Page 1

Pria Barumun Takut Keluar Rumah PADANGLAWAS (Waspada): Pasca bentrok berdarah antara warga dengan polisi di Mapolsek Barumun Tengah, berdampak kepada ketakutan warga pria di Desa Aek Buaton, Kec. Aeknabara Barumun Kab. Padanglawas keluar rumah.

Lanjut ke hal A2 kol. 7

WASPADA Demi Kebenaran Dan Keadilan

SABTU, Pon, 30 Maret 2013/18 Jumadil Awal 1434 H

No: 24178 Tahun Ke-67

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 20 Halaman (A1-12, B1-8)

Harga Eceran: Rp2.500,-

Polisi Tetapkan 21 Tersangka PBB: Penguasa Myanmar Terlibat

17 Tersangka Pembunuh Kapolsek Diserahkan Ke Poldasu MEDAN (Waspada): Polres Simalungun menyerahkan 17 dari 21 tersangka penganiaya Kapolsek Dolok Pardamean, Polres Simalungun Kompol (Anumerta) Andar Siahaan ke Poldasu untuk proses pemeriksaan, Jumat (29/3). Kapolda mengatakan, tujuan pemeriksaan di Poldasu agar lebih netral dan menghindari intervensi. “17 dari 21 tersangka yang diserahkan ke Poldasu untuk menghindari adanya intervensi dari masyarakat, karena itu pemeriksaan dilakukan di Poldasu,” kata Wisjnu seusai memimpin pemakaman Kompol (Anumerta) Andar di Taman Makam Pahlawan Bahagia Jln. Sisingamangaraja, Medan, Jumat sore. Menurut Kapolda, empat ter-

sangka lain yakni IS,MP, US dan WS masih menjalani pemeriksaan di Polres Simalungun. Awalnya, kata Kapolda, pihaknya mengamankan 103 orang. Setelah dilakukan pemeriksaan, 21 orang dinyatakan tersangka dan yang lainnya dipulangkan karena tidak terbukti. Dari 21 tersangka yang ditahan 17 orang. Kapolda mengatakan, pelaku-pelaku akan dikenakan

Lanjut ke hal A2 kol. 1

Waspada/Surya Efendi

POLISI menggiring 17 tersangka pembunuh Kapolsek Dolok Pardamean, Kab. Simalungun ke rumah tahanan Mapoldasu, Jumat (29/3).

YANGON, Myanmar (AP): Utusan khusus Perserikatan Bangsa-Bangsa (PBB) yang mengurus masalah Myanmar mengatakan, Pemerintah Myanmar terlibat dalam pembantaian yang dialami etnis Rohingya. Selain itu ada dugaan bahwa kerusuhan terbaru di Meikhtila telah direncanakan. “Saya memperoleh laporan bahwa Pemerintah Myanmar terlibat dalam beberapa tindakan kekerasan,” ujar utusan PBB Tomas Ojea Quintana, seperti dikutip Press TV, Jumat (29/3). Quintana menyebutkan, keterlibatan pemerintah itu berlangsung selama kerusuhan terbaru yang terjadi di Mekhtila 20 Maret lalu. Quintana mende-

sak agar Pemerintah Myanmar mengambil langkah untuk mencegah aksi kekerasan menyebar ke wilayah lain dari Myanmar. “Kerusuhan semacam ini bisa mempengaruhi proses reformasi. Polisi dan pihak militer (Myanmar) bisa dianggap telah melakukan pelanggaran HAM,” lanjut Quintana. Eskalasi terbaru yang terjadi di Meikhtila menyebabkan lima buah masjid terbakar. Sementara rumah warga juga hangus terbakar oleh kalangan ekstrimis Budha di negeri tersebut. Beberapa jasad yang hangus juga tampak di jalanan

Lanjut ke hal A2 kol. 3

Rp600 Juta Lewong

Aliansi Ormas Islam Sumut Mengutuk

MEDAN (Waspada): Aksi penipuan dengan modus baru terjadi di Medan. Korbannya Kalwant Singh, 57. Dia kehilangan uang 25.000 ringgit Malaysia dan 57.000 dolar Singapura yang seluruhnya setara dengan Rp600 juta. Informasi Waspada peroleh, peristiwa itu terjadi Kamis (28/3) siang dan hari itu juga korban Kalwant Singh penduduk Jl. Karya Bakti, Lk VII, Pangkalan Masyhur, Kec. Medan Johor, melaporkan peristiwanya ke Mapolsek Medan Baru. Dalam laporannya korban

MEDAN (Waspada): Aliansi Ormas Islam Sumatera Utara mengutuk keras tindakan umat Buddha di Myanmar yang terus memburu dan membunuh kaum muslim di negara tersebut dan menghancurkan masjid serta membakar puluhan ribu rumah muslim. Tindakan biadab ini sama artinya dengan pembersihan muslim. “Sebagai pemimpin negara yang dihuni mayoritas muslim di seluruh dunia, kami mendesak Presiden Susilo Bambang Yudhoyono agar menyatakan sikap protesnya kepada

Kejahatan Modus Baru Di Medan

menyebutkan, sebelumnya menerima telefon dari seorang pria mengaku bernama Ir. Jaka Hermanto yang hendak membeli mata uang asing. Dalam perbincangan melalui telefon, korban diduga kena hipnotis karena dia kemudian menyuruh karyawannya Mihardi bersama anaknya Harpret Singh mengantarkan sejumlah uang ringgit dan dolar Singapura kepada Jaka Hermanto di salah satu ruangan yang ada di lantai V kantor Bank Sumut.

Lanjut ke hal A2 kol. 6

Waspada/Arianda Tanjung

SEJUMLAH Personil Brimob melakukan tembakan salvo sebagai pengiring pemakaman Kapolsek Dolok Pardamean AKP Andar Siahaan saat akan dimakamkan di Taman Makam Pahlawan (TMP) Bahagia Medan, Jumat (29/3).

pemerintah Myanmar untuk segera menghentikan pembantaian umat muslim di negeri yang mayoritas Buddha itu,” tegas Drs H Leo Imsar Adnans kepada Waspada Jumat (29/3) di Medan menanggapi kebiadaban umat Buddha terhadap seluruh umat muslim di Myanmar. Menurut Leo, sikap tegas dari Presiden SBY tersebut sangat beralasan, apalagi tindakan keji Pemerintah Myanmar dan umat Buddha sangat

Lanjut ke hal A2 kol. 6

Selamat Jalan Anggotaku...

Waspada/Arman Konadi

WAKIL Direktorat Reserse Narkoba Polda Aceh AKBP Sigit Kumardjoko memperlihatkan barang bukti dan dua dari empat tersangka sabu di Mapolda Aceh, Jumat (29/3). Petugas mengamankan barang bukti sabu seberat 300 gram senilai Rp400 juta.

DERAP langkah pengiring jenazah Kompol (Anumerta) Andar Yonas Siahaan, 51, memasuki pemakaman Taman Makam Pahlawan (TMP) Bahagia Jln. Sisingamangaraja Medan, Jumat (29/3). Jam saat itu menunjukkan pukul 15:45, tetapi matahari masih terlihat garang menyengat, seakan menanti kedatangan peti jenazah berbalut bendera merah putih itu. Hari pemakaman bersamaan dengan peringatan paskah bagi umat Nasrani, dan isak tangis keluarga mulai tumpah. Diiringi musik pengiring kematian, perlahan peti jenazah diturunkan di pinggir liang lahat. Untuk sesaat semua yang hadir terdiam, menanti ucapan belasungkawa Kapolda Sumut Irjen Pol. Wisjnu Amat Sastro yang memimpin upacara pemakaman. Seperti tak sanggup berkata-kata, Kapolda meminta keluarga yang ditinggalkan ikhlas. “Atas nama Kapolri saya mengucapkan belasungkawa terdalam, kita semua kehilangan beliau. Selamat jalan anggotaku,” kata Wisjnu sambil mengusap air matanya. Kapolda beberapakali berhenti bicara, dan terbata-bata menahan sedih saat menyampaikan ucapannya. Dia bahkan tidak menye-

lesaikan kalimat-kalimat duka yang tertulis di kertasnya. Tetapi air mata dan wajahnya yang memerah sudah menandakan kesedihan itu. Sebagai penghargaan Polri, Kapolsek Dolok Pardamean itu kemudian dinaikkan pangkatnya dari Ajun Komisaris Polisi menjadi Komisaris Polisi. Kapolda menambahkan, Andar Siahaan gugur dalam melaksanakan tugas. Dia dapat menjadi contoh bagi anggota polisi lainnya untuk memberantas praktik perjudian di Sumut. “Beliau salah satu prajurit terbaik Polri yang memegang teguh tugastugas kepolisian,” ujarnya. Sebelum peti jenazah dimasukkan ke liang lahat, 10 anggota Brimob yang semula mengangkat peti berbalut bendera merah putih, berjajar di dua sisi liang dan menembakkan tembakan salvo ke udara sebagai tanda penghormatan terakhir. Sementara istri dan tiga anak Kompol (Anumerta) Andar Siahaan tidak dapat menahan tangis ketika peti dimasukkan ke liang. “Selamat jalan amang (bapak),” kata mereka berderai airmata.

Lanjut ke hal A2 kol. 7

2 Polisi Aceh Edar Sabu BANDA ACEH (Waspada): Direktorat Reserse Narkoba Polda Aceh menangkap empat pria terkait kepemilikan narkotika jenis sabu. Dua di antaranya merupakan anggota Polri bertugas di Ditlantas Polda Aceh dan Mapolsek Darul Kamal. Dua pelaku yang diduga sebagai pengedar sabu merupakan warga Aceh Utara yakni, MA, 32, warga Desa DayahTuha, Kec. Syamtalira Bayu, Aceh Utara dan MR, 24, warga Desa Matang Rawa, Kec. Baktiya. Dari kedua pria yang bekerja sebagai pedagang dan tani ini, polisi mengamankan barang bukti sabu 300 gram atau senilai Rp500 juta. Sementara dari oknum polisi yang diduga sebagai pengguna sabu, polisi menyita barang bukti 0,5 gram sabu,

sebungkus daun ganja seberat 10 gram serta alat isap atau bong. Wadir Ditreserse Narkoba Polda Aceh AKBP Sigit Kusmardjoko didampingi Kabag Bin Opsnal AKBP Hery Moch Machfudhi mengatakan, polisi menangkap empat tersangka di lokasi terpisah. “Kalau yang warga sipil berawal dari tertangkapnya MA pada 25 Maret lalu di kawasan Lhoknga Aceh Besar dan petugas menemukan sabu 219 gram,” ujar Sigit. Menurutnya, dari hasil pengembangan polisi kemudian menjemput MR di rumahnya di Aceh Utara pada Selasa 26 Maret lalu dan menemukan barang bukti sabu 97,8 gram.

Lanjut ke hal A2 kol. 3

Al Bayan

Abad Kebangkitan

Gubsu: Jangan Terulang Lagi


GUBSU Gatot Pujo Nugroho memberi sambutan pada prosesi pemberangkatan jenazah almarhum Kompol Andar Siahaan dari rumah duka ke Taman Makam Pahlawan Jl. SM Raja Medan, Jumat (29/3).

GUBSU H Gatot Pujo Nugroho bersama ribuan pelayat hadir di rumah duka Alm AKP Andar Yonas Siahaan, Jalan Pintu Air IV Gang Kelapa Simalingkar B, Medan Johor, Jumat (29/3). Secara khusus Gubsu berpesan agar istri almarhum tegar menghadapi musibah untuk memberi semangat kepada ketiga putra-putrinya. Lanjut ke hal A2 kol. 6


JELANG KLB DEMOKRAT: Sejumlah kader dari berbagai DPC dan DPD Partai Demokrat seluruh Indonesia melakukan pendaftaran setibanya di arena Kongres Luar Biasa (KLB) Partai Demokrat di Hotel Inna Grand Bali Beach, Sanur, Bali, Jumat (29/3). Kongres untuk memilih ketua umum partai tersebut akan berlangsung 30-31 Maret 2013.

Loyalis Anas Tetap Melawan BALI (Waspada): Pemecatan Anas Urbaningrum dari jabatan Ketua Umum Partai Demokrat akan ditetapkan di dalam sidang paripurna Kongres Luar Biasa Partai Demokrat di Sanur, Bali, 30-31 Maret 2013. Sementara itu, pengurus daerah yang menyebut diri sebagai loyalis Anas tetap melawan. Demikian laporan wartawan Waspada Andy Yanto Aritonang dari Bali, Jumat (29/3), yang meliput KLB Partai Demokrat yang akan dibuka SBY di Inna Grand Bali Beach Hotel, Bali, Sabtu (30/3) pukul 13:00, dengan agenda utama KLB memilih ketua umum yang baru. “Surat pemecatan Anas akan ditandatangani Ketua Majelis Tinggi Partai Susilo Bambang Yudhoyono dan akan disepakati seluruh peserta KLB,” kata

HISTORY Sejarah Berdarah Di Stasiun KA Araskabu BANYAK generasi penerus—khususnya yang kurang berminat dengan sejarah tidak mengetahui sejarah heroik Stasiun Kereta Api Araskabu, Kec. Beringin, Deliserdang. Nama stasiun yang sebelumnya bukan untuk menaikkan serta menurunkan penumpang, melainkan sebagai tempat berpapasan kereta api agar tidak bertrabrakan, mulai mengemuka pada medio Juli 2006. Kala itu, mantan wapres Jusuf Kalla singgah di stasiun ini meninjau serta meletakkan batu pertama pembangunan Kualanamu International Airport (KNIA-Bandara Kualanamured). Semula bangunannya tak terlalu besar dengan lantai keramik, bermodal pengembangan dengan memanfaatkan lahan stasiun yang ada panjang sekira 200 meter dan lebar 50 meter, kondisi teranyar Stasiun KA Araskabu jelas berbeda dengan stasiun KA lainnya di Sumatera Utara. Maklum, dari stasiun inilah penumpang pesawat dapat melakukan check in di Bandara Kualanamu yang hanya berjarak 4 kilometer dari bandara termegah di Indonesia tersebut.

Oleh: Tgk. H. Ameer Hamzah Setiap seratus tahun akan lahir seorang mujaddid yang akan memperbaharui agama ini dari kejumudan dan keterbelakangan. (Dr. M Yusuf Qardhawy) ABAD ke-15 hijrah adalah abad kebangkitan Islam. Kita sudah melangkah selama 34 tahun dalam abad baru ini. Sementara tahun Masehi juga sudah 13 tahun memasuki abad barunya yakni abd ke-21. Kita harus yakin dan percaya bahwa abad kebangkitan Islam itu pasti akan datang. Islam bangkit untuk menyelamatkan manusia dari penipuan setan durjana. Islam mengajak manusia kepada jalan kebenaran, jalan Tuhan pencipta alam semesta.

Lanjut ke hal A2 kol. 6 Waspada/R Anwar

STASIUN KA Araskabu.

Syamsuddin, saksi sejarah.

Lanjut ke hal A2 kol. 2

Anggota Majelis Tinggi Partai Demokrat yang juga panitia pelaksana KLB Partai Demokrat Max Sopacua. Menurut Max, sejak menyatakan diri berhenti dari jabatan ketua umum pada 23 Febuari 2013, Anas sama sekali tak pernah menyerahkan surat pengunduran diri sebagai Ketua Umum Partai Demokrat. Atas dasar itu, Anas dianggap mengabaikan tugas dan tanggung jawab jabatannya di partai, selain penetapan status hukumnya sebagai tersangka kasus korupsi Hambalang. Untuk proses pemecatan itu sendiri, lanjutnya, Majelis Tinggi Partai Demokrat memandang tak perlu menghadirkan Anas di KLB.

Lanjut ke hal A2 kol. 3

Ada-ada Saja Desa Kontainer URBANISASI adalah masalah paling sulit diselesaikan. Masalah ini pun terjadi di China. Mahalnya harga sewa rumah di kota Shanghai memaksa para

Lanjut ke hal A2 kol. 3

Serampang Masih prihatin

WASPADA Demi Kebenaran Dan Keadilan


SEJUMLAH personil Brimob mengangkat peti jenazah Kapolsek Dolok Pardamean AKP Andar Siahaan saat akan dimakamkan di Taman Makam Pahlawan Medan, Sumut, Jumat (29/3).

SABTU, Pon, 30 Maret 2013/18 Jumadil Awal 1434 H

Waspada/Surya Efendi

GIRING 17 TERSANGKA PEMBUNUH KAPOLSEK: Polisi menggiring 17 tersangka pembunuh Kapolsek Dolok Pardamean, Kab. Simalungun ke rumah tahanan Mapoldasu, Jumat (29/3).

z zNo: 24177 * Tahun Ke-67

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 20 Halaman (A1-12, B1-8) z zHarga Eceran: Rp 2.500,-

Waspada/Arianda Tanjung

GUBERNUR Sumut Gatot Pujo Nugroho meletakkan karangan bunga duka cita di atas makam Kapolsek Dolok Pardamean AKP Andar Siahaan di Taman Makam Pahlawan (TMP) Bahagia Medan, Jumat (29/3).

TA Provokator Pembunuh Kapolsek

Sudah 17 Warga Jadi Tersangka Peristiwa Ini Jangan Terulang Lagi

Miliki Sabu, Dua Oknum Polda Aceh Ditangkap BANDA ACEH (Waspada): Direktorat Reserse Narkoba Polda Aceh menangkap 4 pria terkait kepemilikan narkotika jenis sabu. Dua di antarannya merupakan oknum polisi anggota Ditlantas Polda Aceh dan Mapolsek Darul Kamal. Dua pelaku yang diduga sebagai pengedar sabu merupakan warga Aceh Utara yakni, MA, 32, warga Desa Dayah

Tuha, Kec. Syamtalira Bayu, Aceh Utara dan MR, 24, warga Desa Matang Rawa, Kec. Baktiya. Dari kedua pria yang bekerja sebagai pedagang dan tani ini, polisi mengamankan barang bukti sabu seberat 300 gram atau senilai 500 juta. Sementara dari oknum polisi yang diduga sebagai pengguna sabu, polisi menyita barang bukti 0,5 gram sabu,

sebungkus daun ganja seberat 10 gram serta alat isap atau bong. Wadir Ditreserse Narkoba Polda Aceh AKBP Sigit Kusmardjoko didampingi Kabag Bin Opsnal AKBP Hery Moch Machfudhi mengatakan, keempatnya ditangkap di empat lokasi terpisah dan waktu Lanjut ke hal A2 kol 2

Waspada/Arman Konadi

WAKIL Direktorat Reserse Narkoba Polda Aceh AKBP Sigit Kumardjoko memperlihatkan barang bukti dan dua dari empat tersangka sabu di Mapolda Aceh, Jumat (29/3). Petugas mengamankan barang bukti sabu seberat 300 gram senilai Rp400 juta.

Pasca Bentrok Berdarah, Pekerjaan Lelaki Diganti Perempuan PADANGLAWAS (Waspada): Pasca bentrok berdarah antara warga dengan aparat keamanan di Mapolsek Barumun Tengah, puluhan anak sekolah dari desa Aek Buaton, Kec. Aeknabara Barumun, Kabupaten Padanglawas kini terancam putus sekolah. Menurut keterangan sejumlah warga bersama kepala desa Aek Buaton kepada Waspada, Jumat (29/3), saat ini warga masih diselimuti rasa

takut pasca terjadi bentrok, bahkan kaum laki- laki di desa itu masih takut untuk menjalani aktivitas seperti biasa, bekerja dan berusaha menutupi kebutuhan hidup keluarga. Sebab itu, tidak ada pilihan lain kaum wanita desa Aek Buaton terpaksa sabar dan turun tangan untuk bekerja, menjalani usaha dan kegiatan yang biasa dikerjakan laki-laki un t uk m enutupi nafkah kebutuhan hidup sehari-hari.

Seperti menderes di areal kebun rambung warga maupun merawat dan memanen kebun sawit. Pekerjaan yang seharusnya dilakukan kaum laki-laki saat ini terpaksa dikerjakan perempuan. Hal itu terpaksa dilakukan, karena mereka lebih takut lagi bila kaum laki-laki di desa itu ditangkap dan ditahan polisi, sehingga mereka/warga Lanjut ke hal A2 kol 1


Al Bayan

Abad Kebangkitan

PEMATANGSIANTAR (Waspada): 17 warga Dusun Rajanihuta, Desa Buntu Bayu, Kec. Dolok Pardamean, Kab. Simalungun ditetapkan sebagai tersangka pembunuh Kapolsek Dolok Pardamean, AKP Andar Siahaan. Sementara, tersangka penulis togel yang diduga sebagai penyebab peristiwa itu masih buron. “Masih 17 orang yang jadi tersangka dan sampai saat ini masih ada warga yang masih diperiksa dan sebagian sudah dipulangkan,” jelas Kapolres Simalungun AKBP Andi Syahriful Taufik, S.Ik, M.Si saat dikonfirmasi melalui Kasubbag Humas AKP H. Panggabean, SH dan Kasat Reskrim AKP Ronny Nicolas Sidabutar, SH, S.Ik, Jumat (29/3). Warga yang menjadi tersangka, yakni DG, 25, RS, 30, FT, 39, PGG, BS, 23, JN, 23, ISG, 26, PS, 29, SS, 43, TA, 48, MP, 28, TP, 57, PHS, 58, Mar, JS dan BS, 42, seluruhnya warga Dusun Rajanihuta, Desa Buntu Bayu, Kec. Dolok Pardamean. Salah satu tersangka yakni TA istri dari penulis togel KS, diduga provokator peristiwa tersebut karena dia yang meneriaki AKP Andar Siahaan dan tiga anggotanya sebagai maling kerbau hingga massa

menjadi terprovokasi dan membantai AKP Andar Siahaan hingga tewas mengenaskan. SementaraKS sampai saat ini belum ditemukan serta belum menyerahkan diri kepada pihak kepolisian meski sudah dihimbau agar menyerahkan diri. Menurut Panggabean, para tersangka pelaku kini ditahan. Sementara, barang bukti yang disita terdiri dari tombak, batu dan broti, juga empat unit sepeda motor dan satu unit mobil truk Mitsubishi Colt Diesel yang diduga digunakan tersangka pelaku saat kejadian. Mobil Toyota Kijang BK 1074 FN milik AKP Andar Siahaan yang dihancurkan para tersangka pelaku saat kejadian itu, turut dijadikan sebagai barang bukti.

berduka tetap berduka. Tapi tatap putra putri yang perlu kasih sayang, mudah-mudahan dengan ketegaran ibu Situmorang dapat menjadi teladan dan sumber semangat bagi putra-putri sehingga membangun karakter mereka agar menjadi orang sukses di kemudian hari,” ujar Gubsu saat memberikan sambutan. Gatot juga mengingatkan agar jangan ada lagi peristiwa

Untuk menekan angka penyalahgunaan narkoba BNN berupaya menyampaikan informasi tentang bahaya narkoba yang dikemas dalam bentuk pementasan seni berupa pertunjukan bondres dan wayang joblar yang rencananya digelar di Lapangan Puputan Badung I Gusti Ngurah Made Agung, Denpasar, Sabtu (30/3). Kesenian tradisional tersebut menjadi salah satu “jurus andalan” bagi BNN dalam menyampaikan pesan moral dan mendidik masyarakat di lapisan paling bawah. Ia berpendapat program bebas narkoba 2015 itu bukan berarti tidak ada lagi pengguna

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 1


SEJUMLAH kader dari berbagai DPC dan DPD Partai Demokrat seluruh Indonesia melakukan pendaftaran setibanya di arena Kongres Luar Biasa (KLB) Partai Demokrat di Hotel Inna Grand Bali Beach, Sanur, Bali, Jumat (29/3).

KLB Demokrat Akan Tetapkan Pemecatan Anas BALI (Waspada): Pemecatan Anas Urbaningrum dari jabatan Ketua Umum Partai Demokrat akan ditetapkan di dalam sidang paripurna Kongres Luar Biasa Partai Demokrat di Sanur, Bali, 30-31 Maret 2013. Sementara itu, pengurus daerah yang menyebut diri sebagai loyalis Anas tetap melawan. Demikian laporan wartawan Waspada Andy Yanto Aritonang dari Bali, Jumat

(29/3), yang meliput KLB Partai Demokrat yang akan dibuka SBY di Inna Grand Bali Beach Hotel, Bali, Sabtu (30/3) pukul 13.00, dengan agenda utama KLB memilih ketua umum yang baru. “Surat pemecatan Anas akan ditandatangani Ketua Majelis Tinggi Partai Susilo Bambang Yudhoyono dan akan disepakati seluruh peserta KLB,” kata Anggota Majelis Tinggi Partai Demokrat yang juga panitia pelaksana

Instrumentalia, Bukti Stasiun KA Araskabu Momentum Sejarah

Oleh: H. Ameer Hamzah Setiap seratus tahun akan lahir seorang mujaddid yang akan memperbaharui agama ini dari kejumudan dan keterbelakangan. (Dr. M Yusuf Qardhawy) ABAD ke-15 hijrah adalah abad kebangkitan Islam. Kita sudah melangkah selama 34 tahun dalam abad baru ini. Sementara tahun Masehi juga sudah 13 tahun memasuki abad barunya yakni abd ke-21. Kita harus yakin dan percaya bahwa abad kebangkitan Islam itu pasti akan datang. Islam bangkit untuk menyelamatkan manusia dari penipuan setan durjana. Islam mengajak manusia kepada jalan kebenaran, jalan Tuhan pencipta alam semesta. Taring-taring pengkhianat akan segera dipatahkan oleh kekuatan Islam yang dahsyat. Ideologi taghut akan runtuh di mana-mana meski mereka mempertahankan Lanjut ke hal A2 kol 2 STASIUN KA Araskabu. Inzet: Syamsuddin.

tragis yang mengorbankan aparat sebagaimana yang menimpa AKP Andar Y Siahaan. Seperti diketahui Kapolsek Dolok Pardamean, Simalungun ini tewas pada Rabu (27/3) dengan cara dibantai massa saat penggerebekan markas judi di Desa Rajani Huta, Kec Dolok Pardamean, Simalungun.

Lanjut ke hal A2 kol 5

BNN: 3,8 Juta WNI Gunakan Narkoba DENPASAR (Antara): Badan Narkotika Nasional (BNN) mencatat angka terendah penyalahgunaan narkoba di Tanah Air saat ini mencapai 3,8 juta penduduk. “Angka itu berdasarkan data statistik dengan terendah sebanyak 3,8 juta sampai paling tinggi 4 juta penduduk,” kata Deputi Pencegahan BNN Yappi Manafe, di Denpasar, Jumat (29/3). Ia menjelaskan, dari angka tersebut, porsi terbesar ada di tempat kerja termasuk pekerja seni sedangkan sisanya di kalangan pelajar. Jika diteliti lebih mendalam pengguna di kalangan pekerja tersebut merupakan kelompok pemakai lanjutan dari kalangan pelajar.

Gubsu Minta Isteri Kompol Anumerta Andar Tegar

MEDAN (Waspada): Gubsu H Gatot Pujo Nugroho bersama ribuan pelayat hadir di rumah duka Alm AKP Andar Yonas Siahaan, Jalan Pintu Air IV Gang Kelapa Simalingkar B, Medan Johor, Jumat (29/3) . Secara khusus Gubsu berpesan agar isteri almarhum tegar menghadapi musibah untuk memberi semangat kepada ketiga putra-putrinya. “Sedih tetap harus sedih,

Waspada/R Anwar

BANYAK generasi penerus—khususnya yang kurang berminat dengan sejarah tidak mengetahui histori sejarah heroik Stasiun Kereta Api Araskabu, Kec. Beringin, Deliserdang. Nama stasiun yang sebelumnya bukan untuk menaikan serta menurunkan penumpang, melainkan sebagai tempat berpapasan kereta api agar tidak bertrabrakan, mulai mengemuka pada medio Juli 2006. Kala itu, orang nomor dua di republik ini Jusuf Kalla singgah di stasiun ini meninjau serta meletakkan batu pertama pembangunan Kualanamu International Airport (KNIA-Bandara Kualanamu-red). Semula bangunannya tak terlalu besar dengan lantai keramik, bermodal pengembangan dengan memanfaatkan lahan stasiun yang ada panjang sekira 200 meter dan lebar 50 meter, kondisi teranyar Stasiun KA Araskabu jelas berbeda dnegan stasiun KA lainnya di Sumatera Utara. Maklum, dari stasiun inilah peumpang pesawat dapat melakukan chek ini di Bandara Kualanamu yang hanya berjarak 4 kilometer dari bandara termegah di Indonesia tersebut. Referensi harian ini menyatat dalam kurun waktu Lanjut ke hal A2 kol 5

KLB Partai Demokrat Max Sopacua. Menurut Max, sejak menyatakan diri berhenti dari jabatan ketua umum pada 23 Febuari 2013, Anas sama sekali tak pernah menyerahkan surat pengunduran diri sebagai Ketua Umum Partai Demokrat. Atas dasar itu, Anas dianggap mengabaikan tugas dan tanggung jawab jabatannya di Lanjut ke hal A2 kol 1

Ada-ada Saja

Desa Kontainer

URBANISASI adalah masalah paling sulit diselesaikan. Masalah ini pun terjadi di China. Mahalnya harga sewa rumah di kota Shanghai memaksa para penduduk dari desa memilih tinggal di kontainer-kontainer bekas yang sudah tidak terpakai. Dengan membayar sekitar Rp600 ribu

Lanjut ke hal A2 kol 5

Serampang - Asal busana tidak ikut bertukar - He.... he....he....

Berita Utama


WASPADA Sabtu 30 Maret 2013

Penyerangan LP Cebongan

KSAD Bela Pangdam IV Diponegoro JAKARTA (Waspada): Tentara Nasional Indonesia Angkatan Darat membentuk tim investigasi untuk mengusut dugaan keterlibatan anggota TNI dalam penyerangan Lembaga Pemasyarakatan Cebongan, Sabtu 23 Maret 2013. Kepala Staf Angkatan Darat Jenderal Pramono Edhie Wibowo menyatakan, tim

investigasi dibentuk atas perintah Panglima TNI berdasarkan temuan Polri yang menyebutkan ada keterlibatan anggota TNI. Menyangkut pernyataan Pangdam IV Diponegoro, Mayor Jenderal Hardiono Saroso yang secara tegas membantah keterlibatan anggota TNI di hari insiden terjadi, Pramono menilai pernyataan

itu bentuk tanggung jawab seorang pimpinan di lapangan. “Kalau dilihat pernyataan itu kan hanya sesaat dari kejadian. Pernyataan Pangdam sesuai situasi, kondisi dan informasi saat itu,” kata Pramono dalam keterangan pers di Mabes TNI AD, Jakarta, Jumat (29/3). Selain itu, pernyataan

Pangdam Diponegoro bertujuan untuk memberikan jaminan keamanan di Yogyakarta, sehingga masyarakat merasa aman dan keadaan bisa terkendali. “Informasi saat itu lebih karena tanggung jawabnya sebagai orang yang ada di lapangan,” tuturnya. Dalam keterangannya kepada wartawan beberapa

waktu lalu , Pangdam IV Diponegoro, Mayjen Hardiono menegaskan, tidak ada keterlibatan anggota TNI dalam penyerangan itu. “Bukan prajurit. Tidak ada yang terlibat. Saya bertanggung jawab penuh sebagai Pangdam Diponegoro,” ujar Hardiono Saroso di Yogyakarta, Sabut 23 Maret 2013. (vn)

Kejahatan Modus Baru Di Medan

Uang Asing Senilai Rp 600 Juta Lewong

Pasca Bentrok ....

nyelesaian untuk memulihkan kembali keadaan, sehingga msyarakat merasa aman dan kondusif. Biala kondisi seperti ini masih terus berlanjut, dimana kaum laki-laki tidak bisa bekerja dan mencari nafkah un-

tuk menutupi kebutuhan hidup sehari-hari, dan tetap mengandalkan tenaga perempuan, maka bukan tidak mungkin akan banyak anak-anak yang putus sekolah karena orangtuanya tidak mampu untuk membiayai, jelas warga. (a33)

bertugas di customer service dan keterangan dari karyawan bank itu menyatakan kalau nomor rekening tersebut tidak ada atas nama Ir. Jaka Hermato. Mendapat penjelasan itu, keduanya segera kembali menuju ke lantai V Bank Sumut dan mencari Ir. Jaka Hermanto, ternyata pelaku sudah tidak ada di lokasi. Karyawan korban mencoba menghubungi handphone pelaku ternyata sudah tidak aktif. Hari itu juga, Kalwant Singh didampingi dua karyawan dan anaknya serta seorang pria mengaku staf pelaku datang ke Mapolsek Medan Baru dan sekaligus membuat pengaduan. Kapolsek Medan Baru Kompol Jean Calvijn Simanjuntak, SH, SIK, MH mengatakan, pihaknya masih melakukan pemeriksaan terhadap pria yang disebut staf tersangka pelaku. Selain itu juga, korban dan sejumlah saksi masih dalam pemeriksaan. Sedangkan, pelakunya hingga kini masih dalam lidik. “Kita sudah turunkan personel ke Tempat Kejadian Perkara (TKP) untuk melakukan menyelidikan dan sekaligus mengumpulkan berbagai informasi yang menyaksikan kejadian itu,” jelasnya. Selesai menjalani pemeriksaan, pria yang disebut staf pelaku mengatakan, dia mengaku staf karena sebelum-

KLB Demokrat ....

merlukan kehadirannya, tetapi cukup dengan surat keputusan pemberhentian ditandatangani majelis tinggi,” ujarnya. Ulah politisi internal Sementara Wakil Ketua Dewan Pembina Partai Demokrat Marzuki Alie menilai keterpurukan elektabilitas partainya dalam dua tahun terakhir akibat ulah politisi internal yang lebih memikirkan kepentingan pribadi. Demokrat tidak dibangun untuk kepentingan partai bersama, melainkan dijadikan kendaraan atau wadah mencari keuntungan sendiri maupun kelompok tertentu. “Partai hancur karena kepentingan pribadi mengemuka daripada

kepentingan partai. Apa yang saya lakukan untuk menegakkan marwah partai,” katanya. Saat disinggung soal aspirasi dan dukungan daerah yang menginginkan dirinya menjadi ketua umum, Marzuki sama sekali tak mau berkomentar. Ia menyatakan sepenuhnya akan mendukung keputusan majelis tinggi untuk memilih nakhoda partai. Pada sisi lain, ketua DPR RI ini mengklarifikasi ditegur SBY karena dituding mengumpulkan puluhan DPC untuk mendukungnya sebagai calon katua umum. “Kalau itu silakan tanya langsung ke Mas I bas , k a re n a k o o rd i n a s i dengan Mas Ibas. Artinya, info tersebut tidak tepat. Apa yang mau ditegur?” tanya Marzuki. Sehari sebelum KLB resmi dibuka, pengurus daerah Par-

tai Demokrat yang menyebut diri sebagai loyalis Anas masih ngotot melakukan perlawanan, bahkan tetap akan memajukan figur calon ketua umum yang akan didukungnya, di luar kandidat SBY. Tridianto yang sudah berada di Bali meskipun tak masuk dalam peserta undangan, menyatakan sudah mantap untuk mencalonkan diri sebagai ketua umum pada arena KLB. Suara pengurus daerah yang mendukung dirinya, diklaim Tridianto merupakan loyalis mantan Ketua Umum Partai Demokrat Anas Urbaningrum. Daerah pendukungnya berasal dari pengurus DPC wilayah Jawa, Kalimantan, Sumatera, Bali, Maluku dan Nusa Tenggara. Sekarang ini, kata Tri, para pendukungnya itu telah mendarat di Bali. (aya)

Andar sempat menyelamatkan tiga anak buahnya dan menghadapi sendiri serbuan massa yang kemudian menewaskannya. Menurut Gubsu, peristiwa yang sangat disesalkan tersebut hendaknya dapat memberikan pembelajaran dan kesadaran kepada semua pihak bahwa keamanan bukan hanya tanggungjawab aparat kepolisian namun juga masyarakat. “Cukup peristiwa ini yang terakhir terjadi. Jangan adalagi kekerasan yang mengorbankan aparat,” ujar Gubsu. Sementara itu tangis pilu ratusan pelayat mewarnai misa terakhir di rumah duka. Duka kehilangan jelas terlihat di wajah isteri almarhum, P Situmorang dan ketiga anak Mei Stephanie, 22, Lestari, 18 dan Daniel, 16, yang mendampingi jenazah. Ribuan pelayat di antaranya anggota polisi maupun kerabat almarhum memenuhi kawasan di sekitar rumah duka Jalan Pintu Air IV. Kepergian Kapolsek yang tewas dengan tragis saat bertugas ini telah menyedot per-

Peristiwa Ini ....

hatian publik. Sekitar pukul 16:00 , jenazah almarhum dibawa ke Taman Makam Pahlawan Jl SM Raja Medan untuk dikebumikan dengan upacara militer. Upacara dipimpin Kapoldasu Irjen Pol Wisjnu Amat Sastro juga dihadiri Gubsu, Pangdam I Bukit Barisan Mayjend Lodewijk F Paulus, Bupati Simalungun JR Saragih dan jajaran Polda Sumut. Tangis haru isteri almarhum menyertai penguburan jenazah almarhum ke liang lahat. “Selamat Jalan pa selamat jalan pa,” jerit Situmorang menangis pilu. Ketiga anakanak yang mengenakan baju hitam pun mengurai air mata saat liang lahat berisi jenazah ditutup kembali dengan tanah. Dalam sambutannya Kapolda menganugerahkan penghargaan pangkat Komisaris Polisi Anumerta kepada almarhum yang adalah putra Alm Letkol Adrian Siahaan. “Atas nama negara, kami mempersembahkan jasa dan raga almarhum. Selamat Jalan Kompol Anumerta Andar Siahaan,” ujar Kapolda sambil terisak.(m28)

mad al-Gazali. “Wahai pemuda, maju terus memperjuangkan hukum Alquran! Sebaik-baik hukum adalah hukum Allah. Tantangan pasti ada dari kaum munafik yang pura-pura tak tahu hukum Allah. Hadapilah tantangan itu dengan sabar dan tawakkal. Bukalah Alquran kepada mereka, tunjukkanlah dalilnya agar mereka mengerti. Sebab kini banyak orang ahli di bidang ilmu-ilmu dunia, tetapi mereka tidak ahli dalam bidang ilmu Allah”.

Akhirnya mari kita berdoa: Ya Ilahi! berilah kekuatan kepada kami. Tunjukkilah kami ke jalan yang benar! terimalah taubat kami dan taubat pemimpin-pemimpin kami yang menyimpang dari ajaran-Mu. Jadikanlah negeri kami sebuah negeri yang aman dan damai. Persatukanlah hati kami dalam satu ideologi yang engkau turunkan dari langit. Ya Allah cabutlah kekuasaan dari orang-orang yang zalim.

MEDAN (Waspada): Aksi penipuan dengan modus baru terjadi di Medan. Korbannya Kalwant Singh, 57, kehilangan uang 25.000 ringgit Malaysia dan 57.000 dolar Singapura yang seluruhnya setara dengan Rp600 juta. Informasi Waspada peroleh, peristiwa itu terjadi Kamis (28/3) siang dan hari itu juga korban Kalwant Singh penduduk Jl. Karya Bakti, Lk VII, Pangkalan Mansyur, Medan Johor melaporkan peristiwa-

nya ke Mapolsek Medan Baru. Dalam laporannya korban menyebutkan, sebelumnya menerima telefon dari seorang pria mengaku bernama Ir. Jaka Hermanto yang hendak membeli mata uang asing. Dalam perbincangan melalui telefon, korban diduga kena hipnotis karena dia kemudian menyuruh karyawannya Mihardi bersama anaknya Harpret Singh mengantarkan sejumlah uang ringgit dan dolar Singapura kepada Jaka

Her manto di salah satu ruangan yang ada di lantai V kantor Bank Sumut; Keduanya kemudian menyerahkan uang tersebut kepada pelaku. Untuk mendapatkan uang rupiahnya karyawan korban bersama seorang pria yang mengaku staf pelaku langsung disuruh pergi ke customer service yang berada di di lantai II Bank Sumut. Ketika menuju ke customer cervice, bertemu dengan karyawan Bank Sumut yang

Waspada/Idaham butar butar

SEORANG ibu sedang menderes di kebun warga ditemani sejumlah ibu lainnya, tidak jauh dari desa Aek Buaton. desa aek Buaton masih terus dihantui ketakutan. Untuk itu mereka sangat mengharapkan uluran bantuan pihak terkait, terasuk pemerintah daerah dan DPRD Kabupaten Padanglawas, mencari solusi pe-

partai, selain penetapan status hukumnya sebagai tersangka kasus korupsi Hambalang. Untuk proses pemecatan itu sendiri, lanjutnya, Majelis Tinggi Partai Demokrat memandang tak perlu menghadirkan Anas di KLB. “Proses pemberhentian Anas tak me-

BNN: 3,8 Juta ....

barang haram tersebut namun keberhasilannya berdasarkan tiga indikator. Pertama, 3,8 juta pengguna narkoba tersebut direhabilitasi supaya pulih, kemudian sisanya yang belum terkena pengaruh ditingkatkan kesadarannya. “Hal yang terakhir adalah pemberantasan sindikat narkoba. Kami ingin membuat miskin para bandar tersebut,” ujarnya menandaskan.

Miliki Sabu ....

berbeda. “Kalau yang warga sipil berawal dari tertangkapnya MA pada 25 Maret lalu di kawasan Lhoknga Aceh Besar dan petugas menemukan Jawaban Problem Catur, sabu seberat 219 gram,” ujar Sigit. TTS Dan Sudoku Menurutnya, dari hasil Dari Halaman Sport. pengembangan polisi kemudian menjemput MR di rumahnya di Aceh Utara pada Jawaban Problem Catur: Selasa 26 Maret lalu dan menemukan barang bukti sabu 1. Bh8+, Rg7. 97,8 gram. 2. Ke8+, RxB. Oknum polisi Briptu DN 3. Mf6+, Rg8 yang merupakan anggota atau Rh7. Polsek Darul Kamal kata Sigit 4. Mg7+mat. (Jika ditangkap Sabtu di Desa Lamkunyet Darul Kamal Aceh 2. ...., BxK. Besar. Barang bukti 0,5 gram 3. Mf6+mat). sabu. Sementara Brigadir DM ditangkap di kawasan Desa Jawaban TTS: Peurada, Kec .Baiturrahman TTS Topik Tekinfokom dengan 0,5 gram sabu. “Yang oknum ini hanya pemakai saja. Jadi ada BB yang jatuh kemudian dipungut oleh pelaku. Tapi memang maunya begitu akan kita tindak juga,” kata Sigit. Untuk mempertanggungjawabkan perbuatannya, keempat pelaku berikut barang bukti kini mendekam di sel Polda Aceh. Pelaku dijerat dengan undang-undang narkotika No 35 tahun 2009 dengan pidana minimal 5 tahun penjara. (cb06)

Albayan .... Jawaban Sudoku: 6 2 4 1 9 3 5 8 7 0

8 5 6 2 0 1 4 7 3 9

4 0 5 3 7 8 1 9 6 2

1 7 8 9 6 2 0 3 5 4

9 3 7 0 4 5 2 6 8 1

7 6 3 4 8 0 9 2 1 5

3 9 1 5 2 7 8 4 0 6

0 8 9 7 1 4 6 5 2 3

2 4 0 8 5 6 3 1 9 7

5 1 2 6 3 9 7 0 4 8

dengan senjata dan teknologi canggihnya. Gempita kebangkitan Islam mulai terasa, gaungnya melintasi gunung, dan lembah-lembah. Para pejuang Islam bangkit mengamalkan Alquran, ibu-ibu mengajak kaum lelaki ke masjid, pemuda-pemuda muslim mengajak perempuan menggunakan busana muslimah. Itulah contoh yang positif. Kita teringat seruan ulama besar Mesir, Syeikh Muham-

nya disuruh oleh pelaku. “Saya sudah jelaskan kepada korban bahwa dirinya bernama Hendri Gunawan warga Jln. Mustafa Medan dan dia sebagai pemilik mobil rental,” jelasnya. Hendri menambahkan, pelaku berlogat Jakarta itu merental mobilnya dua hari Selasa dan Kamis. ‘’Saya sendiri yang membawa mobil. Hari Selasa (26/ 3) saya menjemputnya di hotel Tiara dan Kamis (28/3) jemput di Hotel Aston Medan. “Saya ada tanya pelaku dimana kerjanya dan tinggal dimana, tapi pelaku marah dengan mengatakan jangan kamu tanya dimana alamat saya dan tempat tugasnya, kamu sebagai sopir ikuti saja perintah kemana tujuan. Tapi logat bicaranya seperti tinggal di Jakarta,” jelas Hendri meniru ucapan pelaku tersebut. (m36)

TA Provokator ....

Mengenai warga lainnya yang diamankan ke Mapolres Simalungun sesudah kejadian pembunuhan itu mencapai 104 orang, menurut Panggabean, sebagian besar sudah dipulangkan dan sebagian lagi masih dalam proses pemeriksaan. Pembunuhan terhadap Kapolsek Dolok Pardamean AKP Andar Siahaan di Desa Dolok Saribu, Kecamatan Dolok Pardamean pada Rabu (27/3) pukul 22:30 diduga dilakukan warga Dusun Rajanihuta, Desa Buntu Bayu, Kecamatan Dolok Pardamean, saat AKP Andar Siahaan bersama tiga personilnya melakukan penggerebekan dan penangkapan terhadap tersangka penulis judi togel. Tiga personil yang mendampingi AKP Andar Siahaan tidak turut


KEPALA Staf TNI Angkatan Darat Jenderal TNI Pramono Edhie Wibowo (dua kiri) bersiap memberikan keterangan pers terkait insiden penyerangan oleh gerombolan bersenjata ke LP Cebongan Sleman di Mabes TNI AD, Jakarta Pusat (29/3).

