deli Kec. Medan Belawan Muryani, 39, ini bisa menjadi gambaran buruknya infrastruktur di Medan Utara ini. Buruknya infrastruktrur tersebut, membuat masyarakat enggan membersihkan lingkungannya. Kepada Waspada, Muryani mengaku tidak terlalu memerhatikan kebersihkan lingkungan rumahnya karena daerahnya sering terkena luapan air pasang laut (rob). “Yang kubersihkan paling yang ada di halaman. Sedangkan yang lainnya percuma dibersihkan karena akan kembali lagi jorok akibat datangnya sampah yang terbawa arus air pasang,” katanya. Disinggung pendapatnya akan bahaya DBD, ibu beranak tiga itu mengaku tahu namun karena faktor alam itu dia tidak begitu memperhatikannya. “Setahu aku genangan air bersih saja yang menyebabkan DBD. Namun daerah kami ini lebih sering digenangi air pasang dari pada air hujan,” ucapnya. Beberapa hari yang lalu, DBD hampir merenggut nyawa seorang bocah warga Belawan Alfa Rizky, 7. Pasien ini sempat mengalami kejang-kejang dan muntah darah. Sedangkan, Rita Nadra Sitompul, 29, warga Medan Tembung menghembuskan nafas terakhirnya di RSU dr. Pirngadi Medan akibat DBD. “Cukup sampai di sini DBD ini memakan korban jiwa. Jangan tambah lagi daftar panjang korban penderita DBD,” ujar Bahrum. (h02/m50/h03)


LANTIK: Plt Sekdparovsu Rahmatsyah melantik tiga pejabat di lingkungan Pemprovsu di ruang Beringin Kantor Gubsu, Jumat (4/2). Dari kiri: Randiman Tarigan menjadi Sekwan DPRDSU, Kepala Dinas Penataan Ruang dan Permukiman Khairul Anwar dan Kepala Dinas Kelautan dan Perikanan Zulkarnain.

Randiman Resmi Jadi Sekwan DPRDSU MEDAN (Waspada): Setelah sempat tertunda-tunda, tiga pejabat eselon II di lingkungan Pemerintah Provinsi Sumatera Utara akhirnya dilantik di Ruang Beringin Kantor Gubsu, Jumat (4/2). Ketiga pejabat eselon II itu masing-masing Sekretaris DPRD Sumut Randiman Tarigan (mantan Kadis Pendapatan Medan), Kepala Dinas Penataan Ruang dan Permukiman Provin-si Sumut Khairul Anwar dan Kepala Dinas Kelautan dan Perikanan Provinsi Sumut Zulkarnain. Pengambilan sumpah jabatan dilakukan Pelaksana Tugas (Plt) Sekretaris Daerah Provinsi Sumatera Utara (Sekdaprovsu) Rahmatsyah disaksikan Asisten Administrasi Umum dan Aset Sekdaprovsu Asrin Naim dan sejumlah SKPD. Plt Sekdaprovsu Rahmatsyah dalam sambutannya membacakan pidato Gubernur Sumut Syamsul Arifin mengatakan, pelantikan tiga pejabat struktural eselon II dilakukan dalam rangka pengisian jabatan yang lowong karena

pejabat lama telah pensiun. “Pengangkatan saudara untuk menduduki jabatan tersebut adalah wujud kepercayaan yang harus saudara terima dan syukuri. Kepercayaan ini bukan timbul dengan spontanitas, tetapi melalui suatu tahapan dan pertimbangan yang tidak terlepas dari penilaian kompetensi dan mampu berkoordinasi serta kerjasama yang saudara aplikasikan, baik sebagai unsur aparatur maupun sebagai pejabat struktural di satuan kerja masing-masing,” ujar Gubsu. Gubsu juga mengingatkan agar pejabat yang baru dilantik melaksanakan tugas ini dengan prestasi dan loyalitas yang tinggi serta menanamkan tekad untuk selalu memberikan yang terbaik bagi organisasi. Dia juga mengingatkan kepada tiga pejabat yang baru bahwa saat menerima jabatan bukanlah semata-mata sebagai anugerah maupun kehormatan, tetapi sebagai pembebanan tanggungjawab dan memikul tugas untuk dilaksanakan dengan sebaik-baiknya. (m28)

IPB Sosialisasi SNMPTN Di Medan

Kuota Terbesar Melalui Jalur Undangan MEDAN (Waspada): Institut Pertanian Bogor (IPB) dalam menjaring mahasiswa baru melalui Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) 2011 sebanyak 2.895 orang atau 83% dari total keseluruhan mahasiswa baru yang akan ditampung yakni sekira 3.700-an orang. Hal tersebut diungkapkan Wakil Rektor Bidang Sumberdaya dan Pengembangan IPB, Prof. Dr. Ir. Hermanto Siregar, M.Ec di sela-sela sosialisasi sistem baru SNMPTN 2011 kepada perwakilan murid dan guru dari 30 sekolah SMA/MA di Pascasarjana Universitas Medan Area, Jl. Sei Serayu Medan, Selasa (1/2). Prof. Hermanto Siregar menyebutkan, kuota terbesar penerimaan mahasiswa baru di IPB melalui Jalur Undangan yaitu 63% (2.307), sedangkan Jalur Ujian Tulis hanya 20% (588). Sementara untuk ujian lokal/ mandiri IPB hanya 17% yaitu ujian talenta mahasiswa sebesar 10% dan beasiswa utusan daerah dan prestasi internasional 7%. “Besarnya kuota melalui Jalur Undangan ini merupakan kebijakan IPB dalam aspek pemerataan dan berkeadilan bagi siswa berprestasi di daerah untuk masuk perguruan tinggi berkualitas. Karena selama ini dinilai, kalau melalui ujian tulis yang bisa lulus hanya dari kota-kota besar saja,” jelas Prof. Hermanto yang didampingi Kasubdit Kesejahteraan Mahasiswa IPB, Megawati Simanjuntak, Sp, MSi dan Dr. Ir. Edi Batara Mulya (Ketua Prodi Magister Manajemen Agri Bisnis UMA). Prof. Hermanto menyebutkan, berdasarkan kuota yang akan ditampung di IPB secara rinci per fakultas yaitu, Fakultas Pertanian sebanyak 340 (ujian 48, undangan 292), Fakultas Kedokteran Hewan 150 (ujian 30, undangan 120), Fakultas Perikanan dan Ilmu

Kelautan 350 (ujian 60, undangan 290), Fakultas Peternakan 120 (ujian 50, undangan 70), Fakultas Kehutanan 306 (ujian 56, undangan 250), Fakultas Teknik Pertanian 387 (ujian 95, undangan 292), FMIPA 550 (ujian 88, undangan 462), Fakultas Ekonomi dan Manajemen 425 (ujian 110, undangan 315) dan Fakultas Ekologi Manusia 267 (ujian 51, undangan 216). Lebih lanjut dijelaskan, peserta SNMPTN Jalur Undangan diikuti siswa SMA sederajat kelas XII yang akan mengikuti UN dari sekolah yang terakreditasi A, B, dan C, serta sudah terdaftar dalam databes SNMPTN 2010 lalu. Peserta Jalur Undangan ini adalah siswa berprestasi dari masing-masing sekolah yaitu, akreditasi A Akseleri (100% bisa ikut), akreditasi A RSBI/unggulan (75% terbaik), akreditasi A Reguler (50% terbaik), akreditasi B (25% terbaik) dan akreditasi C (10% terbaik). Menyinggung peluang siswa dari sekolah akreditasi C yang sangat kecil, Prof. Hermanto menyebutkan, hal itu bukan untuk menciptakan diskriminasi, tetapi memiliki tujuan agar sekolah tersebut dapat membangkitkan diri dan meningkatkan prestasi sekolahnya, sehingga ke depan bisa meningkat menjadi akreditasi B dan selanjutnya. Sedangkan mengenai adanya beberapa perguruan tinggi negeri yang menggelar Tes Penjajakan Bidang Ilmu (TPBI) yang akan digunakan sebagai bahan pertimbangan dalam penerimaan mahasiswa baru melalui Jalur Undangan SNMPTN 2011 ini, Prof. Hermanto mengatakan, di IPB tidak ada menggunakan tes apa pun dalam Jalur Undangan tersebut, namun kalau ada PTN yang menggunakan tes, itu hanya merupakan kebijakan PTN tersebut. (m41)

Berbagai Kegiatan Meriahkan Dies Natalis Ke-57 FH USU Hari Ini Family Day MEDAN ( Waspada): Dalam rangka menyambut dan meriahkan Dies Natalis ke57 yang jatuh pada 12 Februari 2011, Fakultas Hukum Universitas Sumatera Utara (FH USU) akan menggelar acara ‘Family Day’ dengan berbagai mata acara di antaranya Jalan Santai, aneka lomba, lucky draw dan hiburan di FH USU, Sabtu (5/2) hari ini. “Kegiatan tersebut merupakan rangkaian kegiatan memeriahkan Dies Natalis ke-57 FH USU yang dilaksanakan sesuai dengan amanah Tri Dharma Perguruan Tinggi, sekaligus mempererat silaturrahmi keluarga besar FH USU,” kata Ketua Panitia Dies Natalis, Prof. Sulaiman Hamid, SH, kepada wartawan kemarin. Rangkaian kegiatan lainnya, kata Prof. Sulaiman, pada 8 Februari mendatang, akan digelar ceramah dari Kapoldasu Irjen. Pol. Oegroseno dengan tema ‘Perubahan Paradigma Kepolisian di Jajaran Polda Sumatera Utara. Selanjutnya pada 11 Februari 2011 akan diselenggarakan Dialog Interaktif oleh sejumlah pengacara dan praktisi hukum dari Jakarta dengan topik ‘Perkembangan Terkini Dunia Hukum Indonesia dan Trend Penyelesaian Sengketa Bisnis Internasional’. Sementara, acara puncak kegiatan ilmiah tersebut, pada 12 Februari 2011, akan diakhiri dengan Orasi Ilmiah dari Dr. Maiyasak Johan,

SH, MH (Anggota DPR-RI) yang merupakan alumni FH USU. Selain itu juga akan digelar Temu Akbar Alumni sekaligus pemilihan Pengurus Ikatan Alumni Fakultas Hukum USU periode mendatang. Prof. Sulaiman menyebutkan, rangkaian kegiatan tersebut sudah dimulai sejak 15 Januari 2011 dengan melaksanakan seminar dengan topik ‘Refleksi Penanganan Masalah Pertanahan di Sumut’ dengan menampilkan Prof. Dr. Tan Kamello (guru besar FH USU), Sontian, SH (Badan Pertanahan Nasional Deliserdang) dan praktisi/advokat Ade Zainab Taher, SH. Untuk bidang pengabdian masyarakat, lanjutnya, pada 19 Januari 2011 telah diselenggarakan Penyuluhan Hukum Perkawinan dan Hukum Pertanahan di Desa Siporkis, Kecamatan Galang, Deliserdang, dengan narasumber dosen-dosen FH USU yang dibuka Dekan FH USU, Prof. Dr. Runtung Sitepu, SH, M.Hum. Rangkaian kegiatan ilmiah lain yaitu Kuliah Umum membahas hukum perminyakan dengan tema ‘Managing of Political Risk on International Petroleum Contracts’ dengan narasumber Ali Nasir, SH, LLM yang merupakan alumni Departemen Hkum Internasional FH USU yang saat ini bekerja sebagai Legal Advisor di Markas Besar OPEC (Organisasi Pengekspor Minyak) di Wina, Austria. (m41)

Medan Metropolitan


WASPADA Sabtu 5 Februari 2011

Kerusakan Jalan Di Medan Utara Sejak 1993 BELAWAN (Waspada): Keterbelakangan pembangunan di Medan utara ditandai dengan kerusakan jalan yang sejak tahun 1993 belum mendapat sentuhan perbaikan dari Pemko Medan di antaranya Jalan PLTU Sicanang Belawan, Jalan Tunda Kelurahan Sei Mati Medan Labuhan, Jalan Mangaan Mabar Medan Deli dan Jalan Kampung Rambung Medan Marelan serta Jalan Pulai Sinabang Kelurahan Belawan Bahari, Kecamatan Medan Belawan. “Maunya semua perbaikan jalan yang diajukan ke Pemko segera diperbaiki,” kata Sekcam Medan Belawan Agustinus Simanjuntak, kemarin. Data di kecamatan Medan Belawan menunjukkan pada 2010 telah diajukan 37 proyek pembangunan agar dianggarkan pada tahun anggaran 2011, termasuk perbaikan parit dan jalan. “Kitabelumtahuberapayang terealisasi tahun ini karena pada 2009 saja hanya 20 jalan yang terealisasi dari lebih dari puluhan lagi telah jalan yang diajukan,” ujarnya didampingi Kasi PMKKecamatanMedanBelawan Selamet Panjaitan, kemarin. Sementara itu, untuk Kecamatan Medan Marelan, jumlah proyek atau pekerjaan yang diajukan berdasarkan hasil Musrenbang terakhir 2010 sebanyak 40 jenis dan 24 di antarnya pekerjaan perbaikan parit dan jalan seperti Jalan Takenaka di Kelurahan Paya Pasir dan Jalan Kebun Rambung serta Jalan M Basir di Kelurahan Rengas Pulau. “Kami juga belum tahu apakah jalan yang diajukan akan terealisasi tahun ini,” tambah Kasi PMK Medan Marelan MY Siregar. Sedangkan Kasi PMK Medan Deli Febriansyah Siregar

mengatakan, ada sekitar 89 proyek atau pekerjaan perbaikan jalan dan drainase serta sejumlah pembangunan lain yang diajukan untuk dikerjakan pada tahun anggaran 2011. Semua pengajuan pekerjaan itu berasal dari hasil Musrenbang kecamatan terakhir tahun 2010. Terkait permasalahan Jalan Mangaan yang sejak tahun 1993 belum pernah diperbaiki, Lurah Mabar Erwin beralasan karena daerah itu terbagi dua dengan Deliserdang. “Warga sepanjang jalan itu terbagi dua, warga Mabar 1.500 KK dan warga Deliserdang 400 KK,” ujarnya. Walaupun demikian, masih kata lurah, pihaknya sudah mengajukan pembangunan jalan itu ke Pemko. Demikian halnya dengan pihak Percut Sei Tuan. “Saya dan kades sudah mengajukan perbaikan jalan itu dan semoga tahun ini perbaiki,” ujarnya. Sementara itu, Mustapa, 45, warga sekitar menyesalkan sikap Pemko tidak mau memperbaiki jalan-jalan rusak di Medan Utara. Alokasikan Rp29 M Sementara itu, Pemko mengalokasikan Rp29.108.182.000 untuk pembangunan infrastruktur seperti jalan dan drainase di Medan Utara pada tahun 2011. Sedangkan untuk

perbaikan jalan setapak hanya Rp1 miliar. Kepala Sub Bidang Prasarana Kota di Bappeda Kota Medan Muh. Nurbakti kepada Waspada, Senin (31/1), mengatakan, adapun rencana pembangunan yang akan dilakukan untuk Medan Utara. Rincian anggaran yang dialokasikan, yakni untuk pembangunan saluran drainase atau gorong-gorong di Medan Utara sebanyak Rp10.734.700.000 yang terbagi menjadi empat kecamatan, yakni di Kecamatan Medan Belawan ada empat kegiatan dengan plafon anggaran Rp660.000.000, Medan Deli tiga kegiatan Rp1.585.600.000, Medan Labuhan lima kegiatan Rp2.907.500.000 dan Medan Ma re l a n t u j u h k e g i a t a n

Rp5.581.600.000. Untuk program rehabilitasi atau pemeliharaan jalan dan jembatan Rp16.991.982.000 dengan rincian dari empat kecamatan, yakni untuk jalan di Kecamatan Medan Belawan ada empat kegiatan dengan plafon anggaran Rp3.382.740.000, Medan Deli 17 kegiatan dengan nilai Rp5.698.602.000, Medan Labuhan lima kegiatan Rp2.916.000.000 dan Medan Marelan 15 kegiatan Rp4.994.640.000. Program rehabilitasi atau pemeliharaan talud atau beronjong Rp1.381.500.000 dengan rincian untuk Kecamatan Medan Belawan ada tiga kegiatan Rp202.250.000, Medan Deli dua kegiatan Rp496.250.000, Medan Labuhan Rp35.000.000,

dan Medan Marelan Rp648.000.000. Dengan begitu plafon anggaran untuk pembangunan infrastruktur Me d a n Ut a r a m e n c a p a i Rp29.108.182.000. Sekretaris Daerah Kota Medan Syaiful Bahri mengatakan, pembangunan infrastruktur seperti jalan dan drainase pada tahun 2011 difokuskan ke Medan Utara yang selama ini jauh tertinggal bila dibandingkan dengan pembangunan di inti Kota Medan. Hal ini dilakukan untuk menjaga kesenjangan antara Medan Utara dan inti Kota Medan. “Kita harus akui bahwa selama ini pembangunan infrastruktur di Medan Utara selalu tertinggal dengan inti kota,” ujarnya. (m50/h03)

Kenaikan Sembako Sengsarakan Rakyat Bulog Dan Disperindag Harus Bertanggung Jawab MEDAN (Waspada): Melonjaknya harga bahan pokok (sembako) terutama beras di pasar-pasar tradisional membuat masyarakat semakin sengsara. Adapun penyebab utamanya karena rendahnya produksi gabah petani akibat cuaca buruk membuat pasokan berkurang. Contohnya, harga beras kualitas sedang di Kota Medan kini naik hingga menembus level Rp10.000 per kilogram. Padahal sehari sebelumnya di pasar tradisional Pusat Pasar, harga beras kualitas sedang hanya Rp9.000 per kilogram. Menurut salah seorang pedagang, kenaikan harga disebabkan oleh anomali cuaca, membuat produksi gabah petani menurun. Kondisi ini menyebabkan harga beras naik 10 hingga 20 persen. Anggota Komisi C DPRD Medan Jhonny Nadeak kepada wartawan di gedung DPRD Me-

dan, Rabu (2/2) , mengatakan, kenaikan harga beras merupakan tanggung jawab dari Bulog sebagai pengendali stok pangan. “Sebenarnya yang punya kewenangan untuk operasi pasar (OP) adalah Bulog. Yang dipercayakan pemerintah untuk mengendalikan stok pangan. Pelonjakan harga terus menerus perlu ada keseriusan pemerintah untuk menangani ini,” katanya. Diungkapkannya, kenaikan harga beras harusnya tidak perlu terjadi semuanya berjalan dengan baik. “Kita sangat menyesalkan lonjakan harga ini, dan seharusnya pemerintah bisa mengatasinya,” tukas Jhonny. Dikatakannya, Pemko dalam hal ini Dinas Perindustrian dan Perdagangan juga harus bertanggung jawab dan tanggap mengantisipasi terjadinya lonjakan harga Sembako seperti beras, karena menambah

beban derita rakyat. “Untuk itu diminta kepada Pemko segera bertindak.” Jhonny juga menduga ada ‘permainan’ spekulan di dalamnya, untuk itu dirinya meminta kepada pihak terkait untuk menindak para spekulan Sembako tersebut, dan menindak tegas oknum-uknum yang sengaja ingin menyengsarakan rakyat. Dengan kata lain, pihakpihak terkait seperti Bulog, Dinas Perdagangan dan Perindustrian (Disperindag) bekerjasama dengan pihak kepolisian untuk melakukan sidak ke gudanggudang beras. Jhonny juga meminta kepada Pemko Medan mengambil langkah-langkan dalam menstabilkan harga beras tersebut, karena kenaikan harga kebutuhan pokok sudah sangat meresahkan masyarakat, terutama warga yang berpenghasilan rendah. (m50)

Pangkohanudnas Minta Pengawasan Udara Wilayah Barat Waspada/Rustam Effendi

BENTENG PIPA: Lurah Labuhan Deli Abdul Karim menunjuk benteng pipa gas yang rusak parah di Lingkungan 10, Rabu (2/2).

Pipa Gas Ancam Keselamatan Warga BELAWAN (Waspada): Pipa gas yang berada di sepanjang Paluh Pom Pong, Lingkungan 10, Kel. Labuhan Deli, Kec. Medan Marelan, mengancam keselamatan warga. Pasalnya, benteng pelindung pipa penyaluran gas dari Pangkalan Brandan ke PT (Persero) PLTA Sicanang itu sudah banyak yang rusak. Sehingga dikhawatirkan suatu saat akan bocor atau patah karena karat dari rendaman lama, air asin. “Dulu pipa ini tertanam tapi sekarang tidak lagi karena benteng pelindungnya sudah rusak,” kata Asma, warga yang bermukim di dekat pipa tersebut, Rabu (2/2). Ditambahkannya, sejak dibangun sekitar tahun 80-an, pipa gas milik PN Gas itu tidak pernah diperbaiki dan terkesan dibiarkan karena tidak pernah ada perawatan. “Benteng pipa ini mulai rusak sejak terjadinya gempa tsunami, dulu. Namun karena tidak ada perawatan kondisinya semakin mengkhawatirkan dan jika tidak segera diperbaiki bisa bocor dan meledak kapan saja,” ujar Sarmiati, warga lainnya. Lurah Labuhan Deli Abdul Karim mengaku, sudah berulangkali menyurati PN Gas mengenai hal tersebut, namun belum mendapat tanggapan. “Bahkan warga juga sudah pernah mengirimkan surat ke PN Gas. Tapi sampai sekarang belum mendapat tanggapan,” kata Karim. (h03)

Proses Tender Kurang Sehat MEDAN (Waspada): Lembaga Kebijakan Pengadaan Barang dan Jasa Pemerintah (LKPP) menilai kondisi proses tender di Indonesia kurang sehat. Hal itu didapatkan dari studi yang dilakukan Badan Perencanaan dan Pembangunan Nasional (Bappenas) termasuk ketika dilakukan studi banding tentang proses pengadaan di negara lain. “LKPP menyiapkan tiga langkah untuk memperbaiki proses tender yang sehat di berbagai instansi pemerintahan,” ujar Kepala LKPP Agus Rahardjo setelah membuka Bimbingan Teknis Pengadaan Barang dan Jasa yang diadakan Ikatan Ahli Pengadaan Indonesia (IAPI) Sumut di Hotel Antares Medan, kemarin. Tiga agenda itu adalah perbaikan regulasi, pembenahaan kelembagaan dan penataan sarana serta pelatihan sumber daya pengadaan di berbagai daerah dengan menyiapkan Rancangan Undang-undang (RUU) Pengadaan yang saat ini telah memasuki tahap harmonisasi dengan berbagai lembaga terkait. Dalam RUU tersebut dicantumkan kesempatan untuk mengikuti proses pengadaan barang dan jasa bukan hanya di lingkungan intansi pemerintahan yang mengelola APBD, tetapi seluruh lembaga yang menggunakan uang negara. Dia mencontohkan Badan Usaha Milik Negara (BUMN) dan Badan Usaha Milik Daerah (BUMD) yang ada di berbagai kabu-paten/ kota di tanah air. Jika diperbandingkan dengan negara lain, Indonesia termasuk terlambat dalam menyiapkan UU yang dimaksudkan untuk menciptakan iklim persaingan yang sehat dalam proses pengadaan tersebut. Dia mencontohkan Filipina yang telah memiliki UU itu sejak tahun 2003,Vietnam 2006 dan China 2009.“Bahkan, Jerman sudah punya sejak tahun 1935, sebelum perang dunia,” katanya. Agus Rahardjo didampingi Ketua Ikatan Ahli Pengadaan Indonesia (IAPI) Sumut, Fery Tanjung mengatakan, agenda pembenahaan kelembagaan itu dengan menciptakan sebuah lembaga yang menangani proses pengadaan secara permanen dan profesional. Agus mengatakan, salah satu upaya untuk merealisasikan agenda itu adalah dengan mendirikan Unit Layanan Pengadaan (ULP) di setiap provinsi, kabupaten dan kota yang akan melakukan proses pengadaan. Jika dinilai secara umum, tidak sehatnya proses tender itu keuangan negara mengalami “kebocoran” antara 10 hingga 50 persen. (m28)

MEDAN (Waspada): Pangkohanudnas memandang perlu mengembangkan kekuatan pertahanan udara agar dapat meningkatkan kemampuan pengawasan udara di wilayah barat Indonesia. Demikian dikatakan Panglima Kohanudnas (Pangkohanudnas) Marsekal Muda TN Eddy Suyanto ST pada upacara serah terima jabatan Pangkosek Hanudnas III dari Marsekal Pertama TNI Chaerudin Ray kepada Kolonel Pnb Bonar H Hutagaol di Lapangan Makosek Hanudnas III Jalan DC Barito Medan, Selasa (1/2). Menurut Eddy, untuk melaksanakan pengamatan udara, Kosek Hanudnas III Medan mengoperasikan satuan-satuan radar Hanud serta menjalin kerjasama dengan unsur radar

sipil Depertemen Perhubungan yang berada di bandara. “Ini untuk mencermati kondisi dan kerawanan wilayah udara Indonesia bagian barat terhadap pelanggaran udara,” ujarnya. Sedangkan dalam konteks kerjasama antara TNI dan Tentara Udara Diraja Malaysia, khusus Kosek III memiliki tanggung jawab untuk melaksanakan kegiatan operasi pertahanan udara perlu terkoordinasi. Keberhasilan tugas operasi dan latihan oleh Kohanudnas, kata Panglima, didukung juga oleh satuan samping seperti halnyasatuanArhanudyangber-ada dalam wilayah tanggung jawab Kodam I/BB dan unsur KRI dari Koarmabar dan jajarannya. Sementara itu, dengan telah dioperasikannya Air Situation Cabin di Satrad 231Dumai

guna pengawasan ruang udara Selat Malaka, perlu adanya koordinasi yang mantap dengan unsur-unsur terkait, peralatan ini beroperasi di ruang udara Kosek Hanudnas III. Untuk itu, kata Panglima, pihaknya berharap Kosek Hanudnas III Medan beserta jajaran mampu secara bertahap dan berlanjut meningkatkan kemampuan operasional dalam pencapaian tugas pokok. Dalam kesempatan tersebut, Panglima juga menyatakan Marsekal Pertama TNI Chaerudin Ray selama ini telah mampu merintis, mengembangkan dan meningkatkan hal-hal yang kontruktif bagi upaya pembinaan kemampuan Kosek Hanudnas III Medan. Prestasi ini dapat dilanjutkan oleh pejabat baru Kolonel Pnb Bonar H Hutagaol. (m32)


LAPAK PEDAGANG: Deretan lapak pedagang korban kebakaran berdiri di lokasi bekas kebakaran di kawasan Pasar Brayan dekat jembatan layang. Pedagang-pedagang itu mencoba bangkit dari musibah yang menimpa mereka.

Perjuangan Awal Korban Kebakaran Tanpa Bantuan Pemerintah BENCANA kebakaran yang melanda mereka tidak memupuskan niat pedagang Pasar Brayan untuk menjadi pengusaha sukses. Lihatlah Pasar Brayan yang mengalami kerusakan dan kehancuran akibat lautan api yang menghanguskan kios-kios dan lapak pedagang, kini mereka memasang dereten terpal di rangka bata kiosnya yang terbakar. Kios dengan atap terpal itu kini dapat berdiri tegak ditopang kayukayu yang menjadi rangkanya. Mereka memulai lagi dari awal usahanya dengan modal utang sana-sini tanpa bantuan pemerintah. Elentina Sirait, 67, menuturkan, dia mengusahakan biaya dari mana pun tanpa bantuan pemerintah untuk membuka kembali usaha pakaiannya yang sempat terhenti akibat kebakaran yang menyebabkannya rugi ratusan juta dalam sekejap. Dia telah membuka kembali tokonya dengan tenda dan modal awal yang tidak sebesar dulu karena kesulitan keuangan yang menerpanya. Maklum dia seorang janda yang memiliki sembilan orang anak. “Saya akan tegar dan berusaha kuat untuk mencari biaya, walaupun itu harus menggadaikan sesuatu,” ungkapnya kepada Waspada, kemarin. Elentina salah satu dari ratusan pedagang korban kebakaran Pasar Brayan pada Januari lalu. Sementara itu Merry, penjaga kios pakaian, mengungkapkan kios yang dijaganya baru buka kemarin tapi sudah ramai pembeli. Dengan

modal awal pemilik kios berkisar puluhan juta, kios diisi dengan pakaian pria dewasa, kostum bola dan jenis pakaian lainnya. “Seharian ini saya menjaga sudah ada puluhan pembeli, walaupun orang-orang yang ke sini juga banyak yang hanya sekadar melihat kios pasca kebakaran,” ujarnya. Hari pertama membuka kios, kami sangat khawatir tidak akan ada pembeli karena isu Pasar Brayan akan diratakan, tapi akhirnya kami lega melihat banyak korban kebakaran berjualan di lokasi kebakaran, begitu juga masyarakat yang mampir dan melihat, juga lumayan. Setidaknya mereka tahu telah ada kios yang buka. Dia mengungkapkan, keterpurukan terlalu lama tidak akan menghasilkan apapun. Dengan bangkit dan berusaha kembali adalah jalan keluar. “Saya mendukung bos saya dan akan semangat bekerja, walaupun berjualan di tempat yang kumuh dan masih berantakan, kami tetap optimis,” tegasnya. Pantauan Waspada, puluha toko dan lapak berjualan kembali berjualan dengan ragam cara. Ada yang berjualan hanya dengan meletakkan dagangannya di atas meja tanpa atap atau tenda, ada pula yang berjualan dengan mengkaitkaitkan tali di tubuh kayu yang kemudian diikat di rangka bata kios mereka, dengan atap tenda berwarna biru yang diikat tiap ujungnya di sudut rangka bata kios mereka. * Silfa Humairah

Korpri Bantu Krisis Stok Darah PMI MEDAN (Waspada): Masih rendahnya minat warga Sumatera Utara mendonorkan darahnya menyebabkan krisis stok darah sebesar 70 persen terus mendera daerah ini dalam 10 tahun terakhir. Karenanya, perlu diterapkan satu gerakan terpadu dan terpola untuk mendorong animo seluruh elemen warga agar lebih antusias lagi melakukan kegiatan donor darah. Demikian Ketua Dewan Pengurus Korpri Sumatera Utara RE Nainggolan dalam kegiatan Safari Donor Darah Anggota Korpri Sumut di Kantor Dinas Pendapatan Sumut, Jumat (4/ 2). Kegiatan yang dikerjasamakan dengan Unit Donor Darah Palang Merah Indonesia Medan itu juga diikuti anggota Korpri dari Dinas Kehutanan dan Badan Penelitian dan Pengembangan Pemprovsu. Menurut Nainggolan, kegiatan tersebut akan berlangsung secara rutin di seluruh Satuan Perangkat Kerja Daerah (SKPD) Pemprov Sumut

pada setiap Jumat dan akan berlangsung hingga tujuh bulan ke depan untuk kemudian ditularkan ke seluruh kabupaten dan kota. Safari Donor Darah Korpri Sumut ini, lanjutnya, untuk menjawab tantangan pemenuhan stok darah yang mengalami krisis sebesar 70 persen. Nainggolan didampingi Ketua Harian Korpri Sumut Arsyad Lubis, Sekretaris Rusdi Batubara, Ketua PMI Medan Kasim Siyo, Kadispenda Sumut Sjafaruddin dan Kepala Unit Donor Darah Delyuzar meyakini Sumut di masa depan tidak akan lagi mengalami krisis stok darah, apabila kegiatan serupa dilakukan seluruh instansi/lembaga pemerintah, swasta dan elemen masyarakat lainnya. Sementara Ketua PMI Sumut Kasim Siyo mengatakanm gerakan Safari Donor Darah Korpri Sumut ini merupakan kegiatan yang sepengetahuannya baru pertama sekali digelar di Indonesia. Karena itu dia sangat mengapresiasi kegiatan tersebut. (m28)

Mahasiswa USU Berkunjung Ke UPM Dan UM Malaysia MEDAN (Waspada): Dalam rangka pengembangan wawasan akademik dan peningkatan hubungan kerjasama antara perguruan tinggi di kawasan IMT GT (Indonesia Malaysia Thailand Growth Triangle) barubaru ini serombongan mahasiswa USU melakukan kunjungan ke beberapa perguruan tinggi di Malaysia. “Rombongan mahasiswa USU tersebut berasal dari Fakultas Pertanian dan telah melakukan kunjungan studi ke Universiti Putra Malaysia (UPM) dan University of Malaya (UM) pada 17-20 Januari 2011 lalu,” kata Pimpinan rombongan sekaligus dosen pembimbing Prof. Dr. Ir. Sumono, MS didampingi Ir. Edi Susanto, MSi kepada wartawan, kemarin. Menurut Prof. Sumono yang juga sebagi ketua Dewan Guru Besar (DGB) USU, kegiatan tersebut untuk membuka

wawasan dan pemikiran serta diharapkan ke depannya sangat berguna dalam meningkatkan kreativitas para peserta kunjungan dan memotivasi mahasiswa lainnya. Kunjungan tersebut dimulai dengan mengunjungi UPM dan rombongan disambut sangat baik oleh para staf setempat khusunya Assoc. Prof. Dr. Zelina Zaiton Ibrahim sebagai Director International Centre. Selanjutnya Guru Besar UPM tersebut menyampaikan presentasi dan melakukan diskusi bersama para mahasiswa Fakultas Pertanian USU. Menurut Guru Besar USU yang juga sebagai ketua Asosiasi Dosen Indonesia (ADI) Sumut ini, Universiti Putra Malaysia merupakan salah satu universitas terkemuka di Malaysia yang terdiri dari 16 fakultas dan 9 institut dengan penawaran 5 program diploma, 53 program

sarjana, 46 program master tanpa tesis dan lebih dari 250 program master dan Phd dengan tesis. Kunjungan ke Universiti Putra Malaysia (UPM) ini berakhir di Perpustakaan Sultan Abdul Samad yang terletak tidak jauh dari Fakultas Pertanian yang terdiri dari dua blok bangunan kembar dengan luas sekitar 17.762 meter persegi. Prof. Sumono menyebutkan, rombongan juga berkesempatan berkunjung ke University of Malaya (UM) dan langsung mengadakan Library Tour di Perpustakaan University of Malaya (PUM). UM merupakan universitas tertua di Malaysia yang terletak di Kuala Lumpur. Perkembangan universitas ini sangat pesat pada abad pertama pembangunannya. PUM tersebut merupakan perpustakaan terbesar di Malaysia. (m41)


FOTO BERSAMA: Rombongan Mahasiswa Pertanian USU foto bersama di sela-sela melakukan kunjungan studi di Universiti Putra Malaysia dan University of Malaya, beberapa waktu lalu.


DONOR DARAH: Ketua Dewan Pengurus Korpri Sumut, DR RE Nainggolan, MM, Sekretaris PMI Medan, drg Susyanto, Kadispenda H Sjafaruddin, SH dan Ketua Harian Korpri Sumut DR Arsyad Lubis, Jumat (4/2) meninjau pelaksanaan Safari Donor Darah Korpri Sumut yang dimulai di Dispenda Sumut Jalan Sisingamangaraja Medan.

Rapimwil Bahas Program PKS Sentuh Masyarakat MEDAN (Waspada): Wakil Gubernur Sumatera Utara Gatot Pujonugroho dijadwalkan membuka acara Rapat Pimpinan Wilayah (Rapimwil) Partai Keadilan Sejahtera (PKS) Sumut hari ini, Sabtu (5/2) di Asrama Haji Medan. Sementara tiga pakar politik dan media juga telah menyatakan kesiapannya untuk memberikan kritikan dan masukan langsung, dalam dialog yang membahas “Wajah PKS Sumut di Media”. “Melalui Rapimwil, PKS Sumut akan segera menghasilkan program-program dan kebijakan politik strategis yang menyentuh langsung pada kebutuhan masyarakat Sumatera Utara. Kita siap langsung bekerja untuk itu,” ujar Ketua Umum Dewan Pimpinan Wilayah (DPW) PKS Sumut Muhammad Hafez didampingi Sekretaris Umum Satrya Yudha Wibowo dan Wakil Ketua Umum Heriansyah di sela-sela persiapan Rapimwil di Kantor DPW PKS Sumut, Jumat (4/2). Pada Rapimwil yang akan berlangsung selama dua hari tersebut, lanjut Hafez, seluruh jajaran pengurus wilayah PKS ditambah dengan Ketua DPD PKS se-Sumut, akan bekerja keras menggodok program yang benar-benar berpihak pada kepentingan masyarakat Sumut ke depannya. “Selanjutnya kita akan langsung mulai bekerja untuk merealisasikan program-program

dan kebijakan politik yang telah diputuskan. Kita akan memanfaatkan seluruh elemen yang ada, baik di dalam maupun luar parlemen. Termasuk memberikan dukungan penuh kepada Gatot Pujonugroho selaku kader partai yang saat ini menjadi pemimpin di Sumut agar benarbenar menjalankan program yang berpihak langsung kepada rakyat,” katanya lagi. Kritik pakar Sekretaris Umum DPW PKS Sumut H Satrya Yudha Wibowo menambahkan, seusai prosesi pembukaan Rapimwil oleh Wakil Gubernur, acara akan dimulai dengan dialog pakar. “Pakarpakar tersebut terdiri dari pakar komunikasi politik Fisip USU Hendra Harahap, sosiolog politik Fisip UMSU Shohibul Anshor Siregar dan KetuaYayasan Kajian Informasi Pendidikan dan Penerbitan Sumatera J Anto,” ujarnya. Para pakar tersebut tambah Satrya Yudha, akan menyampaikan kritikan langsung berkaitan dengan kinerja PKS Sumatera Utara yang selama ini dipahami melalui informasi di media massa. Hendra Harahap akan menyoroti pada aspek komunikasi politik, Shohibul Anshor akan mengkritisi dari aspek sosiologi politik, sedangkan J Anto akan membahas dari intensitas kemunculan di media massa serta logika-logika yang diinginkan media massa terhadap partai politik di era limpahan informasi saat ini. (m28)

Medan Metropolitan

WASPADA Sabtu 5 Februari 2011

Dinilai Sebagai Sarang Maksiat

Eksekusi Lahan KIM II

Ibu-ibu Pengajian Demo Delta Spa MEDAN (Waspada): Setelah didemo kelompok mahasiswa dan Front Pembela Islam (FPI), kini giliran ibu-ibu pengajian mendemo Delta Spa and Health Club di Jln. Ir. H. Juanda Medan, Jumat (4/2).

Waspada/Rudi Arman

DIAMANKAN: Reskrim Unit Jahtanras Polresta Medan mengamankan satu truk Suzuki Elf BM 9910 RA yang mengangkut sawit hasil curian. Sopir dan kernet truk tersebut telah ditahan. Foto diambil, Rabu (2/2).

Ibu-ibu dari pengajian Mathlaul Anwar Kota Medan itu menilai Delta Spa tidak ubahnya sebagai sarang maksiat dan lokasi prostitusi terselubung sehingga mendesak Pemerintah Kota Medan menutup tempat hiburan malam yang menyediakan fasilitas hotel dan karaoke itu. Bahkan, para pengunjukrasa juga mensinyalir lokasi itu tempat peredaran narkoba. Koordinator pengunjukrasa Nila Shintiawaty mengatakan, keberadaan tempat hiburan malam di Medan membuat kaum ibu semakin resah. Selain banyak menyalahi aturan,

Truk Angkut 6 Ton Sawit Curian Ditangkap MEDAN (Waspada): Reskrim Unit Jahtanras Polresta Medan menangkap satu unit truk Suzuki Elf BM 9910 RA yang mengangkut 6 ton sawit curian dalam penyergapan di Pasar XI, Desa Sei Rotan, Percut Seituan. Dua tersangka yakni sopir S, warga Pagar Merbau, Deli Serdang dan kernet S, warga Jln. Pringgan, Medan, dijebloskan dalam tahanan. “Sopir dan kernet sudah kita jebloskan dalam tahanan,� jelas Kasat Reskrim Kompol Fadillah Zulkarnaen melalui Kanit Jahtanras AKP Yudi Frianto di Polresta Medan, Jumat (4/2). Dijelaskannya, truk yang mengangkut sawit itu ditangkap pada Rabu (2/2). “Sopir dan kernet beserta truk pengangkut sawit kemudian diboyong ke Polresta Medan. Dari hasil penyelidikan, baru diketahui bahwa sawit tersebut merupakan hasil curian,� tuturnya. Semula, lanjutYudi, pihak PTPN II sebagai pemilik sawit belum membuat pengaduan. “Tetapi begitu kita tunjukkan barang bukti sawit, pihak PTP langsung mengklaim kalau sawit itu berasal dari kebunnya. Berdasarkan laporan dari korban, sopir dan kernet kemudian dijadikan tersangka dan ditahan,� sebutnya. Pantauan Waspada di Polresta Medan, terlihat truk Suzuki Elf BM 9910 RA yang mengangkut 6 ton sawit masih terparkit di halaman Mapolresta Medan. (m39)

tempat hiburan malam itu telah merongrong moral bangsa, karena menjadi lokasi prostitusi. “Kami minta Pemerintah Kota Medan segera mencabut izin operasional Delta Spa dan sejumlah tempat hiburan lainnya, karena diduga telah mempekerjakan anak di bawah umur, juga tarian telanjang sehingga merusak moral bangsa,� kata Nila dalam orasinya. Menurut mereka, saat ini terdapat 59 lokasi karaoke, 15 diskotek atau klab malam, 35 pertunjukkan live music, 37 panti pijat, 9 reflexology dan 59 spa. Keberadaan lokasi hiburan

ini, minim pengawasan dari pemerintah sehingga rawan penyalahgunaan. Dalam pernyataan sikapnya, para pengunjukrasa juga meminta para tokoh masyarakat, pemuda dan ulama ikut memerangi kemaksiatan di Medan. Pasalnya, Medan dikhawatirkan menjadi kota maksiat metropolitan jika dilihat dari perkembangan tempat hiburan dan hotel yang menjadi sarang maksiat. Meski yang berunjukrasa sekira 10 orang, namun penjagaan terlihat cukup ketat. Setidaknya 15 anggota Satuan Pengamanan (Satpam) Delta Spa berjaga-jaga dan terlihat lima personel Brimob Daerah Sumut. Pengamanan kali ini agak berbeda, karena biasanya pengamanan unjukrasa dilakukan Satuan Samapta.(m27)

Kasus Perselingkuhan

Dua Oknum Polri Terancam Dipecat MEDAN (Waspada): Dua oknum anggota Polri yakni Aiptu DKS dan Aipda YK terancam dipecat atau Pemberhentian Tidak Dengan Hormat (PTDH) atas kasus dugaan perselingkuhan sekaligus perzinahan. Kini kasus perzinahan kedua mantan anggota Satuan Lalu Lintas (Sat Lantas) Polresta Medan itu tengah bergulir di Pengadilan Negeri (PN) Medan. “Hasil pidana umum, ancamannya kurungan. Soal pemecatan tergantung atasan terhukum dan putusan sidang profesi. Bisa saja keduanya terancam sanksi PTDH,� sebut Kapoldasu melalui Kasubbid Dokliput Humas AKBP MP Nainggolan saat ditanya wartawan, Jumat (4/2). Menurutnya, Polri sangat menghormati hasil sidang peradilan umum. Namun secara internal Polri, pasangan selingkuh itu akan menjalani sidang Komisi Kode Etik (KKE) guna

Toko Grosir Dibobol Maling MEDAN (Waspada): Toko grosir milik Reni, 33, di Jalan Jemadi Kelapa I, Pulo Brayan, Kecamatan Medan Timur, Jumat (4/2) dinihari, dibobol kawanan maling. Akibatnya, korban mengalami kerugian Rp 12 juta, dan peristiwa tersebut telah dilaporkan korban ke Polsekta Medan Timur. Informasi yang diperoleh di kepolisian menyebutkan, aksi pencurian tersebut pertama kali diketahui oleh pemilik grosir, ketika akan membuka usahanya melihat gembok dan pintu besi telah dirusak. Mengetahui hal itu, korban memeriksa barangbarang dagangannya, dan diketahui sebanyak 40 karung beras dan rokok telah hilang, dengan total kerugian Rp 12 juta. Diperkirakan kawanan maling menggunakan mobil pick up untuk mengangkut barang hasil kejahatannya. Para pelaku diperkirakan beraksi sekira pukul 03.00WIB, dengan menggunakan peralatan linggis. Pelaku berhasil masuk ke dalam grosir dengan cara mencongkel pintu besi yang terlebih dahulu merusak gembok besi. Berkaitan dengan pengaduan tersebut, pihak kepolisian masih melakukan penyelidikan dilokasi dan meminta keterangan dari penjaga malam. “Penjaga malam dan korban telah dimintai keterangannya,� sebut Kapolsekta Medan Timur Kompol Patar Silalahi. (h04)

memutuskan apakah keduanya dapat diajukan PTDH atau tidak. “Apapun keputusan sidang pidana umum akan kita hormati. Tapi kepada bersangkutan akan dilaksanakan juga sidang kode etik,� tambah Nainggolan. Sebelumnya, Rabu (19/1), majelis hakim PN Medan menunda sidang perkara tindak pidana perzinahan dengan terdakwa Aiptu DKS dan AipdaYK, karena salah seorang terdakwa sakit. “Sidang agenda tuntutan dari jaksa ditunda karena terdakwa DKS sakit,� kata Ketua Majelis Hakim Ardy Johan saat menutup persidangan. Pada persidangan sebelumnya, terdakwa Aiptu DKS mengakui semua perbuatannya. Awal asmaranya dengan terdakwa Aipda YK terjadi sejak Mei 2010. Perselingkuhan antara Aiptu DKS dan AipdaYK dilakukan setiap kali ada waktu luang. Pengakuan keduanya di-


kuatkan keterangan saksi, seperti security dan supervisor salah satu hotel di Medan. Perkara itu terungkap setelah suami Apida YK melaporkan perbuatan istri dan selingkuhannya itu ke Mapolresta Medan, Selasa (28/9). Disebutkan, pada awal Mei 2010, pelapor (suami Aipda YK) sudah mencurigai istrinya “bermain api�. Apalagi beberapa bulan kemudian, pelapor mendapat info istrinya berhubungan dengan Aiptu DKS, teman sekantor sang istri. Setelah mendapat info itu, pelapor mencari tahu kebenarannya. Dari keterangan sejumlah saksi dan diperkuat pengakuan istrinya sendiri yang telah melakukan perzinahan secara berulang kali dengan Aiptu DKS, pelapor langsung membuat pengaduan ke UPPA Sat Reskrim Polresta Medan.(m27)

Polda Keluarkan Surat Penangkapan MEDAN (Waspada): Polda Sumut mengeluarkan surat perintah penangkapan terhadap dua orang diduga sebagai provokator kericuhan saat eksekusi pengosongan lahan KIM II Mabar oleh Pengadilan Negeri (PN) Lubuk Pakam. Keduanya berinisial L dan W, menggunakan masyarakat yang tidak mengerti untuk menghalangi eksekusi. “Kedua orang itu dilaporkan pihak KIM II Mabar ke Poldasu. Karena keduanya menghilang, Poldasu mengeluarkan surat perintah penangkapan,� sebut Kabid Humas Poldasu Kombes Pol. Hery Subiansauri, Kamis (3/2). Dikatakannya, penyidik Poldasu tidak berpihak kepada KIM II, juga masyarakat.

Poldasu sebagai penegak hukum, hanya bertugas melakukan pengusutan. “Polisi hanya menegakkan hukum,� ucapnya. Pelaksanaan eksekusi pengosongan lahan PT KIM II Mabar oleh PN Lubuk Pakam pada Kamis (6/1) berakhir ricuh. Akibatnya, tujuh warga Koptan Tani mengalami luka-luka dan menjalani perawatan medis. Mereka adalah Parman, 42, luka terkena panah beracun;Widodo, 48, luka di dada;Wardi, 53, luka di kaki akibat lemparan batu; Rizal, 29, luka di kaki akibat lemparan batu; Saipullah, 39, luka di kaki akibat lemparan besi dan Heri, 35, luka di kaki akibat lemparan batu. Mereka masih menjalani perawatan di klinik Vivina Huda Jln. RPH Mabar.(m27)

Dua Pengedar Narkoba Diringkus MEDAN (Waspada): Dua pengedar sabusabu ditangkap petugas Polsekta Medan Baru di Jalan Klambir V, Kecamatan Sunggal, Kabupaten Deliserdang, Jumat (4/2). Dari tersangka BS, 32,warga Sunggal simpang Asam Kumbang dan Rfi, 25, penduduk Jalan TB Simatupang, Gang Bersama, disita barang bukti 5 jie sabu-sabu senilai jutaan rupiah. Kapolsekta Medan Baru Kompol Saptono, SH, SIK melalui Kanit Reskrim Iptu Akta Wijaya, SH, mengatakan, terkuaknya kasus itu berdasarkan informasi dari masyarakat. Dalam pengakuan tersangka, kata Akta, mereka membeli sabu dari seorang warga Kotacane. Sedangkan, sabu itu rencana akan diedarkan di kawasan Kota Medan dan Deliserdang. Tersangka Togel Sementara itu, Polsekta Medan Helvetia mengirim tiga tersangka kasus togel yakni JS, 21, penduduk Jalan Kemuning XI, AS, 20, penduduk Jalan Kamboja, IM alias Buyung, 52, penduduk Jalan Kamboja ke Rumah Tahanan (Rutan) Tanjung Gusta.

“Penitipan ke tiga tersangka itu ke Tanjung Gusta karena selesai menjalani pemeriksaan dan selain itu ada saja orang yang datang mencoba mengurus tersangka,� kata Kapolsekta Medan Helvetia Kompol Sutrisno HS, SH,SIK kepada Waspada, Jumat sore. Menurutnya, walaupun tersangka dikirim ke Tanjung Gusta, namun mereka masih status tahanan Polsekta Medan Helvetia. Apabila keterangan dibutuhkan lagi, mereka bisa dijemput kembali. Sutrisno mengatakan, ketiga tersangka ditangkap bersamaan dengan FN, 47, penduduk Jalan Kemuning, di Jalan Tanjung, Perumnas Helvetia, berikut menyita barang bukti dua handphone, kalkulator, empat lembar rekap togel dan dua buah pulpen, kemarin. Ketika diperiksa, kata Sutrisno, FN tidak ada keterlibatannya dalam judi togel tersebut. Hal itu dikuatkan dari pengakuan ke tiga tersangka yang menyatakan FN tidak terlibat, maka dia dibenarkan pulang. Dalam kasus itu, ke tiga tersangka dikenakan pasal 303 junto 55, 56 KUHP dengan ancaman kurungan lima tahun ke atas. (m36)

Mayat Mr.X Masih Di RSPM MEDAN (Waspada): Sudah dua minggu penemuan mayat pria tanpa identitas yang diperkirakan berusia 60 tahun, di perairan Sungai Jernih, Dusun X Desa Cinta Rakyat, Kec. Percut Seituan, hingga Jumat (4/2), belum diketahui identitasnya. Sementara mayat masih berada di intstalasi jenazah RSU Dr Pirngadi. Kapolsekta Percut Seituan Kompol Maringan Simanjuntak, mengimbau agar warga yang merasa kehilangan segera melihat keberadaan mayat tersebut. “Hingga kini, belum ada warga yang melapor ke polisi terkait kehilangan satu sanak keluarganya. Bila ada warga atau pihak keluarga yang melapor akan mempermudah penyelidikan kasus pembunuhan tersebut,� jelas Kompol Maringan Simanjuntak kepada Waspada, Jumat (4/2).

Simanjuntak mengakui, pihaknya sangat kesulitan untuk mengungkap identitas korban, karena pihak keluarga maupun teman korban belum juga ada yang membuat pengaduan. “Jadi kita tidak bisa mengambil langkah untuk mengungkap kematian korban yang diduga menjadi korban pembunuhan, karena masih terkendala pada identitas korban,� tambahnya. Mengenai ciri-ciri korban, Maringan Simanjuntak menjelaskan, ciri-ciri sebagai berikut, tinggi badan 165 -175 cm, kulit berwarna sawo matang, rambut pendek beruban, memiliki janggut yang tidak begitu lebat, gigi ompong dan mengunakan tali ikat pinggang huruf CD.Wajah agak lonjong dan sudah empat hari tewas yang diduga menjadi korban pembunuhan. (h04)

5     „„   Â’ Â?  “ „  Â?“ Â? Â?”



                        Â Â Â?  Â?Â?

4 3 2


ÂŽ     „„„    €   Â? ­ ‰Â? „„ˆ Š    Š  Â? Š ‡Â?Â?



‚ „Œ„        ” •    „ƒ„  Â?     ‹     Â?Â?

 Â?      ­

€‚ � 

€ ƒ   „   


 ‹   ‹   ‚„ ˆ  ‹   ‡ �‡ †��



€          ‘         Â?   „    ­ ‘     „„       Â? „   



  ‡ „ ˆ„ ­­ ‚  ­‡


 ‚ �� ­ ��

…„   € 

­ † €  � ‡


Â?    ˆ  ‡ €­ €  Â? 



         Â   Â?    


  ‹  ƒ„ 

­  Â?€     ÂŒ    ‹    Â?   „  ‹€ „„ „„€„ „„„ 

       ‹   „„    „„ „   Â?„ 




   Â?         Â?      „          ‰Â?‰        Â? „   ‡ Â?    ‹     „         Â? ‹

“       „ š„    „ š„   ‹  „ š„ ‹ Â? „ š„     ­ “  

 “    ‘‘



 � “    

3 1




”‹˜˜˜•­” ‰ „   ‡‡‡‡‡ Â? š„  •“…š•ž˜•

 ­ Jawaban: B ÂĄ¢­Š€ ¢€ Š€ ¢€ €¢


  ˆ ˆ –Š                ”  ‰„ ”  Â? Â?    Â? Š    ‰„        ’„Š’„ —˜„    “” “„‘  ”  

     “” — ’˜Â’ ˜„ ™ “            “”     ’„Š ’„      “”     ’„Š ’„  Â?   “”  ‹  ’„Š’„ Â? Â?   “”    ’„Š’„

   „’„              ‹ “ ‹              ‹  Â?       „   Â?          •Â? Â?     ’„ „Â?   “”   

‹  ‘ ‰    ‹       ‹     Â?   ‘ ˆ        ‘›  Â?       ‹  ›      

‹   › Â?     ‹  ›

€  €

  ¢  ¢   

€ ��

† “          “   •˜  

 Jawaban: B ƒ Â? ‹      ‹   →   ƒ ” → ‹    ƒ ” → ‹    ƒ ” → ‹   


Â?‘     ”‹˜˜˜• ­ ” ‰   “ …„ š   ­  „ Â? Š† 

    „ Â&#x;   Â’  

“  ¢ ÂŁ‹

€     ¢¤   €


” ‚ š„   � 

“  „ †• 


 Jawaban: D ¢ ¢ ¢ € Jawaban: C Â’„ ‘„        


 Jawaban: D ƒ ÂŽ„„ →    ƒ ÂŽ  →  „ 

  Jawaban: C “„   Jawaban: B  ‰ Â? ­ ‰      Â?     

§†Â? € ”   Â? € Jawaban: A „   “¢   ­ Jawaban: D „‹ ” ž 

  Jawaban: B ‘ƒ ‘   ÂŁ “ ‘‘       “ …„ š  ‘        “ …„ š  ‘        “ …„ š  ‘    

   Â? “ …„ š  ‘       € Â?      „„„ÂŒ     ”   Â?„„     ‹  Â? ˜   „ 






     ¢ ∠Â?  ∠    ¢ ∠  ∠  ”         Â?¢ € Â?„ƒ„   ¢Â? ­  

 Jawaban: A Â’ ¢

‰ ¢­  ¢­ ‡ Jawaban: D    Â?

† Jawaban: B 


­  €  ‚ ƒ ƒ  ­

 €  Â?‚ ƒ ƒ

 €  ‚ ƒ ƒ


 Jawaban: D ­ ×���××���

‚ Jawaban: B


Â?        Â’Â 

  Jawaban: B ÂŚ ‡ Jawaban: C    

  Â’ Â 

­ Jawaban: B ÂŽ      ‹  Radiasi    



         Induksi      „    Jawaban: C ƒ š„„­   „„  

  „ ƒ š„„ €    „„   


 ‡ Â?        ” “       ƒ    „„   “  ‘            Â?  

 Jawaban: C “¢‡¼¤­­†¼†¼ ¼ ¢­‡ 

…„  €

‚ “…„š

 Jawaban: C 2

7 5

€ Jawaban: A

¢†•  Â? ‹            „    Â? „

† �� 8

         „ Âœ  –     Â? Â’  Â? ”„  

† Jawaban: B Â?  „‘      ‘ ‚ Jawaban: B ƒ Â?      → Â?     „„ÂŁ  „ „  ƒ


Â?   →  Â?        „„ÂŁÂ?Â?ÂŽ

SINONI SAMA ANTON LAWANnya   Jawaban: D “„    Jawaban: B ­ ”   ‹   …˜     “    € “    Â?   ‡ Jawaban: B  ‹—  ” ‰ Â?™  ‰Â?      „–      Â?   Â? † Jawaban: C š „  ‘    

 ‘   „Œ   ÂĄ“ 

        Â? Â? Â?