Hari Ini 56 Tahun Kesultanan Langkat Anugerahi 6 Tokoh Nasional Gelar Adat MEDAN (Waspada): Sejumlah kerapatan adat kesultanan negeri Langkat, hari ini, Sabtu (30/3) menganugerahi sejumlah tokoh nasional berupa gelar adat. Hal ini dlakukan pasca 56 tahun (dari tahun 1946) peristiwa revolusi sosial di masa Kesultanan Langkat, Sultan Mahmud. “Pemberian anugerah gelar adat tersebut, kita maknai guna membangun kembali adat dan budaya masyarakat Melayu khususnya Langkat yang berproses cukup panjang,” kata Tuanku H. Azwar menjadi korban, karena berhasil melarikan diri atas bantuan warga di tempat kejadian. AKP Andar Siahaan diduga dibunuh menggunakan tombak, parang, balok kayu dan batu hingga tewas mengenaskan dengan wajah dan tubuhnya berlumuran darah. Hasil otopsi yang dilakukan dokter forensik RSUD Dr. Djasamen Saragih, Pematangsiantar menyebutkan AKP Andar Siahaan tewas akibat luka menganga di sekitar kepala dan wajah, tengkorak kepala pecah dan luka-luka lecet di kaki. Menurut Panggabean, para tersangka pelaku akan dijerat dengan tindak pidana pembunuhan berencana sesuai Pasal 340 KUH Pidana dengan ancaman hukuman mati dan maksimum 20 tahun penjara. (a30)

Ada-ada Saja ....

lunta tanpa rumah, ia memutuskan untuk menyewakan kepada kami sebagai tempat tinggal,” Kata Li Yanxin, penduduk asal Provinsi Anhui, dilansir Daily Mail, Kamis (28/3). Banyak warga yang menanyakan bagaimana rasanya tinggal di ‘rumah logam’ itu. Li Yanxin menjelaskan, wadah besi ini cukup kuat dan rapat, sehingga tak perlu khawatir atapnya akan runtuh dan bocor saat hujan. “Saya merasa senang tinggal di kontainer ini. Kami telah diselamatkan oleh pria tua itu. Dia telah menyediakan kami tempat tinggal yang cukup nyaman dan aman,” ujar Li Yanxin. Selain di pinggiran kota Shanghai, Desa Kontainer juga ada di pinggiran kota Gaoqiao. Khawatir makin menjamurnya Desa Kontainer di daerah pinggiran kota, pemerintah daerah Gaoqiao menyatakan bahwa tinggal di Desa Kontainer sangat berbahaya bagi penduduk. (vvn/rzl)

History ....

madrasah di Pasar Sore, begitupun sempat mengikuti pendidikan militer yang dilatih oleh tentara Nipon (Jepang),” ujarnya mengawali kisahnya. Atok Syamsuddin mengaku kejadian itu pada pagi hari, secara tiba-tiba pesawat tentara sekutu menge-brand (tembakan dari pesawat) ke arah gerbong KA di stasiun KA Araskabu. “Warga sekitar jelas berlarian, banyak korban, khususnya penumpang KA. Selain jiwa juga ada yang luka parah di antaranya kakinya patah karena serangan mendadak tersebut,” ujarnya tampak semangat mengingat runutan cerita sejarah tersebut. Lelaki berusia senja ini tampak sumringah saat berhasil mengingat jenis KA korban serangan mendadak tentara sekutu tersebut. “Namanya kalau tidak salah DMS. Pasca serangan tiba-tiba itu, para korban langsung diangkut dengan truk dan warga sekitar berjaga-jaga di lingkungannya masing-masing,” katanya sembari meng-khatamkan kisahnya bahwa serangan itu karena tentara sekutu melihat pakaian kebesaran Jepang di KA dan stasiun tersebut. Sekelumit kisah sejarah

per bulan, mereka akhirnya tinggal di rumah-rumah logam di pinggiran kota Shanghai. Banyak yang menyebutkan rumah-rumah terbuat dari kontainer ini sebagai “Desa Kontainer”. Pembuatan rumah logam ini dicetuskan oleh pria berusia 70 tahun. Biasanya penduduk setempat memanggilnya dengan nama ‘Orang Tua’. Pria tua ini merasa kasihan dengan para pendatang yang tak memiliki tempat tinggal. Akhirnya ia mengumpulkan kontainer-kontainer bekas dan merenovasinya dengan menambahkan pintu, jendela, aliran air, dan listrik. Menurut Li Yanxin, seorang penduduk “Desa Kontainer” yang sudah tinggal selama 10 tahun, awalnya orang tua itu membuat tumpukan kontainer sebagai gudang. “Namun, setelah melihat kami para pendatang terlunta2012-2013 menjelang beroperasinya KNIA, sejumlah pejabat tinggi negara hingga pejabat DPR RI telah melakukan ujicoba dari Stasiun KA Medan ke KNIA melewati Stasiun KA Araskabu yang hanya tinggal perampungan stasiun di dalam areal KNIA, tepatnya di depan terminal utama bandara ber nilai triliunan tersebut. Nah, itu kondisi modern Stasiun KA Araskabu terkini. Namun pada era zaman Jepang, sekitar tahun 1943 stasiun kecil ini memiliki cerita sejarah yang memilukan karena memakan korban jiwa pegiat kesenian Indonesia yang akan tampil di pentas seni Pematangsiantar. Saksi sejarah dari daerah Araskabu sendiri bisa dihitung yang masih hidup. Tak heran, salah satunya sudah usia lanjut, yakni Atok Syamsuddin, 89. Saat ditemui di kediamannya di Jalan Besar Lubukpakam-Pantailabu, tepatnya kawasan Araskabu, Atok Syamsuddin mengaku sudah agak lupa, namun ayah dari lima putri ini tampak bersemangat saat mengisahkan sejarah berdarah di Stasiun KA. “Pada masa itu saya guru

Azis selaku Sultan Langkat saat memberi keterangan pada sejumlah wartawan di Medan, Jumat (29/3). Menurut Azis, kegiatan ini juga dilambangkan sebagai bagian dari pengukuhan kedatukan atau kejeruan negeri Langkat, sekaligus pengukuhan Kepala Balai adat dan penghulu adat. “Ini menarik, karena acara ini baru terlaksana setelah 56 tahun kejadian revolusi sosial di masa Sultan Mahmud,’’ tambah mantan pejabat yang sempat menduduki posisi Kepala Dinas Perindustrian dan Perdagangan Provinsi Sumatera Utara. Ada enam orang penerima anugrah gelar adat seperti, Bupati Kutai Timur Isran Noor, Bupati Langkat H.Ngogesa Sitepu, Prof Dr Hj Mariam

Barus, Prof Dr Ir H Djohar Arifin Husin, Mayjen (Purn) H Barkah Tirta Djaya dan Kol (Purn) Bahtiar Djafar. HT Azwar Azis menyinggung, selain pemberian anugerah adat yang direncanakan akan dilaksanakan di areal Masjid Azizi Tanjungpura Langkat, tercatat juga akan dilakukan pemberian penghargaan pada putra/putri berprestasi di bidang masingmasing. Disampaikan Azis kembali, bahwa ada pihakpihak yang sempat mengklaim dan mengatasnamakan kesultanan Langkat. Untuk itu bagi masyarakat Melayu melalui kegiatan ini akan semakin membuka wawasan bersama dan masyarakat diharap tak menjadi bingung. (m07/rel)

Teuku Riefky: Perlu Pertimbangan SBY Jadi Ketum J A K A R T A (Waspada): Kongres Lu a r B i a s a Par t a i Demokrat sudah siap digelar di hotel Inna Grand Bali Beach, Sanur, Bali, Sabtu dan Minggu (30-31/3) ini. Memasuki Sanur, Bali, bendera Partai Demokrat bertaburan, melambangkan kemegahan pesta pemilihan ketua umum PD ini. Ada sekitar 1.000 peserta yang datang pada KLB pada 30-31 Maret nanti. Jumlah peserta, terdiri dari 575 orang yang memiliki hak suara. Terdiri dewan pembina (5 suara), DPP (3 suara), departemen luar negeri (1 suara), sayap partai (3 suara), DPD 2 suara total 66 suara dan DPC 1 suara total 497 suara. KLB PD yang digelar di Bali ini diadakan dengan sederhana dengan semangat konsolidasi dan pikiran yang jernih untuk perbaikan Partai. Agenda utamanya apalagi kalo bukan untuk melakukan pemilihan kekosongan Ketua Umum periode 20132015, dengan mengutamakan musyawarah dan mufakat sebagai salah satu sikap demokrasi seperti yg tercantum dlm AD/ ART partai Demokrat Anggota SC KLB PD yang juga anggota DPR RI asal Aceh, Teuku Riefky Harsya (foto) mengatakan perkembangan keinginan DPD dan DPC sebelum KLB dimulai untuk meminta SBY turun gunung memimpin langsung Partai Demokrat sebagai Ketua umum periode 2013-2015 perlu pertimbangan yang matang dan baik oleh beliau (SBY) maupun pemilik suara, mengingat karena jabatan dan kegiatan beliau sebagai Kepala Negara (Presiden RI). Riefky menambahkan meski nantinya SBY menerima permintaan kader, wacana adanya posisi Ketua Harian yang bertugas untuk penanggung jawab pelaksanaan roda organisasi sehari-hari diharapkan sebagai solusi alternatif untuk juga menjadi satu kesatuan keputusan dlm KLB ini. (rel) Syamsuddin diperkuat oleh mantan pejuang dan pegiat sejarah Sumut-Aceh, Muhammad TWH. Lewat telefon selular, lelaki yang juga masuk usia senja ini tetap cas memorinya saat ditanya soal sejarah berdarah Stasiun KA Araskabu. “Ya, di dalam KA itu rombongan kesenian pimpinan Lilik Suheri yang akan tampil di Pematangsiantar. Masa itu pesawat tentara sekutu memang sering seliweran di udara dan hari itu sekitar tahun 1943 hanya dengan melihat pakaian seragam yang berbau Jepang mereka langsung melesakkan timah panasnya, seperti kejadian di Stasiun KA Araskabu yang pada saat itu posisi KA sedang berhenti,” sambarnya via selular. Menurut referensi Muhammad TWH, masa itu banyak pegawai KA mengenakan seragam seperti milik Jepang. “Nah, tentara sekutu memang sering menyerang tiba-tiba, akibatnya rombongan kesenian pimpinan Lilik Suheri banyak jatuh korban. Beruntung Lilik selamat, namun setahu saya, selain banyak korban luka parah juga korban jiwa di antaranya penyanyinya bernama Misrobi,” sebutnya yang butuh durasi dua menit

mengingat nama-nama korban jiwa tersebut. Mu h a m m a d T WH menyebutkan, bukti peristiwa bersejarah di Stasiun KA Araskabu kini tersimpan di Stasiun Radio Republik Indonesia (RRI) Medan. “Lilik Suheri menyentil Jepang dan pasca kejadian berdarah itu, dia menyiptakan lagu Araskabu dalam bentuk musik instrumentalia,” ujarnya mengakhiri kisah sejarah itu, sembari mengilustrasikan awal musik instrumental bersejarah karya Lilik Suheri tersebut. Untuk referensi, Stasiun KA Araskabu (ARB) yang terletak pada ketinggian +7,23 m dpl ini berada di Divisi Regional 1 Sumatera Utara dan Aceh. Stasiun yang berada di tengah-tengah persawahan dan kebun penduduk ini saat ini menjadi persimpangan menuju Bandara Kualanamu. Saat ini jalur menuju Bandara Kuala Namu sudah jadi. Hanya menunggu pembangunan stasiun di bandara yang direncanakan akan diresmikan dengan bandara sendiri. Stasiun Araskabu memiliki 2 jalur KA, yakni 1 jalur lurus dan 1 jalur belok untuk persilangan kereta api. * R. Anwar



Sabtu 30 Maret 2013

Polisi Tetapkan 21 Tersangka ... pasal pembunuhan berencana, dengan hukuman maksimal 20 tahun penjara. Tetapi, sebutnya, berapa lama nantinya hukuman yang dijatuhkan kepada para tersangka tergantung di persidangan. “Polisi tidak akan lakukan intervensi. Kita akan hormati tuntunan hukuman yang akan dijatuhkan pengadilan nantinya,” kata Wisjnu, meminta masyarakat menghormati hukum. Jika caracara main hakim sendiri dikedepankan, maka tidak akan selesai permasalahan di negeri ini. Kapolres Simalungun AKBP Andi Syahriful Taufik seusai pemakaman kepada wartawan mengatakan hal sama. Dia menyebutkan penganiayaan itu diduga sudah direncanakan, karena saat istri tersangka bandar judi togel berteriak maling, seratusan massa langsung menghadang. “Ini seperti direncanakan, hanya beberapa saat istri tersangka berteriak, seratusan massa langsung datang menghadang,” ujarnya. Menurut Andi, saat itu Kapolsek sempat menghubungi dirinya menyatakan dihadang oleh massa, tetapi Andar Siahaan mengatakan situasi masih terkendali. “Lalu sekitar 30 menit, dia menghubungi lagi menyatakan mereka terdesak. Saya perintahkan untuk segera mundur meninggalkan lokasi, tetapi karena pengabdiannya dia bertahan sehingga gugur,” kata Andi menyebutkan, dari 17 yang diamankan di Polda Sumut termasuk istri tersangka bandar togel. Mengenai tiga anggota Polsek Dolok Pardamean yang mendampingi Kapolek saat penggerebekan dan memilih lari saat peristiwa itu, Andi mengatakan mereka diperiksa sebagai saksi. “Mereka diperiksa sebagai saksi,” ujarnya seraya menambahkan penangkapan tersangka bandar judi togel sudah sesuai prosedur. Sedangkan situasi di Dolok Pardamean saat ini sudah kondusif. Teriak spontan Sementara itu, tersangka Tamaria Aruan (TA), 48, istri Kosdin Saragih (KS) yang oleh polisi ditetapkan sebagai provokator tewasnya Andar Siahaan mengaku berteriak spontan meminta agar suaminya jangan ditangkap karena sedang sakit. “Aku cuma berteriak minta tolong sama polisi supaya suamiku tidak dibawa. Suamiku sedang sakit,” katanya yang akrap disapa Mak Yenny kepada wartawan di Mapoldasu, Jumat (29/3). Menurut Tamaria, karena polisi bersikeras menangkap suaminya, dia pun kembali berteriak. Tak disangka teriakannya mengundang kedatangan warga yang duduk di warung kopi miliknya. Warga kemudian emosi dan mulai mengancam korban dan tiga polisi lainnya. “Karena warga emosi, suamiku akhirnya dilepas, terus polisi pergi,” kata Tamaria. Setelah polisi pergi, Tamaria mengaku langsung masuk ke rumahnya. Dia mengatakan melihat warga mengejar mobil polisi namun tidak ikut terlibat penganiayaan korban. Tamaria merupakan satu dari 21 orang yang telah ditetapkan sebagai tersangka kasus penganiayaan Kapolsek Dolok Pardamean hingga tewas. Sedangkan tersangka lainnya, Dedi Girsang, 21, mengaku ikut mengejar korban menggunakan sepeda motor. “Malam itu puluhan orang dari dusun kami yang mengejar dan memukuli, sedangkan aku hanya dua kali memukul pakai kayu,” kata dia. Girsang bersama tersangka lainnya mengaku tahu kalau korban polisi. Namun karena terprovokasi, dia tetap saja ikut menganiaya. “Aku tahu dia polisi karena sebelumnya mengaku ketika menangkap Pak Yenny,” sebutnya. Pak Yenny dimaksud Girsang adalah Kosdin Saragih, tersangka bandar togel yang rencananya akan ditangkap Andar bersama tiga polisi lainnya pada Rabu (27/3) malam di Desa Butu Bayu Panei Raja, Kecamatan Dolok Pardamean. Bahkan, kata Girsang, meski korban telah sekarat ada juga warga yang berteriak memerintahkan membakar korban. Namun Girsang tidak mengetahui siapa yang memberikan perintah bakar karena suasana gelap. Sebelumnya, Kapolres Simalungun AKBP Andi Syahriful Taufik melalui Kassubag Humas AKP H. Panggabean dan Kasat Reskrim AKP Ronny Nicolas Sidabutar mengatakan 17 orang tersangka dikirim ke Poldasu. Sampai saat ini masih ada warga yang masih diperiksa dan sebagian sudah dipulangkan. Warga yang menjadi tersangka, yakni DG, 25, RS, 30, FT, 39, PGG, BS, 23, JN, 23, ISG, 26, PS, 29, SS, 43, TA, 48, MP, 28, TP, 57, PHS, 58, Mar, JS dan BS, 42, seluruhnya warga Dusun Rajanihuta, Desa Buntu Bayu, Kec. Dolok Pardamean. Salah satu tersangka yakni TA istri KS, tersangka provokator peristiwa tersebut karena dia yang meneriaki AKP Andar Siahaan dan tiga anggotanya sebagai maling kerbau, sehingga massa terprovokasi dan meramaikan AKP Andar Siahaan hingga tewas mengenaskan. Masih diburon Sementara Kosdin Saragih, penulis togel, sampai saat ini belum menyerahkan diri kepada pihak kepolisian alias buron meski sudah diimbau agar menyerahkan diri. Menurut Panggabean, barang bukti yang disita terdiri dari tombak, batu dan kayu broti, juga empat unit sepeda motor dan satu unit mobil truk Mitsubishi Colt Diesel yang diduga digunakan tersangka pelaku saat kejadian. Mobil Toyota Kijang BK 1074 FN milik AKP Andar Siahaan yang dihancurkan para tersangka pelaku saat kejadian itu, turut dijadikan sebagai barang bukti. Pembunuhan terhadap Kapolsek Dolok Pardamean AKP Andar Siahaan di Desa Dolok Saribu, Kec. Dolok Pardame an pada Rabu (27/3) pukul 22:30 diduga dilakukan warga Dusun Rajanihuta, Desa Buntu Bayu, Kec. Dolok Pardamean, saat AKP Jawaban Problem Catur, Andar Siahaan bersama tiga personilnya melakukan peTTS Dan Sudoku nggerebekan dan penangkapan terhadap tersangka penulis Dari Halaman Sport. judi togel. Tiga personil yang mendampingi AKP Andar Siahaan tidak turut menjadi korJawaban Problem Catur: ban, karena berhasil melarikan diri atas bantuan warga di 1. Bh8+, Rg7. tempat kejadian. AKP Andar Siahaan diduga 2. Ke8+, RxB. dibunuh menggunakan tombak, parang, balok kayu dan ba3. Mf6+, Rg8 tu hingga tewas mengenaskan dengan wajah dan tubuhnya atau Rh7. berlumuran darah. Hasil otopsi yang dilakukan dokter forensik 4. Mg7+mat. (Jika RSUD Dr. Djasamen Saragih, Pematangsiantar menyebutkan 2. ...., BxK. AKP Andar Siahaan tewas akibat luka menganga di sekitar kepa3. Mf6+mat). la dan wajah, tengkorak kepala pecah dan luka-luka lecet di kaki. (m27/a30) Jawaban TTS: TTS Topik


Jawaban Sudoku: 6 2 4 1 9 3 5 8 7 0

8 5 6 2 0 1 4 7 3 9

4 0 5 3 7 8 1 9 6 2

1 7 8 9 6 2 0 3 5 4

9 3 7 0 4 5 2 6 8 1

7 6 3 4 8 0 9 2 1 5

Berita Utama Hari Ini 56 Tahun Teuku Riefky: Perlu Pertimbangan SBY Jadi Ketum Kesultanan Langkat

3 9 1 5 2 7 8 4 0 6

0 8 9 7 1 4 6 5 2 3

2 4 0 8 5 6 3 1 9 7

5 1 2 6 3 9 7 0 4 8

MEDAN (Waspada): Sejumlah kerapatan adat kesultanan negeri Langkat, hari ini, Sabtu (30/3) menganugerahi sejumlah tokoh nasional berupa gelar adat. Hal ini dilakukan pasca 56 tahun (dari tahun 1946) peristiwa revolusi sosial di masa Kesultanan Langkat, Sultan Mahmud. “Pemberian anugerah gelar adat tersebut, kita maknai guna membangun kembali adat dan budaya masyarakat Melayu khususnya Langkat yang berproses cukup panjang,” kata Tuanku H. Azwar Azis selaku Sultan Langkat saat memberi kete-

PBB: Penguasa ... dan menjadi bukti bahwa kerusuhan tersebut sudah terorganisir dengan rapih. Sebelumnya Penasehat PBB Vijay Nambiar yang mengunjungi Meikhtila Minggu lalu melihat bahwa kerusuhan ini memang sudah direncanakan sebelumnya. “Sebagian besar tindakan kekerasan ini sudah direncanakan dan kami mendesak pemerintah untuk menghukum mereka yang dianggap bertanggungjawab atas tragedi itu,” tutur Nambiar. Selama ini, Pemerintah Myanmar dikritik keras karena gagal melindungi komunitas Muslim dan masyarakat Rohingya. Ratusan warga Rohingya diyakini telah dibunuh dan ribuan dari mereka kehilangan tempat tinggal akibat serangan dari pihak esktrimis.

Loyalis Anas Tetap ... “Proses pemberhentian Anas tak memerlukan kehadirannya, tetapi cukup dengan surat keputusan pemberhentian ditandatangani majelis tinggi,” ujarnya. Ulah politisi internal Sementara Wakil Ketua Dewan Pembina Partai Demokrat Marzuki Alie menilai keterpurukan elektabilitas partainya dalam dua tahun terakhir akibat ulah politisi internal yang lebih memikirkan kepentingan pribadi. Demokrat tidak dibangun untuk kepentingan partai bersama, melainkan dijadikan ken-

2 Polisi Aceh ... Oknum polisi Briptu DN yang merupakan anggota Polsek Darul Kamal kata Sigit ditangkap Sabtu di Desa Lamkunyet Darul Kamal Aceh Besar. Barang bukti 0,5 gram sabu. Sementara Brigadir DM ditangkap di kawasan Desa Peurada, Kec .Baiturrahman dengan 0,5 gram sabu. “Yang oknum ini hanya

Ada-ada Saja ... penduduk dari desa memilih tinggal di kontainer-kontainer bekas yang sudah tidak terpakai. Dengan membayar sekitar Rp600 ribu per bulan, mereka akhirnya tinggal di rumahrumah logam di pinggiran kota Shanghai. Banyak yang menyebutkan rumah-rumah terbuat dari kontainer ini sebagai “Desa Kontainer”. Pembuatan rumah logam ini dicetuskan oleh pria berusia 70 tahun. Biasanya penduduk setempat memanggilnya dengan nama ‘Orang Tua’. Pria tua ini merasa kasihan dengan para pendatang yang tak memiliki tempat tinggal.

HISTORY ... Harian ini mencatat dalam kurun waktu 2012-2013 menjelang beroperasinya KNIA, sejumlah pejabat tinggi negara hingga pejabat DPR RI telah melakukan ujicoba dari Stasiun KA Medan ke KNIA melewati Stasiun KA Araskabu yang hanya tinggal perampungan stasiun di dalam areal KNIA, tepatnya di depan terminal utama bandara bernilai triliunan tersebut. Nah, itu kondisi modern Stasiun KA Araskabu terkini. Namun pada era zaman Jepang, sekitar tahun 1943, stasiun kecil itu memiliki cerita sejarah yang memilukan karena memakan korban jiwa pegiat kesenian Indonesia yang akan tampil di pentas seni Pematangsiantar. Saksi sejarah dari daerah Araskabu sendiri bisa dihitung yang masih hidup. Tak heran, salah satunya sudah usia lanjut, yakni Atok Syamsuddin, 89. Saat ditemui di kediamannya di Jalan Besar LubukpakamPantailabu, tepatnya kawasan Araskabu, Atok Syamsuddin mengaku sudah agak lupa, namun ayah dari lima putri ini tampak bersemangat saat mengisahkan sejarah berdarah di Stasiun KA. “Pada masa itu saya guru madrasah di Pasar Sore, begitu pun sempat mengikuti pendidikan militer yang dilatih oleh tentara Nippon (Jepang),” ujarnya mengawali kisahnya. Atok Syamsuddin mengaku kejadian itu pada pagi hari, secara tiba-tiba pesawat tentara sekutu menge-brand (tembakan dari pesawat) ke arah gerbong KA di stasiun KA Araskabu. “Warga sekitar jelas berlarian, banyak korban, khususnya penumpang KA. Selain jiwa juga ada yang luka parah di antaranya kakinya patah karena serangan mendadak tersebut,” ujarnya tampak semangat mengingat runutan cerita sejarah tersebut. Lelaki berusia senja ini tampak sumringah saat berhasil mengingat jenis KA korban serangan mendadak tentara sekutu tersebut. “Namanya kalau tidak salah DMS. Pasca serangan tiba-tiba itu, para korban langsung diangkut dengan truk dan warga sekitar berjaga-jaga di lingkungannya masing-masing,” katanya sembari mengkhatamkan kisahnya bahwa serangan itu karena tentara sekutu melihat pakaian kebesaran Jepang di KA dan stasiun tersebut.

Umum periode 2013-2015, dengan mengutamakan musyawarah dan mufakat sebagai salah satu sikap demokrasi seperti yg tercantum dlm AD/ ART partai Demokrat Anggota SC KLB PD yang juga anggota DPR RI asal Aceh, Teuku Riefky Harsya mengatakan perkembangan keinginan DPD dan DPC sebelum KLB dimulai untuk meminta SBY turun gunung memimpin langsung Partai Demokrat sebagai Ketua umum periode 2013-2015 perlu pertimbangan

Rp 600 Juta ...

tidak aktif. Hari itu juga, Kalwant Singh didampingi dua karyawan dan anaknya serta seorang pria mengaku staf pelaku datang ke Mapolsek Medan Baru dan sekaligus membuat pengaduan. Kapolsek Medan Baru Kompol Jean Calvijn Simanjuntak mengatakan, pihaknya masih memeriksa pria yang disebut staf tersangka pelaku. Selain itu juga korban dan sejumlah saksi masih dalam pemeriksaan. Sedangkan pelakunya hingga kini masih dalam lidik. “Kita sudah turunkan personel ke Tempat Kejadian Perkara (TKP) untuk melakukan menyelidikan dan sekaligus mengumpulkan berbagai informasi yang menyaksikan kejadian itu,” jelasnya. Seusai menjalani pemeriksaan, pria yang disebut staf pelaku mengatakan, dia mengaku

staf karena sebelumnya disuruh oleh pelaku. “Saya sudah jelaskan kepada korban dirinya bernama Hendri Gunawan warga Jln. Mustafa Medan dan dia pemilik mobil rental,” jelasnya. Hendri menambahkan, pelaku berlogat Jakarta itu merental mobilnya dua hari Selasa dan Kamis. ‘’Saya sendiri yang membawa mobil. Hari Selasa (26/3) saya menjemputnya di Hotel Tiara dan Kamis (28/3) menjemput di Hotel Aston Medan. “Saya ada tanya pelaku di mana kerjanya dan tinggal di mana, tapi pelaku marah dengan mengatakan jangan kamu tanya di mana alamat saya dan tempat tugasnya, kamu sebagai sopir ikuti saja perintah ke mana tujuan. Tapi logat bicaranya seperti tinggal di Jakarta,” jelas Hendri meniru ucapan pelaku tersebut. (m36)

kepada semua pihak bahwa keamanan bukan hanya tanggungjawab aparat kepolisian namun juga masyarakat. “Cukup peristiwa ini yang terakhir terjadi. Jangan ada lagi kekerasan yang mengorbankan aparat,” ujar Gubsu.

Sementara itu tangis pilu ratusan pelayat mewarnai misa terakhir di rumah duka. Duka kehilangan jelas terlihat di wajah istri almarhum, P Situmorang dan ketiga anak Mei Stephanie, 22, Lestari, 18 dan Daniel, 16, yang mendampingi jenazah. (m28)

rangan pada sejumlah wartawan di Medan, Jumat (29/3). Menurut Azis, kegiatan ini juga dilambangkan sebagai bagian dari pengukuhan kedatukan atau kejeruan negeri Langkat, sekaligus pengukuhan Kepala Balai adat dan penghulu adat. “Ini menarik, karena acara ini baru terlaksana setelah 56 tahun kejadian revolusi sosial di masa Sultan Mahmud,’’ tambah mantan pejabat yang sempat menduduki posisi Kepala Dinas Perindustrian dan Perdagangan Provinsi Sumatera Utara. Ada enam orang penerima anugerah gelar adat seperti Bupati Kutai Timur Isran Noor, Bupati Langkat H.Ngogesa Sitepu, Prof Dr Hj Mariam Barus, Prof

Dr Ir H Djohar Arifin Husin, Mayjen (Purn) H Barkah Tirta Djaya dan Kol (Purn) Bahtiar Djafar. HT Azwar Azis menyinggung, selain pemberian anugerah adat yang direncanakan akan dilaksanakan di areal Masjid Azizi Tanjungpura Langkat, tercatat juga akan dilakukan pemberian penghargaan pada putra/putri berprestasi di bidang masing-masing. Disampaikan Azis kembali, bahwa ada pihakpihak yang sempat mengklaim dan mengatasnamakan kesultanan Langkat. Untuk itu bagi masyarakat Melayu melalui kegiatan ini akan semakin membuka wawasan bersama dan masyarakat diharap tak menjadi bingung. (m07/rel)

Serangan hebat atas etnis Rohingya sebelumnya terjadi di wilayah Rakhine, dimana etnis Rohingya terus mendapatkan tindakan disrkiminatif baik dari warga maupun pemerintah. Siap gunakan kekuatan Presiden Thein Sein mengatakan pemerintahnya siap untuk menggunakan kekuatan jika perlu untuk menghentikan kerusuhan antara Muslim dan Buddha yang berdampak ke berbagai kawasan sejak meletusnya pekan lalu. Dalam komentar pertamanya mengenai kerusuhan itu, Thein Sein memperingatkan dalam pidato televisinya bahwa dia akan membuat semua upaya hukum untuk menghentikan ‘para oportunis politik dan ekstrimis agama’ yang berusaha untuk membangkitkan kebencian antar keyakinan.

Kerusuhan antar umat beragama terakhir meletus 20 Maret dengan kerusuhan yang dibangkitkan umat Buddha yang ditujukan pada umat Islam di Meikhtila, Myanmar Tengah, yang mengakibatkan sekurangkurangnya 40 orang tewas dan menyebabkan 12.000 lainnya kehilangan tempat tinggal. Kerusuhan itu meluas ke sejumlah kota lainnya yang terletak 160 km di utara kota terbesar Yangon. Thein Sein berada di luar negeri pada saat meletusnya kerusuhan. Dia mengatakan hari Kamis (28/3) bahwa pemerintah “tidak ragu-ragu untuk menggunakan kekuatan segera terutama karena kita tidak ingin membiarkan sesuatu terjadi dalam masa transisi demokrasi dan upaya reformasi yang sedang berlangsung.” (ok/m10)

daraan atau wadah mencari keuntungan sendiri maupun kelompok tertentu. “Partai hancur karena kepentingan pribadi mengemuka daripada kepentingan partai. Apa yang saya lakukan untuk menegakkan marwah partai,” katanya. Saat disinggung soal aspirasi dan dukungan daerah yang menginginkan dirinya menjadi ketua umum, Marzuki sama sekali tak mau berkomentar. Ia menyatakan sepenuhnya akan mendukung keputusan majelis tinggi untuk memilih nakhoda partai. Pada sisi lain, ketua DPR RI ini mengklarifikasi ditegur SBY karena dituding mengumpulpemakai saja. Jadi ada BB yang jatuh kemudian dipungut oleh pelaku. Tapi memang maunya begitu akan kita tindak juga,” kata Sigit. Untuk mempertanggungjawabkan perbuatannya, keempat tersangla berikut barang bukti kini mendekam di sel Polda Aceh. Pelaku dijerat dengan undang-undang narkotika No 35 tahun 2009 dengan pidana minimal 5 tahun penjara. (cb06)

kan puluhan DPC untuk mendukungnya sebagai calon katua umum. “Kalau itu silakan tanya langsung ke Mas Ibas, karena koordinasi dengan Mas Ibas. Artinya, info tersebut tidak tepat. Apa yangmauditegur?”tanyaMarzuki. Sehari sebelum KLB resmi dibuka, pengurus daerah Partai Demokrat yang menyebut diri sebagai loyalis Anas masih ngotot melakukan perlawanan, bahkan tetap akan memajukan figur calon ketua umum yang akan didukungnya, di luar kandidat SBY. Tridianto yang sudah berada di Bali meskipun tak masuk dalam peserta undangan, menyatakan sudah mantap untuk mencalonkan diri sebagai ketua umum pada arena KLB. Suara pengurus daerah yang mendukung dirinya, diklaim Tridianto merupakan loyalis mantan Ketua Umum Partai Demokrat Anas Urbaningrum. Daerah pendukungnya berasal dari pengurus DPC wilayah Jawa, Kalimantan, Sumatera, Bali, Maluku dan NusaTenggara. Sekarang ini, kata Tri, para pendukungnya itu telah mendarat di Bali. (aya)

“Sedih tetap harus sedih, berduka tetap berduka. Tapi tatap putra putri yang perlu kasih sayang, mudah-mudahan dengan ketegaran ibu Situmorang dapat menjadi teladan dan sumber semangat bagi putraputri sehingga membangun karakter mereka agar menjadi orang sukses di kemudian hari,” ujar Gubsu saat memberikan sambutan. Gatot juga mengingatkan agar jangan ada lagi peristiwa tragis yang mengorbankan aparat sebagaimana yang menimpa AKP Andar Y Siahaan. Seperti diketahui Kapolsek Dolok Pardamean, Simalungun ini tewas pada Rabu (27/3) dengan cara dibantai massa saat penggerebekan markas judi di Desa Rajani Huta, Kec Dolok Pardamean, Simalungun. Andar sempat menyelamatkan tiga anak buahnya dan menghadapi sendiri serbuan massa yang kemudian menewaskannya. Menurut Gubsu, peristiwa yang sangat disesalkan tersebut hendaknya dapat memberikan pembelajaran dan kesadaran

Akhirnya ia mengumpulkan kontainer-kontainer bekas dan merenovasinya dengan menambahkan pintu, jendela, aliran air, dan listrik. Menurut Li Yanxin, seorang penduduk “Desa Kontainer” yang sudah tinggal selama 10 tahun, awalnya orang tua itu membuat tumpukan kontainer sebagai gudang. “Namun, setelah melihat kami para pendatang terluntalunta tanpa rumah, ia memutuskan untuk menyewakan kepada kami sebagai tempat tinggal,” Kata Li Yanxin, penduduk asal Provinsi Anhui, dilansir Daily Mail, Kamis (28/3). Banyak warga yang menanyakan bagaimana rasanya tinggal di ‘rumah logam’ itu. Li

Yanxin menjelaskan, wadah besi ini cukup kuat dan rapat, sehingga tak perlu khawatir atapnya akan runtuh dan bocor saat hujan. “Saya merasa senang tinggal di kontainer ini. Kami telah diselamatkan oleh pria tua itu. Dia telah menyediakan kami tempat tinggal yang cukup nyaman dan aman,” ujar Li Yanxin. Selain di pinggiran kota Shanghai, Desa Kontainer juga ada di pinggiran kota Gaoqiao. Khawatir makin menjamurnya Desa Kontainer di daerah pinggiran kota, pemerintah daerah Gaoqiao menyatakan bahwa tinggal di Desa Kontainer sangat berbahaya bagi penduduk. (vvn/rzl)

bertentangan dengan UndangUndang Dasar 1945. “Pada dasarnya, konstitusi negara kita mendukung terciptanya perdamaian di dunia ini,” sebut Leo Imsar. Leo mengaku heran dengan pihak Barat, yang selama ini selalu membesar-besarkan gerakan Hak Asasi Manusia (HAM) dengan standar ganda dalam melihat persoalan HAM. Sebagai contoh, betapa negara Eropa dan Amerika Serikat langsung bereaksi keras saat pemimpin gerakan demokrasi Myanmar bernama Aung San Suu Kyi ditahan oleh Pemerintah Myanmar. “Namun, saat pemerintah melakukan pembantaian terhadap kaum Muslim di negara yang sama, pihak Barat dan AS malah tutup mata, tidak memberikan reaksi apaapa. Masyarakat internasional diam saja. Ini sangat ironi,” sesal Leo Imsar. Dijelaskan Leo, terjadinya perburuan dan pembunuhan terhadap umat muslim Myanmar dan penghancuran masjid-masjid serta pembakaran puluhan ribu rumah warga muslim Myanmar oleh masyarakat Buddha Myanmar adalah karena sikap pembiaran pemerintah Myanmar yang diskriminasi terhadap warga muslim Myanmar. Setelah pembantaian warga muslim di Rohingya, kini

Sekelumit kisah sejarah Syamsuddin diperkuat oleh mantan pejuang dan pegiat sejarah Sumut-Aceh, Muhammad TWH. Lewat telefon selular, lelaki yang juga masuk usia senja ini tetap cas memorinya saat ditanya soal sejarah berdarah Stasiun KA Araskabu. “Ya, di dalam KA itu rombongan kesenian pimpinan Lilik Suheri yang akan tampil di Pematangsiantar. Masa itu pesawat tentara sekutu memang sering seliweran di udara dan hari itu sekitar tahun 1943 hanya dengan melihat pakaian seragam yang berbau Jepang mereka langsung melepaskan timah panasnya, seperti kejadian di Stasiun KA Araskabu yang pada saat itu posisi KA sedang berhenti,” sambarnya via selular. Menurut Muhammad TWH, masa itu banyak pegawai KA mengenakan seragam seperti milik Jepang. “Nah, tentara sekutu memang sering menyerang tiba-tiba, akibatnya rombongan kesenian pimpinan Lilik Suheri banyak jatuh korban. Beruntung Lilik selamat, namun setahu saya, selain banyak korban luka parah juga korban jiwa di antaranya penyanyinya bernama Misrobi,” sebutnya yang butuh durasi dua menit mengingat nama-nama korban jiwa tersebut. Muhammad TWH menyebutkan, bukti peristiwa bersejarah di Stasiun KA Araskabu kini tersimpan di Stasiun Radio Republik Indonesia (RRI) Medan. “Lilik Suheri menyentil Jepang dan pasca kejadian berdarah itu, dia menciptakan lagu Araskabu dalam bentuk musik instrumentalia,” ujarnya mengakhiri kisah sejarah itu, sembari mengilustrasikan awal musik instrumental bersejarah karya Lilik Suheri tersebut. Stasiun KA Araskabu (ARB) yang terletak pada ketinggian +7,23 m dpl ini berada di Divisi Regional 1 Sumatera Utara dan Aceh. Stasiun yang berada di tengah-tengah persawahan dan kebun penduduk ini saat ini menjadi persimpangan menuju Bandara Kualanamu. Saat ini jalur menuju Bandara Kualana-mu sudah jadi. Hanya menunggu pembangunan stasiun di bandara yang direncanakan akan diresmikan dengan bandara sendiri. Stasiun Araskabu memiliki 2 jalur KA, yakni 1 jalur lurus dan 1 jalur belok untuk persilangan kereta api. R. Anwar

yang matang dan baik oleh beliau (SBY) maupun pemilik suara, mengingat karena jabatan dan kegiatan beliau sebagai Kepala Negara (Presiden RI). Riefky menambahkan meski nantinya SBY menerima permintaan kader, wacana adanya posisi Ketua Harian yang bertugas untuk penanggung jawab pelaksanaan roda organisasi sehari-hari diharapkan sebagai solusi alternatif untuk juga menjadi satu kesatuan keputusan dalam KLB ini.(rel)

JAKARTA (Waspada): Kongres Luar Biasa Partai Demokrat sudah siap digelar di hotel Inna Grand Bali Beach, Sanur, Bali, Sabtu dan Minggu (30-31/3) ini. Memasuki Sanur, Bali, bendera Partai Demokrat bertaburan, melambangkan kemegahan pesta pemilihan ketua umum PD ini. Ada sekitar 1.000 peserta yang datang pada KLB pada 3031 Maret nanti. Jumlah peserta, terdiri dari 575 orang yang memiliki hak suara. Terdiri dewan pembina (5 suara), DPP (3 suara), departemen luar negeri (1 suara), sayap partai (3 suara), DPD 2 suara total 66 suara dan DPC 1 suara total 497 suara. KLB PD yang digelar di Bali ini diadakan dengan sederhana dengan semangat konsolidasi dan pikiran yang jernih untuk perbaikan Partai. Agenda utamanya apalagi kalo bukan untuk melakukan pemilihan kekosongan Ketua

Keduanya kemudian menyerahkan uang tersebut kepada pelaku. Untuk mendapatkan uangrupiahnyakaryawankorban bersama seorang pria yang mengaku staf pelaku langsung disuruh pergi ke customer service yang berada di lantai II Bank Sumut. Ketika menuju ke customer cervice, bertemu dengan karyawan Bank Sumut yang bertugas di CS itu dan keterangan dari karyawan bank itu menyatakan kalau nomor rekening tersebut tidak ada atas nama Ir. Jaka Hermato. Mendapat penjelasan itu, keduanya segera kembali menuju ke lantai V Bank Sumut dan mencari Ir. Jaka Hermanto, ternyata pelaku sudah tidak ada di lokasi. Karyawan korban mencoba menghubungi handphone pelaku ternyata sudah

Gubsu: Jangan ...

Aliansi Ormas Islam ...

Pria Barumun Takut ... Pasalnya, menurut sejumlah warga bersama kepala desa Aek Buaton kepada Waspada, Jumat (29/3), saat ini warga masih diselimuti rasa takut untuk beraktivitas terutama para suami mencari nafkah. Tidak ada pilihan lain, kaum wanita di desa itu menyusup mencari nafkah dengan cara menderes di areal kebun rambung warga maupun merawat dan memanen kebun sawit. Warga meminta pemerintah daerah memulihkan keamanan masyarakat. (a33)

Selamat Jalan Anggotaku ... Kemudian secara bergantian, pejabat yang hadir memberi penghormatan terakhir dengan menabur bunga. Mereka Kapoldasu Wisjnu, Gubsu Gatot Pujo Nugroho dan Pangdam I/BB Mayjen TNI Lodewijk F Paulus. Usai pemakaman, Kapolda kembali memberi pengharapan kepada keluarga yang ditinggalkan untuk tetap bersabar, mengelus rambut ketiga anak Andar agar selalu menghubungi dirinya bila membutuhkan sesuatu. Diikuti pejabat lainnya, seperti Waka Poldasu Brigjen Basarudin, Bupati Simalungun JR Saragih, Kapolres Simalungun Andi Syahriful Taufi, seluruh pejabat Poldasu, pejabat TNI, Muspida Sumut dan Muspika Medan, menyalami istri dan anak-anak Andar sebagai tanda turut berduka. Meminta maaf Bupati Simalungun JR Saragih secara khusus menyampaikan permohonan maaf kepada Polri atas peristiwa tersebut. “Simalungun sedang berduka, atasnama masyarakat Simalungun saya menyampaikan belasungkawa dan permohonan maaf atas peristiwa yang terjadi,” kata dia usai pemakaman. Kompol (Anumerta) Andar Siahaan meninggal dunia setelah dianiaya seratusan massa di Desa Butu Bayu Panei Raja, Kecamatan Dolok Pardamean, Kabupaten Simalungun saat menggerebek praktik perjudian toto gelap, Rabu (27/3) malam. Dia bersama tiga anggotanya melakukan penangkapan setelah menerima informasi berkali-kali dari SMS tentang perjudian tersebut. (m27) pembantaian meluas ke kota Meikhtila (yang sudah ditetapkan dalam status darurat), kota Tatkone, kotaYamethin dan kota-kota lain di Myanmar. Pemerintah Myanmar terlihat tidak serius menangani kerusuhan etnis ini, karena keberpihakannya kepada umat Buddha yang mayoritas di Myanmar. Leo Imsar mengutip isi surat Al Baqarah ayat 217 yang isinya: Dan orang-orang kafir tidak akan pernah berhenti membunuh kalian (umat Muslim) sampai mereka mengembalikan kalian meninggalkan agama. Ini artinya, sampai kapan pun orang-orang kafir akan memusuhi umat Islam di seluruh dunia dan pemimpin negara-negara Islam harus kompak dan bersatu untuk menyelesaikan konflik agama di Myanmar. Pemerintah Myanmar harus menyadari bahwa pembantaian terhadap umat muslim oleh mayoritas umat Buddha di Myanmar dapat menyulut sentimen keagaman dan ketidaksenangan Umat Islam di dunia (termasuk Indonesia) terhadap umat Buddha yang dapat menimbulkan permasalahan dan konflik agama jadi melebar. Aliansi Ormas Islam mendesak agar Presiden SBY untuk dapat segera mengambil langkah-langkah politis baik dalam lingkup ASEAN maupunn dunia Internasional untuk menghentikan pembunu-

Al Bayan ... Taring-taring pengkhianat akan segera dipatahkan oleh kekuatan Islam yang dahsyat. Ideologi taghut akan runtuh di mana-mana meski mereka mempertahankan dengan senjata dan teknologi canggihnya. Gempita kebangkitan Islam mulai terasa, gaungnya melintasi gunung, dan lembah-lembah. Para pejuang Islam bangkit mengamalkan Alquran, ibu-ibu mengajak kaum lelaki ke masjid, pemuda-pemuda muslim mengajak perempuan menggunakan busana muslimah. Itulah contoh yang positif. Kita teringat seruan ulama besar Mesir, Syeikh Muhammad al-Gazali. “Wahai pemuda, maju terus memperjuangkan hukum Alquran! Seba-

han massal umat muslim di Myanmar. Kepada umat Muslim Indonesia, Ormas/Orpol dan masyarakat cinta damai di Indonesia, Aliansi Ormas Islam mengimbau untuk bersama-sama membantu umat muslim Myanmar yang saat ini sedang dizalimi dan dalam kondisi yang sangat mengkhawatirkan. “Semoga Allah SWTmemberi kekuatan dan ketabahan kepada saudara kita muslim di Myanmar,” harap Leo Imsar. Sementara itu, Ketua Forum Umat Islam Sumatera Utara Ustadz Sudirman Timsar Zubil mengatakan secara politis posisi Indonesia lebih kuat ketimbang Myanmar. Buktinya Myanmar selalu menyatakan bahwa Indonesia merupakan negara yang dicontoh Myanmar dalam menjalankan proses demokratisasi. Berkaca dari kondisi ini Presiden semestinya menyatakan sikap protes atas pembantaian muslim Rohingnya. “Pemerintah harus mengirim surat nota diplomatik protes keras terhadap Pemerintah Myanmar,” tegas Leo Imsar. Timsar Zubil meminta, Majelis Ulama Indonesia dan pimpinan ormas-ormas Islam mengutuk keras tindakan biadab yang dilakukan oleh tentara Myanmar dan umjat Buddha terhadap kaum muslim Rohingya dan umat Muslim khususnya di Myanmar. (h04)

ik-baik hukum adalah hukum Allah. Tantangan pasti ada dari kaum munafik yang pura-pura tak tahu hukum Allah. Hadapilah tantangan itu dengan sabar dan tawakkal. Bukalah Alquran kepada mereka, tunjukkanlah dalilnya agar mereka mengerti. Sebab kini banyak orang ahli di bidang ilmu-ilmu dunia, tetapi mereka tidak ahli dalam bidang ilmu Allah”. Akhirnya mari kita berdoa: Ya Ilahi! berilah kekuatan kepada kami. Tunjukkilah kami ke jalan yang benar! terimalah taubat kami dan taubat pemimpin-pemimpin kami yang menyimpang dari ajaran-Mu. Jadikanlah negeri kami sebuah negeri yang aman dan damai. Persatukanlah hati kami dalam satu ideologi yang engkau turunkan dari langit. Ya Allah cabutlah kekuasaan dari orang-orang yang zalim.

Medan Metropolitan

WASPADA Sabtu 30 Maret 2013


Polresta Buru Pengedar Narkoba Sejumlah Tempat Hiburan Malam Dirazia MEDAN (Waspada): Adanya informasi tentang keberadaan pengedar narkoba yang sering beroperasi di sejumlah tempat hiburan malam, langsung ditindaklanjuti Polresta Medan. Jumat (19/ 3) dinihari, personel Polresta Medan merazia sejumlah tempat hiburan malam yakni karaoke Stroom Jln. Listrik, Station Jln. Wajir dan diskotik/ karaoke New Zone Jln. Wajir. Razia dipimpin Kabag Ops Polresta Medan Kompol Sugeng Riyadi, Kasat Intelkam Kompol Faisal Napitupulu, Kasat Reserse Narkoba Kompol Dony Alexander, Kasat Sabhara Kompol Tris, Kasi Propam Afdhal dan seratu-

san personel dan Polwan. Kabag Ops Polresta Medan Kompol Sugeng Riyadi mengatakan, razia ini sebagai bentuk kegiatan rutinitas untuk mempersempit peredaran narkoba. Razia pertama dilakukan di karaoke Strome Jln. Listrik. Polisi melakukan pemeriksaan terhadap setiap pengunjung yang berada di setiap ruangan KTV. Dompet dan tas yang dibawa pengunjungdiperiksaapakahada menyimpan narkoba atau tidak. Setelah melakukan pemeriksaan di beberapa ruang KTV yang berisi pengunjung di karaoke Strome ini, tidak ditemukan adanya pengunjung yang membawa narkoba. Razia kemudian dipindahkan ke karaoke Station Jln.Wajir. Di lokasi ini petugas kembali

melakukan pemeriksaan kepada setiap pengunjung karaoke, namuntidakditemukannarkoba. Terakhir razia dilakukan di karaoke New Zone tidak jauh dari karaoke Station. Di sini juga setiap pengunjung diperiksa namun tidak juga ditemukan narkoba. Kasat Reserse Narkoba Polresta Medan Kompol Dony Alexander usai razia mengatakan, razia yang digelar ini merupakan razia rutin yang dilakukan di tempat hiburan malam. “Razia di tempat hiburan malam akan terus kita laksanakan untuk mengantisipasi maraknya peredaran narkoba di Medan, khususnya di diskotik dan karaoke,” sebutnya. Menurut Dony, polisi terus berupaya menekan peredaran narkoba di Medan, dengan

melakukan razia di seluruh tempat hiburan malam, “Harapan kita Medan bisa bersih dari narkoba,” katanya. Dia meminta pengusaha hiburan malam mengawasi daerahnya agar tidak beredar narkoba. ”Pengusahanya kita minta mengawasi usahanya agar tidak dimanfaatkan orangorang tertentu mengedarkan narkoba. Kalau kedapatan, kita tangkap dan proses sesuai hukum,” tutur Dony. Selain melakukan razia hiburan malam, Sat Reskrim Narkoba Polresta Medan juga berupaya semaksimal mungkin melakukan pencegahan peredaran narkoba di wilayah hukum Polresta Medan dengan melakukan sosialisasi kepada para pelajar dan mahasiswa. (m39)

Waspada/Rudi Arman

KASAT Res Narkoba Kompol Dony Alexander (kanan) memeriksa barang milik pengunjung karaoke New Zone di Jln.Wajir Medan, Jumat (29/3) dinihari.

Polsek Medan Baru Amankan Perayaan Paskah MEDAN (Waspada): Personel Polsek Medan Baru mengerahkan 90 personel guna mengamankan perayaan perayaan Paskah di sejumlah gereja. “Setiap gereja dijaga dua personel,” kata Kapolsek Medan Baru Kompol Jean Calvijn Simanjuntak, SH, SIK, MH kepada Waspada ketika melakukan pengamanan gereja di Jln. Hayam Wuruk Medan, Kamis (28/3) malam. Calvijn didampingi Wakapolsek AKP Safaruddin Siagian, SH dan Panit Sabhara Polsek Ipda H Pasaribu, SH mengatakan, pengamanan itu dilakukan untuk mengantisipasi hal yang tidak diinginkan. “Perayaan Paskah di beberapa gereja berlangsung selama tiga hari,” jelasnya. (m36)

Waspada/Ismanto Ismail

KAPOLSEK Medan Baru Kompol Jean Calvijn Simanjuntak, SH, SIK, MH (dua dari kanan) didampingi Wakapolsek AKP Safaruddin, SH (kanan) melakukan pengamanan perayaan Paskah di gereja Jln. Hayam Wuruk Medan, Kamis (28/3) malam.

Medan Metropolitan


WASPADA Sabtu 30 Maret 2013

Waspada/Ismanto Ismail

BANGUNAN penangkaran walet di kawasan Jln. Gatot Subroto dekat Supermarket Berastagi, tidak tersentuh Tim Penertiban Pemko Medan. Hingga Jumat (29/3), bangunan tersebut masih tetap berdiri.

Instruksi Wali Kota Diabaikan Penertiban Bangunan Penangkaran Walet Terhenti MEDAN (Waspada): Instruksi Wali Kota Medan Rahudman Harahap agar seluruh bangunan penangkaran walet ditertibkan, ternyata diabaikan oleh instansi terkait di jajarannya. Penertiban bangunan penangkaran burung walet di tengah kota yang pernah dilakukan tim Pemko Medan, beberapa waktu lalu, kini terhenti.

Padahal, Rahudman pernah menyatakan, usaha penangkaran walet tersebut tidak memiliki izin dan tidak ada membayar pajak. Informasi yang diperoleh Waspada di lapangan, Jumat (29/3), Tim Penegakan Perda No. 12 tahun 2011 tentang Pajak Penangkaran Burung Walet yang dibentukWali Kota Medan dan dikoordinir Kasatpol PP M. Sofyan, pernah melakukan penertiban di kawasan Kesawan

Oknum Polisi Ditangkap Kasus Pencurian Mobil MEDAN (Waspada): Petugas Polsek Medan Kota menangkap oknum polisi Briptu EFS atas dugaan pencurian mobil. Dia ditangkap dari salah satu hotel di Jln. Sisingamangaraja, Medan. Kapolsek Medan Kota Komisaris Polisi Paulus H Sinaga ketika dikonfirmasi, Jumat (29/3), membenarkan penangkapan tersebut. “Sementara ini masih kita lakukan penyidikan sambil menunggu perintah dari pimpinan,” kata Sinaga, tidak menjelaskan lebih rinci kasus tersebut. Namun berdasarkan informasi diperoleh, oknum polisi yang bertugas di Satuan Pengamanan Objek Khusus (Pam Obsus) diduga mencuri mobil Toyota Kijang Kapsul LGX BK 254 RA dari penginapan IS di Jln. Junda Medan. Dia ditangkap setelah pemilik mobil membuat laporan ke Polsek Medan Kota. Dalam penyidikan diketahui mobil tersebut berada di parkiran Hotel S Jln. Sisingamangaraja, dan tak lama oknum polisi itu ditangkap atas dugaan keterlibatannya dalam pencurian mobil. Informasi lainnya menyebutkan, Briptu EFS pernah diringkus personel Polsek Medan Kota dalam kasus penggunaan narkoba. Saat itu dia ditangkap dari sebuah hotel dan divonis enam bulan penjara.(m27)

Kodrati Adakan Donor Darah MEDAN (Waspada): Komunitas Donor Darah Tirtanadi (Kodrati) bekerjasama dengan Unit Donor Darah Palang Merah Indonesia (UDD-PMI) Kota Medan, mengadakan kegiatan donor darah yang diikuti 120 orang dari pegawai kantor pusat maupun cabang, fungsionaris, dan kalangan umum, di aula kantor PDAM Tirtanadi Sumut Jln. SM Raja Medan, Rabu (27/3). Kegiatan tersebut dihadiri langsung Dirut PDAM Tirtanadi Ir Azzam Rizal MEng, yang ikut berpartisipasi melakukan donor darah. Dari kegiatan tersebut, panitia berhasil mendonor 106 orang pendonor/kantong darah untuk diberikan kepada PMI Kota Medan, guna diberikan kepada masyarakat yang membutuhkan darah. Dirut PDAM Tirtanadi Azzam Rizal didampingi Kabid Informasi dan Publikasi Divisi Public Relation Jumirin, Ketua Kodrati Gunawan Hari Mulia dan Sekretaris M Faisal kepada wartawan usai mendonorkan darah, berharap kegiatan donor darah ini dapat terus ditingkatkan dan mengagendakan setiap tiga bulan sekali dilaksanakan. “Kita menyambut baik terselenggaranya kegiatan donor darah ini dan mengajak pesertanya lebih banyak lagi bersedia melakukan donor darah untuk kemanusiaan,” ujarnya. Ketua Panitia Gunawan Hari Mulia mengatakan, kegiatan donor darah ini sudah keenam kalinya dilaksanakan sejak berdiri akhir 2011 bertepatan dengan HUT ke-106 PDAM Tirtanadi. Tercatat sudah 180 orang anggota Kodrati Tirtanadi dan sekitar 400 kantong darah didonorkan ke PMI. Sementara itu, Dr Maulana mewakili PMI Kota Medan mengakui, kebutuhan darah belum terpenuhi. “Targetnya 2.500 kantong/bulan dan sekitar 200 kantong/harinya harus disediakan PMI,” katanya.(cwan)


DIRUT Tirtanadi Ir Azzam Rizal MEng, melakukan donor darah yang dilaksanakan Komunitas Donor Darah Tirtanadi (Kodrati) bekerjasama dengan UDD-PMI Kota Medan.

dan Jln. Ahmad Yani. Namun, penertiban bangunan penangkaran walet yang pernah dilakukan pada akhir November 2012, kini tidak berjalan lagi. Kepala Satpol PP Kota Medan M. Sofyan mengakui belum ada lagi penertiban bangunan penangkaran burung walet. Sebab, setelah dilakukan penertiban, pemilik bangunan berjanji mengurus izin ke Dispenda Medan. “Setelah kita lakukan upaya penertiban waktu itu, pemilik bangunan penangkaran walet berjanji akan mengurus izin ke Dispenda Medan,” kata Sofyan. Karena itu, Satpol PP tidak lagi melakukan penertiban bangunan penangkaran walet. “Sekarang kita akan melakukan konsolidasi dulu dengan Dispenda. Setelah itu, kita melakukan upaya-upaya lanjutan,” tegasnya. Di tempat terpisah, Camat Medan Barat Sutan Tolang Lubis mengatakan, ada 94 gedung

penangkaran walet di Medan Barat yang tersebar di enam kelurahan. Pemilik penangkaran walet tersebut tidak memberikan laporan tentang kepemilikan izin dan pembayaran pajaknya kepada pihak Kecamatan Medan Barat. “Berdasarkan pendataan yang kami lakukan selama dua hari ini, ada 94 bangunan penangkaran walet di Kecamatan Medan Barat. Dari jumlah tersebut, tidak semuanya beroperasi. Kami akan terus melakukan validasi jumlah yang masih beroperasi,” ujar Sutan. Sementara itu, Kepala Dinas Pendapatan Kota Medan HM Husni menjelaskan, pengurusan izin usaha bangunan penangkaran walet itu dikelola Badan Pelayanan Perizinan Terpadu (BPPT) Medan. Setelah itu, pembayaran pajaknya ke Dispenda Medan. “Masalah bangunan penangkaran burung walet perlu

dibicarakan dengan instansi terkait. Pasalnya, usaha ini merupakan usaha perseorangan dan kita mengutip pajak badan usaha. Itu artinya harus ada izin usaha yang dikeluarkan oleh BPPT,” terang Husni. Selain itu, kata Husni, keberadaan bangunan penangkaran burung walet di tengah kota juga masih menjadi masalah tersendiri. “Kalau kita lihat, memang keberadaannya masih bertentangan dengan asumsi-asumsi karena tidak sesuai dengan tata ruang kota. Selain itu, keberadaannya yang dapat menimbulkan penyakit DBD. Karena itu, kita tidak mengejar target PAD dari penangkaran burung walet,” jelas Husni. Kendati demikian, lanjut Husni, bisa saja kawasan Medan Utara dapat dikembangkan untuk penangkaran sarang burung walet, sehingga tidak akan memperburuk estetika kota,” demikian Husni.(m50)

September, SBY Resmikan KNIA MEDAN (Waspada): Presiden Susilo Bambang Yudhoyono (SBY) dijadwalkan akan meresmikan Bandara baru Kualanamu atau Kualanamu Internasional Airport (KNIA) September 2013. Kepastian selesai pembangunan KNIA itu dikatakan Dirut PT AP-II Tri S Sunoko menjawab wartawan, Rabu (27/3), seusai pertemuan dengan Satuan Kerja (Satker) baik sektor private yang dibiayai AP-II maupun sektor publik yang dibangun dana bersumber dari APBN. Dirut AP-II yang didampingi Dirjen Perhubungan Udara Dephub Harry Bakti, GM AP-II Bandara Polonia Medan HT Sa i d R i d w a n m e n g a k u i , peresmian KNIA nantinya tidak dipaksanakan. Namun diyakini sisi udara (air side) maupun sisi darat (land side) diperkirakan

sudah rampung Juli 2013. “Kalaupun yang belum final saat peresmian hanya masjid dan hotel yang dipergunakan untuk penumpang transit,” kata Sunoko. Pada kesempatan itu turut hadir Deputi Bidang Ekonomi SekretarisWapres Tirta Hidayat dan M Ikhsan Tatang, Komisaris Utama AP-II, serta pejabat lainnya. Menurut Sunoko, uji coba (soft operation) akan dilakukan Juli 2013. “Uji coba itu perlu agar saat peresmian oleh Presiden SBY pada September tidak ada kendala lagi, artinya semua sinkron antara sisi darat maupun sisi udara,” ujarnya. Acara paparan di lantai 9 Hotel Arya Duta itu, diawali laporan Joko Waskito, selaku Ketua Proyek Invesment Unit (PIU) Bandara Kualanamu/KNIA. Secara umum pembangunan sudah selesai 94 hingga 95

Oknum Ketua OKP Bawa Sajam Ditangkap MEDAN (Waspada): Salah satu oknum ketua OKP Medan Tembung ditangkap petugas Polresta Medan karena dicurigai sebagai provokator dalam aksi demo di Jln. Selamat Ketaren, Kec. Percut Seituan, Kamis (28/ 3) malam. Tersangka MT alias Ucok, setelah menjalani pemeriksaan di Sat Reskrim Polresta Medan, ditahan dengan tuduhan membawa senjata tajam. Informasi di Polresta Medan, Jumat (29/3), malam itu terjadi aksi demo di Jln. Selamat Ketaren. Massa menuntut agar truk melebihi tonase yang membawa muatan bahan material untuk pembangunan proyek sebuah perumahan di lokasi itu, tidak melintas lagi di jalan tersebut. Dalam aksi itu, massa membakar ban bekas di tengah jalan. “Kita mendapat kabar kalau di lokasi itu berlangsung aksi demo, makanya kita turun ke lokasi kejadian. Namun, karena

jumlah massa cukup banyak dan aksi sudah mengganggu ketenangan dan ketertiban umum, kita minta bantuan ke Polresta Medan sehingga dilakukan pembubaran paksa,” kata Kapolsek Percut Seituan Kompol Erinal. Dalam pembubaran paksa itu, petugas mengamankan salah seorang oknum ketua OKP Medan Tembung berinisial MT yang saat itu berseragam lengkap. Turut juga diamankan, Ketua PPM Medan Barat Asmui dan Aswan. Selanjutnya, ketiganya dibawa ke Mapolresta Medan untuk proses lebih lanjut. “Awalnya saya mau melihat si Ucok yang dinaikkan ke mobil Dalmas. Saya bisa naik ke truk Dalmas namun tidak bisa turun. Setelah di Polres dan semalaman diperiksa, si Ucok ditahan dengan tuduhan senjata tajam. Sementara saya dan Aswan hanya disuruh buat surat pernyataan,” kata Asmui di Polresta Medan. (m39)

persen. Namun ada bagian-bagian yang sudah selesai 100 persen seperti terminal penumpang hanya tinggal memoles saja, terminal barang (cargo), area pengisi bahan bakar (avtur), alat bantu pendaratan pesawat atau Instrumen Landing System (ILS), landasan pacu (runway ) dan taxiway juga selesai. “Yang belum final pembangunan ruangan VIP, terkait dengan keinginan Pemprovsu. Sementara stasiun kereta api jalur bandara hingga saat ini sudah rampung lebih kurang 50 persen, begitupun dipastikan Juli dapat digunakan,” sebut Joko Waskito. Sementara itu, ketika pembicaraan masalah akses jalan non tol (jalan alteri) yang menghubungkan dari persimpangan kayu besar hingga Bandara Kualanamu, berjalan cukup alot. Terlihat antara Kepala Balai I Jalan Nasional Wijaya Seta dengan Staf Ekonomi Wapres Tirta Hidayat dan Dirjen Perhubungan Udara Harry Bakti berulang-ulang membahas akses jalan tersebut. Ada puluhan titik pembangunan jalan yang belum terhubung dari kayu besar hingga ke bandara. Namun, Wjaya Seta meyakini akan selesai Juli 2013, sementara akses jalan tol hingga saat ini belum dimulai ke sana. GM AP-II Bandara Polonia Medan HT Said Ridwan menambahkan, padatnya kegiatan penumpang di Bandara Polonia Medan, mengharuskan Bandara Kualanamu cepat digunakan. Misalnya, pergerakan pesawat setiap hari mencapai lebih kurang 183 pesawat, sebulan 5.490 pesawat bahkan setahun lebih kurang 66.795 pesawat. Sementara pergerakan penumpang/hari mencapai 21.637 orang, setahun diperkirakan mencapai 7.897.505 orang. Sementara pergerakan kendaraan roda dua dan empat, kendaraan pribadi yang masuk ke kawasan Bandara Polonia Medan 5.000 unit, taksi 1.000 unit, taksi umum 175 unit, dan kendaraan airline 180 unit. (m32)

Mantan Bendahara Kesbangpolinmas Divonis 14 Bulan Penjara MEDAN (Waspada): Mantan Bendahara Pengeluaran Badan Kesbangpolinmas Provsu Syarif Muda Hasibuan divonis selama satu tahun dua bulan (14 bulan) penjara, pada persidangan yang digelar di ruang Cakra IV Pengadilan Tipikor Pengadilan Negeri (PN) Medan, Selasa (26/3). Selain kurungan 14 bulan penjara, ketua majelis hakim M Nur juga membebani terdakwa denda Rp50 juta subsider dua bulan penjara. Tak hanya itu, terdakwa juga harus membayar Uang Pengganti (UP) sebesar Rp700 juta, dengan ketentuan apabila tidak dibayarkan maka harta bendanya dapat disita dan dilelang oleh jaksa. Di mana jika harta benda terdakwa tidak mencukupi untuk membayar uang pengganti, maka dapat diganti dengan hukuman badan selama tujuh bu-

lan penjara (subsider tujuh bulan penjara). “Menyatakan terdakwa secara sah dan meyakinkan bersalah melakukan tindak pidana korupsi dan menjatuhkan pidana penjara kepada terdakwa selama satu tahun dan dua bulan penjara,” ujar M Nur. Menurut hakim, adapun hal-hal yang memberatkan, terdakwa tidak mendukung program pemerintah dalam memberantas tindak pidana korupsi. Sementara hal yang meringankan, terdakwa tidak pernah dihukum, berterus terang saat persidangan dan sopan. “Terdakwa juga telah menyadari perbuatan yang dia lakukan. Selain itu terdakwa tidak menikmati uang hasil korupsi dan terdakwa tidak dibuat kaya atas perbuatannya tersebut,” kata hakim. Vonis yang dijatuhi majelis

hakim lebih rendah dari tuntutan jaksa. Sebelumnya, jaksa menuntut terdakwa selama satu tahun dan enam bulan penjara, denda Rp50 juta subsider tiga bulan kurungan serta menjatuhkan hukuman tambahan dengan membayar uang pengganti sebesar Rp700 juta. Jaksa menyatakan terdakwa terbukti secara sah dan meyakinkan melakukan tindak pidana korupsi sisa anggaran dana Badan Kesbangpolinmas Provsu Tahun Anggaran 2010 yang tidak disetorkan pada kas daerah. Terdakwa saat itu dianggap bersalah melanggar pasal 3 jo Pasal 18 Undang-Undang Nomor 20 Tahun 2001 tentang pemberantasan tindak pidana korupsi sebagai mana dalam perubahan Undang-Undang Nomor 31 Tahun 1999 tentang pemberantasan tindak pidana korupsi. (m38)


PRAKTISI Lingkungan Dewi Budiati TJ Said dan Kepala Badan Ketahanan Pangan Provsu Ir Setyo Purwadi saat meninjau Green House (Pertanian Organik) PT Manggadong Jaya di Sibolangit, Jumat (29 3), sebagai langkah awal untuk mensosialisasikan program pertanian perkotaan di kabupaten/ kota Sumatera Utara.

Memasyarakatkan Pertanian Perkotaan MEDAN (Waspada): Banyaknya terdapat lahan tidur di wilayah perkotaan, sebaiknya dapat diberdayakan menjadi lahan produktif dengan memasyarakatkan pola pertanian perkotaan. Hal itu dikatakan praktisi lingkungan Dewi Budiati TJ Said saat meninjau lahan pertanian Mangadong Jaya diSibolangit, Jumat (29/3). “Selain itu, dengan banyaknya terdapat lahan pertanian yang dikerjakan oleh kelompok masyarakat, dapat memanfaat sampah organik perkotaan sebagai kompos,” ujarnya. Menurut Dewi, seperti diketahuai saat ini banyak kelompok sadar lingkungan di kabupaten/ kota yang sudah menguasai cara membuat kompos dari sampah organik, hanya saja ter-hambat di pemasaran. Dengan membudayakan pola pertanian perkotaan di tiap kelurahan,

pupuk organik dari sampah basah ini dapat dimanfaatkan. Hal yang sama juga diungkapkan Kepala Badan Ketahanan Pangan Provsu Ir Setyo Purwadi. Kata dia, di beberapa wilayah kabupaten/kota masih terdapat banyak lahan kosong yang oleh pemiliknya dibiarkan ditumbuhi semak belukar, padahal kalau masyarakat mau memanfaatkannya menjadi lahan pertanian, akan sangat banyak keuntungan yang didapat baik secara ekonomi maupun secara ekologi. Selain itu, kata dia, dengan membudayakan pertanian perkotaan (urban farming) sebagai salah satu sarana ketahanan pangan masyarakat kota. “Dengan membudayakan pertanian perkotaan, sekaligus juga sebagai upaya masyarakat dalam melakukan penghijauan, tentunya kesemuanya ini harus diatur da-

lam satu konsep yang matang,” sebutnya. Artinya, lanjut Purwadi, kita juga sudah harus ikut memikirkan cara pemasarannya, sistem pinjam lahan, dan lain sebagainya. Menurut dia, hendaknya masyarakat perkotaan sudah harus melirik sektor pertanian sebagai lahan usaha, tak hanya sebatas membuka usaha restauran, café, dan industri lain. “Industri pertanian tak kalah maju apabila digarap secara professional,” tuturnya. Untuk itu, selaku Kepala Badan Ketahanan Pangan, Purwadi sangat mendukung gagasan para praktisi lingkungan seperti Dewi Budiati dan kelompok-kelompok Gapoktan lain yang ingin ataupun sudah bergerak mensosialisasikan pertanian perkotaan (urban farming). (cwan)

Medan Metropolitan

WASPADA Sabtu 30 Maret 2013


Masjid Raudhatul Islam Mulai Dibangun MEDAN (Waspada): Setelah tim dari Badan Hisab dan Rukyat Kanwil Kementerian Agama Provsu dan MUI Sumut menentukan posisi arah kiblat, Panitia Pembangunan Kembali Masjid Raudhatul Islam di Jln. Yos Sudarso Gang Peringatan, Kel. Silalas, Kec. Medan Barat, memulai pembangunan masjid tersebut, Jumat (29/3). Sejumlah buruh bangunan terlihat memasang resplang di

sekeliling masjid yang akan dibangun berlantai II itu. Beberapa titik lokasi tiang fondasi menyusul dibuat dengan menggali beberapa titik lubang. Ketua Panitia Pembangunan Kembali Masjid Raudhatul Islam Drs H Leo Imsar Adnans menjelaskan, pihaknya sudah menerima dana awal pembangunan dari Pemko Medan dan ditambah dari infak hamba Allah yang dikirim melalui nomor rekening 0287514316 di Bank BNI USU Medan atas nama Panitia Pembangunan Kembali Masjid Raudhatul Islam.

“Insya Allah, pembangunan akan berjalan lancar, apalagi bila ada dukungan dari para dermawan muslim dan hamba Allah lainnya yang ingin memberikan bantuan dana maupun materi,” sebut Leo Imsar Adnans yang saat itu didampingi oleh Ketua Forum Umat Islam Ustadz Sudirman Timsar Zubil, Ustadz Indra Suheri, dan Kuasa Hukum Aliansi Ormas Islam Sumatera Utara Pembela Masjid Drs H Hamdani Harahap SH, MHum, usai pelaksanaan shalat Jumat di masjid tersebut. Dijelaskan Leo Imsar, pihak-

nya telah membuka nomor rekening 0287514316 di Bank BNI USU Medan atas nama Panitia Pembangunan Masjid Raudhatul Islam, untuk memudahkan bagi para donatur dan hamba Allah yang akan memberikan sumbangan infaqnya untuk kelancaran pembangunan tersebut. “Pak Wali Kota sudah memberikan dana Rp100 juta sebagai tahap awal ke rekening panitia dan Rp200 juta lagi segera menyusul bila dana awal akan habis,” ujarnya. Warga setempat mengharapkan agar pembangunan

kembali masjid tersebut berjalan lancar dan secepatnya rampung, sehingga umat muslim bisa memanfaatkannya kembali untuk melaksanakan ibadah dan kegiatan syiar Islam di Masjid Raudhatul Islam. “Warga juga mengharapkan agar Pemko Medan segera memperbaiki infrastruktur berupa perbaikan jalan umum di kawasan tersebut, sebagaimana janjiWali Kota Medan saat melakukan peletakan batu pertama pembangunan kembali Masjid Raudhatul Islam,” tutur warga. (h04)

Capaian Imunisasi Di Sumut Rendah MEDAN (Waspada): Sebagian masyarakat dinilai belum memahami maksud dan keuntungan dari imunisasi. Sepanjang tahun 2012 jumlah bayi yang diimunisasi hanya 77,5 persen dari perkiraan jumlah bayi yang dilahirkan di Sumut yakni 299.299 bayi. Berdasarkan data di Dinas Kesehatan Sumut, bayi berusia 0 sampai 7 hari diimunisasi Hepatitis B hanya 231.767 bayi atau 77,5 persen. Bila dibandingkan standard Kemenkes RI yakni 80 persen, maka capaian imunisasi di Sumut masih rendah. Kepala Seksi Bimbingan Pengendalain Wabah dan Bencana Dinas Kesehatan (Dinkes) Sumut Suhadi SKM, Mkes, Jumat (29/3) mengatakan, masyarakat belum mengerti apa itu imunisasi dan belum memahami keuntungan dari imunisasi. Dia mencontohkan dengan biaya imunisasi Rp100 ribu (biaya negara) akan memperolah keuntungan Rp50 juta. “Misalnya dengan vaksin imunisasi lengkap seperti Dipteri, Tetanus, Hepatitis B, Campak, Polio, dan Tuberkulosis

(TB) anak akan terlindungi dari 10 penyakit. Kalau mengalami penyakit tersebut kemungkinan biaya yang dikeluarkan besar. Namun masyarakat juga takut kalau anaknya diimunisasi akan demam atau sakit, padahal efeknya itu sementara atau efek normal,” ujar Suhadi. Bahkan bila seorang anak mengalami Difteri (sakit saluran pernafasan) dan terlambat untuk ditangani, kemungkinan 75 persen bisa meninggal. Begitu juga anak yang mengalami Polio dan terlambat ditangani maka 90 persen kemungkinan bisa menyebabkansianakmeninggal. Menurut dia, Dinkes Sumut hanya melakukan bimbingan pembinaan dan pengendalian karena yang mempunyai standar pelayanan minimal (SPM) adalah kabupaten/kota. “Kita juga melakukan sosialisasi kepada pemangku kebijakan di kabupaten/kota dan melakukan pelatihan, on the job training,” sebutnya. Kata Suhadi, manfaat imunisasi Hepatitis B untuk mencegah virus Hepatitis B yang dapat menyerang dan merusak hati,

Satpam Harus Proaktif MEDAN (Waspada): Satuan Pengamanan (Satpam) harus peduli dan proaktif menjaga lingkungan tempat tugasnya untuk menghindari terjadi aksi perampokan, pencurian sepedamotor, dan kejahatan lainnya. Demikian ditegaskan Kapolsek Sunggal Kompol M Luther Dachi SSos, SH, kepada Waspada, Kamis (28/3) malam. “Satpam wajib menanyakan siapa saja orang yang masuk ke wilayah tempat tugasnya seperti di kompleks perumahan, kantor, pabrik. Lebih baik lagi tanda pengenal seperti KTP, SIM, STNK yang bersangkutan ditingggalkan di pos satpam dan dicatat dengan jelas. Kartu pengenal itu dikembalikan apabila yang bersangkutan meninggalkan kompleks tersebut,” katanya. Dachi yang didampingi Kanit Reskrim Iptu Bambang Gunadi Hutabarat SH, MH, dan Kanit Patroli AKP B Saragih SH mengatakan, satpam sebagai Pam Swakarsa di kompleks perumahan dan juga sebagai perpanjangan polisi. Menurut dia, hasil pengamatan dilapangan, satpam harus dididik SDMnya oleh pengelolanya, karena satpam adalah sebagai pelindung. Kata dia, pengelola harus membina satpam agar pekerjaan yang dilakukan penuh tanggungjawab, juga harus mengawasi kegiatan satpam. Selain itu, mengikutsertakan para satpam mengikuti pelatihan dasar di kepolisian. “Jangan hanya pakai baju seragam satpam saja, tetapi kulitasnya tidak diperhatikan,” tutur Dachi. Dachi mengharapkan, satpam tidak boleh lengah dan tetap waspada saat melaksanakan tugas. “Untuk mengantisipasi gangguan Kamtibmas, kita tidak bosan-bosan mengimbau satpam yang bertugas di kompleks perumahan maupun perkantoran dan pabrik agar selalu meningkatkan kewaspadaan,” ujarnya. (m36)

dan bila hal itu terus terjadi sampai si anak dewasa dapat menyebabkan kanker hati. Imunisasi Polio untuk mencegah virus polio yang dapat menyebabkan kelumpuhan. “Sedangkan manfaat imunisasi BCG yaitu mencegah tuberkulosis paru, radang otak yang bisa menimbulkan kematian atau kecacatan. Imunisasi DPT untuk mencegah terjadinya Difteri, Pertusis dan Tetanus. Penyakit Difteri dapat menyebabkan pembengkakan dan penyumbatan pernafasan, serta mengeluarkan racun yang dapat melemahkan otot jantung.

Kalau penyakitnya berat bisa menyebabkan terjadinya pneumonia. Kuman Tetanus mengeluarkan racun yang menyerang syaraf otot tubuh, sehingga otot menjadi kaku, sulit bergerak dan bernafas. Kalau penyakit campak berat dapat mengakibatkan radang paru berat (pneumonia), diare atau bisa menyerang otak,” tuturnya. Suhadi menerangkan capaian imunisasi untuk 33 kabupaten/kota di Sumut tahun 2012 yaitu untuk Hepatitis B231.767 (77,5 persen), BCG sebanyak 284.833 (96,1 persen), Polio 1 sebanyak 292.876 bayi (97,9 per-

Pemprovsu Komit Transparansi Keuangan MEDAN (Waspada): Pemerintah Provinsi Sumut (Pemprovsu) komitmen terhadap transparansi keuangan. Untuk itu dalam pengelolaan keuangannya, Pemprovsu senantiasa patuh dan berharap masukan dari Badan Pemeriksa Keuangan (BPK). Pemprovsu menyerahkan Laporan Keuangan Pemerintah Daerah (LKPD) tahun anggaran 2012 kepada Badan Pemeriksa Keuangan (BPK) RI Perwakilan Sumut, Kamis (28/3). Sekdaprovsu H Nurdin Lubis SH, MM, atas nama Gubernur Sumut H Gatot Pujo Nugroho ST, saat menyerahkannya kepada Plh Kepala BPK RI Perwakilan Sumut R Aryo Seto Bomantari berharap LKPD ini lebih baik dari tahun sebelumnya. Sejumlah pejabat teras Pemprovsu mendampingi Sekdaprovsu antara lain Inspektur Wilayah Provinsi Sumut H Dzaili Azwar, Staf Ahli Gubsu Dr H Arsyad Lubis dan H Fitriyus, Asisten Administrasi H Hasban Ritonga, Kepala Badan Kesbangpol Linmas Sumut H Eddy Syofian dan Kepala Biro Keuangan H Baharuddin Siagian. Plh Kepala BPK RI Perwakilan Sumut didampingi Kasubag Setkalan Iskandar Setiawan dan Kasubag Hukum dan Humas Mikael PH Togatorop. Sekdaprovsu mengatakan, penyerahan laporan keuangan

merupakan wujud komitmen Pemprov Sumut, untuk mengedepankan akuntabilitas dalam penyelenggaraan Pemda sesuai dengan standar akutansi pemerintahan dan aturan perundang-undangan yang berlaku. “Komitmen ini sudah dilaksanakan sejak lama dengan penandatanganan fakta integeritas bersama-sama seluruh bupati/ wali kota se Provinsi Sumut yang disaksikan oleh pihak-pihak kompeten,” ujarnya. Menurut Nurdin, Pemprov Sumut juga sungguh-sungguh menindaklanjuti saran dan temuan dari BPK dan senantiasa berharap adanya bantuan advis atau pemikiran dari BPKP untuk membantu proses keuangan agar penyelenggaran anggaran dapat berjalan lebih baik. “Kami berharap agar tahun ini opini yang diberikan yang lebih baik dapat kita wujudkan tentu dengan memperbaiki, menyempurnakan, serta merujuk dari catatan-catatan dan kelemahan-kelemahan dari tahun sebelumnya,” tutur Sekdaprovsu “Bapak Gubsu selalu mengingatkan dan memerintahkan bupati/wali kota untuk terus bekerja maksimal melayani masyarakat dan melaksanakan tugas-tugas pembangunan dan pemerintahan dengan akuntabilitas yang dapat dipertang-

Polsek Medan Kota Tangkap 10 Tersangka Kejahatan MEDAN (Waspada): Dalam sepekan, Polsek Medan Kota meringkus 10 tersangka tindak kejahatan dari berbagai lokasi. Dari para pelaku polisi mengamankan tiga sepedamotor, satu senjata tajam jenis kelewang, dan satu tas sandang. “Mereka ditangkapatas kasus narkoba,perampokan,pencurian sepedamotor, dan kepemilikan senjata tajam,” kata Kapolsek Medan Kota Kompol Paulus H Sinaga didampingi Kanit Reskrim Iptu Gunawan, Rabu (27/3). Menurut Paulus, dua ter-

sangka pencurian sepedamotor yakni AF, 27, warga Jln. Sutrisno, dan SP, 25, warga Jln. Rahmadsyah/Japaris. Dari mereka diamankan satu sepedamotor Kawasaki Ninja sebagai barang bukti. “Ada tiga laporan curanmor kita terima dengan modus menggertak korban, seakan korban menabrak adik pelaku, lalu merampas sepedamotor korban,” kata Kapolsek. Setiap berhasil merampas sepedamotor korbannya, pelaku menyerahkannya kepada orang lain untuk dijual dan

sen). Untuk imunisasi DPT/HB 1 ada 288.126 bayi (96,3 persen), Polio 2 sebanyak 285.924 (96,6 persen), DPT/HB 2 sebanyak 280.738yangdimunisasi(93,8persen) dan Polio 3 sebanyak 280.780 yang dimunisasi (93,8 persen). Sementara itu, staf bidang wabah dan bencana program imunisasi Heti Sulistyowati SKM menambahkan, ada bayi yang diimunisasi di polio 1 tetapi tidak di imunisasi di polio 2 atau namanya drop out (tidak datang di pemberian dosis berikutnya). “Ini menyebabkan kekebalan tubuh si anak tidak maksimal,” katanya. (h02)

hasilnya dibagi rata. Tersangka AF dan SP, kata Kapolsek, ditangkap saat hendak merampas sepedamotor di Jln. Tenis. Namun korbannya melakukan perlawanan, dan berteriak rampoksehinggapelakudibekuk. Sementara tersangka kejahatan lainnya yang ditangkap berinisial Sur, 23, melakukan perampokan di Jln. Sisingamangaraja, MHH, 19, menjambret seorang wanita di Jln, Sakti Lubis, MR alias Riki, 18, menjambret di Jln, Pelajar. Kemudian TRA, 15, diaman-

kan karena membawa senjata tajam (sajam) jenis kelewang. Pelaku mengaku ingin membunuh geng kereta karena seorang temannya tewas akibat dianiaya. Lalu ASC alias Acuan, 36, A alias Surianto, 31, A alias Alao,32, ditangkap saat menggunakan narkoba dan disita bong (alat isap sabu-sabu) berikut satu paket sabu-sabu. Seorang tersangka lainnya BR, 37, ditangkap karena terlibat kasus narkoba dengan barang bukti dua paket ganja dan satu paket sabu-sabu.(m27)

Waspada/gito ap

TERSANGKA kasus perampokan, narkoba, curanmor, dan kepemilikan senjata tajam beserta barang bukti diperlihatkan Kapolsek Medan Kota kepada wartawan.

gungjawabkan yang telah diamanatkan oleh peraturan dan perundang-undangan yang berlaku,” sebutnya. Sementara itu, R Aryo Seto Bomantari mengapresiasi proses penyerahan lapor an keuangan Pemerintah Provinsi Sumut tahun anggaran 2012 yang disampaikan sesuai jadwal dan laporan dari Pemprov Sumut ini mereka tindaklanjuti sesuai mekanisme yang ada. (m28)

Waspada/Arianda Tanjung

PANITIA Pembangunan Kembali Masjid Raudhatul Islam yang dipimpin Drs H Leo Imsar Adnans, Jumat (29/3), menyaksikan pemasangan resplang di samping kanan Masjid Raudhatul Islam sebagai tanda dimulainya pembangunan masjid yang sempat dirubuhkan oleh pihak pengembang PT Jatimasindo itu.

Cuaca Panas, Waspadai Tiga Penyakit Kulit MEDAN (Waspada): Ada tiga jenis penyakit kulit yang harus diwaspadai saat cuaca panas, yakni biang keringat, jamur, dan kulit kering. Jika mengalami biang keringat dan jamur tubuh akan terasa gatal. Namun jika kulit kering bisa mengakibatkan penuaan dini pada kulit dan kanker kulit. “Ada tiga yang harus diwaspadai, biang keringat, jamur, dan kulit kering. Kulit kering ini bisa menyebabkan penuaan dini pada kulit dan kanker kulit, tapi prosesnya lama dan jika seharian kena matahari,” kata Dokter Spesialis Kulit dan Kelamin RSU dr. Pirngadi Medan dr Irwan F Rangkuti SpKK, kepada Waspada, Kamis (28/3). Dijelaskannya, biang keringat terjadi karena air keringat atau partikel yang mengandung garam dapat menyumbat pori-pori. Biang keringat ini paling sering ditemui pada anak-anak. “Partikel itu lebih besar dari pori-pori kita, sehingga akan menyumbat pori-pori. Pada saat cuaca panas tubuh mengeluarkan keringat, tetapi karena adanya penyumbatan maka keringat tertahan di dalam kulit dan menyebabkan terbentuknya benjolan kecil berwarna merah,” sebutnya. Sedangkan jamur, kata Irwan, umumnya berkembang pada daerah yang lembab. Saat cuaca panas, tubuh akan mengeluarkan keringat

sehingga baju yang dipakai menjadi lembab. “Jamur membutuhkan kelembaban untuk berproduksi. Jamur akan berkembang biak di bagian kulit tubuh yang lembab,” ujarnya. Lainhalnyadengankulitkering. MenurutIrwan, kulit kering diakibatkan karena dehidrasi. Saat cuaca panas, seseorang mengeluarkan cairan dari dalam tubuh. Untuk itu, dia menyarankan perbanyak minumairputihdanbuah-buahansaatcuacapanas. “Kulit kering bisa menyebabkan penuaan dini pada kulit, kulit kering bisa juga disebabkan oleh pengaruh lingkungan seperti udara dingin, terkena sinar matahari terlalu lama,” tuturnya. Jika kulit dalam jangka watu yang lama terpapar matahari, kulit juga bisa mengalami kanker. “Sinar matahari itu bisa merubah sel menjadi ganas, selain itu kulit juga bisa cepat mengering karena dehidrasi dan berakibat pada penuaan dini,” katanya. Untuk itu, Irwan menyarankan agar tidak keluar rumah saat cuaca panas.“Gunakan baju yang tidak ketat, ganti segera ketika baju sudah kena keringat. Banyak konsumsi air dan buah-buahan, agar tidak terjadidehidrasi,”ujarnyasembarimengungkapkan, terjadi peningkatan sekitar 25 persen orang yang mengalami biang keringat. (h02)



Standar Servis Keamanan Kita Kian Rendah


ewasnya Kapolres Dolok Pardamean kembali mencoreng rasa keamanan kita. Sudah segawat inikah tingkat keamanan kita sehingga aparat kepolisian pun menjadi korban. Ini belum lagi dikaitkan dengan berondongan di sel tahanan yang dilakukan sekelompok orang di Sleman. Aksi dalam waktu sekira 10 sampai 15 menit itu sudah cukup menunjukkan bahwa rasa keamanan kita sedang tercabik-cabik. Pada siapa lagi kita mengadu dan meminta pertolongan saat hak kita sebagai warga negara sedang dalam bahaya. Tak berapa lama dari peristiwa itu maka muncullah insiden di Dolok Pardamean itu. Menurut susunan cerita dari kepolisian memang disebutkan bahwa Kapolsek tersebut sedang berusaha menangkap pelaku judi. Namun kemudian diteriaki maling sehingga memancing amuk warga. Lantas dia dan kawannya dikeroyok massa. Itu memang versi polisi. Hingga saat ini kita belum mendengar seperti apa sebenarnya kronologis yang terjadi versi masyarakat. Bisa saja berbeda. Mungkin ada yang belum terungkap dan kita harus sabar menunggunya. Sebab versi yang muncul baru dari satu pihak yaitu kepolisian. Bagaimana respon masyarakat setempat dan mereka yang sudah dijadikan tersangka atas kejadian tersebut? Benarkah seperti itu tinggal menunggu perkembangan saja. Namun sungguh kejadian demi kejadian membuat bulu kuduk kita bergidik membayangkan saat aparat keamanan tak lagi berfungsi maksimal. Itu baru dua kasus yang muncul. Bagaimana mungkin kita bisa terima kalau besok lusa ada lagi orang yang meneriaki polisi sebagai maling lantas tak jadi menegakkan hukum karena ketakutan. Berbagai peristiwa yang melibatkan aparat keamanan bermunculan. Ada lagi sesama aparat umbar senjata dan layaknya perang. Dimana posisi keamanan masyarakat jika sudah begini. Wajar kalau kita harus sadar bahwa standar servis keIntisari amanan untuk kita makin jatuh ke titik nadir. Sungguh ini beban berat. Bagi polisi dan Hingga kini kita belum masyarakat. Terutama untuk memberi jaakan mendapatkan solusi minan keamanan. Kita sering dengar tugas untuk itu. Bisa jadi masih kepolisian untuk toto tentren kerto raharjo. Menjadikan masyarakat aman dan harus menunggu bebera- makmur sejahtera. Kira-kira begitulah pepa tahun lagi hingga rasa ngertiannya. Era reformasi memang telah hilangnya respek masyarakat aman di lingkungan kita menunjukkan terhadap penegak hukum. sendiri. Sementara ini Lihat misalnya di jalanan bagaimana pelanggar lalu lintas bebas berkeliaran berbagai teror kejahatan para tak terjamah hukum. Begitupula dengan akan menerpa kita di ber- sanksi yang begitu saja gampang diselesaikan. bagai tempat. Aparat keamanan kita seperti kehilangan wibawa. Efeknya adalah masyarakat kurang mendapatkan perlindungan dan kehilangan kepercayaan. Sekarang masingmasing orang berusaha menjaga diri dan keluarganya dengan berbagai cara. Belum lagi jika kita melihat kondisi tentang standar antara rasio polisi dan jumlah masyarakat yang wajib dilindungi. Idealnya untuk rasio satu polisi berbanding dengan masyarakat sesuai standar PBB adalah 1: 300. Namun di berbagai wilayah Indonesia masih banyak porsinya 1:1.300 atau malah ada yang sampai 1:2.500. Rasionya begitu timpang. Padang di satu sisi polisi harus menghadapi kualitas dan kuantitas tingkat kejahatan dalam masyarakat yang terus meningkat. Tindakan-tindakan “operasi bersih” terhadap preman (baca: para penjahat) tahun 1990-an dan “Petrus” (pembunuhan misterius) di era 1980-an telah membawa efek kekebalan kejahatan. Para pelaku tidak lagi bisa ditakut-takuti dengan tembakan peringatan. Kesiapan Polri menghadapi kejahatan yang semakin meninggi itu hanya didukung oleh sekitar 40 persen personilnya yang mengikuti pendidikan reserse. Tidak tercukupinya jumlah polisi dalam melayani korban kejahatan bisa berakibat pada kondisi “kejahatan sebagai raja”. Hal ini dapat dirasakan warga masyarakat bila harus menghadapi atau melewati daerah-daerah rawan kriminal. Perasaan takut (fear of crime) menghantui warga masyarakat. Hingga kini kita belum akan mendapatkan solusi untuk itu. Bisa jadi masih harus menunggu beberapa tahun lagi hingga rasa aman di lingkungan kita sendiri. Sementara ini berbagai teror kejahatan akan menerpa kita di berbagai tempat.*


Faks 061 4510025

Facebook Smswaspada

+6285277850101 Demo 25/3 hanya pesanan Jahudi, contoh sudah ada, lihat Palestina, Irak, Libya, Mesir, Afrika dll (semua negara Islam). Mari kita lawan gerakan Jahudi (mengatas namakan HAM dan Demokrasi) ini. +6281397713513 Yth prof dr Syahrin Harahap.Ma.anda galau, resah. Tak menemukan jalan anda menyelesaikan masalah Islam bukan dengan sunnah dgn tiori tiorì dìluar sunnah atau anda mengenal Islam hanya pada kulit luarnya saja. +6285360700823 FPI razia perempuan berjilbab yg berduaan dgn lawan jenis bukan muhrim di cafe2 remang2 dan antar ke ortu/wali mereka apa mereka tahu dan setuju anak mereka seperti itu ? Kalau itu pelecehan terhadap agama islam laporkan kepengadilan +6281264974076 Seandainya Engkau kasihi daku,tunjuki aku jalan lurus terhampar, mohon penuhi dalam dadaku, iman dan yakin diiringi sabar. ( Selamat melaksanakan sholat fardhu Dzuhur ) +6285277882512 Bravo Waspada : Ass .. Pak Muspika atau pejabat yg berwenang di Kec. T.Tiram tolong ditinjau Parkir di Pelabuhan T.Tiram , mahal amat Pak .. Makasih Pak .. +6283194886867 Yth.... Bapak Bupati kami warga Masyarakat Tangkahan Durian Kec. Berandan Barat merasa KECEWA sama Bapak bUpati oleh karena Ka.Kelurahan yang bapak angkat menjadi Lurah sebelumnya pernah menjabat sebagai Bendahara Dinas P dan P Kec.Besitang, menurut informasi oknum tsb tidak menyetor premi asuransi Jiwasraya guru2 SD selama 4 thn kemudian juga menggelapkan gaji guru berserta gaji ke 13 Guru yg sdh Pindah tugas ke Propinsi Aceh sebanyak 7 bulan dia bekerja sama dgn Istrinya selaku Ka.Sekolah Guru yg telah Pindah tugas tsb, mohon diusut Pak, karena katanya selama ini tak pernah diusut oleh pihak terkait. Utk menjaga Citra Bapak Bupati kami mohon keseriusan Bapak dalam membasmi KORUPSI di wilayah Langkat ini, Jelasnya kami selaku warga meminta kepada Bapak Bupati utk segera MENCOPOT Jabatan Kepala atau Pimpinan bagi orang2 telah yg tersangkut Korupsi.. +6283199025981 KONFERENSI LUAR-BIASA P.D.I. PADA MASA dahulu di Asrama Hajji, Pangkalan Manshour Medan, menjadi kenangan tersendiri bagi Bu‘ Megawati Soekarnopoetri • Kemudian Beliau mendirikan Or.Pol. baru dan namanya ada kemiripan dengan yang di tinggalkannya, hanya ditambah huruf P • Or.Pol.yang berasal dari P.N.I. ditambah 4 Par.Pol. yang lebih kecil yang dilebur menjadi satu Or.Pol. ; P.D.I, kemudian lenyap ditelan Bumi • Sa-at ini , K.L. B. sedang di process oleh Partai Demokrat • Akan menjadi kenangan tersendiri bagi Bung Anas Urbaningrum • Siapa yang bakal ? Pohan ? Ulil ? Marzuki ‘Alie? Max Sopacua ? Nur hayati As-Segaf ? ‘Bune Agus ? “Seng ndi tho , Le‘ ?”# awal siang sabtu 23 march di meuligo t. ‘abdou l-ra‘uf kr. sikameng # +6281264100513 Kapolri dan seluruh jajarannya teristimewa kpd Detasemen 88 Anti Teror Mabes Polri diminta utk megungkapkan pelaku TERORISME di LP Cebongan DIY hingga menyebabkan tewasnya 4 tahanan titipan Polda DIY ,,,,,, MEMALUKAN ,,,,, !!! ,,,,, MEMALUKAN ,,,,, !!! ,,,,,, MEMALUKAN ,,,,, !!! bagi orang yg berpikir. +6282361561426 Pilih satu dari tiga : 1. Selamat Dunia Akhirat. 2. Selamat salah satu nya. 3. Hancur kedua dua nya.