 „   ‚ Jawaban: D  „‹   ÂŁ  „ € Jawaban: C Â?  ŠŠŠ

Medan Metropolitan


WASPADA Sabtu 5 Februari 2011

Kapolresta: Tangkap Tersangka Penipu 42 Penarik Betor Polsekta Percut Seituan Targetkan Satu Bulan MEDAN (Waspada): Setelah lebih 190 hari kasus penipuan dan penggelapan terhadap 42 penarik beca bermotor (betor) tidak ada perkembangan, akhirnya Polsekta Percut Seituan mengeluarkan Daftar Pencarian Orang (DPO) atas nama Marihot A. Nainggolan selaku Direktur Koperasi Serba Usaha (KSU) Himpunan Abang Betor Sumatera Utara (HABSU). Kapolresta Medan Kombes Tagam Sinaga, SH saat dikonfirmasi Waspada di ruang kerjanya, Jumat (4/2), mengatakan, pihaknya telah meminta Kapolsekta Percut Seituan menangani kasus tersebut dengan serius dan menangkap pelakunya. Menurut Tagam, polisi sudah mengeluarkan Daftar Pencarian Orang (DPO) terhadap pelaku kasus penipuan dan penggelapan kredit beca ber-

motor (betor) tersebut. “Sudah dikeluarkan DPO untuk tersangka Marihot A Nainggolan yang diduga tidak menyetorkan pembayaran kredit beca bermotor,� tambahnya. Tagam menegaskan, kasus tersebut tetap ditangani Polsekta Percut Seituan. “Saat ini Polsekta Percut Seituan telah membentuk tim terdiri dari empat orang guna menangani kasus tersebut hingga tuntas,� ujarnya. Targetkan satu bulan Di tempat terpisah, Kapolsekta Percut Seituan Kompol Maringan Simanjuntak mengatakan, pihaknya menargetkan akan menangkap Marihot A Nainggolan dan istrinya Dhani Sartika dalam tempo satu bulan. “Polisi sudah melacak lokasi yang selama ini dicurigai menjadi tempat persembunyiannya. Namun keberadaan Marihot

Tersangka Pembunuh Mahasiswa ITMTeridentifikasi MEDAN (Waspada): Penyidik Polsekta Medan Kota berhasil mengidentifikasi tersangka pembunuh M Agus Lubis alias Awit, 21, mahasiswa Institut Teknologi Medan (ITM) yang ditemukan tewas mengenaskan di kamar kosnya Jl. Air Bersih Gg Kasih. Kapolsekta Medan Kota Komisaris Polisi Sandy Sinurat mengatakan kepada Waspada, Kamis (4/2), saat ini pihaknya memburu seseorang yang teridentifikasi berinisial D, yang kini menghilang. “Kita sudah mendapat info tentang orang yang diduga sebagai pelakunya, dia masih menghilang,� kata Sinurat. Namun, Kapolsekta tidak menjelaskan lebih rinci tentang orang yang diduga sebagai pelaku pembunuhan itu. “Nanti akan disampaikan kepada wartawan jika yang bersangkutan sudah ditangkap dandiperiksa,� katanya. Sebelumnya, Polsekta Medan Kota menetapkan empat tersangka diduga pelaku pembunuhan. Namun keempatnya dilepas karena penyidik tidak menemukan bukti-bukti yang cukup untuk menahan para tersangka. Korban M Agus, mahasiswa ITM semester III ditemukan tewas mengenaskan, Senin (24/1) pagi sekira pukul 08:00. Ditemukan belasan tusukan senjata tajam di bagian leher dan dada. Orang pertama yang mengetahui kematian korban adalah Dita, pacar korban yang hari itu datang ke lokasi kejadian. Hasil pemeriksaan di lokasi kejadian ditemukan sejumlah barang bukti alat mengisap shabu-shabu, sehingga ada dugaan sebelum korban tewas, dia bersama beberapa temannya melakukan pesta narkoba. Tetapi, penyidik belum dapat memastikan hal itu, termasuk belum dapat menjelaskan hasil otopsi tentang zat adiktif di tubuh korban.(m27)

belum diketahui. Target saya, sebulan ini Marihot harus berhasil ditangkap,� sebutnya, Jumat (4/2). Simanjuntak menjelaskan, keberadaan Marihot sempat terlacak, namun lokasi yang telah diketahui itu masih diragukan. Apalagi pihaknya masih terbentur masalah teknis untuk menangkap Marihot yang disebutsebut telah berada di luar Pulau

Sumatera. Terkait Dhani Sartika, istri tersangka Marihot A. Nainggolan yang menjabat bendahara KSU HABSU, Simanjuntak mengatakan, pihaknya sudah membuat Berita Acara Pemeriksaan (BAP) dan akan meminta pertanggungjawaban pengacaranya selaku penjamin keberadaan Dhani Sartika. “Saat diperiksa, Dhani Sar-

tika baru saja melahirkan dan belum ditahan karena ada jaminan dari penasehat hukumnya. Jadi, kami akan memita pertanggungjawaban penasehat hukumnya untuk segera menghadirkan Dhani Sartika,� ujar Simanjuntak seraya menambahkan pihaknya sudah mengirimkan surat kepada penasehat hukum Dhani Sartika agar segera menghadirkannya. (m39/h04)

Terkait Kaburnya Tiga PRT

Muspika Medan Timur Tinjau Lokasi Penampungan MEDAN (Waspada): Muspika Medan Timur meminta pihak penyalur Pembantu Rumah Tangga (PRT) menyelesaikan permasalahan dengan tiga tenaga kerja wanita asal Jawa Tengah karena telah terikat dengan kontrak kerjasama. �Kami memberi kesempatan kepada pihak pengusaha agar menyelesaikannya secara internal. Sementara ketiga PRT tersebut masih diamankan di rumah Kepala Lingkugan XI Kelurahan Pulo Brayan Bengkel,� ujar Camat Medan Timur Rizal Effendi, SH kepada sejumlah wartawan, Jumat (4/2), usai meninjau lokasi penampungan tenaga kerja wanita milik CV. Maju Jaya di Jln. Angsa No. 17 Kelurahan Sidodadi, Kecamatan Medan Timur. Bila tidak ada penyelesaian antara pihak perusahaan dengan ketiga TKW tersebut, lanjut Rizal, pihaknya akan bersedia menanggulangi pemulangan ketiga PRT tersebut. Bahkan bila mereka masih mau bekerja di Medan sebagai PRT, pihaknya bersedia menyalurkannya. “Sudah ada warga yang menghubungi untuk menampung PRT tersebut,� sebut Rizal Effendi. Dalam peninjauan ke lokasi penampungan, penanggung-

jawab CV. Maju Jaya H. Syamsul terkesan menghindar dan buruburu meninggalkan tim Muspika Medan Timur yang terdiri dari Camat Medan Timur, Kapolsekta Medan Timur Kompol Patar Silalahi, Kanit Intel Aiptu H Drs. Hermansyah dan Danramil Kapten Inf Kartono. Sementara pihak CV Maju Jaya diwakili Barkat selaku direktur. Direktur CV Maju Jaya Barkat menepis tudingan dari ketiga PRT tersebut. “Sebelum disalurkan ke rumah calon majikan, mereka diberi pembekalan. Sebelum bekerja mereka diberi makan dan tidak pernah dianiaya,� jelas Barkat seraya menambahkan, perusahaannya memiliki izin dari Disnaker dan selalu mengawasi PRT selama bekerja di rumah majikannya. Sebagaimana diberitakan sebelumnya Tiga PRT asal Jawa Tengah melarikan diri dari penampungan CV. Maju Jaya Jl. Angsa Medan. Dua diantaranya meminta perlindungan dari warga, sedang seorang lagi dibawa keluarganya dalam kondisi sakit. Sementara tujuh TKW lainnya masih berada di lokasi penampungan dalam kondisi stres. Ketiga TKW masing-masing, Sumarti ,25, warga Kabu-

Waspada/Rudi Arman

Tersangka Heri saat memperagakan salah satu adegan rekonstruksi pembunuhan di gudang kosong kawasan Kesawan terlihat menutup wajah korban menggunakan kaos. Rekonstruksi dilaksanakan di Mapolresta Medan, Jumat (4/2).

Rekonstruksi Pembunuhan Mr X Di Kesawan

paten Grobokan, Jawa Tengah, Bariah,33, warga Kabupaten Tasikmalaya, Jawa Barat dan Susila ,14, warga Kabupaten Purbalingga, Jawa Tengah. Sumarti dan Bariah untuk sementara diselamatkan di rumah warga di Jalan Purwosari Gg. Hiligeo I, Kelurahan Pulo Brayan Bengkel, Lingkungan XI, Kecamatan Medan Timur. Sedang Susila dijemput keluarganya dalam kondisi sakit, Kamis (3/2) pagi. Ketiga TKW berhasil melarikan diri setelah mencongkel gembok pintu belakang rumah penampungan saat para penjaga rumah sedang tertidur pulas, Rabu (2/2/) dinihari sekira pukul 02:00. Barang-barang yang sempat dibawa kabur hanya beberapa potong pakaian yang dimasukkan dalam plastik hitam. Sementara ijazah, kartu identitas dan telefon seluler, masih disita pihak penyalur. Penyebab kaburnya ketiga PRT tersebut karena tidak tahan mendapat perlakuan yang tak manusiawi dan belum ditempatkan bekerja. Mereka juga merasa ditipu karena sebelumnya dijanjikan akan diberi gaji Rp850 ribu per bulan, namun kenyataannya hanya Rp500 ribu per bulan. (h04)

MEDAN (Waspada): Polresta Medan melaksanakan rekonstruksi pembunuhan di kawasan Kesawan, yang berlangsung di halaman Polresta Medan, Jumat (4/2) siang. Dalam peragaan tersebut, tersangka H alias Heri, 34, warga Kesawan Medan, memperagakan 21 adegan. Rekonstruksi yang dipimpin Kanit Jahtanras Polresta Medan AKP Yudi Frianto dimulai dari tersangka memperagakan langsung bagaimana caranya menghabisi korbannya (masih Mr X-red). Adegan pertama tersangka melihat korban di lapangan Merdeka lalu mengajaknya ke Jalan A Yani dengan mengendarai sepeda motor. Tersangka kemudian membawa korban ke bangunan kosong di Jalan Ahmad Yani (Kesawan) yang juga ditempati tersangka. Setelah itu tersangka menurunkan korban di lokasi kejadian. Selanjutnya diantara keduanya terjadi pertengkaran dan korban mengeluarkan pisau dan mengejar tersangka. Tersangka lalu lari kearah belakang bangunan mengambil sebuah pipa besi. Kemudian tersangka mengejar korban dan memukul punggung korban menggunakan pipa besi sebanyak 15 kali. Tersangka juga memukul muka korban menggunakan kedua tangannya lima kali. Korban terjatuh karena terkena pukulan.

Setelah itu tersangka membuka bajunya dan mengikatkan ke mulut korban. Tersangka juga mengikat kedua kaki dan tangan korban dengan tali plastik. Belum puas juga, tersangka mengambil kantong plastik lalu menyumpalkannya ke mulut korban. Setelah itu tersangka meninggalkan korban untuk membeli rokok dan kembali ke lokasi melihat kondisi korban. Ketika diperiksa tersangka, ternyata korban sudah tidak bernafas lagi. Melihat itu, tersangka menarik kaki korban dan menyeretnya ke kamar mandi. Setlanjutnya tersangka meninggalkan korban dengan menutup pintu kamar bangunan tersebut. Curi VCD Kasus ini sebelumnya berawal dari tersangka menangkap korban yang mencuri kaset VCD di salah satu toko di kawasan Kesawan. Korban yang tidak diketahui identitasnya tersebut kemudian dibawa tersangka ke Polsekta Medan Barat bersama dengan Kepala Lingkungan Kesawan. Karena pemilik toko kaset VCD tidak mau membuat pengaduan, maka korban yang tidak jelas tempat tinggalnya dilepas polisi dan tidak ditahan. Keesokkan harinya korban mengejek tersangka Heri dengan perkataan kibus. Sakit hati dibilang kibus, maka terjadilah peristiwa tersebut. (m39)

5  H ija u

                        Â Â?Â?

  Â Â?Â?Â?

  Â Â Â?



  ” –

M e ra h

K u n in g

P e ra k

ÂŽ   •  Â?Â?  — ˜   Â?  — ˜  Â?Â? „ — ˜  ­Â?„  — ˜ Š ” –

 €   ‚  ƒ�„

   ‚      ƒ…„

 †   ‚ †     ‡†       Â?Â? ˆ ‰Â?„


  � ˆ‰…„


 �� ˆ ‰�„


 ­� ˆ ‰…„


 Â?   ‚  Â?         ‡      Â?Â?Â…   Â?Â?Š…    Â? Â…  ­Â? Â?    ­ ‹Â?‰ÂŒÂŒ ‹ÂŽ  ŒÂ?   Â?Â?‘ŒŠ   Â?ÂŒÂ? Â?Â?Â? ­Â?Â’ „ ‹ÂŒÂ?‰…‹ˆ    ‹ÂŒ   Â?Â?Œ…  Â?Â?ÂŒ   Â?ÂŒ  ­Â?ÂŒÂ?

Â… €   “  Â?‚  Â? ‚  Â?  ”†† •  Â?Â? Â?  Â?   Â? Â?  Â?  Â?Â? Â?  Â?  ­Â? Â? Â?  Â? Â’ ­ †   ‚†    ‰  “       † Â?“Â?‰“   †   ƒ      •   Â?Â?ƒ  Â?Â? ƒ   ­Â? ƒ   Â? ƒ  Â? ”   –

ÂŁ       Â?Â? ¤   Â? ¤  Â?Â? €  ­Â? € 

 „ ”    – ”  ‡   ™Â?     Â?Â?†    •  Â?Â? Â?  Â?   Â? Â?  Â?  Â?Â? Â?  Â?  ­Â? Â? Â?  Â?   š †     † ­    ™Â?   ›Â? 

 ÂŽ   •  Â?Â?   Â?Â? Â?    Â?   ­Â?Â… 

 Â?  †    ‡   Â?Â? Âœ    Â?    Â?Â? ­   ­Â?     Â?‡  ††     Â?ž


Â&#x;ÂĄ  Â?Â? Âœ     Â? Âœ  Â?Â? ”   ­Â? ¢   

Â&#x;ÂĄ   Â?Â?   Â?Â? ”   Â? € ­Â? š

Â… ”       † †   †  ÂĽ  †   Â?Â?     Â? ‹  Â?Â?    ­Â?† Â’        ††                †    Â?Â?   Â?Â?    Â?   ­Â? Â? ÂŚ           ‡               Â?Â?    Â?Â?     Â?‡ ­Â? Š ÂŚ ‘   † †      ÂŚ  ‚   ‚    ‚    Â?      Â?Â?       Â?   Â?Â? ‚‘‚    ­Â?  

  ­    ‘ †     ‡ †  †    †      Â?Â?  Â?Â?    Â?ÂĽ ÂĽ ­Â?  

     Âœ†† †‡  § ¨‡ ‡    †  †¢    †      Š§ › žª  Š ƒ­ ÂŞ† Š€ §ÂŞ ÂĽ ƒ­ €   Š­ÂŤ†ÂŞ€ §   ÂŞ € ‡  Â?†        ¢ ‡    € ‡ ÂŽ‹  Â?     ŠŽÂŞ Š †   †    ¢ Â?‡  †   ‡ ƒ­   Š¢ ÂŞ   †   Š›   ÂŞ  ÂĽ  € ‡   ¢‡   ›     ‡‘ Š¢›Âރ­   †¢  ÂœÂŞ  §  ž  Â?Â?¢   Â?¢   Â?Â?¢  ­Â?¢‹‡  ¢‹‡•  Â?Â?†   Â?‡  Â?Â?   ­Â?    §  †ž  Â?Â?›  §   Â?›   Â?Â?› †§  ­Â?›ÂĽ §

  §  †ž  Â?Â?          Â?     Â?Â?    ­Â?  ‡ÂĽ  ƒ­  „ § ‡  ‹ž  Â?Â? ƒ†‡† †   Â? §† ‡†  Â?Â? §ÂĽ  ‡†  ­Â? ” † 

  Â?‚ ¨   ¨     Âœ› †      †        ‚ÂŽ     † †›−      Â? › ‚‚  †   † ÂŚ  †            Â?Â? Â?           Â? ‚‚    †    Â? ¨   ¨   Âœ ‚  ‚ Â?     Â?Â? ÂŚ†  † ‚›        ­Â? Â?    ‚    †     Â? ‚†

Â… ÂŚ †   †  †    Â?Â? ÂŚ      ¢›   Â? Â?†‚  Â?Â? Â?         ­Â? ”‚††   ‚ Â’ ÂŚ† † †  ††   ÂŚ†    † ‘ † †

Â? ÂŚ  ‚   ‚   Â?Â? Â?  Â?  ‚     Â? Â?   Â?­  Â?Â? ¨ † ‚         ­Â? Â?      ‡    

ÂŁ     Â?Â?†”¢”  † ƒ„   Â? ‚       Â?Â?      † ”¢”   ­Â?  ”¢”  


€ ‚ − €  Ă— 

˜ € 


− ’


˜ ‰ ’




˜ = „˜ ’

Â?         −      ‘  ‚ † ‚ †    

  ÂŻ              ÂŻ € ‚††      ÂŻ € ‚††         Â? Â&#x;    ÂĄ    ‚‚ Â? †   †      € “ ÂŻÂœ  ‚    Â? ÂŻÂœ  ‚ ÂŻÂœ†    ÂŻÂœ  ÂŻÂœ   €     ‰ ‰‚† °  ‰ °‚ ‰ „‰   €   † †    † †  †  “ ”      Â?      Âœ  


Â?”‰ BP Ă— CP ‰ 9 Ă— 16 ‰  ‰  ABC ‰

„  ⋅  ⋅ „   

‰„   Š ”† ”  ¢”  ”¢”Â?      †ƒ„”†     ”†”¢”    †“ ÂŁ¢ ”ÂŁÂ?  ¢  ÂŚ†  

Â?  ”   ‚ 








 ¢‚‰ −  ‰



ÂŚ           Â?Â?   Â? Â?Â? ­Â? 

  �  “ ‰ ‰� ‰  ™‰   ‰  �    ‰Š…   ‰ Š…


=  

+ Â…   Ă— Â? −  Ă— 







�¨ ≅”ƒŽ ∠�¨  = ∠”ƒŽ ∠ �¨ = ∠Ž”ƒ ∠� ¨ = ∠”Žƒ

Â? Â? ƒ           †      Â?   ‚   ‚     ÂŁ §‰ÂŽ‹™ ‰ „ Â?‹ ‡Â?‰Â… ‚ ­ € Â?             †   †  

‰Š…Œ ‰…Š… 


 ¤ ‚      ‚ 


     ‰  † ‰  ‚ † †   ‰     ‚†† 

Â?  ”     †    †  ”  ‚ Â?  ”  “              Â?  €‘ †   “     Â? ‚ 


  ­†  „    Â?     ¢ ‰Â?

 Â? ÂŚ †    ††   Âœ€Â?°¤ ‰°Š



 ‰‘‘„‘ ‘’‘…‘‘�‘Š

  € †  ‘„‘‘ ‘

 € Â&#x; ‡        œ”Â? ‚ 

Â? € ­ †    †   ÂŻ   ÂŻ ÂŚ  ‚  ‚   

Â?  Â?     ††       

Â? Â?       ‘„‘ ‘‘† ‘  ‘‘‚ ‘


   €    † † †     †

­ € ¹    †    




WASPADA Sabtu 5 Februari 2011


Indonesia Tidak Terkena Dampak Efek Domino Mesir JAKARTA (Waspada): Wakil Ketua DPR RI Priyo Budi Santoso memprediksi masa kepemimpinan Presiden Mesir Hosni Mubarak tidak akan lama lagi menyusul berlangsungnya terus gejolak unjuk rasa rakyat mesir menentang presidennya. Meskipun semakin memanasnya gelombang unjuk rasa di Mesir, namun menurut Priyo kepada wartawan di Jakarta Jumat (4/2), gejolak di politik di Mesir, tidak masuk dalam substansi pembicaraan Dewan. “Hemat saya apa yang terjadi di Mesir sudah bisa diprediksi beberapa waktu lalu. Itu adalah efek domino Tunisia. Faktor yang memicu sebagian kalangan termasuk Ikhwanul Muslimin yang dibungkam, melonjaknya harga-harga barang kebutuhan. Saya berpandangan

supaya pemerintah melakukan evakuasiWNI. Saya tidak se-pendapat kita bangsa Indonesia ikut-ikutan nimbrung seperti Amerika Serikat. Kita tidak perlu ikut campur dengan membawa pengaruh, untuk mengubah situasi. Biarkan rakyat Mesir menentukan nasibnya. Meskipun saya prediksi, masa kepemimpinan Hosni Mubarak tidak akan lama lagi,� ungkap Priyo. Wakil Ketua DPR RI itu mengatakan lagi, dikaitkan dengan Indonesia, apakah efek domino itu terjadi? Memang ada analisa yang mengatakan ini perbuatan zionis Israel. “Apakah kemudian merembet ke Indonesia. Harapan saya tidak. Di Indonesia ada faktor-faktor yang lain, di sini tidak dan belum ada politik dinasti. Kita memang terimbas dengan kenaikan harga-harga. Tapi saya berharap tidak akan terjadi efek

Dokter Diminta Ikut Pikirkan Kondisi Masyarakat JAKARTA (Waspada): Komisi IX DPR RI meminta kalangan profesional di bidang kedokteran mempertimbangkan kondisi masyarakat Indonesia yang saat ini sangat membutuhkan pelayanan kesehatan. Kalangan profesional di bidang kedokteran diminta mempersiapkan anak didiknya agar dikemudian hari dapat menjadi dokter yang dapat mengabdikan diri di masyarakat. “Mohon dipertimbangkan situasi bangsa, saat ini masyarakat kita sangat membutuhkan pelayanan kesehatan. Ini yang menjadi concern kami�, ujar anggota Komisi IX dari F-PDIP Caroline Margaret di sela-sela rapat dengar pendapat Panitia Kerja (Panja) Uji Kompetensi Dokter Indonesia (UKDI) dengan Sekretaris Dirjen Pendidikan Tinggi Kementerian Pendidikan Nasional, Persatuan Dekan Fakultas Kedokteran Swasta, Dekan Fakultas Kedokteran UI dan Perhimpunan Dokter

Umum Indonesia di Gedung DPR, Jakarta, Selasa (1/2) Dengan tidak adanya dokter wajib PTT yang diatur melalui Inpres seperti dulu, menurut Caroline, saat ini banyak dokter yang tidak mau lagi bertugas di daerah bahkan di Puskesmas sebuah provinsi di pulau Jawa. Padahal Puskesmas merupakan ujung tombak pelayanan kesehatan terhadap masyarakat, katanya. Caroline mengingatkan bahwa Panja UKDI dibentuk karena keprihatinan Komisi IX DPR terhadap distribusi dokter Indonesia yang sampai saat ini belum ditemukan solusinya sehingga distribusi dokter di seluruh Indonesia tidak merata, kedua produksi dokter Indonesia belum mampu untuk memenuhi kebutuhan pelayanan kesehatan sehingga masyarakat tidak mendapatkan pelayanan kesehatan, dan beberapa masukan terkait dengan pelaksanaan UKDI. (aya)

domino seperti yang dialami oleh Mesir,� ujarnya. Koin SBY Menanggapi pernyataan Kadiv Humas Polri, Anton Bahrul Alam akan memeriksa sejumlah anggota DPR RI yang menggagas pengumpulan Koin SBY, Priyo mengatakan langkah itu terlalu berlebihan. “Saya sejujurnya tidak sreg yang apa yang dilakukan sebagian anggota DPR. Kalau ada upaya ingin mengkriminalkan mereka, itu berlebihan. Aksi itu merupakan pernikpernik demokrasi,� tukasnya. Priyo mengingatkan Bahrul Alam, posisi anggota DPR RI mempunyai hak imunitas dalam kegiatannya baik pernyataannya maupun yang dilakukan sebagai anggota Dewan.

Hak itu dijamin oleh UndangUndang (UU). Kalaupun nanti Polri terlalu pro aktif memeriksa mereka (penggagas pengumpulan Koin SBY), saya minta Polri, anggota Dewan tidak boleh dituntut karena pernyataannya. Anggota Dewan mempunyai imunitas. Menanggapi alasan pemeriksaan itu karena Presiden lambang negara, malah Priyo menyarankan supaya hal-hal semacam itu dibicarakan dulu dengan seniornya dan jangan terlalu bersemangat mengusut semacam itu. “Kalau ini dikriminalkan ini akan menjadi hal yang heboh. Lebih baik kita sudahi saja. Termasuk jangan berlebihan menyatakan presiden simbol negara,� ucapnya. (j07)

SBY Minta Kompolnas Dapat Memeriksa Polisi JAKARTA (Waspada): Pemerintah berencana memperkuat kewenangan pengawasan Komisi Kepolisian Nasional (Kompolnas). Salah satu bentuknya, Kompolnas akan diberi wewenang pemeriksaan internal di kepolisian. Selama ini, pemeriksaan internal di tubuh kepolisian dipimpin Inspektur Pengawasan Umum Mabes Polri. Hal ini diungkapkan Menteri Hukum dan HAM Patrialis Akbar usai Rapat Terbatas tentang Komisi Kepolisian Nasional dan Komisi Kejaksaan di Kantor Presiden, Jumat (4/2). “Dalam melakukan kerjanya, Kompolnas diberikan kewenangan bersama-sama dengan tim pengawas kepolisian. Tapi bukan sendiri. Kalau sendiri nanti bisa kacau,� kata Patrialis. Selain itu, kata dia, supaya tidak melanggar Undang-Undang Kepolisian dan karena kepolisian juga sudah punya aturan main, pemerintah berharap ada sinergi antara Mabes Polri dengan Kompolnas terkait masalah pengawasan ini. Dalam rangka ini juga, Wakil Ketua Kompolnas nanti akan dilantik langsung oleh Presiden. Sekretariat Kompolnas juga akan dipimpin oleh seorang pejabat setingkat eselon satu. “Presiden menginginkan ada revitalisasi komisi ini agar memiliki kiprah yang efektif dan memang berguna, tidak antara ada dan tiada,� Patrialis menjelaskan. Sedangkan untuk Komisi Kejaksaan, pemerintah juga berharap agar komisi tersebut dapat melakukan pemeriksaan jaksa secara internal, dengan berkoordinasi dengan Jaksa Agung. “Kalau dapat, itu berarti di manapun pemeriksaan, dia boleh ikut bersamasama dengan internal kejaksaan,� kata menteri dari Partai Amanat Nasional ini. Revisi Peraturan Presiden mengenai Kompolnas dan Komisi Kejaksaan baru akan dirumuskan secara final minggu depan. (vvn)


EVAKUASI WNI KEDUA: Dua orang petugas mendorong Dewi (21) Mahasiswa yang kuliah di Mesir karena sakit saat mendarat di terminal haji Bandara Soekarno Hatta, Tangerang, Banten, Jumat (4/2). Sebanyak 421 orang Warga Negara Indonesia berhasil di evakuasi dari Mesir, proses evakuasi saat ini terus memprioritaskan anak-anak dan perempuan. Rombongan evakuasi yang ke dua ini di sambut oleh Wakil Presiden RI Boediono.

HMI Sumut Tolak Pembangunan Gedung Baru DPR MEDAN (Waspada): Mahasiswa termasuk Badko HMI Sumatera Utara menolak rencana pembangunan gedung DPR RI karena alasan yang disampaikan dewan dan Badan Anggaran Rumah Tangga dinilai tidak tepat bahkan terkesan mengada-ada. “Apa yang direncanakan pemerintah dan DPR RI untuk membangun gedung baru dengan nilai yang sangat menakjubkan, kami anggap sangat tidak beralasan,’’ papar unsur pengurus Badan Koordinasi Himpunan Mahasiswa Islam Sumatera Utara (Badko HMI Sumut) Ansor Harahap bersama pengurus lainnya kepada Waspada di Medan, pekan lalu. Selain alasan yang tidak tepat, kata Ansor, dinilai keputusan tersebut merupakan keputusan yang tidak bermoral.

Karena di tengah penderitaan rakyat, dewan dan pemerintah membuat kebijakan yang menghabiskan anggaran negara hanya untuk fasilitas yang ditaksir belum penting. ‘’Diyakini apa yang menjadi alasan pembangunan gedung baru DPR RI untuk meningkatkan efektivitas dan kompetensi kerja sama sekali mimpi kosong bagi rakyat,’’ tegas Ansor. Disebutkannya, menurut mahasiswa yang benar pembangunan gedung baru DPR RI hanya bertujuan meningkatkan kenyamanan bagi anggota dewan untuk menambah kemalasan kerja. Sementara, kemewahan yang ditampilkan menunjukkan ketidakberpihakan terhadap prioritas kepentingan rakyat. “Kita tidak yakin sama sekali peningkatan fasilitas akan

meningkatkan kinerja dewan, tapi malah sebaliknya, dengan fasilitas tersebut anggota dewan akan semakin malas kerja. Sementara, dalam urusan moral, kemewahan yang ditampilkan bangunan dan fasilitas gedung baru itu menunjukkan DPR tidak bermoral di mat Terselubung Badko HMI Sumut, lanjut Ansor, menduga pembangunan gedung baru mengandung unsur korupsi terselubung, berjamaah, dan massif. Hal ini ditandai dengan anggaran yang ditetapkan tersebut mengalami pembengkakan dari yang direncanakan sebelumnya. Kemudian, katanya lagi, mahasiswa melihat dengan setujunya semua fraksi menandakan ada hal yang menguntungkan semua kepentingan

partai politik atau oknum-oknum yang memainkan rencana dengan anggaran yang begitu besar. ‘’Oleh karena itu, Badko HMI Sumut menolak keras rencana pembangunangedung baru DPR RI tersebut,’’ tukas Ansor. Ditambahkannya, pembangunan gedung baru DPR RI dengan nilai Rp1,3 triliun semakin mendekati kepastian, apalagi setelah disainnya rampung sebagaimana telah ditayangkan stasiun televisi swasta, pembangunannya akan mulai awal 2011. Namun, ucap Ansor mengakhiri, sejak awal, rencana ini sudah menuai pro kontra, namun agendanya terus jalan. Kini rencana pembangunan gedung baru tersebut dipersoalkan kembali. (m34)



‡                      †            

                      ‚          Â? Â?Â? Â?Â? ­€‚   €  ƒ„Â…€   †  ‡  ˆ

      ‰   Â?  Â?Â? Â?Â?€‚    ŠÂ?Š     ‰  




 � €��  …„ � € ��… ‹ €  ‡  ‚  


… � €



�� ��€‚ ��­��‡€‚ ��†��†€‚ ‡��­��€‚ ���� €‚

 � −  …� � € ‹� + ˆ


ˆ� +  ˆ� −  � −        ‹� −    − ‹�  � − ‹ ˆ� −  ˆ� +     ‹� −     − ‹�

„Â… Š Â?Â?  Â?Â?  Â?Â?ˆ  ††Â?Â?‚‚

   Â?  ‚  

Â?   Â…„Š Â… Â?  € Â?   Â? ­Â?  Â? Â? Â?    Â?Â? Â… Â? €‚  Â?    Â?    ‹



 −  � +   � +Œ − 



 ‚  Â

 � − � + ‹� − � + � + Œ� ‹ −  � ˆ − �   +  �  + � − ‹

� →∞










�→ ∞





�  + � − ‹ − �  +  � + 



 ‹ (A) (B) (C)

•„ Š Š ‚ Š Â’        „  Š 

„  „„Š„  Š  Š         „ Š    „Â’

 sejumlah lapisan masyarakat heterogen dan kurang kritis interaksi langsung mudah tersinggung emosional tidak ada tangung jawab

 kelompok tidak teratur homogen dan kritis interaksi tidak langsung berpikir rasional

ÂŽŠ„ Â… (D)  „„Â?„„„ (E) tanggung jawab  „…Š  bersama ‘ „   „  ÂŒ “Â?—Š   Š   „

  ˜™ ˜ ™      Šƒ     „  „    „

„„    Š           „ „  Â’ ‡       „„„ Â?„„  ÂŽ— „ „       š ÂŽŠ

           ”“Ž      ˆ ˜„„ „— ƒ  „„ ™

“ Š ’„„ Š ÂŽ   „„  Â?”     




 Š     Â

    †  —

„     …„  „„Š  ŠŠ Â’ ŠŠ    Š„   „ Š

 Š Š  Â’Š Š  Š   Š Š    


­ œ    

1 2 3 € ›„„˜ ‘Š

— € ›„„ ž— ‘  € ›„„˜Š   „      „ „

„ „„  „„  Š       Š

–     „ „„ 

™’„ „„Âœ  Â’  —

 „   „Š  „—  Â’  „„…„Š


  ™  —  Â’  ——„  Â’„„ „“„„„ …„—„„ Â’„ƒ…„ —„¢„„„   „ ™ƒ„—„ Â’Â’ „„    Â…Â…Â’…„—„„ Âœ  „ƒ Â’„ „ „—„„Â…ƒ„ —Š „ „ ÂĄ ™  Š Â?„…—„—„Â’Â’Â…   Âœ „ Š „Š „Š Âœ  Â’„ ™Š Â’Â’   ÂŒ „„ ƒ Â’ Â’  Â’’„Š Â’Âœ š„ ƒ„„„ Âœ—„„Âœ„    Â’„ ™Š Â’   Â’„  „ …„ ÂœŠ„ ‡ Â’ —„ƒÂ’„—Š „„œ‰Š„…Â…™…„ƒ ÂœŠ—„ Â’„ Â’Â’Âœ  Â… „ Š     Â’„„„… Â’Âœ„„’„Š „—„Âœ„Ž„„Šƒ —Š„„——„ „ † Âœ  „…Â… Âœ  „ —„ ƒ —„ Âœ  „ Â’„ „¤„—Âœƒ„„ Â’Â’„„Âœ

Â&#x;Â’„……„„—Š „Â?ÂĄ  “ŠÂœ

™…„Š„  „¢Â’Â’„„—„ Âœ Â’  „¢ „„Â’„… Â’  „¢ Âœ Âœ Â’ …„ — Š„¢„„…  

   ‹  š—„ —ƒÂ’ —› ÂŁÂ? › ÂŁÂ?‹ƒ„Š Â’  …„„„„—ƒÂŽŠ­ƒ„—„…… ÂŽŠ†™Â’—› ÂŁÂ?  › ÂŁÂ?ˆ— „ÂŽŠ• Â’— „ÂŽŠ‹ ­   

ˆ Œ

 � →

‘ €Â… €™ „  €Ž„  › Š „  „ Š ˆ ƒ„    „ 


™„Â’„  „Â’

 —  Â’Â’   Â’   Š„…Â’ Â&#x;—Â’—›  ÂŁÂ? › ÂŁÂ?ˆ ÂĄ  ÂŽŠ­  ÂŽŠ‹

ŽŠ†  ŽŠ­  ŽŠ

Â&#x;   „Âœ Â’ „…     Â’„ …„ —„ÂĄ  ¤  Â’„     „… Â’Âœ    „„’„Š

›   Â’„ —„Â’„œ ‰Š„…Â…     —„ —„    Â’„„Â’ ’„ŠÂ’Âœ   —„ —„ „ „   Â’„     „…Â…  —„—„ Â’„   „  Â’  Â’  Â? Â&#x;     Š ÂœŠ„ „ „œ‰Š„…Â…ÂĄ  ¤ Â’„

Âœ Â’„  Â’Â’„„   ¤„„   „ŠÂ’„ Ϊƒ „— „ Â’Â’ „„ Â…Â…Â’ Â? …„—„„ § 

Â&#x; „     —„ ÂĄ Â?  „    „

   ¨Â’Š   Âœ„ Â&#x;Š „ „ „   Â?  Â’„„…„ —„ÂĄ

Â’  Â’„œ‰Š„…Â…

Â’„„„ „„   „…„„ Â’ Â…Â…  Š    Â’„ ŠÂ’ Â’Â’   ¢„…Â’Âœ „„’„Š

Â&#x;  Š Â’    ÂˆÂĄ  „„ —„Âœ „ Â’„

„     ‚ ™ŠÂ’Â’    —„ „¢Âœ „„ ƒ Â’Â’     „     Â’  ’„Š  Â’„ Â’Âœ  ÂĽ’„ ƒ ™  —„ ŠŠŠŠ ­ …„    …„„  Â’„  „ …„

   „ ÂœŠ„  „„…„  ÂĽ…„ƒ  ’„    Â’„ „ „ —„„Â…                            ™’„ „   Â’„   —Š „ „— —„ƒ       …„ „„  ÂŁ‡  ÂŞ‡­ ­ ÂŁÂŞ„



    „Š „ Âœ   


      Š   Š

¨„„„ÂŁ€‚Â?€     ˆ „„ÂŤ„ 

    ÂŹ Š— „œ „    ÂŽ    

˜Š—„ ÂŽ 

“Š— „œ „„   Â?      ¨¤ˆ “šˆ€   = ˆ „   

Â?           Š „„ŠŠ 



› Š „  „


    — Š „„ Š Â? „    —„

€  ÂŻƒˆ€ƒ


Š¨°ÂŽ°”°š   ‘„„  


    ÂŽ     Š Â? „Â?„    

 —Š  „ „ƒ ƒƒ Â?

 ƒ¤ÂŁ ­ƒ Â?‡ƒ 

 ƒ¤– ‹ƒˆÂ?­ƒ     ‚¹ÂŽ€‹Âą‚ƒ ÂŽ€‚ƒ‚Œ‹     

¤ŠÂ’   ƒ  Â’

    ‘„      —Š „„

    “   Â’ Â’Š


     ŠƒÂ’ƒ          Š        “                Š ƒ„„  


  ¨¤ €ÂŻ ˆ €  „

       š¤  „ 

    Â?    ­ €   ‚ Â? ‚Â?      ‚Â?

       Â’    Â…    Â…Â’ Š          ­     ‘Â’            Â’ ‘ Š   Â?          Â?Â?Â?  Â?     ‘    Š Š„œ 

     — Â’ —  „„  Â’  —„„¨Š„Š “      ¤   “      ‘  Š    „        „ Â’ƒŠ  Š    Â?     ‘  Š  Â…  Â? Â? Â…Â?     ‘  Š  Š  Â…     Â?

  �  �    

“„„ Š  Š   ²  ÂĽ   ‘  ˜„²¼² → 

‘² →  “²€

ŠŠ „    Â?  Â?               Â?


Luar Negeri

WASPADA Sabtu 5 Februari 2011

Tentara Thai Dan Kamboja Baku Tembak, Dua Tewas

Tunisia Ganti 24 Gubernur TUNIS, Tunisia (Antara/Reuters): Tunisia telah mengganti semua 24 gubernur, sebagai bagian dari upaya untuk membongkar warisan presiden terguling Zine El Abidine Ben Ali, kantor berita negara itu melaporkan Kamis (3/2). Demonstrasi-demonstrasi besar di jalanan telah berhenti di Tunisia dalam beberapa hari belakangan, setelah perombakan untuk membersihkan pemerintah sementara dari sebagian besar pendukung Ben Ali. Tapi banyak warga Tunisia minta agar lebih banyak lagi pejabat diganti pada tataran keamanan dan daerah. Kementerian dalam negeri telah mengganti banyak pejabat senior keamanan pekan ini, langkah pertama untuk memeriksa secara seksama kepolisian, pasukan keamanan dan mata-mata yang dibangun oleh Ben Ali dalam 23 tahun pemerintahan polisinya.

BANGKOK, Thailand (Antara/Reuters): Pasukan Thailand dan Kamboja terlibat baku tembak di satu daerah perbatasan kedua negara yang disengketakan, kata seorang perwira militer Thailand, Jumat (4/2). Polisi Kamboja mengatakan dua tentara Kamboja tewas dan dua lainnya cedera. Kedua pihak saling tuduh menyangkut tentang siapa yang terlebih dulu menembak di daerah yang dijaga ketat militer dekat kuil Preah Vihear. Kuil yang berusia 900 tahun itu diklaim oleh dua negara Asia tenggara itu dan pada tahun lalu terjadi pertempuran. Penembakan itu dimulai sekitar pukul 15:00 waktu setempat (15:00WIB) dan berlanjut sampai satu jam kemudian,kata para pejabat militer dan saksimata. “Ada pertempuran sporadis tetapi saat ini belam ada informasi yang terinci,” kata seorang perwira angkatan darat Thailand. Seorang komandan daerah militer Thailand di daerah itu, Letjen Thawatchai Samutsakorn, mengatakan tidak ada tentara Thailand yang cedera sejauh ini. Kuil yang dikenal sebagai Preah Vihear di Kamboj dan Khao Phra Viharn di Thailand terletak di satu lokasi lereng gunung yang merupakan perbatasan alam dan telah menjadi sumber ketegangan selama beberapa generasi. Pengadilan Internasional (ICJ) tahun 1962 memutuskan kuil itu milik Kamboja tetapi tidak menetapkan kepemilikan tanah seluas 1,8 km dekat reruntuhan kuil itu, yang menyebabkan menjadi sumber sengketa kedua negara.

Facebooker Maroko Serukan Demonstrasi 20 Februari RABAT, Maroko (Antara/AFP): Satu kelompok pemuda Maroko menyerukan demonstrasi pro-pembaruan akhir bulan ini melalui Facebook, sebagai contoh terakhir dari demonstrasi antipemerintah yang digerakkan oleh Internet di dunia Arab. “Kami mengundang semua warga Maroko untuk berunjuk rasa pada 20 Februari bagi martabat rakyat dan bagi pembaruan demokratis,” kata kelompok itu, yang mengklaim memiliki sekitar 3.400 pengikut, dalam satu pernyataan Kamis (3/2). Tuntutan mereka termasuk perbaikan konstitusi Maroko bersama dengan pembubaran pemerintah dan parlemen. “Kami merasakan ini dengan ketenangan yang sangat besar,” jurubicara pemerintah dan Menteri Komunikasi Khalid Naciri mengatakan pada konferensi pers. “Maroko ... telah mengajak untuk waktu lama dalam proses demokrasi dan keterbukaan yang tak dapat diubah,” katanya menambahkan. Internet memainkan peran besar dalam gerakan-gerakan anti-pemerintah yang tumbuh menjadi revolusi besar di Tunisia dan Mesir. Sementara Maroko belum tersentuh oleh protes kekerasan yang sama, negara itu menyaksikan dengan dekat negara rekannya di Afrika Utara tersebut, dengan peringatan bahkan dari dalam keluarga kerajaan bahwa protes itu mungkin tak akan terhindarkan.

Polisi Malaysia Gunakan Meriam Air Untuk Bubarkan Protes Mesir KUALA LUMPUR, Malaysia (AP): Kepolisian Malaysia menembakkan meriam air terhadap para pemrotes di Kuala Lumpur yang menyerukan agar Presiden Hosni Mubarak mengundurkan diri. Lebih dari 1.000 orang melakukan aksi protes di luar Kedubes AS di negara yang mayoritas berpenduduk Muslim itu di Kuala Lumpur, Jumat (4/2). Mereka menyerukan AS agar menekan Mubarak untuk segera mengundurkan diri dan mencegah kekerasan lebih jauh dalam aksi protes yang marak di Mesir. Sebagian besar demonstran meninggalkan tempat itu dalam waktu satu jam, namun polisi menembakkan meriam air untuk memaksa sisa demonstran bubar. Beberapa orang juga ditangkap. Polisi Malaysia biasanya membubarkan aksi protes yang ilegal. Para pemrotes, temasuk dari kelompok oposisi partai Islam Malaysia, membawa poster yang bertulisan ‘Penindasan 30 Tahun’ dan ‘Kebebasan Mesir’ dan meneriakkan ‘Turunlah, turunlah Mubarak.’ (m10)

22.000 Warga Pakistan Hindari Perang Di Perbatasan Afghanistan KHAR, Pakistan (AP): Kira-kira 22.000 warga desa Pakistan melarikan diri guna menghindari operasi militer terhadap militan Islam di satu kawasan kesukuan dekat perbatasan Afghanistan, demikian menurut seorang pejabat pemerintah dan tentara Jumat (4/2). Serangan itu melibatkan pengeboman udara, serangan artileri darat, yang dimulai 27 Januari di Mohmand, kata Roshan Khan Mehsud, wakil pemerintah rejional. Dia mengatakan sejauh ini hampir 100 orang tewas dan ada sejumlah korban lainnya di pihak tentara. Dia tidak menjelaskan tentang adanya korban sipil. Militer Pakistan telah melakukan serangkaian operasi di kawasan terpencil kesukuan yang berbatasan dengan Afghanistan selama tiga tahun terakhir. Militer menyatakan telah melakukan tindakan yang amat menentukan terhadap para pemberontak, ratusan ribu penduduk belum kembali. Banyak korban di kalangan sipil yang jatuh dalam serangan militan terhadap pasukan Pakistan. Laporan independen di Mohmand dan kawasan perbatasan lainnya tidak mungkin karena dilarang tentara dan daerah itu amat berbahaya. Mehsud mengatakan kira-kira 22.000 orang telah kehilangan tempat tinggal akibat operasi Mohmand. Mereka kini tinggal di satu gedung pemerintah, sekolah dan tiga kemp yang terletak jauh dari peperangan. Pemerintah menyediakan makanan, air dan bantuan pengobatan bagi warga tersebut. Jurubicara militer Mayjend. Athar Abbas membenarkan adanya operasi militer di Mohmand. (m10)

Ledakan Di Ankara, 17 Orang Tewas ANKARA, Turki (AP): Para petugas pertolongan mengatakan mereka telah menemukan lima lagi mayat di dua lokasi ledakan terpisah di satu distrik industri di Ankara, ibukota Turki, sehingga meningkatkan angka korban ledakan jadi 17 jiwa. Pihak berwenang mengatakan Jumat (4/2) mereka melakukan penyelidikan atas sebab-sebab ledakan yang telah mengguncang kawasan yang sama di Ankara hanya selisih waktu beberapa jam satu sama lainnya Kamis. Ada kemungkinan satu tangki oksigen yang tidak berfungsi merupakan penyebab ledakan pertama yang mengakibatkan ambruknya sebagian gedung bertingkat dua di satu fabrik. Para petugas pertolongan berhasil mengeluarkan satu mayat lainnya dari reruntuhan gedung, sehingga meningkatkan angka kematian menjadi tujuh. Ledakan kedua memicu satu kebakaran besar yang menghanguskan beberapa bengkel dan kobaran api marak sepanjang malam. Empat lagi mayat ditemukan di lokasi itu sehingga mningkatkan jumlah korban tewas menjadi 10. (m10)


TUNTUT MUBARAK MUNDUR DI MALAYSIA. Para pemrotes berpawai dalam satu rapat umum yang menuntut pengunduran diri Presiden Mesir Hosni Mubarak di luar Kedubes AS di Kuala Lumpur, Malaysia, Jumat (4/2). Mubarak memperingatkan kekacauan akan terjadi jika dia mengundurkan diri.

Iran: Pergolakan Mesir Tanda Kesadaran Islam TEHRAN, Iran (AP): Peminpin tertinggi Iran mengatakan pergolakan yang terjadi di Mesir dan Tunisia merupakan satu pertanda ‘kesadaran Islam’ di kawasan itu. Ayatollah Ali Khamenei mengatakan pada khotbah Jumat (4/2) bahwa masyarakat nenjadi saksi dari gaung Revolusi Islam Iran 1979. Khamenei mengatakan kerusuhan “saat ini adalah apa yang selalu disebut sebagai ... kesadaran Islam yang ada hubungannya dengan Revolusi Islam yang dilakukan Iran.” Khamenei mendesak para pemrotes Mesir agar mengikuti jejak revolusi Iran yang menggulingkan seorang pemimpin pro-AS dan mengangkat keku-

atan Islam garis keras. Iran juga menyatakan keprihatinannya yang mendalam atas krisis Mesir dengan mengecam campur tangan Amerika Serikat dan Israel pada urusan dalam negeri Mesir. Dalam pernyataannya Kamis, Kementerian Luar Negeri Iran mengatakan bahwa perkembangan dan pembangunan yang penting di Timur Tengah serta Afrika Utara memiliki akar pada “kebangkitan Islam”. Pernyataan itu mengungkapkan bahwa Republik Islam

Iran sedang memantau perkembangan kawasan tersebut dan mendukung penuh tuntutan sah rakyat Mesir. “Republik Islam Iran mengharapkan seluruh rakyat dan pemerintah yang mendukung kemerdekaan di penjuru dunia untuk menghargai tuntutan sah rakyat Mesir dan mengutuk campur tangan Zionis serta AS pada urusan dalam negeri Mesir,” demikian menurut pernyataan tersebut. “Segala upaya dalam menghadapi rakyat Muslim di Mesir dan menindas hak-hak kemanusiaan dari negara besar yang peradabannya telah berlangsung lama tersebut akan dianggap sebagai kejahatan terhadap kemanusiaan dan dapat menye-

babkan kemarahan serta kebencian yang mengerikan dari seluruh negara Muslim dunia,” demikian pernyataan Kemlu Iran sebagai tanggapan atas campur tangan AS dan Zionis dalam konflik Mesir. Tembakan dan kekerasan dalam melawan para pengunjuk rasa di Mesir mengakibatkan enam orang tewas selama satu malam pada Rabu hingga Kamis dini hari. Setidaknya 150 orang tewas akibat serangan polisi Mesir saat unjuk rasa selama sepuluh hari. Selain itu Ketua Badan Hak Asasi Manusia Perserikatan BangsaBangsa (PBB), Navi Pillay mengatakan bahwa sejauh ini lebih dari 300 orang diperkirakan tewas. (m10)

Perundingan Kelompok Islam Dengan Raja Jordania Positif AMMAN, Jordania (Antara/ AFP): Raja Jordania Abdullah II mengatakan dalam sebuah pertemuan dengan pemimpin kelompok Islam bahwa reformasi telah ‘melambat dan terpuruk’ dan berjanji untuk mengambil ‘langkah serous’ bagi perubahan,menurutpihakistana. “Upaya reformasi di Jordania telah melambat dan terpuruk, yang merugikan negara banyak kesempatan untuk mencapai kemajuan,” menurut sebuah pernyataan yang mengutip kata-kata Raja terhadap pemimpin kelompok persaudaraan Islam dan lengan politiknya

Dront Aksi Islam (IAF). “Visi saya untuk reformasi menyeluruh dan modernisasi harus diterjemahkan menjadi langkah-langkah praktis dan serius yang berfokus pada semua kepentingan rakyat dan negara Jordania.” Raja mengatakan dia melihat kesempatan “yang sesungguhnya untuk reformasi yang komprehensif, yang harus diwujudkan dalam sebuah pendekatan yang konstan di Jordania untuk masa depan yang lebih baik, “kata pernyataan itu. Para Islamis, yang mendorong reformasi lebih di bidang

politik dan ekonomi, menyebut pertemuan itu “positif.” “Pertemuan kami dengan raja bersifat positif, tapi saya tidak ingin memberikan rincian sekarang sebelum partai - partai bertemuuntukmengevaluasisituasi,” kata Zaki Bani Rasheid, seorang anggota Dewan Eksekutif IAF. “Partai akan mengeluarkan pernyataan kemudian,” katanya, tapi tidak menjelaskan lebih lanjut. Seorang pejabat Jordania mengatakan Senin bahwa raja berencana untuk bertemu IAF sebagai bagian dari usahanya untuk mengatasi keluhan atas Jordania di tengah ketidakpua-

san umum. Sementara itu, Menteri Luar Negeri AS Hillary Clinton, Kamis, menawarkan dukungan untuk Jordania di “masa sulit” dan mengatakan dia memandang ke depan untuk bekerja sama dengan pemerintah baru ketika dia berbicara kepada raja, menurut jurubicaranya. Clinton yang berbicara selama 15 menit melalui telefon menekankan “pentingnya menempatkan kelanjutkan hubungan baik dengan Jordania. Kami sangat ingin untuk terus mendukung Jordania di masamasa sulit, “kata Philip Crowley.

Malawi Perdebatkan Larangan ‘Buang Angin’ Di Depan Publik Blantyre, Malawi (Antara/ AFP): Anggota parlemen Malawi pekan depan akan memperdebatkan hukum untuk melarang ‘uang angin’di depan publik, yang seorang menteri katakan hal itu didorong oleh demokrasi. “Pemerintah memiliki hak untuk memastikan kelayakan publik. Kami berhak untuk memperkenalkan keteraturan di negeri ini,” kata Menteri Kehakiman dan Urusan Konstitusional George Chaponda kepada stasiun radio independen Capital Radio. “Apa Anda ingin melihat orang buang angin di depan publik di mana pun?” tanya Chaponda.

Sejak negara itu memberlakukan multipartai politik 16 tahun lalu, warga merasa bebas buang angin di mana saja, kata Chaponda. “Hal itu tidak terjadi saat di bawah kekuasaan diktator karena rakyat takut menghadapi akibatnya. Sekarang karena multipartai atau kebebasan, rakyat nyaman buang angin seenaknya,” katanya. Chaponda, seorang tokoh kunci dalam pemerintah Presiden Bingu wa Mutharika, mengatakan bila warga Malawi tidak dapat mengendalikan kebiasaannya “mereka harus pergi ke toilet daripada buang angin di publik.”

“Kebiasaan dapat dikendalikan... akan menjengkelkan bila rakyat buang angin di mana saja,” tambahnya. Chaponda, seorang pengacara, mengatakan di bawah hukum yang diamandemenkan buang angin akan dianggap sebagai pelanggaran ringan. Partai Demokratik Progresif asal Chaponda akan menggunakan kekuatan mayoritasnya untuk meloloskan amandemen tersebut agar menjadi peraturan yang pertama kali diperkenalkan pada 1929. Amandemen tersebut, yang akan membuat buang angin di depan publik sebagai pelanggaran, belum diumum-

kan dan akan diajukan ke parlemen untuk diperdebatkan sebagai bagian dari uji materi oleh Komisi Hukum Pidana yang didanai oleh negara. Belum ada di Malawi yang telah ditahan atau didakwa karena ‘kentut’ berdasarkan hukum tua itu, karena polisi tidak pernah melaksanakannya. Dalam peraturan lama menyatakan: “Setiap orang yang secara sengaja merusak atmosfer di mana pun sebagaimana merugikan kesehatan orang pada umumnya yang melakukan atau melaksanakan sesuatu di masyarakat atau melewati ranah publik, akan dianggap bersalah atas kelakuan buruk.”

Israel Batasi Akses Ke Masjid Al-Aqsa JERUSALEM (Antara/AFP): Akses ke Masjid Al-Aqsa, yang terletak di daerah panas Jerusalem, dibatasi Jumat (4/2) untuk mencegah unjukrasa mendukung perlawanan di Mesir setelah shalat Jumat, kata polisi. “Pada Jumat ini, kami melarang lelaki berusia di bawah 50 tahun pembawa tanda pengenal Israel masuk masjid itu,” kata jurubicara polisi Micky Rosenfeld. Perintah itu berlaku bagi warga Israel keturunan Arab atau warga Palestina, yang tinggal di wilayah terjajah Jerusalem Timur, katanya. Seluruh warga Palestina dari Tepi Barat terjajah dilarang, meski mereka memiliki dokumen Israel. Hanya 6.000 orang, yang dapat shalat Jumat pada pekan ini, karena pelarangan tersebut,” kata badan waqaf Islami. Rosenfeld mengatakan, polisi berjaga di dinding Kota Tua, mengkhawatirkan unjukrasa beringas setelah shalat Jumat sebagai bentuk kesetiakawanan dengan pergolakan rakyat di Mesir. Tetapi, kejadian sporadis dilaporkan hanya terjadi di wilayah Ras Al-Amoud, di mana orang muda melempar batu ke polisi, yang dibalas dengan gas air mata. Daerah masjid itu, selain berisi bangunan Al-Aqsa, juga terdapat kubah Shakhrah dan merupakan tempat tersuci ketiga dalam Islam setelah Masjidil Haram dan mesjid Nabawi.

Myanmar Memilih PM Sebagai Presiden Baru YANGON, Myanmar (AP): Parlemen Myanmar menunjuk perdana menteri dari pemerintahan militer yang lalu sebagai presiden baru Jumat (4/2), mendudukkan seorang anggota pemerintahan junta ke jabatan paling atas di pemerintahan paska pemilihan. “Ini tidak mengejutkan. Itu lah yang sudah kami perkirakan,” kata ikon demokrasi Aung San Suu Kyi kepada para wartawan. Partai Suu Kyi memenangkan pemilihan sebelumnya tahun 1990 namun mereka dicegah dari kekuasaan oleh militer. Partai itu memboikot pemungutan suara November, yang katanya tidak jujur. PM Thein Sein, seorang jenderal yang pensiun dari tentara April tahun lalu, dianggap sebagai calon unggulan di antara tiga calon yang dipilih oleh tentara dan anggota parlemen pekan ini. “Sesi ini telah dimulai dan semua anggota akan memilih presiden. Hasilnya harus selesai sore ini,” kata seorang pejabat Myanmar. Seorang sekutu utama orang kuat junta Than Shwe, Thein Sein dipersiapkan untuk mengisi jabatan itu bahkan sebelum pemungutan suara dan meningkatkan kekhawatiran bahwa rezim telah menyelenggarakan sebuah pemilihan umum terencana untuk menyembunyikan pengaruh militer dibalik pemerintahan sipil. Salah satu tugas pertama presiden adalah menunjuk pemerintah, dan ia dapat cukup percaya diri dengan adanya sedikit perlawanan dari anggota parlemen yang didominasi oleh militer dan kroni-kroninya, menurut pengamat. Ketiga calon presiden yang dinominasikan adalah anggota dari Uni Solidaritas dan Partai Pembangunan, yang merupakan sekutu militer Myanmar, yang telah memerintah negara itu sejak tahun 1962, dan tampaknya akan terus berlanjut dominasinya. Dua calon wakil presiden lainnya adalah Tin Aung Myint Oo, seorang pensiunan jenderal papan atas dan sekutu Than Shwe, dan etnis Shan, Mouk Sai Kham. Than Shwe, yang memerintah dengan tangan besi sejak 1992, tidak berada di antara mereka yang diajukan untuk jabatan politik tertinggi di Myanmar, juga dikenal sebagai Burma. (m10)

Kantor Cabang Al-Jazeera Di Kairo Diserang DOHA, Qatar (Antara/AFP): Al-Jazeera, saluran televisi satelit Arab yang sejak akhir pekan lalu dilarang beroperasi di Mesir, mengatakan Jumat (4/2) kantor cabangnya di Kairo telah diserang. “Beberapa orang tidak dikenal datang ke kantor biro AlJazeera di Kairo dan merusak peralatan di dalam,” kata pernyataan stasiun televisi yang bermarkas di Doha itu, tanpa memberi rincian. Minggu lalu, kementerian informasi Mesir memerintahkan Al-Jazeera — yang memberikan peliputan mendalam akan unjuk rasa yang terjadi di Kairo — untuk berhenti beroperasi di Mesir, dan mencabut tanda pengenal pers wartawannya. Serangan kepada media asing di Kairo, termasuk penahanan dan serangan kekerasan, telah menguat pada pekan ini dengan Presiden Hosni Mubarak menolak permintaan pengunjuk rasa untuk segera mengundurkan diri setelah 30 tahun berkuasa.