WASPADA Sabtu 30 Maret 2013

Marjinalisasi Kesenian Rakyat Oleh H.Irham Taufik Umri, SH, MAP Kementerian Pariwisata dan Kebudayaan yang seharusnya membina kebudayaan/kesenian hanya fokus pada sektor pariwisata dan mengabaikan budaya.


alau unjuk rasa dilakukan oleh mahasiswa dan pemuda,itu lumrah terjadi, namun jika senimanberdemonstrasimerupakan pemandangan langka di negeri ini. Beberapa waktu lalu sejumlah seniman tergabung dalam Paguyuban Reog Ponorogo di Surabaya Jawa Timur mempelopori unjuk rasa besar-besaran. Mereka berjalan kaki long march sepanjang dua kilometer dari alun-alun menuju kantor Gubernur dan DPRD Jawa Timur Surabaya. Sepanjang perjalanan menuju lokasi mereka mengekspresikan tuntutannya dengan atraksi pertunjukan reog.Tentu saja pemandangan langka itu mendapat sambutanmeriahdarimasyarakatyangmenyaksikan di pinggir kiri kanan jalan yang dilalui pengunjukrasa.Dikantorgubernur,seniman reogitusilihbergantimelakukanorasidengan tuntutan agar pemerintahpusatsertapemerintah daerah provinsi, kabupaten/kota melindungisertamelestarikankeseniantradisional reog sebagai aset budaya bangsa Indonesia. Kalau dimaknai substansi, tuntutan mereka menunjukkan telah terjadinya keprihatinan mendalam karena semakin terpinggirkannya (marjinalisasi) kesenian rakyat tradisional reog. Namun kalau kita telusuri eksistensi kesenian rakyat di negeri ini, bukan hanya seni tradisional reog yang termarjinalisasi,tetapihampirsemuakesenianrakyat yang ada di pelosok tanah air mengalami nasib yang sama sama dengan reog. Media Perjuangan Sebelum diproklamirkannya kemerdekaan, negeri ini kaya dengan kesenian rakyat yang merupakan khazanah budaya bangsa. Kesenian rakyat tumbuh dari akar budaya suatu daerah, sangat digemari dan akrab dengan masyarakat dari berbagai kelompok umur. Secara umum, profil kesenian rakyat khususnya yang bernuansa komunikatif merupakan satu totalitas pertunjukan yang di dalamnya terdapat enam unsur, meliputi : cerita, musik, nyanyian, tarian, teater dan lawak. Keenam unsur tersebut dikemas dalam satu paket pertunjukan dan dipentaskan di atas panggung. Terangkumnya enam unsur dalam paket pertunjukan itu menjadikan kesenian rakyattersebutkomunikatif.Artinyakesenian rakyat berfungsi sebagai media informatif (penerangan/penyuluhan), edukatif (pen-

didikan) dan tentu saja entertaintment (hiburan). Kesenian rakyat yang popoler dan telah menjadi ikon di daerah asal, seperti Seudati(Aceh),Randai(SumateraBarat),Mak Yong dan Mendu (Riau), Dul Muluk (Sumatera Selatan), Lenong Betawi (DKI Jakarta), Dagelan (Jawa Barat),Wayang Kulit/Wong, ludruk, ketoprak, Reog (JawaTimur dan Jawa Tengah), Sinrilli (Sulawesi Selatan). Sedangkan di Sumatera Utara dikenal denganTonil Bangsawan dan Opera Batak. Karenakesenianrakyattersebuttumbuh dari akar budaya setempat, kehadirannya tetap ditunggu dan dinantikan masyarakat. Tidak mengherankan, jika kesenian rakyat ini digelar di desa dan kampung, masyarakat akan berbondong-bondong datang untuk menyaksikannya. Bahkan saking gandrungnya penonton tetap bergeming di tempat menonton pertunjukan hingga dini hari (semalam suntuk). Ketika masa perjuangan merebutdanmempertahankankemerdekaan kesenian rakyat ini sangat berperan sebagai media perjuangan bangsa. Pesan-pesan menggelorakan sikap patriotisme, cinta tanah air, memperkokoh persatuan dan kesatuan bangsa dan sebagainya diramu sedemikian rupa, sehingga tanpa terasa pesan tersebut diterima dan diaktualisasikan masyarakat secara nyata. Tak dapat dipungkiri ketika itu kesenian rakyat telah memberikan sumbangan yang cukup besar bagi persatuan dan kesatuan bangsa dalam merebut serta memertahankan negara kesatuan Republik Indonesia. Demikian pula pada zaman orde baru, kesenian rakyat ini tetap dibina dan dikembangkan sebagai media menyampaikan pesan menggelorakan partisipasi rakyat melaksanakan pembangunan sebagai manifestasi isu sentral era orde baru. Pembinaan dan pelestariannya dilakukan dengan cara menggelar festival secara berjenjang dari mulai tingkat desa, kecamatan, kabupaten/kota, provinsi hingga ke tingkat nasional. Selain itu melakukan bimbingan teknis, sarasehan,fasilitasialatinstrumen,menggelar pertunjukan pada peringatan hari besar dan memberikan kesempatan seluas-luasnya untuk tampil mengisi acara diTVRI dan RRI. Bahkan pemerintah ketika itu sangat intensif membina kesenian rakyat.Tidak tanggungtanggung tiga departemen diberikan tugas untukmembinamengembangkansertamelestarikan kesenian rakyat secara terpadu.

Departemen Pendidikan dan Kebudayaan diberi tugas untuk membina dari aspek seni, Departemen Penerangan dari aspek pesanpesan pembangunan. Sedangkan Departemen Dalam Negeri dari aspek kelembagaan grup yang ada di daerah Tergerus Seiring globalisasi dan kemajuan teknologi informasi dan komunikasi yang berkembang dengan cepat dan pesat, eksistensi kesenian rakyat dari waktu ke waktu mulai memudar dan redup bahkan sirna di telan zaman. Banyak kesenian rakyat di negeri ini yang dulunya sangat berkembang dan eksis, kini sudah lama punah dan tak pernah muncul lagi melakukan pertunjukan—seperti Tonil Bangsawan dan Opera Batak di Sumatera Utara. Di Jawa Barat kondisinya sama. Menurut penuturan Kepala Balai Pelestarian Budaya Bandung Toto Sucipto dari 398 jenis kesenian rakyat yang pernah ada di Jawa Barat, hanya tinggal 359 jenis, karena 39 jenis lagi sudah tenggelam dan punah. Demikian pula Lenong Betawi keberadaannya sudah tertatih-tatih ibarat kerakap tumbuh di batu, hidup segan mati tak mau. Sebagai kesenian rakyat, lenong tak dapat dipisahkan dengan masyarakat Betawi. Kalau ada hajatan baik pesta perkawinan maupun khitanan yang diselenggarakan masyarakat Betawi, tak afdol rasanya kalau tidak ada pertunjukan lenong. Pada zaman keemasannya setiap hari pemesannya cukup banyak sehingga grup lenong kewalahan melayaninya. Dalam satu hari satugruplenong bisatigakalimelakukan show, memenuhi undangan masyarakat dalam hajatan pesta perkawinan, kenduri khitanan serta memenuhi acara pemerintahan. Tetapi sekarang keadaannya telah berubah, dalam satu bulan hanya satu kali saja mereka mendapat undangan untuk manggung. Dapat dibayangkan bagaimana mereka memenuhi kebutuhan hidupnya jika hanya tergantung dengan profesi sebagai seniman kesenian rakyat. Ironisnya tidak ada regenerasi, kaum muda tidak tertarik pada kesenian rakyat itu. Mereka lebih suka musik impor yang bernuansa rock and roll, country yang hingar bingar seperti dari Amerika, Eropa bahkan kini telah terjangkit dengan musik Korea.KondisiyangdialamisenimanLenong Betawi serta Reog Ponorogo merupakan sketsa kesenian rakyat di seluruh pelosok tanah air yang berangsur-angsur tergerus dalam taman sari budaya bangsa. Kepedulian Di samping kemajuan teknologi informasi,termajinalnyakesenianrakyatakibat tidak adanya kepedulian pemerintah pusat dan daerah serta masyarakat memelihara,

membina serta melestarikannya. Fenomena masyarakatkiniinginpertunjukanyangserba instan dan praktis. Jika melakukan pesta perkawinan, khitanan, ulang tahun maupun acara lainnya cukup memakai keyboard karena biaya yang dikeluarkan relatif murah. Dengan personil tiga atau empat orang saja sudah cukup untuk menghibur penonton. Sebaliknyakalaumengundanggrupkesenian rakyat jumlah pemainnya cukup banyak sehingga cost yang dikeluarkan cukup besar pula. Demikianpula pasca reformasi melanda negeri ini perhatian dan kepedulian pemerintah sangat kurang terhadap keberadaan kesenian rakyat. Kementerian PariwisatadanKebudayaanyangseharusnyamembinakebudayaan/kesenianhanyafokuspada sektor pariwisata dan mengabaikan budaya. Mungkin pemerintah berasumsi sektor pariwisata digenjot sebagai upaya menarik devisa sebesar-besarnya untuk dikontribusikan ke dalam APBN. Sedangkan sektor kebudayaan hanya menghabiskan anggaran saja. Padahal kesenian rakyat ini merupakan identitas dan jati diri bangsa yang harus dipelihara sepanjang masa. Kita marah dan mencerca ketika negeri jiran Malaysia mengklaim Reog Ponorogo, keris dan batik sebagai warisan budayanya. Protes keras, demonstrasi ke kedutaan dan konsulat jenderal Malaysia bahkan ingin memutuskan hubungan diplomatik serta menarik duta besar merupakanlampiasankemarahantersebut.Tetapi bangsa ini lupa serta tidak melakukan introspeksi bahwa kita sendiri yang tidak mempunyaikepeduliansertamenelantarkan aset budaya yang kita miliki. Revitalisasi Bertitik tolak pada marjinalisasi kesenian rakyat seperti yang terjadi sekarang ini, sudah saatnya pemerintah c/q Kementerian Pendidikan dan Kebudayaan serta pemerintah daerah didukung masyarakat melakukan revitalisasi yang kompherehensip (menyeluruh). Revitalisasi yang dilakukan meliputi : inventarisasi terhadap kesenian rakyat yang masih eksis, serta menggali kembali yang sudah punah untuk dibina dan ditumbuhkembangkan serta dikembangtingkatkan. Juga memberi fasilitas alat atau instrumen yangsemakinlangkadiproduksimasyarakat. Kemudian menggelar festival secara berkala dan berkelanjutan serta memberikan kesempatankepadasenimankesenianrakyat menggelar atraksinya pada setiap acara pemerintah. Demikian pula media massa elektronik dimintakan partisipasinya memberi ruang bagi pagelaran kesenian rakyat.Penulis adalah Dosen Sekolah Tinggi Ilmu Tarbiah Al Hikmah Kota Tebingtinggi.

Tuan Guru Babussalam (Menyambut Haul Tuan Guru Ke-89, 21 Jumadil Akhir 1434 H/2 April 2013 M) Oleh Muhammad Amin, SAg Sebelum perjalanan Tuan Guru sampai di Makkah, ia membuka kedai sampah di Sungai Ujung (Simujung). Para pembeli menimbang sendiri sehingga ia terlepas dari kemungkinan curang


uan Guru Babussalam adalah seorang pemimpin Thariqat Naqsyabandi, seorang pejuang kemerdekaan. NamunTuan guru tidak merasakan alam kemerdekaan bangsa ini, tepat pada 21 Jumadil akhir 1345 H / 27 Desember 1926 Matau 89H/77MtahunyanglaluTuanGuru kembali keharibaan Allah SWT . Sejarah hidupnya akan tetap tercatat dalam tinta emas di negeri ini. Dakwahnya dalam menyi’arkan agama tidak saja tersohor di negeri ini tetapi sampai keluar negeri. Nama asli Tuan Guru adalah Abu Qosim bin Abdul manaf bin M. Yasin bin Maulana Tuanku Haji Abdullah Tembusai. Haji AbdullahTembusai adalah salah seorang Ulama besar di daerah Riau yang mempunyai murid yang banyak yang tersebar di berbagai daerah, termasuk daerah Tapanuli. H. Abdullah Tembusai menikah dengan Putri yang Dipertuan Kota Pinang. Dari perkawinan ini lahirlah Muhammad Yasin yang turut pindah dari Tembusai ke Tanah Putih. Muhammad Yasin menikah dengan Intan dari suku Batu Hampar. Dari pernikahan inilah lahirlah Abdul Manaf— ayah dari Tuan guru. Abdul Manaf menikah dengan Arbaiyah asal tanah putih, putri Datuk Bedagai. Dari pernikahan inilah lahirlah Abu Qosim kemudian, bergelar Fakih Muhammad. Kemudian bergelar dengan AbdulWahab Kemudian bergelar Syekh Abdul Wahab Rokan Alkholidi Naqsyabandi yang kita kenal dengan”TuanGuruBabussalam”.AbdulWahab adalah sebuah gelar setelah melaksanakan haji, sedangkan Rokan adalah nama sungai yang terdapat di hulu Tembusai—adalah asal kelahirannya. Sedangkan Naqsyabandi adalah tarikat yang diperolehnya dari Syekh Sulaiman Zuhdi. Tanggal 19 Rabiul Akhir 1230 H/ 28 September 1811 M, ± 201 H atau 199 M tahun laluTuan Guru dilahirkan.Tempat kelahirannya di kampung Danaurinda, Rantaubinuang Sakti, Negeritinggi, Rokan Tengah, KabupatenKampar,diProvinsiRiau. Pendidikan Gan Guru-guru. Semasa kanak-kanak,Tuan Guru belajar dengan seorang Ulama terkenal dari Sumatera Barat, Minang Kabau yang bernama H. Muhammad Saleh, seorang qori (ahli seni baca Alquran), sampai akhir hayatnya ulama ini meninggalkan ribuan murid. Ketika kecil Tuan guru sudah tampak tanda-tanda orang besar bemartabat tinggi. Dengan ketekunan, kepatuhan dan kesabaran, beliau belajar terkadang sampai bermalam di rumah guru dan dengan kesabarannya ia ikhlas menerima hukuman walaupun ia tak bersalah. Sebuah kisah menceritakan, suatu malamM.YunusdanTuanGuru(AbuQosim) menghapal kaji di rumahnya. M.Yunus mengganggu adiknya ketika ia membaca Alquran.Tuan Guru kecil mengingatkan agar tidak bermain di depan kitab suci. Namun hal tersebut tidak membuat M.Yunus berhenti bermain-main sehingga kitab suci tersebut terjatuh. Abdul Manaf (ayahnya)

memperhatikan mereka, kadang-kadang mendekati kadang membiarkan mereka menghapal.Tatkalamelihatkitabsuciterjatuh ia pun menanyakan siapa yang melakukan hal tersebut. M. Yunus pun langsung menunjuk bahwaTuan Guru kecil yang melakukan. Lalu dipukullahTuan Guru kecil dengan sebilah rotan beberapa kali hingga berdarah kepalanyaolehayahnya(AbdulManaf)tanpa diusut terlebih dahulu. Meskipun sakit dan bercucuran air matanya ia tetap mengaji. Belakangan baru tahu bahwa M.Yunus lah yang menjatuhkan Alquran, dan timbullah penyesalan ayahnya, ia dibersihkannya kepala Tuan Guru kecil seraya berdoa kelak ia tidak disentuh api neraka, kabarnya bekas luka itu masih ada sampai akhir hayatnya. Padakisahlain,TuanGurukecildihukum gurunyakarenaditiputeman-temanyauntuk mengambil mangga karena gurunya menginginkan buah tersebut. Sampai-sampai ia tersengat lebah sehingga bengkak-bengkak badanya. Namun ia menerima hukuman itu dengan tulus tanpa ada kejengkelan di raut wajahnya yaitu membaca Alquran sampai Shubuh. PendidikanTuan Guru kecil dilanjutkan ke Tembusai. Waktu itu Tembusai terkenal dan banyak pelajar-pelajar. Ada di antara mereka yang melanjutkan ke Makkah atau ke Aceh yang saat itu juga terkenal maju dalam bidang Agama Islam. Maulana Syekh H.AbdulHalimdanSyekhMuhammadSaleh Tembusai, kedua Ulama ini tersohor waktu itu di negeriTembusai, Rokan, di Riau. Kedua Ulama ini mengembangkan ilmu agama termasuk nahwu sharof, mantik, tauhid, tafsir, hadits, fiqih dll. Lebih kurang selama 3 tahun Tuan Guru kecil telah mampu menguasai ilmuilmu tersebut dan memperoleh gelar ”Faqih” suatu gelar kehormatan sebagai pertanda kedalaman ilmu dalam bidang fiqih. Dan Tuan Guru pun diberi gelar ”Faqih Muhammad”, yang sebelumnya bernama Abu Qosim. Walaupun tuan guru telah memperoleh gelarfaqih,iatidakmerasapuasdariapayang diperolehnya. Ia ingin melanjutkan pendidikannya ke tanah suci Makkah.Tahun 1277 H /1861 M, sebelum perjalanan Tuan Guru (Faqih Muhammad) sampai di Makkah, ia berdagang dengan membuka kedai sampah di Sungai Ujung (Simujung). Para pembeli disuruhmenimbangsendirisehinggaiaterlepasdarikemungkinancurang.Dalamkegiatan perdagangan dan perekonomian Tuan Guru sangat menjaga dari praktek riba,Tuan Guru sangat memahami betapa berat resiko para pemakan riba di dunia dan akhirat. Di samping berniagaTuan Guru belajar kepada Syekh H. Muhammad Yusuf asal Minang Kabau, yang belakangan menjadi mufti di Langkatdanterkenaldenganpanggilan ”Tuk Ongku”.TukOngkuiniadalahorangkaromah dan wafat diTanjungpura dan dimakamkan di samping Masjid Azizi. Dan sampai sekarang banyak orang yang berziarah kekuburannya. Lebih kurang dua tahun kemudian 1279

H /1863 M , Tuan Guru melanjutkan perjalanannya bersama ayah angkatnya, Haji BahauddinkeMakkah.Sebelumberangkat mereka berziarah kepada salah seorang Syekh yang memiliki banyak karomah bernama Habib Nuh. Makamnya di atas bukit diTanjungpagar di Singapura. Menurut riwayat Pemerintah Singapura hendak memindahkan makam Syekh ini, namun gagal karena tanahnya keras tidak bisa dibongkar. Tuan Guru (Faqih Muhammad) ketika berkunjung kepadanyaterjadihalanehyaituSyekhHabib Nuh ini mencium tangan, bahu dan seluruh tubuhnya,yangtidakpernahialakukankepada orang lain seraya berkata ”Barokallaahu barokallaahu”, hal ini mengherankan orang banyak. Seorang pedagang dari Sungaiujung bersedekah kepadanya namun Syekh ini menolaknya. DiMakkahTuan Gurusetelahmengerjakan haji, mendapat gelar Haji AbdulWahab Tanah Putih. Ia belajar kepada Zaini Dahlan yaitu mufti Mazhab Syafi’i dan kepada Syekh Hasbullahdanbelajarpulakepadaguru-guru asal Indonesia seperti Syekh M. Yunus bin Abd.Rahman Batubara, Syekh Zainuddin Rawa, Syekh Rukhuddin Rawa dan lainnya. Tuan Guru kita BelajarThariqat dengan Syekh Sulaiman Zuhdi, diangkat menjadi Khalifah Besar dengan memberikan ijazah, bai’ahdansilsilahThariqatNaqsyabandi yang berasal dari baginda Rasulullah SAW sampai kepada Syekh Sulaiman Zuhdi dan seterusnya kepada Syekh Abdul Wahab Al Khalidi Naqsyabandi. Ijazah itu ditandai dengan dua cap.Iamemperlihatkan ijazahnyadari Syekh Sulaiman Zuhdi itu kepada Syekh M.Yunus. Membangun Babussalam. Bermula Tuan Guru tinggal di Babussalam ini adalah atas bujukan dan permintaan Sultan Musa Al Mua’zzam syah. ”Kalau saya mati,Tuan lah yang menanam saya dan kalautuanyangmatisayalahyangmenanam tuan”. Sebelum tinggal di Babussalam ini Tuan Guru ditawari untuk bertetap di Kampung Lalang lebih kurang 1 km dari kotaTanjungpura. Namun tempat ini kurang sesuai menurut pertimbangan Tuan Guru karena ramai dan sibuknya tempat tersebut. Maka Tuan Guru meminta kepada Baginda Sultan agar diberikan sebidang tanah untuk sebuah perkampungan di mana ia dapat leluasa beribadah dan mengajarkan ilmu agama. Baginda Sultan Musa pun mengabulkan permintaaninilalumenyarankanuntukmemilih tanah-tanah mana yang ia sukai. Pada suatu hari berangkatlahTuan Guru Kita beserta baginda Sultan,Tuan Baki, Syekh M.Yusuf dan lain-lain menyusuri Sungai Batangserangan menuju ke hulu dengan sebuah perahu. Setibanya di sebuah tempat berhentilah rombongantepatnyadiseberang Sungai Besilam dan mereka naiklah ke darat. Lalu Sultan mempersilahkanTuan Guru untuk memilih tanah-tanah yang ada di tempat itu. Tanah ini sebagian besarnya ditanami palawija,adajugaterdapatdurian,cempedak, margat, dan lai-lain dan sebagiannya yang lain bekas kebun lada. Tatkalarombonganmelihat–lihat,Sultan Musa melihat sebuah batu besar terletak di atas tunggul. Letak batu besar itu persis tentang mihrab madrasah besar sekarang ini. Melihat hal tersebut Baginda Sultan itu pun bertitah : ”Tuan lihatlah batu itu, naik ke atas. Mudah-mudahan kelak nama dan derajat tuanmenjadinaik”.Bagindamemerintahkan supaya batu itu ditanamkan di tempat itu

juga seraya bertitah : ”Batu ini adalah benda yang tetap, sebab itu saya bermohon kepada Tuhan Yang Mahakuasa ,semoga tetaplah Tuan di tempat ini ”. Tuan Guru menjawab pula ” Mudah-mudahan dikabulkan Allah Taala doaTuanku , semogaTuanku ditambah Tuhan pangkat dan derajat dimudahkan rezeki yang halal dan disampaikan segala cita-cita yang baik. Setelah shalat zhuhur makaTuan Guru meresmikan tempat tersebut dengan nama kampung Babussalam. ?Kata Babussalam berasaldariBahasaArab,terdiridariduabuah kata , yaitu “Bab” dan “Salam”. Bab berarti pintu dan Salam berarti keselamatan dan kesejahteraan.Mungkindinamamakantempat itu dengan Babussalam semoga penduduknya beroleh kesejahteraan dan keselamatan dunia dan akhirat. Ada juga yang meriwayatkan bahwa Babussalam adalah hasil pandangan mata hati Tuan Guru melihat Ka’bah melalui pintu Babussalam yang berada di Masjidilharam. SelesaipeninjauanituSultanMusaturun kesungai.TakbeberapalamakemudiandisusulTuanGurudenganmembawalimau nipis sebanyak 3 buah. Inilah pertanda mereka akan bermasam-masaman muka paling lama 3 tahun kemudian baik kembali. Tuan Guru pindah secara resmi ke Babussalam ini tanggal 15 Syawal 1300 H, dengan rombongan berjumlah 172 orang dengan menggunakan 13 buah perahu. Penulis adalah Mahasiswa Beasiswa Pascasarjana IAIN Medan Sumatera Utara.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Produksi hortikultura Sumut belum maksimal - Masih perlu belajar ke negara tetangga * 1April KA barang beroperasi malam hari - Malam pun sudah kayak siang padatnya * DPR-RI: Tuntaskan hambatan jalan arteri KNIA - Maksudnya biar pesawat tak delay


D Wak

Ekonomi & Bisnis

WASPADA Sabtu, 30 Maret 2013

Asita Tetap Perjuangkan Pengembalian Deposit Di Batavia MEDAN (Antara): Asosiasi Perusahaan Perjalanan Wisata Indonesia (Asita) menegaskan pihaknya tetap menuntut agar uang deposit (top up) pengusaha biro perjalanan ke Batavia Air dan maskapai lainnya dikembalikan. Menurut Ketua Umum DPP Asita H.Asnawi Bahar, di Medan, Kamis (28/3), Asita saat ini sedang mempersiapkan diri untuk menuntut hingga ke pengadilan soal dana top up milik perusahaan perjalanan secara nasional di Batavia. Total dananya sekitar Rp100 miliar. Dia berada di Medan sejak Kamis, (27/3) malam untuk menghadiri Musyawarah Daerah Asita Sumut ke-XII. Salah satu agendanya adalah memiih kepengurusan baru 2013-2017. Pada acara itu Solahuddin Nasution, kembali dipilih menjadi Ketua Asita Sumut.

Solahuddin Nasuton, unggul telak dengan suara dukungan sebanyak 76 suara, sedangkan calon lainnya Maruli Damanik hanya dapat tujuh suara. Menurut dia, pemerintah seharusnya memberikan dukungan penuh kepada Asita, karena di tengah kerugian masyarakat atau konsumen yang membeli tiket penerbangan, perusahaan perjalanan wisata juga merugi karena depositnya tidak bisa diambil kembal. “Kasus maskapai pailit yang sudah beberapa kali terjadi dengan terakhir Batavia yang di-

pailitkan Pengadilan Niaga Jakarta Pusat selalu saja merugikan agen perjalanan wisata,” katanya. Asnawi menjelaskan, seharusnya dana deposit untuk keperluan pemesanan tiket ke Batavia tidak masuk kategori aset milik maskapai. Harusnya dana tersebut dikembalikan ke perusahaan agen perjalanan wisata. Seperti diketahui, sebelumnya, manajemen maskapai Batavia Air menyatakan bahwa Pengadilan Niaga Jakarta Pusat telah menunjuk empat kurator untuk membantu menangani segala urusan dan dampak aki-

bat penutupan perusahaan penerbangan itu. Maskapai itu dinyatakan pailit sejak akhir Januari lalu karena tidak membayar utang kepada perusahaan yang menyewakan pesawat untuk keperluan ibadah haji. Asita, ujar eksekutif PT. Minang Permai Sejati itu mengaku semakin kecewa, karena pemerintah terkesan tidak melindungi pengusaha agen perjalanan wisata. Indikasinya terlihat dari tidak terbukanya pemerintah mengenai kasus pailitnya setiap maskapai. “Bayangkan, malam hari sebelum besoknya di-

umumkan pailit, pemerintah masih membantah soal kepailitan Batavia itu ke Asita,” katanya. Ketua Asita Sumut Solahuddin Nasution, menyebutkan, uang deposit travel agent Sumut di Batavia Air tidak banyak. Hanya hanya sekitar Rp150 juta. Itu terjadi karena sejumlah pengusaha sudah mencurigai dan melakukan tindakan hati-hati dalam top up setelah Batavia menutup rute Medan-Jakarta, yang sebelumnya sempat terbang dua kali sehari. “Ada kecurigaan takkala Batavia menghentikan penerbangan jalur gemuk Medan-Ja-

karta sehingga pengusaha mengurangi top up itu dengan berbagai alasam. Nyatanya kecurigaan itu benar,”kata Solahuddin yang juga eksekutif Cipta Tour and Travel itu. Meski tidak besar, tetapi tentunya merugikan perusahaan perjalanan wisiata dan DPD Asita Sumut mendukung langkah DPP Asita menggugat Batavia dan maskapai lainnya yang sebelumnya pailit. “Asita berharap pemerintah mengeluarkan peraturan tentang penempatan dana deposit BPW agar sewaktu-waktu bisa ditarik atau dicairkan,”katanya. Budi Suyanto

Pertagas Bangun Pipa Arun-Belawan BANDA ACEH (Waspada): PT Pertamina Gas (Pertagas) akan membangun pipa transmisi gas dari Point B LNG Arun sampai ke Belawan, Sumut mulai Agustus 2013. Pertagas adalah anak perusahaan PT Pertamina (Persero). Dirut PT Pertagas Gunung Sardjono Hadi, Rabu (27/3), mengatakan pemasangan pipa dijadwalkan berlangsung satu tahun. Yakni diharapkan selesai September 2014. Dikatakan, pembangunan pipa gas ini merupakan proyek nasional untuk revitalisasi Kilang Arun menjadi LNG Plant Arun. Dalam proyek ini Pertagas akan bekerjasama dengan Perusahan Daerah Pembangunan Aceh (PDPA). Gunung Sardjono, mengatakan proyek revitalisasi Kilang Arun merupakan perintah Menteri BUMN kepada PT Pertamina yang selanjutnya menunjuk Pertagas sebagai anak perusahaan melaksanakan proyek ini. Pimpinan proyek pembangunan pipa gas dari PertagasWinarno, menjelaskan pipa transmisi gas yang berada dalam wilayah Aceh sepanjang 235 kilometer (Arun-Tamiang), dari total keseluruhan Arun-Belawan 360 kilometer lebih. Jalur pembangunan pipa ini sebagian besar milik Pertamina, PTPN dan 13 persen lahan masyarakat di Aceh. ‘’Secara keseluruhan tanah milik masyarakat itu dari Arun-Belawan hanya sembilan persen,” tuturnya. Winarno, menjelaskan pipa transmisi gas ini sifatnya terbuka dan bisa dimanfaatkan perusahaan lain dengan biaya ditentukan Badan Pengatur Hilir (BPH) Migas. Ibrahim, dari BPH Migas mengatakan pembangunan pipas gas di Aceh ini nantinya akan terintegrasi dengan negara-negara ASEAN. “Jambi sekarang sudah tersambung dengan Singapura. Jadi Indonesia bagian barat nanti akan terintegrasi dengan ASEAN,” katanya. (b06)

Penyebrang Melalui Bakauheni Normal KALIANDA (Antara): Arus penyeberangan penumpang melalui Pelabuhan Bakauheni, Lampung menuju Pelabuhan Merak, Banten masih tampak normal. Tidak ada peningkatan volume kendaraan pada hari libur ini. “Volume kendaraan yang akan menyeberang maupun yang tiba masih tampak normal,” kata Manajer Operasional PT ASDP Indonesia Ferry Persero Cabang Bakauheni, Heru Purwanto, di Bakauheni, Jumat (29/3). Menurut dia, liburan ini tidak mempengaruhi peningkatan penumpanag yang menyeberang melalu pelabuhan itu baik kendaraan bus, pribadi maupun sepeda motor. Kemudian, antrean calon penumpang pejalan kaki yang akan membeli tiket elektronik juga masih normal seperti hari biasanya saja karena tidak ada peningkatan signifikan. Namun, peningkatan tampak terjadi dari arah berlawanan yakni dari Pulau Jawa menuju Sumatera namun seperti libur akhir pekan seperti biasanya, lebih banyak dibandingkan dari Sumatera menuju Jawa.

Daftar Harga Bahan Pokok Di Medan, Selasa (26/3) Beras Ramos 1 Beras Ramos 2 Beras KKB 1 Beras KKB 2 Beras Arias Beras Jongkong IR 64 Beras Jongkong Kasar Beras Jongkong IR 64/Kw3 Gula Pasir Minyak Goreng Curah Kuning Daging Sapi Murni Daging Ayam Broiler Daging Ayam Kampung Telur Ayam Broiler Telur Ayam Kampung Garam Kasar Garam Halus Terigu Segi Tiga Biru Cabai Merah Cabai Rawit Cabai Hijau Bawang Merah Bawang Putih Tomat Kol Kentang Ikan Asin Teri (no.2) Kacang Hijau Kacang Tanah Kacang Kedelai Minyak Tanah Susu KM Bendera 357 gr Susu KM Indomilk 390 gr Susu Bubuk Bendera 400 gr Susu Bubuk Indomilk 400 gr

: Rp9.400 per kg : Rp9.200 per kg : Rp9.700 per kg : Rp9.500 per kg : Rp9.500 per kg : Rp9.200 per kg : Rp8.500 per kg : Rp8.500 per kg : Rp12.000 per kg : Rp9.000 per kg : Rp85.000 per kg : Rp22.000 per kg : Rp50.000 per kg : Rp1.000 per butir : Rp1.500 per butir : Rp1.200 per kg : Rp2.000 per kg : Rp8.000 per kg : Rp12.000 per kg : Rp24.000 per kg : Rp8.000 per kg : Rp35.000 per kg : Rp23.000 per kg : Rp12.000 per kg : Rp3.000 per kg : Rp8.000 per kg : Rp75.000 per kg : Rp12.000 per kg : Rp23.000 per kg : Rp8.000 per kg : Rp9.000 per liter : Rp7.600 per kaleng : Rp8.200 per kaleng : Rp25.500 per kotak : Rp27.200 per kotak (m41)

Harga Emas London Murni (LM)


Perhiasan (97%)


Emas Perhiasan (70%)


Emas Putih (75%)




(50 %)

A7 Kelapa Sawit Penting Bagi Penerimaan Negara MAMUJU (Antara): Komoditas kelapa sawit mempunyai peran sangat penting sebagai penerimaan negara. Sekitar 3,7 juta jiwa penduduk Indonesia menggantungkan hidupnya dari perkebunan sawit. Sekretaris Direktorat Jendral Perkebunan Kementrian Pertanian Mukti Sardjono, mengatakan itu dalam seminar yang diadakan PT Astra Agro Lestari Tbk di Palu, Jumat (29/3). Menurut dia, selain sumber pendapatan negara, perkebunan kelapa sawit juga mempunyai peranan penting bagi pendapatan masyarakat dan juga mendorong pengembangan wilayah. Karena lebih dari 3,7 juta kepala keluarga terserap dalam industri dan perkebunan kelapa sawit. Begitu juga, kata dia, dari sisi pendapatan ekspor non minyak gas (Migas) nasional, nilai ekspor minyak sawit lebih besar dibanding nilai ekspor hasil pertanian di luar minyak sawit. “Selama 2012 lalu, negara memperoleh Rp 28,3 triliun dari pajak ekspor atau bea keluar, hasil perkebunan kelapa sawit, sehingga sangat mendukung industri dalam negeri,” lanjutnya. Dia mengatakan dengan data-data itu, industri minyak sawit Indonesia harus didukung agar terus maju dan berkembang. Terkait perlunya dukungan terhadap kelapa sawit nasional, Dahlan H. Hasan, staf ahli Pusat Penelitian Lingkungan Hidup Universitas Tadulako, menyinggung pentingnya masyarakat memahami prosedur perijinan Amdal (Analisis Mengenai Dampak Lingkungan). “Ketentuan mengenai Amdal terus mengalami perbaikan. Hal ini dapat dilihat melalui perubahan UU No.23 tahun 1997 tentang Pengelolaan Lingkungan Hidup menjadi UU. No.32 Tahun 2009, dan itu harus dipahami masyarakat,” katanya. Karena, kata dia, dengan semangat baru itu Amdal lebih berperan, terarah dan efektif dalam mengawal pembangunan berkelanjutan yang berwawasan lingkungan khususnya dalam pengembangan perkebunan kelapa sawit. PT Astra Agro Lestari Tbk sebagai perusahaan yang bergerak di perkebunan kelapa sawit yang merupakan perusahaan terbesar di Provinsi Sulbar, mendukung penegasan yang disampaikan pembicara. Karena itu, dalam usaha perkebunan kelapa sawit yang dilakukan, AAL selalu memperhatikan secara serius mengenai studi kelayakan, legalitas usaha, serta perbaikan terus menerus baik teknis maupun non teknis agar kelapa sawit bermanfaat bagi negara maupun masyarakat. “Semua demi pembangunan industri kelapa sawit yang lebih baik,’’ kata Berlian Cahyani, dari Safety, Health and Environment (SHE) AAL.

Sosialisasi Pengadaan Barang Dan Jasa

Waspada/Arianda Tanjung

BUNGA TABUR: Seorang pedagang buka tabur menawarkan dagangannya kepada pelanggan di toko bunga Jl Iskandar Muda, Jumat (29/3). Penjulan bunga tabur pada perayaan paskah tahun ini meningkat 40 % dengan harga jual sebelumnya Rp.10.000 per 3 tangkai, kini menjadi Rp.5000/tangkai.

Sumut Tidak Perlu Impor Bahan Kebutuhan Pokok MEDAN (Waspada): Anggota DPRD Sumut dari Fraksi PKS Siti Aminah, mengaku telah ‘berjuang’ untuk mengatasi naiknya harga bawang. Yakni dengan memberi masukan agar Sumut tidak perlu lagi mengimpor bahan kebutuhan pokok yang memang di Sumut sudah sangat mencukupi. Hal tersebut diungkapkan Siti Aminah, menjawab pertanyaan masyarakat soal harga bawang dan harga bahan kebutuhan pokok lainnya yang belakangan meningkat, sat melakukan reses di Rumah Gadang Banuhamu Jalan Sutrisno, Medan, Kamis (28/3). Menurut Siti Aminah, meskipun pada dasarnya menyangkut harga komoditas merupa-

kan wewenang kementerian terkait, namun dia sudah memberikan agar Sumut menyetop impor bahan kebutuhan. Dengan begitu harga bisa lebih diawasi dan petani mendapat penghasilan yang sesuai. Reses Siti Aminah kali ini dirangkai dengan syukuran kemenangan pasangan Gatot Puju Nugroho dan Tengku Erry Nuradi sebagai Gubernur Sumut. Karenanya ratusan audiens yang hadir, kebanyakan adalah saksi yang utamanya bertugas di daerah Medan Area. Ketua PKS Medan Area Lukman Hakim, berharap masyarakat yang menghadiri reses tidak sungkan menyampaikan masukan dan uneg-unegnya. Pun be-

gitu, ajang ini lebih kepada silaturahmi yang memang menjadi ciri khas PKS. Acara yang dikemas sederhana di pelataran parkir rumah gadang tersebut langsung mendapat antusiasme dari masyarakat. Mereka berbondong bertanya seraya berharap aspirasinya disampaikan kepada pemerintah. Selain tentang harga kebutuhan pokok, masalah lain yang dipertanyakan masyarakat adalah rumitnya mengurus administrasi kependudukan dan soal kesehatan. “Dalam setiap reses, saya maunya pemerintah setempat ikut hadir agar bisa mendengar langsung keluhan masyarakat. Mulai dari wali kota,

camat hingga lurah. Bahkan ada rencana untuk membuat perda soal itu,” kata Siti Aminah. Soal kesehatan, Siti Aminah, juga berharap pemerintah kota Medan meningkatkan anggaran untuk Medan Sehat. “Karena permasalahan yang terjadi di daerah masing-masing adalah tanggung jawab penuh pemerintah setempat,’’ katanya. (m08)

SABANG (Waspada): Guna meningkatkan pemahaman tentang barang dan jasa, puluhan PNS di lingkungan Pemko Sabang mengikuti sosialisasi Peraturan Presiden RI Nomor 70 tahun 2012 tentang pengadaan barang dan jasa, di Sabang, Rabu (27/3). Asisten III Pemko Sabang Kamaruddin, mengatakan kegiatan sosialisasi sangat penting untuk meningkatkan pemahaman tentang aturan, sistem, metode dan prosedur yang lebih sederhana dengan memperhatikan berbagai peraturan yang berlaku karena dalam sistem birokrasi, aparatur dituntut bekerja sesuai ketentuan dan mengedepankan profesionalisme. Diharapkan dengan adanya sosialisasi ini akan meningkatkan pengetahuan tentang mekanisme pengadaan barang dan jasa, dan mampu menghadapi perubahan strategik dalam menangani tugas-tugas sesuai dengan -peraturan yang berlaku. (b31)

Nasabah Bank Di Siprus Tarik Simpanan FRANKFUT (Antara/AFP): Penarikan simpanan oleh nasabah, baik rumah tangga dan perusahaan dari rekening mereka di bank-bank Siprus pada bulan lalu mencapai satu miliar euro (1,3 miliar dolar AS). Dari data yang dikumpulkan oleh Bank Sentral Eropa Kamis (28/3), menunjukkan volume deposito swasta pada rekeningrekening bank di Siprus menurun 2,1 persen bulan-ke-bulan, menjadi 46,4 miliar euro pada Februari. Angka-angka, yang tidak termasuk simpanan oleh pemerintah Siprus atau simpanan antar bank, tampak mencerminkan meningkatnya kekhawatiran di antara para penabung di pulau itu sementara negosiasi dana talangan masih berlangsung antara Nikosia dan pemberi pinjaman internasional.

Jumlah Wisman Ke Sumut Meningkat MEDAN (Antara): Jumlah wisatawan mancanegara (wisman) yang berkunjung ke Sumut dalam enam tahun terakhir terus meningkat. Pada tahun 2012 jumlah wisman mencapai 241.833 orang. “Peningkatan kunjungan wisman selama enam tahun terakhir menunjukkan semakin bagusnya sinergi antara pemerintah, swasta dan masyarakat dalam penanganan pariwisata di Sumut. Dan itu menggembi-

Tanam Sawit Tidak Diizinkan SIGLI ( Waspada): Pemerintah Kabupaten (Pemkab) Pidie tidak member izin penanaman kelapa sawit di kawasan pegu-nungan Kec. Mila. Kata Wakil Bupati Pidie M. Iriawan, pihaknya ‘mengharamkan’ pemberian izin kelapa sawit di daerah itu. Berbicara kepada wartawan, Rabu (27/3), M.Iriawan, mengatakan kawasan pegunungan di Kec. Mila itu merupakan hutan produksi yang harus dilindungi. Katanya hutan produksi tidak boleh ditanami tumbuhan untuk kepentingan pribadi. Yang boleh ditatam di sana adalah pohon untuk kepentingan umum yang tidak boleh dipanen. “Boleh ditanami pohon, tapi sifatnya hanya untuk menjaga lingkungan sekitar,’’ katanya. (b10)

rakan pemerintah,” kata Kepala Dinas Kebudayaan dan Pariwisata (Disbudpar) Sumut H. Naruddin Dalimunthe, di Medan, Jumat (29/3). Pada 2011, kunjungan wisman ke Sumut 223.126 orang atau naik 16,53 persen dari 2010 yang sebanyak 191.472 orang. Meningkatnya kunjungan wisman, dipicu kenaikan kunjungan dari beberapa negara, khususnya asal Malaysia, Korea Selatan, Jepang, Jerman, Australia dan Taiwan. Menurut Naruddin Dalimunthe, pemerintah gembira, karena dengan bertambahnya terus jumlah wisman maupun wisatawan nusantara dan termasuk semakin membaiknya bisnis industri pariwisata itu secara otomatis mendorong peningkatan perekonomian serta membantu menekan angka pengangguran. Untuk mendorong peningkatan wisman itu, kata dia, Disbudpar, juga sudah dan terus melakukan berbagai langkah yang bisa membantu mempermudah perusahaan perjalanan wisata di Sumut menjaring wisatawan itu. Disbudpar misalnya terus melakukan pembenahan destinasi dan meningkatkan promosi objek wisata Sumut itu. “Penandatangan MoU (Memorandum of Understanding) Disbudpar Sumut dengan Disbudpar Bali dalam penanganan wisman adalah salah satu bukti nyata dukungan pemerintah,” katanya.

Belum lagi langkah Pemerintah melakukan promosi objek wisata Sumut ke luar negeri. Mudah-mudahan dengan dukungan Disbudpar dan kerja sama Disbudpar dengan Asosiasi Perusahaan Perjalanan Wisata Indonesia (Asita) untuk memajukan kepariwisataan Sumut, bisa semakin memulihkan kujungan wisman seperti sebelum terjadi krisis moneter 1997/1998 dimana jumlah turis mencapai hampir 500.000 orang. Ketua Asita Sumut, Solahuddin Nasution, mengakui ada tren peningkatan kunjungan wisman ke Sumut dalam beberapa tahun terakhir dan itu menggembirakan. Namun, kata dia, masih perlu kerja keras untuk bisa menarik wisatawan lebih banyak lagi seperti yang sudah bisa dilakukan provinsi lain di Jawa, Bali dan bahkan Sumatera Barat. Menurut dia, Sumut masih terkendala dengan infrastruktur yang belum memadai dari dan ke objek wisata . “Kalau mau jujur objek wisata di Sumut jauh lebih bagus daripada yang ada di negara lain seperti Malaysia.Tapi karena infrastruktur jalannya kurang memadai dan termasuk objek wisatanya kurang perawatan, maka kalah saing,” katanya. Solahuddin menyebutan, wisatawan asing seperti Sumut mengakui keindahan alam Sumut yang ditandai mendominasinya turis asal negara itu di Sumut.


Pendiri Museum Rekor Indonesia (MURI) Jaya Suprana (4 kanan) menyerahkan penghargaan kepada President Director PT Bank CIMB Niaga Tbk Arwin Rasyid (3 kiri) di Jakarta, Rabu (27/3).

CIMB Niaga Luncurkan Rekening Ponsel JAKARTA (Waspada): PT Bank CIMB Niaga Tbk meluncurkan produk Rekening Ponsel, Rabu (27/3). Ini merupakan inovasi terbaru layanan perbankan di Indonesia. Dengan fasilitas ini para nasabah CIMB dapat melakukan transaksi perbankan hanya dengan menggunakan ponsel. Rekening Ponsel merupakan produk mobile wallet pertama di Indonesia dengan kemampuan transfer ke semua nomor ponsel (di Indonesia) yang mendapatkan pengukuhan predikat oleh Dewan Museum Rekor Indonesia (MURI). Melalui Rekening Ponsel, nasabah maupun masyarakat yang belum menjadi nasabah bank bisa melakukan transfer dana gratis ke seluruh nomor ponsel di tanah air, membeli pulsa ponsel prabayar, bayar tagihan bahkan menarik tunai tanpa kartu ATM. Presiden Direktur CIMB Niaga, Arwin Rasyid, mengungkapkan CIMB Niaga be-

rupaya menghadirkan satu layanan inovatif terbaru. Karena itu, hadirnya “Rekening Ponsel” diharapkan mampu memudahkan seluruh lapisan masyarakat bertransaksi perbankan tanpa batas. “Langkah ini juga mendukung program financial inclusion yang dicanangkan oleh Bank Indonesia dalam mengenalkan produk dan layanan perbankan secara luas ke masyarakat.” ungkap Arwin dalam rilisnya yang diterima Waspada, Kamis (28/3). Dikatakan, “Rekening Ponsel” dirancang khusus untuk memudahkan dan memberi kenyamanan bagi penggunanya. Selain itu, penerima dana dapat menarik tunai hanya dengan mendaftarkan nomor ponselnya di cabang CIMB Niaga terdekat. Setelah didaftarkan, penerima dapat langsung mengambil dananya melalui ATM CIMB Niaga yang tersebar luas tanpa kartu ATM, namun cukup menggunakan ponsel saja. Keunggulan lainnya, lanjut Arwin,

nasabah juga bisa langsung mengirim dana ke nomor ponsel dari jaringan operator apapun di Indonesia. Hal lainnya yang menjadi nilai tambah “Rekening Ponsel” adalah dana yang masuk ke rekening penerima tidak harus diambil saat itu juga. Penerima dana bisa mengambil sebagian dari dananya dan menyimpan sisanya untuk digunakan di kemudian hari, tanpa dikenai biaya administrasi bulanan. “Semua yang kami lakukan itu adalah untuk memberikan kemudahan dan kenyamanan bagi seluruh lapisan masyarakat, khususnya pengguna ponsel, sehingga mereka dapat memperoleh layanan perbankan kapanpun dan di manapun,” jelas Arwin. “Saya bangga dengan inovasi ini karena ternyata prestasi CIMB Niaga membuat inovasi ini adalah pertama di Asia. Karena itu pula saya menjadikan prestasi ini sebagai rekor Asia pertama yang diploklamirkan CIMB Niaga,” tutur Jaya Suprana, pendiri MURI. (m33/ID)


A8 sek Dolok Pardamean itu harus menjadi pelajaran penting bagi Kepolisian agar lebih siap, baik dari jumlah personel dan persenjataan untuk menindak kejahatan, khususnya judi dan narkotika,” ujar Yahdil menjawab Waspada, Jumat (29/3) di Jakarta. Menurut Yahdil, kesiapan personil Polri menjadi sorotan sebab aksi seperti ini sudah beberapa kali terjadi. Dengan kesiapan yang matang, maka pihak polisi dapat mengantisipasi jika terjadi perlawanan. (aya)

Kasus Pemerkosaan Mengkhawatirkan JAKARTA (Waspada): Kasus pelecehan seksual dan pemerkosaan terhadap perempuan makin mengkhawatirkan masyarakat. Namun, ancaman hukuman perkosaan tidak berubah dalam RUU KUHP yang diajukan pemerintah ke DPR. Dalam KUHP yang berlaku sekarang, ancaman hukuman bagi tindak perkosaan yang disertai kekerasan terhadap seorang wanita ditentukan paling tinggi 12 tahun penjara. Kenyataan dalam praktiknya, vonis yang dijatuhkan hakim terhadap kasus-kasus perkosaan sangat rendah, jauh dari besaran hukuman maksimal. Menurut anggota Komisi III DPR Martin Hutabarat di Jakarta, Jumat (29/3) melihat

dinamika masyarakat di mana kesadaran hukumnya semakin meningkat, ancaman hukuman maksimal terhadap kasus-kasus perkosaan ini seyogyanya juga harus ditambah, misalnya menjadi 15 tahun, guna menimbulkan efek jera. “Apalagi, rasa solidaritas untuk melindungi kaum wanita dari pelecehan seksual juga makin luas sekarang. Namun, dalam RUU KUHP yang diajukan pemerintah ke DPR baru-baru ini, ancaman hukuman terhadap tindak pidana perkosaan tidak mengalami peningkatan,” ujarnya Dia menyayangkan, ancaman hukuman dalam draf pemerintah itu tetap, yakni paling tinggi 12 tahun penjara. (aya)

Sabtu 30 Maret 2013

Kedubes Arab Saudi Tegaskan Pelanggar Visa Haji/Umrah Dideportasi

Kedepan Polisi Harus Lebih Siap JAKARTA (Waspada): Anggota Komisi III DPRRI dari Fraksi Partai Amanat Nasional (FPAN) mengatakan para pelaku pengeroyokan terhadap Kapolsek Dolok Pardamean, Simalungun, AKP Andar Siahaan hingga tewas harus ditindak tegas. Kedepan jajaran kepolisian diminta harus lebih siap dari segi jumlah personel dan persenjataan yang langsung kelapangan untuk menindak kejahatan, khususnya perjudian dan narkotika. “Peristiwa tewasnya Kapol-



JELANG KLB DEMOKRAT: Sejumlah pekerja memasang baliho menyambut Kongres Luar Biasa (KLB) Partai Demokrat di kawasan Hotel Inna Grand Bali Beach, Sanur, Bali, Jumat (29/3).

KLB Demokrat Diperkirakan Telan Biaya Sekitar Rp700 Juta DENPASAR (Antara): Pelaksanaan Kongres Luar Biasa (KLB) Partai Demokrat di Bali pada 30-31 Maret 2013 menelan biaya sekitar Rp700 juta, kata Ketua Dewan Pimpinan Daerah (DPD) Partai Demokrat Bali, Made Mudarta. “Kalau di Bandung saat kongres 2010 menggunakan event organizer, di Bali semua kader ikut berpartisipasi untuk urunan. Ada yang menyumbang baliho, penjor, semua dikerjakan kader,” katanya di Sanur, Denpasar, Jumat (29/3). “Anggaran juga bisa ditekan, jauh lebih rendah jika dibanding tiga tahun lalu saat di Bandung,” tambah dia. Menurut Midarta, biaya penginapan kader juga berasal dari urunan kader partai di pusat dan daerah. Dia menjelaskan, kongres dirancang bersuasana khas Pulau Dewata. Para kader pun akan diminta mengenakan udeng atau ikat kepala yang biasa digunakan oleh pria Bali. “Kami akan bagikan udeng yang mencerminkan filosofis Bali dengan kepala diikatkan dan disatukan, berarti penyatuan untuk kepentingan masyarakat,” katanya. Sehari menjelang pelaksanaan, panitia sibuk menyiapkan segala keperluan kongres di Hotel Inna Grand Bali Beach Sanur. Ruang pelaksanaan kongres sebagian besar didekorasi dengan hiasan warna putih dan biru. Beberapa spanduk, baliho, dan penjor—bambu berhias rangkaian janur— sudah dipasang di sekitar lokasi kongres dan jalanan menuju kawasan Sanur.

JAKARTA (Antara): Kedutaan Besar Kerajaan Arab Saudi menyatakan bahwa pemegang visa haji dan umrah tidak diperkenankan bekerja di negara itu dan para pelanggarnya akan dideportasi saat itu juga. Bagian Penerangan Kedubes Arab Saudi di Jakarta mengeluarkan tanggapan yang diterima Antara, Kamis (28/3) sehubungan dengan berita yang dimuat di beberapa media baru-baru ini perihal adanya sebagian warga negara Indonesia bekerja di Arab Saudi dengan menggunakan visa haji dan umrah. Dalam pernyataannya, Kedubes Arab Saudi memberitahukan bahwa pemegang visa haji dan umrah tidak diperkenankan bekerja dan peraturan ini berlaku bagi siapa saja yang masuk ke Arab Saudi untuk melaksanakan ibadah haji dan umrah termasuk di dalamnya warga negara Indonesia, terlepas dari dihentikannya atau dibukanya kembali pengiriman tenaga kerja Indonesia. Sesuai prosedur, Arab Saudi akan menghukum biro perjalanan wisata, haji dan umrah yang menyalahgunakan jenis visa tersebut dengan denda uang dan sanksi, katanya. Adapun bagi individu yang melanggar akan dideportasi saat itu juga. Menteri Tenaga Kerja dan Transmigrasi Muhaimin Iskandar mengemukakan bahwa pihaknya menerima laporan

indikasi pengiriman TKI ilegal berkedok umrah/haji yang ditemukan di Arab Saudi, padahal saat ini Pemerintah Indonesia masih melakukan moratorium penempatan TKI domestik terhadap negara Arab Saudi, Kuwait, Syria dan Jordania. “Tindakan tegas sudah kita terapkan. Sudah ada ketentuan dan penanganan ketat terhadap biro-biro perjalanan wisata yang selama ini memberangkatkan umrah. Travel yang memberangkatkan jamaah umroh/haji wajib memastikan kepulangan jamaahnya 100 persen,” ucap Muhaimin. Menurut dia, pihaknya akan

memberikan sanksi tegas bagi pengiriman TKI ilegal yang berkedok haji/umrah ke Arab Saudi karena pemerintah masih memberlakukan penghentian sementara pengiriman TKI sektor domestik ke negara tersebut. “Kami akan berkoordinasi dengan Kementerian Agama dan Kementerian Luar Negeri untuk membentuk tim khusus dalam menanggulangi adanya pengiriman TKI ilegal bermodus umrah/haji ini,” kata Menakertrans. Jika ada travel yang melayani umrah terbukti melakukan pengiriman TKI ke Arab Saudi

dan kawasan Timur Tengah lainnya dengan modus ibadah umrah atau haji maka akan dicabut izinnya oleh Kementerian Agama, katanya. Penyelenggara umrah mengadukan ke menteri bahwa banyak jamaahnya yang melarikan diri ketika mau pulang ke Tanah Air. Ada juga kecenderungan para TKI yang datang dengan visa umrah ini memang sengaja untuk tidak pulang. Para TKI ilegal itu banyak diduga melanggar peraturan karena diiming-imingi bekerja di Timur Tengah dengan gaji tinggi oleh TKI yang sudah terlebih dulu tinggal di sana.

Kurikulum Baru Diterapkan Juli KUDUS (Antara): Menteri Pendidikan dan Kebudayaan Mohammad Nuh menegaskan kembali bahwa kurikulum baru siap diterapkan mulai pertengahan Juli 2013. “Saat itu, bertepatan dengan tahun pelajaran 2013/2014,” ujarnya ditemui usai menghadiri Maulid Nabi Muhammad SAW, Istighosah, dan Harlah Muslimat NU di halaman SD Unggulan Muslimat NU Kudus di Jawa Tengah, Jumat (29/3). Saat ini, katanya, sedang dipersiapkan mulai dari buku pelajaran, pelatihan tenaga pensosialisasi, hingga pelatihan guru.

Ia mengatakan, saat sekarang masih dalam tahap sosialisasi kurikulum 2013 tersebut. Rencananya pelatihan guru secara massal akan dilaksanakan Juni 2013 yang bertepatan dengan liburan sekolah. Perubahan paling mendasar dari kurikulum baru tersebut, katanya, untuk kurikulum SD akan menggunakan tematik terpadu atau pelajaran yang jumlahnya cukup banyak akan dikurangi dan diramu. Nantinya, kata dia, setiap pelajaran mencakup tiga aspek, yakni keterampilan, sikap dan pengetahuan menjadi

satu paket. Ia mencontohkan, mata pelajaran Bahasa Indonesia juga akan mengajarkan kejadian sehari-hari. Selain itu, kata dia, metodologi yang digunakan yang membangkitkan kreativitas, sehingga anak akan diajarkan observasi, bertanya, berfikir/ nalar, presentasi, dan menyampaikan gagasan.”Insya Allah kurikulum baru nantinya lebih bagus,” ujarnya. Terkait dengan muatan lokal, katanya, tetap ada, karena tidak ingin akar dari daerah setempat dihilangkan.

Nama-nama Pemenang MTQ IX Dan FSN X Kab Serdangbedagai

Waspada/Edi Saputra

Waspada/Edi Saputra

BUPATI Sergai, H.T Erry Nuradi,Wabup Sergai, H. Soekirman, Dandim 0204 DS, Letkol.Arh.Syaiful Mukti Ginanjar , Sekdakab Sergai, Drs. H. Haris Fadillah foto bersama juara II MTQ ke IX Sergai, Kafilah Kec. Sei Rampah, Kamis (28/3) malam di pelataran replika Sultan Serdang. PERBAUNGAN (Waspada): Berdaskan keputusan Dewan Hakim Musabaqoh Tilawatil Qur’an (MTQ) IX tingkat Kab. Serdangbedagai tahun 2013 tentang Qori dan Qoriah terbaik, ditetapkan di Perbaungan, 28 Maret 2013 yang ditandatangani Ketua Dewan Hakim MTQ IX, H.M Nasir, Sekretaris, H.M.David Saragih SAg.MM diketahui Kakan Kemenag Sergai, Drs.H.M Hasbi, MH selaku Ketua Harian LPTQ Sergai. Cabang Musabaqoh Tilawatil Qur’an (MTQ) Golongan Dewasa Putra, pembaca terbaik I NPP 33 nilai 93, Sarwedi Harahap (Kec.Tanjung Beringin), terbaik II, NPP 11 nilai 91, Muhammad Rifa’i (Kec.Tebing Tinggi), terbaik III, NPP 29 nilai 87, Ahmad Rahmadani (Kec. Dolok Merawan), Harapan I, NPP 27, Wandi (Kotarih), Harapan II, NPP 05,Muhammad Azhan (Kec.Teluk Mengkudu) dan harapan III, NPP 23 Muhammad Azra’i Nasution (Dolok Masihul) Golongan Dewasa Putri pembaca terbaik I NPP 04 nilai 92, Khairiah (Kec.Perbauangan) terbaik II NPP 08 nilai 91, Dewi Rosita (Kec.Tebing Syahbandar) terbaik III NPP 18 nilai 87, Siti Hajar (Kec.Pegajahan), Harapan I NPP 24, Nurhabibah (Kec.Sei Rampah), harapan II NPP 30,Wira Mustaqimah (Kec. Serba Jadi) harapan III NPP 12, Desi Nursahniya (Kec. Kotarih). Golongan Remaja Putra, pembaca terbaik I NPP 47 nilai 86, Hadi Gunawan Tanjung (Kec.Tanjung Beringin) terbaik II NPP 57 nilai 80, Miswanto (Kec. Serba Jadi) terbaik III NPP 59 nilai 78, Amidhan Khairi (Kec. Perbaungan) Harapan I NPP 67, Fajar Siddiq (Kec. Bintang Bayu) harapan II NPP 37, Agus Pranata (Kec. Kotarih) harapan III NPP 39, Marzuki (Kec.Tebing Syahbandar). Golongan Remaja Putri, pembaca terbaik I NPP 64 nilai 89, Irma Albani (Kec. Kotarih) terbaik II NPP 60 nilai 83, Nadia Khair (Kec. Tanjung Beringin) terbaik III NPP 54 nilai 77, Nur Afni Nasution (Kec. Dolok Masihul) Harapan I NPP 62,Rahma Widari (Kec. Pantai Cermin)Harapan II NPP 38, Ria Agustina (Kec. Sei Rampah) Harapan III NPP 48, Suciani (Kec. Serba Jadi). Golongan Anak-Anak Putra, pembaca terbaik I NPP 71 nilai 89, Hasbie Farizi (Kec. Pegajahan) terbaik II NPP 95 nilai 84, Rhaka Isnandi (Kec. Tanjung Beringin) terbaik III NPP 77 nilai 80, Fajar Syahmir (Kec. Serba Jadi) Harapan I NPP 73, Ahmad Tarmizi (Kec. Sei Bamban) harapan II NPP 75, Muhammad Arif Prayoga (Kec. Kotarih) harapan III NPP 89, Syaiful Lizan (Kec. Perbaungan) Golongan Anak-Anak Putri, pembaca terbaik I NPP 102 nilai 93, Rahma Mayan Dalimunthe (Kec.Sei Rampah) terbaik II NPP70 nilai 85, Khoiratun Hisan (Kec. Perbaungan) terbaik III NPP 76 nilai 78,Sri Hayati (Kec. Serba Jadi) Harapan I NPP 80,Siti Azzahra (Kec. Silinda) harapan II NPP 98 Irma Widia (Kec. Tebing Syahbandar) harapan III NPP 84,Syaibatul Aslamiyah (Kec. Tanjung Beringin) Golongan tartil Putra, pembaca terbaik I NPP 129 nilai 87, Muhammad Fauzhi Azhima (Kec.Tanjung Beringin) terbaik II NPP 121 nilai 84, Hasbi Fadillah (Kec. Kotarih) terbaik III NPP 123 nilai 81, Muhammad Ihsan Fadly (Kec. Perbaungan) Harapan I NPP 113, Farhan Muttaqin Fatin (Kec.Pantai Cermin)harapan II NPP 125 Maslahatul Imam (Kec.Pantai Cermin) harapan III NPP 135, Muhammad Shopian Al Fathir (Kec. Serba Jadi) Golongan Tartil Putri, pembaca terbaik I NPP 126 nillai 92, Najwaulin Nuha (Kec.Tanjung Beringin) terbaik II NPP 118 nilai 89, Putri Amalia Fahira (Kec. Tebing Syahbandar) terbaik III NPP 122 nilai 82,Nurul Hidayah (Kec.Kotarih) Harapan I NPP 112, Rafida (Kec. Teluk Mengkudu) harapan II NPP 116, Cut Ayu (Kec. Pantai Cermin) harapan III NPP 130, Alvinna Syafila Harahap (Kec. Silinda) Golongan Canet Putra, pembaca terbaik I NPP 149 nilai 75, Alamuddin (Kec. Dolok Masihul) terbaik II NPP 137 nilai 7, Khairul Ibnu (Kec. Sei Rampah) Golongan Cenet Putri terbaik I NPP 152 nilai 62, Nevi Ariani (Kec. Sei Rampah). Golongan Qira’at Sab’ah Putra, pembaca terbaik I NPP 521 nilai 89,Muhammad Zaid Nasuition (Kec. Tebing Syahbandar) terbaik II NPP 527 nilai 84, Suyatman (Kec. Kotarih) terbaik III NPP 533 nilai 8,Ikhwan Saragih (Kec. Sei Rampah) Harapan I NPP 515, Ahmad Fauzi Nasution (Kec. Perbaungan). Golongan Qira’at Sab’ah Putri, pembaca terbaik I NPP 520 nilai 86, Dewi Wahyuni (Kec.Sei Rampah) terbaik II NPP 540 nilai 83, Ainul Afifah Nasution (Kec.Perbaungan) terbaik III NPP 516 nilai 73, Yusmita Susanti (Kec.Teluk Mengkudu)

BUPATI Sergai, Ir.H.T Erry Nuradi MSi bersama Wabup Sergai, Ir.H.Soekirman dan Sekdakab Sergai, Drs.H.Haris Fadillah MSi selaku Ketua Panitia menyerahkan trophi bergilir juara umum MTQ IX dan FSN X tahun 2013 tingkat Kab.Sergai Kec.Perbaungan yang diterima Camat Perbaungan, Drs.Akmal, Kamis (28/3) malam di pelataran replika Istana Sultan Serdang, Kel.Tualang, Kec.Perbaungan.

Cabang Musabaqoh Hifzil Qur’an (MHQ) untuk Golongan Tahfiz I Juz Tilawah Putra, pembaca terbaik I NPP 171 nilai 87,5, MHD.Irsandi Haikal Tanjung (Kec. Kotarih) terbaik II NPP 203 nilai 82,5, Muhammad Hamdi Saragih (Kec.Sipispis) terbaik III NPP 195 nilai 81,5, Ahmad Mufrih (Kec.Perbaungan) Harapan I NPP 183, Apriyandi Wijaya (Kec.Sei Rampah) harapan II NPP 187, Husni Sitorus (Kec.Pegajahan) harapan III NPP 191, Zainul Akbar (Kec.Bintang Bayu) Golongan Tahfis I Juz Tilawah Putri pembaca terbaik I NPP 202 nilai 88,5, Bai’ah (Kec.Tebing Syahbandar) terbaik II NPP 186 nilai 88, Danisha Salsabilla Hasibuan (Kec.Perbaungan)terbaik III NPP 180 nilai 86,3, Putri Nabila (Kec.Pantai Cermin) Harapan I NPP 196, Sara Afriani (Kec.Sei Rampah) harapan II NPP 194, Nurul Vikha Fitri (Kec.Teluk Mengkudu) harapan III NPP 176, Syakinah Alfina (Kec.Silinda). Golongan Tahfiz 5 Juz Tilawah Putra, pembaca terbaik I NPP 213 nilai 89,5, Ahmad Syafi’i (Kec. Teluk Mengkudu) terbaik II NPP 231 nilai 89, Chumaidi Munthe (Kec. Pegajahan) terbaik III NPP 223 nilai 88, Tri Alvianda (Kec.Tebing Tinggi) Harapan I NPP 217, Muflihun Naja (Kec. Tanjung Beringin) harapan III NPP 221, Rahmat Mulinun (Kec. Kotarih). Golongan Tahfiz 5 Juz Tilawah Putri, pembaca terbaik I NPP 208 nilai 94, Ramona (Kec. Tebing Syahbandar) terbaik II NPPP 206 nilai 88, Alysha Andini Hasibuan (Kec.Perbaungan) terbaik III NPP 226 nilai 77, Mutia Rahmadani (Kec. Dolok Masihul) Harapan I NPP 236, Lili Linawati (Kec.Pegajahan) harapan II NPP 234, Mita Sulistiani (Kec.Silinda) harapan III NPP 228, Tika Apriani (Kec. Kotarih) Golangan Tahfiz 10 Juz Putra, pembaca terbaik I NPP 259 nilai 92,5, Muhammad Fauzi (Kec. Tebing Syahbandar) terbaik II NPP 257 nilai 91, Akbar (Kec. Perbaungan) terbaik III NPP 267 nilai 90, Andriansyah Siagian (Kec. Pegajahan) Harapan I NPP 269, Muhammad Fahmi Reza (Kec. Dolok Masihul) harapan II NPP 255, Komaruddin (Kec. Sei Rampah) harapan III NPP 243, Kholilullah Tamba (Kec. Silinda) Golongan Tahfiz 10 Juz Tilawah Putri, pembaca terbaik I NPP 258 nilai 85, Inayati Syaflinda (Kec. Sei Rampah) terbaik II NPP 250 nilai 79, Nurjannah Lubis (Kec. Perbaungan) terbaik III NPP 268 nilai 74, Leli Susanti (Kec.Tebing Syahbandar) Harapan I NPP 260, Astuti Raudhatul Huda (Kec. Tanjung Beringin) harapan II NPP 254, Tika Kumalasari (Kec. Pegajahan) harapan III NPP 266, Milpadiyanti (Kec. Dolok Masihul). Golongan Tahfiz 20 Juz Putra, pembaca terbaik I NPP 277 nilai 93, Azrian Syah (Kec. Tebing Syahbandar) terbaik II NPP 289 nilai 92,5, Bayu Muhammad (Kec. Kotarih) terbaik III NPP 301 nilai 85, Rahmatd Romadhon Nasution (Kec.Pantai Cermin) Harapan I NPP 291, Andri Amriza (Kec. Perbaungan) harapan II NPP 287, Khairul Sahri (Kec. Dolok Masihul) harapan III NPP 275, Akbar Ar Razak (Kec. Sei Rampah). Golongan Tahfiz 20 Juz Putri, pembaca terbaik I NPP 282 nilai 79, Syarifah (Kec. Sei Bamban) terbaik II NPP 274 nilai 51, Rahmah Hildani (Kec. Teluk Mengkudu) terbaik III NPP 304 nilai 50, Fitri Handayani (Kec. Sei Rampah) Harapan I NPP 276, Halimatus Sa’diyah (Kec. Tanjung Beringin) harapan II NPP 278, Nurjulia Rohada (Kec. Dolok Masihul) harapan III NPP 296, Sri Muthiah (Kec. Silinda). Golongan Tahfiz 30 Juz Putra, pembaca terbaik I NPP 335 nilai 89, Ahmad Sholihin (Kec. Kotarih) terbaik II NPP 323 nilai 84,5, Ananda setiawan (Kec. Perbaungan) terbaik III NPP 317 nilai 78,5, Mustofa Sihombing (Kec.Tanjung Beringin) Harapan I NPP 331, Muhammad Fadli Alhadi (Kec. Dolok Masihul) Golongan Tahfiz 30 Juz Putri, pembaca harapan I NPP 312, Arwa Inayati (Kec. Perbaungan) harapan II NPP 318, Rafiqah Marhumah (Kec. Sei Rampah) harapan III NPP 324, Rofikotul Husna (Kec. Dolok Masihul) Cabang Musabaqoh Syarhil Qur’an (MSQ) pembaca terbaik I NPP 354 nilai 86,5, Widya Fazrina, Siti Rahmayani, Siti Nurjannah (Kec. Perbaungan) terbaik II NPP 346 nilai 85, Ira Agustina Tarigan, Neni Sapriani, Miftahul Jana (Kec. Serba Jadi) terbaik III NPP 342 nilai 84,5, Khairunnisa, Disky Firdaus, Nurjannah Lubis (Kec. Sei Rampah) Harapan I NPP 351, Muhammad Arif Sanjaya, Nurmadinah

Waspada/Edi Saputra

BUPATI Sergai, H.T Erry Nuradi,Wabup Sergai, H.Soekirman, Dandim 0204 DS, Letkol.Arh.Syaiful Mukti Ginanjar, Sekdakab Sergai, Drs.H.Haris Fadillah foto bersama , Kafilah Kec. Teluk Mengkudu, Kamis (28/3) malam di pelataran replika Sultan Serdang, Kel.Tualang, Kec.Perbaungan.

Siregar, Mhd. Fikri Maulana Nasution (Kec.Pantai Cermin) harapan II NPP 353, Ita Khairani, Muliana Manurung, Fatmawati Putri (Kec. Teluk Mengkudu) harahap III NPP 347, Muhammad Irsyad, MHD. Nurhammdi Prasetya, Kahirun Nisa (Kec. Silida) Cabang Musabaqoh Fahmil Qur’an (MFQ) pembaca terbaik I NPP 365 nilai 1120, Muti’an Ridhon, Eka Safitri, Muhammad Prasetio (Kec.Sei Rampah) terbaik II NPP 366 nilai 605, Tengku Zulfikar, Sri Wahyuni, Cahya Syahputri (Kec.Serba Jadi) terbaik III NPP 371 nilai 475, Raudhatul Husna Hasibuan, Muhammad Nizar Hamdi, Hilmiyah Humaidi Damanik (Kec.Perbaungan) Harapan I NPP 358, Yogi Pratama, Syaiful Ramadhan, Muhammad Tri Gunawan (Kec.Pantai Cermin) harapan II NPP 373, Lailatusy Syifa Sirait. Adytia Eko Maulana (Kec.Tanjung Beringin) harapan III NPP 362, Susilawati, Siswanti, Desi Diliyanti (Kec.Bintang Bayu) Cabang Musabaqoh Makalah Ilmiyah Al Qur’an (M2IQ) Golongan M2IQ Putra, pembaca terbaik I NPP 377 nilai 80,83, Herman Syafi’i (Kec. Sei Rampah) terbaik II NPP 383 nilai 77,5, Untung Aulia Safri Sitorus (Kec. Perbaungan) terbaik III NPP 76,33, Arief Dharmawan (Kec. Pegajahan) Harahapan I NPP 407, Agus Pratama (Kec.Pantai Cermin) harapan II NPP 399, Lilik Sugianto (Kec. Sei Bamban) harapan III NPP 391, Abdur Rahman Hadi Saragih (Kec. Silinda) Golongan M2IQ Putri, pembaca terbaik I NPP 400 nilai 88, Ridha Risti (Kec. Pantai Cermin) terbaik II NPP 382 nilai 81,66, Sri Kasmilah (Kec. Bintang Bayu) terbaik III NPP 380 nilai 81,16, Juliana Nasution (Kec. Sei Rampah) Harapan I NPP 369, Badratul Khairiyah (Kec. Perbaungan) harapan II NPP 398, Rosyidatul Afifah (Kec. Pegajahan) harapan III NPP 390, Ulfah (Kec. Tebing Syahbandar) Cabang Musabaqoh Tafsir Al Qura’an, Golongan Tafsir Bahasa Indonesia Putra, pembaca terbaik I NPP 419 nilai 165, Ratno Sahat Ramanda (Kec. Kotarih) terbaik II NPP 435 nilai 162, Irwansyah (Kec. Sei Rampah) terbaik III NPP437 nilai 160 Ahmad Suhaili (Kec. Tanjung Beringin) Harapan I NPP 431, Abdul Mukhlis (Kec. Perbaungan). Cabang Musabaqoh Tafsir Al Qur’an, Golongan Tafsir Bahasa Indonesia Putri, Pembaca terbaik Harapan I NPP 414, Masrifah (Kec. Tanjung Beringin) Harapan II NPP 416, Fauziah (Kec. Tebing Syahbandar). Cabang Musabaqoh Tafsir Al Qur’an, Golongan Tafsir Bahasa Inggris Putra, Pembaca terbaik I NPP 475 nilai 183,5 Zulkifli (Kec. Perbaungan) terbaik II NPP 469 nilai 178, Zainul Fadli (Kec. Sei Rampah) terbaik III NPP 445 nilai 173, Muhammad Syaifullah Siregar (Kec. Kotarih) Harapan I NPP 455, Muhsin Al Mubarik (Kec. Tanjung Beringin) Harapa II NPP 449, Ramlan Saat (Kec. Tebing Syahbandar) Harapan III NPP 465, Suprayitno (Kec. Sei Bamban). Cabang Musabaqoh Tafsir Al Qur’an, Golongan Tafsir Bahasa Inggris Putri, Pembaca terbaik I NPP 470 nilai 162,5 Aini Darli Saragih (Tebing Syahbandar) Harapan III NPP 468, Achirani (Kec. Perbaungan). Cabang Musabaqoh Tafsir Al Qur’an, Golongan Tafsir Bahasa Arab Putra, Pembaca terbaik II NPP 481 nilai 147,5 Nico Irvana (Kec. Kotarih). Cabang Musabaqoh Khattil Qur’an (MKQ), Golongan Tulisan Buku Putra, Pembaca terbaik I NPP 567 nilai 252, Ja’far Al Amin (Kec. Sei Rampah) terbaik II NPP 551 nilai 246, Muhammad Zaty Permana (Kec. Bintang Bayu) terbaik III NPP 577 nilai 239, Teguh Hasibuan (Kec. Tebing Syahbandar) Harapan I NPP 557, Zainuddin Lubis (Kec. Perbaungan) Harapan II NPP 545, Fatur Rahman (Kec. Pantai Cermin) Harapan III NPP 573, Ahmad Fauzi Harahap (Kec. Dolok Masihul). Cabang Musabaqoh Khattil Qur’an (MKQ), Golongan Tulisan Buku Putri, Pembaca terbaik I NPP 554 Nilai 247, Ningtyas Viviana Ningsih (Kec. Perbaungan) terbaik II NPP 568 Nilai 240, Mawaddah (Kec. Sei Rampah) terbaik III NPP 576 nilai 234, Irma Yani (Kec. Tebing Syahbandar) Harapan I NPP 546, Nurazizah Bancin (Kec. Tanjung Beringin) Harapan II NPP 552, Weni Azrina Siregar (Kec. Silinda) harapan III NPP 574, Asih Purwasih (Kec. Dolok Masihul). Golongan Hiasan Mushaf Putra, Pembaca Terbaik I NPP 613 nilai 257, Muhammad Rizal (Kec. Tebing Syahbandar) terbaik II NPP 635 nilai 252, Edwin Syaputra Matondang (Kec. Dolok

Masihul) terbaik III NPP 625 nilai 241, Muammar Munthe (Kec. Perbaungan) harapan I NPP 619, Khairul Amri Pane (Kec. Silinda) harapan II NPP 621, Mustafa Anni Zhami (Kec. Sei Rampah) harapan III NPP 627, Muhammad Ridho (Kec. Sipispis). Golongan Hiasan Mushaf Putri, Pembaca Terbaik I NPP 638 nilai 248, Novita Sari (Kec. TebingTinggi) terbaik II NPP 644 nilai 342, Annisa Kinasih (Kec. Perbaungan) terbaik III NPP 632 nilai 234, Nur Rahmayani Ahda (Kec. Sei Rampah) harapan I NPP 614, Khairiah (Kec. Tanjung Beringin) harapan II NPP 628, Dewi Puspita Sari (Kec. Tebing Syahbandar) harapan III NPP 648, Leni (Kec. Teluk Mengkudu). Golongan Dekorasi Putra, Pembaca terbaik I NPP 611 nilai 260, Heri Kiswanto (Kec. Teluk Mengkudu) terbaik II NPP 597 nilai 253, Dwiky Wendi Rahmadana (Kec. Perbaungan) terbaik III NPP 579 nilai 246, Hendra Wijaya (Kec. Tanjung Beringin) harapan I NPP 603, Rustam Efendi (Kec. Sei Rampah) harapan II NPP 585, Muhammad Ronaldo Alfarabi (Kec. Silinda) Harapan III NPP 593, Ahmad Zaikhu Tambunan (Kec. Pegajahan). Golongan Dekorasi Putri, Pembaca terbaik I NPP 584 nilai 255, Ermi Daini (Kec. Tebing Syahbandar) terbaik II NPP 598 nilai 249, Nazli Arfah Nasution (Perbaungan) terbaik III NPP 610 nilai 241, Rika Chairani (Kec. Tanjung Beringin) harapan I NPP 592, Sri Wahyuni (Kec. Sei Rampah) harapan II NPP 612, Zulaikha (Kec. Pegajahan) harapan III NPP 590, Khairunnisa (Kec. Silinda). Peringkat Kafilah Terbaik Juara umum 1 (satu) Kec. Perbaungan nilai 58, Juara umum 2 (dua) Kec. Sei Rampah nilai 52, Juara umum 3 (tiga) Kec. Tebing Syahbandar nilai 49, Peringkat ke empat Kec. Kotarih nilai 34, Peringkat ke lima Kec. Tanjung Beringin nilai 30, peringkat ke enam Kec. Teluk Mengkudu nilai 14, peringkat ke tujuh Kec. Pegajahan nilai 11, peringkat ke delapan Kec. Serbajadi nilai 11, Peringkat ke Sembilan Kec. Dolok Masihul nilai 10, peringkat ke sepuluh Kec. Tebing Tinggi nilai 9, peringkat ke sebelas Kec. Pantai Cermin nilai, 7, peringkat ke dua belas Kec. Bintang Bayu nilai 6, peringkat ke tiga belas Kec. Sei Bamban nilai 5, peringkat ke empat belas Kec. Sipispis nilai 3, peringkat ke lima belas Kec. Dolok Merawan nilai 1, peringkat ke enam belas Kec. Silinda, peringkat ke tujuh belas Kec. Bandar Khalifah. Peserta Pawai Ta’aruf Terbaik Terbaik I, Kec.Sei Rampah, terbaik II, Kec.Dolok Masihul, terbaik III, Kec.Perbaungan, Terbaik IV, Kec.Tebing Tinggi, terbaik V PGRI Kab.Sergai terbaik VI Kec.Pegajahan. Stand Pameran Terbaik Terbaik I Stand Badan Pemberdayaan Perempuan, Anak dan KB Kab.Sergai, terbaik II Stand Kantor Kementrian Agama Kab.Sergai, terbaik III stand Dewan Kerajinan Nasional Kab.Sergai. Harapan I stand Badan Pemberdayaan Masyarakat Desa Kab.Sergai, harapan II stand Dharma Wanita Persatuan Kab. GOPTKI Sergai, harapan III stand gabungan Kec.Tebing Syahbandar dan Kec.Dolok Masihul, Favorit , stand Dinas Kesehatan Kab.Sergai. Peserta FSN ke X Terbaik Keputusan Dewan Juri Festival Seni Nasyid (FSN) ke X tingkat Kab.Sergai yang ditandatangani Ketua Dewan Hakim, Hj.Rita Nurai Nasution dan Sekretaris Dewan Hakim, Drs.H.M Hasbi MH. Golongan Putra, terbaik I NPP 23 , grup Amal Ihklas, nama solis Muhammad Nur Fadli (Kec.Perbaungan) terbaik II NPP13grup Syifail Hayati nama solis Abdul Halim (Kec.Tebing Tinggi) terbaik III NPP 31 grup Al Ikhwan nama solis Ahmat Faisal (Kec.Dolok Masihul) Harapan I NPP 07 grup Al Hidayah nama solis Muhammad Saleh (Kec.Seraba Jadi) harapan II NPP 09 grup Al Azhar nama solis Azhar Handono (Kec.Pegajahan) harapan III NPP 33 grup Inayah nama solis Muhas IR (Kec.Sei Rampah) Golongan Putri terbaik I NPP 28 grup Az Zahra, solis Suziana (Kec.Tebing Syahbandar) terbaik II NPP 32 grup Nurul Huda, Solis Nurbaiti (Kec.Bandar Khalipah) terbaik III NPP 34 grup Khairunnisa, solis Saniah (Kec.Pantai Cermin) Harapan I NPP 16 grup Annisatul Jamilah, solis Yunita Sari (Kec.Tebing Tinggi) harapan II NPP 06, grup Al Hidayah, solis Santi Purnama Sari (Kec. Serba Jadi) harapan III NPP 24 grup Al Kahfi, solis Mahairani Harahap. Selaku Ketua Panitia MTQ ke IX dan FSN ke X Kab.Sergai tahun 2013, Drs.H.Haris Fadillah MSI (Sekdakab Sergai) Sekretaris Panitia, Ikhsan AP (Kabag Kesos Sergai). (c03)

Luar Negeri

WASPADA Sabtu 30 Maret 2013


Peruindingan Damai Muslim-Thai:

BRN: Bebaskan Semua Tahanan BANGKOK, Thailand (Bangkok Post): Para wakil pejuang Muslim menuntut agar pihak berwenang Thai agar membebaskan semua tahanan yang divonis dalam berbagai kasus kerusuhan di selatan dan meniadakan perintah penahanan yang dikeluarkan bagi para tersangka militan selama putaran pertama perundingan damai formal di Kuala Lumpur, Malaysia. Pada saat berlangsung perundingan di satu kemp polisi yang tak disebutkan di ibukota Malaysia, tiga anggota rangers militer tewas dalam satu ledakan bom di Narathiwat. Berbicara setelah perundingan 12 jam, Sekjen Dewan Keamanan Nasional (NSC) Letjend. Paradorn Pattanatabut mengatakan kepala kantor penghubung Barisan Revolusi Nasional (BRN) HassanTaibtelahmengajukansatu tuntutan umum bagi pemberian amnestiuntukparapemberontak selatan.

Tuntutan itu termasuk juga pengguguranperintahpenangkapan terhadap para tersangka pemberontak,untukmembebaskanparatahananyangtelahdihukumdalamkasuskerusuhandiselatan; untuk membersihkan semua kasus terhadap para tersangka pemberontakdanmencabutdaftar hitamatastersangkapemberontak. Letjend Paradorn mengatakan dia menolak tuntutan untuk membebaskan para tahanan, sementara pasal lainnya akan dibicarakan dulu dengan Kementerian Kehakiman serta berbagai

lembaga terkait. KepalaNSCitujugamengatakan dia menyerukan kepada para pemberontak agar menahan diri dan tidak menyerang sasaran sipil. Dalam merespon janji Taib untuk mencoba dan meyakinkan kelompok separatis lainnya agar mencegah kerusuhan. Namun, Taib mengakui sulit untuk mendesak kelompok lainnyayangmenentangperundingan damai untuk mengurangi serangan mereka, kata Letjend Paradorn, yang memimpin delegasi pemerintah yang beranggota sembilan orang.

Para separatis yang diwakili oleh para anggota Koordinasi BRN, Kongres BRN dan Pattani United Liberation Organisation (Pulo). Sebelumnya diduga masing-masing kelompok separatis akan mengirimkan 15 delegasinya, termasuk para wakil dari sembilan kelompok pemberontak, akan hadir. KeduabelahpihakKamisjuga menyetujuibeberapapasaluntuk perundingan damai berikutnya yang akan dilanjutkan pada 29 AprildiMalaysia.Satupernyataan bersama mengenai perundingan Kamis itu akan disiarkan Jumat

dalam tiga bahasa, Thai, Inggris dan Bahasa Melayu. Sekretaris Dewan Keamanan Nasional Malaysia Mohamed Thajudeen Abdul Wahab mengonfirmasi hal tersebut kepada Xinhua. Paradorn dikutip oleh media Thailand mengatakan bahwa ia mengharapkan kekerasan akan menurun pada saat pembicaraandenganBarisanRevolusiNasional (BRN) berlangsung. Para pejabat pemerintah Thailand mengatakan mereka berharap untuk mengidentifikasi hambatan-hambatan agar kekerasan

itu berkurang. BRNadalahsalahsatukelompok pemberontak utama di Thailand selatan yang bergolak. Para pihak mencapai kesepakatan dengan pihak berwenang Thailand pada Februari untuk memulai pembicaraan damai yang difasilitasi oleh Malaysia. Lebih dari 5.000 orang telah tewas di Thailand Selatan yang mayoritas didominasi penduduk etnis Melayu Muslim, meliputi ProvinsiYala, Pattani, Narathiwat danempatdistrikSongkhladiperbatasanselatan-sejakaksikekerasan meletus pada Januari 2004. (m10)

Syria Gagal Pertahankan Kota Dekat Perbatasan Jordania BEIRUT, Lebanon (AP): Para aktivis mengatakan pasukan Syria gagal mempertahankan satu kota strategis dekat perbatasan dengan Jordania setelah terjadi pertempuran sengit sehari yang menewaskan 38 orang. ObservatoriumHAMSyriamengatakan16pemberontaktermasuk di antara korban tewas dalam pertempuran di dan sekitar Dael yang berakhir Jumat (29/3) dinihari. Kota tersebut terletak hanya beberapa mil dari perbatasan Jordania di provinsi Daraa di mana pergolakan terhadap rezim Presiden Bashar Assad dimulai pada 2011. Kawasan itu dianggap satu gerbang ke Damaskus. Bentrokanbentrokan di sana baru-baru ini telah meningkat ketika pemberontak berusaha untuk mendesak ke ibukota Syria. Pertempuran untuk merebut Dael terjadi ketika satu serangan mortir atas kampus Universitas Damaskus yang menewaskan sekurang-kurangnya 10 mahasiswa Kamis. PBB mengatakan perang saudara Syria telah merenggut 70.000 jiwa. (m10)

Empat Bom Mobil Meledak Di Masjid Baghdad, 4 Tewas BAGHDAD, Irak (AFP): Empat bom mobil menghantam beberapa masjid Syiah pada saat shalat Jumat (29/3) di Baghdad dan di daerah bertikai Kirkuk di Irak Utara, yang menewaskan sekurang-kurangnya empat orang dan mencederai lebih dari 80 orang, demikian menurut sejumlah pejabat. Semua ledakan terjadi dengan selisih waktu satu jam satu dengan lainnya di kawasan Jihad, Qahira dan Zafraniyah di Baghdad, serta satu kawasan lainnya di selatan Kirkuk. Serangan tersebut terjadi di tengah meningkatnya kerusuhan di seluruh Irak ketika negeri tersebut bersiap untuk melaksanakan pemilihan umum pertama dalam tiga tahun — pemungutan suara provinsi itu akan dilakukan di 12 dari 18 provinsi Irak pada 20 April. Dalam serangan yang paling maut itu, tiga orang tewas dan 70 lainnya cedera akibat satu bom mobil di selatan kota Kirkuk, dekat masjid al-Rasul al-Aadham, demikian menurut Sadiq Omar Rasul, kepala direktorat kesehatan provinsi. (m10)

COTABATO, Filipina (AFP): Sekurang-kurangnya 12 orang dilaporkan tewas diterjang tornado kecil di sebuah wilayah selatan Filipina.Sebagianbesarkorbanadawargayangtengahmenaikikapal motor yang melintas sebuah rawa. Kapal motor berukuran kecil itupadaawalnyadidesainuntuk10penumpang.Tetapiketikakecelakaan terjadi penumpang kapal dikabarkan mencapai 18 orang. Kapal itu punolengsaatditerjanganginkencangdisebuahdesakecildiCotabato. “Anginyangmenghembussangatkencangkekuatannya.Adatornado kecil yang lewat di dekat kapal yang mengakibatkan penumpang panik dan akhirnya kapal pun terbalik,” ujarWali Kota Cotabato Alan Aguas, seperti dikutip AFP, Kamis (28/3). Di antara korban tewas terdapat bocah kecil berusia antara 3, 7, dan 9 tahun. Aguas menggambarkantornadokecilyangtelahmemicukepanikan,meskipun memang ada laporan angin kencang yang disertai hujan deras ketika kecelakaan terjadi. Selain itu, kegelapan yang meliputi rawa makin mempersulit proses pencarian korban.

Kemarau Pengaruhi 23 Juta Orang Di China BEIJING, China (Antara/Xinhua-OANA): Kemarau, yang telah berlangsung sejak Oktober lalu, setakat ini telah mempengaruhi 23,7 juta orang yang tinggal di ProvinsiYunnan, Gansu dan Sichuan, sehingga menimbulkan kerugian ekonomi lebih dari 1,1 miliar dolar AS, kata pemerintah urusan sipil. KomisiPenguranganBencanaNasional(NDRC)danKementerian Urusan Masyarakat menggagas reaksi darurat terhadap kemarau Kamis (28/3) dan mengirim beberapa tim kerja untuk membantu meringankan dampak bencana, kata Xinhua. NDRC juga telah mengatur pertemuan guna menganalisis penyebab kemarau dan merancang tindakan untuk meringankan penderitaan warga. Pemerintah menyatakan kemarau tersebut mungkin masih berlangsung, sebab hujan lebat diperkirakan baru akan turun pada April.

Musharraf Dilempar Sepatu KARACHI, Pakistan (AP): Seorang pengacara yang marah melemparkan sepatunya ke arah kepala mantan Presiden Pervez Musharraf ketika dia menuju ke pengadilan di Pakistan Selatan Jumat (29/3) guna menghadapi tuduhan hukum menyusul kepulangannya ke tanahairnya setelah selama empat tahun mengasingkan diri, demikian menurut polisi. Sementara itu, seorang pengebom bunuhdiri Taliban yang menggunakan sepeda menyerang iring-iringan kendaraan yang membawa panglima polisi paramiliter di Pakistan Baratlaut, yang menewaskan sekurang-kurangnya 11 orang, termasuk se-orang bayi berusia empat bulan, kata polisi. Tidak jelas apakah Abdul Majeed Marwat, komandan paramiliterFrontierConstabularyuntukProvinsiKhyberPakhtunkhwa,terluka dalam serangan itu. “Itu adalah serangan bunuh diri, targetnya adalah komandan FC,” kata pejabat polisi Arshad Khan kepada AFP. Serangan itu terjadi ketika kepala polisi sedang melewati pos pemeriksaan militer di daerah pecinan yang sibuk di Peshawar. “Kami telah menerima enam mayat, termasuk dua wanita. Sebelas orang juga terluka,” kata Sayed Jameel Shah, juru bicara Rumah Sakit utama Lady Reading Peshawar kepada kepada AFP. Tidakadayangmengakuber-tanggungjawab,tetapipolisi,tentara dan satuan paramiliter Pakistan sering ditargetkan oleh Taliban domestik, yang telah melakukan pe-rang separatis sejak Juli 2007. Musharraf — yang berkuasa dalam kudeta militer tahun 1999 namundipaksamengundurkandirihampirsatudasawarsakemudian — tidak disenangi oleh banyak pengacara di seluruh Pakistan karena keputusannya untuk menskors hakim ketua Mahkamah Agung pada saat dia berkuasa. Pengacara tersebut melemparkan sepatunya ke arah Musharraf padasaatmantanorangkuatmiliterituberjalandisatulorongdigedung pengadilan di Karachi yang dipenuhi oleh polisi anti-huruhara, pendukungnyadanparawartawan,katapejabatkepolisianNasirAftab. Sepatu itu tidak mengenai Musharraf, dan pengacara tersebut tidak ditangkap karena tidak ada tuduhan yang dapat diajukan terhadap dia, kata Aftab. Pelemparan sepatu ke arah seseorang adalah suatu penghinaan terutama sekali di negara-negara Muslim karena barang tersebut dianggap najis. (m10)

Tornado Mini Tewaskan 12 Warga Filipina

Pejuang Moro Desak Filipina Percepat Proses Damai

The Associated Press

MANTAN Presiden Pakistan Pervez Musharraf (tengah, memegang kepala) dikawal ketat oleh para pendukungnya, setelah dia dilempar sepatu pada saat berjalan menuju ruang sidang pengadilan di Karachi, Pakistan, Jumat (29/3) yang menyidangkannya atas tuduhan pelanggaran hukum.