WASPADA Sabtu 5 Februari 2011

Klasemen Liga Premier Man United Arsenal Man City Chelsea Tottenham Sunderland Liverpool Bolton Blackburn Newcastle Stoke Fulham Blackpool Aston Villa Everton West Brom Birmingham West Ham Wigan Wolves

24 15 9 0 24 15 4 5 25 13 7 5 24 13 5 6 24 11 8 5 25 9 10 6 25 10 5 10 25 8 9 8 25 9 4 12 24 8 6 10 24 9 3 12 25 6 11 8 24 8 4 12 25 7 7 11 24 5 12 7 24 7 5 12 23 4 12 7 25 5 9 11 25 4 11 10 24 6 3 15

54-22 50-23 39-22 46-21 33-26 30-28 33-31 35-35 31-38 36-34 28-30 26-26 35-44 28-43 28-31 31-45 23-33 27-44 22-41 24-42

54 49 46 44 41 37 35 33 31 30 30 29 28 28 27 26 24 24 23 21

Sabtu, 5 Februari (GMT) Stoke v Sunderland (1245) *Global Live pkl 19.45 WIB Aston Villa v Fulham (1500) Everton v Blackpool (1500) Man City v West Brom (1500) Tottenham v Bolton (1500) Wigan v Blackburn (1500) Newcastle v Arsenal (1500) Wolves v Man United (1730) *Global Live pkl 00.30 WIB

Minggu, 6 Februari

West Ham v Birmingham (1330) Chelsea v Liverpool (1600) *Global Live pkl 23.00 WIB

Pencetak Gol Terbanyak 19 Dimitar Berbatov (MU) 15 Carlos Tevez (Man City) 11 Andy Carroll (Newcastle)

Klasemen Liga Seri A

AC Milan 23 14 6 3 39-18 48 Napoli 23 13 4 6 36-22 43 Inter Milan 22 12 5 5 39-24 41 Lazio 23 12 5 6 29-21 41 AS Roma 22 11 6 5 32-25 39 Palermo 23 11 4 8 38-29 37 Udinese 23 11 4 8 37-30 37 Juventus 23 9 8 6 37-29 35 Cagliari 23 9 5 9 27-23 32 Chievo 23 7 9 7 25-22 30 Fiorentina 22 7 7 8 22-23 28 Sampdoria 22 6 9 7 20-23 27 Genoa 22 7 6 9 18-21 27 Bologna 22 7 8 7 24-30 26 Parma 23 6 7 10 22-29 25 Lecce 23 6 6 11 22-39 24 Catania 23 5 8 10 19-30 23 Cesena 23 5 6 12 17-29 21 Brescia 23 5 4 14 18-31 19 Bari 23 3 5 15 14-37 14 *Bologna dikurangi 3 poin karena pajak.

Sabtu, 5 Februari (GMT) Udinese v Sampdoria (1700) *Indosiar Live pkl 00.00 WIB Cagliari v Juventus (1945) *Indosiar Live pkl 02.45 WIB

Minggu, 6 Februari

Bologna v Catania (1130) Brescia v Bari (1400) Genoa v AC Milan (1400) Lazio v Chievo Verona (1400) Lecce v Palermo (1400) Napoli v Cesena (1400) Parma v Fiorentina (1400) Inter Milan v AS Roma (1945) *Indosiar Live pkl 02.45 WIB

Top Skor Liga Seri A

17 Edinson Cavani (Napoli) 15 Antonio Di Natale (Udinese) 14 Marco Di Vaio (Bologna) 13 Samuel Eto’o (Inter Milan) Zlatan Ibrahimovic (Milan)


Klasemen Liga Primera Barcelona Real Madrid Villarreal Valencia Espanyol Ath Bilbao Atl Madrid Sevilla Sociedad Getafe Mallorca S Gijon Hercules Deportivo Zaragoza Osasuna Santander Levante Almeria Malaga

21 21 21 21 21 21 21 21 21 21 21 21 21 21 21 21 21 21 21 21

19 16 14 12 12 11 9 9 9 8 8 5 6 5 5 5 5 5 3 5

1 1 3 2 3 4 5 4 1 8 2 8 3 9 3 9 1 11 3 10 3 10 7 9 4 11 7 9 7 9 6 10 6 10 3 13 8 10 2 14

67-11 48-18 41-21 34-24 28-27 34-31 31-26 33-35 32-33 29-34 23-29 22-27 22-34 18-30 20-33 20-28 16-30 22-34 20-36 28-47

58 51 45 41 37 35 30 30 28 27 27 22 22 22 22 21 21 18 17 17

Sabtu, 5 Februari (GMT) Ath Bilbao v S Gijon (1700) Getafe v Deportivo (1700) Osasuna v Mallorca (1700) Zaragoza v Santander (1700) Almeria v Espanyol (1700) *tvOne Live pkl 00.00 WIB Villarreal v Levante (1900) *tvOne Live pkl 02.00 WIB Barcelona v Atl Madrid (2100) *tvOne Live pkl 04.00 WIB

Minggu, 6 Februari

Sevilla v Malaga (1600) *tvOne Live pkl 23.00 WIB Real Madrid v Sociedad (1800) *tvOne Live pkl 01.00 WIB Valencia v Hercules (2000) *tvOne Live pkl 03.00 WIB

Klasemen Ligue 1 Lille PSG Lyon Rennes Marseille Montpellier St Etienne Bordeaux Toulouse Sochaux Brest Lorient Valencs Nancy Auxerre Caen Nice Lens Monaco Arles

21 21 21 21 21 21 21 21 21 21 21 21 21 21 21 21 21 21 21 21

11 8 2 39-21 41 10 7 4 34-23 37 9 7 5 30-23 34 9 7 5 23-17 34 8 9 4 29-18 33 9 6 6 19-21 33 8 8 5 29-23 32 7 9 5 27-23 30 9 3 9 23-22 30 8 4 9 35-26 28 7 7 7 21-20 28 8 4 9 24-27 28 6 7 8 24-24 25 7 4 10 22-32 25 4 12 5 26-25 24 6 6 9 22-29 24 5 8 8 14-22 23 5 7 9 21-34 22 3 12 6 20-21 21 1 5 15 11-42 8

Sabtu, 5 Februari (GMT) Caen v FC Lorient Montpellier v Etienne OGL Nice v Sochaux Marseille v AC Arles Lens v Valenciennes Stade Brest v Nancy Rennes v Paris SG

(1800) (1800) (1800) (1800) (1800) (1800) (2000)

Minggu, 6 Februari AJ Auxerre v Lille Toulouse v Monaco Lyon v Bordeaux

(1600) (1600) (2000)

Pencetak Gol Terbanyak 15 Mousa Sow (Lille) 13 Anderson Nene (PSG) 11 Youssef El-Arabi (Caen) 10 Kevin Gameiro (Lorient) Gervinho (Lille) 9 Brown Ideye (Sochaux) Modibo Maiga (Sochaux) (jonny/espn/uefa)

Pazzini Paling Penting Bari Vs Inter Milan 0-3 ROMA (Waspada): Inter Milan naik ke urutan tiga klasemen Liga Seri A setelah menggunduli tim terbawah Bari 3-0 di San Nicola Stadium. Sempat mengalami kebuntuan sampai 20 menit jelang bubaran, gelandang anyar Inter asal Maroko Houssine Kharja mencetak gol pertamanya untuk membuka pesta sang juara bertahan menit 70. Sesama pemain yang baru dikontrak pada hari terakhir bursa transfer Januari 2011, Giampaolo Pazzini, menit 90 menyarangkan golnya yang ketiga dalam dua laga bersama I Nerazzurri. Gol Pazzini itu menjadi yang pertama dari dua yang tercipta dalam pertambahan waktu, sebelum Wesley Sneijder menambahkan gol ketiga pasca tampil lagi usai cedera. Namun yang paling penting, tentu saja fenomena Pazzini

yang kini menjadi sangat terkenal di antara Internisti, julukan pendukung La Beneamata. “Saya gembira, saya telah mencetak tiga gol dalam dua laga, tetapi yang paling penting adalah menang,” ucap Pazzini, seperti dikutip dari TribalFootball, Jumat (4/2). “Bari menyulitkan. Kami kesulitan pada babak pertama, namun kemudian pada babak kedua kami lebih baik dan memenangi pertandingan penting,” tambah mantan striker Sampdoria itu. Dengan hasil 0-0 AC Milan saat menjamu Lazio dan Napoli ditekuk Chievo 0-2, berarti kans Inter makin besar untuk memperpendek jarak sekaligus menapak naik ke papan atas kla-

semen. Syaratnya menurut Pazzini, Biru Hitam mesti terus mendulang kemenangan. “Kami harus terus seperti ini, yang paling penting mempertahankan keinginan kami untuk menang,” pinta Pazzini. Ternoda Chivu Alenatorre Inter Leonardo de Araujo mengawali pola permainannya dengan tiga penyerang di markas Bari, Kamis (Jumat WIB). Pazzini membentuk formasi trisula bersama Diego Milito dan Samuel Eto’o. Hasilnya menurut pelatih asal Brazil itu, skuadnya mengalami peningkatan. “Saya kira karena dengan tiga penyerang, mereka lebih sedikit menerima bola,” jelas mantan winger sekaligus manajer AC Milan tersebut. Tetapi sukses Inter ternoda ketika bek kirinya Christian Chivu memukul muka bek Bari Marco Rossi. Insiden menit 59 itu luput

dari pengamatan wasit, namun tertangkap kamera televisi. Usai laga bek Rumania itu minta maaf kepada Rossi. “Sangat sulit dijelaskan. Saya ingin minta maaf kepada Marco Rossi dengan segala harga diri yang saya punya,” ucap Chivu dalam Sky Sports. “Saya minta maaf kepada siapapun yang melihat pertandingan tadi. Terutama dua anak saya yang suatu hari nanti mungkin akan melihat tayangan ulang kejadian itu,” katanya lagi. Rossi sendiri menerima permintaan maaf Chivu dengan menegaskan, “Kejadian seperti itu bisa terjadi. Bukan terserah saya untuk menghakimi, orang lain akan memikirkannya.” “(Marco) Materazzi bilang kepada saya untuk tenang, karena saya bisa diusir wasit. Kami akan mengurusnya sendiri, dia pasti harus membayarnya,” tambah Rossi. (m15/tf/afp/sky)

Roma Minus Mexes Kontra Inter-Napoli


Bek Roma Philippe Mexes (kiri) terkena sanksi setelah ototototan dengan kiper Brescia Michele Arcari, Rabu lalu.

ROMA ( Waspada): AS Roma harus kehilangan bek andalannya Philippe Mexes pada dua laga krusial Liga Seri A kontra Inter Milan dan Napoli. Menurut, Jumat (4/2), bintang Prancis itu kena hukuman dua laga dari hakim Pengadilan Tinggi Italia Gianpaolo Tosel. Pasalnya, dia dianggap melecehkan ofisial pertandingan saat Roma ditahan Brescia 1-1, Rabu lalu. Absennya Mexes melawan Inter dan Napoli, tentu menjadi ujian berat buat Il Lupo yang sedang berjuang keras menembus papan atas Seri A. Apalagi alenatorre Roma Claudio Ranieri sempat mengaku, kurangnya amunisi telah menyulitkan I Giallorossi dalam persaingan merengkuh Lo Sudetto. Bahkan akibat krisis finansial, Serigala Merah tidak melakukan belanja pemain pada bursa transfer Januari lalu. Justru Giallorossi harus kehilangan beberapa pemain, di antaranya Julio Baptista (Malaga), Okaka (Bari), Cicinho (Villarreal), Antunes (Livorno). “Direktur olahraga Roma, Daniele Prade mengatakan Milan dan Inter memang sedang membutuhkan pemain baru, tapi kami tidak. Saya tidak setuju dengannya,” ujar Ranieri. Milan dan Inter memang mendatangkan beberapa pemain baru. Hasilnya ternyata sangat positif, terutama bagi I Nerazzurri yang memenangkan dua laga terakhirnya berkat kontribusi Giampaolo Pazzini dan Houssine Kharja. “Mereka (Milan dan Inter) tetap lebih kuat dari kami. Mereka memiliki uang lebih banyak untuk membeli pemain, sekalitus mampu menekan pasar,” tutur Ranieri. (m15/okz/sportal/goal)

Striker Inter Milan Giampaolo Pazzini gagal dibendung dua bek Bari Kamil Glik (kanan) dan Andrea Masiello di San Nicola Stadium, Jumat (4/2) dinihari WIB. -AP-

Barca Lawan Tepat Atletico MADRID (Waspada): Gelandang Atletico Madrid Tiago Mendes menilai, Barcelona sebagai lawan yang tepat untuk menandai momentum kebangkitan mereka. “Saat ini merupakan waktu yang sulit, karena kami harus keluar dari situasi yang rumit. Ini laga tepat bagi kami untuk membangun kepercayaan diri,” tegas Tiago dalam El Mundo Deportivo, Jumat (4/2). Atletico baru mengalami rangkaian kekalahan mengejutkan dari tim-tim semenjana. Dalam periode sulit tersebut, Los Rojiblancos justru akan dibenturkan dengan sang juara bertahan dinihari WIB nanti di Camp Nou. “Tidak ada beban. Kami akan menghadapi lawan yang sangat tangguh di kandang dan ini kesempatan besar untuk meningkatkan moral,” tekad Tiago. “Kami harus menyuguhkan permainan sempurna dan bertahan sebagai tim. Lalu,

Bayern Cemas Menanti Robben BERLIN (Waspada): Juara bertahan Bayern Munich cemas menanti kesembuhan Arjen Robben (foto) saat akan menghadapi tim papan bawah Bundesliga, FC Koeln, Sabtu (5/2) ini. Robben tampil bersinar bagi Bayern ketika menaklukkan Werder Bremen, akhir pekan lalu, kendati lama absen akibat cedera paha pasca membela Belanda pada Piala Dunia 2010. Dia telah mencetak tiga gol

dalam empat pertandingan, termasuk dua di Bundesliga, tetapi kemudian mengalami demam tinggi. Bintang berusia 26 tahun itu akibatnya tidak ikut pelatihan, kemarin. Keputusan apakah dia akan mentas di Koeln akan dibuat menjelang duel dimulai. Untungnya gelandang asal Turki Hamit Altintop siap menggantikannya. Ada kabar baik lainnya bagi

Problem Catur Hitam melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2.

FC Hollywood. Sebab winger Prancis Franck Ribery akan berada di bangku pemain usai penampilan mengesankan pada sesi pelatihan, kemarin, setelah hampir tiga pekan absen karena cedera pergelangan kaki. Pemain berusia 27 tahun itu terkilir lututnya pada pertandingan tandang pertama pasca Natal keWolfsburg, Januari lalu. Sejak itu Ribery belum bermain kembali, namun dia sudah me-


lanjutkan pelatihan dan bakal bisa tampil malam ini. Koeln yang berada di urutan ketiga dari bawah menang atas Bremen dua pekan lalu, sehingga menunjukkan mereka tidak akan mudah dikalahkan FC Hollywood. Bayern yang menghuni urutan ketiga, terpaut 14 poin dari tim teratas Borussia Dortmund. Pasukan Louis van Gaal telah memenangi tujuh dari delapan

berharap saat itu bukan hari keberuntungan mereka. “Karena jika nanti merupakan hari baik mereka, maka kami tidak mungkin menang,” katanya menambahkan. Tiago pun tak peduli dengan catatan kekalahan 1-2 pada pertemuan pertama di kandang mereka sendiri, StadionVincente Calderon, 19 September 2010. Kenangan di Calderon itu malah potensial menyulut emosi para punggawa El Barca, mengingat tekel keras yang telah dilakukan bek Los Colchoneros Tomas Ujfalusi terhadap Lionel Messi. “Ada sebuah komite yang memutuskan (hukuman) dan ketika mereka melihat gambar, dia (Ujfalusi) harus menerima hukuman yang layak karena perilakunya brutal,” kecam David Villa waktu itu. Bek Gerard Pique dan Carles Puyol ikut mengecam Ujfalusi. Sedangkan pelatih Barca Pep Guardiola saat itu berusaha mendinginkan situasi dengan

mengatakan; “Saya tidak berpikir Ujfalusi berniat mencelakai Messi. Hal seperti ini kerap terjadi dalam dunia sepakbola,” ujar Guardiola. “Tomas sama sekali tidak berniat mencederai lawan, itu hanyalah nasib sial. Kehebohan ini terjadi karena Messi yang mengalaminya,” bela el entrenador Atletico Quique Sanchez Flores. Akibat insiden tersebut, Messi sempat absen dua pekan lebih. “Kita semua tahu, jika menyangkut Messi atau Cristiano

Top Skor La Liga 22 Cristiano Ronaldo (Madrid) 21 Lionel Messi (Barcelona) 14 David Villa (Barcelona) 12 Giuseppe Rossi (Villarreal) Fernando Llorente (Bilbao) Pedro Rodriguez (Barcelona) 10 Nilmar (Villarreal) 9 David Trezeguet (Hercules) Ronaldo, semua orang akan bereaksi. Padahal Tomas sudah meminta maaf seusai pertandingan,” tambah Flores. (m15/as/goal)

Sabtu, 5 Februari (GMT) Koeln v Bayern Munich Nuremberg v Leverkusen Mainz v Werder Bremen Hanover v Wolfsburg Hoffenheim v K’lautern M’Gladbach v Stuttgart

(1430) (1430) (1430) (1430) (1430) (1730)

Minggu, 6 Februari AP

Hamburg v St. Pauli Freiburg v E Frankfurt

(1430) (1630)

laga terakhir dan hanya hasil imbang di Wolfsburg yang merusak rekor sempurna mereka sepanjang 2011. “Kami tergelincir di Wolfs-

burg, namun sebaliknya kami melakukan awal yang baik pada paruh kedua musim,” papar gelandang Bayern Andreas Ottl. (m15/ant/afp/dpa)

Tomas Ujfalusi menekel keras Lionel Messi (kiri) dalam duel di Vincente Calderon, 19 September silam.


24. Siaran bukan siaran langsung. 25. Rakyat (Menurut UU No.40/99 boleh melaporkan kekeliruan pemberitaan pers).

Isi kotak kosong dengan angka 0 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 5x2 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di halaman A2 kolom 1.



1. Kamera (Belanda). 3. Usaha percetakan dan penerbitan; Orang yang bertugas dalam pencarian dan penyiaran berita. 5. Komisi Penyiaran Indonesia. 7. Panggilan akrab untuk atasan. 9. Tulis: Benar atau Salah. Harian Waspada merayakan hut 8 windu pada 11 Januari 2011. 10. Televisi. 11. Gelar kesarjanaan, misalnya Master of Arts di bidang Komunikasi. 12. Terjemahan kata card dari press card. 14. Fungsinya antara lain menetapkan dan mengawasi pelaksanaan Kode Etik Jurnalistik. 15. Jumlah yang banyak sekali. 17. Organisasi wartawan. 19. Penyiaran kabar-berita (benar maupun salah) dengan tujuan untuk mencari pengikut atau dukungan. Sering dilakukan saat perang. 21. Model dalam teori ilmu pengetahuan; Kerangka berpikir. 22. _____ mulut, menolak bicara.


1. Penerbitan pers yang ukurannya lebih kecil dari suratkabar. 2. Serikat Penerbit Suratkabar. 3. Humas (Inggris populer). 4. Kata kerja dari menyiarkan. 6. Foto, gambar yang dibuat dengan kamera. 8. Singkatan Sekolah Tinggi Ilmu Komunikasi Pembangunan. 11. Oplah. 12. Juru ulas suatu berita. 13. Kupas (berita dsb). 16. Bintang (Inggris) selalu dipakai untuk nama koran. 17. Alat, perangkat, misalnya hardware komputer adalah _____ keras. 18. Si kulit bundar, nama penerbitan pers atau suplemen media cetak. 20. Buat berita suatu peristiwa. 21. Alat menulis/mencatat pakai tinta. 23. Mengetuk mesin tulis dengan ujung jari.

7 0 9 5 6 2


7 6 3 4


4 3

2 8 9 5 5 1 2 1

7 9


1 3 0 2 8 6

1 7 5 4 6 4


2 8 6 7


6 3 1 2 8 5 6



WASPADA Sabtu 5 Februari 2011

Gunners Krisis Kiper LONDON ( Waspada): Berita buruk menerpa Arsenal dalam persiapannya menyambangi markas Newcastle United malam ini di St James Park. The Gunners dipastikan mengalami krisis kiper, setelah Lukasz Fabianski dinyatakan mesti absen hingga akhir musim 2010/2011 ini. “Kami punya kabar buruk dari Lukasz Fabianski, karena dia butuh operasi di pundaknya,” ungkap arsitek Arsenal Arsene Wenger dalam situs

resmi Gunners, Jumat (4/2). Kiper Polandia berusia 25 tahun itu cedera bahu saat menjalani latihan pemanasan untuk menghadapi Manchester City, Januari lalu. Fabianski pun harus terbang ke Jerman demi menjalani operasi. “Keputusan ini diambil setelah beberapa spesialis melihat dia harus menjalani operasi di Jerman. Dan itu berarti musimnya telah berakhir,” beber Wenger. Untungnya kiper Manuel Almunia telah pulih kembali

dari cedera dan akan bertarung dengan Wojciech Szczesny untuk menjadi penjaga gawang utama Meriam London. “Kompetisi untuk kiper saat ini hanya antara Wojciech dan Almunia. Wojciech akan bermain pada pertandingan selanjutnya,” klaim Wenger. Sejak kedatangan Fabianski dan Wojciech, posisi Almunia jadi terancam. Kiper asal Spanyol itu bahkan jarang diturunkan Wenger musim ini, karena kalah bersaing dengan kedua juniornya.


Wojciech Szczesny (kiri) dan Lukasz Fabianski (kanan) menggusur posisi Manuel Almunia.


lengkap Andrew Thomas Carroll tersebut. Dia pun bertekad menjaga konsentrasi dan performanya demi membantu kebangkitan prestasi The Reds asuhan Kenny Dalglish. Terutama ketika melawan Chelsea yang diperkuat mantan penyerang Liverpool Fernando Torres pada laga lanjutan Liga Premier, Minggu (6/2). “Saya merasa siap. Saya tahu apa yang harus saya lakukan dan harus menjaga konsentrasi permainan,” ujar striker berusia 22 tahun tersebut. “Sesungguhnya, Torres pemain hebat dan saya hanya butuh menjaga konsentrasi performa dan bermain sejauh pengetahuan saya,” katanya menambahkan. (m15/goal/espn)

Jersey tersebut dicetak dengan tiga varian warna sesuai seragam kandang dan tandang The Blues. Menurut Yahoo Sport, Jumat (4/2), permintaan atas jersey Torres lebih laris 40 persen dibanding saat dia datang ke Liverpool. Bukan tak mungkin pemain berjuluk El Nino itu bakal jadi bintang yang seragam replikanya paling laku untuk paruh kedua musim 2010-11. Dua musim belakangan, Torres memang memimpin dalam hal penjualan jersey. Dia

pastikan menambah persaingan untuk menentukan siapa yang akan menjadi ‘nahkoda’ PSSI untuk empat tahun mendatang. Maklum saja karena calon incumbent Nurdin Halid yang sejak jauh-jauh hari mengatakan keinginannya kembali memimpin PSSI bakal mendapat lawan di ajang Kongres nanti. “Kita pun belum mengetahui siapa saja calon yang akan maju. Sebab tidak menutup kemungkinan dalam beberapa hari ke depan ada calon lain yang muncul. Karena itu kenapa kami tidak ingin buru-buru menetapkan pilihan kepada salah satu calon,” jelas Idris. Dtambahkannya, keengganan menentukan pilihan saat ini tidak lepas dari posisi skuad PSMS yang tengah berjibaku di pentas kompetisi Divisi Utama Liga Indonesia. Dirinya juga mengaku tidak ingin keputusan yang dibuat pengurus maupun manajemen tim saat ini justru merugikan PSMS yang sedang mengikuti kompetisi di bawah naungan

PSSI yang sacara kebetulan masih dipimpin Nurdin Halid. Ditanya mengenai figur Ketua Umum PSSI seperti apa yang dinginkan PSMS untuk persiode mendatang, Idris sedikit memberikan bocoran, yakni yang bisa membawa sepakbola nasional ke arah lebih baik mengingat prestasi nasional saat ini tengah terpuruk. “Perubahan yang saya

maksud jangan sampai diartikan pergantian Ketua Umum PSSI. Tapi perubahan sistem kompetisi dan lain sebagainya. Kalau pun harus ganti Ketua Umum, itu nanti saja. “Yang jelas, sepakbola kita harus banyak berubah sekiranya ingin terus maju. Tanpa adanya perubahan itu, sulit bagi kita untuk meraih prestasi yang diharapkan,” tandas Idris (yuslan)

Riedl Pinggirkan 5 Calon Pemain Inti JAKARTA (Waspada): Pelatih tim nasional Indonesia Alfred Riedl (foto), meminggirkan lima calon pemain inti Pra-Olipiade 2012 yang saat ini menjalani pelatnas di Lapangan PSSI, Senayan. Lima pemain dimaksud mengalami cedera menjelang


LONDON (Waspada): Replika kostum Fernando Torres (foto) dengan nomor punggung ‘9’ yang diproduksi klub barunya Chelsea, penjualannya laris bahkan melebihi saat dia pindah ke Liverpool dari Atletico Madrid.

Idris Tepis Dukung Toisutta JAKARTA (Waspada): Sekum PSMS Medan Idris SH, menepis kehadirannya dalam deklarasi yang dilakukan KSAD Jenderal George Toisutta (foto) sebagai calon Ketua Umum PSSI periode 2011-2014 di Mabes TNI AD Jakarta, sebagai wujud dukungannya. Menurutnya, sejauh ini PSMS belum menjatuhkan pilihan siapa yang akan didukung dalam Kongres PSSI di Pulau Bintan, Pekanbaru, 19 Maret mendatang. Sebab PSMS tidak ingin terjebak dengan polemik yang terus berkembang jelang dilangsungkannya pemilihan Ketua Umum PSSI. “Saya memang hadir di sini, tapi sama sekali bukan dalam kapasitas sebagai pendukung Pak Goerge Toisutta. Masih terlalu dini kami menyampaikan dukungan, karena proses yang akan dilalui beliau masih panjang,” dalih Idris ditemui Waspada usai deklarasi Toisutta, Kamis kemarin. Diakuinya, kehadiran Toisutta dalam bursa pemilihan di-

karena mantan pemain Celta Vigo itu masih terikat kontrak bersama Gunners. “Dia masih terikat kontrak dan sejauh dia masih berada di sini, kami senang memilikinya. Saya senang dia masih disini,” jelas Wenger. “Almunia sudah tidak bermain dalam waktu lama, lama sekali. Saya rasa tidak ada satu orang pemain pun yang senang, jika tidak dapat bermain,” katanya menambahkan.

Jersey Torres Lebih Laris

Kampanye Carroll LONDON (Waspada): Andy Carroll (foto) kampanye bahwa dirinya pantas dibeli mahal oleh Liverpool dari Newcastle United pada harihari terakhir bursa transfer Januari 2011. “Jumlah yang besar, tapi saya yakin bisa melakukan apa yang harus saya lakukan untuk membuktikan uang itu layak dikeluarkan,” klaim Carroll, seperti dilansir Goal, Jumat (4/2). Bomber kelahiran 6 Januari 1989 itu ditransfer seharga 35 juta pound, jumlah fulus yang merupakan rekor penjualan termahal The Magpies. “Saya mencetak gol saat di Newcastle dan itu yang ingin saya bawa ke sini (Liverpool). Tinggal lihat dan tunggu saja,” janji Carroll. “Saya di sini untuk mencetak gol dan menciptakan peluang buat tim, itulah yang bisa saya lakukan. Waktu yang akan menjawabnya,” kampanyenya lagi. Soal kabar miring bahwa dia terpaksa mandah dari St James Park ke Anfield, Carroll menepisnya sekaligus mengaku bahagia hijrah ke Merseyside Merah. “Memang transfer itu terjadi di menit-menit akhir, tapi tak ada pengaruhnya dengan saya. Sekarang saya di sini dan hanya ingin bermain di Liverpool. Saya sangat bahagia,” tegasnya. “Ambisi kami memenangkan sesuatu dan saya yakin setiap orang percaya kami bisa mewujudkannya,” tambah penyerang bernama

“Untuk saat ini Wojciech adalah yang nomor satu. Dia tidak melakukan apapun saya saat saya menariknya keluar. “Saya bisa merotasi kiper. Dalam setiap laga, kadang saya memainkan kiper yang berbeda, dan hasilnya baik,” tambah manajer asal Prancis yang dijululi Professor tersebut. Pelatih berumur 61 tahun itu juga yakin, Almunia tidak akan meninggalkan Emirates Stadium kendati posisinya sudah digusur Fabiansky dan Wojciech. Salah satu alasannya,

laga uji coba melawan Pelita Jaya U-21 di Stadion Utama Gelora Bung Karno, Jakarta, Sabtu (5/ 2) ini. Mereka adalah Oktovianus Maniani, Dendi Santoso, Egi Melgiansyah, Nasution Karubaba dan Rishadi Fauzi. “Saya tidak akan memak-

sakan diri untuk menurunkan pemain yang cedera pada pertandingan uji coba nanti. Terlalu berisiko,” ucap Riedl usai latihan di Lapangan PSSI, Senayan, Jakarta, Jumat (4/2). Menurut dia, kelima pemain hampir semuanya mengalami cedera otot. Dengan kondisi tersebut, Riedl menginstruktsikan kepada tim medis untuk memantau perkembangan mereka. Kemarin, kelimanya hanya berlatih ringan seperti berlari dan dibimbing langsung oleh tim medis. Waktu latihanpun tidak sama dengan pemain yang prima. Dengan absenya kelima pemain melawan Pelita Jaya U21, bisa dipastikan formasi akan berubah. Sebab mereka yang cedera adalah calon pemain inti. Tapi arsitek asal Austria itu tidak akan kesulitan untuk mencari penggantinya. Khusus di lini tengah, stok pemain yang ada di antaranya Hendro Siswanto, Engelbert Sani, Aris Alfiansyah, David Lali dan JohanYoga. Timnas Pra-Olimpiade 2012

akan melakukan pertandingan resmi melawan Turkmenistan di Stadion Jakabaring, Palembang, 23 Februari mendatang. Selain dengan tim lokal, Yongky Ariwibowo dan kawankawan juga dijadwalkan melakukan eksibisi internasional lawan Tim U-23 Hongkong dan klub lokal Hongkong, 9 dan 11 Februari 2011. Menurut Riedl, khusus untuk melawan Hongkong, pihaknya akan membawa 21 pemain tidak termasuk pemain keturunan Indonesia-Belanda Diego Michiels yang akan kembali ke Negeri Kincir Angin. Hingga hari ke-12 pelaksanaan pelatnas, sedikitnya lima pemain telah dipulangkan, yaitu Saiful Amar, Jordy de Kat, Ramdani Lestaluhu, Fahrudin dan Alan Martha. Dengan mencoret lima pemain lagi, maka jumlah skuadnya akan sesuai dengan kuota yang ditetapkan untuk sebuah pertandingan Pra-Olimpiade 2012, yaitu 18 pemain. (yuslan/ant)


bahkan mampu mengalahkan penjualan jersey Cristiano Ronaldo saat masih membela Manchester United. Padahal secara prestasi, Torres mencetak gol lebih sedikit dibanding Ronaldo dan tidak menghasilkan gelar apapun buat The Reds. Menanggapi fenomena dimaksud, mantan penyerang Liverpool Robbie Fowler menyampaikan rasa prihatinnya. Sebagai bentuk ekspresinya, Fowler pun menggunakan se-

ragam Merah bernomor ‘9’ milik Torres untuk kemudian disumbangkan ke korban banjir di Queensland, Australia. Kaus Yang Menyakitkan “Tidak ada yang salah dengan nama di bagian depan kaos. Tapi nama di belakangnya yang jadi masalah,” papar Fowler kepada WA Today. Gerakan sosial yang digagas Fowler cs mengambil tema unik untuk mengumpulkan sumbangan kaus bekas, yakni

‘Kaus Yang Menyakitkan’ (The Shirts That Hurt). “Kaus ini bakal banyak ditinggalkan di lemari. Saya tidak tahu apa yang akan terjadi dengan kaus-kaus itu,” tambah striker yang mencetak 183 gol buat Si Merah tersebut. Torres cabut dari Anfield ke Stamford Bridge tepat di hari terakhir transfer Januari 2011 dengan nilai 50 juta pound. Keputusannya itu mendapat reaksi keras pada fans The Reds yang kemudian menjulukinya Judas,

simbol pengkhianat dalam agama Nasrani. Fans Merah juga membakar jersey Torres di markas latihan Liverpool di Melwood. Ironisnya, Torres justru langsung diturunkan Si Biru untuk menjamu The Pool besok malam pada laga lanjutan Liga Premier. “Dia (Torres) meninggalkan klub tidak dalam keadaan dan bentuk yang baik. Untunglah, sudah ada dua pengganti (Andy) Carroll dan (Luis) Suarez,” beber Fowler. (m15/vvn/yahoo/wat)



WASPADA Sabtu 5 Februari 2011

Lewis Hamilton (kiri) dan Jenson Button foto bersama di depan mobil McLaren MP4-26 terbaru di Berlin, Jumat (4/2). -AP-

Duo McLaren Kagum MP4-26 BERLIN (Waspada): Kubu Vodafone McLaren resmi meluncurkan mobil terbarunya dengan nama MP4-26 di Potsdamer Platz, Berlin, Jumat (4/2). Dengan “jet darat” anyar ini, McLaren berharap Jenson Button dan Lewis Hamilton bisa bersaing untuk memperebutkan gelar juara dunia Formula 1 (F1) 2011.

Hasil Uji Terakhir Robert Kubica Adrian Sutil Jenson Button Mark Webber Felipe Massa Timo Glock Pastor Maldonado Sergio Perez Michael Schumacher Sebastien Buemi Narain Karthikeyan Jarno Trulli

(Renault R31) (Force India VJM-03) (McLaren MP4-25) (Red Bull RB7) (Ferrari F150) (Virgin VR01) (Williams FW33) (Sauber C30) (Mercedes W02) (Toro Rosso STR6) (HRT F110) (Lotus T128)

1:13.144 (96 lap) 1:13.201 (117) 1:13.553 (105) 1:13.936 (105) 1:14.017 (80) 1:14.207 (114) 1:14.299 (101) 1:14.458 (104) 1:14.537 (110) 1:14.801 (73) 1:16.535 (63) - (38)

McLaren menjadi tim yang terakhir memperkenalkan mobilnya. Padahal, para rival mereka sudah lebih dulu melakukannya sehingga bisa memakai mesin baru tersebut pada tes resmi perdana di Valencia pekan ini. Dengan demikian, McLaren baru akan mencoba MP4-26 tersebut pada tes pramusim kedua di Sirkuit Jerez, Spanyol, pekan depan. Di Valencia, tim yang bermarkas di Woking

Kubica Tercepat VALENCIA, Spanyol (Waspada): Pembalap Polandia, Robert Kubica (foto), tampil sebagai driver tercepat dalam latihan penutup sesi ujicoba F1 di Sirkuit Ricardo Tormo, Valencia, Jumat (4/2) dinihari. Dengan menorah waktu 1 menit 13,144 detik di atas LotusRenault, Kubica mengalahkan pembalap Force India Adrian Sutil yang memimpin di sesi pagi hari. Di sesi awal itu, Kubica sendiri gagal menunjukkan kepiawaiannya karena hanya menempati posisi 10. “Latihan itu dibagi atas dua bagian, pagi dan sore. Pagi hari, kami masih membuat waktu buruk dan tidak dapat menyelesaikan semua putaran. Beruntung kami lebih baik di sesi sore hari,” kata Kubica. Selaku runner-up, Sutil melalui 117 lap dengan waktu terbaik 1 menit 13,201 detik dan menyatakan gembira dengan kembali berada di kokpit untuk pertama kali tahun ini. Posisi ketiga


menjadi milik pembalap McLaren, Jenson Button. Juara dunia 2009 itu mengendarai MP4-25 dan mencatat waktu 1 menit 13,553 detik. Pembalap tercepat keempat dan kelima masing-masing diduduki Mark Webber (Red Bull) dan Felipe Massa (Ferrari). Webber meraih catatan waktu 1:13,936 (105 lap), sedangkan Massa bangkit pasca mobilnya terbakar dengan mencatat 1:14,017 (80 lap). (m33/auto)

McDyess Bikin Lakers Malu LOS ANGELES, AS (Waspada): San Antonio Spurs memetik 41 kemenangan dalam lanjutan kompetisi NBA musim ini setelah mempermalukan Los Angeles Lakers 89-88 di Staples Center, Jumat (4/2). Kemenangan Spurs tersebut ditentukan tip in dari Antonio McDyess. Duel antara Spurs kontra Lakers memang berlangsung ketat. Spurs lebih dahulu memimpin di kuarter pertama 2218. Lakers lalu menyusul dan menyamakan skor 42-42 di akhir kuarter kedua. Tensi per-

tandingan akhirnya kian tinggi pada 12 menit berikutnya. Kendati Spurs sempat jauh memimpin, Lakers pantang menyerah dan membuntuti lawannya di empat menit menjelang kuarter ketiga berakhir. Sayang, penampilan Kobe Bryant cs kurang maksimal di penghujung kuarter tersebut hingga dimanfaatkan Spurs yang kembali memimpin. Jump shot Shannon Brown di awal kuarter penentu membawa Lakers unggul 67-66. Selanjutnya, Lakers gagal mena-

han laju Spurs dan tercecer hingga 71-73 dengan sisa delapan menit.Tak ingin malu di hadapan publiknya, Lakers terus berupaya merapatkan jarak. Sesaat Paul Gasol dan Tim Duncan saling membalas dalam urusan mencetak angka, Spurs tertinggal hasil aksi three point Lamar Odom yang menjadikan Lakers unggul 88-87 di sisa 22 detik terakhir. Pasca time out, Spurs menguasai bola dan mengoper bola kepada Manu Ginobili dan Tony Parker yang sama-sama gagal. Bola rebound dikuasai Duncan yang segera melempar bola ke jaring. Di sini, kegagalan Duncan dijadikan McDyess se-

bagai momennya tampil sebagai pahlawan Spurs saat meneruskan bola ke dalam keranjang Lakers. Di Orlando, penampilan gemilang kembali diperlihatkan LeBron James. Kali ini, LeBron mencetak 51 angka 11 rebound dan delapan assist bagi Miami Heat yang unggul 104-100 atas tuan rumah Magic. Di Oakland, tuan rumah Golden State Warriors mengalami nasib berbeda dari Lakers dan Magic. Menjamu Milwaukee Bucks, Warriors mengemas kemenangan 100-94 berkat sumbangan 24 poin dari Monta Ellis. (m33/ap)

NBA Rilis Skuad All Star NEW YORK, AS (Waspada): Kompetisi NBA memasuki separuh jaraknya dengan pergelaran NBA All Star. Menjelang laga bintang NBA itu di Los Angeles, NBA merilis para perwakilan yang akan tampil membela timWilayah Barat dan Wilayah Timur. Pada 27 Januari lalu, NBA sudah mengumumkan pemain yang berhak menjadi pemain inti dalam All Star Weekend di Staples Center, 20 Februari mendatang. Guard LA Lakers Kobe Bryant menjadi pemain dengan pengumpul suara terbanyak ditemani Chris Paul (New

Orleans Hornets), Kevin Durant (Oklahoma City), Carmelo Anthony (Denver Nuggets) danYao Ming (Houston Rockets). Masuknya nama Yao Ming mengejutkan karena center asal China itu tengah cedera. Untuk mengisi tempatnya, akan dipilih satu orang center oleh Komisioner NBA, David Stern. Di Wilayah Timur, Dwight Howard (Orlando Magic) menjadi pemuncak voting. Pelengkap tim Timur adalah Derrick Rose (Chicago Bulls), Dwyane Wade, LeBron James (Miami Heat) dan Amare Stoudemire (New York Knicks). (m33/nba)

Skuad All Star NBA 2011


Sebuah tip dari Antonio McDyess (hitam) menentukan kemenangan San Antonio Spurs atas LA Lakers dalam laga NBA di Staples Center, Los Angeles, Jumat (4/2).

Tim Barat: Kobe Bryant (Lakers), Chris Paul (Hornets), Kevin Durant (Thunder), Carmelo Anthony (Nuggets), Yao Ming (Rockets)*, Tim Duncan (Spurs), Pau Gasol (Lakers), Manu Ginobili (Spurs), Blake Griffin (Clippers), Dirk Nowitzki (Mavericks), Russell Westbrook (Thunder), Deron Williams (Jazz) Tim Timur: Derrick Rose (Bulls), Dwyane Wade (Heat), LeBron James (Heat), Amar’e Stoudemire (Knicks), Dwight Howard (Magic), Ray Allen (Celtics), Chris Bosh (Heat), Kevin Garnett (Celtics), Al Horford (Hawks), Joe Johnson (Hawks), Paul Pierce (Celtics), Rajon Rondo (Celtics)

tersebut menggunakan mobil MP4-25 dan hanya fokus pada pengembangan ban serta sekedar “pemanasan”. “Kita telah melihatnya saat menjalani simulasi, tapi kali ini baru pertama kali melihat MP426 secara langsung bersama Jenson (Button). Benar-benar lebih indah dan gagah dilihat dalam ukuran aslinya,” papar Hamilton. “Inilah ‘anak’ baru kami. Semoga mobil ini bisa membawa

saya dan Lewis (Hamilton) kembail merebut gelar juara F1 musim ini sekaligus predikat tim konstruktur terbaik nantinya. Sungguh indah dipandang mata mobil tersebut,” tambah Button. Pengenalan mobil baru tersebut dilakukan dengan cara yang unik karena MP4-26 datang ke lokasi peluncuran dalam bagian-bagian kecil yang terpisah. Baru kemudian mobil tersebut disatukan dilokasi untuk kemudian dipamerkan pada publik. Mobil anyar McLaren tersebut mengusung beberapa konsep baru yang berbeda. Di antaranya adalah bagian hidung yang lebih flat dan panjang, sidepod yang juga lebih tinggi berbentuk ‘L’ serta pada bagian airbox. Meski begitu, kubu McLaren mengklaim kendaraan

yang mereka pamerkan tersebut bukan merupakan bentuk asli dari MP4-26. “Berhati-hatilah, Anda belum melihat semuanya. Sesungguhnya, kami belum menunjukkan pada para kompetitor kekuatan penuh kami,” ungkap Ketua Tim McLaren, Martin Whitmarsh sambil tersenyum. “F1 menyangkut pengembangan yang berkesinambungan, dan kami akan memulai pengetesan pada minggu depan. Pada tahap itu, mobil akan bergerak secara halus. Ada beberapa inovasi yang fantastis. Tidak pernah berhenti membuat saya takjub bahwa meskipun peraturan jauh lebih ketat, terutama di sekitar daerah diffuser, itu hanya kreativitas mengemudi,” paparWhitmarsh lagi. (m33/auto)


WASPADA Sabtu 5 Februari 2011


PSMS Lolos Ke Piala Indonesia Kalahkan Persita 2-1 MEDAN (Waspada): PSMS Medan memastikan diri lolos ke Piala Indonesia, setelah mengungguli Persita Tangerang 2-1 sekaligus menempati posisi tiga besar klasemen sementara kompetisi Divisi Utama Liga Indonesia 2010/2011. Kemenangan yang diperoleh secara dramatis itu membuat posisi Ayam Kinantan melonjak ke urutan ketiga klasemen dengan mengantongi nilai 20 dari enam kali menang, dua seri dan empat kali kalah. Sebelumnya, skuad pelatih Suharto dan H Edy Syahputra berada di urutan tujuh. Bagi Pendekar Cisadane yang juga sempat menempati posisi tiga besar, harus menerima kenyataan turun ke peringkat empat menyusul dua kekalahan di Medan. Di awal pekan, Persita dikalahkan Pro Titan 2-1. Kepastian PSMS tampil di ajang Piala Indonesia dikarenakan Badan Liga Indonesia (BLI) PSSI menetapkan lima tim teratas di klasemen setiap grup berhak mengikuti turnamen berhadiah miliaran rupiah itu. Hal ini diakui Manajer Tim dan Asisten Manajer PSMS Idris SE dan Drs Benny Tomasoa. Di samping itu, M Affan Lubis cs pun mewujudkan harapan manajemen dan 17 ribu pendukung PSMS dengan menutup putaran pertama dengan

kenangan manis. Alhasil, penonton yang mbludak spontan menyambut kemenangan dengan suara hiruk pikuk serta menyalakan kembang api. Sebelumnya, kembang api itu juga menyambut gol Kurniawan Dwi Yulianto di menit 13 dan Vagner Luis De Olivera di menit 77. Gol penyama kedudukan pasukan Elly Idris terjadi di babak pertama lewat Agus S. Keberhasilan Ayam Kinantan itu sendiri digapai dengan susah payah lewat pertarungan keras dan ketat, mengingat kedua tim sama-sama ngotot mendapatkan tiket lolos ke pentas Piala Indonesia. “Kita menyadari Persita akan tampil ngotot, karena sudah menjadi tradisi lawan yang menghadapi PSMS di Stadion Teladan akan meningkat permainannya dua kali lipat. Menyadari hal inilah, saya tekankan kepada pemain agar tidak meremehkan lawan,” ujar pelatih PSMS Suharto. Kendati larut dalam kegembiraan, kemenangan PSMS turut diwarnai kepemimpinan wasit

Klasemen Grup I Persiraja PSAP PSMS Persita Persih Persipasi PSLS Persitara Persikabo PSSB Bengkulu ProTitan Persires

11 8 11 6 12 6 12 5 11 6 11 5 11 3 11 4 11 3 11 2 12 2 11 2 11 0

2 4 2 4 1 3 6 1 3 5 5 4 2

1 1 4 3 4 3 2 6 5 4 5 5 9

23-13 26 18- 8 22 15-13 2 0 18-10 19 16-14 19 18- 8 18 8-10 15 15-20 13 17-17 12 7- 9 11 9-14 11 9-13 10 3-27 2

Supratman (Lampung) yang buruk. Kurang tegasnya dan sikap plin-plan wasit pun nyaris menyulut kemarahan penonton dan kubu PSMS, setelah beberapa kali keputusannya merugikan PSMS. Sempat mengabaikan pelanggaran tim tamu terhadap Kurniawan di kotak penalti, wasit juga kerap menghentikan jalannya pertandingan di saat PSMS tengah membangun serangan ke jantung pertahanan lawan karena adanya negative football dari Cristian Carrasco cs yang berpura-pura cedera. “Kita harus berjiwa besar makanya protes selalu kita lontarkan kepada Pengawas Pertandingan (PP) Julius Dede, bukan kepada wasit,” terang Benny. (m17/m33)

Tim U-16 Sumut Menuju Bangkinang MEDAN (Waspada): Ketua Umum Pengcab PSSI Medan, Drs HM Darwin Syamsul, melepas tim Medan II sebagai perwakilan Sumut pada babak 12 besar Piala Mennegpora U-16 di Stadion Tuanku Tambusai, Bangkinang, Riau, 5-8 Februari ini. Pelepasan menuju Bangkinang yang digelar di lapangan SSB Patriot Jl Air Bersih Medan, Kamis (3/2) malam, itu turut dihadiri orang tua pemain. Medan II merupakan tim yang menjuarai Piala Mennegpora Regional Sumatera dan berhak mewakili Sumut di tingkat Sumatera dan nasional. “Sebagai perwakilan Sumut, kalian harus bisa menjaga nama baik sepakbola Sumut. Sebab kalianlah yang diharapkan kelak menjadi pesepakbola handal masa depan,” harap Darwin didampingi pengurus PSSI Medan di antaranya H Supianto dan Nunuk Sanhaji. Hal senada diucapkan Manajer Tim Goklas Butar Butar

Waspada/Setia Budi Siregar

Ketua PSSI Medan Drs HM Darwin Syamsul (kiri) melepas tim Medan II di lapangan SSB Patriot, Jl Air Bersih Medan, Kamis (3/2) malam. dan Asisten Manajer Kompol H Sujono. Goklas berpesan agar setiap pemain selalu tampil fight hingga peluit akhir berbunyi. Di Bangkinang, tim U-16 Sumut bergabung dengan Lampung yang menggantikan Sumbar akibat terkena diskualifikasi dan tuan rumah Riau. Dilatih Sudarto dan Wagner Sinaga, tim Sumut diperkuat Aulia Rahman, Indra Kembar

Bungsu, Dimas Aditya, Indra Damara, Farhan Hafiz, Yoga Kuswanda, M Kanigia Tinambunan, Aaron Gunanta Barus, Ahmad Fadlan Nasution, Tri Hanafi, Deni Kurniawan, Fiwi Dwipan, Novri Ardiansyah, Agil Gustira, Irvan Pratama, Hendi Syahputra, M Nasta, Paulo Oktavianus S, Heru Kiswanda, Tino Pratama, Zulfikar Lubis dan Wardana Putra. (m18)

Tekad Bangkit Bintang Medan MEDAN (Waspada): Kekalahan dari Real Mataram 13 pada laga Liga Primer Indonesia (LPI) sebelumnya membuat Bintang Medan bertekad bangkit. Pada Minggu (6/2) besok, Manado United ditargetkan menjadi sasaran tembak tim asuhan Michael Feichtenbeiner kala tampil di Stadion teladan Medan. Pada laga kandang kedua ini, pelatih Bintang Medan Michael Feichtenbeiner menargetkan poin penuh. Dikatakan, kekalahan menyakitkan dari Real Mataram akan coba ditebus dengan kemenangan. “Kita sudah kehilangan poin. Untuk itu, menghadapi Manado United kita harus memenangkan pertandingan,” ujar pelatih asal Jerman itu di sela-sela laga PSMS kontra Persita Tangerang, Jumat (4/2) malam. Namun Bintang Medan belum mengetahui peta kekuatan calon lawannya tersebut. Seperti disampaikan CEO Bintang Medan, Dityo Pramono, ia mengharapkan Rudi Hartono cs tampil maksimal. “Urusan kalah menang itu belakangan. Yang utama bermain maksimal dan mempersembahkan sepakbola cantik serta menghibur penonton dengan menjunjung tinggi profesionalitas,” kata Dityo via ponsel. “Tentu saja, kami meng-

Waspada/Austin Antariksa

Duo pemain asing Bintang Medan, Amine Kamoun (kanan) dan Cosmin, bertekad menjadikan Manado United sebagai korban kedua di Stadion Teladan Medan, Minggu (6/2) besok. inginkan tiga poin, tapi seperti apa hasilnya lihat saja di lapangan nanti. Kita juga belum tahu kekuatan Manado United,” lanjut Dityo. Yang harus diwaspadai Bintang Medan adalah kepercayaan diri lawan yang tengah meninggi menyusul kemenangan atas Cenderawasih Putra 3-0. Sementara itu, kubu Manado United juga tidak memasang target muluk-muluk.

Saat meladeni Bintang Medan, tim asuhan pelatih Muhammad Alhadad hanya menargetkan hasil imbang. “Kita belum tahu seperti apa permainan Bintang Medan,” katanya. Menurutnya, 20 menit pertama merupakan waktu bagi anak asuhnya mempelajari kekuatan lawan. “Dari situ, kita akan coba mencari kelemahan lawan dan disesuaikan dengan strategi kita,” katanya. (m17)

Waspada/Austin Antariksa

Kurniawan Dwi Julianto (kiri), membuka kemenangan PSMS Medan dengan mudah mempecundangi kiper Persita Tangerang dalam lanjutan kompetisi Divisi Utama Liga Indonesia 2010/2011 di Stadion Teladan Medan, Jumat (4/2) malam.

Pro Titan Siap Ulangi Sukses Jamu Persipasi Sore Ini MEDAN (Waspada): Setelah menang atas Persita Tangerang, Pro Titan FC siap mengulangi sukses saat menjamu Persipasi Bekasi dalam lanjutan kompetisi Divisi Utama Liga Indonesia 2010/2011 di Stadion Teladan Medan, Sabtu (5/2) sore ini. Untuk mewujudkannya, skuad Dick Van Butelaar akan menampilkan permainan menyerang dengan formasi 4-3-3 seperti ketika menaklukkan Persita. Dalam latihan Jumat (4/2),Van Butelaar sendiri masih tampak terpincang-pincang pasca kakinya cedera masuk parit pembuangan air di Stadion Teladan. Namun mantan pelatih Persitara dan Perseden Denpasar itu tetap semangat. Dia pun yakin pemain muda Pro Titan dapat mengimbangi Persipasi yang dihuni pemain senior yang sudah memiliki jam terbang di kancah sepakbola nasional. “Kita memberdayakan pemain yang ada saat ini,” terang Butelaar didampingi Asisten Pelatih Yahya Yoesworo dan Sugiar. Dikatakan, Ghozali Muharram masih menjadi andalannya di lini depan bersamaYanpieter Rumbekwan dan Tambun Naibaho. Tapi menurut Sugiar, bisa saja formasi berubah dengan menempatkan M Junaidi Syahputra di lini depan. “Kita masih melihat kesiapan pemain. Namun dalam latihan kemarin pemain tidak ada yang mengalami cedera termasuk pemain belakang Rama Pratama,” tambah Sugiar. Dia menilai kekalahan Persi-pasi atas PSMS Medan (1-2) bukan menjadi jaminan bahwa lawan bakal enteng. Karenanya, Manajer Tim H Wahyu Wahab meminta pemainnya untuk tampil lepas dan tidak terbebani. “Selain itu, tunjukkan kerjasama tim dalam merusak pertahanan lawan,” pintanya. Media Relations Pro Titan Sony Agus Santoso menambahkan, pihaknya akan mencetak tiket sebanyak 3.000 lembar untuk tribun tertutup pada laga penutup putaran pertama itu. “Kita tidak banyak mencetak tiket. Melawan Persita, kita juga mencetak sekitar 3000an tiket hanya untuk tribun tertutup,” terangnya. (m18)

Avian: Memangnya PSSI Milik Golkar? MEDAN (Waspada): Pernyataan Ketua Umum PSSI Nurdin Halid yang mengatakan PSSI sukses karena Golkar merupakan pengakuan yang tidak tepat. Pernyataan itu justru membuktikan bahwa selama ini PSSI terlibat dalam praktek politik. Hal itu ditegaskan Vice President LPI Regional SumateraAceh, Avian Tumengkol, saat dihubungi di sela-sela kunjungan ke Padang, Jumat (4/2). Waspada/Austin Antariksa Dalam kunjungan ke beberapa kota peserta Liga Primer Indonesia (LPI) di Sumatera ini, Avian didampingi Pelatih Minangkabau FC Divaldo Alves yang juga menyesalkan sikap membanggakan diri dari Nurdin tersebut. “Apa urusannya Golkar dengan PSSI? Memangnya PSSI itu milik Golkar? Secara pribadi, saya loyalis Golkar tapi tidak sepakat dengan pernyataan itu. Salah arah dan justru merugikan partai tersebut,” tambah Avian. Avian menjelaskan, LPI hadir di Indonesia sebagai visi baru dan semangat masa depan persepakbolaan Indonesia ke depan. Visi dan semangat ini, menurutnya, milik masyarakat Indonesia bukan milik partai tertentu. “Kalau kita mau memajukan sepakbola di Indonesia. Karena itu, sebaiknya PSSI dipimpin sosok yang memahami ilmu-ilmu dasar sepakbola. Ini aspirasi bangsa kita, bukan kepentingan partai. Sepakbola nasional tidak akan maju kalau orang-orang yang terlibat asal-asalan. Apalagi tidak mengerti bola,” tegas Avian. Sebelumnya, Letjen Marinir (Purn) Suharto mengatakan sosok seperti Nurdin Halid tidak pantas memimpin PSSI. “Nurdin harus segera diganti karena sangat tidak layak. Dia saja sudah dua kali masuk penjara,” ketus Suharto. Menurut mantan Komandan Jenderal Korps Marinir ini, Jenderal George Toisutta merupakan sosok yang sangat disiplin dan tepat memimpin PSSI. “Banyak kebobrokan di PSSI selama Nurdin yang memimpin. Jadi, sebaiknya Nurdin ditendang saja dari PSSI,” sambung Suharto. (m33)

Bangun Semangat Olahraga Bersepeda Fun Bike SMA Istiqlal Deli Tua MEDAN (Waspada): Sejumlah 120 siswa bersama sejumlah guru SMA Istiqlal Deli Tua, Kabupaten Deli Serdang tampak bersemangat mengikuti acara fun bike (sepeda santai) dengan menempuh perjalanan lebih kurang 60 Km, Kamis (3/2) lalu. Berbeda dengan fun bike biasanya yang digelar di jalanjalan raya, kali ini peserta harus melalui jalan-jalan dusun di tiga kecamatan wilayah Kabupaten Deli Serdang yakni Kecamatan Deli Tua, Patumbak dan Sibiru-

biru. “Kegiatan ini rutin kita gelar dalam membangun semangat olahraga bersepeda para siswa. Selain bermanfaat dalam menjaga kebugaran tubuh, olahraga sepeda juga dapat ditekuni untuk berprestasi menjadi atlet nasional dan internasional,” ujar Kepala SMA Istiqlal Deli Tua, Drs H Enda Tarigan, Jumat (4/2). Dikatakan, generasi muda tidak perlu malu bersepeda karena di negara-negara maju seperti Jepang, sepeda menjadi

alat transportasi pilihan. “Dari segi prestasi, olahraga sepeda merupakan salah satu cabang yang dipertandingkan di Pekan Olahraga Nasional (PON) dan Olimpiade. Untuk itu, jangan pernah malu untuk bersepeda,” pungkasnya. (m42) Waspada/Dedi Riono

Sejumlah siswa SMA Istiqlal Deli Tua istirahat sejenak setelah melalui jalan tanjakan pada kegiatan fun bike 60 Km, Kamis (3/2).

Waspada/Austin Antariksa

Kurniawan Dwi Julianto (10) menjawab kepercayaan pelatih dengan sempurna.

Kurniawan Is Back! PASCA dua laga menghuni bangku cadangan, Kurniawan DwiYulianto akhirnya kembali mendapat kepercayaan masuk starting eleven dalam laga kontra Persita Tangerang di Stadion Teladan, Jumat (4/2) malam. Kepercayaan yang diberikan Pelatih PSMS Suharto pun dijawabnya dengan sebuah gol cantik. Ketika laga memasuki menit ke-13, Si Kurus menandai laga comeback dengan memaksimalkan umpan terobosan Zulkarnaen. Lolos jebakan offside, Kurniawan tinggal berhadapan dengan Ricky di bawah mistar Persita. Alhasil, tanpa kesulitan berarti sang mantan bintang timnas Indonesia ini dengan tenang membuat kiper lawan mati langkah. Stadion Teladan pun bergemuruh menandai kembalinya kepiawaian sang bomber di lapangan hijau. Ditemui sesaat usai pertandingan, Kurniawan tak ingin bercerita banyak tentang gol tersebut. Sebaliknya, Ia hanya memilih ter-

senyum sembari berjalan meninggalkan stadion menuju bus rombongan. Di sini, kejelian Pelatih PSMS Suharto pun patut mendapat acungan jempol. Pasalnya, Suharto jeli dengan memasang Kurniawan berduet dengan Gaston Castano dalam menghadapi lawan setangguh Persita. Padahal, urusan mencetak gol dalam dua pertandingan terakhir yang dilakoni Ayam Kinantan dipercayakan kepada Gaston dan Rinaldo maupun Mahadi Rais secara bergantian. Sayang, kedua nama terakhir belum berhasil menjawab kepercayaan pelatih. “Siapapun yang saya turunkan merupakan bagian dari strategi. Tentu, pemain yang paling siap akan bermain di lapangan,” ujar Suharto. Semoga saja kembalinya kepercayaan pelatih dan ketajaman Kurniawan terus membawa PSMS bertengger di papan atas klasemen. Ayo Kurniawan! Kamu bisa….. *Austin Antariksa

Misi Ganda Laskar Rencong BANDA ACEH (Waspada): Posisinya di klasemen sementara tak bisa terusik tim lain. Namun, Persiraja Banda Aceh, Sabtu (5/2) petang ini tetap mengusung misi ganda dalam pertemuannya dengan PSLS Lhokseumawe. Misi ganda itu adalah revans dan menjaga ‘keangkeran’ Stadion H Dimurthala, Banda Aceh dalam lanjutan Divisi Utama Liga Indonesia. Sepanjang paruh musim ini, Andria cs belum terkalahkan di kandang sendiri. Dari enam

laga di Lampineung, empat kali di antaranya menang dan dua kali seri. Karena itu, misi menjaga status tak terkalahkan di kandang menjadi kewajiban bagi Dicky Anggriawan cs. Selain ingin membalas kekalahan dari tim yang sama di Kompetisi Piala Gubernur Aceh I di Stadion Cot Gapu Bireuen pada Oktober 2010 lalu. Kali ini, dalam laga bertajuk Derbi Aceh jilid ketiga, tren positif sepertinya berpihak pada anak asuh Herry Kiswanto. Ba-

gaimana tidak, jika acuannya laga terakhir, pasti emosi Azhari dkk sedang bagus-bagusnya, setelah menang tipis 1-0 dari PSSB Bireuen. Apalagi, sang lawan baru saja dihempas PSAP Sigli 2-0. Melihat fakta tersebut serta kedalaman skuad kedua tim, tuan rumah berpeluang menjaga marwah Lampineung. Pun begitu, Laskar Pase juga tak ingin terpeleset lagi dan segera mengakhiri keterpurukan. (b05)

Sumatera Utara

WASPADA Sabtu 5 Februari 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:40 12:53 12:40 12:47 12:47 12:44 12:40 12:36 12:43 12:42

‘Ashar 16:02 16:15 16:03 16:10 16:09 16:07 16:03 15:59 16:06 16:05

Magrib 18:39 18:50 18:40 18:45 18:45 18:46 18:40 18:36 18:42 18:40



Shubuh Syuruq


19:51 20:01 19:51 19:56 19:57 19:58 19:52 19:48 19:54 19:52

05:10 05:26 05:11 05:20 05:19 05:11 05:10 05:06 05:13 05:14

05:20 05:36 05:21 05:30 05:29 05:21 05:20 05:16 05:23 05:24

L.Seumawe 12:46 L. Pakam 12:39 Sei Rampah12:38 Meulaboh 12:50 P.Sidimpuan12:37 P. Siantar 12:38 Balige 12:38 R. Prapat 12:35 Sabang 12:53 Pandan 12:39

06:38 06:54 06:39 06:48 06:47 06:39 06:38 06:34 06:41 06:42

Zhuhur ‘Ashar 16:08 16:02 16:01 16:12 16:00 16:01 16:01 15:58 15:15 16:02




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:43 18:38 18:37 18:48 18:40 18:38 18:39 18:36 18:49 18:41

19:55 19:50 19:49 20:00 19:51 19:50 19:51 19:48 20:01 19:53

05:18 05:09 05:09 05:21 05:05 05:08 05:07 05:03 05:26 05:07

05:28 05:19 05:19 05:31 05:15 05:18 05:17 05:13 05:36 05:17

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:39 12:41 12:50 12:43 12:40 12:47 12:35 12:45 12:38 12:38

18:41 18:41 18:47 18:44 18:39 18:45 18:35 18:45 18:40 18:37

19:41 19:53 19:59 19:56 19:51 19:57 19:47 19:57 19:52 19:49

05:07 05:10 05:23 05:12 05:11 05:19 05:05 05:16 05:07 05:08

05:17 05:20 05:33 05:22 05:21 05:29 05:15 05:26 05:17 05:18

Panyabungan 12:36 Teluk Dalam12:43 Salak 12:41 Limapuluh 12:37 Parapat 12:38 GunungTua 12:36 Sibuhuan 12:35 Lhoksukon 12:45 D.Sanggul 12:39 Kotapinang 12:34 AekKanopan 12:36

06:47 06:38 06:37 06:49 06:33 06:36 06:35 06:32 06:55 06:36

16:02 16:03 16:13 16:06 16:03 16:09 15:58 16:08 16:02 16:01

06:35 06:38 06:51 06:40 06:39 06:47 06:33 06:44 06:35 06:36

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

LSM P3H Adukan PT SLP Ke Disnaker Dan DPRD Langkat BINJAI (Waspada): Lembaga Swadaya Masyarakat(LSM) Peduli PolitikPemerintahandanHukum(P3H)Binjaikuasaenamkaryawan PT Sinar Langkat Perkasa (SLP) mengadukan masalah Pemutusan Hubungan Kerja (PHK)sepihak kepada Dinas Tenaga Kerja dan DPRD Langkat di Stabat. Ketua LSM P3H Binjai Syamsuddin Damanik didampingi Sekertaris Mhd. Jaspen Pardede, Ketua Litbang Rudolf Nadeak dan Humas Zulkifli, Kamis( 3/2) mengatakan, pengaduan kepada Dinas Tenaga Kerja Kab. Langkat sebagai instansi terkait masalah tenaga kerja. Kemudian, pengaduan juga dikirimkan kepada DPRD Kab.Langkat,agar wakil rakyat bisa memberikan bantuan kepada rakyat. Sekaligus, meneliti kondisi pabrik. Apakah izinya memenuhi syarat atau tidak, sebab menurut Jaspen,pendirian Pabrik Kelapa Sawit (PKS) harus tersedia 6 ribu ha tanaman kelapa sawit. Syamsuddin menyebutkan, inti masalah, enamkaryawan yang diberhentikan harus ditangani Dinas Tenaga Kerja Kab.Langkat, masalah izin dan kondisi sawit serta limbah diharapkan anggota DPRD Langkat memperhatikannya. Jika nanti tidak memenuhi syarat, tentu DPRD bisa memberikan saran kepada Bupati Langkat mempertimbangkan izinnya. Sedangkan Ka Litbang Rudolf Nadeak dan Humas Zulkifli mengemukakan, setiap pemutusan hubungan kerja harus memenuhi syarat-syarat ketenagaan kerja. Diharapkan Disnaker Kab.Langkat segera memanggil kedua belah pihak guna menyelesaikan secara hukum.(a04)

Curi 120 Butir Telur Bebek Ditangkap Polisi SEI RAMPAH(Waspada): HZ alias Izul, 35,warga Dusun II, DesaSukajadi,Kec.TanjungBeringin,Kab.SerdangBedagaiditangkap Polres Sergai Rabu(2/2) siang atas sangkaan mencuri 120 butir telur bebek milik Irwansyah, 41, warga Dusun Sidodadi, Desa Liberia, Kec.Teluk Mengkudu. Selain menangkap tersangka, petugas juga berhasil mengamankan 1 keranjang plastic berisi rumput, 1 pasang sandal, 1unit sepeda motor BK 5530 MV dan 120 butir telur bebek hasil curian sebagai barang bukti. Keterangan yangWaspada peroleh, tersangka sudah berulang kali hari mencuri telur bebek milik korban dan diprediksi sudah berlangsung 8 bulan. Kasubbag Humas Polres Sergai AKP ZN.Siregar ketika dikonfirmasi membenarkan penangkapan tersangka.(a08)

Polisi Tangkap Pria Cabuli Anak Di Bawah Umur BINTANGBAYU (Waspada): Seorang pria berinisial HDP,19, warga Dusun II, Desa Damak Tolong Buho, Kec.Bintang Bayu, Kab.Sergai ditangkap Polsek Kotarih saat berada di Desa Gudang Garam, Rabu(2/2) pukul 03:30 atas sangkaan tiga kali mencabuli anak dibawah umur. Keterangan yang Waspada peroleh, Rabu(2/2) menyebutkan, sebelum peristiwa pencabulan itu terjadi tersangka mengajak korban lari ke Desa Gudang Garam. Sesampainya di Desa Gudang Garam tersangka memaksa korban JL,16, yang berstatus pelajar kelas II SMA itu melakukan perbuatan cabul. Korban menolak, tetapi tetap dipaksa dengan cara bujukrayu. Sehingga tersangka sempat tiga kali mencabuli korban.Yang pertama kali terjadi, Kamis(27/1) pukul 04:00, kedua kalinya pukul 08:00 dan ketiga kalinya pukul 13:30. Akibat kejadian itu orangtua korban merasa keberatan dan melaporkannya ke Mapolsek Kotarih. Atas pengaduan orang tua korban Helman Sihotang tersangka ditangkap. Kasubbag Humas Polres Sergai AKP ZN.Siregar yang dikomfirmasi Waspada, Rabu(2/2) membenarkan tersangka telah ditangkap.(a08)

Waspada/Andi Nasution

TARIK TAMBANG: Para guru dan pegawai di lingkungan Yaspendhar yang terdiri dari 12 tim mengikuti lomba tarik tambang pada Harapan Expo 2011 rangkaian HUT ke-44 Yaspendhar di kampus II Johor, Gedung Johor, Kec. Delitua, Kab. Deliserdang, Jumat (4/2).

19 Sekolah Meriahkan Tari Tradisional Harapan Expo 2011 GEDUNG JOHOR (Waspada): Sebanyak 21 grup tari dari 19 sekolah turut berpartisipasi dalam lomba tari-tarian memeriahkan Harapan Expo 2011 dalam rangkaian HUT ke-44 Yaspendhar di kampus II Johor, Gedung Johor, Kec. Delitua, Kabupaten Deliserdang, Jumat (4/2). 19 Sekolah itu, SMAN 11, SMA Azizi, SMP Amir Hamzah, SMP Harapan 3, MTs Miftahussalam, SMPN 2 Delitua, SMA Harapan 2, SMP Darul Ilmu Murni (DIM), SMP Harapan 2, SMA Brigjend Katamso Sunggal, SMP Namira, SMA Harapan I Medan, SMA Harapan 3, SMK Farmasi Afifsu, SMP Harapan Mandiri, SMKN 7 Medan, SMA DIM, SMKN 3 dan SMP Azizi. Sedangkan SMP Negeri 2 Delitua dan MTs Miftahussalam mengirimkan dua grup tari. Di saat yang bersamaan juga digelar lomba tarik tambang diikuti 12 tim dan lomba trompa (bakia) terdiri dari 15 tim dari seluruh unit di lingkungan Yaspendhar antara lain STIE, STTH, STBA, pegawaiYaspendhar, SD Harapan 3, SMP Harapan 1, SMP Harapan 2, SMA Harapan 1, SMA Harapan 2, SMA Harapan 3, TK Harapan dan SD Harapan 1 di Lapangan Bola kampus itu juga berlangsung meriah. Ketua panitia Hairul Anwar menyebutkan, perlombaan antar sekolah Yaspendhar (intern) diadakan untuk mempererat tali silaturrahim antar pengurus, guru dan pegawai Yaspendhar. “Dengan adanya perlombaan intern ini diharapkan tali silaturrahim antar pengurus, guru dan pegawaiYaspendhar tetap terjaga dan semakin meningkat. Untuk tari tradisional ini agar para siswa dapat menampilkan bakat dan kreativitas yang mungkin selama ini belum tersalurkan,” jelasnya. (c02/m43)

B1 Zhuhur ‘Ashar 15:59 16:06 16:04 15:59 16:01 15:59 15:58 16:08 16:02 15:57 15:59




Shubuh Syuruq

18:39 18:46 18:42 18:36 18:39 18:38 18:38 18:42 18:40 18:35 18:36

19:51 19:58 19:53 19:48 19:51 19:50 19:50 19:54 19:52 19:47 19:48

05:03 05:09 05:10 05:07 05:08 05:03 04:59 05:18 05:08 05:02 05:05

05:13 05:19 05:20 05:17 05:18 05:13 05:09 05:28 05:18 05:12 05:15

06:31 06:38 06:38 06:35 06:36 06:32 06:31 06:46 06:36 06:30 06:33

MA Vonis Ketua DPRD T. Tinggi Setahun Penjara Dan Denda Rp50 Juta TEBINGTINGGI (Waspada): Mahkamah Agung Republik Indonesia, memvonis Ketua DPRD Tebingtinggi HM Sjafri Chap dengan hukuman penjara setahun dan denda Rp50 juta dalam kasus korupsi asuransi anggota DPRD periode 1999-2004. Salinan vonis, telah diterima PN kota Tebingtinggi dengan No.567/Pid.B/2007/PN.TTD tanggal 29 juli 2009.Vonis itu merupakan hasil kasasi yang dilakukan JPU KejariTebingtinggi atas putusanmajelishakimPNTebingtinggi. “Kitasudahmenerimasalinan putusan MA soal itu, 24 Januari lalu untuk didisposisi,” ujar HumasPNTebingtinggiMhd.Nuzuli, SH, Rabu (1/2) di ruang kerjanya. Kata dia lagi, setelah didispo-

sisi Ketua PN, dalam waktu dekat PN akan mengirimkannya ke JPU Kejari untuk dilakukan eksekusi. Kasusini,diakuinyamengundang perhatian warga, sehingga harus secepatnya ditindaklanjuti. Di hari yang sama, pimpinan dan anggota DPRDTebingtinggi, beraudiensi dengan Ketua PN terkaitinformasiturunnyasalinan putusan MA itu. Dikatakan, sebelumnya JPU Kejari Tebingtinggi mengajukan kasasi ke MA terkait putusan majelis hakim PN Tebingtinggi yang menjatuhkan vonis hukumanpercobaankepadaterdakwa Ketua DPRD HM Sjafri Chap atas kasuskorupsiasuransi25anggota DPRD periode 1999-2004. Pengajuan kasasi itu terdaftar dengan No.Reg.1213K/PID.SUS/ 2009 atasa nama HM Sjafri Chap. Kemudian MA melalui sidang 18 Agustus 2010 dengan ketua majelis hakim R. Iman Harjadi, SH dan

anggota HM Zaharuddin Utama, SH.MMdanHMansurKartayasa, SH.MH, memutuskan Ketua DPRD T. Tinggi yang sudah tiga periodememimpinitu,ber-salah. Dalam amar putusan MA itu, tertulis terdakwa HM Sjafri Chap tidak terbukti secara sah dan meyakinkanbersalahmelakukantindakan pidana, sebagaimana di dakwaan primer dan membebaskan terdakwa dari dakwaan primer. Menyatakan terdakwa HM Sjafri Chap telah terbukti secara sah dan meyakinkan bersalah melakukan tindak pidana secara bersama-sama melakukan tindakpidanakorupsi.Menjatuhkan pidana terhadap terdakwa HM Sjafri Chap dengan pidana penjara selama 1 tahun dan denda Rp50 juta, dengan ketentuan apabiladendatidakdibayarmaka akan diganti dengan hukuman kurungan selama 4 bulan. (a09)

Tarif Listrik Di Rusunawa Melebihi Tarif Umum T.TINGGI (Waspada):Tingginya pembayaran tarif listrik yang melebihi pemakaian golongan umum bagi penghuni rumah susuncarasewa(Rusunawa)diJalan Sekh Beringin, Sei. Segiling, Kec. Padang Hilir, Tebingtinggi membebanipenghuniRusunawayang umumnyawargakurangmampu. Keresahan masyarakat komplek Rusunawa LingkunganVIII, Kel.Tebingtinggi,Kec.PadangHilir, Tebingtinggi itu disampaikan kepada Pj.WalikotaTebingtinggi, Drs Eddy Syofian, MAP melalui suratnya tertanggal 23 Desember 2010 dengan nomor 01/MASRusun/XII/2010. Akantetapihinggakinibelum adajawabandanresponterhadap surat itu. Berdasarkan informasi di sana , tarif listrik untuk Rusunawa 1.380 per meter kwh, sedangkan golongan masyarakat

umum Rp 495 per meter kwh. “Masyarakat di sini cukup resah dan rencana akan melakukan aksi unjukrasa ke DPRD dan PemkoTebingtinggi. Selainmasalah listrik, banyak lagi permasalahanyangmembebanikeuangan warga di sini,” ucap salah seorang penghuni Rusunawa yang tidak mau disebutkan namanya. Dalam surat itu mereka menyatakan keberatan dengan kebijakan yang dikeluarkan pengelola Rusunawa mengenai tarif dasar listrik (TDL) yang terlalu tinggi dibandingkan dengan TDL yang dikeluarkan PLN kepada masyarakat umumnya. TDLyangdibebankankepada penghuni Rusunawa berbedabeda sehingga membingungkan dan tidak ada standar harga TDL yang menjadi acuan pengelola Rusunawa dengan kata lain,

aturannya semena-mena. Kepala Rusunawa Abdul Hayat Sinambela ketika dikonfirmasi, mengakui tingginya pembayaran tarif listrik di Rusunawa melebihi tarif listrik golongan umum. Hal itu diakui untuk menghidupkan mesin yang ada di Rusunawa secara keseluruhan terlalubesarpemakaianaruslistrik yang digunakan. Pembayaran listrik kepada PLN oleh pihak pengelola Rusunawa secara keseluruhan. Sedangkan pengutipan pembayaran tarif listrik kepada penghuni Rusunawa dilakukan pengelola. Ada biaya abudemen di sana, dimana pakai tidak pakai tetap dikenakan biaya. Karena itu katanya, perlu duduk bersama antara PLN, Pemko dan pengelola Rusunawa untuk membahas masalah itu. (a09)

Pemko T. Tinggi Asuransikan 10 Ribu Warga TEBINGTINGGI (Waspada): PemkoTebingtinggi bekerjasama dengan PT Askes Cabang P. Siantar, mengasuransikan 10 ribu warga tidak mampu, melalui Program Jaminan Kesehatan Masyarakat Umum. Nilai kontrak jaminan itu mencapai Rp1,8 miliar, berasal dari APBD TA 2011. Penandatangananperjanjian kontrak itu dilaksanakan, Selasa (1/2), di ruang kerja Pj Walikota Eddy Syofian dengan Pimpinan PT Askes Cabang Pematangsiantar dr Nur Eva Parinduri, disaksikan Sekdako H Hasbi Budiman. Dari perjanjian itu, warga kurang mampu akan mendapatkan pelayanan kesehatan gratis selama 11 bulan, terhitung 1 Februari 2001 hingga 31 Desember 2011. Sedangkan jenis pelayanan kesehatan yang diberikan, yakni rawat jalan tingkat pertama di Puskesmas, rawat inap tingkat pertama di Puskesmas, rawat inap-rawat jalan tingkat lanjutan, rawat inap tingkat lanjutan. Persalinan, pelayanan haemodialisa, pelayanan obat, pelayanan darah (bagian darah), pelayanan am-

bulans.Khusus untuk pelaya-nan rawatinaptingkatlanjutandilaksanakandiRSUDrPirngadi,Medan. Pj Walikota H Eddy Syofian di sela-sela acara penanda tanganan,mengatakankerjasama ini merupakan wujud dari kepedulian Pemko Tebingtinggi atas warga kota. Di mana dengan adanya kerjasama itu, ada jaminan kesehatan kepada warga khusus-

nyawargakurangmampu,bahwa jika mereka sakit, tak perlu harus memikirkan biaya perobatan. Selama ini, lanjut Pj.Walikota, rakyat kecil merasakan sulitnya mendapatkan pelayanan kesehatan, karena biaya yang besar. Atasdasaritu,PemkoTebingtinggi bertekad memberikan perhatian kepadawargauntukpeningkatan derajat kesehatan mereka. (a09)

Warga Pegajahan Temukan Mayat Perempuan PEGAJAHAN (Waspada): Warga Kecamatan Pegajahan dibuat gempar dengan ditemukannya sesosok mayat perempuan yang dikenal bernama Herlina Barus, 53, warga Dusun IV, Desa Pegajahan, Kec.Pegajhan, Kab.Sergai di areal perladangan milik korban, Jumat (4/2) pukul 08:30. Diduga kematian korban akibat meneguk racun rumput. Menurut keterangan saksi mata, mayat itu ditemukan dalam keadaan telentang di areal perladangan. Saat ditemukan korban berpakaian lengkap dan mulut korban dalam keadaan mengeluarkan buih. Sementara disamping mayat ditemukan sebotol racun rumput yang diamankan polisi sebagai barang bukti. Korban diduga mati bunuh diri dengan meminum racun rumput tersebut. Kasubbag Humas Polres Serdang Bedagai AKP ZN Siregar, Jumat (4/2) sore membenarkan telah ditemukannya mayat perempuan yang diduga mati bunuh diri. (a08/c03)


LIHAT STAND: Pengunjung saat melihat stand Harapan yang menawarkan berbagai produkproduk kerajinan siswa, buku-buku, busana muslim, tas dan aksesoris pada bazar Harapan Expo 2011 di kampus II Johor, Gedung Johor, Kec. Delitua, Kab. Deliserdang, Jumat (4/2).

123 Stand Ramaikan Bazar Harapan Expo 2011 GEDUNG JOHOR (Waspada): 123 Stand meramaikan bazar Harapan Expo 2011 dalam rangkaian HUT ke-44Yayasan Pendidikan Harapan(Yaspendhar)yangdigelarsejakKamishingga Minggu (3-6/2) di Kampus II Johor, Gedung Johor, Kec. Delitua, Kab. Deliserdang, Jumat (4/2). Ke-123 stand itu terdiri dari 13 stand profil pendidikan di lingkunganYaspendhar Medan, 100 stand UMKM antara lain stand aksesoris, makanan, fotografer, permainan dan lain-lain serta 10 stand surnival terdiri dari perbankan, asuransi dan otomotif. Sedangkan stand SD, SMP dan SMA Harapan 3 selain menampilkan profil dan prestasi sekolah juga menawarkan berbagai produk antara lain kreativitas siswa, buku, busana muslim dan berbagai aksesoris. Stand SD, SMP dan SMA Harapan 1 juga menampilkan profil dan prestasi sekolah, juga menawarkan berbagai produk mainan anak-anak, aksesoris serta makanan dan minuman ringan. Stand SD, SMP dan SMA Harapan 2 Medan juga menampilkan profil dan berbagai prestasi sekolah. Menurut Wakil Kepala Bidang Kurikulum SMP Harapan 2 Drs Syawaluddin Akbari, pihak sekolah hanya menampilkan profil dan prestasi sekolah agar para pengunjung stand bisa mengetahui tentang perkembangan sekolah. “Denganmengetahuiperkembangansekolah diharapkan hubungan baik antara sekolah dengan orangtua dan masyarakat tetap terjalin,” ujarnya.

KetuaPanitiaSuryahadiMarwan,SPdmengatakan, antusias pengunjung pada hari pertama melebihi target yang diharapkan.“Alhamdulillah pada hari pertama bazar mencapai 6.000 pengunjung,” sebutnya. Menurut Marwan, bazar dibuat semeriah danselengkapmungkinsehinggaparapengunjung dapat melihat berbagai kebutuhan masyarakat pada stand-stand yang telah disediakan,” ujarnya. Dikatakan Marwan, bazar Harapan Expo tersebut merupakan wujud terimakasih kepada siswa,orangtuasiswadanmasyarakatyangselama ini telah membesarkanYaspendhar Medan.“Terimakasih kepada pembina, pengurus dan pengawasYaspendharyangtelahmendukungsepenuhnya kegiatan ini. Juga kepada orangtua dan yang mewakili orangtua,” sebut Marwan lagi. Positif Sementara para pelaku UMKM yang turut meramaikan bazar Harapan Expo 2011 menyambut positif kegiatan tersebut. “Kegiatan ini sangat bagus dan diharapkan kedepannya kegiatan ini menjadi agenda tahunan sekolah,” ungkapYanti salah seorang pelaku UMKM yang turut memeriahkan bazar yang menawarkan berbagai aksesoris antara lain dompet, kacamata dan topi dengan harga bervariasi. Dadang,salahseorangpelakuUMKMlainnya yangmenawarkanmakananberupadodoldengan berbagai rasa juga menyatakan hal senada. “Semoga Yaspendhar tetap dan semakin jaya agar di tahun-tahun berikutnya dapat mengadakan bazar kembali,” ungkapnya. (c02/m43)

Sindikat Belum Terungkap, Curanmor Terus Meningkat STABAT (Waspada): Aksi pencurian kendaraan bermotor (curanmor) terus meningkat di Kab. Langkat. Dalam pekan silam empat sepeda motor hilang di Kec. Secanggang, Tanjungpura, Serapit dan dua di Stabat. Sementara kini dua hari berturut-turut, Rabu dan Kamis (3/2), tiga kendaraan bermotor kembali raib. Kasat Reskrim Polres Langkat AKP Doni Alexander ketika dimintai konfirmasinya, Jumat (4/2), meminta pemilik kendaraan lebih meningkatkan kewaspadaan khususnya saat parkir. ’’Gunakan kunci ganda dan secepatnya laporkan kejadian untuk mempersempit ruang gerak pelaku. Kepolisian akan terus menindaklanjuti laporan masyarakat,’’ tuturnya. Tiga kendaraan bermotor yang hilang Rabu

dan Kamis (3/2) sebagaimana dimaksud, yakni di Kec. Babalan, Sei Lepan dan di parkiran PengadilanNegeriStabat.DiJalanThamrinKec.Babalan, sepeda motor Mio warna putih BK 5402 LP milik NurJannah,hilangditerasrumahnya,Rabumalam. Saat dia hendak memasukan sepeda motor bernomor rangka MH328D-2039KI46730 itukedalamrumah,sudahtidakterlihatditerasnya. Meskikorbanbersamaanggotakeluarganyamelakukan pencarian, sepeda motor tidak ditemukan. Berikutnya, Husen, 35, warga Lingkungan V Alur Dua, Kec. Sei Lepan, kehilangan mobil L300 BK 9675 PH saat parkir di halaman rumahnya Kamis waktu subuh. Selanjutnya, sepeda motor milik Rulihatoni Barus yang hilang diparkiran Pengadilan Negeri Stabat, Rabu. (a03)

Istana Balon Harapan Expo Diminati Anak-anak BALON berbentuk istana menjadi incaran para siswa dan pengunjung yang hadir meramaikan Harapan Expo 2011 rangkaian HUT ke-44 Yaspendhar di kampus II Johor, Gedung Johor, Kec. Delitua, Kab. Deliserdang. “Balon-balondisinibukanlah balonyanggampangmeletustapi inflatableballoon,balonyangmemang dirancang khusus untuk dijadikan wahana permainan anak-anak,” ujar Andi yang merupakan pemilik istana balon. Menurutnya, di wahana seluncuran, anak-anak dilatih untuk berani meluncur dari ketinggiansekitarsatumeterdanjuga melatih nyali seorang anak sedini mungkin. “Hanya dengan voucher Rp5.000 anak-anak dapat menikmati asyiknya bermain di istana balon selama 10 menit,”

sebut Andi. Dikatakannya, minat anakanak terhadap wahana istana balon sangat tinggi yang dibuktikan dengan ramainya anak-anak yang bermain. “Hari kedua memang berkurang mungkin dikarenakan sedang hari sekolah,” katanya sembari mengawasi anak-anak yang bermain. Disebutkan pria yang berasal dari Ranah Minang ini, di wahana anak-anak bisa asyik berlompatlompatan di atas balon yang mementalkan badan mereka sambil berteriak-teriak gembira. Disampingitu,paraorangtua tidak perlu khawatir dengan keamanan anak-anak karena wahanayangdimasukianak-anak akan tetap dijaga dan diawasi selama bermain. Terlihat puluhan anak diwarnai tawa sedang menikmati dan asyik bermain di wahana istana balon dengan berseluncur dari ketinggian sekira satu meter dan

melompat-lompat sehingga mementalkan badan mereka. Di samping itu, Andi juga mengucapkan terimakasih kepada Yaspendhar atas pelaksanaan bazar tersebut dan berharap Yaspendhar tetap eksis di dunia pendidikan serta mengharapkan agar bazar serupa menjadi agenda tahunan Yaspendhar. Permainan Anak Dalam arena bazar itu juga dimeriahkan dengan suguhan balonmandibolayangmendapat perhatian serius bagi pengunjung yang mayoritas anak-anak. Selain itu juga, dua kereta api anak-anak uga turut menyahuti kebutuhan anak-anak yang hari itu benarbenar bergembira. MenurutKetuaPanitiaSuryahadi Marwan, SPd, kita sengaja mengundang berbagai permainan dalam bazar kali ini. Hal itu kita lakukan untuk menyahuti keinginan anak-anak yang masih haus akan hiburan.

Di samping itu, untuk anakanakyang menyukai tantangan kita sediakan flying fox yang dikoordintor dari Kampoeng Stakoetoe. “Permainan ini menggunakan media tali untuk meluncur dari ketinggian tertentu dan mendarat di tempat lain. Di sini peserta dituntut untuk berani dan percaya diri, serta tidak menganggapsepele terhadaptantangan sekecil apapun,” katanya. Dijelaskan Marwan, melalui berbagai permainan ini, suasana kondusif dapat diciptakan. Membangun konsentrasi anak untuk dapat berpikir, bertindak lebih baik dan lebih efektif. Sebab , kegiatan akan terfokus dan dinamis. Terfokus dengan materi yang akan diberikan kemudian, sehingga anak merasa perlu belajar dalam suasana tidak menjemukan. Dinamis dalam mengikuti kegiatan pembelajaran, tidak terpaksakarenakurangbergairah. Andi Nasution

Waspada/Andi Nasution

ISTANA BALON: Puluhan pengunjung yang terdiri dari anakanak ditemani orangtua mereka meminati wahana istana balon yang tersedia pada bazar Harapan Expo 2011 rangkaian HUT ke-44 Yaspendhar di kampus II Johor, Gedung Johor, Kec. Delitua, Kabupaten Deliserdang dipadati para pengunjung, Jumat (4/2).

Sumatera Utara


Akses Jalan Kapias Batu VIII Rusak Parah


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Edisi Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Kalitbang: Hj. Emma Sujianti Tarigan. Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); H.T. Donny Paridi (Aceh); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Rustam Effendi, Mursal Alfa Iswara. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri Batubara. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Asahan: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapak Tuan: Zamzamy Surya. Blang Pidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Partai Demokrat L. Batu Hari Ini Gelar Muscab II RANTAUPRAPAT (Waspada) : Dipastikan hari ini, Sabtu (5/2), Dewan Pimpinan Cabang (DPC) Partai Demokrat Labuhanbatu menggelar Musyawarah Cabang (Muscab) II di Gedung Nasional Rantauprapat, yang langsung dihadiri dan dibuka Ketua DPD Partai Demokrat Sumut HT Milwan. Hal itu ditegaskan Ketua DPC Partai Demokrat Labuhanbatu H.Mukhlis Hasibuan, Jumat (4/2) ketika meninjau persiapan Muscab II itu di Gedung Nasional Rantauprapat. Dikatakan, Muscab II DPC Partai Demokrat Labuhanbatu ini bertujuan untuk memilih dan menyusun kepengurusan DPC Partai Demokrat Labuhanbatu Periode 2011-2016, sekaligus dalam rangka menyusun program kerja untuk lima tahun ke depan. Menurut Mukhlis, Muscab II DPC Partai Demokrat Labuhanbatu ini berthemakan“Melanjutkan Bakti Untuk Sumatera Utara”. Bahkan ia menambahkan bahwa persiapan untuk pelaksanaan Muscab II ini sudah rampung. Peserta Muscab II Partai berlambang Bintang Segitiga itu terdiri dariPengurusDewanPimpinanPusat(DPP),DewanPimpinanDaerah (DPD) Sumut, Dewan Pimpinan Cabang (DPC) Labuhanbatu dan 9 Pengurus Dewan Pimpinan Anak Cabang (DPAC) se-Labuhanbatu. Disinggung masalah kandidat ketua, Mukhlis Hasibuan mengatakan, sebagai kandidat Ketua DPC Partai Demokrat Labuhanbatu, dirinya siap mengibarkan Partai Demokrat untuk lima tahun ke depan. (c07)

WASPADA Sabtu 5 Februari 2011

ASAHAN (Waspada) : Akses jalan dari dan menuju Desa Kapias BatuVIII, Kec.Tanjungbalai, Kab. Asahan kondisinya memprihatinkan sehingga sangat sulit untuk dilalui, baik kendaraan roda dua maupun empat. Pantauan Waspada, ruas jalan sepanjang belasan kilometer lebihmiripkubangankerbau,karenaselaindipenuhilubangmenganga dan berlumpur juga tergenang air sehingga pengguna jalan harus ekstra hati-hati saat melintas. Menurut salah seorang warga, Ramlah Saragih, 32, jalanan yang licin sering menyebabkan terjadinya kecelakaan terutama bagi siswa yang hendak pergi dan pulang sekolah. Hal senada juga dikatakan Syamsul, 40, bahwa kondisi jalan diperkirakan rusak berat sekitar 85 persen dan hampir tidak dapat dilalui jika hujan turun. Sehingga, kata Syamsul, berbagai aktivitas akan terganggu mulai dari palayanan kesehatan, pemerintahan, pendidikan, juga transportasi barang dan jasa mengakibatkan roda perekonomian tidak bergerak. Oleh karena itu, harap Syamsul, dirinya dan warga desa meminta perhatian Pemkab Asahan segera membangun infrastruktur jalan agar roda perekonomian yang selama ini terganggu terutama akibat besarnya biaya angkutan tranportasi dapat berjalan dengan baik. “Kalau jalan rusak begini, ongkos angkutanpun bertambah menjadi dua kali dari harga standar,” pungkas Syamsul. (a32)

Waspada/Rasudin Sihotang

KUBANGAN: Akses jalan dari dan menuju Desa Kapias Batu VIII, Kec. Tanjungbalai, Kab. Asahan kondisinya lebih mirip kubangan kerbau karena banyaknya lubang menganga di badan jalan sehingga kerap menyebabkan kecelakan. Foto direkam, Rabu (2/ 1).

Fasilitas SMPN 1 Seikepayang Memprihatinkan 6 Bulan Tak Pernah Upacara SEIKEPAYANG (Waspada) : Sarana dan prasarana SMP Negeri 1 Kec. Seikepayang Barat memprihatinkan. Malah, sejak 6 bulan terakhir, siswanya tidak pernah melaksanakan upacara bendera dan praktik olahraga, karena lahan sekolah selalu terendam air. “Sejak 6 bulan ini kami tak pernah upacara bendera, karena halamansekolahselaluterendam air. Untuk praktik olahraga, terpaksa di ruangan belajar,” ujar siswa SMP Negeri 1 Seikepayang, Syafrina Amalia, Azmi Hardiansyah, Arief Rahman dan Aulia Syahfitri, Jumat (4/2). Keempat siswa itu menyatakan, selain halaman yang selalu terendam air, masih banyak fasilitas sekolah yang belum dinikmati mereka. Di antaranya, komputer, mushalla, laboratorium dan kamar mandi serta minimnya buku referensi di perpustakaan. “Sampai kelas III, kami hanya dua kali memegang komputer,” ujar Syafrina, Azmi dan Arief. Sementara Aulia, belum pernah menyentuh keyboard komputer. Kepala Sekolah SMP Negeri 1 Bakhtiar Nasution mengakui jikasiswanyatakpernahmelaksanakanupacarabenderatiapSenin. “Siswa tidak upacara karena kondisitidakmemungkinkan.Jadi anak-anak langsung belajar pada pukul 07:30,” ujar mantan Kasek SMP Negeri 1 Seidadap yang pernah mendapat nominasi Adiwiyata Nasional ini. Bakhtiar menuturkan, saat ini sekolah juga tidak punya komputer, sehingga siswa hanya mendapatkanteori.Dan,menurut Bakhtiar, meskipun siswanya 100 persen muslim, namun tidak ada mushalla dan tempat wuduk di sekolah itu. Malah kamar mandi pun, kondisinya sangat memprihatinkan. “Kami menampung air hujan untuk keperluan di kamar mandi,” jelas Kasek yang bermukim di Kisaran itu. Pertama Di Seikepayang Ketua Komite SMP Negeri 1AzwaniSiagianmengungkapkan,

Waspada/Rahmad F Siregar

TERENDAM: Siswa SMP Negeri 1 Seikepayang Barat, Kab. Asahan, tidak pernah melaksanakan upacara bendera dan praktik olahraga akibat lahan sekolah selalu terendam air. Sekolah ini juga tidak memiliki mushala, padahal siswanya 100 persen Islam. Foto direkam, Jumat (4/2). sekolah itu merupakan SMP Negeri pertama yang didirikan di Seikepayang. Masa itu bangunannyamasih6ruangan,dankini bertambah menjadi 15 ruangan. Akan tetapi, 6 ruangan yang pertama dibangun itu, hingga kini tak pernah direhab oleh Pemkab AsahanmelaluiDinasPendidikan. Ironisnya, meubiler di ruang guru merupakansisa-sisabuatan1980an. Dia menuturkan, minimnya saranadanprasaranaSMPNegeri 1, otomatis berimbas pada penurunan gairah belajar siswa. “Bangunannya tak ada perubahan dan kami pun sudah bolak-balik mengusulkan ke Pemkab melalui Dinas Pendidikan, tapi belum disahuti,” ungkap Azwani. Pantauan Waspada, siswa SMP Negeri 1 belajar di ruangan dengan menggunakan meubiler yang tidak layak pakai. Kursi kayu tanpasandaran,mejabelajaryang kropos dan lantai ruangan yang mulai mengelupas. Untuk menutupi kekurangan kursi, guru pun terpaksa merelakan kursi plastiknya dipakai siswa. Di sejumlah ruangan bahkan ditemukan pintu yang sudah dimakan umur, reyot, dan posisinya pun miring. Pintu itu merupakan peninggalan tahun 1980-an.

Gebyar Peduli Pendidikan Kendati fasilitas sekolah sangat minim, namun semangat siswa dan guru untuk saling memberi dan menerima pelajarantetaptinggi.DinasPendidikan kurang peduli dengan kondisi sekolah, maka Kepala Sekolah, Ketua Komite dan guru serta orang tua siswa pun bergerilya dengan membentuk program Gebyar Peduli Pendidikan. Program ini dicanangkan pada 23 Maret 2010 lalu dengan motto “ tiada hari tanpa membangun.” “ Gebyar peduli pendidikan ini tujuannya membenahi sarana dan prasarana sekolah dalam rangka menyadarkan seluruh elemen untuk berperan serta meningkatkan fisik sekolah, terutama para alumni,” kata BakhtiarNasutionyangmenjabat Kasek SMP Negeri 1 sejak Januari 2010 lalu. Ketua Peduli Pendidikan B Sigalingging menjelaskan, sejak dicanangkan, dana yang terkumpul melalui program itu baru Rp8 juta dari target Rp 496 juta. Dana yang tidak seberapa itu, lanjut Sigalingging,dimanfaatkanuntuk pembangunan jalan dari pintu gerbang ke ruang kelas dan kantor, pembangunan jembatan ke komplek sekolah dan parkir, pembuatan lantai parkir, podium

upacara, pemasangan lantai keramik dan pengadaan majalah dinding. Kemudian, pengecatan gedung dan pagar sekolah, pengadaan lemari kaca, pengadaan kursi plastik dan tempat sampah, perbaikan seluruh lemari guru, dan pembuatan taman sekolah. “Dibandingkan tahun lalu, sekolah ini sudah jauh berubah. Meskipun lingkungan sekolah tanah rawa, sehingga pengangkutan material bangunan sulit, tapidengankomitmendansemangat tinggi, kami sudah mulai membangun melalui program peduli pendidikan,” ujar Sigalingging di dampingi guru S.Perangin-angin. Dia menambahkan, untuk mensukseskan pembenahan sarana dan prasarana sekolah, diharapkan peran serta alumni SMP Negeri 1, termasuk putraputri Seikepayang yang sukses di perantauan, seperti di legislatif Asahan maupun Sumut. Ketua Komite Sekolah Azwani Siagian mengakui, setahunterakhiriniwajahsekolah mulai berubah, meskipun belum maksimal. “Sekolah ini sempat terpuruk, sehingga perlu pembenahan serius. Dan, Alhamdulillah mulai ada peningkatan sejak setahun terakhir ini,” jelas Azwani. (a14)

“Mereka hanya mencari keuntungan dan memanfaatkan peluang.Olehsebabitupihaknnya akan berkoordinasi dengan lurah dan petugas kesehatan, untuk menghentikanpenjualanitu,”kata Habinsaran. Pengawas Supervisor Pemberantasan Penyakit Bersumber dari Binatang (P2 B2) Abdul Haris mengatakan, bubuk yang dijual itubelumbisadipastikankeasliannya dan mampu mengatasi per-

kembangan nyamuk penyebar DBD. Sedangkan pihak Dinkes menyediakan bubuk abate dengan gratis untuk masyarakat yang bisa diambil puskesmas terdekat. “Kita harap masyarakat lebih berhati-hati, dan jangan terpengaruh sehingga membeli bubuk itu. Bila ditemukan para penjualnya segera menghubungi pihak kesehatan terdekat,” kata Haris. Informasi dihimpun, Kamis

(3/2) menyebutkan, penjual bubuk abate itu seharga Rp2.500 per bungkus berasal dari Medan dan membawa nama Dinkes Asahan. Tidak hanya itu, oknum tersebut memaksa masyarakat membelinya.Tapi hingga saat ini penjualnya belum diamankan, sehingga mereka bebas berkeliaran dan tidak tertutup kemunkinankegiatanitutelah menyebar di wilayah Kabupaten Asahan. (a15)

3 Warga Pantaiburung Terserang DBD TANJUNGBALAI (Waspada): Jangka waktu sepekan terakhir, tiga warga Jalan M Abbas, Kel. Pantaiburung, Kec.Tanjungbalai Selatan terserang penyakit demam berdarah dengue (DBD). Ketiga korban yaitu Nabila, 6, terpaksa dilarikan keluarga ke RumahSakitUmumTanjungbalai pada Kamis (3/1) karena kondisinya kritis dan sekejur tubuhnya berubah membiru. Menurut ibunya Lindawati, korban sempat dirawat di rumah selama beberapa hari di bawah pengawasan

RANTAUPRAPAT (Waspada): Bupati Labuhanbatu dr H Tigor Panusunan Siregar, SpPD diminta agar teguh pendirian dan tetap berjalan lurus mengemban amanah rakyat. Ketua Pimpinan Daerah (PD) Al Washliyah Kabupaten L.Batu Drs H Abdul Roni Harahap mengingatkan itu saat Seminar Nasional dan Musyawarah Daerah (Musda) XII Al Jamiatul Wasliyah L.Batu, Rabu (2/2) di Asrama Haji Rantauprapat. Menurut mantan Ketua DPRD L.Batu itu, apabila seorang pemimpin tetap komit dan amanah menjalankan mandat rakyat, Insya Allah segala kebijakan, program dan kegiatan yang dicanangkan akan menuai hasil yang baik pula. “Masyarakat khususnya kader AlWashliyah berharap agar sampai kapanpun Tigor terhindar dari perbuatan menyimpang sehingga tersangkut perkara seperti yang dialami oleh beberapa kepala daerah saat ini,” ujarnya. Pada bagian lain, Abdul Roni mengharapkan agar AlWashliyah yang salah satu misinya bergerak di sektor pendidikan dapat meningkatkan kerja sama dengan Pemkab L.Batu untuk mencapai pendidikan berkualitas di daerah tersebut. Menanggapi itu, Tigor menyatakan, harapan yang disampaikan kader Al Washliyah kepada dirinya adalah harapan sama yang dimaksudkan Pemkab Labuhanbatu. (a18)

Siswa SMPN T Tiram Juara Langgam Melayu

Penjualan Bubuk Abate DBD Bermasalah KISARAN (Waspada) : Penjualan bubuk abate Demam Berdarah Dangue (DBD) di Kisaran bermasalah karena dinilai menjual nama Dinkes Asahan disebabkan tidak ada kontrak kerja. Hal itu ditegaskan Kadis Dinkes Kabupaten Asahan Habinsaran Nasution, Jumat (4/2). Menurutnya, oknum penjual bubuk itu, tidak ada kontrak kerja dan hanya menjual nama agar barangnya laku terjual.

Tigor Siregar Diminta Tetap Lurus

dokter setempat, namun kondisinya tak kunjung membaik malah semakin parah. “Panasnya kadang naik dan turun, bahkan pernah tubuhnya sangat dingin seperti es. Setelah di rumah sakit baru diketahui bahwa Nabila terserang DBD,” tutur Linda, Jumat (4/2). Sementara pasien lainnya Rizaldi, 13, juga sempat dirawat di rumah, namun hanya tiga hari dan langsung dibawa ke rumah sakit karena khawatir terserang demam berdarah mengingat dua

hari sebelumnya terdapat korban DBDdilingkungannya.Dikatakan kakeknya, dirinya kecewa terhadap petugas Dinas Kesehatan yang melakukan pengasapan (fogging), karena tidak pernah dilakukan di rumah korban. “Pernah saya lihat pengasapandisekitarsitu,sayafikirrumah saya juga difogging, namun ternyata tidak sampai, padahal telah banyak jatuh korban DBD disini,” terangnya. Sedang pasien ketiga Allu Hafis, 7,5, dirawat di

rumahsakitselamaseminggulalu, namun akhirnya diperbolehkan pulang mengingat kondisinya telah membaik. Direktur RSUD T Mansyur Tanjungbalai dr Hj Diah Retno W Kusuma didampingi Kabag Humas Pemko Tanjungbalai DarulYanaSiregarmembenarkan. Dikatakan Diah, semua pasien masih menjalani perawatan intensif, namun Allu Hafiz telah diperbolehkan pulang ke rumah sejak dua hari lalu. (a32)

TANJUNGTIRAM (Waspada) : Siswa SMPN 2 Ujungkubu Tanjungtiram Irfan dan Mawaddah, siswa SMPN 1 Tanjungtiram menjuarai Lomba Langgam Melayu antar siswa SMP se-Batubara. Penyerahan piala, hadiah dan bingkisan pemenang dalam penutupan seminar sosialisasi peran serta Komite Sekolah dan Lomba Lagu Langgam Melayu Batubara diikuti pelajar SMP-MTs itu di Recreation Hall Tanjung Gading, Sei Suka, Sabtu (29/1) Pemenang dengan lagu wajib ‘Batubara Bertuah’ karya Sofyan Alwi dan lagu pilihan ‘Selayang Pandang, Malenggang’ (putra) juara I,II, III dan harapan adalah Irfan (SMPN 2 T.Tiram), Sayiful R (SMPN 1 T.Tiram), Wisnu (SMP Terpadu Indrapura) dan Jilang Raisi Dewo (SMPN 1 Sei.Su ka).Juara putri I,II,III dan harapan adalah Mawaddah (SMPN 1 TTiram), Ika Risnawati (SMPN 1 Limapuluh), Rika Ma lia(SMPN2SimpangDolok)danNovikaSriDewi(SMPN5Limapuluh). (a12)

Dua Pemakai SS Diciduk KISARAN (Waspada): Dua pemakai shabu-shabu (SS) diamankan personil Sat narkoba Polres Asahan, Rabu (2/2) sekitar pukul 21:00, dan hingga saat ini masih dilakukan pemeriksaan dari mana barang haram itu didapat. Informasi dihimpun Waspada, SY alias Yanto, 37, warga Dusun IV, Desa Tanjung Alam, Kecamatan Seidadap, diringkus di kediaman rekannya, SD, 36, warga Dusun V, Desa Sidomulyo, Kecamatan Pulaubandring, Asahan. Mereka diringkus saat akan mengonsumsi SS. Ikut diamankan barang bukti dua mancis (korek api), bong untuk menghisap barang haram itu, dan kaca pirek, sebagai barang bukti. Kapolres Asahan AKBP J Didiek Dwi Priantono, melalui Kasat Narkoba AKP Napsanto, dikonfirmasi Waspada, Kamis (3/2) membenarkan. Hingga kini masih dilakukan penyelidikan untuk menangkap bandar SS tersebut.(a15)

Panitia Persiapan Dewan Pendidikan L. Batu Gelar Sosialisasi RANTAUPRAPAT(Waspada):PanitiaPersiapanDewanPendidikan Kabupaten Labuhanbatu menggelar sosialisasi kepada para calon anggota Dewan Pendidikan dan perwakilan organisasi profesi, Sabtu (29/1) di UPT SKB Pemkab Labuhanbatu. Dalam sosialisasi ini, Ketua Panitia Persiapan H Rida Amran Siregar didampingi Sekretaris Ngampuni Tarigan dan para anggota HMH Thamrin Hasibuan, H Hasballah Basyah dan Osman Naibaho mengatakan latar belakang panitia persiapan untuk pembentukan Dewan Pendidikan di daerah ini. Menurut Rida Amran, penetapan Panitia Persiapan Dewan Pendidikan Labuhanbatu berdasarkan SK Bupati No 420/251/ KESRA/2010 tanggal 27 Desember 2010 yang bertugas antara lain, menerima pendaftaran calon menyeleksi/mengidentifikasi calon danmenyusunkriteriaparacalonuntukdiumumkansertadisampaikan kepada bupati untuk memilih dan menetapkan Dewan Pendidikan Kabupaten Labuhanbatu. Dalam sosialisasi ini, panitia memberikan kesempatan kepada seluruh peserta memberikan saran dan masukan tentang kriteria yang pantas untuk duduk dalam dewan pendidikan di daerah ini. Dalam agenda kerja, Panitia persiapan Dewan Pendidikan Labuhanabatumenerima57pendaftarditambah5panitiauntukdiseleksi menjadi 22 calon hingga 7 Februari 2011. 22 Nama yang diputuskan, selanjutnya akan disampaikan kepada bupati untuk mendapat pengesahan/penetapan 11 orang untuk duduk menjadi Dewan Pendidikan Kabupaten Labuhanbatu. (c07)

Warga Bagan Asahan Kritis Dibacok OTK BAGANASAHAN (Waspada) : Hendri, 28, warga Dusun III, Desa Baganasahan, Kec.Tanjungbalai, Kab. Asahan kondisinya kritis setelah dibacok oleh orang tak dikenal di dekat rumahnya, Kamis (3/1) sekira pukul 22:00. Informasi dihimpun, korban ditemukan bersimbah darah dengan luka bacok dan tusukan di sekujur tubuhnya di pinggir jalan, namun tidak seorang dijumpai di sekitar lokasi kejadian. Melihat kondisinya sekarat, warga melarikan ke rumah sakit umum daerah (RSUD) Tanjungbalai untuk mendapatkan pertolongan. Direktur RSUD T Mansyur Tanjungbalai dr Hj Diah Retno W Kusuma melalui Kepala Ruang IGD Ilen Sundari membenarkan. Menurut Ilen, korban mengalami luka robek di bagian kelopak mata, wajah dan telinga, kemudian jari dan telapak tangan, dan luka tusukan di dada kanannya. Dikatakan, korban malam itu juga dirujuk ke rumah sakit Adam Malik Medan mengingat kondisinya yang sangat parah. Kapolres Asahan AKBP J Didiek Dwi Priantono, melalui Kasat Reskrim AKP Yoris MY mengatakan, pihaknya masih melakukan penyidikan dan memburu tersangka, untuk sementara ditetap hanya satu orang dan diduga warga sekitar. (a32/a15)

WASPADA Sabtu 5 Februari 2011

Sumatera Utara


Kesimpulan Praperadilan Dugaan Korupsi PS Sidimpuan

Tersangka Dan Jaksa Tetap Pada Pendapatnya P.SIDIMPUAN (Waspada): Pengadilan Negeri Padangsidimpuan kembali menggelar sidang praperadilan yang dimohonkan tersangka dugaan korupsi Persatuan Sepakbola (PS) Sidimpuan, HAN,denganagendakesimpulan, Jumat (4/2). Sidang dipimpin Majelis Hakim tunggal Tommy Manik, bersama Panitera Pengganti, Mangara Hutapea SH. Termohon, Kejaksaan Negeri Padangsidimpuan diwakili jaksaYudha Utama Putra, Sartono Siregar dan Indra Zamachsyari. Sedangkan pemohon, HAN, diwakili kuasa hukumnya, Syamsir Alam Nasution, Hendra Pardamean Nasution, M Irsandi Nasution dan Parwan Bangun Harahap. Persidangan ini sangat menentukan. Karena kesempatan terakhir pemohon dan termohon untuk menyampaikan argumentasi penguatan atas jawaban, barang bukti, dan keterangan saksi, yang mereka ajukan sebelumnya.

Pada persidangan yang berlangsung sekira 10 menit itu, pemohon praperadilan HAN menyimpulkan tetap pada permohonan sebagaimana yang diajukan sebelumnya. Sama halnya termohon, menyimpulkan tetap pada jawaban dan barang bukti yang diajukan pada persidangan sebelum ini. Kedua ‘kubu’ tetap pada pendapat masing-masing. “Kami tetap pada permohonan kami. Kiranya Majelis Hakim dalam putusan nanti mengabulkan permohonan kami. Kemudianmenjadikanketeranganpara saksi sebagai bahan pertimbangan kuat dalam membuat putusan nantinya,” pinta kuasa hukum pemohon, Hendra Pardamean. “Kami juga menyimpulkan tetap pada jawaban dan buktibukti yang kami ajukan di persidangan sebelumnya. Kiranya Majelis Hakim menerima jawaban dan bukti tersebut, serta menolak permohonan pemohon,” sambungtermohondiwakilijaksa

Sartono Siregar. Dikarenakan pemohon maupun termohon sama-sama tidak ada yang mengalah dan tetap pada pendirian masingmasing, maka keputusan pokok permasalahan ini dikembalikan kepada Majelis Hakim tunggal, Tommy Manik. “Harapan dan permintaan pemohon maupun termohon akan kami pertimbangkan. Sidang kita tunda hingga Senin (7/2) dengan agenda putusan,” tutup Tommy Manik. Menentukan Informasi diperoleh Waspada dilapangan,putusansidang praperadilan ini sangat menentukan bagi pemohon dan termohon. Karena menyangkut masa depan pemohon dan nama besar termohon sebagai lembaga penegak hukum di P. Sidimpuan. Bila majelis hakim memutuskan menolak permohonan praperadilan itu, maka semua proses penerapan hukum yang dilakukan Kejari Padangsidimpuan terhadap HAN, sah secara hukum.