Korut Siapkan Roketnya Untuk Serang AS SEOUL, Korea Selatan (Antara/AFP): Pemimpin Korea Utara (Korut) Kim Jong-Un Jumat (29/ 3)memerintahkanpersiapanbagi serangan roket strategis ke daratan dan pangkalan-pangkalan militer Amerika Serikat setelah pembom-pembom siluman AS melakukan pelatihan di Korea Selatan (Korsel). Perintah itu dikeluarkan saat Menteri Pertahanan AS Chuck Hagel,saatketeganganmeningkat di semenanjung Korea, mengatakanWashingtontidakakangentar dengan ancaman-ancaman perang Pyongyang. Kim memerintahkan kesatuan-kesatuan roketnya siaga, dalam satu pertemuan mendadak Kamis malam setelah pengebom siluman AS B-2 yang dapat membawa senjata nuklir dikerahkan dalampelatihanmilitergabungan AS dengan Korsel. SekiranyaterjadiprovokasiAS ‘yangnekad,’pasukanKorutharus melancarkan “serangan tanpa ampunkedaratanAS...pangkalanpangkalan militer di Pasifik termasuk Hawaii dan Guam, dan di KoreaSelatan,”kataKimyangdikutip kantor berita resmi Korean Central News Agency. Kendatipun Korut tidak membuktikan kemampuan untuk melakukan serangan seperti itu, Kim mengatakan: “Saatnya tiba untuk menyelesaikan perhitungan dengan imperialis-imperialis AS.” Pemimpin muda itu menentang penerbangan pembomsilumanituyangmerupakan demonstrasi kekuatan dan mem-

berikan ‘ultimatum kepada AS bahwa mereka akan melancarkan perang nuklir.’ SeorangpejabatmiliterKorsel yang tidak disebut namanya yang dikutip kantor beritaYonhap mengatakan“peningkatantajam”dalam pergerakan personil dan kendaraan di lokasi-lokasi rudal jangkauan jauhdanmenengahKorut. AS jarang mengakui penerbangan-penerbangan B-2 ke Korsel yang secara teknis tetap berada dalam perang dengan Korut. Pesawat itu, untuk menghindari pertahanan antipesawat, membom target-target dalam konflik-konflik di Serbia, Afghanistan, Irak dan Libya. Pesawat-pesawat itu datang

sebagai bagian dari pelatihan militer tahunan antara Amerika Serikat dab Korsel, yang Korut setiap tahun kecam sebagai persiapan-persiapan bagi perang. Pyongyang sangat vokal saat ini,mengecam sanksi-sanksiPBB yang diberlakukan setelah peluncuranroketjarakjauhnyaDesember dan uji coba nuklir tiganya bulan lalu . Perintah Kim mengukuhkan langkah-langkah yang dilakukan oleh Tentara Rakyat Korea (KPA), yang menempatkan kesatuankesatuan roket strategis dalam status siap tempur Selasa. Pada hariberikutnya negaraitumemutuskanhubunganteleponkhusus langsung militer degan Korsel.

Ancaman-ancamanyangdatang dari Pyongyang itu dibantah sebagai gertakan, dan Korut tidak mengonfirmasikan kemampuan rudal untuk mencapai daratan AS- atau bahkan Guam atau Hawaii di Pasifik.TetapiWashington menanggapiancamanitudengan memperkuat kekuatan militernya. “Kami harus menegaskan bahwa provokasi-provokasi Korut ini ditanggapi dengan sangat seriusdankamiakanmenanggapi itu,” kata Hagel, membela penggelaran B-2. Intelijen militer AS menyatakanbahwaancamanperang Korut Korut itu sejauh ini tidak ditanggapi peningkatnya pasukan.

China Penjarakan 20 Warga Muslim Uighur Di Xinjiang BEIJING, China (Antara/ AFP): China menjatuhkan hukumanpenjarahinggaseumurhidup kepada 20 orang karena terlibat dalam terorisme dan‘mengobarkan separatisme’ di wilayah barat negara itu, Xinjiang, kata media pemerintah Kamis (28/3). Mereka dinyatakan bersalah atas serangkaian kejahatan, yang mencakup penyebaran bahan keagamaan garis keras dan upaya membentuk tempat perbincangan Internet untuk mendorong “separatisme etnik”, kata situs berita Tianshan. Situs yang merupakan corong pemerintah daerah itu juga mengatakan, orang-orang itu dituduh menyebarkan informasi mengenai Gerakan IslamTurkes-

tanTimur, yang dianggap sebagai sebuah organisasi teroris oleh Beijing, AS dan PBB. Warga tak berdosa Salah seorang dari mereka dituduh menyerang “warga tak berdosa” dan menghancurkan mobil, sepeda-motor serta benda-bendalain,katasitusitu,Selasa, setelah para terdakwa itu dijatuhi hukuman. Seorang pejabat di Xinjiang mengatakan kepada AFP, Rabu, pihaknya belum memiliki rincian mengenai kasus itu, sementara pengadilan setempat dan polisi tidak bisa dihubungi untuk diminta komentarnya. Xinjiangadalahtempattinggal penduduk etnik Uighur, warga muslim berbahasa Turki yang

berjumlah lebih dari 40 persen dari penduduk kawasan itu yang mencapai lebih dari 21 juta jiwa. Rabu,kelompokUighurdipengasingan menyebut hukumanhukumanitusebagaipenindasan. “Itu merupakan alat penindasan khusus pihak berwenang China untuk mendakwa warga Uighur melakukan terorisme dan menjatuhkaan hukuman berat kepadanya,” kata Dilxat Raxit, jurubicara Kongres Uighur Dunia kepada AFP. Ibu kota Xinjiang, Urumqi, menjadi pusat kerusuhan terburuk di China dalam beberapa dasawarsa pada 5 Juli 2009. Kerusuhanitumerengguthampir 200 jiwa dan mencederai sekitar 1.700 orang.

Piagam Senjata PBB Diblokir Iran, Korut Dan Syria

The Associated Press

KELUARGA KURDI TURKI LEMPARKAN KTP. Seorang wanita melemparkan kartu tanda pengenalnya (KTP) ketika para anggota keluarga 34 warga sipil Kurdi Turki — yang tewas dalam serangan pesawat tempur Turki di Uludere, di perbatasan Turki-Irak Desember 2011 lalu, yang menduga mereka anggota pemberontak Kurdi yang bermarkas di Irak — memegang foto anggota keluarganya yang tewas ketika mereka melakukan protes di luar parlemen di Ankara, Turki, Kamis (28/3). Mereka meneriakkan slogan-slogan untuk memprotes pemerintah dan meminta ‘mereka yang bertanggungjawab atas pembantaian Uludere’ agar diseret ke depan pengadilan.

TEHERAN, Iran (AP): Iran, Korea Utara (Korut) dan Syria dikabarkan memblokir piagam senjata yang ditujukan untuk mengendalikanperdagangansenjata yang nilainya mencapai AS$60 miliar atau sekira Rp582,7 triliun. Piagam yang masih berupa rancangan itu, diajukan ke hadapan negara anggota Perserikatan Bangsa Bangsa (PBB) untuk dimintai dukungan suara. Piagam itu nantinya akan melarang penjualan atau transfer senjata yang bisa berujung kepada tindakan genosida, kejahatan atas kemanusiaanataupunkejahatanperang. Penolakan dari ketiga negara yang saat ini dianggap sebagai musuh dunia itu memang beralasan.Parapendukungdaripiagam tersebut bahkan mengakui draf

final dari piagam tidak sempurna dan menciptakan beberapa lubang,meskipundianggapsebagai langkah awal untuk menghadapi perdagangan senjata ilegal. Tetapi setelah dua pekan melakukan negosiasi, piagam tersebut gagal untuk mendapatkan dukungan. “Ini bukan sebuah kegagalan, hari ini kami gagal untuk sepakat.Tetapi kegagalan itu tidak akan berlangsung lama,” ujar KetuaPerundingInggrisJoAdamson, seperti dikutipThe Associated Press, Jumat (29/3). Pemerintah Inggris selama ini menjadi pendukung utama dariPiagamPerdaganganSenjata. Piagam itu dianggap penting untukmemenuhistandarperedaran senjata dari para eksportis Inggris dengan negara-negara yang

dianggaptidakbisamemilikistandar itu. Industri senjata Inggris juga mendukung piagam tersebut. Sementara itu Menteri Luar Negeri Inggris William Hague mengaku kecewa karena anggota di PBB tidak berhasil mendapat konsensus bersama mengenai piagam tersebut. “Kami hampir saja berhasil. Amat mengecewakanbahwatiganegaramemblokir perjanjian bersejarah tersebut,” tutur Hague. “Sayamerasakecewadengan kegagalan negosasi itu. Setelah tujuh tahun kerja keras, dunia internasionalmemilikikesempatan untuk menyepakati ketentuan yang mengikat dan berpeluang untuk membuat dunia lebih aman,” jelas Hague. (ok/m10)

MANILA, Filipina (AFP): Front Pembebasan Islam Moro (The Moro Islamic Liberation Front/MILF) mendesak Pemerintahan Presiden Beningno Aquino untuk mempercepat proses perdamaian antara kedua belah pihak. MILF memperingatkan kekerasan bisa kembali pecah di Mindanao bila pakta perdamaian belum juga ditandatangani sebelum 2016. “Sebenarnya,bilakamitidakbisamenyelesaikannegosiasiinidengan sebuahkeberhasilandimasaPemerintahanPresidenBenignoAquino III, maka kami tidak tahu apa tantangan yang akan dihadapi pada 2016,” pernyataan pihak MILF, seperti dikutip AFP, Kamis (28/3).“Apa yang terjadi saat ini, bisa menjadi penyebab baru aksi kekerasan dan pertempuran di Mindanao,” lanjut pernyataan itu. Sebelumnya penasihat khusus Presiden Aquino untuk proses perdamaianinimengumumkan,PresidenAquinomemintanegosiasi damai yang dijadwalan pada 25 hingga 27 Maret ke depan sedianya ditunda hingga bulan depan. Kedua belah pihak akhirnya sepakat akan melanjutkan negosiasi pada pekan kedua April.

Filipina Beri Bantuan Pada Pengungsi Konflik Sabah MANILA, Filipina (Antara/Xinhua-OANA): Sekitar 4.700 warga Filipina telah melarikan diri dari Sabah karena konflik bersenjata terus berlangsung antara pendukung Sultan Sulu Jamalul Kiram III dan Kepolisian Kerajaan Malaysia, kata Dewan Pelaksana Pengurangan Risiko Bencana Nasional Filipina (NDRRMC). Para pengungsi Filipina tersebut lari ke provinsi Filipina selatan Basilan, Sulu danTawi-Tawi, kata lembaga itu. Departemen Kesejahteraan Sosial dan Pembangunan (DPKS) Filipina telah memberikan bantuan makanan dan non-pangan senilai 23.790.000 peso (581.662 dolarAS).EnampusatevakuasidiBongao,Tawi-Tawitelahmelakukan pra-identifikasi dalam mengantisipasi masuknya banyak pengungsi dari Sabah, kata NDRRMC Kamis (28/3).

Soyuz Pecahkan Rekor, Capai Angkasa Luar Dalam 6 Jam MOSKOW, Rusia (AP): Wahana antariksa milik Rusia, Soyuz, berhasil memecahkan rekor dengan membawa awak baru ke Stasiun Ruang Angkasa Internasional (ISS) dalam waktu hanya enam jam. Setelah diluncurkan dari Baikonur di Kazakhstan, kapsul Soyuz memasuki orbit, dengan menggunakan manuver balistik rumit, namun dengan cara baru ini lama penerbangan bisa dipangkas. Biasanya penerbangan dari bumi ke ISS memakan waktu 50 jam, demikian menurut BBC Jumat (29/3). Lintasan penerbangan yang lebih pendek membuat tiga awak, dua dari Rusia dan satu dari Amerika Serikat, bisa menghindari perjalanan melelahkan selama dua hari dan berimpit-impitan di dalam kapsul Soyuz, sebelum masuk ke ISS. Badan ruang angkasa Amerika (NASA) mengatakan para awak ini selama enam bulan ke depan akan melakukan 137 penelitian di bagian ISS yang dioperasikan oleh Amerika dan 44 penelitian di ruang yang dioperasikan Rusia. NASAmenjelaskanparaawakakanmelakukanpenelitiantentang manusia, biologi, fisika, teknologi, observasi bumi, dan pendidikan. Para ahli Rusia mengirim tiga kargo ke ruang angkasa melalui jalur cepat ini sebelum berupaya mengirim misi berawak. Mereka juga sedang mencoba untuk memperpendek lagi perjalanan ke ruang angkasa ini.(m10)

Prancis Akan Kurangi 1.000 Tentara Di Mali Akhir 2013 PARIS, Prancis (Antara/AFP): Empatribu tentara Prancis yang dikerahkan di Mali untuk melawan gerilyawan Islam akan dikurangi menjadi 1.000 pada akhir tahun ini, kata Presiden Prancis Francois Hollande. “Kami akan mulai menarik pada akhir April,” katanya dalam satu wawancara dengan televisi Prancis 2 Kamis (28/3). “Pada Juli, tidak akan ada lebih dari 2.000 tentara di Mali. Pada akhir tahun, hanya akan ada 1.000 tentara.” Prancis-yangmemimpinintervensimiliteruntukmengamankan Mali utara dari jaringan gerilyawan al-Qaida - yang ingin menarik diri danmenyerahkankepadapasukanAfrikayangdikenalsebagaiAFISMA yang akan berubah menjadi misi penjaga perdamaian PBB. Prancis telah menyerukan kepada 15-anggota Dewan Keamanan PBB untuk meloloskan satu resolusi April guna menyiapkan pasukan penjaga perdamaian, yang bisa berada di tempatnya pada Juli.

AS Tunjuk Breedlove Jadi Panglima Baru NATO WASHINGTON (Antara/AFP): Amerika Serikat menominasikan Jend. Philip Breedlove, seorang pilot veteran di Eropa, sebagai komandan tertinggi NATO sebulan setelah panglima perang di Afghanistan John Allen mengundurkan diri. Breedlove juga akan memimpin semua pasukan AS di Eropa. Nominasi Breedlove, yang telah diperkirakan, Kamis (28/3) sebelumnya diumumkan oleh Menteri Pertahanan Chuck Hagel, yang digambarkan secara umum sebagai “sangat berkualitas baik”. Dewan Atlantik Utara di Brussels menyetujui nominasi. Posisi ini secara tradisional dipegang oleh Amerika yang dominan perannya dalam aliansi. Breedlove akan mengambil alih dari Laksamana James Stavridis, yang telah menjabat sebagai Panglima Tertinggi NATO, Eropa sejak tahun 2009.



WASPADA Sabtu 30 Maret 2013

Bayern Hanya Pikiri Nyonya Tua Dilarang Pesta Juara Bundesliga BERLIN (Waspada): Bayern Munich dilarang berpesta di Marienplats Munich, jika mengunci gelar Bundesliga malam nanti dengan menaklukkan tamunya Hamburg SV pada spieltag 27. Ketua Bayern Karl-Heinz Rummenigge melarangnya, karena Arjen Robben cs harus segera fokus untuk menjamu Juventus pada leg pertama perempatfinal Liga Champions, Selasa (2/4) malam. “Kami mesti cepat berkumpul, kemudian kami segera pulang dan sejak Minggu kami hanya akan berpikir mengenai Juve. Bahkan tidak akan ada sekedar makan malam (bersama),” tegas Rummenigge, seperti dikutip dari DPA, Jumat (29/3). Pengibaran bendera-bendera merah dan putih atau bunyi dentang gelas-gelas bir dari balkon-balkon rumah ribuan pendukung, berarti tidak akan melibatkan skuad Jupp Heynckes. Unggul 20 angka dengan delapan partai tersisa, FC Hollywood (nilai 69) dapat mengunci mahkota Liga Jerman ke-22 jika mengalahkan Hamburg dan juara bertahan Borussia Dortmund (nilai 49) gagal menang di markas VfB Stuttgart. Meski itu menjadi trofi pertamanya sejak 2010, ketika mereka meraih dua gelar domestik di bawah pelatih Louis van Gaal,

dus mengakhiri rezim sensasional Dortmund selama dua musim, hanya ada sedikit nuansa untuk perayaan. Ketika gelar domestik meningkatkan tekanan terhadap para pemain, para petinggi FC Hollywood lebih mengincar kejayaan Eropa. “Kami ingin menjuarai Liga Champions,” tegas Presiden klub Uli Hoeness. Puasa gelar Eropa sejak 2001 sebagai mahkota kelima secara keseluruhan, The Bavarians telah dua kali kalah di final Liga Champions dalam tiga musim terakhir. “Saya tidak akan memikirkan mengenai mahkotai sebagai juara Liga Jerman di kandang kami sendiri, kami tidak akan terlalu merayakannya,” jelas gelandang Bastian Schweinteiger. “Semua orang memiliki target di depan mata dan itu adalah tampil baik pada Selasa (melawan Juventus). Itu sebabnya mengapa tidak akan ada

Sabtu, 30 Maret (GMT) 14:30 Augsburg v Hannover 14:30 Dusseldorf v Leverkusen 14:30 Mainz v Werder Bremen 14:30 Freiburg v B M’gladbach 14:30 Schalke v Hoffenheim 14:30 Stuttgart v Dortmund 17:30 Bayern Munich v Hamburg *Indosiar live pkl 00:30 WIB

Minggu, 31 Maret (GMT) 13:30 Wolfsburg v Nuremberg 15:30 Fuerth v E Frankfurt *Indosiar live pkl 22:30 WIB banyak pesta di sana. Kami tidak memenangi gelar dalam dua tahun dan kami hanya perlu melakukannya,” tambahnya. Untuk menjajal Hambur, striker Mario Gomez mestinya pulih tepat waktu pasca mengalami cedera otot minor yang membuat dirinya absen pada dua laga Pra Piala Dunia 2014 yang dilakoni Jerman melawan Kazakhstan. “Memenangi pertandingan melawan Hamburg akan memberi kami kepercayaan diri yang diperlukan untuk meneruskannya,” papar kiper Manuel Neuer. Apakah ini akan menjadi laga biasa saja bagi Bayern, yang memenangi 22 dari 26 pertandingannya, itu juga bergantung tim peringkat delapan Hamburg. Klub yang berniat mengamankan tiket zona Eropa itu punya pengatur permainan Rafael van

ARJEN Robben (tengah) dan kawan-kawan begitu fokus untuk menghadapi Juventus di perempatfinal Liga Champions, Selasa (2/4). -APder Vaart yang sedang dalam penampilan terbaiknya. “Dia saat ini begitu hebat. Dua golnya untuk Belanda beberapa hari lalu tentu saja mendongkrak rasa percaya dirinya,” puji pelatih Hamburg Thorsten Fink. (m15/ant/rtr/dpa)

Tutto Totti ... ROMA (Waspada): Kapten AS Roma Francesco Totti (foto) mengklaim, karir panjangnya di kompetisi teratas Italia sebagai air mengalir ketika dia akan merayakan 20 tahun kiprahnya pekan ini. Ikon Il Lupo yang pekan lalu mencetak gol ke-226 di Liga Seri A untuk membuat dirinya menjadi pencetak gol terbanyak sepanjang masa di bawah Silvio Piola tersebut, mengaku belum siap gantung sepatu. “Saya menginginkan kesepakatan baru,” tutur Totti kepada Gazzetta dello Sport, yang pada edisi Kamis membanjiri halaman depannya dengan foto besar Il Capitano di bawah judul Tutto Totti (semuanya mengenai Totti). “Waktu mengalir saja, karena semua yang saya lakukan, saya melakukannya dengan hasrat,” tambahnya, seperti dikutip dari AFP, Jumat (29/3). Tim Kuning Merah hanya sekali menjuarai Liga Italia (pada 2001) sepanjang 20 tahun kiprah Totti. Namun bintang berusia 36 tahun itu akan dikenang sebagai salah satu legenda di Italia. Ketika berbagai sanjungan mengemuka pekan ini, salah satu pujian datang dari kawan lama sekaligus rivalnya Gianluigi Buffon, kiper Juventus. “Hai Francesco, Anda menorehkan sejarah di sepakbola Italia: 20 tahun di Liga Italia, betapa hebatnya. Selamat,” ucap Buffon. Setelah orang tuanya menolak tawaran menggiurkan dari AC Milan, pria yang dikenal dengan berbagai julukan seperti Il Bimbo d’Oro (Anak Emas), Il Re di Roma (Raja Roma), dan Il Gladiator (Sang Gladiator) itu, melakukan debutnya untuk Serigala Merah pada 28 Maret 1993. Saat itu timnya menang 2-0 di kandang Brescia. “Anda tidak pernah melupakan saat-saat pertama dalam kisah cinta... Hari itu di Stadion Rigamonti pada Maret impian menjadi kenyataan bagi saya,” kenangnya melalui Reputasi Totti sebagai salah satu pencetak gol handal mungkin terdorong oleh fakta, dia dapat bermain di berbagai posisi. Dia juga mentas di tim yang memiliki kekurangan peralatan untuk secara konsisten meraih kejayaan. Memulai karir sebagai penyerang, dia kemudian didorong untuk bermain sebagai pemain sayap kiri pada formasi 4-3-3 yang digunakan pelatih Zdenek Zeman pada 1997/ 1998. Zeman menunjuk Totti sebagai kaptennya dan dia membalasnya dengan mencetak 30 gol selama dua tahun masa kerja pria Ceko itu. Absen pada Piala Dunia 1998 di Prancis, Totti menjadi pemain muda terbaik Liga Seri A pada 1999. Ketika Fabio Capello datang untuk melatih pada musim 2000/2001, ia membangun timnya untuk mendukung Totti. Saa itu dia berperan sebagai treaquartista (gelandang serang) dengan mencetak 13 gol dan membawa Roma memenangi scudetto ketiganya. Meski menjadi pemain terbaik Italia pada 2000 dan 2001, Totti tidak pernah memenangi penghargaan Ballon d’or yang prestisius. Ketika Luciano Spalletti menggantikan Capello, AP Totti ditarik ke belakang untuk berperan sebagai penyerang tunggal, dia mencetak 15 gol dari 24 partai. Totti masih tertinggal 49 gol dari Piola. “Jika saya selalu bermain sebagai penyerang, saya akan menorehkan 300 gol saat ini,” klaimnya. (m15/ant/afp/lgds)

Madridistas Lebih Ingin LC MADRID (Waspada): Tiga tim teratas La Liga Primera, lebih memfokuskan diri pada perempatfinal Liga Champions pekan depan. Pemuncak klasemen Barcelona melawat ke markas Celta Vigo dengan dibayangi laga tandang nan keras melawan Paris Saint Germain, Selasa (2/4) mendatang. Juara bertahan Real Madrid berada di Aragon untuk menjajal Real Zaragoza, tetapi terlihat lebih berkonsentrasi pada komitmen di Eropa dengan menjamu Galatasaray, Rabu (3/4). Pada hari yang sama, Malaga mesti bertarung dengan Borussia Dortmund. “Liga Champions begitu terhormat bagi kami, semua Madridistas (penggemar Real)

Klasemen Liga Premier Man United 29 24 2 3 Man City 29 17 8 4 Chelsea 29 16 7 6 Tottenham 30 16 6 8 Arsenal 29 14 8 7 Everton 29 12 12 5 Liverpool 30 12 9 9 West Brom 30 13 5 12 Swansea 30 10 10 10 Fulham 29 9 9 11 Stoke City 30 7 13 10 Norwich 30 7 13 10 Newcastle 30 9 6 15 West Ham 29 9 6 14 Sunderland 30 7 10 13 Southampton 30 7 10 13 Aston Villa 30 7 9 14 Wigan 29 7 6 16 Reading 30 5 8 17 QPR 30 4 11 15

69-31 51-26 58-30 51-37 55-32 46-35 57-39 40-38 40-38 40-44 27-35 28-46 41-52 32-43 33-42 42-52 31-56 35-56 35-57 26-48

74 59 55 54 50 48 45 44 40 36 34 34 33 33 31 31 30 27 23 23

ingin melaju ke final,” ungkap gelandang Madrid Xabi Alonso, setelah bertemu para penggemar pada acara pembagian tanda tangan. “Apa yang paling banyak mereka katakan kepada saya adalah mereka menginginkan (gelar Eropa) kesepuluh. Kami ingin mengantungi hasil bagus dan memastikan untuk menjalani pertandingan bagus dan atmosfer hebat,” tambah Alonso, seperti dilansir Reuters, Jumat (29/3) Los Blancos tidak pernah mencapai final sejak 2002, ketika mereka mengalahkan Bayer Leverkusen dengan skor 2-1 untuk merebut gelar kesembilan. Kegagalan dalam kurun waktu lama dari ajang terelit Eropa, tidak cocok dengan rasa lapar para penggemar yang terbiasa dengan kesuksesan reguler.

“Situasi liga tidak ideal, tapi kami tetap ingin melakukannya dengan sikap sama. Melakukan sejumlah hal dengan baik dan berusaha memenangi setiap pertandingan,” tekad Alonso. “Zaragoza memiliki masalah, meAP reka berada di laju XABI Alonso (kiri) bisa saja disimpan entreburuk. Namun se- nador Jose Mourinho di markas Zaragoza. mua pertandingan tandang di setiap tempat begitu itu. Sungguh kontras dengan rumit dan saya tidak berpikir ini akan mudah,” katanya lagi. Real asuhan Jose Mourinho, Tim Aragon itu belum per- yang menang 4-0 ketika kedua nah memenangi laga liga sejak tim bertemu di Santiago Berpergantian tahun, sehingga ter- nabeu pada November 2012 puruk satu posisi di atas zona dan menang enam kali berturutdegradasi. Zaragoza hanya me- turut di La Liga. Tim tuan rumah raih empat angka dari kemung- terlihat hanya memiliki sedikit kinan 33 angka dan hanya men- peluang untuk sukses. (m15/ant/rtr/afp) cetak lima gol selama periode

Sabtu, 30 Maret (GMT)

Klasemen La Liga

12:45 Sunderland v MU *Global TV live pkl 19:45 WIB 15:00 Arsenal v Reading 15:00 Man City v Newcastle *Global TV live pkl 22:00 WIB 15:00 Southampton v Chelsea 15:00 Swansea v Tottenham 15:00 West Ham v West Brom 15:00 Wigan v Norwich 17:30 Everton v Stoke City

Minggu, 31 Maret (GMT) 12:30 Aston Villa v Liverpool *Global TV live pkl 19:30 WIB

Senin, 1 April (GMT) 19:00

Fulham v QPR

Pencetak Gol Terbanyak 22 19 16 15

Luis Suarez (Liverpool) Robin van Persie (MU) Gareth Bale (Tottenham) Demba Ba (Chelsea) Miguel Perez (Swansea)

Barcelona 28 Real Madrid 28 Atl Madrid 28 Sociedad 28 Valencia 28 Malaga 28 Real Betis 28 Getafe 28 Vallecano 28 Sevilla 28 Levante 28 Valladolid 28 Espanyol 28 Ath Bilbao 28 Osasuna 28 Granada 28 Zaragoza 28 Mallorca 28 Celta Vigo 28 Deportivo 28

24 19 19 13 13 12 13 12 13 11 10 9 9 9 7 7 7 6 6 4

2 4 3 8 6 8 4 6 2 5 7 8 8 5 7 7 5 6 5 8

2 5 6 7 9 8 11 10 13 12 11 11 11 14 14 14 16 16 17 16

88-31 71-27 50-24 49-35 41-40 38-27 39-42 38-44 37-46 43-40 33-41 36-38 33-37 32-51 23-32 26-39 25-42 30-55 27-41 32-59

74 61 60 47 45 44 43 42 41 38 37 35 35 32 28 28 26 24 23 20

Sabtu, 30 Maret (GMT)

15:00 Vallecano v Malaga 17:00 Celta Vigo v Barcelona *Trans TV live pkl 00:00 WIB 19:00 Zaragoza v Real Madrid *Trans TV live pkl 02:00 WIB 21:00 Levante v Sevilla

Minggu, 31 Maret (GMT) 10:00 Valladolid v Osasuna 15:00 Mallorca v Deportivo 17:00 Espanyol v Sociedad 19:00 Atl Madrid v Valencia *Trans 7 live pkl 02:00 WIB

Senin, 1 April (GMT) 18:00 20:00

Ath Bilbao v Granada Real Betis v Getafe

Pencetak Gol Terbanyak 42 27 21 15 14

Lionel Messi (Barcelona) Cristiano Ronaldo (Madrid) Radamel Falcao (Atletico) Alvaro Negredo (Sevilla) Roberto Soldado (Valencia)

Inter Segalanya Bagi Super Juve R O M A ( Waspada): Penyerang Mirko Vucinic (foto kanan) menegaskan, Juventus tidak akan meremehkan Inter Milan dalam Derby d’Italia, yang ditayangkan langsung TVRI malam nanti mulai pkl 21:00 WIB. “Kami main melawan Inter, nama itu mengungkapkan segalanya bagi kami. Mereka tim kuat dan saya tidak percaya kepada orang-orang yang mengatakan mereka tengah kesulitan,” ucapVucinic dalam, yang dikutip Jumat (29/3). Namun penampilan solid Inter pada paruh pertama musim hingga mampu menjinakkan Super Juve, telah digantikan inkonsistensi dalam beberapa bulan terakhir. Meski menghuni peringkat kelima, skuad Andrea Stamaccioni tertinggal tujuh angka dari AC Milan untuk perburuan tiket kualifikasi Liga Champions. I Nerazzurri juga mesti menjamu I Bianconeri di Sta-

dion Giuseppe Meazza dalam kondisi sejumlah pemain andalannya asal Amerika Latin, terkendala penundaan penerbangan seusai tugas bela negara. Namun Vucinic percaya Inter dapat memperlihatkan determinasi dan keberanian sama, seperti saat menang 4-1 pada leg kedua setelah takluk 0-3 pada leg pertama babak 16 besar Liga Europa melawan Tottenham Hotspur. “Saya melihat pertandingan kedua melawan Tottenham. Kendati kalah, mereka nyaris lolos setelah melakukan penampilan sangat membanggakan. Jadi kami harus konsentrasi sepanjang laga dan seperti ini pertandingan terakhir dalam hidup kami,” harap Vucinic. Inter membungkam pihakpihak yang meragukan mereka saat menggasak Si Nyonya Tua 3-1 diTurin, awal November lalu. Ketika itu striker Argentina Diego Milito mencetak dua gol, Rodrigo Palacio menambahkan satu gol lagi. Kali ini Milito menepi karena cedera serius, sedangkan Palacio (Argentina) kemungkinan


tampil di bawah standar terbaiknya setelah mentas melawan Bolivia di dataran tinggi La Paz, Rabu lalu. Alvaro Pereira dan Walter Gargano merupakan bagian dari tim Uruguay. Winger Kolombia Fredy Guarin cadangan yang tidak terpakai saat negaranya menang 1-0 atasVenezuela. Seperti rekan-rekan setimnya

asal Latino, dia tak mampu kembali tepat waktu ke Italia. “Kami akan berjuang dari bawah sampai atas untuk dapat kembali ke Liga Champions. Ini merupakan peperangan tua yang berat untuk peringkat ketiga, karena terdapat banyak tim di sana. Tapi kami berada di dalamnya juga,” tekad allenatore Stramacioni. (m15/ant/afp/rtr)

Wilshere Masih Rehat


LONDON (Antara/Reuters): Gelandang Jack Wilshere (kiri) akan absen membela Arsenal pada matchday 30 Liga Premier melawan Reading malam nanti di Emirates Stadium. Menurut manajer Arsene

Wenger, Jumat (29/3), Wilshere masih rehat karena masalah pergelangan kakinya sejak awal bulan lalu. Namun sempat tersebar rumor, bintang muda Inggris itu akan kembali bermain akhir pekan ini. “Mengenai Jack? Saya pikir dua pekan pada Minggu. Bukan pertandingan berikutnya, namun pertandingan setelahnya,” beber Wenger (kanan). The Gunners akan melawat ke markas West Bromwich Albion pada 6 April, lantas menjamu Norwich City sepekan sesudahnya. Kembalinya pengatur per-

Mancini Menyerah

mainan berusia 21 tahun ini tidak dapat terlalu cepat bagi Arsenal, yang bersaing denganTottenham Hotspur dan Chelsea untuk satu posisi kualifikasi Liga Champions. Bek kiri Kieran Gibbs juga diragukan dapat tampil menjamu Reading karena flu. Sedangkan penyerang Theo Walcott mengalami sobek otot saat melakukan tugas internasional bersama tim nasional Inggris. Namun Wenger menolak menyalahkan pelatih Inggris Roy Hodgson. “Cedera Walcott akibat kecelakaan yang dapat terjadi di sini,” tutur Wenger.

LONDON (Waspada): Tertinggal 15 angka dari Manchester United menjelang berakhirnya musim, membuat Manchester City menyerah dalam perburuan gelar juara Liga Premier. “Telah berakhir.Tapi itu tidak mengubah segala sesuatu untuk kami memberikan yang terbaik hingga akhir musim,” ucap manajer City Roberto Mancini, seperti dikutip dari Goal, Jumat (29/3). “Setiap tim besar yang sudah kehilangan kesempatan meraih gelar, tentu harus terus mempertahankan permainan terbaik untuk memenangkan setiap partai. Tapi ingat, kami

masih memiliki kesempatan di Piala FA,” tambahnya. Citizens malam nanti akan menjamu Newcastle United di Etihad Stadium, Mancini (foto) mengimbau anak asuhnya untuk tetap waspada. Sebab timtim yang berada di bawah bisa saja menjadi batu sandungan, terutama Chelsea dan Tottenham Hotspur. “Chelsea kini empat poin di belakang kami, sedangkan Tottenham lima poin. Kami samasama sedang berjuang untuk meraih hasil terbaik. Kondisi seperti ini mengharuskan kami tetap bekerja keras,” tegasnya. Pertarungan untuk tiket Liga

Champions memang masih akan berlangsung. Setelah mengalahkan Arsenal beberapa pekan silam, Tottenham menjadi kandidat paling tepat untuk mengakhiri musim dengan menduduki peringkat ketiga. Spurs mengunjungi markas tim papan tengah Swansea City, sambil berharap winger Wales Gareth Bale dapat menghidupkan kembali harapan-harapan mereka. Chelsea mengunjungi Southampton mencari kemenangan ketiga berturut-turut di liga. Tim peringkat keenam Everton masih berharap mengakhiri musim di posisi empat besar setelah mengalahkan City, menjamu Stoke City. (m15/goal/rtr)

Klasemen Liga Seri A

Sabtu, 30 Maret (GMT)

Klasemen Ligue 1

Juventus 29 20 5 4 57-18 65 Napoli 29 16 8 5 50-26 56 AC Milan 29 16 6 7 52-32 54 Fiorentina 29 15 6 8 53-35 51 AS Roma 29 14 5 10 60-49 47 Inter Milan 28 14 5 9 44-37 47 SS Lazio 29 14 5 10 37-35 47 Catania 29 13 6 10 39-36 45 Udinese 29 10 11 8 38-38 41 Sampdoria* 28 10 6 12 35-33 35 Bologna 29 10 5 14 39-38 35 Torino* 29 8 12 9 34-36 35 Parma 29 9 8 12 36-39 35 Cagliari 29 9 8 12 35-48 35 Chievo 29 10 5 14 31-44 35 Atalanta* 29 10 5 14 30-42 33 Genoa 29 6 8 15 29-45 26 Siena* 29 8 7 14 29-40 25 Pescara 29 6 3 20 21-58 21 Palermo 29 3 12 14 23-43 21 *Siena dikurangi 6 poin, Atalanta 2, Sampdoria dan Torino 1 poin.

14:00 Atalanta v Sampdoria 14:00 Cagliari v Fiorentina 14:00 Genoa v Siena 14:00 Lazio v Catania 14:00 Palermo v AS Roma 14:00 Parma v Pescara 14:00 Udinese v Bologna 14:00 Inter Milan v Juventus *TVRI live pkl 21:00 WIB 17:30 Chievo v AC Milan *TVRI live pkl 00:30 WIB 20:00 Torino v Napoli *TVRI live pkl 03:00 WIB

Pencetak Gol Terbanyak 20 16 15 13

Edinson Cavani (Napoli) Stephan El Shaarawy (Milan) Antonio Di Natale (Udinese) Giampaolo Pazzini (Milan) Erik Lamela (AS Roma)

Paris SG 29 17 7 5 53-20 Lyon 29 15 8 6 48-30 Marseille 29 15 6 8 34-32 St-Etienne 29 13 10 6 48-23 Nice 29 13 9 7 41-33 Lille 29 12 10 7 41-30 Montpellier 29 13 6 10 44-35 Lorient 29 11 10 8 47-44 Bordeaux 29 10 12 7 28-24 Rennes 29 12 6 11 41-39 Toulouse 29 9 11 9 33-32 Valencs 29 9 9 11 37-41 Ajaccio 29 8 11 10 30-37 Bastia 29 9 6 14 34-53 Evian 29 7 9 13 32-41 St Reims 29 7 9 13 26-35 Brestois 29 8 5 16 28-42 Sochaux 29 7 7 15 30-46 Troyes 29 4 12 13 34-51 Nancy 29 5 9 15 26-47 *Ajaccio dikurangi dua poin

58 53 51 49 48 46 45 43 42 42 38 36 33 33 30 30 29 28 24 24

“Saya tidak melakukan pembicaraan dengan manajer Inggris. Dia menggunakan para pemainnya sebagaimana dia menggunakan mereka,” katanya lagi. Arsenal tidak memiliki harapan untuk memenangi trofi musim ini setelah tersingkir di Piala FA dan Liga Champions, namun laju bagus di Liga Premier memberi rasa optimistis bagi Wenger. Olivier Giroud cs memenangi empat dari lima pertandingan terakhirnya dan berada di peringkat kelima klasemen.


Sabtu, 30 Maret (GMT) 16:00 Troyes v St Etienne *CNTV live pkl 23:00 WIB 19:00 Ajaccio v Toulouse 19:00 Evian v St Reims 19:00 Rennes v Nancy 19:00 Valencs v Bastia *CNTV live pkl 02:00 WIB

Minggu, 31 Maret (GMT) 12:00 Nice v Marseille *CNTV live pkl 19:00 WIB 15:00 Brestois v Lille *CNTV live pkl 22:00 WIB 19:00 Lyon v Sochaux *CNTV live pkl 02:00 WIB

Pencetak Gol Terbanyak

25 Zlatan Ibrahimovic (PSG) 16 P-E Aubameyang (Etienne) 12 Dario Cvitanich (Nice) Bafetimbi Gomis (Lyon) 11 Jeremie Aliadiere (Lorient) (jonny/afp/espn)


WASPADA Sabtu 30 Maret 2013

Mobil Peserta IOX Masuki Aceh

Hangeland Bahagia Perpanjang Kontrak LONDON (Antara/AFP): Kapten Brede Hangeland (foto) menandatangani perpanjangan kontrak dua tahun dengan Fulham. Kontrak Hangeland sebelumnya akan habis akhir musim ini. Tapi pelatih The Cottagers, Martin Jol, berniat mempertahankan pemain 31 tahun ini. Bek Norwegia ini gabung Fulham dari FC Copenhagen pada Januari 2008. Dia telah melakukan 233 penampilan untuk klub London Barat itu di semua kompetisi, sehingga menjadikan dirinya sebagai salah Reuters satu pemain kunci Cottagers. “Saya begitu senang, gembira. Memerlukan waktu yang lama, tapi kami kini ada di sini dan saya berharap klub gembira, saya tentu saja benar-benar gembira untuk menandatanganinya,” ucap Hangeland, Jumat (29/3). “Saya menyenangi waktu-waktu saya dengan Fulham. Ini sudah lewat lima tahun dan saya merasa benar-benar berada di rumah sejak pertandingan pertama,” ujarnya lagi. Hangelan tidak dapat melihat dirinya pergi dari Craven Cottage. “Maka pada akhinya memiliki perpanjangan kontrak ini memberi saya perasaan hebat,” pungkasnya.

BANDA ACEH (Waspada): Sekira 35 unit mobil offroad milik peserta Indonesian Offroad Expedition (IOX) 2013 Aceh-Sumut sejak Kamis (28/3), mulai memasuki Kota Banda Aceh untuk mengikuti event jelajah Aceh-Sumut pada 6-20 April mendatang. “Mobil-mobil yang diangkut menggunakan truk itu merupakan milik peserta dari Palembang, Jakarta, Bandung, hingga Kalimantan,” ujar Humas Pengda IOF Aceh, Marhiansyah, kepada Waspada di Banda Aceh, Jumat (29/3). “Semua mobil diangkut dari Jakarta menggunakan kapal. Setelah diturunkan di Pelabuhan Belawan Medan, mobol-mobil ini kemudian diangkut dengan truk ke Banda Aceh,” jelas Marhiansyah. Saat diturunkan di kawasan Batoh, Banda Aceh, Kamis dan Jumat, kedatangan mobil-mobil offroad ini sempat menyita perhatian masyarakat Banda Aceh, sehingga membuat kawasan tersebut seketika menjadi ramai. Selain peserta dari Pulau Jawa dan Kalimantan, sebut dia, dalam beberapa hari ke depan akan tiba pula melalui jalur darat peserta dari Padang dan Medan. Dari Aceh sendiri, akan ada lima unit kendaraan offroad yang mengikuti tersebut. Kegiatan jelajah belantara Indonesia tahun ini melintasi jalur Aceh-Sumut mulai 6 April 2013 dengan mengambil start di Kota Banda Aceh. Perserta selanjutnya menuju Sabang dan esok harinya mulai menembus hutan mulai Banda Aceh-JanthoMila-Tiro melalui perbukitan Bukit Barisan dan menyusuri hutan serta sungai hingga finish di Medan pada 20 April. “Perjalanan selama 14 hari itu diharapkan memberi wawasan kepada para peserta mengenai alam dan budaya Aceh serta Sumatera Utara,” harap Marhiansyah. (b04)


BEBERAPA mobil offroad peserta IOX 2013 Aceh-Sumut ditempatkan di lapangan dekat Sekretariat Panitia Lokal IOX 2013 Aceh-Sumut di kawasan Batoh, Banda Aceh.

Kompetisi 2014 Ganti Nama BANDA ACEH (Waspada): Pelatih Persiraja Banda Aceh, Maman Suryaman, memberi reaksi keras menyikapi hasil Kongres Luar Biasa (KLB). Bersatunya kompetisi terobosan positif di kancah sepakbola tanah air, tetapi itu masih ada cacat di matanya. Catatan besar yang diungkapkan mantan Pelatih Timnas U-14 ini tak lain menyangkut nama kompetisi yang masih memakai nama Indonesian Super League (ISL). Selain itu, kongres tersebut juga memutuskan liga gabungan hanya diikuti empat perwakilan Indo-


nesian Premier League (IPL). Menurut Maman, harusnya ada win-win solution yang membuat perserta IPL tetap termotivasi untuk berkompetisi. “Liat saja sekarang hasilnya, kontestan liga terlihat ‘malas’ dan tidak ada motivasi lagi,” ujarnya seperti dikutip media

di Malang, Jumat (29/3). Mantan Pelatih Persikabo Bogor ini mengatakan ketidakadilan itu adalah tidak adanya win-win solution. “Kalau mau adil ya misalnya 60-40, sehingga dengan 22 tim di liga tertinggi, ISL mendapatkan 12 tim sementara IPL dapat jatah 10 tim,” ujarnya. Disebutkan, saat ini mereka yang punya kuasa (PSSI-red) memberikan jatah 18 tim kepada ISL. “Dengan kata lain, saat ini kondisi IPL seperti seleksi Divisi Utama menuju liga tertinggi,” urai mantan Asisten

Pelatih Persib Bandung ini. Kata Maman, keputusan kongres itu sangat tidak adil bagi tim IPL, termasuk kepada Persiraja sendiri, meski saat ini masih ada di peringkat ketiga. Ketidakadilan itu sudah terjadi pada Persema dan Persija IPL, begitupula dengan tim lain. “Saya rasa LPIS harusnya mengerti jika keputusan ini sangat tidak baik bagi perkembangan liganya, sementara untuk yang ISL atmosfer tetap bagus karena 18 tim tidak ada yang hilang,” lanjut Maman. Kalaupun keputusan terse-

but sudah bulat, maka Maman juga meminta agar nama kompetisi juga diganti agar dalam unifikasi dua kompetisi ini tak ada yang merasa dirugikan. “Kalau masih dipakai nama ISL, pasti yang IPL merasa sudah kalah dan yang menang ISL, makanya lebih baik nama kompetisi juga diganti,” pungkas dia. Seperti yang diberitakan sebelumnya, unifikasi kompetisi musim depan menghasilkan keputusan 18 tim ISL yang berasal dari 15 tim ditambah tiga promosi akan digabung dengan empat tim dari IPL. (b07)

PSSI Aceh Didesak Gelar Musda SIGLI (Waspada): Ketua Umum PSAP Sigli, Muhammad Yasin Amin, mendesak Pengprov PSSI Aceh segera menggelar Musyawarah Daerah (Musda). Hal ini penting dilakukan karena masa kepempinan pengurus lama telah berakhir sejak Februari lalu. “Sebaiknya Musda tidak diulur-ulur dan segeralah digelar agar kepengurusan yang baru dapat terbentuk. Dengan begitu, roda organisasi PSSI Aceh dapat berjalan dengan lebih baik,” ujar Muhammad Yasin Amin yang akrab disapa Kolonel Yasin ini, Jumat (29/3). Menurut dia, Musda tidak dapat ditundatunda lagi demi kelangsungan persepakbolaan Aceh. Ia berharap kepada seluruh Pengcab PSSI di Aceh memilih calon Ketum PSSI Aceh yang profesional dan bertanggung jawab terhadap

Petinju Medan Try Out Ke LN MEDAN (Waspada): Ketua Persatuan Tinju Amatir Indonesia (Pertina) Kota Medan, Kapten CPM Binson Simbolon, mengatakan pihaknya terus berupaya meningkatkan memotivasi dan semangat atlet dengan merencanakan menggelar try out ke luar negeri. “Untuk memacu semangat dan motivasi petinju, kami akan melakukan pertandingan eksibisi ke Thailand atau Malaysia. Pertandingan eksibisi ini diharapkan juga menambah jam tanding sekaligus pengalaman atlet,” ujar Binson di Medan, Jumat (29/3). Dikatakan, laga eksibisi ke luar negeri merupakan program Pertina Medan jika para petinju mampu membawa harum nama Kota

Waspada/Abdul Mukthi Hasan

PEMAIN PSSB melakukan peregangan seusai melakoni laga ujicoba di Stadion Cot Gapu, Kota Juang, Bireuen, Jumat (29/3).

PSSB Bireuen Genjot Latihan BIREUEN (Waspada): PSSB Bireuen terus meningkatkan kemampuan tim dengan latihan intensif di Stadion Cot Gapu, Kota Juang. Selain latihan, PSSB yang akan tampil di kompetisi Divisi Utama PSSI juga sudah menggelar sejumlah laga ujicoba. “Tim terus menunjukkan peningkatan, terutama dari segi kekompakan dan disiplin di lapangan. Kita berharap kemampuan tim terus meningkat hingga kompetisi berlangsung,” ujar Asisten Pelatih PSSB Bireuen, Iswandi, seusai memimpin latihan tim, Jumat (29/3).