Jika itu terjadi, maka perkara dugaan korupsi yag disangkakan terhadap HAN akan berlanjut ke prosespersidangandiPNPadangsidimpuan. Bila HAN divonis bersalah dan putusannya telah memiliki kekuatan hukum tetap, makakarirbirokrasinyaterancam putus dan karir politiknya sudah pasti berakhir. Jika majelis hakim menerima permohonan praperadilan itu, maka nama besar dan citra Kejari Padangsidimpuan akan tercoreng. Karena diangap lalai dan tidak ‘becus’ dalam menegakkan keadilan. Apalagi putusan seperti ini, hakim menerima praperadilanterhadaplembagapenegak hukum, jarang sekali terjadi di Indonesia . Jika majelis hakim menerima permohonan pemohon, maka Kejari Padangsidimpuan juga harus membebaskan HAN dari tahanan.Kemudianmemulihkan nama baik HAN yang sudah sempat tercoreng akibat penahanan yang dilakukan jaksa. (a27)

Jarang Ngantor, Warga Tambangan Minta Kepala Sekolah Diganti PANYABUNGAN(Waspada): Kepala Sekolah seharusnya menjadi contoh bagi guru dan siswa,namuntidakdenganKepala Sekolah SD No 142632 Tambangan Jae, Kecamatan Tambangan,Kab.MandailingNatal.Sejak terpilih menjadi kepala sekolah tiga tahun lalu yang bersangkutan jarang masuk kantor dan sampai saat ini belum ada tindakan dari Dinas Pendidikan Mandailing Natal. Hal itu disampaikan warga Tambangan Jae melalui perwakilannya Nasri (Ketua Komite) Husin Lubis (Kepala Desa), Ismail (anggota BPD), Abdul Wahab (Ketua LPM) didampingi beberapa orangtua siswa kepada Waspada, Rabu (2/2) di Tambangan. Menurut mereka, akibat jarangnya kepala sekolah masuk,

kualitas pendidikan di SD itu jauh menurun. Begitu juga dengan disiplin sekolah tidak ada, anakanakmasukpuku08:00danpukul 10:00 sudah pulang. Kalaupun anak pulang lama, di sekolah mereka hanya main-main bukan belajar.“Kualitas pendidikan jauh menurun, belajar tidak aktif. Kita sangat keberatan terhadap sistem yang dilakukan kepala sekolah yang jarang masuk,” ujar Nasri. Selain itu, lanjut Nasri, beberapa tahun ini anak-anak di sekolah tidak pernah melaksanakan upacara bendera. Mereka ibarat ayam kehilangan induk. “Kita tidak tahu apa alasan kepala sekolah tidak masuk kerja selama ini. Hal ini sudah berlangsung lama,kitasudahlaporkankeadaan ini kepada Dinas Pendidikan Madina, namun sampai saat ini

belumadatanggapan,”kataNasri. Parahnya lagi, guru-guru di dalam menjadi 2 blok, ada blok yang pro kepala sekolah dan ada yang kontra. Akibatnya sangat mengganggu proses belajar mengajar. Sebagian guru merasa tidak nyaman mengajar, akibatnyasaatjamistrihat,sebagianguru ada di dalam kantor dan sebagian lagi ada di luar. Sementara kepala sekolah tidak mau tahu hal ini, karena ia lebih suka melakukan aktivitasnya di luar dari pada datang ke sekolah. “Kita keberatan tentang hal ini, kami menganggap kepala sekolah selama ini makan gaji buta. Coba pikirkan, tidak pernah datang ke sekolah, tapi gaji jalan terus. Upaya teguran dan saran dariaparatdesadankomitesudah kita sampaikan kepada kepala

sekolah dan guru-guru agar mereka memperbaiki kualitas mengajar,namunbelumadaperubahan,” ujar Kepala Desa Tambangan Husin Lubis. KepalaSekolahSDNo.142632 Tambangan Jae, Miswar ketika ingin dijumpai di sekolahnya untuk dimintai keterangannya tidak berada di tempat, begitu juga saat dihubungi via seluler tidak diangkat. “Kepala Sekolah tidak berada di tempat, beliau jarang masuk. Kita pun saat ini sedang mencaricari beliau, karena hari ini kan gajian guru-guru, namun beliau tidak hadir. Bendahara sekolah dan satu orang guru lagi sedang mencari beliau,” ujar salah seorang guru yang enggan disebutkan namanya. (c15)

Pengangkatan Pejabat Eselon Pemkab Madina Jangan Karena Faktor Politis PANYABUNGAN(Waspada): Rekrutmen maupun penempatan pejabat eselon II,III dan IV pada Satuan Kerja Perangkat Daerah (SKPD) pasca diberlakukannya perampingan dan penggabungan organisasi dan tata kerja di Pemkab Madina, harus bensr-benar berdasarkan potensi kinerja. Artinya, faktorfaktor lain seperti faktor politis harus dihindarkan. Penegasan itu disampaikan Ketua DPRD Madina As Imran Khaitamy Daulay, Rabu (2/2) sekaitan dengan mulainya Pj Bupati Madina Aspan Sofian merombak kabinet yang diawali

dengan pemutasian sejumlah camat berlangsung di perkantoran Payaloting Payabungan, Selasa (1/2). Imran menjelaskan, sebagus apapun suorta (susunan organisasi dan tata kerja) di Pemkab Madina, kalau itikad baik tidak tetap dijalankan dalam pengangkatan pejabatnya, maka tidak tertutup kemungkinan hasil kinerja yang akan diperoleh dari pejabat yang bersangkutan nantinya tidak akan maksimal. ”Karenanya roda perombakan kabinet maupun pengangkatan pejabat berjalan di Pemkab Madina harus mempertim-

bangkan kualitas kinerja setiap pamong yang diberikan amanah. Kemudian pengangkatan harus benar-benar menggambarkan peningkatan kinerja pejabat dari tahun-tahun sebelumnya,” ucapnya. Kata dia, adanya kebijakan bersama antara Pemkab dan DPRD dalam pelaksanaan perampingan struktur organisasi ini dengan semboyan miskin struktural dan kaya fungsi. Kemudianjugaakanterjaditingkat kompetisi yang baik serta persaingan yang sehat antara sesama birokrat di Pemkab Madina. Koordinator LSM LIRA Wilayah Sumut VII Abdul Muis

Pulungan menyarankan agar setiap calon pejabat setingkat eselon II dan III yang diangkat di Pemkab Madina dilakukan dengan uji kemampuan dan kelayakan atau dengan istilah populernya sekarang “ fit and profer test “ bagi calon pejabat setingkat eselon II dan III. Menurutnya, pengangkatan pejabat eselon II dan III juga harus memperhatikan aspek struktural dan kultural. Apabila dipandang dari sudut struktural, untuk meningkatkan kualitas dan kuantitas instansi pemerintah daerah diperlukan calon pejabat yang profesional dan kredibel. (a24)

Festival Lagu Melayu 2 Dimensi Dibuka LABUHANDELI (Waspada): Anggota DPRD SU H. Ali Jabbar Napitupulu didampingi pemrakarsa Festival Lagu Melayu 2 Dimensi anggota DPRD Deliserdang H. Hasaidin Daulay dan Camat Labuhandeli Dedi Maswardi membuka resmi festival tersebut, Rabu (2/2) malam di Lapangan Nanda Putra Daulay, Desa Helvetia, Kec. Labuhandeli, Kab. Deliserdang. Pembukaan tersebut juga dihadiriunsurMuspikaLabuhandeli lainnya, para Kades, Kepala Dusun, tokoh masyarakat, warga dan lainnya termasuk sejumlah peserta festival lagu Melayu itu. Ali Jabbar Napitupulu dalam sambutannya, mengemukakan antara lain, Festival Lagu/Langgam Melayu 2 Dimensi ini patut didukungsehinggaterusberkembangnya kecintaan masyarakat, terutama generasi muda terhadap seni budaya negeri sendiri,

khususnya Langgam Melayu. ‘’Di tengah-tengah derasnya mengalirarusbudayabangsalain, terutama Barat, maka aktivitas atau kegiatan festival seni budaya negeri sendiri sangatlah penting. Dengan demikian generasi muda kita tidak lupa atas budaya bangsanyasendiri,’’kataAliJabbar. Dia juga berpesan sekaligus berharap, kegiatan dan festival ini terus terselenggara, berkembang serta meluas di Sumatera Utara sehingga kelak dibutuhkan suatu lembaga atau institusi tetap sebagai pengelola atau pelaksananya. Sementara, Hasaidin selaku pemrakarsa mengemukakan, meski dirinya adalah etnis Mandailing akan tetapi beristrikan etnis Melayu, maka pelaksanaan festivallanggamMelayuinibukan semata karena hal itu, melainkan adarasatanggungjawabsekaligus

menyahuti aspirasi masyarakat perihal pelestarian budaya negeri sendiri, termasuk Melayu. Dikatakannya, festival yang memperebutkan tropi Bupati Deliserdang Drs. H. Amri Tambunanini,merupakanyangpertama diselenggarakan di Labuhandeli.Namundemikianpesertanya selain dari Deliserdang juga dari Kota Medan, Kota Binjai, Kabupaten Langkat, KotaTebingtinggi, Tanjungbalai serta Labuhanbatu, bahkan dari Provinsi Aceh. Sedangkan Camat Labuhandeli Dedi Maswardi dalam kesempatan itu menyatakan menyambut baik festival langgam/ lagu Melayu tersebut. ‘’Selama berlangsungnya festival ini hingga penutupan Sabtu malam atau 5 Januari 2011, diimbau para Kadus, Kades serta masyarakat untuk tetap menghadirigunamemeriahkannya,’’ucap

Dedi. Sebelumnya,pihakpelaksana Sapriadi melaporkan, peserta festival 75 orang dari berbagai daerah dengan sistem gugur. Ini ditandai dengan tampilnya 10 peserta pada malam pembukaan. Disamping kegiatan festival juga berlangsung bazar makanan dan minuman serta busana. Sementara,parapesertayang tampil malam pembukaan itu, terdiridariputradanputridengan tingkat usia 17 hingga 40 tahun darikalanganmasyarakatumum, pelajar dan mahasiswa. Umumnya, para peserta tersebut mempunyai bakat serta potensi besar dalam seni suara atau lagu/ langgam Melayu.Terbukti, mulai pembukaan dan tampilnya masing-masing peserta, para undangan maupun masyarakat penonton tidak beranjak untuk menikmatialunanmusikdanlagu Melayu itu.(m34)


Sumatera Utara

SALAK (Waspada): Pekerjaan PNPM-LMP (Program Nasional Pemberdayaan Masyarakat-Lingkungan Masyarakat Pedesaan) tahun anggaran (TA) 2010 di Desa Penanggalan Binangaboang, Kecamatan Salak, Kabupaten Pakpak Bharat diduga telah menyalahi. Adapun pekerjaan dimaksud adalah tentang pengadaan bibit tanaman berupa, pohon mahoni, sengon, pinus dan nira dengan berbiaya Rp100 juta lebih untuk penghijauan di seputar DAS (Daerah Aliran Sungai). Pada proses pendaftaran waktu itu yang berdasarkan kesepakatan bersama antara masyarakat desa setempat/pelaksana pekerjaan dengan pihak FKL (Fasilitator Kecamatan Lingkungan) dan TFK (Tim Pengelola Kegiatan) satu diantaranya adalah bibit harus memiliki tinggi 30 cm. Namun nyatanya, berdasarkan pantauan, Rabu (19/1) di lapangan, bibit diperkirakan hanya setinggi 15 cm. Dan, ironisnya lagi, dari beberapa bibit yang ada terlihat dengan jelas daun dan batangnya sudah kering ataupun akan mulai mati. Sehingga, kedepan dikhawatirkan bibit yang nantinya akan ditanam tidak akan dapat bertahan hidup ataupun mati. (a37)

Pertahankan Kamtibmas Aman Dan Terkendali Di Bumi Turang

Kacab PLN Tak Punya Data Pemakai BERASTAGI (Waspada) : Kepala Cabang (kacab) PLN Berastagi Hendri Sitiyo mengaku tidak tau, mengenai jumlah masyarakat di wilayah kerjanya, yang berada di kota Berastagi hingga Sibolangit, Kabupaten Deliserdang. Hal itu diungkapkan kepada Waspada, Selasa (1/2). Sitiyo mengatakan, jumlah ke seluruhan masyarakat yang mengunakan Pembangkit Listrik Negara (PLN) di wilayah kerja yang dijabatnya selama satu tahun, tidak diketahuinya. Disebabkan data tersebut hanya ada di pusat, dan peningkatan penguna PLN dari tahun 2009 hingga 2010. “Hanya jumlah pelangan yang ada sama kami, yaitu 26,815 ribu pelangan dari data terakhir yang kami terima diakhir tahun 2010,”terangnya. Menjawab pertayaan Waspada, adanya pemadaman lampu berkisar 8 menit pada malam hari, terutama dalam minggu terakhir di Jalan Suryah Indah Kecamatan Berastagi, dirinya membantah. Dan akan mengecek langsung bersama anggotanya ke lokasi malam hari. (c19)

Manajer Ranting PLN Berastagi Minta Maaf BERASTAGI (Waspada) : Manajer Ranting PLN Berastagi Hendri Sitiyo minta maaf kepada pelangan PLN atas pemadaman listrik FEDR BT2 berkisar satu jam dimulai pukul 16:00 hingga 17:00 di kota Berastagi hingga ke sebagian Desa Tongkoh, Kabupaten Karo. Sehingga kini sudah ada penyisipan satu unit trafo di Jalan Veteran Berastagi. Demikian disampaikannya, Rabu (2/2) sore di kantornya. Dikatakannya, pemadaman dilakukan akibat kapasitas travo Over Blas (OB) yang berlebihan, maka dilakukan penyisipan seperti yang terjadi di Jalan Veteran, dan penyisipan itu akan dilakukan kembali pada Jumat mendatang.“Trafo sengaja disisip karena sudah bermuatan penuh dan kalau tidak segera dilakukan akan berakibat fatal yang bisa membuat trafo tersebut terbakar,” terangnya. Lebih lanjut dikatakannya, pengerjaan dilakukan pada pagi hari dan memakan waktu lumayan lama, karena harus menyambung ke kabel inti (jumperan) dan harus dilakukan pemadam listrik di inti kota serta desa. “Untuk wilayah yang padam listriknya terutam di inti kota Berastagi,sertasebagianDesaTongkohyangkeseluruhannyamencapai 8.000 KK, saya minta maaf demi kepentingan bersama. Khususnya di Desa Tongkoh hanya sebagian yang mati karena mengunakan dabel FEDR (trafo),” jelasnya. (c19)

Wabup Dairi Sidak Ke Dinas SIDIKALANG (Waspada):Wakil Bupati Dairi Irwansyah Pasi,SH didampingi Kepala Inspektorat Edward Hutabarat, SH dan Kabag Humas Erika Hasugian, melakukan inspeksi mendadak (sidak) ke sejumlah SKPD di lingkungan Pemerintah Kabupaten Dairi,Jumat (4/2). Dari SKPD yang dikunjungi ditemukan banyak pegawai yang tidak masuk kerja alias mangkir. Namun, sebagian pegawai merasa kesal karena absensi sudah terlanjur ditandai karena terlambat beberapa menit saja. Sidak dilakukan karena, Kamis (3/2) merupakan hari libur nasional dan Jumat kembali masuk kerja. Disinyalir, sudah menjadi kebiasaan pegawai untuk memanfaatkan hari ‘terjepit’ dimaksud untuk libur pribadi. Hasil sidak didapati tingkat kehadiran terendah di Dinas Pertambangan dan tertinggi di Dinas Pendapatan Pengelolaan Keuangan dan Aset Daerah (Dippeka). Khusus di Dinas Pendidikan, Wabup langsung memimpin apel pagi dihadiri Kepala Dinas Drs Pasder Berutu dan sejumlah staf. (a20)

Pabrik Pengeringan Tembakau Terbakar KABANJAHE (Waspada): Pabrik pengeringan tembakau milik PT STTC Cabang Pematangsiantar di jalan Kabanjahe-Tigapanah, Desa Bunuraya Baru, Kec. Tigapanah, Kab. Karo terbakar, Kamis (3/2) pukul 15:30. Kepala UPT Barisan Pencegah Pemadam Kebakaran (BP2K) Bakesbang Pol dan Linmas Kab.Karo, Juris Tarigan,SH kepada Waspada, Kamis sore mengatakan, dua unit mobil Damkar bersama personilnya di turunkan ke lokasi untuk memadamkan kobaran api sehingga kebakaran tidak lebih meluas ke bangunan lainnya. Dalamkebakaranitu1unittempatpengeringantembakaumusnah terbakar. Korban jiwa tidak ada, kerugian diperkirakan Rp50 juta. Asal api menurut Juris Tarigan, akibat dari susut tembakau yang jatuh ke oven. (c09)

Sabtu 5 Februari 2011

DPRD Simalungun ‘Tak Bergigi’ Kritisi Bupati

Pekerjaan PNPM-LMP Diduga Menyalah

KABANJAHE(Waspada): Kapolres Tanah Karo AKBP Drs Ig Agung Prasetyoko, SH.MH menegaskan agar seluruh anggota Polri dapat dan sanggup mempertahankan Kamtibmas yang aman dan terkendali diwilayah hukum Bumi Turang Tanah Karo Simalem dengan 17 wilayah Kecamatannya dan 258 desa/kelurahan dengan luas 2.127,25 KM2 berpenghuni 311.012 jiwa. Hal itu disampaikannya, Selasa (1/2) dalam sambutan dan arahannya seusai serah terima jabatan 7 pejabat dijajaran Polres Tanah Karo dihalaman Mapolres Jalan Veteran Kabanjahe. Kompol Buyung Sitanggang, SH dimutasikan menjadi Propam Poldasu yang sebelumnya Kabag Ops, penggantinya Kompol Zulkifli, SH sebelumnya Irwasda Polda Sumut. AKP Pinda Nainggolan, SH selaku Kasat Lantas Polres Tanah Karo dimutasikan ke Dir Lantas Poldasu, penggantinya AKP Anhar Rangkuti, SIK sebelumnya Kasat Sabhara Polresta Tebing Tinggi. AKP Massa Amri Ritonga, Kapolsek Barusjahe pindah tugas ke Mapolsek Indrapura, penggantinya AKP Inget Sembiring dari SPN Sampali. AKP Edward Simamora Kapolsek Simpang Empat pindah tugas ke Dir Lantas Poldasu, penggantinya AKP Kandar sebelumnya Kapolsek Tigabinanga. AKP Kornes Matanihari menjadi Kapolsek Tigabinanga, sebelumnya Kanit Intel Medan Area. AKP Afriani Siregar, Kapolsek Mardinding pindah tugas ke Polda Sumut, penggantinya AKP Anwar Barus (c10)


Waspada/Natar Manalu

NYARIS: Truk pembawa alat berat nyaris terguling, akibatnya, arus lalu lintas di jalan nasional di tikungan S Desa Sitinjo, Kec Sitinjo Kabupaten Dairi macet 9 jam lebih, Kamis (3/2). Sopirnya, Buyung Berutu menjelaskan, Kamis (3/2) tengah malam ia coba melintasi mobil berat itu. Tibatiba, dia terkejut melihat excavator jatuh nyaris terguling. Kepala truk juga miring. Spontan saja ia memundurkan busnya sehingga terbalik karena terperosok ke lobang. Tidak ada bantuan pemerintah untuk menangani masalah itu hingga menjelang siang. Sedangkan petugas pun tidak ada.

Aksi Pencurian Masih Tinggi Di P. Siantar Perhiasan Senilai Rp6 Juta Lenyap P. SIANTAR (Waspada): Aksi pencurian di rumah warga terutamasaatrumahdalamkeadaan kosong, tempat usaha dan lainnya masih tinggi di wilayah hukum Polres Pematangsiantar dan belum mengalami penurunan hingga membuat warga merasa resah. Seperti diungkapkan korban Tiurma Sitompul, 77, ibu rumah tangga, warga Jalan Rela, Kelurahan Sukadame, Kecamatan Siantar Utara, Kota Pematangsiantar menyampaikan keluhannya saat mengadu ke Polres Pematangsiantar, Jumat (4/2). Menurut korban, perhiasannya senilai Rp 6 juta lenyap dari tempat penyimpanannya di dalam kamar rumah mereka saat mereka pergi berobat ke Penang dan diketahui pada Kamis (3/2) pukul 16:00 ketika mereka baru pulang dari Penang, Malaysia. Ketika sampai di rumah, korban dan suaminya tidak langsung memeriksa rumahnya dan duduk-duduk sebentar di teras rumah. Hilangnya perhiasan itu baru diketahui ketika suami korban hendak masuk ke dalam kamar. Saat itu, suami korban tidak langsung masuk ke dalam

kamardankembalilagimenemui korban serta menyebutkan pintu kamar saat didorong sudah terbuka, padahal saat mereka pergi, pintu kamar dikunci dan seluruh pintu lainnya. Mendengar itu, korban segera beranjak dan pergi ke kamar. Ternyata memang benar, pintu kamar sudah terbuka dan ketika diperiksa engselnya sudah rusak. Penasaran melihat pintu kamar rusak, korban segera memeriksa barang-barangberhargadidalam kamar. Sesudah diperiksa, ternyata perhiasan berupa sepasang anting-anting emas 24 karat seberat 2 mayam, tiga peniti berlian dan bross salib yang terbuat dari emas 24 karat seberat 1 mayam sudah tidakadalagiditempatnya.Akibat hilangnya perhiasan emas itu, korbanmengalamikerugianmencapai Rp 6 juta. Sesudah diperiksa seluruh rumah, tersangka maling yang diduga melakukan pencurian di rumah korban dan belum diketahui identitasnya, masuk ke dalam rumah melalui pintu belakang yang dirusak kuncinya. Secaraterpisah,aksipencurian juga menimpa korban Nguok Lan Veronica, 60, wiraswasta,

warga Jalan Pane, Kelurahan Tomuan, Kecamatan Siantar Timur, Pematangsiantar. Korban mengetahui terjadi pencurian di bengkelnya di Jalan Pattimura, Simpang Jalan Pane, Kelurahan Tomuan, Kecamatan Siantar Timur, Pematangsiantas, Jumat (4/2) pukul 03:00 sesudah saksiWenly Hadinata Saragih, 26, warga Jalan Perwira, Kel Siopat Suhu, Kec Siantar Timur, menemukan tersangka Di, 17, warga JalanPane, dalambengkelkorban. Saksi segera memberitahukannya kepada korban dan mendengar itu, korban segera berangkat ke bengkelnya. Ternyata, sesudah ditanyai, Di mengaku mencuri di bengkel korban pada pukul 02:00 berupa 15 baterei GS, 60 tapak rem dan 60 karburator. Akibat pencurian itu, korban mengalami kerugian mencapai Rp 3 juta. Kapolres Pematangsiantar AKBP Alberd TB Sianipar saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu dan Kasat Reskrim AKP Azharuddin di Mapolres, Jumat (4/1) menyebutkan pengaduankeduakorban masih dalam penyelidikan dan Disudahditahandanmasihdicari tersangka lainnya. (a30)

RSU Kabanjahe Kekurangan Dokter Anak KABANJAHE (Waspada) : RSU Kabanjahe sejak 2008 hanya memilikisatudokterspesialisanak (SPA) serta kurangnya tenaga medis membuat pasien antri untuk mendapatkan pertolongan. Hal itu diungkapkan Humas RSU Kabanjahe Ramhta Br Tarigan kepada Waspada, Jumat (4/2)dikantornya.Dokterspesialis anak hingga saat ini belum ada yang melamar, bahkan lebih menyedihkanpadawaktutengah malam pasien anak yang sangat memerlukan perawatan terpaksa harus dilarikan ke rumah sakit swasta. “Pengumuman lamaran untuk dokter SPA sudah dibuat rumah sakit, dan di tahun 2010 sudahpernahdisarankankepusat untuk penambahan dokter, namun hingga saat ini hanya dr Seri br Ginting yang mengabdi di sini,”terangnya.

Dilanjutkannya, pemikiran dokter sekarang sangat berbeda dibandingkan tahun – tahun sebelumnya. Di tahun 1980 tiga dokter SPA ada, meski perlengkapan rumah sakit lebih lengkap seperti adanya Insenerator (pembakar limbah medis) yang belum ada dimiliki pihak rumah sakit swasta di Tanah Karo. Namun, katanya, dokter sangatengganmembuktikanjanji serta kemampuanya, untuk menolong sesuai fungsinya. “Jadwal pembakaran limbah itu saya tidak tahu persis, berapa dana yang dikutip pihak rumah sakit juga saya tidak tahu, dan berapa lama hal itu terjadi,’’ katanya. Namun, ujarnya lagi, kemungkinansampaimerekamempunyai alat Insenerator dan medisnya. Namun untuk penyebaran penyakit B3 dari rumah sakit lain

hal itu tidak mungkin, meski tidak sterildanhanyadibungkusplastik. Karena pembakaran tersebut ditangani medis yang membidanginyadanasap(corong)pembakarancukuptinggi,sehinggatidak menyebar kepada masyarakat sekitar. Untuk pengunaan Askes, lanjutnya,sangatgampangcukup dengan mengambil nomor antrian maka pasien akan mendapatkan penanganan dari dokter tanpa dikutip biaya apapun. Jadi jika ada yang mengatakan RSU Kabanjahe mengutip biaya atas pasien Askes, tidak benar. Ditambahkan, pengidap hipertensi, darah tinggi dan penyakit gula sering ditemukan di Tanah Karo, dan dengan bertambahnya pasien, diminta agar para dokter sesuai keahliannya, terutama spesialis anak dapat mencalonkan diri ke RSU Kabanjahe. (c19)

Semua Kegiatan TSR Diperintah Berhenti Operasi KABANJAHE (Waspada): Plh Bupati Karo Ir Makmur Ginting menegaskan, mulai Rabu (2/2) telahdiperintahkankepadastakeholdersupayamemberikanstatus quo kepada TSR, dan seluruh kegiatan yang ada dihentikan, sebelum seluruh unsur persyaratan yang dibutuhkan dipenuhi, hal itu demi kebaikan mereka (investor) dan kebaikanTanah Karo. Penegasan ini disampaikan Makmur Ginting yang juga Sekdakab Karo, ketika menerima delegasi DPD Lumbung Informasi Rakyat (LIRA) Kab Karo yang berunjuk rasa ke kantor Bupati Karo,Selasa (2/2), terkait masalah IMB dan keberadaan kawasan wisata Taman Simalem Resort (TSR) yang dikelola PT MerekIndahLestari(MIL)diDesa Sikodon-Kodon, Kec. Merek, Kab. Karo, Pertemuan LSM LIRA denganPemkabKaroyangdipimpin Plh Bupati Karo Ir Makmur Gin-

ting, M.Si,juga dihadiri Asisten I Pemerintahan DrsTM. Tarigan, Plh Asisten II Drs Simon Sembiring,KakanPerizinanDrsDarmin Karo Sekali, Kakan Satpol PP Drs IrwanGantiTarigandansejumlah kepala instansi terkait lainnya, di ruang rapat asisten Sekretariat Pemkab Karo Jalan Djamin Gintings, Kabanjahe. Dalam pertemuan tersebut, juru bicara LIRA Julianus Sembiring,SPd,menudingPemkabKaro tidak berdaya menegakkan Perda No. 7Tahun 2006 terhadap keberadaan TSR, sehingga menjadi preseden buruk dalam perizinan di daerah ini. “Sangat ironis, di atas lahan seluas 206 hektare dapat berdiri bangunan megah di kawasan wisata berkelas internasional tanpa memiliki IMB,’’ ujarnya. Julianus Sembiring dengan tegas mengatakan, pihaknya butuh ketegasan Pemkab Karo terhadappembangunankawasan

wisata TSR sesuai dengan Perda No. 7 Tahun 2006. “Pemkab Karo seharusnya bertindak tegas dengan membongkar seluruh bangunan yang ada di lokasi TSR sesuai Perda No. 7 Tahun 2006,’’tegasnya. Bukan itu saja, kata Julianus, PT MIL selaku penanggungjawab juga harus ditindak dengan dikenakan sanksi pidana kurungan enam bulan sesuai Pasal 55 dan 56 yang diatur dalam Perda No. 7 tahun 2006. Plt Bupati Karo Makmur Gintingmengatakan,padaprinsipnya apa yang disampaikan LSM LIRA merupakan bentuk dan rasa tanggung jawab terhadap daerah ini. Kata Makmur Ginting yang juga Sekdakab Karo, pemberian izinmendirikanbangunanseperti resorttidakbisaperunit(terpisahred), tapi harus secara menyeluruh.(c09)

SIMALUNGUN (Waspada): Anggota DPRD Simalungun terus mendapat kecaman dari elemen masyarakat. Selain dianggap sudah tidak punya‘gigi’ lagi mengkritisi kebijakan dan kinerja Pemkab, para wakil rakyat tersebut juga dinilai sudah menjadi ‘humas’ dan ‘tukang stempel’ Bupati Simalungun, JR Saragih. Ketua DPP LSM Lepaskan, Jansen Napitu, mengatakan, pimpinan dan anggota DPRD Simalungun dalam beberapa bulan terakhir tidaklagipeduliterhadaprakyatyangdiwakilinya, tetapi sudah lebih peduli kepada pemerintah daerah. Banyak kebijakan pembangunan dan keputusanyangdiambil,khususnyamenyangkut alokasi anggaran di APBD 2011, tidak pro terhadap kepentingan rakyat. “ Pimpinan dan anggota DPRD Simalungun sudah tidak pro lagi terhadap kepentingan rakyat. Mereka (angota dewan) sudah tidak punya gigi lagi alias ompong, bahkan terkesan sudah menjadihumasdantukangstempelbagibupati,” kecam Jansen kemarin. Menurut Jansen, kinerja para wakil rakyat tak lebih dari mementingkan diri sendiri (individu)dankelompoknyasaja. Bilakepentingannya tercapai, maka dia (anggota dewan) tidak peduli lagiterhadapkebijakan-kebijakanyangdilakukan Pemkab Simalungun, meskipun keputusan atau kebijakan yang diambil oleh penguasa itu menyakitkan bagi rakyat. Bahkanyanglebihmemalukan,lanjutJansen, ada oknum pimpinan dan anggota DPRD Sima-

lungun yang setiap hari ‘lengket’ dengan bupati. Mereka (oknum pimpinan dan anggota dewan) itu lebih senang menyuarakan suara bupati dibanding dengan menyuarakan aspirasi rakyat. Lebih jauh lagi, mereka juga sepertinya siap menjadi tameng bagi membela kepentingan bupati. “ Tidak perlu saya sebutkan nama pimpinan dan anggota dewan itu, orang sudah pada tahu semuanya. Karena dimana ada bupati, disitu ada mereka,” beber Jansen. Sejauh ini Jansen menilai apa yang sudah dilakukanDPRDSimalungunsebagaiwakilrakyat dalam membahas APBD 2011 adalah konyol. Karena banyak alokasi anggaran yang ditampung bukan untuk kepentingan masyarakat, tetapi untuk kepentingan pemerintah. Contohnya, pembangunan bandara, biaya renovasi guest hause yang dijadikan rumah dinas bupati dan biaya renovasi kantor bupati dan kantor SKPD yang anggarannya mencapai puluhan miliar. Padahal bila alokasi anggaran itu diberikan pada kepentingan rakyat, maka sudah puluhan kilometer jalan kabupaten dan jalan produksi, atau jaringan irigasi yang dapat diperbaiki, ujar Jansen. Sementara,anggotaDPRDSimalungunBernhard Damanik, memaklumi bila ada pernyataan elemen masyarakat yang menyatakan DPRD Simalungunsudahtidakpunya‘gigi’ataumenjadi ‘tukang stempel’. Karena diakui, kinerja wakil rakyat hingga saat ini belum maksimal dan belum sesuai dengan apa yang diharapkan masyarakat. (a29)

Baru 75 Persen Penduduk Nikmati Air Bersih P. SIANTAR (Waspada) : Banyak yang tidak mengetahuinya, bahkan banyak pula yang tidak mau untuk mengetahuinya. Tetapi itulah kenyataannya, harga air yang didistribusikan Perusahaan Daerah Air Minum (PDAM) Tirta Uli Pematangsiantar untuk masyarakat pelanggannya tercatat yang termurah di Indonesia. “Tarif air itu hanya Rp0,58 per liter. Boleh jadi ini tarif air yang termurah di Indonesia,” kata Direktur utama (Dirut) PDAM Tirta Uli P.Siantar,Badrik Kalimantan, Selasa,(1/2). Menurutnya, harga air per liternya yang diberlakukan kepada pelanggannya itu adalah ketetapan yang diberlakukan tahun 2002. Untuk tujuan peningkatan pelayanan, pihak manajemen perusahaan air minum di Pematangsiantar sudah membahas masalah rencana penyesuaiantarifairbaru.“Rencanapenyesuaian tarif itu baru dibahas di kalangan internal,belum sampai pada Badan Pengawas dan DPRD,” aku Badrik. Dia memberikan gambaran tantangan berat yang dihadapkan kepada pihak perusahaan, khususnya untuk memenuhi tingginya permin-

taan pasang (pelanggan) baru serta pelayanan distribusi air selama 24 jam. Jumlah pelanggan yang terdaftar saat ini sebanyak 54 ribu, termasuk pelanggan yang berdomisilidiKabupatenSimalungun.Sementara debit air yang tersedia hanya 760 liter per detiknya. Padahal untuk memberikan pelayanan distribusi air penuh 24 jam, seharusnya debit air yang ideal dimilikiperusahaanuntukdidistribusikansebesar 950 liter per detik. Umbul baru PDAMTirtaUlidalamupayamengejartuntutan tingginya permintaan air bersih, tahun ini sudahmenjadwalkanakanmencaridanmemanfaatkan umbul-umbul (sumber air) baru. “Ada dua umbul yang direncanakan untuk dikelola,yaitu umbul Nagahuta IV dan umbul Bah Sikam,” ujar Dirut PDAMTirta Uli Pematangsiantar. Dari ke dua umbul itu sudah diteliti akan ada pertambahan debit air sebesar 130 liter per detiknya. Sehingga, jika rencana ini terealisasi, maka sumber air yang ada untuk didistribusikan kepada masyarakat sebesar 890 liter per detiknya. (c16)

Kejar Jambret PNS Pemko Sibolga Tewas TAPTENG (Waspada) : Calon Pegawai Negeri Sipil(PNS)PemkoSibolgaRosariaTimuriaNingsih br Siregar, 23, tewas dalam tubrukan dengan truk pengangkut es ketika mengejar penjambret diJalanRayaPSidempuankm6,Sarudik,Tapteng, Rabu (2/2) pagi. Sebelumnya, korban sempat dilarikan ke RS Kodim 0211 TT Jalan SisingamangarajaSibolga, namun nyawa Ningsih CPNS di Dinas Sosial dan Tenaga Kerja Pemko Sibolga tersebut tak tertolong lagi. Dia meninggal dunia karena kehilangan banyak darah akibat luka parah di wajah dan lambungnya. Informasi menyebutkan, korban berusaha mengejar penjahat yang menjambretnya. Sebelumnya, korban sempat memberitahukan ia telah dijambret kepada personil Sat Lantas Bripka Gandil yang melintas di Jalan Sisingamangaraja, Simpang Tugu Ikan/Beo, Sibolga. Tanpa pikir panjang, keduanya lalu berbalik arah dan berusaha mengejar pelaku yang lari ke arah Pandan, jelas Kasat Lantas PolresTapteng, AKP Eddy S melalui Kanit Laka, Aiptu Taya. Dalam pengejaran itu, lanjut Taya, sesuai penuturan personil Polantas, korban memacu laju sepeda motornya cukup kencang. Bahkan,

kata Taya, personil kita tertinggal beberapa ratus meter di belakang korban. Di sepanjang jalan, korban juga sempat berteriak maling-maling menunjuk ke arah orang yang dikejarnya. Namun di Km. 6 Sarudik, korban didapati sudah terluka parah karena menabrak truk es. Sepeda motor korban jenis Yamaha Mio berwarna merah bernomor polisi B 6662 BSV kini diamankan di Unit Sat Lantas PolresTapteng. Bagian depan sepeda motor ringsek parah karena benturan dengan bagian kepala kanan truk es. DemikianjugatrukesjenisMarcedesBenznomor polisiBB8110MBmilikCVYakin,Sibuluan,Tapteng yang ditabrak korban masih diamankan di Unit Sat Lantas Polres Tapteng. Secara terpisah sopir truk es, Mangantar Hutabarat, 57, menuturkan, sebelum terjadi tabrakan, dari jarak sekitar 50 meter dia sempat melihat korban yang mengendarai sepeda motor melajukencangdariarahberlawanan.Mangantar mengatakansempatmelihatkorbanmendahului sebuah angkot di depannya. Sesuai penuturan Kasat Reskrim Polres Tapteng, AKP Ari SWibowo, hingga kini pihaknya belumadamenerimaLaporanPengaduanterkait penjambretan dari pihak korban. (a34)

Walikota P. Siantar Harapkan Musda PAN Sesuai AD/ART PEMATANGSIANTAR (Waspada):Walikota Pematangsiantar Hulman Sitorus, SE mengharapkan Musda IV PAN yang akan digelar pada 12 Februari 2011 sesuai dengan AD/ART PAN dan para kandidat ketua bertarung dengan sehat. Walikota Pematangsiantar menyampaikan harapannya saat menerima audiensi panitia Musyawarah Daerah (Musda) IV Partai Amanat Nasional (PAN) di rumah dinasnya, Jalan Kapten MH. Sitorus, Rabu (2/2). Hadir dalam audiensi kali itu diantaranya KetuaPanitiaPelaksana(SC),SamsudinHarahap, Sekretaris Turmuzi, Bendahara Romi Koto, Ketua Panitia Pengarah (OC) M. Ali Harahap, Sekretaris Osner Sitio dan Humas Fadri Sikumbang, tiga anggota DPRD dari PAN terdiri Zainal Purba, H. Aulul Imran, SPdI dan Erlinda Arista Sirait. Sedang Walikota didampingi Asisten I Djumadi, SH, Kepala Badan Kesbangpol dan Linmas LincolnTampubolon dan Kabag Humas dan Protokoler Drs. Daniel H Siregar. Samsudinmenjelaskankedatanganpihaknya

guna menerima masukan dari Walikota terkait pelaksanaan Musda IV PAN Pematangsiantar. “Panitia selama ini sudah melakukan berbagai tahapan pelaksanaan, namun ada kendala teknis hingga Musda itu akan dilaksanakan pada 12 Februari 2011.” Menurut Samsudin, penundaan Musda itu dilakukan sesudah pihak panitia berkordinasi dengan DPD PAN Pematangsiantar serta DPW PAN Sumut serta menambahkan, dengan Musda itu diharapkan dapat melahirkan pemimpin yang kapabel dan berkemampuan dalam membesarkan PAN di Pematangsiantar. “Selain itu, diharapkan dapat memberikan kritikan sehat kepada Pemko terhadap berbagai kebijakannya,” sebut Samsudin yang jugaWakil Sekretaris DPD PAN periode 2005-2010 itu. Sesudah mendengar penjelasan itu,Walikota menyatakan PAN merupakan salah satu partai terbesar di Indonesia serta dikenal sebagai partai nasionalis, meskipun awalnya berbasis agama. (a30)

Dua Tewas Tersambar Petir Di Pakpak Bharat SALAK (Waspada): Butet Sembiring, 44, warga Pasar Kecil, Diski, Deliserdang dan Pa Amos Berutu,70, warga Desa Simerpara, Kecamatan PGGS (Pergetteng-Getteng Sengkut), Kab. Pakpak Bharat tewas mengenaskan setelah keduanya disambar petir di Desa Simerpara. Menurut saksi mata, kejadian dimaksud berlangsung, Kamis (3/2) sekira pukul 16:00. Saat itu, ketika hujan turun dengan diselingi gemuruh petir, keduanya berteduh di balai desa pada wilayah pemukiman.Tak ayal, kilatan petir menyambar Butet Sembiring dan selanjutnya

mengarah kepada Pa Amos. Di lokasi kejadian juga terlihat tiang dan dinding balai desa yang terbuat dari bahan kayu pecah. Seketika, Pa Amos tewas di tempat dan tidak turut dievakuasi ke rumah sakit. Sementara, Butet sempat dilarikan ke RSUD Salak. Namun, dalam perjalanan, nyawanya tak terselamatkan lagi. Oleh pihak keluarga, jenazah Butet selanjutnya di boyong ke Diski. Hal itu juga dibenarkan oleh Plt Direktur RSUD Salak dr Pintar Manihuruk kepada wartawan melalui telefon selularnya. (a37)


WASPADA Sabtu 5 Februari 2011

B5 Bina Marga Diminta Perbaiki Jalan Dan Jembatan Rusak

UU Perlindungan Anak Harus Ditinjau Ulang ACEH UTARA (Waspada): Zainal Abidin Badar Koordinator Lembaga Swadaya Masyarakat (LSM) Reuncong Aceh, mengatakan Undang-undang Perlindungan Anak (UUPA) harus ditinjau ulang. Pasalnya, UU itu telah menjadi momok yang menakutkan bagi para pendidik. UUPA telah membuat para guru di sekolah-sekolah atau di dayah-dayah takut dalam bertindak. Misalkan, takut menjewer kuping siswanya yang nakal. “UUPA telah menghilangkan wibawa seorang guru di hadapan siswanya. Dengan UU itu, siswa berani berbuat apa saja di sekolah atau di dayahdayah. Kalau saja ada guru yang nekat menampar siswa nakal, maka dapat dipastikan guru ini akan berurusan dengan pihak berwajib,” kata Zainal Abidin Badar, Rabu (2/2). Dalam agama Islam saja, orang tua dibolehkan menghukum anaknya yang telah wajib shalat, tapi tidak mengerjakannya dengan cara mencambuk. Hal ini dibolehkan, agar si anak mengerti yang mana hak dan kewajiban seorang hamba terhadap pencipta-Nya. “Karena itu, menurut hemat kami dari LSM Reuncong Aceh, UUPA harus segera ditinjau ulang dan DPR-RI serta Pemerintah Pusat harus segera merevisi UU itu. Jika pun harus dipertahankan, maka tidak diberlakukan bagi sekolah atau dayahdayah. Karena UU itu telah mengekang kebebasan pendidik dalam mengubah pola pikir siswa,” pinta Zainal.(cmun)

KUTACANE (Waspada): Sejumlah pengguna jalan di Aceh Tenggara (Agara) mendesak pihak Dinas Bina Marga Agara agar segera memperbaiki ruas jalan dan jembatan penghubung yang kondisinya semakin parah. Pasalnya, akibat kurangnya perawatan dan perhatian pihak Dinas Bina Marga dan Cipya Karya Agara, sejumlah ruas jalan dan jembatan semakin sulit dilalui warga yang kerap melintas. Adi, salah seorang warga Badar kepada Waspada mengaku prihatin, melihat lamban dan kurang perhatiannya dinas terkait menyi-

Petani Beli Pupuk Bersubsidi Di Atas HET

Dewan Soroti Parkir Komplek Balaikota BANDA ACEH (Waspada): Ketua DPR Kota Banda Aceh Yudi Kurnia, SE minta perhatian Pemko Banda Aceh mengenai semrawutnya penataan areal parkir di kompleks balaikota. “Sungguh sangat tidak indah dan sangat mengganggu,” ungkap Yudi Kurnia, pada rapat paripurna pembukaan masa persidangan I DPRK Banda Aceh tahun 2011, Rabu (2/2). Kata Yudi, walikota dapat mengambil kebijakan tersendiri untuk menata kembali masalah perparkiran tersebut, sehingga keteraturan, keserasian dan hamonisasi lingkungan dapat kembali. Apalagi, sebut Yudi, Pemko Banda Aceh sendiri telah mewujudkan fungsi pelayanan satu pintu yaitu dengan adanya Kantor Pelayanan Terpadu Satu Pintu, di gedung baru balaikota. Karenanya, persoalan areal parkir di depan gedung megah ini harus ditata secara profesional, tuturnya. Yudi menyebutkan, dalam masa persidangan I Tahun 2011 DPRK Banda Aceh mengagendakan enam kegiatan yang menjadi fokus dewan, yaitu rapat paripurna mengenai program prioritas tahun 2011, pelaksanaan kegiatan Rakernas XAsosiasiDPRDKotaSeluruhIndonesia,RapatParipurnaLaporan Kinerja Pertanggungjawaban (LKPJ) Walikota tahun 2010. Selanjutnya, Rapat Paripurna memperingati Hari Jadi Kota Banda Aceh ke-806 Tahun 2011, Rapat-rapat dengan pendapat umum dengan berbagai stake holder terkait dan penetapan agenda dan kegiatan reses anggota DPRK Banda Aceh.(b06)

Tertib Lalulintas, Polres Kumpulkan Penarik Betor PENANGGALAN, Subulussalam (Waspada): Program mewujudkan tertib lalu lintas bagi segenap pengendara, khususnya para penarik beca bermotor (betor) di wilayah hukum Polres Aceh Singkil – Subulussalam, Satuan Lalu Lintas (Sat Lantas) Polres setempat mengumpulkan penarik betor, Rabu (2/2), di Pos Polantas Penanggalan, Subulussalam. Dalam arahannya, Kapolres Aceh Singkil melalui Kasat Lantas Iptu Andri mengajak para penarik betor terkait untuk lebih serius mematuhi semua ketentuan tertib lalu lintas, seperti Surat Izin Mengemudi (SIM) sebagai identitas diri dan Surat Tanda Nomor Kenderaan (STNK) sebagai identitas kenderaan yang dikendarai. Terkait pengurusan SIM, Andri berjanji memberi kemudahan kepada segenap penarik betor secara kolektif. “Silahkan bapak-bapak pengemudi beca bermotor mengurus SIM,” saran Andri memastikan, dengan biaya Rp100 ribu para penarik betor di sana bisa memiliki SIM. Andri diamini Kepala Pos Polantas Silalahi malah berjanji, untuk antar jemput hingga mendampingi para penarik betor ke Polres Aceh Singkil, pihak mereka siap. “Untuk antar jemput, dan kami dampingi ke Polres untuk mengurus SIM, pihak kami siap membantu bapak-bapak,” tambah Silalahi memotivasi penarik betor. Andri pun memastikan kalau SIM dan STNK yang masih berlaku (baca: hidup) sangat penting bagi pengendara, apalagi jika terjadi laka lantas. Selain itu, Andri juga mengingatkan agar pengendara memakai helm standar, kaca spion dan kelengkapan kenderaan lainnya. “Jika terjadi kecelakaan di jalan, SIM dan STNK yang masih berlaku menjadi salah satu syarat untuk mendapatkan asuransi Jasa Raharja,” tegas Andri. Menurut Andri, Kantor Samsat di Subulussalam dijadwalkan mulai beroperasi antara Februari – Maret 2011, jika pemerintah setempat menyediakan kantor sehingga para pemilik kenderaan lebih mudah membayar pajak.(b33)

Pemko Salurkan Bantuan Korban Puting Beliung BANDA ACEH (Waspada): Pemerintah Kota Banda Aceh melalui Dinas Sosial Rabu (2/2), menyalurkan sejumlah bantuan masa panik bagi korban angin puting beliung di dua kecamatan yakni Baiturrahman dan Banda Raya. Bantuan yang berupa beras, gula, mi instan, telur, kecap, minyak goreng, dan sarung diserahkan Kepala Dinas Sosial Kota Banda Aceh kepada para korban yang rumahnya mengalami kerusakan akibat terjangan angin putting beliung, Selasa siang (1/2). Kepala Dinas Sosial Kota Banda Aceh Purnama Karya mengatakan, bantuan tersebut merupakan bantuan masa panik untuk mengurangi beban yang dialami para korban. Sedangkan bantuan untuk perbaikan rumah, dikatakan Purnama, akan didata terlebih dulu oleh geuchik baru diserahkan ke Pemko untuk penyaluran bantuan. Menurut data yang ada pada Dinas Sosial, jumlah rumah yang rusak 42 rumah, rusak sedang dan berat 21 rumah, dan 21 rumah mengalami kerusakan ringan. Kemudian sarana pendidikan dua unit di Desa Lamlagang dan Neusu Jaya. Angin puting beliung menerjang Kota Banda Aceh, Selasa (1/2) siang. Sekitar 42 unit rumah rusak, rumah yang paling banyak rusak kebanyakkan atapnya beterbangan. Tidak ada korban jiwa dalam kejadian itu, namun kerugian ditaksir mencapai puluhan juta rupiah. Terjangan angin itu sempat membuat sebagian warga panik dan tidak berani keluar rumah.(gto)

Waspada/Gito Rolis

BANTUAN: Kepala Dinas Sosila Kota Banda Aceh menyerahkan bantuan masa panik berbentuk sembako kepada korban amukan angin puting beliung yang melanda kota Banda Aceh, Selasa (1/2) siang, tidak ada korban jiwa dalam musibah itu.

kapi jembatan berlubang yang menghubungkan Lawe Bekung, Kec. Badar dengan Salang Baru, Kec. Deleng Pokisen. “Jembatan Lawe Bekung, jalan penghubung dua kecamatan dan vital bagi masyarakat serta pengguna jalan, tapi sayangnya lubang besar yang menganga terkesan masih dibiarkan begitu saja,” tukas Adi. Kadis Bina Marga dan Cipta Karya Agara, Ir.Khairul Anwar ketika dikonfirmasiWaspada via telepon selular, Kamis (4/2) hanya menjawab singkat, jalan dan jembatan yang rusak itu diperbaiki tahun ini.(b27)

Waspada/Ali Amran

JEMBATAN BERLUBANG: Seorang pengguna jalan sedang memperhatikan lubang yang menganga pada kepala jembatan Lawe Bekung yang menghubungkan Kecamatan Badar-Deleng Pokisen.

Tanggul Pengaman Jalan Ambruk Lagi Hubungan Tapaktuan-Medan Kembali Terancam Putus TAPAKTUAN (Waspada): Hubungan darat Tapaktuan, Aceh Selatan- Medan, Sumatera Utara, kembali terancam putrus, akibat tanggul pengaman badan jalan negara di kawasan pegunungan Pintu Angin (Panorama Hatta) Gampong Lhok Reukam, Kecamatan Tapaktuan, sekira 12 kilometer dari Tapaktuan ke jurusan Medan ambruk lagi, Kamis, (3/2) pagi. Ambruknya tanggul pengaman yang baru beberapa pekan usai diperbaiki itu sangat mengejutkan warga sekitar. Karena tanggul ini baru saja diperbaiki setelah sebelumnya juga ambruk ke dasar jurang akibat pembangunan diduga asal jadi. Sejumlah warga Lhok Reukam kepada Waspada di lokasi Jumat sore kemarin menyebutkan tanggul pengaman ini telah dua kali ambruk ke dasar jurang karena ppekerjaannya asalasalan. “Seharusnya tanggul ini menggunakan besi bertulang

dengan ukuran standar, tetapi ini hanya dibuat kawat kecil sebagai tulangnya menyebabkan proyek tidak bertahan lama dan kembali ambruk, sehingga badan jalan di lereng gunung itu menyempit dan sulit dilewati,” ucap Mukhtar, 45, seorang warga setempat. Menurut Mukhtar, ambruknya tanggul pengaman sepanjang 25 meter itu, bukan hanya menyebabkan hubungan darat Tapaktuan-Medan terancam putus, melainkan juga dikhawatirkan keselamatan pengguna jalan roda dua dan empat pun tak terjamin. “Apalagi yang lewat di lintasan truk-truk fuso roda berbadan lebar karena jalur ini satu-satunya lintasan barat Selatan- Sumut,” ucapnya. Bupati Aceh Selatan Husin Yusuf mengaku prihatin terhadap kondisi ruas jalan di daerahnya yang tidak berkesudahan, meski pihaknya telah berulang kali melaporkannya ke berbagai pihak di provinsi maupun pusat. “Terakhir kembali saya laporkan kepada Wagub Muhammad Nazar,S.Ag dalam acara silaturrahmi dan kenduri laut di Gampong Sawang Ba’U, Kecamatan Sawang, Selasa (1/ 2) lalu,” ucapnya seraya menga-

kupersoalanitumembuatpusing tujuh keliling, karena hampir sepanjang jalan di tiga perbukitan itu kawasan rawan longsor. Bupati kembali menyindir pihak provinsi yang terkesan pilih kasih dalam membangun badan jalan di daerahnya. “Kalau kita lewat di sebelah utara tertulis peringatan hati-hati jalan diperbaiki, tetapi di Aceh Selatan tertulis hati-hati jalan rawan longsor,” sebutnya. Menanggapi laporan Bupati Husin Yusuf, Wagub Muhammad Nazar kembali menegaskan persoalan jalan di tiga perbukitan yang menghubungkan Tapaktuan-Medan hingga kini masih dalam tahap survei dan penelitian guna dibangun jalan alternatif. Sebab kondisi jalan ini tak mungkin lagi dipertahankan karena dinilai sebagai perbuatan sia-sia karena menghabiskan banyak dana. “Tak mungkin lagi kita pertahankan karena hari ini diperbaiki besok lusa kembali rusak dan longsor lagi, sehingga pekerjaan kita itu-itu saja,” ucapnya seraya meminta masyarakat masyarakat Aceh Selatan bersabar menunggu kelanjutan hasil penjajakan tim dari Bina Marga provinsi.(b19)

Jangan Ada Lagi Ibu Hamil Dan Bayi Meninggal Akibat Lalai BIREUEN (Waspada): Pembinaan kepada para bidan terus ditingkatkan. Oleh sebab itu jangan ada lagi ibu hamil dan bayi meninggal akibat dari kelalaian bidan. Makanya pembinaan kepada bidan dilakukan secara rutin. Hal itu dikatakan, Ketua

Ikatan Bidan Indonesia (IBI) Provinsi Aceh, Suryati Mahmud, SKM dalam musyawarah cabang pertama IBI Bireuen sekaligus memilih ketua di aula MA Jangka Unimus Peusangan, Bireuen, Kamis (3/2). Sementara Bupati Bireuen, Nurdin Abdul Rahman menga-

takan, bidan adalah pedoman dalam melaksanakan tugas dan tanggungjawab. Bidan harus jadi garda terdepan dan orang pertama memberi pelayanan kesehatan bagi ibu dan anak. IBI juga harus berperan menjadi penyebar informasi bidang kesehatan, ke tengah masyarakat.(amh)

ACEH UTARA (Waspada): Kendati pemerintah telah menetapkan Harga Eceran Tertinggi (HET) pupuk urea bersubsidi hanya Rp1.600 per kilogram, namun sejumlah petani Aceh Utara membeli pupuk dari pedagang kios sampai Rp2.000. Usman Ishak, 43, warga Tanah Pasir Aceh Utara kepada Waspada, Kamis (3/2) mengakui harga pupuk di Pasar Simpang Peuet, Tanah Pasir Rp2.000. “Di sini harga pupuk putih (urea-red)Rp2000 per kilo, tapi kalau kita beli banyak mungkin lebih murah lagi,” jelasnnya. Ketika ditanya soal harga tertinggi yang telah ditentukan pemerintah, dia mengaku tidak mengetahui tentang hal itu. Saat ini warga Kecamatan Tanah Pasir, Samudera, Syamtalira Aron, Syamtalira Bayu, dan beberapa kecamatan lainnya sedang membutuhkan pupuk urea. Tanaman padi mereka telah beberapa minggu dipindah dari tempat persamaian, oleh sebab itu perlu segera diberi pupuk untuk kesuburan tanah. Petani wilayah timur kabupaten ini juga mengaku membeli pupuk diatas harga HET. Bustami Yakub, 37, petani dari Kec. Seunud-

don membeli pupuk urea di pusat pasar kecamatan Rp2.000. Kawasan itu juga telah memasuki masa tanam padi, sehingga amat membutuhkan pupuk. Salah seorang pedagang Nisam, berdalih terpaksa menjual pupuk di atas HET, karena mengaku untuk biaya bongkar pupuk dari truk. Meskipun dia mengakui, pemerintah telah menetapkan harga HET hanya Rp1.600, namun terpaksa dinaikkan untuk mendapatkan keuntungan dagang. Sementara Kepala Badan Ketahanan Pangan (BKP) Aceh Utara, M. Abbas beberapa waktu lalu mengatakan, harga HET pupuk urea bersubsidi Rp1600 per kilogram. Pupuk bersubsidi untuk petani Aceh Utara disalurkan sesuai Rencana Definitif Kebutuhan Kelompok (RDKK) yang telah diusulkan ke pemerintah pusat. Pupuk murah itu disalurkan kepada petani melalui distributor resmi. Distributor lalu menyalurkan kepada kios resmi. “Sehingga tidak dibenarkan kios menjual pupuk diatas harga HET,” tegas Kepala BKP Aceh Utara.(b17)

Krisis Air Di RSUD Idi Belum Teratasi IDI, Aceh Timur (Waspada): Krisis air bersih di RSUD Idi, Kab. Aceh Timur, hingga kini menuai kritikan tajam pihak keluarga pasien. Kondisi tersebut ikut dibenarkan pihak rumah sakit. Sementara mesin genset—pengganti lamu penerang listrik—masih dijadikan andalan dalam pelayanan pasien. “Meski telah kita bangun sumur bor, tapi keberadaan air di sini belum aman. Artinya, kita masih mengharapkan PDAM segera memasang instalasi ke RSUD Idi,” ujar Direktur RSUD Idi, dr. H. Edi Gunawan, MARS, kepada Waspada, Jumat (4/2) di Idi. Dia menjelaskan, selama ini pihaknya sangat kewalahan dalam mengatasi krisis air besih sebagaimana layaknya standar sebuah Rumah Sakit Umum Daerah (RSUD). “Kita menginginkan tidak sedikitpun keluhan pasien, baik terkait pelayanan maupun soal sarana dan prasarana yang tersedia,” ujar dr. Edi. Namun pihak RSUD Idi, lanjutnya, tidak mampu berbuat banyak, dikarenakan air yang tersedia di sana belum mencukupi dan terus menjadi masalah sejak dirinya menjabat sebagai direktur. “Tapi dibanding sebelumnya, persediaan air sudah lumayan, namun belum

aman,” sebut Edi. Ketika disinggung sarana persediaan penunjang lainnya untuk standar sebuah RSUD? Edi mengaku banyak sarana dan prasarana lain yang diperlukan di sana. Bahkan, kekuatan listrik yang dimiliki RSUD Idi, belum mencukupi. Padahal, pihaknya sudah melayangkan permohonan ke PLN Cabang Langsa, untuk segera dilakukan penambahan arus listrik ke sana. Edi menguraikan, akibat minimnya daya listrik, arus listrik yang dialirkan ke sana kerap terjadi padam. Bahkan, saat padamnya listrik sejumlah alat medis mengalami kerusakan, seperti peralatan medis di gedung laboratorium. “Saat listrik padam, alat medis rusak dan tidak difungsikan lagi, bahkan lima unit komputer dan pendingin ruangan di RS kita sudah rusak,” sebutnya. Untuk mencari jalan keluar dalam mengatasi keluhan pasien seperti listrik dan air bersih di RSUD Idi, sambung Edi Gunawan, mesin genset di sejumlah ruangan, seperti di Gedung Radiologi untuk alat ronsen dan menggali sumur bor untuk mencukupi air di sana. (cmad)

Guru Pemberi Kunci Soal UN Sama Juga Berikan Contoh Buruk BIREUEN (Waspada): Bila guru atau pengawas siswa yang sedang mengikuti Ujian Nasional (UN) memberikan kunci jawaban kepada siswa itu sama juga memberikan atau mengajarkan kepada anak didik satu contoh buruk dan itu juga sama dengan meracuni siswa saat mereka sedang berjuang mendapat yang terbaik. “Makanya tahun ini tak ada lagi istilahnya bocor soal atau hal negatif lain yang menyangkut UN. Melainkan kali ini siswa di Bireuen lulus murni seratus persen bukan dengan bocor soal atau ada pihak lain yang mencoba meracuni mereka,” demikian Kadis Pendidikan Kebudayaan, Pemuda dan Olahraga (Kadisdikbudpora) Bireuen, Drs Asnawi M.Pd menjawab Waspada, Kamis (3/2) soal persiapan UN di Bireuen. Menurut Asnawi, aksi membocor soal atau memberi kunci jawaban kepada siswa dengan bentuk dan jenisnya itu satu hal buruk yang selama ini diperlihatkan oknum-oknum tertentu, namun untuk tahun ini hal itu tak terulang lagi karena citra guru atau marwah sebagai pendidik di depan siswa jatuh. “Kalau mau bantu siswa sebelum Ujian Nasional

ajarkan dia dengan berbagai cara dan teknis, sehingga mereka mampu menjawab soal UN, bukan memberi jawban saat UN,” kata Asnawi. Adapun target kelulusan siswa di UN kali ini, lanjut Asnawi adalah 100 persen. Dan itu katanya lagi, bukan andai-andai, melainkan target atau harapannya seperti itu. “Target lulus seratus persen itu harus diupayakan meski bukan sebuah angan-angan, melainkan perlu kerja keras para kepala sekolah, dewan guru dan pengawas dalam menyiapkan siswanya,” katanya seraya menambahkan UN itu dijadwalkan berlangsung April hingga Mei 2011 mendatang. Asnawi menyebutkan, soal nilai atau satn dari nilai UN mendatang adalah minimal 5,50 merupakan nilai gabungan (NG) perpaduan UN (X) dan nilai sekolah (Y) dengan bobot presentase hasil UN 60 persen dan hasil ujian sekolah serta penilaian guru (nilai rapor) sekitar 40 persen. “Standar kelulusan minimal 5,50 merupakan nilai gabungan dari UN (60%) dan nilai sekolah (40%). Sedangkan untuk mata pelajaran dalam UN tak boleh di bawah nilai 4,00 usai digabung hasil UN dan nilai di sekolah,” jelasnya.(amh)

Menerawang ‘Tikus’ Di Rumah BRA UNTUK kesekian kalinya Hasbi Abbas, 47, kembali harus mengurut dada. Seperti tahun-tahun sebelumnya, harapan duda fakir itu untuk memperoleh bantuan dari Badan Reintegrasi Aceh (BRA), kembali pupus. Padahal ia murni korban konflik. Ironisnya lagi, beberapa warga di Kampung Hasbi yang sebenarnya bukan korban konflik, justru dapat bantuan BRA. Bahkan ada yang menerima berkali-kali. Hasbi adalah duda fakir warga Desa Matang Seupeng, Kec. Simpang Ulim, Kab. Aceh Timur. Lelaki itu akrab disapa Cek Bi. Pekerjaannya serabutan. Di masa konflik, Cek Bi pernah menjadi penjaga tambak di pesisir Kuala Simpang Ulim, kawasan rawan. Suatu malam, ketika masih bekerja sebagai penjaga tambak, Cek Bi pernah ditangkap salah satu pihak bertikai dengan tuduhan membantu pihak lainnya. Hasbi pun dibawa serta setelah sebelumnya babak belur dihajar, dekat gubuk tambak. Bahkan punggungnya sempat dibacok. Hampir sebulan ia dipaksa jadi penunjuk jalan bagi kelompok itu. Cek Bi dilarang pulang. Masih untung, akhirnya ia dilepas karena memang tak bersalah. “Begitu Aceh damai sekitar 2006, saya mengajukan proposal bantuan ke BRA. Saaya butuh uang untuk berobat. Almarhumah istri saya, Nuraini, ketika itu kena kanker otak. Saya sendiri menderita batu ginjal. Tapi bantuan yang saya ajukan tak pernah cair,” kata Cek Bi kepada Waspada baru-baru ini. Nasib sama dialami Musliadi Ibrahim, 31, juga warga Desa Matang Seupeng, Kec. Simpang Ulim. Tahun 2002, ayah dua anak ini ditangkap salah satu pihak yang bertikai, saat hendak memanen udang di kawasan Alue Lhong, Desa Kuala Simpang Ulim. Musliadi ditahan dan dianiaya tiga hari. Bahkan hari ke dua ia sudah diperintah menggali kuburnya sendiri. Beruntung, di hari terakhir, Musliadi diizinkan pulang setelah sekelompok ibu-ibu, termasuk

ibu Musliadi, mencarinya ke lokasi penganiayaan. “Kami ditangkap sekitar pukul 07:00 pagi. Saat itu saya dalam perjalanan untuk memanen udang di tambak pakcik saya, Bahtiar. Setiba di Alue Lhong, tiba-tiba kami distop dan langsung disiksa. Selanjutnya kami dibawa ke kawasan Tambuw, dekat pantai. Di sana kami kembali disiksa. Jempol kaki kiri saya ditembak dari dekat,” kata Musliadi sembari memperlihatkan jempol kaki kirinya yang cacat. Sama seperti Hasbi Abbas, Musliadi pun sudah berulangkali melayangkan proposal ke BRA. Tapi, bantuan yang diidamkan juga tak pernah sampai. Ketika hal itu dipertanyakan ke pihak terkait,selalu diminta bersabar,menunggu giliran.Di pihak lain,orang yang sebenarnya sama sekali tidak ada sangkut pautnya dengan konflik—terutama mereka yang punya jaringan khusus dengan sejumlah oknum di BRA, justru kenyang menikmati bantuan. Tidak Tepat Sasaran Diakui atau tidak, penyaluran bantuan dari BRA untuk semua kategori korban konflik di Aceh selama ini memang ada yang tidak tepat sasaran. Jumlahnya tentu tidak seratus persen. Tapi yang jelas, fakta itu ada. Keberadaan tim verifikasi dan rekomendasi dari aparat desa hingga Muspika, belum menjamin data yang dihasilkan betul-betul valid. Potensi pemalsuan data tetap saja ada. Maklum, mareka juga manusia. Indikasi adanya pemalsuan data bisa dianalisa dari daftar nama penerima bantuan rumah dibakar/dirusak total tahun anggaran 2010. Berdasarkan hasil penelusuran Waspada, khusus untuk Kec. Simpang Ulim, terdapat sejumlah nama korban konflik palsu, termasuk dua oknum kepala desa berinisial SK dan SH. Keduanya dikenal punya jaringan luas dan dekat dengan penguasa. Tapi satu hal yang pasti, mereka tidak pernah memiliki rumah

yang dibakar atau dirusak total, semasa konflik. Camat Simpang Ulim, Lukman SP, ketika dikonfirmasi via telefon, mengaku tidak pernah mengeluarkan rekomendasi korban konflik kategori rumah terbakar untuk kedua keuchik tersebut. Menurut Camat, untuk tahun anggaran 2010, pihaknya hanya mengeluarkan rekomendasi untuk 25 korban konflik dan dari jumlah itu tidak termasuk nama Keuchik SK dan SH. “Buktinya, bisa dilihat dari surat yang saya kirim ke BRA Aceh Timur, tertanggal 2 Desember 2010,” katanya, meyakinkan. Uniknya, Ketua BRA Aceh Timur, Hasballah, yang ditemui terpisah, justru mengklaim, yang paling bertanggungjawab soal sah tidaknya seseorang dinyatakan sebagai korban konflik adalah pihak Muspika. “Muspika yang mengeluarkan rekom, lalu diverifikasi tim provinsi. Kita, di kabupaten hanya melaksanakan instruksi atau keputusan BRA proivinsi. Jika memang ada orang yang tidak berhak menerima bantuan, silahkan komplain secara tertulis dan kirim ke BRA. Kalau terbukti, pihak yang terlibat bisa dipidana,” katanya. Terlepas dari siapa yang salah dan benar, yang pasti pemalsuan data korban konflik selama ini memang nyata terjadi di Aceh. Banyak hak masyarakat yang benar-benar korban konflik, terampas oleh praktek tidak sehat. Dan ini diduga melibatkan sejumlah oknum, termasuk oknum di sekeliling BRA. Oknum seperti ini layak disebut ‘tikus’— binatang pengerat yang suka mencuri hak orang lain saat tuan rumah keluar atau tertidur pulas. Mareka bermuka tebal menikmati bantuan dari BRA, meski terkadang itu hak anak yatim yang ayah- ibunya mati akibat konflik. Namun, jangan pernah berharap bisa melihat mereka dengan mudah. Mereka tersembunyi dan harus diterawang. -Musyawir



WASPADA Sabtu 5 Februari 2011

Jembatan Gantung Blang Teungoh Terancam Ambruk

Petugas Penertiban Sita Keripik BIREUEN (Waspada): Petugas penertiban kota di Bireuen, kembali melakukan penertiban terhadap sejumlah pedagang keripik yang menggelar dagangannya di emperan toko dan bahu jalan di kawasan kota, Kamis (3/2) malam. Pada aksi itu, petugas Satpol-PP dibantu aparat kepolisian juga menyita barang dagangan dan etalase. Penertiban yang berlangsung sekira pukul 20.00 – 22.00 itu, adalah tindak lanjut sosialisasi yang telah dilakukan sebelumnya. Penertiban dipimpin Camat Kota Juang Dahlan, SE, Kapolsek Jeumpa, Iptu P.M. Ketaren, Danramil Kota Juang, Kapten Ronald Samosir, dan Kasubbag Penertiban dan Satpol PP, Khairullah, SE, serta anggota TNI. Namun dalam aksi itu, tidak semua pedagang PKL dapat terjaring. Pasalnya, pedagang voucher pulsa handphone di alun-alun Kota Bireuen segera menyingkir sebelum tim tiba di lokasi. Di sela-sela kegiatan itu, Camat Kota Juang, Dahlan mengatakan, penertiban ini dilaksanakkan khusus untuk pedagang keripik, pedagang buah-buahan dan pedagang pulsa (voucher) yang memakai minibus dengan memarkirkan kendaraannya di badan jalan. Sedangkan pedagang makanan dan minuman di depan bekas terminal Bireuen akan ditertibkan pada kesempatan lain. ‘Penertiban dilakukan bertahap, lain kali akan ditertibkan semua pedagang makanan dan minuman di Jalan Malikussaleh dan alun-alun Kota Bireuen’. Begitupun, Dahlan berjanji akan menertibkan pedagang warung makananyangmembuatkanopihinggaketrotoarjalan.(cb03)

Berkas Tujuh Perkara Illegal Logging Ke Kejari Bireuen BIREUEN (Waspada): Sedikitnya tujuh berkas serta tujuh tersangka perkara illegal logging yang ditangani Polres Bireuen, selama ini, Rabu (2/2) dilimpahkan ke Kejari Bireuen untuk diproses lebih lanjut. Demikian , Kapolres Bireuen AKBP HR Dadik Junaidi, melalui Kasat Reskrim AKP Khairul Saleh, Rabu (2/2). “Penyerahan berkas kasus illegal logging kali ini penyerahan yang kedua kali yang sebelumnya dinilai masih kurang, namun kali ini sudah P-21 atau sudah lengkap,” kata Kasat. Menurutnya tujuh berkas yang dilimpahkan ke pihak Kejari kali ini kasus yang pernah melibatkan tiga anggota Polhut Bireuen yaitu Junaidi, 23, Husaini, 31, dan M Yusuf, ketiganya ditangkap November lalu karena diduga ikut terlibat jual beli kayu haram dengan tersangka lain yang diamankan sebelumnya yaitu HM Thaeb, pemilik sebuah panglong di Gandapura, Anwar juga penampung kayu asal dari kecematan yang sama dan Husen serta Yuni tersangka kasus kayu lainnya yang ditangkap jajaran Polres Bireuen secera terpisah sebelumnya. “Kasus itu terus dikembangkan waktu itu dan menetapkan tiga anggota Polhut terlibat dalam kasus yang dilaksanakan dalam Operasi Babat Rencong,” kata AKP Khairul, seraya menambahkan, saat ini pihkanya terus memburu beberapa tersangka lain terkait dengan kayu temuan di beberapa kecamatan. termasuk kasus kayu gelondongan yang ditemukan di Desa Ie Rhop, Kec. Simpang Mamplam November lalu.(amh)

BRA Kembali Salurkan Bantuan Untuk Korban Konflik BIREUEN (Waspada): Badan Reintegrasi Aceh (BRA) Kabupaten Bireuen, Jumat (4/2) kembali menyalurkan bantuan untuk pembangunan rumah korban konflik (rumahnya rusak akibat konflik). Jumlah bantuan masingmasing mendapatkan Rp40 juta yang disalurkan dalam dua tahap. Ketua BRA Bireuen, Muhammad Usman mengatakan, dana bantuan pembangunan rumah korban konflik ini sebagaimana telah ditetapkan tahun 2010 dengan jumlah anggaran Rp2,2 miliar. Muhammdd Usman menjelaskan, bantuan dana yang disalurkan untuk tahap pertama Rp20 juta, tahap kedua Rp20 juta. Di mana penyerahan tahap kedua dilaksanakan jika penerima telah membuat laporan pertanggungjawaban penggunaan tahap pertama dan dilengkapi dengan foto pembangunan rumah yang sudah mencapai 50 persen. Menurutnya, jumlah rumah bantuan korban konflik yang rusak total (RT) yang telah dibantu BRA sejak tahun 2005-2010 sebanyak 3.052 unit yang rinciannya yakni, tahun 2005, 196 rumah, 2006 sebanyak 249 rumah, 2007 sebanyak 450, 2008 sebanyak 806, 2009 sebanyak 801, dan tahun 2010 sebanyak 550 unit. Sementara jumlah rumah rusak total yang belum menerima bantuan di Kabupaten Bireuen sesuai dengan hasil verifikasi tahun 2008 dan data susulan pengaduan yang disampaikan masyarakat tahun 2009 dan tahun 2010 adalah 2.238 unit. “Calon penerima rumah bantuan yang belum terbantu pada tahun ini, akan dialokasikan pada tahun-tahun berikutnya,” ucap Muhammad Usman seraya menadaskan, adanya sisa pengaduan rumah korban konflik yang diajukan masyarakat karena kealpaan dari kepala desa dan perangkatnya mengusulkan ketika diverifikasi pada tahun 2008. (cb03)

Pagar Tembok UPPKB Jontor Ambruk

SIGLI (Waspada): Jembatan gantung menghubungkan Desa Blang Teungoh dengan Blang Bungong, Kec. Tangse, Pidie terancam ambruk. Hampir seluruh papan lantai jembatan lapuk dan sebagian di antaranya patah. Demikian pantauan, Jumat (4/2). Tgk. Usman, 62, warga Desa Blang Bungong, Tangse mengatakan jembatan ini satu-satunya sarana penghubung antara Desa Blang Bungong dengan Blang Teungoh. Jembatan ini urat nadi masyarakat kedua desa, setiap hari dilintasi warga ke kebun atau menurunkan hasil panen dibawa ke pusat pasar Kec. Tangse. Buruknya kondisi jembatan gantung ini berlangsung sekira empat tahun lebih. Meski warga kedua desa selalu menyampaikan keluhan ke Kec. Tangse dan Kab. Pidie, namun tak ada tanda-tanda akan diperbaiki. “Kami mengharapkan jembatan ini dibangun baru. Setiap hari kami menggunakan jembatan ini, karena tidak ada jembatan lain,” kata Sinta Anggraini, 16, siswa SMA Tangse. (b20)

Lahannya Diserobot, Warga Adukan Pemilik HGU Ke Wagub

JEMBATAN RUSAK: Para pelajar melintasi jembatan Blang Teungoh, yang rusak, Jumat (4/2).

Pria Beristri Tiga Ditemukan Tewas BANDA BAROE, Aceh Utara (Waspada): Zulkifli, 45, warga Ulee Nyeu, Kecamatan Banda Baroe, Aceh Utara, Jumat (4/2) pagi, ditemukan tewas bersimbah darah di areal persawahan Lhok Weng, kecamatan setempat. Jasad pria beristri tiga itu ditemukan para pelajar yang sedang melintas di Jalan Elak. Dr. Faisal Akbar, di Rumah Sakit Umum Daerah Cut Meutia, Aceh Utara ketika dikonfirmasi Waspada kemarin menyebutkan, hasil visum pihaknya, korban atas nama Zulikfli mengalami luka serius, kepala bolong, leher patah, sebagian isi kepala terburai keluar, sebagian tulang kepala terpisah, luka robek di kelopak mata bagian atas sebelah kanan, tulang mata patah, tulang pipi kiri patah, dan tulang bahu kanan patah. Lalu, perut bengkak dan keras, dari alat kelamin tidak mengeluarkan sperma atau kotoran lainnya. Kondisi mayat le-

bam dan kaku. “Perkiraan medis, peristiwa yang dialami Zulkifli telah mencapai satu hari. Pasalnya, kondisi mayat lebam membutuhkan waktu enam jam, sedangkan mayat kaku butuh waktu dua jam. Semuanya delapan jam,” terang dr. Faisal Akbar saat memberikan keterangan kepada pers. Ramlah, 35, istri kedua korban ketika ditanyai wartawan di RSUDCM mengatakan, selama ini almarhum tidak mempunyai musuh. Keseharian korban berprofesi sebagai penjual barang kelontong di Jalan Elak. Informasi suaminya telah meninggal diketahui dari M. Isa, 35, ponakan suaminya. “Kata M. Isa kepada saya, kamu udah tahu sesuatu belum. Apa Don (Zulkifli) sudah meninggal di persawahan tadi pagi. Begitu kata ponakan saya,” ucap Ramlah meniru ucapan ponakannya itu. Sampai di Tempat Kejadian Perkara (TKP) Ramlah mendapati suaminya dalam kondisi tragis, batok kepala bolong dan hampir seluruh isi kepala terburai, leher dan tangannya patah. Ramlah mengaku tidak mengetahui motif di balik kematian suaminnya itu. Pasalnya, selama

Buntut Enam Ruko Ambruk

Bangunan Di Tepi Sungai Dilarang SIGLI (Waspada): Camat Tangse Jafaruddin, S.Sos mengingatkan masyarakatnya tidak melakukan pembangunan gedung di tepi sungai, dikhawatirkan cepat ambruk akibat erosi (pengikisan air-red). Hal itu disampaikannya pasca peristiwa enam ruko yang amblas ke dalam Daerah Aliran Sungai (DAS) Krueng Muko, Tangse, Kabupaten Pidie yang berhulu di kawasan pegunungan Singgah Mata. “Kami selalu mengingatkan masyarakat tidak melakukan pembangunan di tepi sungai, ini sangat berbahaya dapat mengancam jiwanya. Selain itu pembangunan gedung di tepi sungai juga tidak diizin kan dalam pemberian Izin Mendirikan Bangunan (IMB),” ujarnya. Kata dia, ambruknya enam ruko Kamis (3/1) siang, peristiwa yang tidak diinginkan semua pihak. Namun karena tetap membandel dengan menambah pembangunan belakang gedung sampai

melewati batas tebing sungai menyebabkan bangunan ruko tersebut sangat mudah dihantam terjangan air dalam DAS Krueng Muko yang selalu mengalir deras Apalagi peristiwa itu terjadi setelah hujan turun yang menyebabkan air dalam sungai itu meluap dan menghantam bangunan gedung ruko. Ia mengungkapkan masih banyak pemilik ruko di Tangse yang telah menambah pembangunan belakang rumahnya melewati tebing sungai. Bahkan dari sejumlah ruko itu, empat diantaranya dalam waktu dekat akan segera roboh kembali. Dari pantauan langsung di lokasi melihat bangunan ruko itu telah retak, sementara pondasi bagian bawah gedung terus dikikis air. Jika dalam waktu dekat hujan kembali turun dan air dalam sungai itu meluap, bangunan belakang ruko itu akan kembali amblas dalam sungai. Jafaruddin memaparkan, pasca peris-

GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *

PADA suatu pagi menjelang siang, di sebuah bilik di ujung sebuah barak di kawasan Desa Bakoy, Kec. Ingin Jaya, Kabupaten Aceh Besar. Seorang ibu yang sudah berusia setengah abad lebih itu duduk di teras tempat tinggalnya. Di bilik sebelahnya ada dua wanita muda juga duduk di teras rumahnya. Namun di depan teras barak ada tiga wanita tengah baya sedang menyuci pakaian sambil ngobrol. Alur pembicaraan tak jauh soal janji manis NGO asing dan BRR serta

pihak Pemerintah Aceh. Yang namanya bencana seperti bencana tsunami dan bentuk sejenis lainnya, pasti tidak akan ada seorang pun yang senang menghadapi, apalagi menerimanya kedatangan bencana tersebut. Begitu juga halnya yang dialami warga di Provinsi Aceh pada enam tahun lalu, tepatnya 26 Desember 2004. Di mana, bencana gempa dan tsunami itu telah meluluhlantakkan harta benda dan nyawa, bahkan hingga sekarang ratusan kepala keluarga (KK)


Berangkat (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta


11:35 JT 397 Medan/Jakarta 20:00 JT 307 Jakarta

06:40 12:15

12:55 SJ011 Medan/Jakarta


12:20 AK 306 Kuala Lumpur *

FY 3401 Penang ** 14:10 FY 3400 Penang “” * Setiap Senin, Rabu, Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

tiwa enam unit ruko amblas ke sungai, pihaknya langsung melaporkan peristiwa itu kepada Bupati Pidie Mirza Ismail dan sejumlah dinas terkait. Dia mengharapkan Pemkab Pidie segera mengalokasikan dana untuk dilakukan pembangunan tebing sungai supaya dapat meminalisir peristiwa erosi yang kian hari makin parah. Apalagi, daerah Tangse dan sekitarnya dikelilingi banyak sungai yang airnya mengalir deras. Akibat erosinya sungaisungai tersebut, banyak lahan dan perumahansertatempatibadahjugajalanterancam amblas ke dasar sungai akibat erosi. “Kita setiap tahun selalu mengusulkan melalui Musrenbang, tetapi belum ada pembangunannya. Kita tunggu tahun ini mudah-mudahan pemerintah Pidie dapat melakukan pembangunan tebing sungai di daerah Tangse ini,” katanya. (b20)

APMS Belum Kantongi Rekomendasi UPL Dan UKL SEUNUDDON, Aceh Utara (Waspada): Sarana agen premium dan solar (APMS) di Kec Seunuddon, Aceh Utara, sampai saat ini belum mengantongi rekomendasi Upaya Pemantauan Lingkungan (UPL) dan Upaya Pengelolaan Lingkungan (UKL). “Kantor Linkhi belum pernah mengeluarkan rekomendasi, meski bangunan APMS ini sudah mendekati rampung,” kata kepala kantor Linkungan Hidup (Kakanlinkhi) Aceh Utara, Nuraina, SKM, M.Si (foto) menjawab Waspada di ruang kerjanya, Jumat (4/2). Sebagaimana diberitakan sebelumnya, Selasa (1/2), sarana bisnis bahan bakar minyak (BBM) di atas areal sawah seluas 1000 meter ini belum punya izin mendirikan bangunan (IMB), hingga Selasa (1/2). “Bukan itu saja, rekomendasi memperoleh UPL dan UKL juga belum,” tegas Kakanlinkhi tersebut. Berbagai tanggapan muncul, seiring pembangunan satu unit APMS yang belum memenuhi syarat di Gampong (Desa) Mane Kawan, Kec Seunuddon, Aceh Utara ini yang dimulai akhir tahun 2010 lalu. Terkait ini, Aina (panggilan akrab) menyebutkan, ke depan persyaratan bangunan stasiun pengisian bahan bakar umum (SPBU), maupun APMS semakin ketat. Mulai memasuki tahun 2011, kata Aina halaman SPBU maupun APMS tidak boleh ditutupi semen atau aspal, tapi harus memakai paping block, guna mencegah hilangnya daya serap tanah terhadap air hujan dan untuk mengurangi pantulan panas matahari. “Pokoknya terhitung awal tahun 2011 ini, seluruh SPBU dan APMS harus mengacu kepada konsep berwawasan linkungan, maksudnya bersinergis dengan linkungan,” tegasnya. Bersumpah Sehubungan tudingan belum miliki IMB, berikut UPL dan UKL tersebut, pihak pengusaha APMS Kec Seunuddon ini, T Fadlin bersumpah, “semua sudah lengkap. IMB diteken Kakan KP2T Aceh Utara, T Sulaiman, Rabu (2/2). Sementara UPL dan UKL sudah lebih dahulu dikantongi yang ditanda tangani oleh Dr Saiful dari Unsyiah,” tegasnya, kemarin.(b10)

340 Kepala Keluarga Sudah 6 Tahun Tinggal Di Barak

Penerbangan Di Bandara SIM Banda Aceh Garuda Indonesia

ini almarhum tidak memiliki musuh. Jika Zulkifli dirampok, sepeda motor jenis Samurai milik korban tidak hilang dan letaknya beberapa meter dari lokasi ditemukan mayat, bahkan diperkirakan, ada yang mencoba membakar sepeda motor itu. “Tidak ada yang hilang dari suami saya. Jadi dia bukan dirampok. Saya menduga, suami saya dibunuh, sebelum dibunuh suami saya diseret beberapa meter dari sepeda motornya, tapi saya tidak tahu motif di balik pembunuhan itu,” ucap Ramlah. Ramlah menyebutkan, terakhir dia bertemu suaminya, Kamis (3/2) sore, saat pulang ke rumah mengambil jatah beras miskin, dan sempat menyerahkan racun tikus kepada dirinya untuk membunuh hama tikus di areal persawahan milik mereka. “Tidak ada tanda-tanda yang aneh hari itu. Saat dia pulang, kemarin saya sedang duduk di anak tangga rumah pintu depan. Sumi saya memiliki tiga orang isteri, dulu dia karyawan kontrak PT. KKA,” jelas Ramlah diakhir wawancara. (cmun)

Sebuah Penantian Panjang Yang Tak Pasti

JONTOR, Subulussalam (Waspada): Pagar tembok bagian belakang Unit Pelaksana Penimbangan Kenderaan Bermotor (UPPKB) Jontor Kec. Penanggalan, Subulussalam sekira empat meter ambruk. Padahal pembuatan tembok yang dikabarkan sepaket dengan Pembangunan Gudang UPPKBitubaruDesembersilamrampungdikerjakan.Sumber di sana menyebutkan, kejadian diperkirakan terjadi, Rabu (2/2) malam, bersamaan dengan tutun hujan rintik-rintik. Pantauan Waspada, Kamis (3/2) di lokasi terkait, selain ambruknya sebagian pagar tembok juga terlihat bagian lantai retak. Ambruknya sebagian pagar tembok di sana diperkirakan masih akan disusul dengan ambruk lanjutan setelah sebagian besar lantai hingga pagar tembok sekitarnya terlihat retak. “Bukan tidak mungkin pagar ini akan ambruk lagi, apalagi lantainya juga sudah retak,” tutur sumber setempat kepada Waspada menduga kalau kualitas bangunan yang dikerjakan pemborong terkait tidak sesuai bestek. Seperti papan proyek terkait, anggaran Pembangunan Gudang Jembatan Timbang Jontor Subulussalam yang berasal dari APBA senilai Rp 1.552.000.000 ini dikerjakan oleh PT Cot Sawa, Aceh Besar. Sementara tanggal kontrak 1 September 2010 dan selesai 22 Desember 2010.(b33)

Tiba (flight, asal, waktu):

Waspada/Muhammad Riza

BLANG PIDIE (Waspada): Mengaku lahannya diserobot pemilik Hak Guna Usaha (HGU), warga Darul Makmur, Kabupaten Nagan Raya mengadu kepada Wagub Aceh H. Muhammad Nazar dan meminta Wagub menyelesaikan kasus dugaan penyerobotan lahan itu. Dalam laporannya kepadaWagub Aceh saat berkunjung ke Blangpidie, Kab. Aceh Barat Daya, Rabu (2/2) tengah malam, masyarakat mengadukan tiga perusahaan pemilik HGU di wilayah itu. Yakni PT Asra, PT Gelora Sawita Makmur dan PT Kadista Alam yang telah mengklaim lahan milik warga menjadi kawasan pengembangan perusahaan itu. “Kami berharap ketiga perusahaan itu segera mengembalikan lahan yang diserobotnya itu kepada masyarakat pemilik,” kata Suryadi, tokoh masyarakat Darul Makmur di hadapan Wagub Aceh H Muhammad Nazar. Diungkapkan, ketiga perusahaan pemilik HGU di Nagan Raya itu diduga telah menyerobot lahan milik warga yang diperkirakan mencapai ribuan hektar. Suryadi menyebutkan, salah satu dari ketiga perusahaan itu yakni, PT Asra memiliki izin sekitar delapan ribuan hektar, namun yang digarap telah mencapai sekitar sepuluh ribu hektar. Dikatakannya, penyerobotan lahan itu meliputi gampong (desa) Seuneu-am Peut, Seuneuam Dua, Seuneam Tiga dan Alue Kuyun. “Kami juga minta agar ada pengukuran ulang kawasan yang dimiliki perusahaan itu, sehingga tidak merugikan masyarakat setempat,” ujarnya seraya menambahkan, ketiga perusahaan itu selama ini kurang memberikan perhatian terhadap masyarakat sekitar. SementaraWagub Aceh Muhammad Nazar mengatakan, pihaknya akan segera memanggil pimpinan ketiga perusahaan untuk mencari solusi penyelesaian persoalan itu. “Saya minta perusahaan pemilik HGU dapat membantu masyarakat sekitar dengan melakukan berbagai program pembangunan ekonomi kemasyarakatan,” katanya. Nazar menjelaskan, semua pimpinan kabupaten/kota supaya melibatkan masyarakat setempat sebelum memberikan izin perusahaan untuk berinvestasi di daerah itu. Hal itu perlu guna menghindari persoalan di kemudian hari.(b09)

12:45 14:30

Waspada/Rusli Ismail

ANAK BARAK PENGUNGSI : Sejumlah anak-anak korban tsunami yang hingga sudah memasuki tahun ketujuh pasca bencana tsunami masih menetap di barak sebagai anak pengungsi di Desa Bakoy, Kecamatan Ingin Jaya, Kabupaten Aceh Besar. Mereka kesehariannya asyik bermain di depan barak tanpa beban yang terpikirkan di benaknya, maklum yang namanya masih anak-anak. Foto direkam Selasa (1/2).

masih menempati barak-barak hunian sementara. Itu semua, tidak lain hanya ditimbulkan kerana bencana yang sangat dahsyad yang menimpa kawasan pemukiman mereka. Anisah, 60, (foto) wanita yang sejak 6 tahun sudah menjadi penghuni abadi barak di Desa Bakoy, Kecamatan Ingin Jaya, Aceh Besar.Wajahnya mulai keriput dan giginya hanya tinggal satu dua lagi, tak sabar lagi menunggu rumah bantuan yang dijanjikan pemerintah. Baginya barak adalah sahabat menemaninya selama 6 tahun, saat gelisah dan punya masalah, bahkan barak juga menjadi istana bersama Zainal Abidin, 66, suaminya sekarang yang berprofesi sebagai tukang becak barang. Perempuan yang sudah berusia setengah abad lebih itu merupakan salah satu dari sekian banyak penghuni barak Bakoy yang kini terus menunggu rumah bantuan yang dijanjikan Pemerintah Aceh. Menurut data sementara ada 340 Kepala Keluarga (KK) orang-orang kecil lainnya yang sudah enam tahun tinggal di barak. Dan selama itu pula kurang mendapat perhatian, terutama pemerintah dan orang-orang berduit. Setiap hari dia merenungi nasibnya bersama hampir dua ratus Kepala Keluarga (KK) lainnya yang harus terus menunggu bantuan rumah yang tak kunjung ada kepastiannya.“Inilah kondisi kehidupan kami yang serba tak menentu terus menerus tinggal di barak,“ ungkapnya sambil memamerkan senyum sumringah. Hal serupa juga disampaikan Kepala Barak Bakoy I, Idris,50, warga Ulee Lheue, Kecamatan Meuraxa, Kota Banda Aceh.

Me-nurutnya, kini ada sekira hampir 200 Kepala Keluarga (KK) korban tsunami dari berbagai daerah yang berkumpul dan menempati barak hunian sementara Desa Bakoy. Khusus barak Bakoy I, kata Idris, terdapat 115 KK, mereka pin-dahan dari beberapa tempat penampungan lain sebelumnya. “Saya sendiri pindahan dari ge-dung Sosial ke Barak Bakoy hing-ga sekarang, “sebut Idris. Menurut Idris, di antara penghuni Barak Bakoy saat ini, ada yang sudah enam kali pindah dari tempat penampungan sebelumnya, namun belum juga ada kejelasan kapan akan mendapatkan rumah bantuan.“Setelah sekian lama menanti, realisasinya masih kabur,“ ungkap Idris. Diakui atau tidak, kehadiran NGO asing sangat bermanfaatnya bagi korban tsunami. Masyarakat dapat bangkit kembali setelah terpuruk akibat terjangan tsunami. Namun bagi penghuni barak Bakoy, kata Idris rumah bantuan sebenarnya sudah selesai dibangun 340 unit sejak dua tahun lalu oleh sebuah NGO SCC Arab Saudi di Desa Mirek Lamreudeup, Kecamatan Pekan Bada, Kabupaten Aceh Besar. Namun sangat disayang dan bakan disesalkan, entah kenapa proses penyerahannya kepada calon pemilik yang hingga sekarang belum juga kunjung dilakukan.

Informasi yang diperoleh, kata Idris, pihak Deputi Perumahan Arab Saudi, Humam, sejak lama mau diserahkan untuk calon pemiliknya melalui Pemerintah Aceh. “Namun, gubernur yang selalu tak punya waktu dan kesempatan untuk penyerahan rumah bantuan Arab Saudi itu, hingga kini masih terkatung-katung,” sebut Idris mengutip keterangan Deputi Perumahan Arab Saudi, Humam. “Sekarang saya idak tahu lagi bagaimana kelanjutan proses penyerahan rumah bantuan SCC Arab Saudi yang jumlahnya 340 unit, yakni untuk penghuni barak Bakoy I sebanyak 103 unit, dari Regional I sebanyak 15 unit, dan ADB 2 unit, totalnya 115 unit khusus untuk penghuni barak Bakoy I, selebihnya diperuntukkan untuk penghuni barak Bakoy II yang tergantung Pemerintah Aceh,” sebut Idris. H. Rusli Ismail


WASPADA Sabtu 5 Februari 2011


Banjir Bandang Rusak Puluhan Rumah Warga SINGKIL (Waspada): Sedikitnya 60 rumah warga di Kampong Bulusema Kecamatan Simpang Kanan, Kabupaten Aceh Singkil, Rabu (2/2) sekira pukul 20.00 Wib mengalami kerusakan berat akibat diterjang banjir bandang secara tiba–tiba. Kepala Desa Bulusema Ismail Berutu kepada wartawan mengatakan, peristiwa banjir bandang yang merusak puluhan rumah warga di sana terjadi secara tiba–tiba, pada saat masyarakat hendak menunaikan shalat Isya tiba–tiba suara deras yang disertai banjir dan bongkahan kayu menyapu puluhan rumah warga. Akibat banjir bandang disebabkan menguapnya Lae Ordi itu, satu rumah penduduk hanyut, 19 rumah rusak parah dan 40 lainnya rusak ringan dan 50 hektar sawah rusak parah dan 200 meter aspal hanyut yang mengakibatkan jalan penghubung juga mengalami kerusakan yang cukup parah. “Kendati dalam peristiwa itu tidak ada korban jiwa namun kerugian secara materi ditaksir senilai Rp1 miliar lebih sebut Ismail

dan hingga kini masyarakat masih trauma akibat peristiwa itu. Sementara Bupati Aceh Singkil H. Makmursyah Putra yang menerima informasi terjadinya banjir bandang langsung turun ke lokasi untuk menyerahkan bantuan kepada masyarakat 100 karung beras, 100 kardus mi instant dan 100 karton air mineral. Kepada wartawan Kamis (3/2) di lokasi kejadian Bupati Aceh Singkil H. Makmursyah Putra mengaku peristiwa banjir bandang yang menerjang puluhan rumah warga di Kampong Bulusema, banjir yang terdahsyat di kabupaten yang dipimpinnya itu. “Selama menjabat kepala daerah, banjir Bulusema kali ini banjir terparah. Pemerintah daerah akan segera berupaya membantu warga korban banjir dengan berupaya tanggap darurat dan akan segera berkordinasi bengan pemerintah provinsi dan pusat membantu korban,” sebut Makmur. Hingga berita ini dikirim masyarakat korban banjir bandang terpaksa dievakuasi ke rumah penduduk lainnya. (cb02)

Dewan Nilai, Banyak Perangkat Kampung Tak Pahami Tupoksi REDELONG (Waspada): Anggota Dewan Perwakilan Rakyat Kabupaten (DPRK) Bener Meriah, Ir Suterisno, menilai banyak aparat kampung, mulai dari gecik, imam hingga kaur kampung yang ada di Kabupaten Bener Meriah, tidak memahami tugas pokok dan fungsinya (Tupoksi). Akibatnya, pekerjaan untuk tingkat pemerintahan kampung menumpuk dan dikerjakan oleh kepala kampung. Hal itu diungkapkan Ir Suterisno, Senin (31/1) dalam pandangan umum pada sidang paripurna pembahasan Kebijakan Umum Anggaran (KUA) dan Prioritas Plafon Anggaran Sementara (PPAS) yang dilaksanakan di ruang sidang DPRK Bener Meriah. Dikatakan, melihat kondisi ini, pihak Pemkab Bener Meriah, diharapkan bisa segera membenahi bidang pemerintahan desa terutama tentang tugas aparat kampung. Selain itu, sebut Suterisno, Sekretaris Desa (Sekdes) yang telah diangkat menjadi Pengawai Negeri Sipil (PNS), justru lebih sering berdinas di kantor-kantor camat dan bukan bertugas untuk membantu kerja aparat kampung sesuai dengan tugas dan fungsinya. “Kami melihat banyak sekdes yang telah menjadi PNS justru bekerja di kantor-kantor camat, sehingga pekerjaan aparat kampung menumpuk dan

dikerjakan oleh keucik,” ungkap Ir Suterisno dalam pandangan umum yang disampaikan di hadapan para anggota dewan dan pihak eksekutif Pemkab Bener Meriah. Dalam paparannya anggota DPRK Bener Meriah ini, juga menyinggung tentang jumlah penduduk di daerah itu. Berdasarkan data dari Badan Pusat Statistik (BPS) Tahun 2010, jumlah penduduk Kabupaten Bener Meriah, secara keseluruhan sebanyak 121 ribu jiwa. Namun, berdasarkan data dan laporan dari Dinas Kependudukan setempat, jumlah penduduk justru membengkak menjadi 149 ribu jiwa. “Nah dari mana datangnnya jumlah penduduk yang membengkak sekitar 28 ribu jiwa. Ini yang perlu segera diluruskan,” tanya Ir Suterisno. Dalam sidang paripurna pembahasan KUA dan PPAS Tahun Anggaran 2011 itu, mencuat juga beberapa persoalan tentang masih banyaknya beberapa Satuan Perangkat Kerja Kabupaten (SKPK) yang masih kekurangan pegawai serta terdapatnya beberapa jabatan yang masih kosong. Selain itu, dalam pandangan umum dan penyampaian hasil panitia khusus (Pansus) dewan, pihak legislatif menyoroti sejumlah bidang di daerah itu yang perlu adanya perhatian serta perbaikan.(cb04)

Jalan Rusak Tahunan Tak Kunjung Diperbaiki MEULABOH (Waspada): Sejumlah warga dan pengguna jalan mengeluhkan buruknya jalan alternatif yang menghubungkan Jalan Gajah Mada dan Sentosa di Desa Drien Rampak, Kec. Johan Pahlawan, Aceh Barat. Meski telah rusak sejak puluhan tahun lalu, namun jalan itu tak kunjung mengalami perbaikan. Indra, 27, salah seorang pengguna jalan mengatakan, buruknya kondisi jalan itu tak hanya menyulitkan pengguna jalan, tapi juga warga sekitar. “Anda lihat sendiri kondisinya kalau hujan begini jalan becek, tapi waktu kemarau berdebu. Padahal jalan ini di tengah kota dan jalan satu-satunya menuju rumah sakit jiwa Meulaboh,” kata Indra kepada Waspada, Jumat (4/2). Menurut Indra, tak hanya pengguna jalan, kondisi itu juga dikeluhkan warga sekitar karena saat kemarau, maka jalan menimbulkan kepulan debu. Dikatakan, meski telah berlangsung tahunan jalan dengan panjang sekitar 300 meter itu, tak ada tanda-tanda akan

diperbaiki. “Tentunya kami berharap, pihak terkait memperhatikan ini, kasihan warga, apalagi ini juga jalan masuk menuju rumah sakit jiwa Meulaboh. Bagaiman mau bawa pasien kalau rusak begini,” kata Indra sembari menambahkan masalah itu telah disampaikan kepada pihak terkait, namun hingga kini belum ada tanda akan diperbaiki. PantauanWaspada selain rusak parah dan lubang, pengendara juga disulitkan dengan sempitnya jalan. Selain itu ketiadaan ramburambu peringatan di sekitar jalan Badak juga beresiko menimbulkan kecelakaan. Meski rusak, warga lebih memilih jalan dimaksud karena merupakan rute terdekat menuju jalan Gajah Mada ke arah Sentosa dan dari arah sebaliknya. ”Kami berharap kepada pemerintah tolonglah diaspal, apalagi jalannya tidak terlalu panjang,” kata Hasanuddin warga sekitar jalan Badak.(cak)


TERKELUPAS: Tak kurang dari 200 meter jalan kabupaten di Kampong Bulusema, Aceh Singkil, terkelupas akibat diterjang banjir bandang, Rabu (2/2) sekira pukul 20.00 Wib.

‘Cek Gu’ Langka, Kelulusan UN Siswa 2011 Aceh Barat Terancam MEULABOH (Waspada): Angka ketidaklulusan siswa di Aceh Barat dalam mengikuti Ujian Nasional (UN) tahun 2011 mendatang diprediksi akan meningkat dibanding tahun 2010. Pasalnya, 40 persen dari guru di tingkat SMP, SMA, SMK dan MAN di Aceh Barat merupakan berlatar belakang pendidikan Sarjana Agama bukan pengajar mata umum. Kepala Bidang Dikmenti Dinas Pendidikan Pariwisata, Pemuda dan Olahraga Aceh Barat, Drs Tamren mengatakan, 36 dari 349 tenaga pengajar menengah atas sederajat tahun 2010 di Aceh Barat, merupakan Sarjana Agama. Sementara guru bidang studi pelajaran umum jumlahnya di bawah 33 orang, selebihnya guru bidang studi Matematika sebanyak 38 orang.

“Itu menjadi kekhawatiran kita, karena mereka rata-rata lulusan Pendidikan Agama Islam (PAI). Nah apakah mereka juga mampu di pelajaran umum,” kata Thamren kepada Waspada, Kamis (4/2). Meski demikian kata Thamren, kewenangan pembagian hasil nilai kelulusan berupa Standart Kompensasi Kelulusan (SKL), yang diberikan antara daerah dan pusat sebesar 40,60 diharap dapat menekan angka ketidaklulusan siswa pada tahun 2011. ”Itu mungkin menjadi harapan kita di samping akan menambah jam belajar pada sore. Ke depan dalam perekrutan sarjana lulusan mata pelajaran umum akan kita prioritaskan. Kini untuk mata pelajaran Geografis dan IPS kita tidak ada,” kata Thamren. Menurutnya, meski Provinsi Aceh jadi sentralisasi penerapan Syariat Islam yang ditindaklanjuti penambahan jam dan mata pelajaran agama, namun standar kelulusan yang menca-

Waspada/Arman Konadi

21 April ini, kita akan menggodok komite sekolah meningkatkan jam pelajaran, khususnya sore seperti Remedial, dan mata pelajaran yang belum tertangani,” pungkas Thamren.

Tahun 2010 dari 2.541 orang siswa di Aceh Barat yang mengikuti UN, 494 siswa atau 18,88 persen di antaranya tidak lulus. Sementara 81,12 persen atau 2.047 dinyatakan lulus.(cak)

Tabrak Beruntun, 2 Bocah Luka Parah MEULABOH (Waspada): Sopi dan Ika bocah berusia 3 dan 1 tahun mengalami luka parah setelah sepeda motor bernomor polisi BL 6814 EH yang dikemudikan MYusuf, 40, ayahnya, terlibat tabrakan beruntun, di Jalan Sisingamangaraja, Meulaboh, Kamis (3/2) petang, sekira pukul 14.00 Wib. Keduanya langsung dilarikan ke Rumah Sakit Cut Nyak Dhien, Meulaboh untuk mendapatkan perawatan intensif karena mengalami luka di bagian kepala. M Yusuf, ayah bocah malang warga Desa Ujung Brasok, Kec. Johan Pahlawan itu mengatakan, kecelakaan berawal saat becak yang dikendarai Agus, 38,

yang datang dari arah Meulaboh menuju Lapang ditabrak mobil Avanza. Karena tabrakan itu katanya becak yang dikemudikan Agustiman, 38, tiba-tiba memakan badan jalan persis di depannya. “Saya terkejut tiba-tiba becak itu sudah di depan dan posisinya tidak bisa dihindari lagi. Anak yang parah, saya dan istri hanya lecet,” kata M.Yusuf yang datang dari arah sebaliknya. Menurut Yusuf, becak yang dikendarai Agus hendak masuk ke persimpangan menuju Desa Cot Kandeh. Diduga sopir Avanza lalai, sehingga meski telah memberi tanda hendak berbelok, namun sopir minibus itu

tetap menabraknya. ”Dari jauh Agus mengaku sudah memberi tanda dengan tangannya hendak berbelok, tapi tetap ditabrak mungkin sopir tidak melihatnya,” kata M. Yusuf. Tak ada korban jiwa dalam tabrakan beruntun di kawasan SMP 3 Meulaboh itu. Warga di sekitar lokasi langsung membawa kedua bocah ke Rumah Sakit Umum Cut Nyak Dhien, Meulaboh. Sementara pengemudi becak dan Avanza hanya mengalami luka lecet di bagian kaki. Namun becak dan sepeda motor rusak parah dan dibawa petugas Satlantas ke Polres setempat. Kasus itu kini ditangani Polres Satlantas Polres Aceh Barat.(cak)

Pawang Rusa Meninggal Dunia Di Tengah Hutan PEUREULAK, Aceh Timur (Waspada): Sedang berburu rusa, M. Yusuf, pawang rusa asal Desa Seuneubok Baro, Kec. Ranto Peureulak, Kab. Aceh Timur, meninggal dunia di tengah hutan persisnya di kawasan P-3, Kec. Ranto Peureulak. Korban meninggal diduga akibat mengalami serangan jantung saat berburu bersama rekan-rekannya, Kamis (27/1) pekan lalu. “M. Yusuf meninggal saat sedang berburu bersama rekannya di tengah hutan,” ujar Geuchik Seuneubok Baro, Baharuddin, Kamis (3/2) siang. Kata dia, berdasarkan keterangan dari rekan-rekannya saat itu, M. Yusuf ketika itu terlihat semangat dan tidak ada ciri-ciri kesehatannya kurang fit. Rencana berburu rusa itupun pada hari itu terlaksana setelah menempuh perjalanan lebih 2 jam. Saat sedang mengejar rusa yang sempat dilihatnya kawanan pemburu rusa, M. Yusuf mengeluh kesakitan di bagian ulu hati. Usai mengetahui salah satu temannya sakit, kawanan pemburu rusapun menghentikan aktivitas itu dan berkumpul melihat kondisi kesehatan M. Yusuf yang mulai tidak normal. “Sesaat setelah M. Yusuf di pangkuan temannya, dia menghembuskan nafas terakhir,” ujar Baharuddin.(cmad)

Ekspos RTRW Kota Subulussalam Dikritik

Jalan rusak sejak 2005 lalu namun hingga kini tak juga diperbaiki.

pai 5,5 sangat berpengaruh pada mutu pendidikan di Aceh karena kewenangan kelulusan hanya 40 persen dari daerah. “Menghadapi ujian nasional yang berlangsung 18 hingga

SUBULUSSALAM (Waspada): Ekspos Rencana Tata Ruang Wilayah (RTRW) Kota Subulussalam dikritik sejumlah kalangan. Pasalnya, penyusunan RTRW yang dilaksanakan, Selasa (1/2) di Gedung Pertemuan DPRK Subulussalam, dihadiri Wakil Walikota, Ketua/Wakil Ketua DPRK dan sejumlah anggota, unsur Muspida Kota Subulussalam, perwakilan Aceh Selatan dan Aceh Singkil, para kepala SKPK Subulussalam, camat dan sejumlah elemen masyarakat setempat ditengarai memiliki sejumlah kelemahan. Misalnya, luas wilayah yang berbeda jika dibandingkan dengan data BPS, peralihan sejumlah wilayah ke wilayah lain, adanya Hutan Produksi (HP) yang mestinya menjadi Hutan Rakyat (HR) dan lainnya. Bahkan Ketua Komisi B DPRK Subulussalam Netap Ginting kepada Waspada, Rabu (2/2) di ruang kerjanya menandaskan, HP di wilayah Sisik Naga Kec. Penanggalan semestinya menjadi HR, lokasi Swaka Margasatwa di Kec. Rundeng yang mestinya menjadi pemukiman warga. Parahnya lagi adanya perbedaan mencolok luas wilayah Kota Subulussalam antara data Badan Pusat Statistik (BPS) berdasarkan UU No. 8/2007 tentang Pemko Subulussalam, yakni 139.000 ha dengan hasil ekpos konsultan yang hanya seluas 119.750 ha. “Finalisasi tentang luas wilayah Kota Subulussalam menjadi penting,” tandas Netap diamini Supriadi Boang Manalu, anggota DPRK setempat menambahkan perlunya dilakukan koordinasi dengan semua pihak terkait luas wilayah Kota Subulussalam. Hal senada disampaikan Syahril Tinambunan, Ketua LSM Berkah Subulussalam secara terpisah. Dikatakan, membandingkan peta yang dikeluarkan Tim Penyusun RTRW dengan peta lama telah terjadi perluasan beberapa wilayah kecamatan, di sisi lain tejadi pengecilan. “Wilayah Kec. Penanggalan menjadi lebih kecil jika dilihat peta RTRW, pada peta lama tidak seperti ini,” terang Syahril menunjukkan peta RTRW. Seperti arahan Wakil Walikota Subulussalam Affan Alfian Bintang saat membuka acara ekspos, Tata Ruang Wilayah Kota Subulussalam yang memiliki luas 1.319 km2, terdiri atas lima kecamatan, delapan kemukiman dan 74 desa harus valid dan akurat, sehingga penataan daerah ini ke depan akan semakin lebih baik. (b33)

Waspada/Arman Konadi

Petugas Satlantas Polres Aceh Barat menggunakan ambulan, mengangkut sepeda motor yang terlibat tabrakan beruntun di Jalan Sisingamangaraja Meulaboh Kamis (3/2) petang. Tak ada korban jiwa, namun dua bocah mengalami luka serius di bagian kepala.