Sejumlah pengamat dan pemerhati PSSB juga menilai kekompakan tim Kota Juang sudah mulai terlihat. Hanya saja, kemampuan tiga kiper yang dimiliki PSSB perlu ditingkatkan. Hal ini berdasar pernampilan mereka saat laga ujicoba maupun ketiga latihan. “Penampilan penjaga gawang PSSB perlu ditingkatkan, mengingat kiper turut memiliki peran penting dalam membangun satu tim yang tangguh. Dari pantau kami, kiper yang dimiliki PSSB masih kurang maksimal,” ujar salah seorang pe-

Problem Catur

merhati PSSB. Iswandi sendiri tidak membantah penilaian sejumlah pengamat PSSB soal kemampuan penjaga gawang yang dinilai belum memperlihatkan penampilan terbaik selama latihan, maupun ketika melakukan laga ujicoba. “Tidak bisa dipungkiri, penampilan tiga penjaga gawang kita memang masih perlu ditingkatkan. Terima kasih atas perhatian para pengamat PSSB, segala kritik dan saran akan kita tindak lanjuti dengan sebaikbaikknya,” ujar Iswandi. (cb02)


Jawaban di halaman A2.







1 A








Medan dalam kejurda tingkat provinsi sebanyak tiga kali. Keberhasilan pertama telah dibuktikan para petinju Medan dengan tampil juara umum Kejurda Elite di Langkat. “Bagi yang telah berhasil, teruslah giat berlatih. Bagi yang belum berhasil, jangan putus asa, melainkan lebih giat lagi dalam meningkatkan kemampuan diri. Kegagalan merupakan cambuk untuk membawa keberhasilan di masa mendatang,” katanya. Pelatih Pertina Medan, Amir Hasan, mengatakan saat ini banyak petinju Medan yang memiliki potensi besar menjadi petinju profesional. Untuk itu, diperlukan dukung semua pihak agar potensi yang ada dapat terus dikembangkan. (m42/ant)

Novi Kesulitan Tiket MEDAN (Waspada): Libero terbaik PSMS LPIS Novi Handrawan dikabarkan kesulitan tiket pesawat untuk kembali ke Medan, bergabung dengan rekan-rekannya mengikuti latihan. Demikian seorang rekannya mengungkapkan di sekretariat PSMS, stadion Kebun Bunga Medan Jumat (29/3). Pemain andalan Ayam Kinantan ini sudah mengabarkan kesulitannya kepada pelatih H Edy Syahputra dan CEO PSMSWimpy Tri Hadi Irawan, namun tidak ditanggapi. Sebab, mereka tidak memiliki dana untuk mengirim kepadanya. Pengurus sendiri sudah menyerahkan segala keperluan para pemain dan kebutuhan tim pada CEO yang hadir di dalam skuad PSMS LPIS, karena peran pelatih H Edy Syahputra dan seorang pemain senior Donny F Siregar. Jangankan masalah tiket Novi, minuman para pemain saja yang mengikuti latihan kecuali air mineral yang disumbangkan salah seorang pengurus Julius Raja SE disediakan oleh seorang pemain Saktiawan Sinaga. Pantauan Waspada, sejak Novi tidak bersama rekan-rekannya membuat barisan pertahanan PSMS benar-benar rapuh. Inilah yang membuat pendukung enggan untuk menyaksikan persiapan PSMS, tidak seperti sebelumnya selalu banyak dihadiri publik sepakbola Medan. (m17)


Sudoku 10x10

Putih melangkah, mematikan lawannya empat langkah.


organisasi. “Pilihlah kandidat ketua umum yang benarbenar mengerti sepakbola dan memiliki rasa tanggungjawab, bukan sebaliknya memilih kandidat yang memanfaatkan organsiasi untuk memperkaya diri dan kelompoknya, sementara prestasi sepakbola Aceh terus merosot,” katanya. Dikatakan, Ketua Umum PSSI Aceh ke depan harus mengerti ADRT organisasi, sehingga tidak terjadi jabatan ganda. Seorang Ketum PSSI Aceh ke depan harus fokus pada urusan sepakbola bukan olahraga lainnya. “Kita berharap dengan kepengurusan baru PSSI, ke depan prestasi sepakbola daerah ini semakin baik. Apalagi Aceh memiliki banyak bibit pemain berbakat dan sejumlah klub yang berkompetisi di liga profesional,” pungkasnya. (b10)


1. Perangkat lunak browser yang dilengkapi kata Firefox. 4. Bentuk drama panggung dengan nyanyian, nama salah satu browser terbaik dunia. 7. Singkatan Internet Service Provider. 8. Penyidikan; Penyelidikan fakta dengan peninjauan. 10. Tajuk rencana. 12. Koreksi; Pembetulan. 15. Revolusi teknologi yang menghubungkan semua komputer di dunia. 16. Singkatan Personal Home Page (kini hypertext preprocessor). 17. Huruf tebal. 18. Tombol simpan pada komputer. 19. Koran terbitan Medan; Mengelilingi bumi dengan pesawat antariksa. 21. Matahari (Inggris); Koran terbitan Malaysia. 23. Pola; Corak; Alasan seseorang melakukan sesuatu. 25. Tidak profesional. 26. Singkatan anak koran. 27. Singkatan ibidem (dalam karangan, buku, dsb yang sama).

28. Laporan tentang peristiwa; Warta.


1. Surat (Inggris). 2. Salah satu metode pengarsipan di Windows; Singkatan Zone Improvement Plan (kode pos). 3. Iklan di media massa. 5. Halaman (koran, buku dsb). 6. Surat edaran; Karangan ringkas; Notula. 8. Saling aktif; Dialog antara komputer dan terminal atau antara komputer dan komputer. 9. Email sampah. 11. Keterangan atau bahan nyata sebagai dasar kajian. 13. Singkatan Lembaga Pers Dr Soetomo. 14. Televisi Pendidikan Indonesia. 15. Penerangan; Kabar atau berita tentang sesuatu. 17. Kantor berita Malaysia. 20. Penyedia layanan internet seperti halnya FTP dan Telnet. 21. Salah satu halaman favorit Waspada. 22. Majalah berita terbitan Jakarta. 24. Komputer tablet produksi Apple.

Isi kotak kosong dengan angka 0 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 5x2 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu kurang dari 15 menit. Jawaban di halaman A2 kolom 1.


9 5 8 0 7 3 1 9 0 6 5 3 8 0 4 6 2 5 3 2 7 3 1 4 2 9 6 7 9 3 5 1 6 1 0 2 8 0 5 ****33



WASPADA Sabtu 30 Maret 2013

Indonesia Rebut Puncak Klasemen SURABAYA (Waspada): Babak penyisihan hari kelima Axiata Cup 2013 berhasil dilewati tim Indonesia dengan kemenangan 3-1 dari Thailand, Jumat (29/3). Dengan hasil ini, Indonesia pun menggeser posisi Thailand di puncak klasemen. Indonesia mengumpulkan total 15 kemenangan dari 20 pertandingan sejak awal penyisihan. Di putaran pertama minggu lalu, Indonesia menang atas Vietnam dan Singapura 4-0 serta dua pertandingan berakhir seri 2-2 melawan Malaysia dan Asian All Stars. Dua laga lagi melawan Filipina dan European All Stars akan dilakoni Indonesia pada babak penyisihan untuk meraih tiket ke semifinal yang akan berlangsung di Kuala Lumpur, 13 April mendatang. Melawan Thailand di DBL Arena, Surabaya, kemenangan Indonesia ini dipastikan ganda putra Angga Pratama/Rian Agung Saputro yang menum-

bangkan Boonsak Ponsana/ Songphon Anugritayawon 21-16, 21-12. Usai pertandingan, Manajer Tim Bambang Roedyanto mengakui kemenangan 3-1 ini sesuai prediksi. Menurut Bambang, kekuatan Thailand terletak di tunggal putri sehingga Indonesia fokus memenangkan partai lain. Terbukti, Merah Putih tertinggal 0-1. Pada partai pertama, Lindaweni Fanetri tumbang saat melawan Ratchanok Intanon 17-21, 19-21. Kemudian, Tommy Sugiarto menyamakan poin dengan menaklukkan Tanongsak Saensomboonsuk 21-17, 21-14. Indonesia membalikkan ke-

adaan untuk unggul lewat Tontowi Ahmad/Liliyana Natsir yang menang mudah atas Sudket Prapakamol/Saralee Thoungthongkam 21-12, 21-11. Kemenangan 3-1 dipastikan Angga/Rian yang turun di partai terakhir. ManajerTimThailand, Udon Luangphetcharaporn, mengatakan kekalahan 1-3 dari Indonesia bukan hasil yang buruk. Namun, Udon mengakui tidak menduga duet Sudket/Saralee begitu mudah ditumbangkan oleh Tontowi/Liliyana. Tim Indonesia selanjutnya akan menghadapi Filipina pada Sabtu (30/3) ini dan bintangbintang Eropa pada Minggu (31/3). (m33/ant) GANDA campuran terbaik Indonesia, Tontowi Ahmad/Liliyana Natsir, menambah kekuatan tim Garuda ketika menang mudah atas pasangan Thailand, Jumat (29/3). -Antara-

Murray Menang Variasi Pukulan


JUARA dunia F1 Sebastian Vettel (kanan) sudah meminta maaf kepada Mark Webber dan seluruh anggota tim Red Bull.

Vettel Sudah Minta Maaf MILTON KEYNES, Inggris (Waspada): Suasana tak harmonis di kubu Red Bull Racing masih menjadi perbincangan hangat di dunia Formula One (F1). Namun, Christian Horner mengatakan suasana sudah mencair seiring permintaan maaf Sebastian Vettel kepada seluruh anggota tim. Pada GP Malaysia lalu, hal tak mengenakkan menghinggapi kubu Red Bull ketika Vettel mengabaikan team order dan menyalip posisi Mark Webber yang berada di posisi terdepan. Padahal, team order jelas menginstruksikan keduanya tetap ada pada posisi masing-masing alias bermain aman. “Dia berkata kalau tak bisa memutar waktu, tapi mengakui kalau apa yang telah dilakukan salah,” ujar Horner, Ketua Tim Red Bull, Jumat (29/3). “Seba (Vettel) meminta maaf kepada tim,

kepada setiap anggota staf atas aksinya, karena menyadari bahwa (kesatuan) tim benar-benar penting. Dan, menjadi bagian dari tim adalah aspek krusial untuk bisa menjajal tantangan dalam kejuaraan tersebut,” sambungnya. Horner juga mengatakan kalau Webber pasti bisa menerima dengan lapang dada atas kejadian pada GP Malaysia tersebut. Dan, untuk selanjutnya, Hornet yakin Webber akan tampil seperti biasa dan meraih kemenangan demi kemenangan dalam kondisi tim yang dinilainya tetap solid. “Berdasarkan instruksi tim, Mark seharusnya memenangi lomba. (Tapi), dia cukup dewasa menyadari tak ada kebencian untuknya dan tim tidak bermaksud menciptakan situasi tidak mengenakkan. Saya juga tak ragu Mark akan menjalani sisa musim bersama kami,” tutup Horner. (m33/auto)

MIAMI, AS (Waspada): Peringkat tiga dunia, Andy Murray (foto), melaju ke semifinal Miami Masters 2013 hasil menundukkan wakil Kroasia, Marin Cilic, Jumat (29/3). Kendati demikian, Murray sempat merasa kesulitan, khususnya pada set pertama. Di sini, petenis Skotlandia itu kecolongan pada dua game pembuka sebelum akhirnya mampu membalikkan keadaan dan menang 6-4. Setelah itu, permainannya membaik dan menang 6-3 pada set kedua. Usai pertandingan, Murray mengatakan variasi pukulan yang dilakukannya membuat Cilic kerepotan. “Itu pertandingan yang bagus setelah game pertama. Saya tertinggal 0-40 pada game pertama dan tak bisa mengatasinya. Namun kemudian saya melakukan break, tapi beberapa kali juga kerap gagal,” ujar Murray. “Kemudian saya melakukan variasi yang membuat lawan hilang keseimbangan. Itu adalah pertandingan ketat dan melelahkan, karena kami memainkan poin dan laga panjang. Saya senang bisa menyelesaikannya dalam dua set,” pungkas petenis asal Britania Raya tersebut. Di semifinal, Murray akan berhadapan dengan Richard Gasquet. Petenis Prancis ini lolos ke babak empat besar dengan menundukkan Tomas Berdych (Rep Ceko) 6-3, 6-3. Laga semifinal lain mempertemukan Da-

vid Ferrer (Spanyol) dan Tommy Haas (Jerman). Ferrer, unggulan kelima, mengandaskan Juergen Melzer (Austria) 6-4, 3-6, 6-0. Sementara Haas, sukses menyingkirkan Novak Djokovic, berhasil mengatasi perlawanan Gilles Simon (Prancis) 6-3, 6-1. Di tunggal putri, final bakal mempertemukan dua unggulan teratas. Ratu tenis Serena Williams (AS) dan Maria Sharapova (Rusia) masing-masing menyingkirkan hadangan mereka di semifinal sekaligus menciptakan final ideal. Serena tampil gemilang dan nyaris tanpa catat ketika menang 6-0, 6-3 atas wakil Polandia, Agnieszka Radwanska. Padahal, Radwanska ditempati sebagai unggulan keempat. Terkait laga kontra Sharapova, Serena mengaku antusias dan berharap bisa menunjukkan penampilan terbaik. Untuk mendekatkan diri pada gelar Miami Masters perdananya, Sharapova menundukkan Jelena Jankovic (Serbia) 6-2, 6-1. Menghadapi Serena di laga puncak, Sharapova sendiri mengaku senang dan berharap tampil sebagai jawara. “Itu (melaju ke final) sangatlah berarti. Saya cinta dengan kota ini, karena inilah kota pertama yang saya kunjungi pertama kali datang di Amerika Serikat saat masih kanak-kanak,” kenang Sharapova. (m33/ap)


Lakers Alami Derita Ganda MILWAUKEE, AS (Waspada): Los Angeles Lakers mengalami pukulan ganda ketika melakoni laga tandang melawan Milwaukee Bucks di Bradley Centers, Jumat (29/3). Selain tumbang 103-113, Lakers juga kehilangan Kobe Bryant yang cedera. Penampilan menurun di paruh kedua pun menjadi kunci kekalahan Lakers, apalagi di sini Kobe mengalami cedera kaki. Padahal, Lakers tampil perkasa di kuarter pertama dengan memimpin 25-18 dari Bucks. Keunggulan masih bisa dipertahankan Lakers setelah mengemas 31 angka untuk memimpin 56-53 di akhir babak pertama.

Bucks akhirnya berhasil menyalip Lakers di akhir kuarter ketiga setelah mengumpulkan 29 poin dan berbalik unggul 82-77. Kemenangan tuan rumah ditentukan di paruh penentu berkat permainan kompak Brandon Jenning cs. Bucks menempatkan Larry Sanders sebagai pemain terbaiknya setelah mencetak 21 poin 13 rebound. Point guard Bucks, Brandon Jennings, menambah 20 angka dan Monta Ellis 18 poin. Bertahan selama 36 menit, Kobe tetap menjadi top skor Lakers dengan torehan 30 angka. Dwight Howard tampil dingin dengan sumbangan

15 poin 15 rebound. “Kekalahan ini disebabkan karena buruknya kerjasama tim. Kami butuh bekerja sama melawan Bucks. Kami hanya tidak melakukannya malam ini. Pertahanan membutuhkan upaya dari seluruh tim di setiap pertandingan,” ucap Howard. Di laga lain, Indiana Pacers secara mengejutkan memenangi pertandingan atas Dallas Mavericks. Paul George mengoleksi 24 angka ketika Pacers unggul 103-78. Di US Airways Center, tuan rumah Phoenix Suns dikalahkan Sacramento Kings 103-117. (m33/ap)

Yamaha Ingin Tambah Jatah ASEAN SEPANG, Malaysia (Waspada): Kepopuleran MotoGP di Asia, tepatnya di Asia Tenggara, diakui oleh bos Yamaha Motor Racing, Lin Jarvis. Dia bahkan mengatakan seharusnya kalender balap di Eropa dikurangi untuk menambah jatah di Asia. Dari 18 balapan di musim 2013 nanti, 11 di antaranya digelar di benua biru dengan Asia hanya diwakili oleh Qatar, Jepang, dan Malaysia. Sirkuit Sepang di Malaysia bahkan menjadi satu-satunya negara di Asia Tenggara yang menggelar balapan MotoGP. “Saya ingin melihat olahraga ini bergerak menuju pangsa pasar dunia dan itu ada di Asia Tenggara. MotoGP menjadi balapan yang sangat populer di sana. Sayangnya, saat ini hanya ada satu seri di Sepang. Seharusnya jatah balapan di Asia diperbanyak,” tutur Jarvis, Jumat (29/3). MotoGP memang sangat populer di Indonesia. Bahkan, di setiap tahun Yamaha selalu mengutus pebalapnya untuk melakukan promo di Indonesia. Mulai musim ini, Yamaha kembali diperkuat oleh Valentino Rossi yang sempat hengkang ke Ducati. Nantinya, Rossi mendampingi juara dunia MotoGP, Jorge Lorenzo. Selain ke Asia Tenggara, Jarvis juga mendesak untuk lebih memeratakan balapan ke seluruh dunia, antara lain Amerika Selatan dan Afrika, dan tidak hanya berkutat di Eropa dengan harapan kejuaraan yang benar-benar global. “Saya ingin melihatnya di Amerika Selatan, melihatnya kembali di Afrika, melihat dua balapan di Asia Tenggara, dan yakin jika bergerak ke area yang kesulitan ekonominya maka akan menyaksikan kondisi keuangan yang lebih baik,” tutupnya. (m33/mgp)


CENTER LA Lakers Dwight Howard (kanan) kesulitan melewati hadangan pemain Milwaukee Bucks Larry Sanders dalam lanjutan kompetisi NBA di Milwaukee, Jumat (29/3).


Sumatera Utara

WASPADA Sabtu 30 Maret 2013


Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:33 12:46 12:34 12:41 12:40 12:37 12:34 12:29 12:36 12:36

15:37 15:53 15:37 15:47 15:46 15:38 15:36 15:32 15:39 15:41

Magrib 18:37 18:51 18:38 18:45 18:45 18:41 18:38 18:34 18:41 18:40



Shubuh Syuruq


19:46 19:59 19:46 19:54 19:53 19:49 19:46 19:42 19:49 19:49

05:02 05:15 04:03 05:09 05:09 05:06 05:03 04:58 05:05 05:04

05:12 05:25 05:13 05:19 05:19 05:16 05:13 05:08 05:15 05:14

L.Seumawe L. Pakam Sei Rampah Meulaboh P.Sidimpuan P. Siantar Balige R. Prapat Sabang Pandan

06:26 06:39 06:27 06:34 06:33 06:31 06:27 06:22 06:29 06:29

Zhuhur ‘Ashar 12:39 12:32 12:31 12:43 12:31 12:31 12:31 12:28 12:46 12:32

15:46 15:36 15:35 15:48 15:32 15:34 15:32 15:29 15:54 15:33



Imsak Shubuh Syuruq


18:44 18:37 18:36 18:48 18:35 18:36 18:36 18:32 18:51 18:37

19:52 19:45 19:44 19:56 19:43 19:44 19:44 19:41 19:59 19:45

05:07 05:01 05:00 05:12 05:00 05:00 05:01 04:57 05:14 05:02

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

05:17 05:11 05:10 05:22 05:10 05:10 05:11 05:07 05:24 05:12

06:32 06:25 06:24 06:36 06:24 06:25 06:25 06:22 06:39 06:26

Zhuhur ‘Ashar 12:32 12:34 12:44 12:36 12:33 12:40 12:29 12:39 12:32 12:31

15:33 15:36 15:50 15:37 15:37 15:45 15:31 15:42 15:32 15:34





Shubuh Syuruq


18:37 18:38 18:48 18:41 18:38 18:45 18:33 18:43 18:36 18:35

19:45 19:46 19:57 19:49 19:46 19:53 19:41 19:51 19:44 19:44

05:02 05:03 05:12 05:06 05:02 05:09 04:58 05:08 05:01 05:00

05:12 05:13 05:22 05:16 05:12 05:19 05:08 05:18 05:11 05:10

Panyabungan Teluk Dalam Salak Limapuluh Parapat Gunung Tua Sibuhuan Lhoksukon D.Sanggul Kotapinang Aek Kanopan

06:26 06:27 06:37 06:30 06:27 06:33 06:22 06:32 06:25 06:24

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur 12:29 12:36 12:34 12:30 12:32 12:29 12:29 12:38 12:33 12:27 12:29

‘Ashar Magrib 15:31 15:39 15:36 15:33 15:34 15:30 15:30 15:45 15:33 15:27 15:30

18:33 18:40 18:39 18:34 18:36 18:33 18:33 18:43 18:37 18:31 18:33



Shubuh Syuruq

19:41 19:48 19:47 19:43 19:44 19:41 19:41 19:51 19:45 19:39 19:41

04:59 05:06 05:03 04:59 05:01 04:58 04:58 05:07 05:02 04:56 04:58

05:09 05:16 05:13 05:09 05:11 05:08 05:08 05:17 05:12 05:06 05:08

06:23 06:30 06:28 06:23 06:25 06:22 06:22 06:31 06:26 06:21 06:22

Warga Besitang Diculik OTK Haji Ngogesa Jadi Anggota Minta Tebusan Rp90 juta Kehormatan Aceh Sepakat Masih Layak Menjadi Bupati Periode 2014-2019

BESITANG (Waspada): Khairul, 28, warga asal Aceh yang menetap di Desa Bukitselamat, Kec. Besitang, diculik orang tak dikenal tiga hari lalu. Kepada istrinya pelaku minta tebusan Rp90 juta. Pihak kepolisian sektor Besitang belum dapat menyimpulkan motif penculikan. Menurut Kades Bukitselamat, Effendy Tarigan, penculikan terjadi, Rabu (27/3) sekira pukul 10:00, ketika korban berada di kebun karet

Dusun III, Desa Bukitselamat. Saksi melihat mobil Honda Jazz BK 517 AT datang dari arah Medan masuk ke lokasi kebun. Saksi melihat, dua pria turun memaksa korban naik ke mobil. Tiga hari setelah penculikan,

pelaku menghubungi nomor ponsel keluarga korban menggunakan handphone Khairul, minta tebusan Rp90 juta sebagai biaya ongkos pembebasan. OTK mengirim sms kepada istri korban. Dalam pesan singkatnya pelaku mengaku disuruh pihak ketiga untuk menculik Khairul. Jika uang tebusan yang diminta tidak dipenuhi, keselamatan Khairul tidak terjamin. Ancaman penculik membuat istri korban, Hermayani, 22,

cemas. Pelaku juga mengaku mereka berada di Aceh. Namun informasi di kepolisian, berdasarkan hasil monitor Polres Langkat melalui teknologi GPS, posisi terakhir korban dan penculik berada di seputar kawasan ring-road, Medan. Kapolsek Besitang, AKP Sukerman yang dikonfirmasi, Jumat (29/3), mengatakan pihaknya sedang melakukan penyelidikan.(a02)

Pos Pengaman Didirikan Galian C Tetap Marak PATUMBAK (Waspada): Meski beberapa waktu lalu Muspika Patumbak mendirikan Pos Pengamanan di Jalan Pertahanan, Desa Sigara-gara, Patumbak, Deliserdang dan menempatkan personel kepolisian dan TNI di pos tersebut, namun operasi galian C ilegal di Patumbak tetap marak. Galian C ilegal yang beroperasi di antaranya dua galian pasir batu (sirtu) di daerah aliran sungai (DAS) Seruai, Desa Sigara-gara. Menurut warga, kedua galian sirtu ini kerap ‘curicuri’ mengangkut tanah timbun (tanah merah) dengan menempatkan sirtu atau batu di pinggir bak dump truk. Selain itu, galian ilegal tanah timbun di Gang Bandrek, di Gang Pemuda dan di Gang Saudara,

kesemuanya di Desa Patumbak II. Juga di Desa Patumbak I. Dump truk/intercooler pengangkut material galian C ilegal ini melintas dari Desa Patumbak I dan ke luar di Jalan Besar Delitua. Sementara intercooler tanpa muatan marak melintas dari Amplas menuju lokasi galian masing-masing. Warga melalui sejumlah tokoh masyarakat menyatakan resah karena sejak dua pekan terakhir praktik galian C ilegal t e t a p m a ra k , m e s k i p o s pengaman telah didirikan. “Dengan maraknya kembali galian C ilegal, maka jalan protokol Kec. Patumbak pun kembali dipenuhi debu. Terutama galian C di DAS Sungai Seruai yang dekat dengan pemukiman warga, menyebabkan debu

memenuhi seisi rumah,” ujar Syam, tokoh masyarakat sembari menunjuk galian C yang beroperasi di DAS Sungai Seruai dari belakang rumahnya. Dison Barus menambahkan, kondisi jalan yang tidak merata pengaspalannya dalam waktu dekat akan kembali hancur disebabkan tingginya intensitas intercooler galian C ilegal yang melintas. “Pemkab harus mencari solusi terbaik agar galian C ini tutup total,” tegasnya sembari menambahkan, warga akan kembali memblokir jalan utama bila galian C ilegal ini terus beroperasi. Sementara warga Kec. Delitua juga resah atas dampak dari maraknya praktik galian C ilegal utamanya di Patumbak. Sebab intercooler pengangkut

material galian C ilegal itu kini melintas dari jalan utama Delitua, sehingga menyebabkan kemacetan arus lalulintas. Camat Patumbak saat dikonfirmasi tidak berada di kantor, beberapa kali dihubungi via telefon selular juga tidak aktif. Sementara Sekcam Timur Tumanggorjugaengganberkomentardanhanyamengatakankonfirmasi langsung kepada Camat. Secara terpisah, Camat Delitua EdyYusuf dihubungi via telefon selularnya mengatakan, sudah melakukan operasi penertiban pasca maraknya intercooler galian C ilegal yang melintasi wilayahnya. “Kecamatan kita hanya lintasan, harusnya kecamatan terkait yakni Patumbak dan Biru-biru lebih pro aktif menertibkan galian C ilegal itu. (c02)

Pemasok Tanah Timbun Proyek PLTU Tak Punya Izin Galian C PANGKALANSUSU (Waspada): Lima perusahaan pemasok tanah timbun untuk kebutuhan mega proyek perusahaan listrik PLTU 2 x 200 Tanjungpasir, Kec. Pangkalansusu, tidak memiliki izin Galian C sehingga Pemkab Langkat dirugikan dari sektor retribusi. Pantauan Waspada, Rabu

(27/3), alat berat excavator dan beberapa unit dump truk tampak stand by di Dusun V Abdi, Desa Payatampak dan Dusun I, Desa Sei Siur, Kec. Pangkalansusu. Kegiatan pengangkutan tanah tampaknya terhenti sementara menyusul aksi demo warga. Keterangan dihimpun,

aktivitas galian di lokasi kedua desa ini sudah berlangsung lama, namun tak ada tindakan dari instansi terkait.Warga minta Pemkab Langkat tegas, sebab aktivitas truk merusak jalan dan menimbulkan debu. Camat Pangkalansusu, Sukyar Mulyamin, dikonfirmasi Waspada mengatakan dari lima


AKTIVITAS Excavator di lokasi galian C ilegal terhenti menyusul aksi demo warga.

Pengedar Narkoba Ditangkap Polisi BINJAI (Waspada): Petugas Serse Narkoba Polres Binjai menangkap tersangka pengedar sabu di daerah Pasar X Tanjung Jati Kel. Sukamaju Kec. Binjai Barat, kemarin. Kini tersangka DM alias Dopak, 29, penduduk Pasar X Tanjung Jati bersama barang bukti 5 paket sabu dan timbangan elektrik, diamankan di Polres Binjai. Kasat Serse Narkoba Polres Binjai AKP Achiruddin Hasibuan, SH, M.Hum ketika dikonfirmasi membenarkan penangkapan itu. Menurutnya, kasusnya masih dalam pengembangan.(a05)

Pengunjung ‘Serbu’ Paviliun DS Di PRSU MEDAN (Waspada): Salahsatu paviliun yang mendapat animo tinggi dari pengunjung Pekan Raya Sumatera Utara (PRSU) dalam pelaksanaan PRSU ke-42 di Tapian Daya, Jalan Jenderal Gatot Subroto Medan, adalah Paviliun Deliserdang (DS). “Saya mencari informasi lebih banyak tentang Kualanamu Airport International (KNIA), yang kabarnya akan beroperasi pertengahan 2013,” ujar Ahmad, salah seorang mahasiswa, kemarin. Ternyata, di Paviliun DS PRSU tidak hanya ada informasi tentang KNIA, di pavilun ini juga dipamerkan aneka buah unggulan Deliserdang yakni pisang barangan, jambu biji Deli dan salak ponti. Ada juga ditampilkan miniatur Kawasan Rumah Pangan Lestari (KRPL) yang pekarangannya dihiasi berbagai tanaman konsumsi pangan yang saat ini telah menjadi program nasional. Demikian juga tampilan produksi Dekranasda yang diketuai Anita Amri Tambunan, berupa tenunan khas Deliserdang serta gerabah unik dan anyaman dari berbagai tumbuhan alam Deliserdang. Di paviliun ini, Bupati Deliserdang Amri Tambunan melalui Wakil Bupati Deliserdang Zainuddin Mars menerima para pengunjung termasuk kehadiran anggota DPD RI Parlindungan Purba, sekaligus memberikan penjelasan tentang perkembangan di Kab. Deliserdang. (ihn)

perusahaan yang beroperasi, belum satu pun punya izin resmi. Ada dua perusahan yang masih dalam proses pengurusan izin, itu pun berkasnya belum lengkap. Mulyamin menegaskan, permasalahan ini sudah dilaporkan ke Satuan Polisi Pamong Praja (Satpol PP) Pemkab Langkat sepekan lalu. “Kita menunggu tindakan Satpol PP,” ujarnya seraya menambahkan, pihaknya juga telah melayangkan teguran kepada PT Bagus Karya, salah satu konsersium PLTU. Sementara Kasi Trantib Kec. Pangkalansusu, Taufiq, memastikan kelima perusahaan tidak punya izin. Ia mengakui, ada dua perusahaan yang masih dalam proses pengurusan izin, yakni PT Aca dan Koperasi Kasela. Tapi hingga kini izin resmi belum diterbitkan. Salah seorang pengawas lapangan yang ditemui tak jauh dari lokasi galian mengatakan, sekitar dua pekan lalu Satpol PP turun ke lokasi, namun tidak ada perintah hentikan kegiatan. “Kalau galian ini tidak punya izin, pasti ada tindakan,” ujarnya.(a02)

Target PAN T. Tinggi Bentuk Fraksi DPRD TEBINGTINGGI ( Waspada): Ketua PAN kota Tebingtinggi Drs. Syafrial Firdaus, MBA mengatakan dalam Pemilu Legislatif 2014, Parpol bentukan Amien Rais itu bertekad meraih satu fraksi di DPRD Tebingtinggi. PAN juga bertekad memberdayakan perempuan dalam rekruitmen politik dengan memenuhi kuota bakal Caleg dari kalangan perempuan. Tekad politik itu ditegaskan dalam laporannya, pada pelantikan DPD PAN kota Tebingtinggi periode 2010-2015, barubaru ini, di Balai Kartini. Hadir Ketua DPW PAN

Sumut H. Syah Affandin, SH dan jajarannya,Wali Kota Ir.H.Umar Z Hasibuan, MM, dan Wakil H. Irham Taufik, SH, MAP, mewakili DPRD, kalangan Parpol dan Ormas serta OKP. Terpilih kembali memimpin Drs. Syafrial Firdaus, MBA, Sekretaris M. Zulfiansyah, SH, Bendahara Drs. Muliadi dan sejumlah pengurus lainnya. Sedangkan DPD PUAN periode 2010-2015 Tebingtinggi yang dilantik, Ketua DPW PUAN Sumut Dra. Yusnidar Tanjung, MAP, yakni Ketua Suryani, Sekretaris Sukhairani dan Bendahara Yuni Syahfitri.(a09)


KELUARGA besar PAN pada pelantikan pengurus DPD PAN kota Tebingtinggi.

PANGKALANSUSU (Waspada): Aceh Sepakat Cabang X mendukung Haji Ngogesa Sitepu untuk menjadi Bupati Langkat periode 2014-2019. Dukungan disampaikan padaacarasyukuransekaligusperingatan Maulid Nabi Muhammad di Meunesah Aceh Sekapat, Pangkalansusu, Kamis (28/3). Selain memberi dukungan, Ketua Panita, Bijamil Daud mewakili Ketua Aceh Sekapat Cabang X, Ibrahim Hasan, di hadapan ribuan warga Aceh menyatakan menerima Bupati Langkat, Haji Ngogesa Sitepu sebagai anggota kehormatan Aceh Sepakat. “Sekarang ini Haji Ngogesa adalah keluarga besar Aceh Sepakat. Karena itu sebagai satu keluarga kita harus mendukungnya untuk menjadi bupati priode mendatang. Jika pun ada calon bupati yang lain, kita tetap memilih Haji Ngogesa,” ujarnya. Sementara Ketua DPP Aceh Sepakat Sumut, H. Husni Mustafa mengatakan, Haji Ngogesa Sitepu adalah teman nomor satu yang harus didukung untuk memimpin Langkat. Pada kesempatan itu, atas nama DPP Aceh Sekapat, ia menitipkan amanah kepada Haji Ngogesa agar menjaga warga Aceh. Sementara Bupati Langkat, Haji Ngogesa Sitepu menyambut posisif dan bersyukur atas dukungan warga Aceh untuk mencalonkannyamenjadibupati periode kedua. “Mudah-mudahan dengan dukungan warga Aceh saya mampu berbuat lebih baik lagi dimasa mendatang.” Sitepu menjelaskan, di Kab. Langkat terdapat 14 etnis. Seluruh etnis, katanya, hidup ber-


BUPATI Langkat, Ngogesa Sitepu, SH mengenakan pakaian adat Aceh setelah diterima menjadi anggota kehormatan Aceh Sepakat. dampingan secara damai dan penuh nuansa keharmonisan. Karena itu ia mengimbau warga Langkat yang multi etnis ini supaya tetap bersatu dan terus berupaya membuat hal terbaik demi kemajuan daerah. Haji Ngogesa juga mengajak seluruh anggota Aceh Sepakat yang hadir, untuk berdoa semoga Langkat tetap kondusif menjelang pemilihan bupati dan wakil bupati, yang rencananya berlangsung September mendatang. Mengakhiri acara, Ustadz H. Abdul Majid Syam, menyampaikan tiga gaya Nabi Muhammad SAW yang perlu ditiru. Pertama, selalu ceria dan membuang sifat kebengisan. Kedua, penolong serta selalu menjalin hubungan kasih sayang (silatu-

rahim) kepada sesama dan terakhir tidak punya rasa dendam. Di akhir acara, Haji Ngogesa Sitepu menyerahkan bingkisan 1000 paket kain sarung kepada warga Aceh Sepakat.“Kehadiran saya di sini dilandasi rasa cinta. Kalau tidak karena cinta, tak kan mungkin kita bertemu di sini,” ujarnya sembari mengingatkan, jika kain sarung ini kurang, segera beritahu. Masih Layak Haji Ngogesa Sitepu masih layak melanjutkan kepemimpinannya sebagai Bupati Langkat periode kedua. Ini mengingat masa kepemimpinan beliau pada periode sebelumnya banyak memperhatikan Ormas Pemuda Pancasila di Langkat. “Haji Ngogesa Sitepu layak melanjutkan kepemimpinan-

nya. Sosok beliau dikenal ramah, santun dan penuh perhatian terhadap Pemuda Pancasila mau pun masyarakat pesisir dan petani di Langkat,” ungkap Ketua Pimpinan Ranting Pemuda Pancasila Brandan Timur, Muslim Yusuf SN. Dikatakan, Haji Ngogesa Sitepu yang juga Ketua Dewan Pembina MPC PP Kab. Langkat itu sangatberperanpentingterhadap perubahan Pemuda Pancasila yang dulu disebut-sebut organisasi preman, kini menjadi pemuda berkarya dan mau bekerja. “Untuk itu keluarga besar Pemuda Pancasila Brandan Timur siap mengantarkan Haji Ngogesa Sitepu, SH untuk melanjutkan kepemimpinannya menjadi Bupati Langkat periode 2014-2019.”(a02/c01)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Satpol PP Labusel Jaring 20 Pelajar Bolos KOTAPINANG (Waspada): Satuan Polisi Pamong Praja (Satpol PP) dan Linmas Pemkab Labusel menjaring 20 pelajar dalam operasi kasih sayang yang digelar di seputaran Kec. Kotapinang dan Torgamba, Kamis (28/3). Ke-20 pelajar itu dijaring karena kedapatan berada di luar sekolah pada saat jam belajar. Kasatpol PP Fuadi, melalui Sekretaris Satpol PP Darman mengatakan, pelajar tersebut terjaring petugas di sejumlah warung internet (warnet) dan lokasi game on-line. “Dalam operasi ini kita amankan sebanyak 20 pelajar yang sedang berada di sejumlah warnet di dua kecamatan pada saat jam belajar berlangsung,” katanya. Menurutnya, ke-20 pelajar yang terjaring kali ini berasal dari tingkat SMP dan SMA. “Razia ini guna menghindarkan para siswa yang bolos melakukan hal-hal yang melanggar hukum. Selain itu, diharapkan juga supaya dapat mengurangi kenakalan para siswa yang sering menggunakan pakaian sekolah. Karena ini berdampak buruk pada sekolah,” katanya. Pengamatan Waspada, seluruh pelajar yang terjaring digiring ke markas Satpol PP Pemkab Labusel untuk dicatat dan diberi pengarahan. Setelah mendapat bimbingan petugas, pelajar-pelajar itu dikembalikan ke sekolah asalnya. (c18)

WASPADA Sabtu 30 Maret 2013

Honor Bidan Di Asahan Dipotong KISARAN (Waspada): Para bidan yang bertugas di Puskesmas Asahan menjerit. Pasalnya, honor mereka pada bidang pelayanan Posyandu, imunisasi bias dan pemberian vitamin A diduga telah dipotong oleh oknum petugas Dinas Kesehatan dan Puskesmas. “Sudah sering honor kami dipotong, bahkan akhir triwulan dinyatakan tidak ada,” kata salah satu bidan yang bertugas di Kab. Asahan. Dia mengungkapkan, untuk pelayanan Posyandu, honor yang disalurkan hanya Rp30 ribu tiap Posyandu, sedangkan anggarannya Rp50 ribu. “Itulah yang kami bagi-bagi. Biasanya satu Posyandu itu, petugasnya lebih dari 2 orang,” ujar sumber. Honor tersebut, lanjutnya, diberikan tiap tri wulan. Hanya saja, pada triwulan terakhir, yaitu Oktober-Desember, jarang disalurkan tanpa alasan jelas. “Honor untuk tri wulan terakhir nggak keluar, begitu saja yang diucapkan kepala Puskesmas,” ungkap sumber.

Hal sama juga terjadi untuk pemberian vitamin A. Dinas hanya menyalurkan Rp30 ribu untuk satu Posyandu, padahal dana yang dianggarkan mencapai Rp50 ribu. “Sebenarnya nggak tahu pasti berapa anggarannya, tapi ada yang bilang Rp50 ribu tiap Posyandu,” kata sumber. Begitu juga dengan honor imunisasi bias atau suntik TT pada siswa sekolah. Imunisasi itu dilaksanakan setahun dua kali dan honor untuk tiap sekolah Rp50 ribu. “Cuma Rp30 ribu atau Rp20 ribu yang kami terima untuk satu sekolah, itulah yang kami bagi-bagi. Gawat kali ini bang, yang kecilkecil pun dipotong uangnya, padahal yang nyuntik itu kami, resiko kami yang nanggung,”

ketus sumber Waspada. Disebutkannya, praktik pungutan liar oleh para atasan ini, hendak dilaporkan langsung ke Kadis Kesehatan ataupun Bupati Asahan. Akan tetapi, lanjut sumber, para bidan takut terjadi intimidasi. “Tolong rahasiakan identitas, kami hanya ingin mendapatkan hak bukan untuk menjatuhkan orang lain,” kata sumber. Bupati Asahan Drs.H. Taufan Gama Simatupang yang dikonfirmasi melalui Kabag Humas Zainal Arifin mengatakan, berdasarkan keterangan Kadis Kesehatan, tidak ada pemotongan terhadap honor bidan yang bertugas di Posyandu, imunisasi bias bahkan pemberian vitamin A. “Sudah kita cek ke Kadis Kesehatan, dan pengakuannya tidak ada pemotongan. Begitupun kita instruksikan agar Kadis menelusuri masalah ini hingga ke tingkat bawah mencegah terjadinya penyimpangan,” kata Zainal. (a14)

Kadiskanla Batubara Dinilai Tidak Kuasai Masalah LIMAPULUH (Waspada): Ketua DPRD Kab. Batubara menyatakan, Kepala Dinas Perikanan dan Kelautan (Diskanla) setempat Ir Rinaldi tidak menguasai perkembangan dari masalah kelautan yang terjadi terkait pengoperasian pukat gerandong. “Bagaimana dia (Kadis Kanla) tau, adanya izin dikantongi/ dimiliki nelayan pukat gerandong karena tidak hadir dalam rapat yang digelar Muspida Plus Batubara,” tukas Ketua DPRD

Batubara Selamat Arifin, SE, MSi menjawab Waspada terkait pernyataan dinilai keliru dari Kadiskanla yang menyatakan, adanya pukat gerandong mengantongi izin dari dinas terkait, Kamis (28/3). Sekretaris DPD Partai Golkar ini penyesalkan pernyataan itu dan mencerminkan Kadiskanla tidak menguasai perkembangan dari masalah. “Ini sangat kita sesalkan, karena dirinya tidak menguasai perkembangan dari masalah terjadi

di wilayah kelautan. Maunya informasi ini dia (Kadiskanla) cek dulu kebenarannya ke lapangan dan tidak spontan mengatakan hal itu keliru,” ujarnya. Rapat yang digelar Muspida Plus paska kericuhan nelayan ditandai aksi bakar pukat terlarang di Pelabuhan Tanjungtiram baru lalu, katanya, sebagai upaya mencari solusi mengatasipasi masalah dan terungkap adanya nelayan gerandong memiliki izin, sehingga menjadi riskan yang harusdiselesaikanbersama.(a13)

16 Perusahaan Terima Penghargaan Zero Accident RANTAUPRAPAT (Waspada): Sebanyak 16 perusahaan menerima penghargaan Zero Accident dari Pemkab Labuhanbatu karena telah berhasil melaksanakan kegiatan perusahaan tanpa kecelakaan. Penghargaan itu diserahkan Bupati L.Batu dr H Tigor Panusunan Siregar SpPD saat Peringatan Hari Keselamatan dan Kesehatan Kerja (K3) Tingkat L.Batu di Lapangan sepak bola PTPN IV Kebun Meranti Paham, Kec. Panai Hulu, Rabu (27/3). Pada kesempatan itu, PT Jamsostek juga memberikan beasiswa kepada pelajar dan mahasiswa yang orang tuanya bekerja di perusahaan. Ke-16 perusahaan yang mendapat penghargaan itu, terdiri dari, PT Pangkatan Infonesia Mill dan PT Pangkatan

Estate Desa Perkebunan Kec. Pangkatan, PMKS PT Daya Labuhan Indah, PT Daya Labuhan Indah Kebun Wonosari Kec. Bilah Hilir, PT Bilah Platindo, PTPN III Kebun Aek Nabara Selatan, PMKS PT Supra Matra Abadi. PT Sinar Pendawa, PTPN III Kebun Aek Nabara Utara, PT Socfindo, PTPN III Kebun Rantauprapat, PMKS PT Daya Labuhan Indah, PT Sembada, PMKS PTPN IV Unit Usaha Ajamu dan PTPN IV Kebun Meranti Paham. Adapun penerima beasiswa tingkat SD, yakni Indra Kusuma, Fernanda Riski danWahyu Indra Pratama. Untuk tingkat SMP, Ratih Hartini, tingkat SMA Surya Widiawaty dan Perguruan Tinggi Sarmauli Purba dan Sari Devi. Menteri Tenaga Kerja dan Transmigrasi, Muhaimin Iskandar dalam sambutan tertulisnya

yang dibacakan Tigor Siregar mengatakan, pada 26 November 2011, kita semua dikejutkan runtuhnya jembatan Kutai Kartanegara, Kaltim, yang mengakibatkan korban jiwa lebih dari 20 orang dan harta benda. Salah satu penyebab kejadian ini adalah pelaksanaan K3 pada pekerjaan perawatan kurang memadai. Kejadian ini harus dijadikan pelajaran yang sangat berharga untuk mencegah terulangnya kejadian serupa. Hadir pada acara itu antara lain Wakil Bupati Suhari Pane SIP, para unsur pimpinan daerah, para kepala SKPD, ketua tim penggerak PKK L.Batu dr Hj Fitra Laila TP Siregar, Ketua Dharma Wanita Persatuan Ny Hj Khairani Ali Usman, para manajer perusahaan, Satpam, tenaga medis dan pelajar. (a18)

Sisi Sungai Longsor, Warga Minta Pasang Bronjong RANTAUPRAPAT (Waspada): Beberapa titik sisi jalan yang berbatasan dengan Sungai Meilil di Lingkungan Kampung Tali, Kelurahan Siringo-ringo, Kec. Rantau Utara, Kab. Labuhanbatu, longsor. Karenanya, warga setempat meminta Pemkab L. Batu segera memasang bronjong. Salah seorang warga Kampung Tali, Mirza kepada wartawan, Rabu (27/3) di sela-sela peninjauan sisi sungai yang longsor itu mengatakan, semakin hari jalan yang dilalui warga semakin sempit karena longsor. Itu karena tidak ada bronjong di tepi Sungai Melil yang ber-

fungsi menahan badan jalan agar tidak rubuh. Dia menjelaskan, kondisi badan jalan yang semakin sempit dikhawatirkan semakin rawannya kecelakaan lalu lintas. Apalagi, jalan tersebut merupakan jalan satu-satunya alias jalan utama yang digunakan warga untuk segala keperluan khususnya mengangkut hasil pertanian. “Tidak ada jalan lain menuju Kampung Tali selain jalan yang sempit itu. Jalan itu jugalah yang digunakan warga untuk mengangkut hasil pertanian buah kelapa sawit. Makanya warga sangat takut ada kendaraan yang masuk ke sungai karena

sempitnya jalan itu,” sebutnya. Untuk mencegah terjadinya kecelakaan lalulintas yang dapat memakan korban, warga, secara bergotong royong telah memperbaiki sejumlah titik badan jalan yang longsor tersebut. Namun, perbaikan badan jalan yang dilakukan hanya bersifat sementara. “Wargahanyamampumembuat timbunanan tanah dalam karung dan menanami batang pohonbambusertabatangkelapa di tepian jalan pinggiran sungai yang longsor. Agar kekuatannya permanen, Pemkab L.Batu diharapkan segera membangun bronjong,” ungkap Mirza. (a18)

Waspada/Rasudin Sihotang

SEORANG anak berdiri di dekat mobil X Trail yang menabrak warung, sementara lauk pauk dan kaca steling pecah berserakan.