Mutasi Besar-besaran Di Pemkab Bener Meriah REDELONG (Waspada): Sejumlah pejabat mengalami pergeseran di Pemkab Bener Meriah, untuk eselon II sebanyak 14 orang kepala dinas maupun badan serta empat orang di antaranya memasuki masa pensiun. Eselon III yang terdiri atas kepala bagian (Kabag) Kepala Bidang (Kabid) dan Sekretaris sebanyak 62 orang. Sementara pegawai eselon IV yang ikut dilantik untuk jabatan kepala seksi (Kasi) dan Kepala Sub Bagian (Kasubbag) sebanyak 103 orang. Sedangkan salah seorang pejabat dari empat orang yang memasuki masa pensiun, salah satunya karena dalam kondisi sakit parah. Pelantikan serentak itu dilakukanWabup Bener Meriah, Sirwandi Laut Tawar, Rabu (2/1) di aula Setdakab setempat. Selain dilantik wakil bupati juga disaksikan sejumlah anggota Muspida setempat. Pejabat eselon II yang mengalami pergeseran antara lain, Ir. Azwirianyah, dari Asisten Bidang Ekonomi dan Pem-

bangunan Pemkab Bener Meriah, menjadi Kepala Dinas Transmigrasi dan Tenaga Kerja. Ir Makmun dari staf Ahli Bupati menjadi Asisten Bidang Ekonomi dan Pembangunan, menggantikan posisi Ir. Azwiriansyah. Dra Mayang Semayang, jabatan lama Kabag Organisasi Pemkab Bener Meriah, menjadi staf Ahli Bupati Bidang Pembangunan, Lutfi Mirwan, dari Kepala Dinas Transmigrasi dan Tenaga Kerja menjadi Kepala Badan Penanggulangan Bencana (BPB) Bener Meriah. Lalu, Bairinnuri dari Kepala Dinas Kependudukan dan Catatan Sipil dilantik menjadi Kepala Badan Pemberdayaan Masyarakat (BPM), M Hasdi Kusman SH dari Kabag Evaluasi dan Data pada Bapedda Bener Meriah, menjadi Kepa Dinas Pemberdayaan Masyarakat. Syuhada dari Kepala Kantor Perizinan Terpadu Satu Pintu (KPTSP) Bener Meriah, pindah menjadi Inspektur pada Inspektorat Kabupaten Bener Meriah, drh Sofian dari sekretaris Distanakkan, dilantik

menjadi Kepala Dinas Peternakan dan Perikanan Kabupaten Bener Meriah. Dan terakhir, Ir Rusman dari sekretaris Badan Penyuluhan menjadi Kepala Dinas Pertanian dan Ketahanan PanganKabupatenBenerMeriah. Sedangkan empat pejabat yang pensiun, antara lain Zaini Yusra, Staf Ahli Bupati Bidang Pemerintahan dan Hukum, Drs Bacrumsyah SE Msi, Kepala Badan Pemberdayaan Masyarakat dan Keluarga Berencana. Ishak MS Staf Ahli Bupati Bidang Pendidikan yang juga mantan Sekdakab Bener Meriah. Sementara mantan Kepala Inspektorat Bener Meriah, Aliudin Suku, juga memasuki masa pensiun karena kondisi kesehatan yang tidak memungkinkan. Bupati Bener Meriah, Ir H Tagore Abubakar, yang dihubungi wartawan, Kamis (3/2) mengatakan, mutasi di lingkungan Pemkab Bener Meriah, bertujuan mengisi kekosongan pada sejumlah jabatan karena ada beberapa pejabat yang telah memasuki pensiun. (cb04)



Rusuh Mesir, Kemana Harga Minyak


risis Mesir telah mendorong harga minyak ke level yang sangat tinggi. Akibatnya kenaikan harga bahan bakar non subsidi di dalam negeri pun patut dipertimbangkan. Minyak mentah brent sempat naik satu persen menjadi 103,37 dolar AS per barel, tertinggi dalam 28 bulan, sebelum diperdagangkan pada 102,90 dolar AS di New York. Tembaga juga menuju level 10.000 dolar AS per metriks ton dan kapas melonjak 2,3 persen. Stoxx Europe 600 Index tergelincir 0,3 persen dan Standard & Poor’s 500 Index berjangka berfluktuasi. Kerusuhan di Tahrir Square Kairo hari ini menuntut diakhirinya pemerintahan 30 tahun rezim Mobarak. Harga minyak mentah Brent melampaui 100 dolar Amerika Serikat per barrel untuk pertama kalinya sejak 2008. Presiden Mesir Hosni Mubarak merombak pemerintahannya dalam upaya untuk meredakan pemberontakan populer yang telah menaikkan kekhawatiran tentang pengiriman minyak melalui Terusan Suez dan sebuah jalur pipa utama yang melalui negeri itu. Lonjakan pada Brent, yang telah naik dari 70 dolar per AS barel pada Agustus karena peningkatan permintaan global, juga menggerakkan kekhawatiran di negara konsumen bahwa kenaikan harga bahan bakar bisa mengganggu pemulihan ekonomi global. Organisasi Negara Pengekspor Minyak (OPEC) menegaskan tidak ada kekurangan minyak di pasar dan tidak perlu meningkatkan produksi sekarang. Di London, minyak mentah Brent ICE untuk Maret naik 1,59 menjadi berakhir pada 101,01 dollar per barel dan intraday mencapai 101,73 dollar, tertinggi sejak harga menyentuh 103,29 dollar pada 29 September 2008. Intisari Minyak mentah AS untuk pengiriman Maret naik 2,85 dollar, atau 3,19 persen, menjadi menetap di 92,19 dolar AS per barel, Untuk menjaga pa- mencapai 92,84 dollar pada intraday, sokan, pemerintah berte- keduanya yang tertinggi sejak Oktober 2008. Pedagang membeli minyak di tengah kad menggenjot produk- kekhawatiran bahwa segala hal bisa mesi minyak. Namun harga ningkat lebih jauh di Timur Tengah dan Pertamax tentu saja pasti menyebar ke negara-negara lain. Kekuatharga mempersempit kesenjangan akan lebih berluktuasi an acuan minyak mentah West Texas Intersetiap bulan. mediate terhadap Brent menjadi kurang dari sembilan dollar per barel setelah melebar ke rekor mendekati rekor di atas 12 dollar per barrel minggu lalu. Produksi Brent North Sea semakin berkurang dan persediaan minyak mentah AS tinggi, terutama pada saat Cushing, Oklahoma, poin penyerahan WTI, telah dilihat sebagai faktor yang menyebabkan kesenjangan melebar, bersama dengan daya tarik investor ‘dengan momentum bullish. Destilasi (sulingan) AS terlihat jatuh untuk pekan hingga 28 Januari akibat cuaca dingin di raksasa pasar minyak pemanas Northeast AS, sedangkan kenaikan impor AS terlihat meningkatkan cadangan minyak mentah, menurut jajak pendapat Reuters terhadap para analis menjelang data persediaan AS pada Selasa dan Rabu. Mesir bukan merupakan penghasil minyak utama tetapi protes dan tuntutan untuk perubahan politik di sana datang dua minggu setelah presiden Tunisia digulingkan dan investor khawatir bahwa negara-negara produsen minyak di kawasan tersebut mungkin menghadapi protes serupa. Mesir mengontrol Terusan Suez dan jalur pipa Suez-Mediterania(SUMED), yang bersama-sama memindahkan lebih dari dua juta barel per hari (bpd) dari produk minyak mentah dan produk minyak pada 2009. Pengiriman sejauh ini berjalan seperti biasa melalui Terusan Suez 192-km (120 mil) namun operasi pelabuhan telah melambat oleh protes. Apa pun itu kenaikan harga minyak dunia pasti akan mengimbas dalam negeri. Kisruh Mesir pasti membuat pemerintah cemas. Paling tidak karena produksi minyak dalam negeri selama ini pun terus merosot. Pemerintah, menurut Menko Perekonomian, mulai menyiapkan langkah untuk mewaspadai lonjakan harga minyak tersebut. Rencananya paling tidak akan mencapai beberapa hal seperti pengelolaan pasokan dan permintaan minyak dalam negeri. Untuk menjaga pasokan, pemerintah bertekad menggenjot produksi minyak. Namun harga Pertamax tentu saja pasti akan lebih berluktuasi setiap bulan. Kita lihat saja mulai bulan depan revisi harga akan tercapai di level berapa.*


Faks 061 4510025


Saya setuju kalau gayus dihipnotis sama uya kuya, seru tu kayaknya,,, kalau uya kuya dapat menghipnotis gayus, saya berikan 4 jempol sekaligus,,,,go go go uya...salam anti korupsi Ummi A-biqir Khair +628126003609 Camat Sunggal tolong dilihat PKL di simpang stasiun Kapung Lalang karena sudah sampai ke jalan mengakibatkan pukul 5.30 sudah macet takkaruan dan kalau bisa para PKL-nya pindahkan ke arah stasiun. +628126469623 Membaca keluhan keluarga Afrika Ayu, 16,Waspada, Sabtu 29 Jan 2011 kepada KAPOLRI saya prihatin, tapi buat aja pengaduan FB dan mana pelaku jangan singkat NF tapi jelas aja agar orang lain nggak korban berikutnya. Tksh. +6281396987022 Pembiaran PKL di trotoar dan badan jalan di Tanjungbalai adalah investasi masalah buat penegakan Perda. +628153195774 Mobil-mobil dinas Aceh banyak berkeliaran di Medan, terutama BL kode F, U, I, R, dan TB, seperti sengaja ditinggalkan di Medan untuk keluarga dan anak-anak pejabat Aceh yang ada di Medan, mobil Doubel Gabien Logo Perhubungan sering ditinggal di door smeer Titipapan Medan. +6281396399738 Kami warga jalan.Penguin Raya 1 Perumnas Mandala memohon kepada instansi agar memperbaiki jalan kami yang rusak karena mengganggu aktivitas sehari-hari. +628126329716 WaspadaYth,Mengapa hasil pertandingan PSMS lawan Persipasi tidak dimuat diWaspada yang dikirim ke Aceh? Saya penggemar dan pendukung PSMS merasa KECEWA,mohon setiap kegiatan PSMS ditulis. trmkh dari HSy-Lsk. +6285296034353 Kab.Sergai..Yang masih banyak pengangguran, karena sedikitnya peluang kerja di Kab.Sergai.perhatian pemerintah untuk memberantas pengangguran sangat minim, pak Eri yang terhormat tingkatkan dan perhatikan nasib masyarakat bapak. +6282170162184 Assalamu’alaikum...selamat siang bapak pimpinan Waspada? bapak, saya mau tanya kenapa ZODIAK ngak ada lagi di surat kabar Waspada? makasih bapak... +6281396987022 Kolaborasi nakal oknum Dinas Tata Kota dan Satpol PP Kota Tanjungbalai dalam penegakan Perda IMB eleminier PAD. +6281397369442 Kepada Bapak pimpinan Waspada yang terhormat, saya mau nanya anak saya Destri Yanti br Nababan dilarikan terdakwa RM pada tanggal 10 Desember 2010 saya sudah buat pengaduan ke Poltabes pada hal si pelaku sudah mengakui semua perbuatannya tapi sampai sekarang belum pernah disidang padahal anak saya masih 14 tahun kog bisa gitu pak? trimakasih atas informasinya pak. dari Alex Nababan bapak si korban.

WASPADA Sabtu 5 Februari 2011

Wali Nanggroe Versi Romantisme Sejarah Oleh Alfiansyah Harus dimaklumi jika pada akhirnya rancangan qanun tersebut mendapatkan reaksi penolakan dari sejumlah kalangan di Aceh


orotan tentang Wali Nanggroe di Aceh menguat kembali setelah DPRA menyampaikan hak inisiatif penyusunan Qanun Lembaga Wali Nanggroe (LWN) awal Desember lalu. Sedangkan draft rancangan qanun (Raqan) kelembagaan Wali Nanggroe telah pula diselesaikan penyusunannya oleh Badan Legislasi DPRA. Lalu, apa yang salah ketika muncul beragam reaksi yang mengkritisi rencana tersebut? Untuk mengingatkan kembali dalam proses legislasi di DPRA tarik ulur Raqan Wali Nanggroe, sebenarnya pernah pula berkembang di ujung masa tugas para anggota DPRA periode 2004-2009. Di tengah harapan para anggota dewan waktu itu agar Rancangan Qanun Wali Nanggroe yang telah mereka susun dapat disahkan, sebelum mereka ‘lengser’ sebagai anggota dewan, ternyata pihak eksekutif selaku pemegang kendali Pemerintahan Aceh menganggap Qanun tersebut belum mendesak untuk ditetapkan. Penolakan pihak eksekutif waktu itu setidaknya memiliki dua alasan, yakni masih banyak hal lain di Aceh yang perlu untuk mendapatkan penanganan dan perhatian dengan segera yang lebih mendesak untuk diselesaikan daripada permasalahan Wali Nanggroe. Selain itu dari segi substansi, Irwandi Yusuf selaku Gubernur Aceh, juga menilai Raqan Wali Nanggroe yang disusun DPRA waktu itu dianggap masih perlu adanya penyempurnaan dan penyelarasan karena dikhawatirkan akan bersinggungan dengan Raqan yang sudah ada. Penyelarasan tersebut diantaranya terkait keberadaan Majelis Adat Aceh yang menjalankan salah satu fungsi Wali Nanggroe sebagaimana tercantum dalam Qanun No. 9 tahun 2008.

Dengan komposisi anggota legislatif (DPRA) saat ini yang telah jauh berbeda dengan periode 2004-2009, kembali isu tentang Lembaga Wali Nanggroe digulirkan untuk disetujui dalam sebuah Qanun. Dari segi dasar hukum, keberadaan Lembaga Wali Nanggroe di Aceh memang me-mungkinkan untuk dibentuk. Sesuai dengan kesepakatan Pemerintah RI dan GAM dalam MoU Helsinki,Wali Nanggroe di Aceh dimungkinkan keberadaannya sebagaimana tercantum dalam butir 1.1.7 yang menegaskan Lembaga Wali Nanggroe akan di-bentuk dengan segala perangkat upacara dan gelarnya. Selanjutnya secara formal, perumusan lemb a g a Wa l i Nanggroe diatur lebih lanjut pada Bab XII pasal 96 dan 97 Undang-undang Pemerintahan Aceh (UUPA). Dalam ketentuan itu keberadaan dan fungsi Wali Nanggroe secara gamblang disebutkan sebagai kepemimpinan adat pemersatu masyarakat yang independen, berwibawa, dan berwenang membina dan mengawasi penyelenggaraan kehidupan lembaga-lembaga adat, adat istiadat, dan pemberian gelar/derajat dan upacara adat lainnya. Untuk lebih memperjelas lagi peran dan fungsi dari

Wali Nanggroe dalam dinamika Pemerintahan di Aceh, Pemerintah mengeluarkan PP No. 19 tahun 2010, yang menjadikan Wali Nanggroe sebagai salah satu unsur kepemimpinan di Aceh dan tergabung dalam forum koordinasi pimpinan daerah yang diketuai oleh Gubernur. Mengalir dari ketentuan yang ada dalam UUPA, sudah barang tentu PP yang mengatur Lembaga Wali Nanggroe tersebut memposisikan Wali Nanggroe sebagai unsur pimpinan adat di Aceh. Namun demikian ketika DPRA melalui Badan Legislasi DPRA menyusun ulang draft QanunWaliNang-groe dan merubah total draftyangtelahdisusun anggota DPRA periode sebelumnya, beragam reaksi penolakan bermunculan di Aceh. Rancangan Qanun yang diajukan sebagai inisiatif DPRA tersebut, dinilai banyak kalangan sarat kontroversial dan berpotensi ‘menabrak’ kaidah-kaidah konstitusi di wilayah hukum Indonesia. Kritikan keras elemen masyarakat, para politisi, praktisi, dan kalangan akademisi terjadi ketika berlangsung Seminar Nasional“Membedah Rancangan Qanun LembagaWali Nanggroe”, yang diselenggarakan di Hotel Hermes Palace, Banda Aceh, Sabtu (18/12). Para peserta mengkritisi sejumlah pasal dalam raqan, diantaranya pasal kewenanganWali Nanggroe menguasai semuaasset(kekayaan)Acehdidalamdan luar negeri (pasal 5 poin 2d), dinilai bertentangan dengan UUD 45 yang menyebutkan semua kekayaan alam, laut dan udara dikuasai negara dan dimanfaatkan

sebesar-besarnya untuk kemakmuran rakyat. Selain itu nuansa pemandulan atas demokratisasi yang telah berkembang di Aceh juga tampak dari pasal Pasal 5 poin 2n, dimana lembaga Wali Nanggroe mempunyai kewenangan untuk membubarkan parlemen ketika situasi berada dalam kekacauan. Kemunduran demokrasi di Aceh juga tampak dari penentuan masa jabatan Wali Nanggroe dalam pasal 16 poin 1, dimana disebutkan masa jabatanWali Nanggroe adalah seumur hidup. Dengan mencermati sebagian pasal dari RaqanWali Nanggroe tersebut, maka menjadi kejelasan dan harus dimaklumi jika pada akhirnya rancangan qanun tersebut mendapatkan reaksi penolakan dari sejumlah kalangan di Aceh. Selain bertentangan dengan konstitusi RI dan prinsip-prinsip demokrasi, perdamaian yang telah terbangun di Aceh juga dipertaruhkan dengan adanya pasal yang lebih mengakomodir kepentingan kelompok tertentu di Aceh, yakni pasal 14 tentang Tata Cara dan KriteriaWali Nanggroe. Sehingga menjadi sangat wajar pula ketika masyarakat Gayo di Aceh Tengah dan Bener Meriah, dalam reaksi penolakkannya juga menghembuskan kembali suara pemekaran Provinsi ALA (Aceh Leuser Antara) di Aceh. Sisi positif penyusunan Qanun Wali Nanggroe adalah berupaya mengangkat nilai-nilai budaya dan sejarah Aceh, untuk dapat dijalankan kembali dalam kehidupan masyarakat Aceh modern. Namun demikian tidak sedikit pula yang mengkhawatirkan qanun tersebut justeru akan menghidupkan sistem feodal di Aceh masa kini, dengan memberikan kekuasaan yang luas kepada figur sentral ‘Wali Nanggroe’. Romantisme sejarah Aceh masa lalu janganlah dijadikan cerita, yang hanya dapat meninabobokan masyarakat Aceh, sehingga terlena dan kembali terjebak dalam keterpurukkan di segala bidang. Sudah saatnya para elit politik di Aceh menghadapi dunia nyata, dengan melahirkan kebijakan-kebijakan yang real dan menyentuh bagi peningkatan kesejahteraan masyarakat Aceh seutuhnya. Penulis adalah Pemerhati Masalah Aceh

Persoalan Klasik Perguruan Tinggi Swasta Oleh Zulkarnain Lubis Sangat tidak logis jika kualitas lulusan ditentukan oleh kategori akreditasi program studinya tetapi ditentukan oleh kualitas individu yang bersangkutan


ersoalan statuta merupakan persoalan mendasar yang mestinya menjadi perhatian pimpinan perguruan tinggi dan yayasan pengelolanya. Statuta merupakan fondasi utama bagi sebuah perguruan tinggi yang isinya terutama mengatur hal-hal mendasar tentang segala sesuatu hal di perguruan tinggi tersebut termasuk fungsi dan tugas masingmasing unit dan hubungan antar unit yang ada di perguruan tinggi tersebut termasuk hubungan antara yayasan dengan perguruan tingginya. Persoalan selanjutnya yang sering menjadi momok bagi PTS namun sangat didambakan bahkan sering dengan segala cara dilakukan untuk mendapatkannya, yaitu persoalan akreditasi. Status terakreditasi sesungguhnya hanya merupakan salah satu indikator penilaian terhadap penyelenggaraan perguruan tinggi, namun sepertinya telah dijadikan “segala-galanya” oleh pengelola perguruan tinggi khususnya PTS. Salah kaprah pemahaman masyarakat termasuk dunia usaha dan kalangan pemerintahan terhadap akreditasi juga turut mendukung terlalu dipentingkannya akreditasi oleh kalangan perguruan tinggi bahkan mengabaikan indikator lainnya. Akreditasi telah dianggap sebagai legalitas sebuah program studi atau lembaga pendidikan tinggi bahkan dianggap sebagai jaminan terhadap mutu lulusannya, padahal sesungguhnya legalitas untuk sebuah perguruan tinggi bukanlah akreditasi tetapi berupa izin operasional dari pemerintah melalui Kementerian Pendidikan Nasional, persisnya melalui Direktorat Jenderal Pendidikan Tinggi yang perpanjangan tangannya di daerah adalah Koordinasi Perguruan Tinggi Swasta (Kopertis). Izin operasional ini secara periodik mesti diperbaharui dimana salah satu pertimbangan perpanjangan izin tersebut adalah pengisian laporan Evaluasi Program Studi Berbasis Evaluasi Diri (EPS-BEDS) yang dalam waktu dekat akan diganti dengan Pangkalan Data Pergurun Tinggi (PDPT). Selanjutnya untuk penentuan penerimaan lulusan perguruan tinggi bagi para penggunanya mestinya lebih ditekankan pada kompetensi, kapasitas kemampuan, dan kualitas individu lulusan yang bersangkutan yang ditentukan berdasarkan seleksi yang dilakukan. Jadi sangat tidak logis jika kualitas lulusan ditentukan oleh kategori akreditasi program studinya tetapi ditentukan oleh kualitas individu yang bersangkutan, sehingga diharapkan dunia usaha dan dunia industri tidak

lagi mensyaratkan kategori hasil akreditasi lembaga pendidikan tinggi sebagai penentu diterima atau tidak diterimanya seseorang mengisi lowongan pekerjaan yang ada. Terlepas dari salah kaprah tentang pemahaman akreditasi tersebut, hal lain yang terkait dengan akreditasi adalah lamanya waktu yang dibutuhkan sampai keluar hasilnya yang antara lain disebabkan oleh terbatasnya tenaga asesor, luasnya wilayah yang digarap, serta banyaknya program studi yang jumlahnya juga terus bertambah, padahal mulai 2012 nanti setiap program studi sudah wajib terakreditasi. Tentu ini juga menjadi kekhawatiran bagi kalangan PTS yang selama ini sangat membutuhkan status akreditasi tersebut sebagai modal promosi dan selalu dijadikan sebagai “objek pengawasan secara ketat”, tidak seperti PTN yang kelihatannya “tenang-tenang saja” dengan akreditasi ini. Wacana untuk “mendesentralisasi” akreditasi dengan catatan tetap di bawah koordinasi BAN pusat rasanya menjadi salah satu alternatif dalam upaya mempercepat proses akreditasi tersebut. Persoalan PTS lainnya adalah persoalan yang saling terkait antara rendahnya atmosfir akademik, persoalan kuantitas dan kualitas tenaga akademik termasuk jenjang jabatan akademik dan gelar akademinya, ketersediaan fasilitas pendukung, dan mutu pembelajaran. Rendahnya atmosfir akademik terkait dengan kualitas tenaga pengajar yang masih sebahagian besar bergelar S-1 dan rendahnya jumlah dosen yang jabatan akademiknya lektor ke atas. Rendahnya dosen yang memiliki gelar S-2 dan S-3 terkait dengan kurangnya program perguruan tinggi untuk menyekolahkan dosennya yang berkaitan dengan rendahnya alokasi dana PTS untuk menyekolahkan dosennya, dan rendahnya alokasi dana ini terkait dengan lemahnya keuangan PTS. Lemahnya keuangan PTS terkait dengan rendahnya rata-rata jumlah mahasiswa per program studi, rendahnya kemampuan mendapatkan dana, serta kurangnya perhatian pimpinan yayasan dan pimpinan PTS untuk memprogramkan pendidikan lanjutan bagi dosennya. Rendahnya atmosfir akademik terkait pula dengan rendahnya fasilitas penunjang seperti perpustakaan dan laboratorium yang biasanya di banyak PTS hanya untuk sekedar memenuhi pesyaratan formal, bukan untuk memenuhi kebutuhan dosen dan mahasiswa dalam aktivitas akademik mere-

ka, bahkan ada PTS yang memajang buku dan menata laboratorium hanya saat akan ada visitasi asesor ataupun adanya kunjungan pihak berwenang dalam penentu kebijakan di bidang pendidikan. Rendahnya aktivitas akademik juga terkait dengan kurangnya program yang terencana dari pimpinan PTS dan kurangnya dukungan yayasan untuk melakukan kegiatan ilmiah yang terprogram dan berkelanjutan seperti diskusi ilmiah, seminar hasil penelitian, bedah buku, dan lainlain. Kalaupun ada kegiatan ilmiah, sebagian besar hanya ditujukan untuk tujuan promosi yang lebih ditekankan pada seremoninya daripada substansi keilmiahannya. Rendahnya sarana penunjang dan kegiatan ilmiah di PTS terkait dengan tiga hal yang disinggung di atas, yaitu kurangnya dana yang tersedia, rendahnya alokasi untuk kegiatan ilmiah, serta fokus utama yang hanya untuk penyelenggaraan perkuliahan. Kurangnya sarana pendukung kegiatan akademik, kurangnya kualitas tenaga dosen, atmosfir akademik yang lemah, dan kurangnya dana pendukung menjadi saling terkait yang mengakibatkan belum meningkatnya mutu pendidikan di sebagian besar PTS, ditambah lagi kualitas bahan baku mahasiswa yang rendah karena diperoleh tanpa melalui proses seleksi yang memadai bahkan lebih sering tanpa proses seleksi sama sekali. Persoalan terakhir adalah persoalan spesifik perguruan tinggi kesehatan yang yang sampai sekarang belum berujung. Menurut aturannya mestinya perguruan tinggi kesehatan khususnya keperawatan dan kebidanan sudah sepenuhnya berada di bawah Kementerian Pendidikan Nasional, tetapi pada kenyataannya masih saja “diintervensi” oleh jajatan Kesehatan khususnya Dinas Kesehatan dengan alasan merekalah yang menjadi pengguna, bahkan sampai kepada hal yang sangat akademik seperti penentuan kelulusan, penentuan jumlah mahasiswa yang dapat diterima, dan pengeluaran ijazah yang mestinya sudah merupakan kewenangan mutlak institusi penyelenggaranya. Peran pemerintah daerah untuk menjembatani jajaran Dinas Kesehatan, Kopertis, dan PTS Bidang Kesehatan sangat diharapkan untuk mengahiri dualisme tersebut sehingga PTS Bidang Kesehatan tidak lagi merasa terombang ambing dalam ketidakpastian. Salah satu langkah yang mungkin bisa dilakukan oleh pemerintah adalah dengan mereposisi peran kopertis agar dapat lebih meningkatkan pengawasan, pengendalian, dan pembinaannya terhadap dunia PTS termasuk membantu dalam fasilitas, pengembangan sumberdaya manusia, dan peningkatan kelembagaan serta mutu manajemen PTS. Kopertis perlu ditingkatkan kapasitas dan kewenangannya yang selama ini telah banyak ber-

kurang, walau belakangan sudah sedikit lebih diberdayakan. Untuk itu reorganisasi kopertis perlu dilakukan dengan memperbesar organisasinya dan melengkapi pejabat yang ada di dalamnya dengan pejabat yang berlatar belakang penguasaan akademis sehingga tidak hanya diisi oleh pejabat dengan kemampuan administratif saja karena yang dilayani adalah dunia perguruan tinggi. Upaya lainnya yang dapat dilakukan adalah peningkatan kerjasama antar PTS baik secara sendiri-sendiri maupun secara kolektif melalui organisasinya seperti APTISI. Kerjasama dimaksud tentu terkait dengaan penguatan posisi tawar ketika berhadapan dengan berbagai pihak, pembangunan kapasitas, maupun penguatan kelembagaan PTS secara keseluruhan. Sebetulnya masih banyak yang ingin diungkapkan mengenai persoalan dan hal yang mesti dilakukan untuk mengatasi, semoga bermanfaat dan semoga PTS betul-betul tumbuh sebagai penopang mutu pendidikan secara keseluruhan yang pada gilirannya dapat meghasilkan lulusan berkualitas untuk membangun bangsa ini dalam segala bidang. Semoga juga PTS menjadi lebih terangkat harkat dan martabatnya. Penulis adalah Mantan Rektor, Guru Besar, Kepala Sekolah, Anggota DRD Sumut

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * IMF puji ekonomi Indone sia - Alamak perkara mengumbang * DPRDSU komit perjuangkan guru honor - Jangan cuma ‘talk only’ * Camat minta infrastruktur Medan Utara diperbaiki - Kayak permintaan ‘bersayap’, he...he...he


D Wak

Ekonomi & Bisnis

WASPADA Sabtu, 5 Februari 2011


Armin Nasution


Redaktur Ekonomi

Imlek G O N G X i Fa Chai. Selamat tahun baru Imlek. Tulisan bertinta emas dan berdasar merah itu menghiasi hampir semua pusat perbelanjaan di Medan sepanjang pekan lalu. Bagaimana tidak penduduk yang setidaknya menjadi terbesar ketiga di Medan itu merayakan pergantian tahun. Pada dasarnya tidak ada yang unik dengan pergantian tahun macan ke kelinci. Hanya saja sebagai salah satu masyarakat yang merayakan, wajar kalau kemeriahan kelihatan dimana-mana. Yang paling jelas sesungguhnya adalah bagaimana aktivitas perekonomian di Medan terhenti sesaat ketika mereka merayakan Imlek. Pusat bisnis seperti Jl. Pemuda, Jl. Thamrin, Jl. Asia, Jl. Semarang dan beberapa ruas jalan lain sepi. Apalagi Jl. Palangkaraya yang biasanya susah dilalui. Namun saat Imlek, ruas jalan itu berubah lancar. Bukan hanya kawasan perdagangan, sentra transaksi perbankan seperti Jl. Imam Bonjol juga Jl. Zainul Arifin pun ikut sepi. Selain karena bank memang tutup, mereka pun menghentikan aktivitas bertransaksi. Sebenarnya wajar kalau untuk mengetahui peran masyarakat Tionghoa di Medan dari pengusaan mereka terhadap jalur bisnis. Begitu mereka libur, otomatis kompleks pertokoan pun ikut tutup. Sebenarnya jika ditelusuri lebih jauh batas-batas diskriminasi itu yang selama ini seolah nyata kian terlihat dengan perayaan Imlek. Beda yang khas untuk membandingkan siapa sebenarnya penguasa ekonomi kota Medan. Walau secara aturan sesungguhnya sudah tidak ada lagi yang memperlakukan sikap diskriminatif. Sehari sebelum Imlek saya sempat berbicang dengan praktisi bisnis Vincent Wijaya. Menurut dia, sebenarnya tidak ada lagi aturan yang diskriminatif. “Aturan diskrminatif sudah tidak ada lagi. Tapi kalau orang-nya yang berlaku diskriminasi bisa saja masih ada.” Sebab, menurut dia, perlakuan diskriminatif itu bisa dilakukan oknum bukan negara atau aturan. Dia menyontohkan di AS saja ada klub warga negara kulit putih yang tidak boleh dimasuki yang lain. Kalau di Medan, dia mengungkap tergantung bagaimana warganya bersosialisasi. Hitung-hitungan diskrminasi itu makin tidak kentara ketika perayaan Imlek di rumah Sofyan Tan. Tokoh Tionghoa yang ’nyaris’ jadi walikota

Medan itu terasa kontras dengan kebanyakan. Sejak pagi di rumahnya berhimpun warga dari berbagai etnis dan suku. Sampai dia kemudian mengaku terkejut atas lonjakan tamu. Memang pada dasarnya dia mengaku sedang open house. SementaraVincent mengungkap kalau dalam istilahnya tidak pernah ada istilah open house. “Karena rumah saya ini selalu terbuka untuk siapa pun tidak saja kala Imlek. Awak ini apalah, siapa pun boleh bertamu,” ujarnya. Begitupun di tempat Sofyan Tan, tamu yang berdatangan berbaur dan tidak menunjukkan sikap yang berlebihan. “Paling tidak ini bagian dari majemuknya warga Medan. Tidak ada perlakuan diskriminasi,” kata Sofyan Tan. Sebab siapa pun tamu-nya hari itu pasti disalaminya. Selain kunjungan para tamu, pusat perayaan Imlek di Medan ikut berpindah sampai ke pusat perbelanjaan. Di beberapa tempat, kepadatan tak terhindarkan. Perayaan inilah salah satu cara untuk menilai peran mereka dalam perekonomian Medan. Untungnya hingga saat ini Medan merupakan kota yang masih sangat kondusif untuk hubungan antar suku dan hubungan bisnis. Memang sentimen selalu saja muncul, namun setidaknya peran ekonomi mereka di Medan benar-benar tak terbantahkan. Kalau orde lama, malah peran mereka sampai ke pemerintahan. Saat orde lama dulu sebenarnya terdapat beberapa menteri Republik Indonesia dari keturunan Tionghoa seperti Oei Tjoe Tat, Ong Eng Die, Siauw Giok Tjhan, dll. Bahkan Oei Tjoe Tat pernah diangkat sebagai salah satu tangan kanan Soekarno pada masa Kabinet Dwikora. Pada masa ini hubungan Soekarno dengan beberapa tokoh dari kalangan Tionghoa dapat dikatakan sangat baik.Walau pada Orde Lama terdapat beberapa kebijakan politik yang diskriminatif seperti Peraturan Pemerintah No. 10 tahun 1959 yang melarang WNA Tionghoa untuk berdagang eceran di daerah di luar ibukota provinsi dan kabupaten. Namun orde baru warga keturunan Tionghoa dilarang berekspresi. Sejak 1967, warga keturunan dianggap sebagai warga negara asing di Indonesia dan kedudukannya berada di bawah warga pribumi, yang secara tidak langsung juga menghapus hak-hak asasi mereka. Namun kini semua itu sudah terhapuskan. Kini saatnya bersinergi. Aturan yang diskriminatif sudah dihapus. Tinggal bagaimana sikap individu-nya.

Pemerintah Waspadai Kenaikan Harga Minyak JAKARTA (Wasapda): Pemerintah mencermati dan mewaspadai kenaikan harga minyak mentah dunia diakibatkan faktor cuaca dan kondisi di Mesir yang bergejolak. "Memang kita harus mencermati betul situasi harga minyak. Karena kenaikan harga minyak 1 dolar AS akan meningkatkan penerimaan negara. Tapi juga akan mempengaruhi, tidak hanya subsidi yang membengkak. Namun demikian, kita tetap mewaspadai," kata Menko Perekonomian Hatta Rajasa, di Kantor Presiden, Jakarta, Jumat (4/2). Akan tetapi, Hatta menam-

bahkan, hal yang harus diingat harga minyak akan selalu berhubungan dengan sektor-sektor lain, bisa juga mendorong inflasi. "Oleh sebab itu kita mencermati dengan sangat dekat soal ini. Kita, bersama menteri keuangan terus melakukan suatu pantauan," tandasnya. Di sisi lain, Hatta menganggap situasi di Mesir hanya bersifat sementara, karena Mesir bukan pengekspor minyak. Sehingga tidak begitu besar pengaruhnya. "Terusan Suez tentu tidak akan terganggu, karena bagaimana pun juga walaupun wilayah kedaulatan, itu adalah

perairan yang digunakan secara internasional yang mempengaruhi ekonomi dunia," bebernya. Maka dari itu, Hatta menganggap hal ini tidak fundamental. Jadi, apabila dilihat dari demand dan supply, sebetulnya ada kecenderungan, yakni menurunnya permintaan seperti dari Ameirka dan sebagainya. "OPEC sendiri berkomitmen untuk meningkatkan produksi sampai 1,5 juta. Jadi sebetulnya, fundamental demand dan supply-nya cukup. Sehingga kita harapkan ini tidak akan panjang," pungkasnya. (okz)

RI Tetap Patok 80 Dolar AS Per Barel JAKARTA (Waspada): Krisis politik di Mesir membuat harga minyak dunia cenderung naik dan menciptakan ketidakstabilan. Bahkan, harga sudah menyentuh di atas 100 dolar AS per barel. Namun, Menteri Keuangan Agus Martowardojo masih meyakini kenaikan ini masih bersifat temporer. "Kami masih meyakini nanti akan stabil kembali," kata dia di Kantor Presiden, Jumat (4/2). Menteri Agus menambah-

kan, walau harga minyak menyentuh di atas 100 dolar AS per barel, namun kebijakan anggaran pemerintah masih berpegang pada asumsi semula. Di Anggaran Pendapatan dan Belanja Negara, pemerintah menetapkan asumsi dasar dengan patokan harga minyak 80 dolar AS per barel. "Anggaran itu masih tetap kita pegang asumsi dasar. Harga minyak yang 80 dolar AS masih kita pegang," ujar Agus.

Agus melanjutkan, kalau pun ada perubahan harga, pemerintah akan menyampaikannya. "Tapi sekarang kan belum sampai pada perubahan," ujarnya. Sementara itu, Menteri Koordinator bidang Perekonomian Hatta Radjasa mengatakan situasi politik di Mesir hanya mempengaruhi kenaikan harga minyak untuk sementara. "Sebab, Mesir bukan penghasil minyak," ujar Hatta. (vvn)

Dinas PKD DS Sosialisasi Perda BPHTB LUBUK PAKAM (Waspada) : Dinas Pengelolaan Keuangan Daerah (PKD) Kab.Deliserdang sosialisasikan Peraturan Daerah (Perda) No. 2 Tahun 2011 tentang Pajak Bea Perolehan Hak Atas Tanah dan Bangunan (BPHTB) di ruang rapat kerja Dinas PKD di Lubuk Pakam, Selasa (1/ 2). Sosialisasi dihadiri M Alwy dari Kantor Badan Pertanahan Nasional (BPN) Deliserdang, Reno Yanti dan Elawgaya dari Ikatan Pejabat Pembuat Akte Tanah (IPPAT), Pimpinan Cabang BRI Lubuk Pakam Kusnadi beserta H Sembiring, Subechan dan Sabran Sianturi dari KPP Pratama Lubuk Pakam, Rachmadi dan Marwan Sembiring dari KPKNL Medan serta Redwin SH Kabag Hukum Setdakab Deliserdang. Kadis PKD Deliserdang Drs Agus Sumantri menjelaskan menindaklanjuti UU No. 28/ 2009 tentang pajak dan retribusi daerah antara lain menetapkan BPHTB merupakan pajak daerah. Berdasarkan hal itu, Pemkab Deliserdang telah membuat Perda No 2 Tahun 2011 tentang pajak daerah dimana pada bab XII mengatur tentang BPHTB.

Bahkan, Deliserdang merupakan satu-satunya kabupaten di Sumut telah melahirkan Perda tentang BPHTB. Menurut Agus Sumantri, kenaikan target Pendapatan Asli Daerah (PAD) Deliserdang tahun anggaran 2011 cukup signifikan hingga mencapai Rp300 miliar. Untuk mencapai target tersebut, tentu saja dibutuhkan kerja keras dan kerjasama dari semua pihak. Tanpa bantuan dan kerjasama yang baik dari berbagai pihak dan instansi terkait maka target PAD tersebut akan sulit dicapai,katanya. Karena itu, sosialisasi Perda No. 2 Tahun 2011 merupakan kegiatan sangat penting dengan tujuan agar masyarakat dan semua pihak terkait dapat memahami dan mengetahuinya. Pada kesepatan itu, Agus Sumantri mengajak semua pihak khususnya instansi terkait untuk mendukung dan bekerja sama, sehingga target pajak BPHTB kini telah menjadi salah satu sumber pemasukan pajak daerah dapat tercapai, sehingga ke depan pembangunan kabupaten Deliserdang dapat semakin ditingkatkan.

Menanggapi hal itu, Pimpinan Cabang BRI Lubuk Pakam Kusnadi menyatakan jajarannya siap bekerja sama mendukung dan mensukseskan program dimaksud demi meningkatkan pembangunan daerah. Seluruh BRI sudah online dan usulan agar kita membuka kas penerima di kantor BPN akan kita upayakan, kata Pinca BRI Lubuk Pakam. Pada sosialisasi itu dilakukan dialog untuk mensinergikan tugas dan wewenang dari masing-masing pihak dan instansi terkait baik IPPAT, KPP Pratama Lubuk Pakam, KPKNL Medan, BRI Cabang Lubuk Pakam, maupun pihak BPN dan Dinas PKD Deliserdang.(a06)


BERAS: Sejumlah pekerja di Gudang Bulog Sub Divisi Regional III Kisaran, terlihat sedang membungkus beras dengan berat 5 kg untuk didistribusikan ke masyarakat Asahan dalam OP. Foto direkam, Jumat (4/2)

Beras Impor Mulai Kuasai Pasar MEDAN (Waspada): Membanjirnya beras impor melalui Pelabuhan Belawan kini mulai menyebar ke pasar dan telah pula menguasai perdagangan beras hingga ke tingkat desa. Serbuan beras impor ini bukan saja terjadi di Sumatera Utara, namun juga berimbas hingga ke daerah tetangga di Provinsi Sumatera Barat dan Riau. Namun berdasarkan hasil pantauan di pasar Jumat (4/2), walau terjadinya serbuan beras impor tetapi harga beras tidak kunjung mereda bahkan harga beras impor yang dilepas dari gudang Bulog hanya Rp6.650 per kg akhirnya dijual ditingkat pengecer hingga mencapai Rp8.000 per kg. Beberapa pedagang pengecer menyebutkan, mereka menjual beras impor dengan harga jauh diatas harga tebus di Bulog karena harga pembelian memang telah tinggi, sehingga diperkirakan telah terjadi sindikat permainan yang menyebabkan harga terguras naik di pasaran. Bahkan yang lebih parah lagi, walau harga beras impor

terjual jauh dari harga tebus namun diduga mutunya juga telah berubah karena telah terjadi pencampuran. Praktik ini telah berhasil diungkap oleh kepolisian beberapa waktu lalu di Asahan. Humas Bulog Divre Sumut Rusli ketika dihubungi membenarkan pihaknya memasuki awal tahun 2011 ini mendapat izin untuk memasukkan beras impor dari Thailand. Kebijakan pengimporan beras itu diberikan hanya untuk dua daerah saja yakni Jakarta dan Sumatera Utara. Pemasukan beras impor diharapkan akan dapat memperbanyak jumlah stok beras di pasar yang selama ini memang terjadi kekurangan akibat gagalnya panen petani dalam negeri. Sejak beras impor itu masuk ke Sumut, pihak Bulog Divre Sumut telah memasarkannya dengan sistem bebas sehingga beras berjenis premium ini telah menyentuh hingga ke pedagang lingkungan, bahkan beras impor ini telah dipasarkan jauh hingga ke provinsi Sumatera Barat dan Riau. Data kunjungan kapal dan bongkar muat barang yang dikeluarkan Pusat Pelayanan Satu Atap (PPSA) PT Pelabuhan Indonesia I (Persero) Cabang Belawan, Minggu (30/1), terlihat Januari 2011 ini hampir setiap

minggu kapal berbendera asing merapat di dermaga pintu gerbang ekonomi Sumut ini. Setiap kapal mengangkut puluhan ribu ton beras, sehingga dari perhitungan sementara jumlah beras impor yang telah dibongkar mecapai 60.000 ton.. Derasnya beras impor memasuki Pelabuhan Belawan merupakan imbas dari keputusan Menteri Pergangan yang mengeluarkan izin mengimpor 300.000 ton beras untuk memperkuat stok beras nasional yang mengalami penurunan akibat adanya anomali cuaca sehingga buat gagalnya panen petani Membanjirnya beras impor memasuki Pelabuhan Belawan dibenarkan Kepala Perum Bulog Divre Sumut Muchtar Saad yang dihubungi beberapa waktu lalu. Kadivre Perum Bulog Sumut ini bahkan menyebutkan memasuki tahun ini akan masuk beras impor sebanyak 110 ribu ton. Mengenai terjadinya gejolak harga hingga jauh dari harga tebus di gudang Bulog, dia tidak dapat mencegahnya karena beras itu telah berada ditangan pedagang dan memantah kalau kenaikan itu akibat adanya penambahan buat orang dalam, ‘’ yang jelas harga tebusnya di gudang Bulog tidak mengalami kenaikan walau diakui permintaan meningkat.’’(m35)

14 Hari, 135 Ton Beras Tersalur KISARAN (Waspada): Selama 15 hari operasi beras dilakukan di Kabupaten Asahan, sedikitnya 135,5 ton beras tersalur di 105 titik distribusi. Pendistribusian itu dimulai sejak 21 Januari dengan menggunakan sistem membungkus beras dengan berat 5 kg, dan mengantar langsung ke titik distribusi dan semua pembiayaan ditanggung Kantor Bulog Sub Divisi Regional III. langkah itu sengaja dilakukan untuk memudahkan masyarakat dalam mendapatkan beras. Hal itu diungkapkan Kepala Kantor Bulog Sub Divisi Regional III Kisaran Muhammad Zaim Madjid, didampingi Kepala Seksi Pelayanan Publik Rudi Adlin Damanik ditemui Waspada, Jumat (4/2). Menurutnya OP itu dilakukan dengan bekerja sama dengan Pemkab Asahan, dan dijual dengan harga Rp 6.200 per kg. Wilayah Kisaran terdapat 25 titik distribusi, meliputi tiga pasar tradisional (Diponegoro, Kartini dan Bhakti) ditambah lagi di beberapa titik tempat umum. Sedang untuk tiap kecamatan di Asahan ada sekitar 80 titik dengan permintaan meningkat tiap hari.

“Hari ini saja mencapai 32,5 ton kami salurkan. OP itu akan tetap berlanjut hingga harga beras di Asahan kembali normal, dan itu dilihat dengan permintaan berkurang sehingga mengurangi harga beras di pasaran,” kata Madjid. Persediaan beras untuk OP, kata Madjid, Bulog mempunyai stok cukup, sehingga warga diharapkan jangan khawatir, karena pihaknya telah mempersiapkan beras cadangan hingga harga beras kembali normal. Berdasar pengamatannya, normalnya harga beras akan terjadi pada Mei, karena musim panen di beberapa tempat di Asahan berlangsung. “Kita mempunyai stok beras sebanyak 2.300 ton, akan disalurkan pada OP di Asahan. Tidak hanya itu bulog akan selalu ada untuk menstabilisasi harga beras di pasaran, sehingga masyarakat jangan khawatir,” ungkap Madjid. Dalam OP Asahan, lanjut Madjid, Pemkab Asahan membentuk tim monitor sehingga tepat sasaran, serta melibatkan setiap elemen pemerintah dari tingkat desa hingga kecamatan, untuk bertanggung jawab OP

Harga Emas Di Medan Jenis



London Murni






24 Karat

90 s/d 93%


Emas Putih

75 %

22 Karat




20 s/d 35%


ini berjalan lancar. “Kita menyalurkan beras ke langsung ke titik distribusi sesuai dengan permintaan. Sedangkan untuk masyarakat tidak dibatasi pembeliannya. Dengan demikian OP ini bisa tepat sasaran dan membantu masyarakat dalam memenuhi permintaan beras,” kata Madjid. Beras Turun Di lain tempat, pemilik toko grosir di Jalan Diponegor Kisaran, Adan, kepada Waspada mengakui dampak OP mengakibatkan harga beras di pasaran turun mencapai Rp 300 per kilogram, dan harga itu diperhitungkan akan terus mengalami penurunan. “OP berdampak langsung dengan harga beras, selam seminggu harga terus mengalami penurunan,” kata Adan. Sebelum OP dilakukan, harga terus mengalami kenaikan hingga mencapai Rp 8.600 perkilogram untuk jenis IR 64 , sedangkan jenis C4 mencapai 8.200 perkilogram. “Namun kini telah harga itu telah turun, walaupun tidak banyak tapi sangat berpengaruh.” kata Adan. (a15)

Valuta Asing Di Medan

Rp292.000 (m40)

Mata Uang



Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

9.140 8.226 8.620 14.068 1.169 104,50 6.679 11.825 2.870

8.890 8.054 8.454 13.783 1.148 101,50 6.445 11.063 2.800

Bupati L.Batu TerimaAudensi Pengurus BPC HIPMI RANTAUPRAPAT (Waspada): Bupati Labuhanbatu atas nama Pemkab Labuhanbatu siap memfasilitasi dan mendukung program kerja dari Himpunan Pengusaha Muda Indonesia (HIPMI), karena HIPMI hadir sebagai mitra kerja dari pemerintah. Pemerintah juga mengharapkan dukungan seluruh elemen masyarakat termasuk HIPMI dalam upaya menyongsong perubahan untuk kemajuan di Labuhanbatu. Bupati Labuhanbatu Tigor Panusunan Siregar bersama wakil Bupati Suhari Pane yang didampingi asisten II Edi Sampurna Rambe saat menerima audensi pengurus DPC HIPMI, Selasa (1/2). Ketua BPC HIPMI Labuhanbatu Idlinsah Harahap mengatakan, program utama HIPMI kedepan adalah HIPMI go to kampus, disini HIPMI akan membela semangat kewirausahaan kepada para mahasiswa, agar mereka senantiasa tidak terobsesi untuk menjadi PNS saja. (c07)

128 Unit Penangkapan Ikan Di Batubara Miliki Izin LIMAPULUH(Waspada): Sebanyak 128 unit armada milik pengusaha perikanan di perairan Kuala Batubara mulai dari Pagurawan, Kec Medang Deras, Kuala Tanjung hingga sampai Tanjungtiram yang baru memiliki izin dari Dinas Perikanan dan Kelautan setempat. Sedangkan lainnya masih banyak ditemukan belum memilikki izin. ‘’Ini sesuai hasil pendataan petugas dua tahun terakhir baru 128 unit armada nelayan memiliki surat izin baik berupa Surat Izin Usaha Penangkapan (SIUP) maupun Surat Izin Penangkapan Ikan (SIPI),’’tukas Kepala Dinas Perikanan dan Kelautan (Kadis Kanla) Kab Batubara, Ir Azuar Hamid dikonfirmasi Waspada, Jumat (4/2). Pihaknya berupaya untuk mengejar bola dalam arti kata melakukan pelayanan langsung pembuatan izin diperlukan setelah nanti kapal bantuan dari pemerintah pusat diterima diperkirakan pada bulan Pebruari 2011 ini. ‘’Kita sudah mengirimkan petugas atau tekong untuk menjemput kapal bantuan pemerintah pusat itu di Jakarta dan kini masih dalam proses mobilisasi diperkirakan akan dibawa mengunakan kapal kargo,’’ujarnya. Dengan bantuan kapal tersebut pihaknya dapat melakukan pelayanan langsung ditengah laut dalam penerbitan izin diperlukan bagi nelayan sehingga tidak ada lagi kapal nelayan nanti tidak memilikki izin sebagaimana ketentuan dan peraturan berlaku. Disamping mengejar masukan pendapatan ke kas daerah melalui sektor Perikanan dan Kelautan. ‘’Sesuai peraturan, Diskanla kabupaten dapat mengeluarkan izin dari 5 hingga 10 GT (Gross Ton). Sedangkan di atas itu wewenang Provsu dan Pemerintah Pusat mengeluarkan,’’katanya. Selain itu akan lebih mudah melakukan pengawasan ditengah laut terutama terhadap zona tangkapan nelayan. ‘’Kita yakin melalui kapal itu nanti pengawasan akan lebih meningkat sehingga tidak ada lagi terjadi pelanggaran zona tangkapan nelayan sebagaimana dikeluhkan sebagian nelayan berskala kecil,’’ungkap Zuar.(a13)

Harga Berbagai Jenis Bahan Pokok Cabai rawit Cabai merah Cabai hijau Tomat Kentang Wortel Kol

Rp50 ribu Rp52 ribu Rp18 ribu Rp6000 Rp10 ribu Rp4000 Rp3000

per kg per kg per kg per kg per kg per kg per kg

Harga Beras: KKB Ramos Jongkong IR 64 Bulog Beras kita Gula Putih Minyak goring Pulut Tepung Trigu Mentega

Rp9.500 Rp10.500 Rp8.750 Rp9500 Rp6170 Rp7400 Rp11 ribu Rp11 ribu Rp12 ribu Rp7000 Rp7000

per kg per kg per kg per kg per kg per kg per kg per kg per kg per kg per kg.

B10 1 CM 2 CM

Rp. 12.000 Rp. 24.000

WASPADA 3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

CHEVROLET Trooper Thn. 88. Diesel 4x4. Silver, AC, Tape, Ban Savero. 5 Pintu. Hrg. 28Jt (Rwt Cat). Hub. 0852 621 44171 Jl. STM.

BIMANTARA / Cakra MT Sedan Thn. 1996. Warna hitam metalic. Hub. 0812 6004 3763 - 0813 9624 1969 DAIHATSU Xenia Thn. 2008. Tgn pertama dari baru. Type Li VVTi yang paling komplit, Km. rendah. Harga 112Jt/Nego. BK Medan asli, Hub. 061-77387284 / 0815 3324 5574 DAIHATSU Espass Th. 95/96. 1,3. W. Merah. BK Mdn. AC, TP, VR, BR, Body kaleng2. Cat mulus, Kondisi siap pakai. H. 33 Jt/ Nego. Hub. 0852 6176 2517- 763 82311

DAIHATSU Espass Pick Up. Thn. 2004. Warna biru, BK Medan, Mobil siap pakai. Jl. Sukaria No. 17 A. HP. 0813 6179 0291

DAIHATSU PU 1.3 Thn. 95 Dijual. Warna hitam, mulus. Harga Rp. 25Jt/TP. Hub. HP. 0812 6523490 DAIHATSU Xenia Family LE, Th. 2009, Warna hitam, BK Mdn. Lengkap. Hub. 061.753 40199 DAIHATSU Taft GTS 4x2 Thn. 88 Warna Biru, AC, Tape, Velg Racing, BK Medan (Mutasi). Siap Pakai. Telp. 0852 6108 9110 #PAKET TERBARU ASTRA DAIHATSU...TERMURAH # - New Pick Up DP 5 Jt-an Angs. 2 Jt-an - New Luxio DP 6 Jt-an Angs. 3 Jt-an - New Xenia DP 11 Jt-an Angs. 3 Jt-an

Pesan segera ke: Ahmad Arif Nasution: 0812 6005 2465 / 061-76277622 NB: Simpan Nomor ini, sewaktu2 berguna untuk Anda.

DAIHATSU Espass 1.6 ZSX Thn. 2000. Warna Silver. BK Medan Asli, AC Double Blower/Lengkap. Harga. Damai. Bisa Kurang. Hub. 0813 9604 0559 / 771 43068

# DAIHATSU 100% BARU # * Xenia DP: 11Jt. Terios DP: 14Jt * Pick-Up DP: 7 Jt. Luxio DP: 8Jt Proses cepat, Data dijemput...! Hub. Kalpin 0852 7041 9000 All New HONDA Jazz Thn. 2009 Dijual. Pemakaian 2010 Hitam, Tipe 5 MT (Manual), TV, DVD, Touch Screen, VR 17, Asuransi All Risk atau balik DP 65 Jt. Sisa Angs. 36 Bln / bln Rp. 5.568.400. Hub. 0852 9644 8488

HONDA Jazz RS M/T 08. W. Hijau muda metalic. BK Mdn asli, BPKB 1 tgn. Jok kulit, mulus, 205Jt. Nego. Hub. 0852 9841 2232 !!! NEW HONDA !!!

Ready Jazz, Freed, CR, V, City, Civic, Accord, ODY + V.Kool. DP 15%. 1 s/d 5 Thn. Proses Cepat. Hub. Dedy. 0813 6230 8018, 061.76486240 ISUZU Truk ELF 120 HD 6 Roda. BK Medan. Thn. 2007. Kondisi mulus, terawat, siap pakai. Hub. 0813 6234 7336 / 0821 6551 8933. Jl. Sekata No. 2 Gaperta Ujung. Harga Rp. 145Jt/Nego (BU)

ISUZU Panther Box, Th. ‘04, Wrn biru, Box Cantik, siap pakai, Rp. 75 Jt. Hub. H. Alex. 0813 9682 8808 KIA Picanto DP 16,5 Jt/Angs. 2 Jt-an KIA Pride DP 20 Jt/Angs. 2 Jt-an Hot Line. 0852 6117 5111 (Andri)

Picanto Cosmo - 2011 KIA New DP 17 Jt

Mobil HP. 0813 8723 8734 MITSUBISHI Kuda GLS Solar Thn. 1999 Biru BK Mdn Asli Lengkap. Siap pakai. Hrg. 76Juta/damai. Hub. 0812 6491 529

M-Eterna-90. BK Asli Medan. Kondisi original, mulus. Hub. 0815 3374 8820 MITSUBISHI Eterna DOHC Thn. 91. Warna Hijau, Original. Hrg. 28Jt. Nego. Hub. 0813 6108 7834

NISSAN Frontier Thn. 2006. BK Asli 1 (satu) tangan. Warna hitam. Keadaan mulus. Harga 162Jt (Bs. Nego). Hub. 0821 66 4535 69 - 0812 6055 9999 SUZUKI Katana Thn. 2001 Dijual, Wrn biru met. AC, TP, VR, Ban baru, Siap pakai. Hrg. 58Jt Nego. Bisa Kredit. DP 10Jt. Angsuran 2,2Jt x 35 bln (asuransi). Hub. 0813 7030 1442

5 CM 6 CM

Rp. 65.000 Rp. 78.000

SUZUKI Sidekick Drag One Thn. 97/98. Hitam, BK Mdn lengkap. Hrg. 76juta/Damai. Suzuki Sidekick Drag One Thn. 97/98. Silver, BK Mdn Lengkap. Hrg. 76Juta/Nego. HP. 0812 6545 1974

SUZUKI Katana: Thn. 91. Warna biru. BK Medan. Hub. 77723498


Fortuner, Innova, Avanza, Yaris, Rush, Cash/Credit, Proses Cepat, Full Cash Back. Terima Tukar Tambah. Hub. 0821 6060 4998 TOYOTA Kijang Commando Long Thn. 88. W. Biru met. Mobil mulus, cantik, AC, TP, BR, VR, H. 42Jt Nego. Hub. 0812 6443 004 / 7777 8725

TOYOTA Corolla GL 85. W. Merah mulus. Hrg. 19Jt/Nego. BK Pilihan 2 angka. Honda Tiger 2000 CW. W. Hitam. Thn. 08. Mulus, Hrg. 18Jt. Hub. 0812 6396 269 (No Agen) TOYOTA Corolla SE Salon, 87. Merah Lengkap, PR, BR, Tape, AC + P. Steering. Harga 28 Juta/Nego Boleh TT. dengan Kijang, Panther, Taft GT. Honda Grand Civic 88, Hitam, lengkap, mulus sekali, nama sendiri. Harga 33 Juta/Nego. Hub. 0811 645 684. HSB.

!! TOYOTA 100% BARU !!


TOYOTA Starlet 1.3 Thn. 88. Warna hitam, Asli Medan, pajak panjang, AC, Ban 4 Baru. Hub. 0813 9621 6511 - (061) 76793535

SUZUKI Baleno Th. ‘02, Wrn hijau met, Balik DP RP. 23Jt. Sdh bayar 11 kali x Rp. 2.477.000. Hub. 0852 9630 0405 TOYOTA Corona Twin Cam 1.6 ‘00. VR 17”, AC Dingin, PS, PW, EM, CL, RT, BM (pajak s/d Bln 12-11). Hrg. 33,5Jt/Ng. Hub. Sei Mencirim No. 184 (Medan Baru). HP. 0812 7579 3131, 0821 6764 1010

TOYOTA Innova G Diesel Th. ‘04, Balik DP RP. 39Jt. Sdh bayar 13 kali. Wrn silver, bln 12, mbl cantik. Kembar Ponsel. (Dpn sklh Eria). 7851402 TOYOTA Avanza Type S Th. ‘07 1500cc, wrn silver, pakai sensor, mbl cantik, 1 tgn dari baru, Rp. 138Jt. Kembar Ponsel. Jl. SM. Raja No. 200. 0815 337 336 88 / 7851402

TOYOTA Avanza, 2005 Dijual. Hijau Silver, Bensin. 148Jt. Hub. 0852 97198008 TOYOTA Kijang Super 87 Dijual. Siap pakai. Velg Racing. Ban Radial, AC, Ta[e, warna abu-abu. Pajak Baru Bayar Bln Ini. Harga 39Juta. Hub. HERY 0812 64 17 585 Toyota Avanza Type-S VVTi Hitam 2008 Toyota Avanza Type-G Biru 2006 Toyota Kijang LGX Bensin Silver 2003 Toyota Kijang LGX Diesel Hijau Tua 2003 Toyota Kijang LSX Diesel Abu-abu 1997 Toyota Kijang Grand Extra Hijau 1993 Suzuki Carry Adi Putro 1.3 Abu-abu 1996 Daihatsu Zebra Escada 1.3 Merah 1995 Toyota Kijang Commando Abu2 1989 Cash - Credit - Tukar Tambah Jl. Mustafa Depan Gudang Bulog Telp. (061-6624884 / 061-30089303)

TOYOTA 100% BARU Ready: Avanza, Rush, Innova, Fortuner, Yaris, Vios, Altis, Camry. Hub. 0813 7043 7766

TOYOTA Avanza Thn. 2007 W. Hitam. G. BK Medan. Hub. 0812 636 8184 TOYOTA Kijang Thn. 88. W. Biru Long/LSX. Hub. 0813 6176 1239 DUMP Truk Toyota Dyna 125 HT. Thn. 2004 BK Medan, kondisi mulus, terawat. Hub. Jl. Sekata No. 2 Gaperta Ujung. Hp. 0813 6234 7336 / 0821 6551 8933. Harga Rp. 122Jt/Nego (BU)

TIMOR 97 merah metalic. Mobil mulus. cat asli, nego. HP. 0813 7094 4002 - 77601080 TIMOR Th. 97/98 W. Merah, BK Asli Mdn, AC, TP, VR, BR, Body kaleng2. Cat mulus, Original. Siap pakai. H. 43Jt/Nego. Hub. 0811 65 3384

Pasang Iklan Mini

“WASPADA” Telp: 061 - 4576602

7 CM 8 CM

Rp. 91.000 Rp. 104.000

9 CM Rp. 126.000 10 CM Rp. 140.000



1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633

DANA EXPRESS SHM, SK Camat 1 Hari Clear 0813 6229 0001 0812 6095 5531 (Henrik)

HA TI-HA TI terhadap penipuan yang ATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu,






1 Bh Mesin Press Hidrolik Paving Blok Dinamo 5 HP. Sekali Cetak 4 Unit. Untuk segi enam. Harga 30Jt Ng. Hub. 0812 652 3490


ELEKTRONIK JUAL DAN BELI TV, LCD, Kulkas, M. Cuci, Handycam, DSLR, Laptop, LCD Projector, Laptop, PS 1, 2, 3, H. Theater, Sound System, dll. Hub. CV. MARKET, Telp. 7632 4682 - 0812 65393000 S. Budi T. Sari No. 424 B Psr. IV Dkt BNI BELI DNG HARGA TINGGI AC, TV, LCD, PS, Ampli, Spk, AC, Kulkas, Projector, Laptop, Handycam, Camera, Keyboard, dll. UD SENANG HATI: 4517509 - 69677449. Jl. Sekip 67 A



Asli Surat Ganti Rugi Tanggal 4 Juni 1981. Yang diketahui Oleh Lurah Titi Papan. Abdul Wahab Dong. Tercecer sekitar Titi Papan. Hub. 0813 61977 123 - 0812 6016 668 tahun 2000. TERCECER

1 (Satu) Buah BPKB Asli STNK BK 9247 PH a/n. WAHYU RAYA SEJATI. Alamat Jl. Sudirman Dsn Setia DS. Perdamaian Stabat Langkat.


BPKB Spd. Motor Honda BK 4905 GF a/n. NURASAMINA HULU. Alamat Jl. Saudara Gg. Baru I No. 14 A - M. Kota. No. Rangka: MHIJB 211 62 K 008770. No. Mesin: JB 21E - 1008464


BPKB a/n. ANNA SUHARTIANA, BK 6101 XR. alamat: Jl. Jala II Lingk 11 Terjun M. Marelan. No. Mesin: JF 31E0054289. No. BPKB : 1780277. Tercecer sekitar Jl. Kapt. Rahmat Budim

TELAH TERCECER 1 Lembar Asli a/n. SULAIMAN. Luas Tanah 2400 Mtr. Letak tanah di Lingk. II Kel. Paya Pasir Kec. Medan Marelan. Tercecer disekitar Jl. Marelan s/d Jl. Helvetia. pada pertengahan Juli 2006. Belum ditemukan.





Cuci AC, Isi Freon, Bongkar Psg, AC Tambah Freon, Perbaikan, Spare parts. AC - KULKAS - MSN CUCI Hub.06177972065 / 0813 6149 7921

Baru 100% / Garansi 3 Tahun Rp. 2.090.000 + Pipa + kabel. Tersedia: Cuci AC, isi Freon, Bongkar Pasang. NB: Tukarkan AC Rusak Anda dengan AC Baru Kami Hub. Sumatera Jaya Jl. G. Subroto 401

Tel. 4143670 / 77555550 / 0821 6069 6273






Servis Kulkas, M. Cuci. Hub. MANDIRI TEKNIK 061-7676 4660 0812 6557 521

SERVICE BERGARANSI Cuci AC/Tambah Obat Bongkar Pasang

HP. 0813 7536 4412 7767 7220





HP. 0812 6053 690


REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757- 0812 1671 84742 Siap Ketempat



Matematika / Fisika. 0821.6750.7577 Berpengalaman, Dari Mahasiswa Peg. Negeri KURSUS KOMPUTER CEPAT -


Ms Office (Word + Excel)......................... 200 Rb (2 minggu) Komputer Aplikasi Perkantoran Lengkap 450 Rb (1 bulan) Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Merakit Komputer/ Lengkap................... 400 Rb (6 hari) Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) Desain Grafis + iNTERNET....................... 600 Rb (1 bulan) WEB Programing...................................... 500 Rb (10 hari) DISCOUNT 20% Daftar langsung belajar Waktu Bebas, Tanpa batas usia Jl. Sei Batang Hari Ujung 170 Medan Telp. 844.2158 - 844.2159 WEBSITE:


Merek TV, Siap ditempat. Garansi

MASTER TV RIDWAN 0812 6303 4400 77621674 JAYA TV 0813 7071 3504










Menyediakan Paket Cuci Pakaian Hub. 0878.6809.7912- 0821.6751.3463


Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan





Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)

Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866


Ingin Promosikan Produk Anda Harian

DIBUTUHKAN Tkg Pangkas Muslim Jaminan 40 Rb, Full AC Hub. 0812.604.4564



Lls SLTA/ sdrj Unt diddk & lsg dislrkan mjd Guru PG/ TK Hub: Jl. KH. Wahid Hasyim 92 Medan, Tp. 7623.5314 - 9158.3487 4533.875 - 456.9269


Perusahaan yang bergerak dibidang jasa terapi anak membutuhkan terapis, dengan syarat: 1. Laki-laki/ perempuan 2. Mempunyai ijazah: - Psikologi - Fisioterapy - Terapy Wicara - Guru TK 3. Mampu bersosialisasi dengan anak 4. Berpengalaman kerja sebagai terapis anak dengan kebutuhan khusus min. 1 tahun (lebih diutamakan 5. Dapat bekerja dengan tim, dan mempunyai disiplin yang tinggi Untuk informasi lebih lanjut, hubungi Fitri: (061) 455.0065 pada jam kerja (08.00 s/d 16.00)


Dibutuhkan tenaga kerja P/W usia 17-40 thn, untuk ditempatkan di Perusahaan Swasta cab. Medan (non Sales), syarat: - Pendidikan min SMU/ sederajat - Berkas lamaran diantar langsung ke kantor dgn menunjukkaniklan - Penghasilan 1.800.000/bln+ Uang kerajinan HUB. BPK. HERIADI, SE/ BPK. SANDY MUNTAZA

HP. 0821.6629.7255 - 0813.7703.4510

Alamat kantor: Jl. Brigjend. Hamid No. 8B (±10m dari Titi Kanal) arah Delitua Medan



WASPADA Media yang Tepat untuk Iklan Anda


Jl. Brigjen. Katamso No. 402-B Medan

Hub. 8219951 Jl. Setia Budi No. 2

Ingin Promosikan Produk Anda

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


Sebuah Perusahaan Infor masi & Teknologi, membutuhkan karyawan sbb: 1. Marketing: Diutamakan yg berpengalaman, memiliki wawasan tangguh, siap menghadapi tantangan, minimal tamatan SMU 2. Staf Adm: Minimal tamatan SMK, rajin, disiplin, kuat mental, bisa mengoperasikan computer minimal Word/ Excel 3. Teknisi: SMK Elektronika/ Listrik, rajin, disiplin, berprilaku baik Surat lamaran diantar langsung atau dikirim via pos ke alamat:

AHLI Toshiba, Sony, polytron & Segala


Telah tercecer/hilang sebuah BPKB Sepeda Motor atas nama MARTUA BATUBARA. alamat Komplek Cemara Madina Blok F No. 5. Tercecer/hilang diperkirakan bulan Mei 2010 di sekitar Aek Godang - Pasar lama Panyabungan. Jika ada yang menemukan mohon dikembalikan ke alamat di atas atau menghubungi 0821 6605 1135, tidak akan dituntut dan akan diberikan imbalan sepantasnya.




Media yang Tepat untuk Iklan Anda


061-4576602. Terimakasih



127 Pengemudi Pria/ Wanita. Komisi, Bonus, Insentif, GPS, Mess, Mobil baru, dll. Syrt: 23 - 50 thn, SIM & KTP, Tdk bertato/ bekas tato, Segera dtg/ kirim lamaran ke: Jl. Kapt. Muslim No. 92 Medan Telp. 7637.5840

silahkan hubungi kami di

RENTAL MOBIL Bisa antar jemput mulai pagi jam 5. Untuk Acara Pesta, dll. Rp. 380.000/hari. Termasuk supir dan bensin. 0852 6102 1435

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

BUTUH DANA DANA Th. 75 - 2010 MOBIL + Sp. MOTOR % D. TRUCK + TRONTON, BM: KILAT T.OVER: SHM + SKC + DP & KTA BPKB Mr. JG.0813 7548 5990, 777 90 557 BUTUH DANA CEPAT

11 CM Rp. 165.000 12 CM Rp. 180.000

Sabtu, 5 Februari 2011



14 Jt s/d 38 Jt (Nego)



JL. YOS SUDARSO KM. 15,5 NO. 121 MEDAN RINALDI: (061) 685.0456 MOBILE 0813.6214.3160

Persh. Kurir Cargo Jl. SM. Raja No. 480 (depan Jl. Garu 1) Membutuhkan segera

I. Kurir 20 orang II. Leader 6 orang III. Customer Service 5 Orang IV. Supir 4 orang V. Marketing 4 orang Syarat-syarat: Memiliki kend. roda 2 + SIM C (1) SIM A/B (IV) Ktp Sim masih berlaku (I, II, III, IV, V) Laki-laki (I, II, IV) Per (III, V) Usia max. 35 thn (I, II, IV) 27 thn (III, V) Pend min SLTA (I, II, IV) Pend. min D3 semua jurus (III, V) Diutamakan yg berpengalaman makr cargo (V) Domisili Medan, Belawan, Sunggal, Helvet, Lubuk Pakam, Tembung, Binjai (1) Medan II, III, IV, V) Mau bekerja keras dan jujur Lamaran diantar langsung pelamar yang memenuhi syarat akan dipanggil dan di interview Lamaran ditutup tanggal 26/02/2011


BLUE BIRD GROUP, perusahaan jasa transportasi dengan skala nasional, mengajak anda bergabung menempati posisi: TELEPHONIS (KODE: TELP) Min Diploma (semua jurusan), max 30th, bersedia kerja shift, mampu berbahasa Inggris, paham wilayah Medan, terbuka untuk lulusan SMA dengan pengalaman kerja 4 thn OPERASIONAL (KODE: OPS) Min Diploma (semau jurusan) max 30th, Kerja shift, tegas, punya pengalaman berorganisasi merupakan nilai lebih TEHNICAL ADVISOR/ SERVICE ADVISOR (KODE: TA/ SA) Min STM, maks. 35 thn, mampu menganalisa kerusakan mobil, berpengalaman dibidangnya minimal 1 thn MEKANIK OTOMOTIF (KODE: MO) STM Otomotif, Max 30 thn, bersedia bekerja shift, pengalaman di bidang mobil min. 1 thn MEKANIK BODY REPAIR (KODE: MBR) Maks. 40 thn, pengalaman dibidang las ketok atau pengecatan mobil minimal 1 tahun Segera kirimkan berkas lamaran ke:


Jl. Kapt. Muslim 92 Sei Sikambing, Medan Paling lambat 10 hari setelah iklan dimuat


Pondok Pesantren Arroyyan menerima tenaga pengajar sesuai disiplin ilmu sbb: - PAI - IPS - Matematika - Psikologi anak - Bahasa Indonesia - Bahasa Arab - Hafizh Qur’an - Bahasa Inggris - Olah raga - PKN - Kesenian A. Syarat Khusus 1.Berakhlak mulia dan berdisiplin tinggi 2.S h a l a t d a n b i s a m e m b a c a Al Qur’an 3.Bersedia untuk tinggal di Pesantren Arroyyan B. Syarat Umum 1.Melampirkan surat lamaran kerja 2.Fotocopy Ijazah dan transkrip nilai 3.Curriculum vitae 4.Fotocopy KTP 5.Pas foto 3x4: 3 lembar Lamaran dikirim ke email: Untuk keterangan selengkapnya dapat dilihat di Atau dapat menghubungi kami CP: 0812.7609.5999

LOWONGAN KERJA Dibutuhkan beberapa karyawati Yang akan di tempatkan sebagai: 1. Pembukuan 2. Penjualan Dengan syarat: - Pendidikan terakhir min. SMA/ SMK sederajat - Fotocopy Ijazah terakhir - Berpenampilan menarik - Jujur, disiplin dan bertanggung jawab - Belum menikah - Usia max. 22 tahun Lamaran langsung diantar: TOKO ANEKA JAYA Grosir Perlengkapan Bayi dan Pakaian Jadi Anak-anak Jl. Pusat Pasar No. 7P Telp. (061) 4533.602 Medan



Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik


Dua unit Ruko Gandeng 2½ Tingkat, LT. 9x15m,LB. 8x13m, SHM, Keramik, PLN,PAM, Cocok usaha, F. copy, Grosir, Internet, Laundry, Cost dll Lokasi Jl. Amal Luhur dekat Sekolah dan RS. Sari Mutiara Jl. Kpt. Muslim Bila berminat/ serius hub. 0811.640.016

DIJUAL CEPAT Rumah, Murah, Mau Pindah, Hanya Rp. 355 Jt, Komp. Villa Malina Ring Road Setia Budi Telp. 0811.644.793 - (061) 8211.488


Rumah Makan berikut isinya, 10x16m², SHM, Permanen, Lokasi Strategis, Omset lumayan, Rp. 750 Jt/ng, Jl. Pasar III No. 132 (Krakatau) di depan Pabrik Telp. (061) 662.6731 HP. 0852.6299.3232

JUAL MURAH 3 PINTU RUKO RP. 800 JT Jl. Cemara Pulau Brayan Hub HP. 0821.6535.6188 TANAH TANAH DIJUAL

Komplek Bumi Asri Blok G-20 Jl. Asrama (Ring Road), B.U TP Hub. 0812.641.9165 - 0852.2131.1158 DIJUAL 2 BIdang Tanah Darat dekat Lampeunurut, ±6km dari Banda Aceh di Pinggir rencana ringroad, Cocok utk, Bangun perumahan (Bebas tsunami 2004), Ukuran luas 8236m² (SHM) dan 1367 (SHM), Harga Rp. 200 Rb/m², Bisa nego Hub. 0812.6432.006 TANAH Siap bangun Uk. 15x27m, SHM, Lokasi di Jl. Mesjid dekat Kantor Kep. Desa Pematang Johor Lab. Deli, ±10menit dari Simp. Cemara Asri Sampali, Hrg nego Hub. 0813.9760.8506 (TP)


Dan 16,5 Ha di Langsa NAD, Srt Akte Camat, Hrg Rp. 30 Jt/ ng Hub. 0821.1485.7557


Luas Tanah 11x54mtr, Jln Besar Ta n j u n g S e l a m a t d e p a n Swalayan Ido Kec. Medan Sunggal, Contac Person Bu Ani (061) 7707.6327


Luas ±3 Rante di Pinggir Jalan Aspal, Jl. Bangau Kp. Nangka Mencirim Timur Binjei, Masuk dari Jl. H. Juanda samping Swalayan Ramayana s/d Kebun Tebu, SK Camat Harga Net Rp. 100 Jt Hub. 0813.7503.4449, TP







DISEWAKAN BULANAN/ HARIAN Fasilitas: TV/ AC/ Springbed, dll Bangunan Baru di Tengah Kota/ daerah Ayahanda Jl. Rantang No. 2 Hub. 0813.8340.2818 0821.6658.3000 - (061) 6969.1753


RUMAH DIJUAL Komp. Pondok Karya Prima Indah Blok A No. 4, Jl. Karya Kasih Medan Johor , LT . 12x15mtr, LB. 70m², KT 2, KM 1, Air PAM, PLN, Telp Harga bisa nego Hub. 0811.648.275





Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA


WASPADA Mau Menjual Rumah, Tanah, Kendaraan, Barang

Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:



Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347

Ekonomi & Bisnis

WASPADA Sabtu 5 Februari 2011


BI Rate Jadi 6,75 Persen Bank Jangan Latah Naikkan Suku Bunga JAKARTA (Waspada): Setelah mempertahankan suku bunga acuan (BI Rate) sebanyak 18 kali di level 6,5 persen, Bank Indonesia (BI) akhirnya menaikkan suku bunga sebesar 25 basis points atau menjadi 6,75 persen. Keputusan ini berdasarkan faktor inflasi karena kenaikan harga pangan. "Ya, itu salah satu pertimbangan kami," kata Deputi Gubernur BI, Halim Alamsyah, di gedung BI, Jakarta, Jumat (4/ 2). Dalam rilis Bank Indonesia disebutkan, bank sentral mewaspadai tekanan inflasi cenderung meningkat ke depan, seiring dengan gangguan

pasokan bahan-bahan kebutuhan pokok (volatile foods) dan kemungkinan penyesuaian harga-harga ditetapkan pemerintah (administered prices). Bank Indonesia berpandangan kenaikan ekspektasi inflasi akan dapat diminimalisasi apabila dilakukan peningkatan efektivitas produksi, distribusi, dan ketersediaan bahan pokok di tingkat nasional serta daerah. Dari sisi Bank Indonesia, bauran kebijakan moneter dan makroprudensial telah ditempuh tahun lalu akan terus diperkuat dengan mengoptimalkan semua instrumen secara seimbang dan terukur. Seperti diketahui, selama ini Bank Indonesia telah menempuh sejumlah kebijakan untuk mengendalikan likuiditas dan capital inflows seperti kenaikan giro wajib minimum (GWM) rupiah dan valas, one month holding period (OMHP) terhadap Sertifikat Bank Indonesia (SBI), dan pembatasan pinjaman luar negeri jangka pendek

bank. Dewan Gubernur berpandangan, momentum pemulihan ekonomi global kembali meningkat meskipun masih dibayangi oleh risiko krisis utang di Eropa. Di tengah masih lemahnya pemulihan ekonomi di negara maju, kinerja ekonomi negara emerging markets tetap menunjukkan peningkatan. Selain itu, harga komoditas global terus meningkat, tidak hanya dipengaruhi faktor penawaran dan permintaan, tetapi didorong oleh beralihnya investasi ke pasar komoditas akibat pelemahan dolar AS dan rendahnya imbal hasil di negara maju. Sejauh ini, respons kebijakan bank sentral negara-negara maju masih cenderung mempertahankan suku bunga pada level relatif rendah. Sementara itu, beberapa negara emerging markets telah meningkatkan suku bunga kebijakannya disertai kebijakan untuk mengelola capital inflows

Pegawai Kemenkeu Wajib Lapor Pajak Pribadi JAKARTA (Waspada): Kementerian Keuangan (Kemenkeu) gencar menggelar kegiatan bersih-bersih aparatnya dari tindakan tidak terpuji. Saat ini, seluruh staf di Kemenkeu harus menyerahkan Laporan Pembayaran Pajak Pribadi (LP2P). Kemenkeu juga menginstruksikan kepada seluruh pimpinan eselon satu untuk menyerahkan daftar nama pejabat yang harus menyerahkan Laporan Hasil Kekayaan Pejabat Negara (LHKPN) kepada Komisi Pemberantasan Korupsi (KPK). "Triger-nya kan, waktu itu kasus-kasus di bidang perpajakan tapi sekaligus menyangkut tidak hanya pejabat

yang mengurus masalah pajak saja, tetapi pejabat di lingkungan Kemenkeu. Itu sebagai upaya kami untuk meningkatkan disiplin dan penegakan hukum di kementerian," kata Sekretaris Jenderal Kemenkeu, Mulia P Nasution, di kantornya, Jalan Wahidin, Jakarta, Jumat (4/2). Mulia menuturkan, permintaan penyerahan LP2P dari seluruh staf Kemenkeu dilakukan karena semua pegawai di lembaganya saat ini sudah menjadi wajib pajak dan mengisi Surat Pemberitahuan Tahunan (SPT) pajak. Dengan LP2P tersebut, Kemenkeu akan menilai disiplin




Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243



Di asuh


Raja susuk pelet pengasihan dan teravi alat vital. 1. Bila anda ingin jadi artis, ngelamar kerja ingin di terima, meningkatkan karier, cantik mendadak, dll...! 2. Menampilkan kecantikan yg luar biasa tiada tanding, membukakan aura pesona karisma, agar semua laki-laki tergilagila, pengeretan materi bagi wanita malam dll.. ! 3. Menampilkan wajah menjadi ganteng dan berwibawa akhirnya semua cewek melirik jatuh cinta dll....! 4. Semua orang lawan maupun kawan bertekuk lutut (menyembah bersujud) bawahan maupun atasan. dll 5. Perjodohan, buang sial, pemanis, karisma, memanggil orang pergi tanpa pamit (hilang), merujukan keluarga yang lagi bermasalah, persidangan, dll..! 6. Hutang setumpuk terbayar dalam waktu singkat

para pegawainya dengan melihat ada tidaknya keanehan dari kekayaan pegawainya yang bisa ditindaklanjuti kementerian. "Misalnya, pengisian dengan tidak benar itu berlaku ketentuan undang-undang, kalau ada keanehan-keanehan, itu bisa ditindaklanjuti," kata Mulia seraya menambahkan pengenaan sanksi diberikan berjenjang mulai dari ringan, sedang, dan berat sesuai tingkat kesalahan. Sementara itu, untuk pejabat wajib menyerakan LHKPN, Mulia mengatakan hal tersebut sudah diatur dalam ketentuan tersendiri. Pemeriksaan juga dilakukan aparat dari KPK. (vvn)


Tambah ukuran besar dan panjang/ jumbo, ejakulasi dini cepat keluar, lemah syahwat/ kurang keras, nafsu besar tenaga kurang karna diabetes keturunan dll..! KHUSUS WANITA, mengembalikan keperawanan (virgin) hasil bisa dicek, memperindah payudara, keputihan, kanker payudara/ rahim, lambat keturunan, dll..! MENYEDIAKAN PEGANGAN UNTUK BISNIS, PAGAR PERUSAHAAN, JAGA DIRI DARI GANGGUAN ILMU HITAM, DLL..!! Semua di berikan garansi dan Semua bisa dikerjakan jarak jauh...! ALAMAT: JL. MEDAN KM 4,5 NO. 16 PAS SONYA PONSEL DEKAT SIMPANG KERANG EMATANG SIANTAR HP. 0813.9658.8786 / 0857.6083.3558

Blog: email: facebook: Di tangani Bpk. HANDI dan M. HURYANA







Anda Telat? Produk import untuk Telat Bulan 5 - 7 Jam pasti lancar aman & bergaransi Hub. Apotek Sinar Farma Jl. Ampera 88B Sibolga HP. 0812.5095.0888


Garansi luar kota obat di pakai Baru dilunasi


Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!



Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481 DITANGANI LANGSUNG



Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663




Melayani berbagai macam keluhan antara lain:


- Panjang: 13 - 16 - 19 - 22 cm - Diameter: 3.5-4-4.5-5-5.5-6cm - Kuat dan tahan lama - Ejakulasi dini, sphilis/ Raja singa - Mani encer - Lemah syahwat, diabetes, impoten, dl KHUSUS WANITA: - Memperbesar, payudara, terapi perawan/ virgin, kista, lemah kandungan, kanker payudara, ingin mempunyai keturunan, dll PRIA & WANITA Ingin cepat dapat jodoh, penghasilan disegani atasan, menyatukan & memisahkan PIL/ WIL, Puter giling, juga melayani pasang susuk, dll --> Bergaransi, hasil permanen alami tanpa efek samping, langsung reaksi ditempat Alamat: Jl. SM. Raja dekat Taman Makan Pahlawan No. 130B Medan samping Show Room AUTO 2000. Dibelakang bengkel tambal ban

HP. 0813 8042 6253

dan menstabilkan pergerakan nilai tukar. Sebelumnya, data Badan Pusat Statistik (BPS) menyatakan kenaikan bahan pokok menjadi momok dalam kenaikan inflasi akhir-akhir ini. Bahkan, inflasi year on year (yoy) Januari telah menembus 7,02 persen. Inflasi Januari tercatat sebesar 0,89 persen. Dengan kenaikan inflasi, ekonom banyak menyarankan agar BI menaikkan suku bunga acuan. Pemer intah berharap kalangan perbankan tidak ikutikutan atau latah menaikkan tingkat suku bunga paska Bank Indonesia (BI) memutuskan menaikkan suku bunga acuan (BI Rate) sebesar 25 basis poin. Sebab, perbankan masih memiliki spread cukup lebar dari pengenaan bunga berlaku selama ini. "Karena spread-nya kan masih lebar, jadi tidak perlu ikutikutan. Saya harapkan itu (menaikkan suku bunga kredit) tidak perlu," kata Menteri Koordinator Bidang Perekonomian Hatta Rajasa di kantornya, Jalan Wahidin, Jakarta, Jumat (4/2). Menurut Hatta, BI pastinya sudah memperhitungkan berbagai aspek, termasuk ekspektasi dari pasar dalam keputusannya menaikkan BI Rate. Namun, pemerintah berharap hal sama tidak diikuti perbankan dan malah mendorong agar tingkat suku bunga diturunkan. Permintaan pemerintah tersebut juga seiring upaya untuk terus menjaga agar laju inflasi tidak melewati target ditetapkan. "Harus kita lihat, kalau inflasi tinggi biasanya harus dijaga juga keseimbangan," kata Hatta. Selain itu, pemerintah berharap dengan terjaganya spread suku bunga bank idealnya tidak sampai pada level 4-5 persen akan turut membangun kepercayaan pasar tetap tinggi. (vvn)


RATAS DUNIA USAHA. Menteri Keuangan Agus Martowardoyo (kiri) berbincang dengan Kepala Badan Koordinasi Penanaman Modal (BKPM) Gita Wirjawan (kanan) usai mengikuti Rapat Terbatas (Ratas) tentang dunia usaha yang dipimpin Presiden Susilo Bambang Yudhoyono di kantor presiden, Jakarta, Jumat (4/2).

HPP Beras Tidak Naik J A K A RTA ( Wa s p a d a ) : Pemerintah bersikeras tidak akan menaikan harga pokok penjualan (HPP) kendati disinyalir banyak petani merugi akibat rendahnya HPP itu. Menko Perekonomian Hatta Rajasa menegaskan jika HPP tidak akan dinaikan karena menurutnya HPP saat ini masih jauh diatas. HPP baru akan dinaikkan jika harga beras sudah jatuh. “Tidak perlu,yang penting beras masyarakat (petani) itu harganya harus diatas HPP. Sekarang kan masih jauh diatas, tapi dinaikkan itu kalau harga beras sudah jatuh dibawah HPP,” jelas Hatta di kantornya,

Jalan Wahidin Raya, Jakarta, Jumat (4/2). Menurut Hatta PMK 241 mengenai pembebasan bea Masuk harus tetap dilaksanakan karena harga beras tidak boleh melambung dan stok harus tetap ada. “PMK 241 itu cuma sampai Maret saja, harga beras kan tidak boleh tinggi dan harus selalu tersedia,” jelas Hatta. Jadi, Hatta berkesimpulan jika panen terjadi tidak boleh ditanggapi dengan gegabah agar tidak menimbulkan resiko, karena belum tentu tiap daerah mengalami hal yang sama. “Kita tidak boleh ambil resiko karena spot-spot daerah

Pelindo I Belawan Salurkan Pinjaman Untuk UKM Dan Koperasi Rp410 Juta MEDAN (Waspada): PT Pelabuhan Indonesia I (Persero) Cabang Belawan memasuki awal tahun 2011 kembali menyalurkan dana pembinaan usaha kecil dan menengah (UKM) dan Koperasi yang menjadi mitra binaan Rp410 juta. Humas Pelabuhan Cabang Belawan Azmi menjelaskan, Jumat (4/2), penyerahan bantuan pinjaman yang berbunga lunak ini merupakan program lanjutan yang diperoleh dari pembagian keuntungan hasil operasional pelabuhan. Untuk awal tahun ini diberikan kepada 12 pengusaha yang menjadi mitra binaan, di ruang rapat Tacoma Belawan, Kamis (31/1). Manajer Keungan Diehl Ardianto, atas nama General Manajer Pelabuhan Cabang Belawan Syahputra S saat pemberian pinjaman lunak men-

jelaskan, dasar pemberian dana pinjaman ini merupakan penyaluran bergulir, sehingga kelancaran menyalurkan kepada calon peminjam berikutnya tergantung dari kelancaran pembayaran para mitra binaan yang mendapatkan sebelumnya. Diehl mengingatkan apabila 3 bulan berturut turut mitra menunggak maka proses penagihannya diserahkan kepada Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) dimana biaya penagihan itu akan ditanggung mitra penunggak. Asisten Manajer PKBL Cabang Belawan Fatimah Zuhri menambahi keterangan Manajer Keuangan, pinjaman lunak ini mer upakan pr ogram berkelanjutan sesuai Peraturan Menteri Negara BUMN No. PER-05/MBU/2007 Tentang Program Kemitraan BUMN

dengan UKM dan Program Bina Lingkungan dan Surat Direktur Keuangan Pelindo I yang menegaskan program ini merupakan bentuk kepedulian Pelindo I kepada masyarakat lingkungannya. Usaha yang mendapat pinjaman lunak diantaranya usaha makanan ringan, pedagang pengecer, rias pengantin, usaha listrik dan usaha rumah kost. Setiap mitra binaan mendapat bantuan pinjaman lunak Rp20 juta sampai Rp50 juta. Batas waktu pengembalian pinjaman 36 bulan berbunga rendah 6 % per tahun. Mitra juga diberikan masa tenggang pelunasan 3 bulan pertama saat pinjaman diterima. Penyaluran dana bantuan lunak ini disaksikan Notaris Risna Rahmi Arifa, SH yang menyampaikan tentang aspek legalnya.(m35).

Pj. Wako T.Tinggi: Bank Sumut Berperan Dorong Perekonomian Daerah TEBINGTINGGI ( Waspada): PT Bank Sumut Cabang Tebingtinggi mengadakan penarikan nomor Undian Tabungan Martabe Bank Sumut Priode-II tahun 2010 WilayahII (Tebingtinggi, Lubukpakam, Sei Rampah, Binjai dan Stabat), Rabu (2/2) di Anjungan Sri Mersing Lapangan Merdeka Jalan Sutomo Tebingtinggi, memperebutkan hadiah 21 unit televisi LCD 32" merk LG, 2 unit sepeda motorYamaha Mio serta hadiah grand-price 1 unit mobil Toyota Avanza. Hadir dalam acara tersebut Penjabat (Pj) Walikota Tebingtinggi H Eddy Syofian Purba, Waka Polresta Tebingtinggi Kompol Safwan Khayat SH, Sekdako H Hasbi Budiman, Direktur Pemasaran dan Syari’ah PT Bank Sumut Zainil Har, Pinca Bank Sumut Tebingtinggi H Khairil Anwar, Pinca Bank Sumut Syari’ah H Syawaluddin Harahap para Pimpinan Cabang Bank Sumut Wilayah-II serta ratusan nasabah Bank Sumut. Pj Walikota Tebingtinggi Eddy Syofian mengatakan, peranan Bank Sumut untuk pembangunan daerah sangat strategis dalam mendorong roda perekonomian dan pembangunan serta sebagai salah satu sumber pendapatan daerah dalam meningkatkan taraf

hidup rakyat. “Banyaknya jumlah penabung di Bank Sumut Wilayah II mencapai 108.304 nasabah dengan uang tabungan sebesar Rp605,307 miliar, tentunya menjadi kebanggaan tersendiri bagi pemerintah daerah, karena cukup dipercaya dan didukung oleh managemen baik serta pelayanan prima terhadap nasabahnya”, ujar dia. Khusus Bank Sumut Cabang Tebingtinggi, lanjut Syofian, peranannya untuk Pemko Tebingtinggi selama ini sudah dirasakan secara langsung yang salah satunya dipercaya sebagai penyalur kredit UKM Dana Bergulir melalui Dinas Koperasi, Perindustrian dan Perdagangan (Diskoperindag), “Sejak 2003 hingga 2010, dana bergulir sudah disalurkan sebesar Rp9,776 miliar kepada 1.273 nasabah UKM, dana bantuan ini membantu para pengusaha kecil di Kota Tebingtinggi,” jelasnya. Direktur Pemasaran dan Syari’ah PT Bank Sumut, Zainil Har dalam sambutannya mengatakan, PT Bank Sumut terus menyempurnakan diri baik dari segi fitur maupun layanan sesuai dengan kebutuhan dan keinginan masyarakat di Sumut. “Salah satu keuntungan Tabungan Martabe para nasabah secara otomatis dilindungi oleh

asuransi jiwa tanpa dibebankan sedikit pun kepada nasabah, kemudian tingkat suku bunga bersaing, kemudahan dalam berbagai macam fitur (produk perbankan) serta penarikan nomor undian dilakukan setahun dua kali”, katanya. Disamping itu, tambahnya, saat ini Bank Sumut telah memiliki 24 kantor cabang konvensional, 4 kantor cabang syari’ah, 73 kancapem konvensional, 5 kancapem syariah, 7 kantor kas, 19 unit pelayanan mobile, 12 unit payment poin KPP Pratama dan 22 unit payment point mantab. “Bank Sumut juga menyediakan layanan internet banking, ATM Bersama dan BPD-Net Online yang bisa mengirim kepada seluruh jaringan BPD (Bank Pembangunan Daerah) di Indonesia,” papar Zainil Har. Pemenang hadiah 2 unit Yamaha Mio masing-masing nasabah Kancapem Galang no. rekening 118.0204.008444-0 dan nasabah Kancapem Perbaungan dengan no. rekening 301.0204.005827-3. Sedangkan nasabah pemenang 21 unit televisi LCD 32" LG tersebar di 5 kantor cabang dan 9 kancapem Bank Sumut Wilayah II meliputi Kanca Tebingtinggi, Lubukpakam, Sei Rampah, Binjai dan Stabat. (rel/a09)

itu belum tentu menggambarkan secara nasional kita kan

melihatnya secara nasional,” tandasnya.(okz)

Bapepam Godok Aturan Perusahaan Penjaminan Untuk Pemda JAKARTA (Waspada): Biro Pembiayaan dan Penjaminan Bapepam-LK tengah menggodok sebuah aturan agar tiap-tiap pemerintah daerah di Indonesia bisa mendirikan sebuah perusahaan penjaminan. “Kita tengah menggodok sebuah aturan agar tiap-tiap Pemda di Indonesia bisa mendirikan sebuah perusahaan penjaminan,”ungkap Kepala Biro Pembiayaan dan Penjaminan Bapepam-LK Ikhsanudin di kantor Bappepam-LK, Jakarta, Jumat (4/2). Ikhsan menambahkan,perusahaan penjaminan di Indonesia ada dua macam, yaitu perusahaan penjaminan non produktif, dan perusahaan penjaminan produktif. Sementara di Indonesia baru ada empat perusahaan penjaminan, yaitu Jaminan kredit Indonesia (Jamkrindo), Penjaminan Kredit Pengusaha Indonesia (PKPI), Jamkrida Jatim, dan Jamkrida Bali. Dia melanjutkan sejumlah Pemda di Indonesia hanya memiliki modal Rp5-10 miliar untuk mendirikan sebuah perusahaan penjaminan. Padahal, idealnya untuk mendirikan sebuah perusahaan penjaminan dibutuhkan dana paling sedikit Rp25 miliar,dan itu pun hanya untuk pegawai sebanyak dua orang, direksi dua orang dan komisaris dua orang. “Jika modalnya kurang dari itu, jika terkena klaim perusahaan bisa ambruk,” pungkasnya. Namun terkait hal itu dia mengaku masih menunggu keputusan dari Kementerian Keuangan terkait berapa modal yang harus ada untuk mendirikan sebuah perusahaan penjaminan. “Sampai saat ini kita tunggu saja seperti apa keputusan kemenkeu mengenai hal ini,”ungkap Ikhsanudin. (okz)

PemerintahKuatirKonsumen Lari Ke Premium JAKARTA (Waspada): Pemerintah menyatakan kenaikan harga bahan bakar minyak non subsidi jenis Pertamax dikhawatirkan akan menyebabkan masyarakat kembali beralih menggunakan Premium. Akibatnya, anggaran negara bisa membengkak. “Memang, Pertamax masuk wilayah komersial. Jangan sampai jika harga Pertamax terlalu tinggi, semua beralih ke Premium,” kata Menteri Koordinator Bidang Perekonomian, Hatta Rajasa, di Jakarta, Jumat (4/2). Hatta mengatakan, pemerintah dan Dewan Perwakilan Rakyat selama ini sepakat menjaga agar volume Premium tidak bertambah tahun ini. Dengan pertimbangan itu, pemerintah berupaya agar tidak ada pembengkakan volume subsidi melalui program pembatasan Premium. “Kami punya pemikiran, yang kaya, sudah lah jangan lagi menggunakan minyak-minyak bersubsidi,” kata dia. Dia menyadari Pertamax termasuk jenis bahan bakar minyak yang harganya tidak diatur pemerintah, karena masuk dalam ranah komersial. Per 3 Februari 2011, harga Pertamax di wilayah Jakarta awalnya sempat naik menjadi Rp8.050, kini menjadi Rp7.950 per liter. (vvn)

Januari, Cadangan Devisa Turun Jadi 95,3 M Dolar AS JAKARTA (Waspada): Posisi cadangan devisa pada Januari 2011 tercatat sebesar 95,3 miliar dolar AS atau setara dengan 6,3 bulan impor dan pembayaran utang luar negeri pemerintah. Angka tersebut cenderung menurun jika dibandingkan dengan cadangan devisa bulan Desember 2010 lalu yang mencapai 96,2 miliar dolar AS atau setara dengan 7,1 bulan impor dan pembayaran utang luar negeri. Demikian disampaikan Kepala Biro Direktorat Perencanaan Strategis dan Hubungan Masyarakat Difi A.Johansyah dalam siaran pers hasil RDG BI, Jumat (4/2) Meskipun mengalami penurunan, namun transaksi berjalan pada triwulan I-2011 diperkirakan masih akan mencatat surplus yang cukup besar. Transaksi modal dan finansial (TMF) juga diperkirakan mencatat surplus besar, terutama didukung oleh kuatnya aliran modal masuk investasi langsung (PMA). "Secara keseluruhan, Neraca Pembayaran Indonesia (NPI) pada triwulan I-2011 diperkirakan masih akan mencatat surplus yang besar," jelasnya. Sebelumnya, Bank Indonesia (BI) memperkirakan neraca pembayaran pada 2011 akan mengalami surplus sekira 16,4 miliar dolar AS dengan cadangan devisa mencapai 112,6 miliar dolar AS pada akhir tahun 2011. "Penanaman modal langsung (FDI) diperkirakan akan berperan lebih besar dalam komposisi arus modal masuk. Secara keseluruhan, neraca pembayaran pada 2011 diprakirakan akan mengalami surplus 16,4 miliar dolar AS, dengan cadangan devisa mencapai 112,6 miliar dolar AS pada akhir 2011,” ungkap Gubrenur BI Darmin Nasution beberapa waktu lalu. (okz)


B12 07:00 Film Keluarga Brother Bear 0 9 : 0 0 D A H S YAT Weekend 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang Ada CInta Di Hati 14.30 Si Kecil Berhati Besar 15.00 Kabar Kabari 16.00 BEDAH RUMAH 17:00 Seputar Indonesia 17:30 Lagu CInta Nirmala 19:30 Putri Yang Ditukar 22:30 BOM: Daredevil


07:00 Inbox 09:00 Liputan 6 Terkini 09:03 Hot Shot 10:00 SCTV FTV Pagi 12:00 Liputan 6 Siang 12:30 SCTV FTV 14:30 Status Selebriti 15:00 Get Married Series 17:00 Liputan 6 Petang 17:30 Uya Emang Kuya 18:00 Islam KTP 21:00 Arini 2 22.30 Liputan 6 Terkini 22:33 SCTV Sinema : Tentang Cinta

07.00 Animasi Spesial 08.30 Santapan Nusantara 09.00 Cerita Pagi 10.00 Cerita Pagi 11.00 Jendela 11.30 Sidik Kasus 12.00LAyarKemilau 14.00 Layar Spesial 16.00 Lintas Petang 16.30 Zona Juara 17.30 Animasi Spesial 18.00 Upin Ipin 18.30SinemaSpesial 19.30 Keluarga Z 2 0 . 0 0 Ta w a r Tawaran Tawa 21.00 Sinema Malam 23.30 Jendela 00.00 Lintas Malam

07.00 Star Kids 08.00 Sinema Pagi 10.00 Kabut Cinta 11.30 Topik Siang 12.00 Klik! 13.00 Mantap 14.00 Buaya Darat 15.00 Djarum Indonesia 17.00 Topik Petang 17.30 Katakan Katamu 18.30 Super Family 19.30 Super Deal 2 Milyar 21.00 World Most Amazing Video 22.00 Mohon Ampun Aku 23.00 Telisik 00.00 Topik Malam

07.00 Sinema Keluarga 09.00 KiSS Plus 10.00 Arti Sahabat 12.00 FTV Siang 14.00 Fokus 15.00 Liga Premier Indonesia 17.00 1 Lawan 100 18.00 Dia Anakku 19.00 Nada CInta 20.00 Cinta Fitri Season 2 21.00 Just Dance 22.00 Take A Celebrity Out 00.00 Liga Italia serie A 01.00 Fokus Malam

07.05 Editorial Media Indonesia 08.05 Agung Sedayu 09.30 Fashion Gallery 10.30 Metro Xin Wen 11.05 Oprah Winfrey 12.05 Metro Siang 13.30 Metro Expedition 14.30 Destroyed In Second 16.05 Super Nanny 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Metro Files 20.05 Metro Exposed 21.05 Top Nine News 21.30 World Cinema 22.05 World Cinema 23.30 Metro Sports

WASPADA Sabtu 5 Februari 2011

07.30 Kuliner Pilihan 08.00 Gula Gula 08.30 Koper Dan Ransel 10.00 Ala Chef 11.00 Insert 12.00 Hidup Ini Indah 12.30 Ngulik 13.00 Peppy The Xplorer 14.30 Kenari 16.00 Gaul Bareng Bule 16.30 Investigasi Selebriti 17.00 Reportase Investigasi 1 8 . 1 5 Te r m e h e k Mehek 19.00 Indonesia Mencari Bakat 2 22.00 Bioskop 24.00 Bioskop 01.00 Sinema Dinihari

06.30 Apa Kabar Indonesia 09.00 Property Agung 09.30 Tinju Legendaris 10.30 Soccer One 11.00 Prediksi 12.00 Kabar Siang 13.00 Bangkit Indonesiaku 15.00 Documentary Indonesia 16.00 News Bus 17.00 Tepi Jaman 17.30 Kabar Petang 19.00 Tokoh 20.00 Apa Kabar Indonesia 21.00 Bumi Dan Manusia 22.00 Ketemu Pepeng 23.00 Kabar MAlam 23.50 Liga Spanyol (live) Almeria vs Espanyol

08.30 The Penguin 09.00 One Piece 10.00 Danamon Semangat Bisa 10.30 Turtels Can Fly 12.30 Kabaret Show 13.30 Genie 14.00 One Cubed 14.30 Petualangan Panji 15.00 Ill Feel 15.30 Ugly Betty 16.30 Berita Global 17.00 Spongebob 18.00 Super Hero Kocak 19.15 Barclays Premier League 21.30 Tom Yum Gong

07.30 Selebrita Pagi 08.00 Tom & Jerry 09.00 Scooby Doo 10.00 Mariam Mikrolet 11.00 Rahasia Sunnah 11.30 Redaksi Siang 12.00 Selebrita Siang 13.00 Laptop Si Unyil 14.30 Dunia Bintang 15.00 Koki Cilik 16.00 Jejak Petualang 16.30 Redaksi Sore 17.00 Asal Usul Fauna 18.00 Selebrita Sore 18.30 Pintu Kejutan 19.30 On The Spot 20.00 Opera Van Java 22.00 Bukan Empat Mata 23.30 Mata Lelaki 00.00 Jam Malam*


Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Agnes Kian Gigih Wujudkan Impian

Presiden Perancis Nicolas Sarkozy (kanan) bersama Ibu Negara Carla Bruni saat mengunjungi sebuah acara. (Ant/rtr)

Carla Bruni Gebrak Pembukaan Festival Film Cannes Film Midnight in Paris, garapan sutradara kondang Woody Allen, dengan tampilan mempesona akting Carla Bruni-Sarkozy, telah dipilih sebagai film pembuka festival Cannes 2011. Ingin lebih menaikkan sisi

dramatis, Woody Allen membantah rumor bahwa Carla Bruni telah memerlukan 30 take terpisah saat pengambilan adegan film Midnight in Paris, seperti dikutip “Dia (Bruni) telah berpengalaman,” kata Allen. Midnight in Paris telah membuat para punggawa di festival film Cannes kepincut, terlebih penampilan Carla Bruni yang mendulang banyak decak

kagum. Film itu mengisahkan usaha perjalanan sebuah keluarga ke ibukotaPerancisyangmelibatkan OwenWilson, Rachel McAdams, Marion Cotillard dan Michael Sheen. “Midnight in Paris tampil bagaikansuratcintakeParis,”kata direktur festival Thierry Frémaux. “Inilah film garapanWoody Allen yang mengambil dan melihat lebih dalam isu-isu sentral soal

hubungan kita dengan sejarah dan pesona seni. Filmnya ini mengungkapkan seluruh inspirasinya.” Filminijugamemikatlantaran menampilkan debut akting dari CarlaBruniyangberperansebagai direktur museum Paris. Festival Film Cannes ke-64 berlangsung pada 11-22 Mei, dengan dewan juri dikomandani aktor Amerika Robert De Niro.(ant)

Spider-Man Peran Impian Andrew Garfield SEJAK Sony Pictures mengumumkan Andrew Garfield menjadi Peter Parker si manusia laba-laba dalam film produksi MarkWebb mendatang, Garfield mengaku senang bukan kepalang. Pengumumaninisempatjadi kejutan karena beberapa media tak memperkirakan Andrew Garfield bakal menerima kehormatan ini. Andrew Russell Garfield, nama asli aktor ini, lahir di Los Angeles, California, pada 20 Agustus1983.Diaaktorberkebangsaan Amerika-Inggeris, kerap tampil di radio, teater, film, dan televisi. Andrew Garfield sangat puas dan senang bisa memerankan tokohPeterParkerdifilmkeempat Spider-Man besutan Marvel Comics. Itu karena dia selalu berangan-angan berakting menjadi sang alter-ego superhero itu. Bahkan,diasukaberdebatdengan sahabatnya tentang siapa paling hebat akan membuat jaring labalaba nanti. Garfield akan memerankan Peter Parker dan Spider-Man di bawah arahan s u t r a d a r a M a r c We b b . Sebelumnya, ketiga film SpiderMan disutradarai Sam Raimi. Menurut MarcWebb, walau masih dianggap pendatang baru buat kebanyakan orang, Garfield sangat cocok memerankan Peter Parker. Sebagai aktor, Garfield memiliki talenta luar biasa dan mempunyai beragam kombinasi yang menjadikannya pantas memerankan Peter. “Dia memiliki kombinasi karakter unik, antara kecerdasan, jenaka, dan sangat manusiawi. Ingat kata-kata saya, Anda akan menyukai Andrew sebagai Peter Parker,” kata Webb. Penilaian serupa juga disampaikan produser tiga film Spider-Man sebelumnya, Avi Arad. “Kamipercayatelahmenemukan sosok yang tepat dan cocok bagi karakter ini di masa mendatang,” kata Avi.

Andrew Garfield/

Aktor The Social Network ini terpilih membintangi prequel terbaru serial, mengambil alih peranitudariTobeyMaguireyang berhenti tahun lalu setelah tiga film Spider-Man. Karier Andrew Garfield dalamduniafilmmemangbelum terlalu panjang. Ia mulai terjun ke dunia film saat membintangi film berjudul Lions For Lambs pada2007.Iajugasempatmenjadi salahsatupemeranfilmTheOther Boleyn Girl dan The Imaginarium of Doctor Parnassus. Tahun 2010 lalu Andrew Garfield membintangi tiga judul film: Never Let Me Go, The Social Network, dan I’m Here. Dengan track record tak terlalu panjang itu, pantaslah jika banyak media terkejut pada keputusan Sony

Pictures. Andrew Garfield memang memukau dalam film The Imaginarium of Dr Parnassus. Walau tergolong pendatang baru, Garfield mampu mengimbangi akting Heath Ledger, Jude Law, Johnny Depp, dan aktor senior Christoper Plummer. Garfield mengakui mendapatkan kasting untuk peran tersebut merupakan nasib mujur. Dia sering berlatih memerankan peran-peran superhero dengan sahabatnya Terry. Keduanya sama-samabersikeraskalausalah satu diantara mereka kandidat sempurna untuk memerankan superhero itu. Garfield bertutur kepada The Sun,“Apapunterjadidalamhidup ini terhadapku, aku tak akan

pernah melupakan kata-kata ini (kutipan dari dialog Peter Parker), ‘Dengankekuatanhebatyangada padaku, maka tanggungjawab besar pun akan datang’. Ini adalah berkahku, kutukanku. Siapakah aku? Aku Spider-Man. “Aku bercermin memperagakan peran itu lagi dan lagi. Aku danTerry berdiskusi tentang interpretasi peran itu. Dia terusterusan bilang, ‘Tidak, tidak, Kau tidak akan pernah bisa menjadi Spider-Man. Akulah yang akan jadi Spider-Man.’ “Makanya begitu aku mendapat pemberitahuan kalau akulah mendapat peran itu, langsung saja kuemail dia, ‘Hey sobat, ingat enggak enam tahun lalu ketika kita ngobrol-ngobrol tentang siapa yang jadi SpiderMan? Kau ternyata tidak mendapatkannya!’ “Kami tertawa dan terus tertawa-tawa. Namun kami yakin terobsesi dengan film tersebut.” Garfield terlahir dari ibu berkebangsaan Inggeris berasal dari Essex dan ayahnya warganegara Amerika dari California. Keluarganya pindah ke Inggeris ketika dia berusia tiga tahun. Garfield pemelukYahudi dan dibesarkan dalam keluarga berekonomi menengah. Orangtuanya mengelola usaha bisnis desain interior kecil-kecilan. Ayahnya, Richard, akhirnya menjadi pelatih kepala Klub RenangGuildfordCity,sedangkan ibunyaasistenpengajardisekolah keperawatan. Sampai saat ini bagian keempat Spider-Man akan menjadi reboot dari serial ini masih belum mendapatkan judul pasti. Yang bisa dipastikan, film ini akan disutradarai Marc Webb berdasarkannaskahdikerjakanJames Vanderbilt. Film diproduksi Columbia Pictures dan Marvel Studios ini akan dibuat dalam format 3D dan akan mulai diedarkan pada 3 Juli 2012.(ananova/ajekoi)

KENDATI langkah go-internasionalnya tak berjalan mulus sesuai target dan harapan, biduanita multitalenta Agnes Monica, tak sedikit pun patah semangat. Lewat album terbarunya bertajuk The Best “Agnes is My Name” (AiMN) hasil kolaborasi KFC Indonesia,SwaraSangkarEmasdan Aquarius Musikindo , kian gigih mewujudkan impian lamanya sukses di industri musik pop dunia. “Sungguh tak gampang bagi saya menggapai sukses menjadi penyanyi internasional. Yang terpenting hingga detik ini saya tak pernah patah semangat kendatiharusmelaluiperjuangan panjang dan berliku. Apalagi mengiringi peluncurankompilasi album the best dengan tembang andalan bertitel Paralyzed dan Karena Kusanggup, jalan go-internasional bagi saya kian terbuka lebar. Jadi, wajar kalau dua bulan terakhir saya kian gigih berjuang mewujudkan impian lama tersebut,” tandas Agnes Monica kepadaWaspada di KFC Kemang – Jakarta Selatan baru-baru ini. Menurut mantan penyanyi cilik popular yang diera medio tahun 1990-an sukses merilis tiga album anak-anak Si Meong,Yess! dan Bala-Bala ini, jalannya untuk go-internasional terbuka lebar lantaran baru-baru ini dirinya telah menanda-tangani kontrak dengan Sony/ATV Music Publishing yang saham terbesarnya dimiliki keluarga Michael Jackson dan Sony.

“Saya juga menggandeng Beto Cohen, produser musik, pencipta lagu, remixer dan sound engineer berpengalaman yang pernah bekerjasama dengan penyanyi sekaliber Madonna. Sebab, lewat Sony/ATV – perusahaan yang pernah menangani publishing lagu-lagu artis musik kondang dunia seperti The Beatles, Bob Dylan, Neil Diamond danDianeWarrentersebut,album rekaman terbaru saya akan dirilis secara internasional di Amerika dan Inggris,” tandas Agnes. Album The Best AiMN bermaterikan koleksi karya lagulaguterbaikAgnesMonicaselama karir bermusik peraih penyanyi terbaik Asia Song Festival di Soul – Korea Selatan tahun 2008 dan 2009 ini. Dari kantung album perdana And The Story Goes (2003) dicuplik lagu-lagu hits Jera ciptaan Melly Goeslaw dan Bilang

Agnes Monica Saja (ciptaan Ari Bias). Ada pula lagu Tak Ada Logika (Yudis Dwikorana & Yoyo), Tanpa Kekasihku dan Cinta di Ujung Jalan (Dewiq) diambil dari album Whaddup A’..?! (2005).

Kemudian lagu Godai Aku Lagi (Agnes), Matahariku (Yuan Passer), singel Teruskanlah (Pay dan Dewiq) serta Janji-janji (Dewiq/ Arie SW) dari album Sacredly Agnezious (2009). * (AgusT)

Trans TV Gelar Audisi The Real Reality Show TRANS TV menggagas acara The Real Reality Show dengan menggelar audisi dimulai hari ini Sabtu (5/2) di Fakultas Farmasi USU Jalan Almamater Medan. Menurut Henny MulyaniExecutive Produser didampingi Adit H, Produser serta Sulistyohadi-Marketing Public Relation saat temu pers di Garuda Plaza Hotel Medan Jumat (4/2) menyebutkan, acara ini telah sukses dilakukan di sejumlah negara

seperti Amerika Serikat, Australia, Inggris,Filipina,Indiadanlainnya. “Program ini belum diberitahu judulnya, agar lebih surprise”, tuturnya. Audisi digelar di empat kota masing-masing Bandung, Medan, Surabaya dan Jakarta tidak mentargetkan jumlahpesertayangmasuknominasi. Setelah mendaftar kemudian diinterview, akan terlihat karakter atau keunikan seseorang. “Kami mencari peserta seleksi memiliki

karakter unik dan setiap pemenangdimasing-masingkotaakan dilaga di final audisi dilaksanakan di Jakarta. The Real Reality Show bukan mencari orang yang the best. Tetapi sifat unik peserta yang bisa ditonjolkan khususnya dari sisi hiburan.“Tentumenjadidayatarik tersendiri jika dalam satu festival, berkumpul keunikan-keunikan peserta dari berbagai kota,” kata Henny.(m19)

Kartu As SoundblASz, Konser Musik Rame-Rame Bersama Kotak GRUP band Kotak bakal menguncang publik Medan Sabtu (5/2) malam di Lapangan Merdeka dalam konser bersama Kartu As di event Soundblasz Konser Musik Rame-Rame. Grup musik bergenre modern rock beranggotakan Tantrivokal, Icez-bassit, Cella-gitar dan Posan-drummer ini akan menyuguhkan tembang-tembang hits mereka bersama 320 anggota School Community serta penggemar Kotak lainnya. Menurut HerrybertusBranch Manager Medan didam-

pingi Hadi Sucipto-Manager Corporate Communications Area Sumatera serta Kurnia Hadi menyebutkan Jumat (4/2), Event Kartu As Sounblasz Konser Musik Rame-Rame ini merupakan konser puncak dilakukan pada empat kota, Medan, Duri, Pekanbaru dan Palembang. Pada konser kali ini juga akan disuguhkansesuatuyangberbeda, dimana akan ditampilkan kelompok Band merupakan anggota Telkomsel School Community. Sebelumnya event Soundlasz ini telah dilakukan di

70 kota di Sumatera sejak tanggal 5 Maret 2010. Bagi pelanggan telah bergabung di Telkomsel School Community (TSC) yang mempunyai hobby musik berkesempatan mengikutimeetandgreetdengan para personel Band Kotak sebelum acara berlangsung. Sementara penggemar Kotak lainnya ingin menyaksikan konser ini dapat membeli ticket dipintu masuk di lokasi acara dengan harga Rp20.000, dan setiap pembelian ticket akan mendapat perdana kartu As.

Herrybertus mengharapkan, melalui kegiatan ini akan terjalin kedekatan emosional Telkomsel dengan pelanggannya maupun sesama anggota komunitas Telkomsel. Selain memberikan kesempatan kepada band pelajar yang merupakan anggota Telkomsel School Community untuk tampil pada acara ini, agar mereka memiliki wadah untuk menyalurkan bakatdanmenunjukkankemampuan musikal mereka dihadapan ribuan penonton. (m19)

Herrybertus-Branch Manager Medan (tengah) didampingi Hadi Sucipto-Manager Corporate Communications Area Sumatera (kiri) serta Kurnia Hadi saat memberikan penjelasan seputar konser band Kotak di Lapangan Merdeka Medan Sabtu (5/2) malam ini

Waspada, Sabtu 5 Februari 2011  

Waspada daily

Waspada, Sabtu 5 Februari 2011  

Waspada daily