Nissan X Trail Seruduk Warung TANJUNGBALAI (Waspada): Sebuah mobil pribadi Nissan X Trail BK 1500VW menyuruduk warung nasi milik Bu Ani di Jl. Imam Bonjol, tepatnya di Pangkal Titi, Kisaran, Kamis (28/ 3) sekira pukul 12.00. Tidak ada korban jiwa dalam kejadian itu, namun kerugian diperkirakan jutaan rupiah. Steling tempat berjualan, lauk pauk, dan barang lainnya pecah berhamburan, sementara roda depan bagian kanan mobil rusak karena menabrak tiang. Informasi dihimpun, sebelum kejadian mobil mewah tersebut sudah parkir sejak matahari belum terbit dengan kondisi mesin hidup. Begitu tengah hari, tiba-tiba mobil mobil bergerak ke sisi kanan dan melesat menabrak warung yang waktu itu tengah ramai pengunjung. Seorang saksi mata Ibu Anum penjual pisang goreng mengatakan, saat membuka warung sekitar pukul 08.00 dirinya sudah melihat mobil naas itu parkir sekitar dua meter dari tempatnya berjualan. Alarm mobil sesekali berbunyi, mesin kendaraan hidup dan wiper kaca depan bergerak. “Aneh juga sih, tapi saya tidak terlalu ambil pusing,” kata Ibu Anum. Saksi lain Agus menjelaskan, sempat mendengar mirip suara ledakan, kemudian

suara kaca pecah, dilanjutkan dengan jeritan orang. “Memang mobil itu sudah lama parkir di situ, eh tiba-tiba langsung menabrak warung,” kata Agus. Sementara, penumpang yang keluar dari mobil mengaku bernama Fery saat ditanyai polisi mengaku tidur di bangku belakang saat kejadian. Dia mengatakan bukan dirinya yang mengemudikan mobil melainkan rekannya. “Saya tak tau persis kejadiannya pak, karena ketika bangun dari tidur mobil sudah menubruk warung,” kata Fery dengan wajah lesu seperti kelelahan. Pengakuan Fery ini dinilai cukup aneh karena sejumlah saksi melihat hanya dirinyalah yang keluar dari mobil naas tersebut.Warga juga melihat Fery mengambil sandal jepit dari belakang setir tepatnya di dekat pedal gas untuk menghindari pecahan kaca yang berserakan di warung. Pantauan Waspada di lokasi, selain petugas Sat Lantas, juga tampak personel Sat Narkoba Polres Asahan melakukan penggeledahan di mobil . “Katanya seperti habis mengkonsumsi narkoba gitu, setelah diperiksa mobilnya, kita tidak menemukan benda-benda mencurigakan,” kata Kanit I Narkoba Aiptu G Siregar. (a32)

Pernyataan Ketua DRPD Batubara Dinilai Keliru Soal Pukat Gerandong Miliki Izin LIMAPULUH (Waspada): Pengusiran terhadap nelayan sangat disesalkan, karena bukan merupakan alternatif terbaik dalam menyelesaikan masalah paska kericuhan nelayan yang ditandai aksi bakar pukat terlarang oleh nelayan jaring beberapa waktu lalu. Akibatnya nelayan tangkul teri seine net takut ke laut dan mengancam mata pencarian masyarakat, terutama yang bergantungan hidup sebagai awak dan buruh nelayan. ‘’Tindakan ini sangat disesalkan, karena secara tidak langsung melarang mereka mencari nafkah. Padahal pekerjaan nelayan bukan mencari kaya, melainkan sebatas bertahan hidup untuk perut (makan),’’ tukas beberapa tokoh masyarakat dan nelayan di Batubara kepada Waspada, Kamis (28/3). Pengusiran nelayan oleh aparat itu, terjadi jika ditemukan turun ke laut menangkap. Pihak pelabuhan tidak mengeluarkan persyaratan melaut yang dibutuhkan nelayan tangkul teri seine net, ekses dari Kep 02/Men/ 2011, yang tidak membenarkan alat penangkapan ikan gandeng dua, meskipun pengoperasiannya tidak sampai ke dasar laut, melainkan mengambang pada kedalaman air. Alat tangkat jenis ini, bahkan disebut telah diuji oleh Balai Besar Pengembangan Penangkapan Ikan (BBPPI) Semaran, yang pengoperasiannya ramah lingkungan dan menangkap ikan selektif (khusus teri). Sedangkan pukat tarik berkedok pukat layang dan sejenisnya bebas beroperasi tanpa ada larangan, sebagaimana Kepres No 39 Tahun 1980 tentang pelarangan menggunakan jaring trawl. Begitu juga keberadaan pukat ikan gandeng dua PT AS yang bertangkahan di Kuala

Pagurawan, Kec. Medang Deras yang di sebutsebut mengantongi izin. ‘’Ini yang kita pertanyakan apakah peraturan ini hanya ditegakan kepada masyarakat kecil,’’ ujar Alang Yusuf dan Fauzi di Tanjungtiram. Kepala Dinas Kelautan dan Perikanan Kab. Batubara Ir Rinaldi dikonfirmasi Waspada seputar keberadaan pukat ikan gandeng dua PT AS mengaku tidak mengetahui hal itu. Padahal sudah lama berlangsung. Termasuk izin pukat gerandong sampai sekarang belum ada, dan menuding pernyataan Ketua DPRD Batubara keliru. ‘’Setahu kita tidak ada pukat gerandong mengantongi izin dan jika ada menyatakan itu merupakan hal keliru,’’ tukasnya melalui selular. Terkait merajalelanya pengoperasian pukat tarik kerang atau dikenal dengan tank Thailand asal Tanjungbalai di perairan Batubara, sehingga memicu keresahan nelayan berskala kecil jaring selapis, dan beroperasi berjarak sekitar satu mil dari daratan/pantai, pihaknya mengaku bersama tim pengawas telah berupaya menertibkan. ‘’Di sini kita telah berupaya untuk menertibkan bersama tim yang terlibat dalam pengawasan, namun begitu turun melakukan patroli pukat tarik kerang menghilang,’’ ujarnya. Ditempat terpisahWakil Ketua HNSI Sumut H Darius, SH, MH menilai supremasi hukum di wilayah kelautan Batubara tidak berjalan sebagaimana mestinya dan bernuansa kepentingan sehingga berpotensi konflik. “Kita menilai ini tidak berjalan, sehingga semua pihak yang terlibat harus proaktif untuk menjalankan ketentuan berlaku guna menghindari hal tak diingini,” ujar Darius yang juga anggota DPRD Batubara. (a13)

Bupati L. Batu Tutup Diklat Pengawas Sekolah RANTAUPRAPAT ( Waspada): Bupati Labuhanbatu Dr H Tigor Panusunann Siregar SpPD menutup pelaksanaan Diklat Pengawas sekolah yang diselenggarakan di Aula Diklat BKD, Kamis (28/3). Penutupan Diklat yang ditandai dengan pelepasan atribut oleh Bupati kepada tiga orang perwakilan itu berlangsung khidmat. Diklat tersebut berlangsung selama sembilan hari dari 18 sampai 27 Maret 2013. Dalam pidato arahannya, Bupati Tigor Panusunan Siregar mengatakan, sebagai seorang pendidik mengikuti pendidikan dan latihan (Diklat) merupakan suatu kebutuhan. “Dengan mengikuti Diklat kita akan selalu mengupdate pengetahuan kita, karena ilmu pengetahuan terus berkembang. Kalau kita tiak mengikuti perkembangan, maka maka kita akan

tertinggal jauh di belakang,” tegas Tigor. Kepala BKD Aswad Siregar SE MAP melaporkan, jumlah peserta yang mengikuti Diklat tersebut sebanyal 30 orang yang berasal dari lingkungan Disdik Kab. Labuhanbatu yang terdiri dari 8 orang pengawas SD, 16 orang pengawas pendidikan menengah umum (Dikmenum), dan 6 orang pengawas pendidikan menengah kejuruan (Dikpenjar). Hadir pada acara penutupan tersebut antara lain Wakil Bupati Suhari Pane SIP, Asisten Pemerintahan Drs H Sarbaini, Kadis Pendidikan Drs Iskandar, Kadis PPKAD Ahmad Muflih SH, Asisten Ekbang dan Kesos H Burhanuddin SH, Asisten Administrasi Umum Elfin Riswan SE, Kadis Sosnakertrans Mahadi SH, dan Kaban Kesbangpol Linmas Hasnul Basri S Sos. (c07)

Pajak Kerang Butuh Perbaikan

Waspada/Armansyah Abdi

SISI Sungai Meilil, Lingkungan Kampung Tali, Kec. Rantau Utara, L.Batu, terus longsor sehingga badan jalan semakin sempit.

TG.TIRAM (Waspada): Warga nelayan pencakar kerang tradisional sekitar Tanjungtiram, Sukamaju, Bagandalam meminta Pemkab Batubara memperbaiki bangunan pajak yang rusak. “Entah macam mana hendak naik ke tangkahan, salah panjat tercebur masuk sungai,” tukas nelayan kerang Tanjungtiram, Jumat (29/3). Menurut nelayan, tangga pajak sudah lebih

tiga tahun rusak. Lantai dan tiang bertanggalan tetapi belum mendapat perbaikan. Padahal, setiap hari nelayan memanfaatkan tangkahan menaikkan kerang, termasuk ibu-ibu pencari kerang dengan resiko terjatuh ke dalam sungai. Karena itu, ratusan nelayan kerang mohon perbaikan tangga pajak dialokasikan dananya di APBD Batubara 2013 agar memudahkan nelayan memasarkan hasil tangkapan kerang mereka. (a12)

Sumatera Utara

WASPADA Sabtu 30 Maret 2013


Madina Peringkat 11 Dari 33 Kabupaten/Kota Se-Sumut PANYABUNGAN (Waspada): Penyerahan Laporan Keterangan Pertanggung Jawaban (LKPJ) keuangan Pemerintah Daerah Kabupaten Mandailing Natal (Madina)TA 2012 ke Badan Pemeriksa Keuangan Republik Indonesia (BPK RI) di Medan, berhasil mendapat peringkat ke11 dari 33 kabupaten/kota se- Sumatera Utara. Hal tersebut disampaikan Bupati Hidayat Batubara melalui Kabag Humas dan Protokol Arbiuddin S. Harahap kepada Waspada di ruang kerjanya di perkantoran Payaloting Panyabungan, Kamis (28/3). “Madina urutan ke-11, dengan demikian Pemkab Madina sudah memenuhi tenggang waktu penyampaian laporan keuangan daerah, sehingga BPK RI bisa melakukan langkahlangkah selanjutnya,” ujarnya Menurutnya, penyerahan laporan pengelolaan keuangan Pemkab Madina TA 2012 kepada BPK-RI di Medan dilakukan langsung Bupati Madina Hidayat Batubara didampingi Kadis Pengelola Keuangan dan Aset Daerah (DPKAD) Murnadi Pasaribu untuk diaudit atas

penggunaannya pada Senin (25/3) lalu. Kata dia, ini merupakan prestasi atau hasil kinerja yang bisa dibanggakan dari segi administrasi. Kemudian, sebagai bukti, Pemkab Madina serius dalam mengelola keuangan negara untuk membangun Mandailing Natal dan Sumut serta Indonesia demi kesejahteraan masyarakat. Karenanya, bupati menyampaikan rasa terimakasih dan apresiasi tinggi kepada segenap jajaran eksekutif dan legislatif dalam hal ini Pemkab dan DPRD Madina yang selama ini telah bekerjasama dengan memainkan peran masing-masing sehingga Madina mampu meraih peringkat ke-11 itu. Ia menjelaskan, berdasarkan urutan itu, Pemkab Madina telah dapat melengkapi beberapa kekurangan yang selama ini perlu diperbaiki di antaranya tutup buku setiap SKPD agar dilaksanakan tepat waktu dan melakukan pembenahan di bidang administrasi termasuk administrasi aset yang dimiliki pemerintah daerah. (a28)

Pameran Pembangunan Meriahkan HUT Sibolga Waspada/Sori Parlah Harahap

JEMBATAN Trikora Aek Sirumambe yang menghubungkan Desa Balakka dengan Desa Parupuk Jae dan beberapa desa lainnya di Kec. Padangbolak Julu, Kab. Padanglawas Utara (Paluta) ambruk saat dilewati tronton bermuatan alat berat.

Jembatan Aek Sirumambe Runtuh Akses Jalan Ke Tujuh Desa Terganggu PADANGBOLAK JULU (Waspada): Jembatan Trikora Aek Sirumambe yang menghubungkan Desa Balakka dengan Desa Parupuk Jae dan beberapa desa lainnya di Kec. Padangbolak Julu, Kab. Padanglawas Utara (Paluta), ambruk saat dilewati tronton bermuatan alat berat, kemarin. Tidak ada korban jiwa dalam peristiwa itu, namun pantauan Waspada di lokasi, Jumat (29/3), arus lalulintas ke tujuh desa terganggu, yakni Desa Parupuk Jae, Parupuk Julu, Hasona Baru, Hasona Lama, Sodongdong, Pakkal Dolok dan Sialang. Informasi dihimpun, peristiwa itu terjadi, Selasa (26/3) sore sekira pukul 15.30. Saat itu, truk tronton milik salahsatu pengusaha asal Paluta mengangkut alat berat jenis beko (eskavatorred) hendak dibawa menuju Desa Parupuk Jae untuk melakukan pengerjaan salahsatu proyek di wilayah setempat. Semula, warga dan beberapa pihak terkait di desa melarang agar truk tronton itu melewati jembatan yang baru selesai pengerjaannya beberapa waktu lalu. Namun, mereka tetap ngotot melewatinya. Selang beberapa menit di atas jembatan, diduga karena bebannya terlalu berat, jemba-

tan pun ambruk bersama truk dan alat berat. Kepala Desa Parupuk Jae Parmohonan Siregar, 34, menyebutkan, beban truk tronton yang bermuatan alat berat itu sekira 30 ton, sedangkan konstruksi jembatan disiapkan untuk beban maksimal 8 ton. Sopir truk memaksakan diri melewati jembatan yang berukuran 28 meter di atas Sungai Sirumambe. Jembatan pun ambruk, yang mengakibatkan aktivitas perekonomian warga di tujuh desa terganggu. Di lokasi kejadian, sejumlah warga tidak menduga jembatan itu akan putus karena masih tergolong baru.Warga mengharapkan pihak terkait segera memperbaiki jembatan itu karena jembatan itu termasuk transportasi satu-satunya bagi petani menuju lahan mereka. Jika tidak diperbaiki maka warga terpaksa menyeberang melalui sungai. Anggota DPRD Paluta Tua

Pembangunan Terminal Kotanopan Dilanjutkan PANYABUNGAN (Waspada): Pemkab Madina melalui Dinas Perhubungan dan Informatika melanjutkan pembangunan terminal Pasar Kotanopan, Kec. Kotanopan, Kab. Mandailing Natal pada tahun anggaran (TA) 2013 ini, sehingga kelak diharap keberadaan terminal menjadi sempurna dan nyaman dengan kehadiran beberapa fasilitas. Hal tersebut disampaikan Kadis Perhubungan dan Informatika Madina Harlan Batubara, SH di Panyabungan, Selasa (26/3). “Pembangunan terminal yang dimulai TA 2012 lalu itu belum sempurna atau masih dalam pembangunan tahap I, karena fasilitas yang sudah rampung masih beberapa item dari target seluruhnya,” ujarnya. Menurutnya, fasilitas yang dibangun tahun lalu, masih sebatas ruang tunggu penumpang, loket, parit, sementara lapangannya masih berjenis tanah. Sementara pada TA 2013 ini akan dilanjutkan dengan pembangunan tahap II yang meliputi pengaspalan lapangan terminal dengan jenis hotmik, pembangunan kamar mandi umum, kios dan hangar. “Hangar diperuntukkan sebagai lokasi turun naik penumpang serta lokasi pemarkiran angkutan umum agar terhindar dari hujan dan terik matahari, sehingga diharapkan agar kucuran dana pembangunan tahap II untuk penyempurnaan terminal itu segera atau tidak mengalami kendala,” terangnya. Sementara Rahmad Riski Daulay, sebagai anggota DPRD Madina asal daerah itu menyambut baik dan mendukung sepenuhnya upaya Pemkab Madina untuk perluasan sekaligus memfungsikan terminal tersebut. “Kami menyambut baik dan mendukung adanya pembangunan terminal, karena sudah lama didambakan rakyat Kotanopan dalam upaya meminimalisir kemacetan jalan raya ( jalinsum ) di titik pusat pasar terutama pada setiap pekan Sabtu sekaligus menuju tercapainya keindahan kecamatan itu ,” ungkapnya. (a28)

Bupati Simalungun Segera Berkantor Di Gedung Baru SIMALUNGUN (Waspada): Bupati Simalungun, JR Saragih pada 1 April 2013 mulai berkantor di gedung kantor bupati baru di Hapoltakan Pamatangraya, Kec. Raya. “Meski belum rampung 100 persen, awal April ini saya sudah mulai melaksanakan tugas di kantor bupati yang baru,” terang JR kepada Waspada, belum lama ini. Menurutnya, secara fisik, bangunan kantor bupati Simalungun yang baru sudah selesai, hanya saja interiornya (bagian dalamnya) saat ini masih dalam proses tender, sehingga belum memungkinkan sekretariat dan SKPD lainnya berkantor di gedung dimaksud. “Untuk sementara ini, baru saya (bupati) yang berkantor di gedung baru, hitung-hitung sekaligus agar dapat diketahui segera bagian-bagian bangunan yang mungkin bocor, mumpung bangunan itu masih dalam tahap perawatan dari rekanan,” tukas JR. Dikatakan, pembangunan gedung kantor bupati yang baru merupakan bagian upaya Pemkab Simalungun untuk memberikan pelayanan prima kepada masyarakat secara profesional dan dukungan aksesibilitas yang mudah karena berada persis di seputar perkantoran SKPD lainnya. “ Dengan dukungan fasilitas yang baru tersebut, tentu harus ada perubahan positif dalam peningkatan kualitas pelayanan yang diberikan kepada masyarakat,” tandasnya. Terkait dengan rencana peresmian, JR Saragih menyatakan akan dilaksanakan pada pertengahan Agustus 2013 atau selesai perayaan lebaran. Menurutnya, acara peresmian akan dilakukan dengan cara adat dan pesta rakyat, minimal mengundang tokoh masyarakat, baik yang tinggal di Simalungun maupun di luar daerah. (a29)

Rohot Siregar berharap pemerintah daerah melalui Dinas PU, membentuk tim untuk mengidentifikasi dan mengkaji runtuhnya jembatan. Tujuan pembentukan tim tersebut terutama untuk mengetahui kerusakan dan mencegah hal tak diinginkan serta mengamankan jembatan yang amblas itu. Ambruknya jembatan di Desa Parupuk Jae, menunjukkan pengawasan terhadap truk bermuatan melebihi tonase tidak berjalan maksimal di Paluta. Pantauan Waspada, akibat masih terputusnya akses jalan yang menghubungkan antara

Desa Parupuk Jae dengan desa lainnya karena ambruknya jembatan Trikora beberapa waktu lalu, membuat warga yang hendak menyeberang terpaksa harus melewati sungai dan bahkan harus memberanikan diri melewati jembatan yang rusak. Selain itu, ada juga para siswa SD terpaksa turun menyeberangi sungai dan bahkan ada yang ditolong oleh para relawan dan warga untuk bisa melewati sungai. Salah seorang guru yang enggan identitasnya dimuat mengungkapkan, saat ini beberapa warga harus rela turun ke sungai

dengan kondisi basah untuk menyeberang ke desa tetangga, bahkan tak jarang harus menyeberang Sungai Sirumambe dengan cara meniti bentangan jembatan yang telah rusak. Hingga berita ini diturunkan belum ada keterangan resmi dari Dinas PU terkait jembatan runtuh dan belum ada upaya perbaikan di sekitar kejadian sehingga untuk kendaraan roda duadanrodaempatmasihbelum bisa melintas. Padahal jembatan dibangun 1980 ini baru saja selesai pengerjaan lantai direhab oleh CV Putra Langsa Perdana lima bulan lalu. (a35)

SIBOLGA (Waspada): Menyambut sekaligus memeriahkan hari ulang tahun (HUT) ke-313 Kota Sibolga, dilaksanakan pameran pembangunan di Lapangan Simare-mare, Sibolga. Wali Kota Sibolga Drs HM Syarfi Hutauruk, Senin (25/3) malam membuka pelaksanaan pameran pembangunan ini. Wali kota melakukan peninjauan stand, ada 200 stand termasuk stand Sibolga Sambas. Kedatangan wali kota disambut Camat Sibolga Sambas Faisal Pahmi Lubis. Ada 60 stand peserta pameran berada di dalam Lapangan Simare-mare Sibolga, 140 stand pameran berada di luar lokasi Lapangan Simare-mare, sekitar ruas jalan yang mengelilingi lapangan Simare-mare. Wali Kota Sibolga Drs Syarfi Hutauruk meminta masyarakat Kota Sibolga bekerjasama dengan pemerintah untuk saling membantu dalam mensukseskan pembangunan yang pro masyarakat, dan menciptakan masyarakat yang lebih kondusif. “Saat ini pemerintah Kota Sibolga sedang

gencar-gencarnya melaksanakan pembangunan pro kerakyatan, untuk itu kepada para pimpinan SKPD dan para pegawai di Kota Sibolga dapat meningkatkan pelayanan untuk kepentingan masyarakat, baik layanan kesehatan, pendidikan maupun beberapa kepentingan masyarakat lainnya, sebab pejabat pemerintah adalah pelayan masyarakat,” katanya.. Turut memberikan Sambutan Ketua DPRD Sibolga Syahlul U Situmeang, dan laporan ketua Panitia hari jadi kota Sibolga Drs Junedi Tanjung. Turut hadir dalam pembukaan Pameran pembukaan pameran pembangunan kota Sibolga Wakil Wali Kota Sibolga Marudut Situmorang, Ketua DPRD Syahlul U Situmeang, Kapolres Sibolga AKBP Joas F Panjaitan, Kapolres Tapteng AKBP MIsnan, Dandim 0211/TT Letkol G.Siagian, Danlanal Sibolga Letkol Ivan Gatot, Kepala BI Sibolga Yiyok, Muspida lainnya, Ketua TP PKK Kota Sibolga Ny Delmeria H Syarfi Hutauruk, pimpinan SKPD, camat, lurah tokoh masyarakat, tokoh agama, pimpinan OKP, Ormas, anggota DPRD Sibolga dan udangan lainnya. (a24)

Humbahas Pilot Project Pemberantasan Korupsi DOLOKSANGGUL (Waspada): Kabupaten Humbang Hasundutan (Humbahas) berhasil meraih berbagai prestasi di Indonesia, merupakan kabupaten terbaik yang telah ditetapkan sebagai pilot project pencegahan dan pemberantasan korupsi mewakili Pulau Sumatera. “Pelayanan prima harus tetap ditumbuhkembangkan, keramahan dan sikap bersahaja, sehingga terwujud pelayan prima terhadap seluruh masyarakat. Saya alergi beramai-ramai kunjungan keluar kota atau kemana-mana, kendati tidak melanggar aturan. Ini saya lakukan untuk efisiensi,” ujar Bupati Humbhas Drs Maddin Sihombing Msi pada rapat tertutup dengan Asisten dan seluruh Kepala Bagian Setdakab Humbahas, Kamis (28/3). Penekanan ini penekanan Bupati Humbahas kepada seluruh peserta rapat dalam menyikapi berbagai program dan pelayanan kemasyarakatan Pemkab Humbahas, ujar Kabag Humas Osborn Siahaan kepada Waspada, Jumat (29/3).

Katanya, sejak menjabat sebagai Bupati Humbahas 2005, hingga saat ini tidak pernah mengarak-arak atau membawa para pimpinan SKPD beramairamai keluar daerah untuk mendampingi. “Yang dibawa adalah yang memiliki Tupoksi sesuai dengan kegiatan. Jika suatu kegiatan hanya tugas bupati maka pejabat lainnya tidak ada instruksi untuk mengikutinya. Semuanya dilakukan untuk efisiensi dan efektifitas kegiatan serta tertibnya administrasi. Tidak perlu

ada Kabag atau Asisten yang melakukan pemborosan dana pemerintah, yang penting bekerja baik sesuai tugas pokok dan fungsi,”ujar bupati. Menurut bupati, apa yang sudah laksanakan di Humbahas sudah mendapat nilai positif dari pemerintah pusat dengan berbagai prestasi yang diperoleh dan yang dibuktikan dengan penghargaan kepada Pemkab. Pada 2011 memperoleh OpiniWajar Tanpa Pengecualian ( WTP), 2012 memperoleh penghargaan atas LPPD serta tahun ini masuk dalam peringkat 16 terbaik dari seluruh kabupaten se-Indonesia. Mengenai penilaian LPPD, Pemkab Humbahas telah dievaluasi oleh Tim Nasional EPPD yang melakukan penilaian secara ril di lapangan. “Pada 2013 harus menjadi tahun prestasi dan prestise. Maka, Asisten dan Kabag di Setdakab Humbahas dan seluruh kepala SKPD harus bekerja dengan ulet, setia dan takwa kepada Tuhan Yang Maha Esa,” tegas bupati. (a21)

Martandang Di PRSU MARTANDANG merupakan suatu budaya mudamudi di tanah Angkola, khususnya di Kota Padangsidimpuan. Budaya martandang (seorang pemuda menemui seorang gadis) ke rumahnya untuk niat hati menjalin asmara. Karena semakin pudar reaksi martandang yang dibentengi nilai-nilai adat dalihan na tolu saat ini, akibat semakin maraknya kecanggihan teknologi seperti jejaring sosial (facebook, twitter) melalui telepon genggam (handpone), ipad. Namun Pemerintah Kota (Pemko) Padangsidimpuan menyegarkan kembali budaya muda/i masa lalu yang mulai pudar zaman ini,

dengan menggelar pagelaran drama kolosal martandang di Pekan Raya Sumatera Utara (PRSU), Tapian Daya, Jalan Jenderal Gatot Subroto, Medan, Senin (25/3), sekaligus menyambut hari jadi Provinsi Sumatera Utara ke-65 dihadiri 500an warga Padangsidimpuan tinggal di Medan. Tidak tanggung-tanggung, Wali Kota Padangsidimpuan Andar Amin Harahap, MSi, Wakil Wali Kota M Isnandar Nasution, Ketua DPRD H Azwar Syamsi MM, sejumlah anggota DPRD setempat, serta pimpinan SKPD turut menyaksikan serta memeriahkan pagelaran martandang dibawakan 20 muda-mudi Kec. Padangsidimpuan Hutaimbaru. Sebelumnya, acara itu di-

bukaWali Kota Padangsidimpuan Andar Amin Harahap dengan semarak tortor somba-somba yang diikuti rombongan Wali Kota dimeriahkan para anggota DPRD, SKPD lainnya untuk membudayakan nilai kultural di era modernisasi saat ini. ‘’Untuk meningkatkan silaturahmi, mari kita bergandeng tangan dengan seluruh elemen masyarakat, dengan menggelar drama kolosal martandang. Sehingga, warga Kota Padangsidimpuan yang berdomisili di Medan dan daerah perantauan tetap ingat akan kampung halamannya,’’ujar Andar Amin. * Ahmad Cerem Meha


PEMERINTAH Kota Padangsidimpuan menyegarkan kembali budaya muda/i masa lalu dengan menggelar pagelaran drama kolosal martandang di Pekan Raya Sumatera Utara (PRSU), Tapian Daya, Jalan Jenderal Gatot Subroto Medan.

Waspada/Alam Satriwal Tanjung

WALI KOTA Sibolga Drs HM Syarfi Hutauruk memukul gong tanda dibukanya pameran pembangunan Kota Sibolga 2013 di Lapangan Simare-mare, Sibolga.

Pangdam I BB Buka Karya Bhakti TNI Di Simalungun SIMALUNGUN (Waspada): Pangdam I BB Mayjend TNI Lodewijk F Paulus didampingi Bupati Simalungun JR Saragih, Rabu (27/3) membuka secara resmi pelaksanaan Karya Bhakti TNI Kodim 0207 Simalungun di Kec. Silou Kahean dan Doloksilou, Kab.Simalungun. Acara pembukaan di Lapangan Merdeka Silou Kahean ditandai dengan pemukulan gong dan penyerahan pelaralatan kerja berupa cangkul dan skop secara simbolis kepada perwakilan anggota TNI dan masyarakat dan penanaman bibit pohon. Kegiatan Karya Bhakti TNI merupakan optimalisasi kegiatan teritorial, agar setiap Kodim dijajaran Korem 022/PT dapat lebih mengenal kondisi lingkungan dan menjalin hubungan yang positif serta manunggal dengan masyarakat. “Kehadiran TNI semata-mata membangun desa, sebagai bentuk peran TNI dalam meningkatkan kepekaan dan kepedulian sosial serta mampu mengembangkan komunikasi sosial yang persuasif kepad seluruh lapisan masyarakat,” tegas Pangdam I/BB. Pangdam juga mengharapkan, kegiatan Karya Bhakti TNI ini dapat memotivasi tekad dan semangat masyarakat untuk membangun daerahnya sendiri, serta meningkatkan kembali

kesadaran untuk budaya gotong royong yang selama ini mulai memudar akibat adanya globalisasi budaya yang tidak bisa dibendung, sehingga mempengaruhi nilai-nilai kebersamaan. Secara khusus, Pangdam I/BB menyampaikan pesan kepada prajurit TNI agar dalam melaksanakan tugas harus selalu dengan penuh keikhlasan dan rasa tanggungjawab. Kemudian bekerja secara profesional dengan tetap memperhatikan faktor keamanan dan memanfaatkan kegiatan Karya Bhakti TNI untuk berinteraksi dengan masyarakat, guna memantapkan kemanunggalan TNI dengan rakyat. Tokoh masyarakat Kec. Silou Kahean St Samin Sinaga didampingi Jagamada Sinaga dan Sudiarman Sinaga menyampaikan terimakasih kepada TNI yang telah melaksanakan kegiatan Karya Bhakti TNI di daerahnya. Sebelumnya, Kodim 0207 Simalungun Letkol Inf Martin SM Turnif melaporkan bahwa kegiatan Karya Bhakti TNI Kodim 0207 Simalungun dilaksanakan mulai 27 Maret sampai 27 September 2013 di Negeri Dolok, Nagori Dolok Merawa Kec. Silou Kahean dan Huta Batu Holing, Nagori Togur, Nagori Marubun Lokkung Kec. Dolok Silou. (a29)

Perlu Dibentuk BUMD Di Tobasa PORSEA (Tobasa): Memperhatikan kondisi infrastruktur di Kab. Toba Samosir (Tobasa) khususnya jalan dan jembatan yang cukup memprihatinkan, anggota DPRD Sumatera Utara Budiman P. Nadapdap menyarankan agar Pemkab Tobasa memberdayakan seluruh potensi yang dimiliki supaya pembenahan sektor ini dapat segera direalisasikan. “Pemberdayaan potensi itu dengan melakukan kajian untuk membentuk suatu Badan Usaha Milik Daerah (BUMD) yang khusus menangani pembenahan infrastruktur jalan dan jembatan karena sudah layak untuk dipertimbangkan, dan selanjutnya dapat diatur dalam peraturan daerah,” kata Budiman P. Nadapdap di Gedung Pertemuan Porsea, Rabu (27/3). Menurutnya, dengan keberadaan BUMD ini nantinya, kondisi jalan maupun jembatan yang merupakan sarana vital bagi masyarakat dapat selalu mendapat perhatian, sehingga kerusakan yang terjadi dapat sewaktu-waktu diperbaiki. Budiman juga mengakui, untuk menyikapi kondisi ruas jalan dan jembatan di Tobasa, Bupati Toba Samosir, Pandapotan Kasmin Simanjuntak, cukup intens membangun komunikasi

dengannya termasuk anggota DPRD SU dari Sumut VIII lainnya, agar perbaikan jalan dan jembatan ini dapat diakomodir. Asisten Pemerintahan Setdakab Toba Samosir Wasir Simanjuntak pada kesempatan tersebut menyampaikan harapannya, agar anggota DPRD SU khususnya dari Daerah Pemilihan Sumut VIII, dapat menampung aspirasi warga Tobasa dan memperjuangkannya di tingkat provinsi. Anggota DPRD Tobasa Viktor Silalahi menilai, rapat konsultasi tersebut dapat dimanfaatkan masyarakat Tobasa sebagai momentum untuk menyampaikan usulan pembangunan lainnya secara cerdas, karena telah membuka peluang terbukanya pintu aspirasi warga ke wakil rakyat di DPRD. Viktor juga menitipkan berbagai usulan pembangunan dan alokasi anggaran untuk Tobasa, untuk selanjutnya dapat diperjuangkan Budiman P. Nadapdap di tingkat provinsi ataupun ke tingkat pusat. Budiman P Nadapdap, anggota DPRD SU dari Fraksi PDI Perjuangan dalam kunjungannya di tanah kelahirannya di Porsea kali ini, merupakan rangkaian dari Reses Anggota DPRD SU. (a22)



WASPADA Sabtu 30 Maret 2013

Di Agara, Bendera Aceh Disikapi Dingin KUTACANE (Waspada) : Kendati di daerah Aceh pesisir telah menjadi euforia dan diwarnai dengan konvoi dan pengibaran bendera baru Aceh, namun di Agara, pengesahan Qanun tentang bendera yang mirip lambing GAM tersebut disikapi dingin komponen masyarakat. Pantauan Waspada, hingga berita ini diturunkan belum ada satu pun bendera Aceh yang telah disahkan DPR Aceh tersebut berkibar di Aceh Tenggara, bahkan sambutan warga terhadap lahirnya Qanun Nomor 3 /2013 tentang bendera Aceh sangat dingin. Sah-sah saja DPRA mengesahkan qanun tentang bendera Aceh tersebut, ujar Amin, warga Kutacane, namun harus di ingat lagi qanun itu tidak serta terus diberlakukan karena masih membutuhkan koresksi dan evaluasi dari Mendagri. Jadi, biarlah di daerah Aceh pesisir lain pengesahan qanun tersebut disambut dan disikapi dengan suka cita, bahkan ada sekelompok warga mengibarkan bendera Aceh dan ada lagi yang konvoi mengarak bendera yang baru disahkan DPR Aceh tersebut. Waspada/Dede Juliadi Kasat Reskrim AKP Muhammad Firdaus ketika menujukan barang bukti sebilah parang dan mobil pick-up untuk mengangkut bawang merah yang digunakan para tersangka, Kamis (28/ 3)

Waspada/Dede Juliadi

KASAT Reskrim AKP Muhammad Firdaus ketika menujukan barang bukti sebilah parang dan mobil pick-up untuk mengangkut bawang merah yang digunakan para tersangka, Kamis (28/3)

Pelantikan Bupati Aceh Selatan 9-10 April TAPAKTUAN (Waspada) : Berkas usulan pengesahan dan pengangkatan Bupati Aceh Selatan terpilih periode 2013-2018, T Sama Indara-Kamarsyah kini masih dalam proses Kemendagri di Jakarta. Pihak DPRK Aceh Selatan menjadwalkan pelantikannya pada 9-10 April 2013 mendatang, sejalan dengan berakhirnya masa berlaku pelaksana harian (Plh) Bupati yang dijabat Sekdakab Harmaini. “Pelantikannya kita jadwalkan 9-10 April mendatang, sesuai habisnya masa jabatan Plh bupati yang dijabat Sekdakab Harmaini,” kata Wakil Ketua DPRK Aceh Selatan, Marsidiq, Kamis (28/ 3) di Tapaktuan. Sebelumnya pimpinan DPRK Aceh Selatan telah menyerahkan berkas usulan pengesahan dan pengangkatan Bupati Aceh Selatan terpilih, hasil Pilkada kepada Gubernur Aceh Zaini Abdullah untuk diteruskan kepada Kemendagri. “Berkas usulannya tak ada masalah lagi setelah keluarnya putusan Mahkamah Konstitusi dan Gubernur Zaini Abdullah telah menyampaikan kepada Mendagri,” tambah Marsidiq. Gubernur Aceh Zaini Abdullah memastikan pihaknya segera melantik Bupati Aceh Selatan, setelah keluarnya SK dari Mendagri. “InsyaAllah, secepatnya kita akan lantik bupati terpilih setelah SK-nya keluar,” ucap Zaini Abdullah. (b30)

Warga Semarang Tewas Di Subulussalam SUBULUSSALAM (Waspada): M Nur Abidin, 37, warga Semarang,JawaTengah,sekiraduapekanterakhirberjualanhiasanmushaf/ relif Islami di Kota Subulussalam, Aceh ditemukan tewas di teras bagian belakang salah satu mushalla setempat, Rabu (27/3). Saksi dan rekan kerja M Nur Abidin, Khodihul Khairi di Mushalla Assalam Desa Penanggalan Kecamatan Penanggalan, Subulussalam, Kamis (29/3) mengatakan, M Nur, punya dua istri dan empat anak berada di Jateng (Semarang Selatan dan Purbalingga). Ia baru sekira dua pekan terakhir berada di daerah ini untuk berjualan. Selama di Subulussalam, mereka menumpang nginap di salah satu warung warga tak jauh dari lokasi kejadian. Dikatakan, karena jualan mushaf tak lancar, M Nur dan Agus bekerja buat taman di mushalla itu. Sementara jualannya sebagian diserahkan kepada Khodihul. Tak ada keluhan korban sebelum kejadian. Namun jelang magrib, Nur ditemukan terbujur kaku di sana. “Saya laporkan ke Polsek Penanggalan, kemudian bersama beberapa orang personil polsek jenazah dibawa ke Puskesmas menggunakan ambulans,” terang Khodihul menambahkan, rencana dalam waktu dekat mereka kembali ke Pulau Jawa. Dikatakan, atas persetujuan pihak keluarga, jenazah M Nur dimakamkan di pekuburan umum Penanggalan, tak jauh dari lokasi kejadian. (b28)

Siswa Sekolah Belajar Kesiapsiagaan Bencana BANDA ACEH (Waspada): Sedikitnya 250 orang siswa Sekolah Dasar Negeri 2 Banda Aceh diajak untuk belajar kesiapsiagaan bencana, Kamis (28/3). Program kesiapsiagaan ini sudah masuk dalam kegiatan ekstrakurikuler sekolah. Ketua panitia pelaksana Muhammad Iqbal kepada wartawan mengatakan, acara yang berlangsung di Escape Building tersebut merupakan inisiatif yang dilakukan oleh sekolah untuk menindak lanjuti kegiatan sekolah siaga bencana. SD Negeri 2 Banda Aceh merupakan salah satu sekolah siaga bencana binaan Tsunami Disaster Mitigation and Reseach Center (TDMRC) Universitas Syiah Kuala Banda Aceh.“Pelajaran kebencanaan ini sudah masuk dalam kegiatan ekstrakurikuler sekolah,” ujar dia. Disebutkan, dengan adanya kegiatan tersebut, anak-anak di tingkat usia sekolah dasar tahu dan paham apa itu gedung penyelamatan (escape building) sehingga hal ini ada kelanjutannya. “Dalam kagiatan ini TDMRC menjelaskan tentang bencanabencana yang terjadi di sekolah seperti gempa bumi, tsunami dan kebakaran,” papar dia. Hingga kini, TDRMC Unsyiah sudah melakukan pembinaan terhadap 35 sekolah siaga bencana di Banda Aceh. Sekolah siaga bencana dari TDMRC ada sekitar 35 sekolah, SD 34 sekolah, SMP 7, SMA 2 dan 1 MAN. (b07)

Minta Bawang Merah Dilepas, Massa Datangi Bea Cukai Langsa

LANGSA (Waspada): Puluhan massa bersenjatakan parang menyerang Kantor Bea Cukai di Jalan Cut Nyak Dhien Kota Langsa menuntut agar bawang merah yang ditangkap pihak Bea Cukai, Rabu (27/3) kemarin segera dikembalikan kepada mereka, Kamis (28/3). Kapolres Langsa AKBP Hariadi melalui Kasat Reskrim AKP Muhammad Firdaus yang dikonfirmasi wartawan membenarkan penyerangan yang dilakukan puluhan massa tersebut. “Massa yang berjumlah lebih kurang 30 orang dengan bersenjatakan parang sengaja mendatangi kantor Bea Cukai Langsa menuntut bawang merah yang ditangkap pihak Bea Cukai segera dikembalikan. Karena mereka mengklaim bahwa barang itu milik mereka. Dalam kaitan itu mereka berargumen sembari juga mencontohkan bahwa banyak barang-barang tangkapan Bea Cukai bisa

dilepas begitu saja kenapa punya kami ditahan,” kata mereka. Lalu, karena tuntutan mereka tidak digubris pihak Bea Cukai akhirnya mereka marah dan menyerang serta meminta paksa kunci gudang tempat barang bukti bawang sitaan disimpan di bawah ancaman parang. Lalu, melihat massa yang semakin beringas dan takut akan terjadi hal yang tidak diinginkan, petugas Bea Cukai menyerahkan kunci gudang. Setelah itu, mereka langsung menuju gudang bawang merah tepatnya di belakang kantor Bea Cukai dan langsung memarkirkan truk dan memuat bawang tersebut. Akan tetapi pada saat mereka mengangkut bawang merah ke atas truk, pihak Polres Langsa langsung menangkap dan mengamankan massa, yang selanjutnya dibawa ke Polres Langsa. Menurut Firdaus, dalam penyerangan itu petugas mengamankan 21 orang, sementara 19 orang lain dilepas kembali karena mereka merupakan buruh galian kabel upahan yang disewa untuk mengangkut bawang tersebut. “Namun, ke-19 orang ini tetap kita jadikan saksikan, dibebaskan setelah kita

lakukan pemeriksaan,” katanya. Sedangkan, dua orang lagi ditetapkan sebagai tersangka, yang diduga menjadi otak di balik penyerangan Kantor Bea Cukai ini. Kedua tersangka yakni, SM, 33, warga Alue Lhok, Kec. Peureulak Timur, Aceh Timur, yang merupakan pemilik bawang tersebut dan Z, 32, warga Desa Sematang Keude, Peureulak Timur, Aceh Timur. Dari penyerangan itu, petugas mengamankan satu unit truk fuso. BL 9204 ZA, satu pickup Isuzu Fanther BL 8168 AJ berserta muatan bawang merah hasil rampasan yang diambil dari gudang Bea Cukai lebih kurang 500 kg. Kemudian sebilah parang yang ditemukan di TKP. “Kedua tersangka dikenakan Pasal 365, Ayat 1 dan 2 KUHP tentang pencurian dengan kekerasan dengan ancaman hukuman 9 tahun penjara,” katanya. Dalam kesempatan itu, Firdaus menyayangkan lambannya pihak Bea Cukai melaporkan penyerangan itu. “Saya sempat menerima telepon dari Kepala Bea Cukai meminta aparat untuk pengamanan di BC terkait ditangkapnya bawang merah di perairan Aceh. (m43)

Hukum Cambuk Harus Ditegakkan LANGSA (Waspada): Kadis Syariat Islam kota Langsa Ibrahim Latif mengatakan, hukum cambuk harus ditegakkan. Siapapun yang melakukan pelanggaran terhadap Qanun Syariat Islam harus dihukum sesuai dengan hukum qanun syariat Islam, yaitu harus dicambuk di depanumum.Agarmembuatjera para pelaku dan menjadi i’tibar, pelajaran kepada yang lain. Hal itu dikatakan Ibrahim Latif, dalam khutbah Jumatnya di Masjid At Taqwa Kodim 0104 Aceh Timur, Jumat (29/3). Lebih lanjut Ibrahim Latif mengatakan, Aceh sudah menjalankan Syariat Islam, maka jangan mempermaikan hukum Allah. Kepada pelaku pelanggar Syariat Islam harus dicambuk sesuai perintah qanun. Baik yang melanggar Qanun No.11

tahun 2002 tentang ibadah, aqidah dan Syiar Islam, qanun nomor 12 tahun 2003 tentang khamar dan sejenisnya, qanun nomor 13 tahun 2003 tentang maisir (perjudian), dana qanun nomor 14 tahun 2003 tentang khalwat/ mesum. Maka mereka yang melanggar qanun-qanun itu harus dihukum cambuk. Ini supaya tegaknya syariat. Hukuman cambuk disebutkan secara jelas di dalam qanun Syariat Islam. Bagi yang tidak melaksanakan shalat Jumat tiga kali berturut-turut tanpa uzur syar’i dapat dicambuk 3 kali di depan umum atau dipenjara 6 bulan (qanun nomor 11 thn 2002). Mengonsumsikan minuman khamar dan sejenisnya dapat dicambuk 40 kali di depan umum. Melakukan perbuatan maisir (perjudian) dapat dicam-

buk 12 kali di depan umum (qanun nomor 13 tahun 2003 tentang maisir (perjudian). Melakukan perbuatan khalwat (mesum) dapat dicambuk 9 kali di depan umum. “Kita mengharapkan kepada semua pihak untuk mendukung penegakan syariat. Wujud dari penegakan hukum Syariat Islam adalah hukum cambuk. Kalau hukum tidak dilaksanakan, berarti kita tidak menjalankan amanah qanun syariat yang disahkan oleh pemerintah Aceh. Syariat Islam bukan untuk Lips service saja, atau bukan untuk bahan pidato saja, tetapi harus dilaksanakan. Siapapun yang melakukan pelanggaran terhadapSyariatIslam,harusdihu-kum dengan hukum syariat, yaitu dihukum cambuk, sesuai qanun yang berlaku,” katanya. (m43)

SPBU Di Singkil Tak Miliki Genset SINGKIL (Waspada): Konsumen yang mengantre untuk mendapatkan BBM di SPBU Lipat kajang, Kecamatan Simpang Kanan, Aceh Singkil, Rabu (27/3) sore kecewa karena SPBU tidak beroperasi dampak aliran listrik PLN padam, sementara SPBU tidak memiliki mesin genset. Informasi yang dihimpun,

Rabu (27/3) di sana mengatakan, para konsumen baik pengguna sepedamotor dan kendaraan lainnya yang telah mengantre beberapa saat merasa kecewa karena tidak bisa membeli bahan bakar minyak (BBM) yang dibutuhkan karena SPBU tidak beroperasi karena suplai listrik PLN padam, sementara SPBU tidak memiliki generator

listrik (Genset) sebagai mesin cadangan untuk memperlancar operasional fasilitas umum itu. Kekecewaan konsumen terlihat dengan cara meninggalkan SPBU tersebut, solusinya sejumlah pengguna sepeda motor membeli bensin eceran di seputar kawasan SPBU dengan harga lebih mahal Rp.6 000 per liter. (b27)

Dua Tahun Bercerai, Kembali Serumah Ditangkap WH LANGSA (Waspada): Mantan sepasang suami-istri, warga gampong Alue Pineung Kecamatan Langsa Timur yang sudah dua tahun bercerai kembali hidup serumah tanpa nikah yang sah, Kamis (28/3) malam digerebek masyarakat setempat dan nyaris diramaikan massa. Untuk selanjutnya kedua pasangan itu dijemput WH dan digelandang ke kantor Dinas Syariat Islam kota Langsa. Menurut keterangan masyarakat, E, 40 dan L, 35, sudah dua tahun lalu bercerai, tiba-tiba dua minggu lalu mereka sudah hidup bersama kembali. Masyarakat telah memperingatkannya, namun mereka tidak peduli. Kadis Syariat Islam Langsa Ibrahim Latif yang dihubungi wartawan mengatakan, kedua anak manusia itu yang sudah memiliki dua anak mengaku sudah becerai dua tahun lalu dan mengaku dua minggu lalu sudah hidup bersama lagi. Mereka mengaku salah dan sekarang mereka berjanji menikah kembali. (m43)

Waspada/Tarmizi Ripan

SEJUMLAH warga mengantri di SPBU Lipat Kajang untuk mendapatkan BBM, namun operasional SPBU terhenti karena pasokan listrik PLN padam, SPBU disebutkan tidak memiliki genset. Foto direkam, Rabu (27/3)

Namun yang jelas, masyarakat Agara tidak mau gegabah dan ikut-ikutan bereuforia terhadap hasil kerja DPRA mengesahkan qanun tentang bendera Aceh tersebut. “Daripada membahas dan ikut mengibarkan bendera Aceh, apalagi sampai berkonvoi mengarak bendera tersebut, lebih baik bekerja di sawah dan di ladang ataupun mencari nafkah untuk keluarga,” ujarAnwar, warga Kutacane lainnya. Sebab itu, wajar saja bila pengesahan qanun tentang bendera Aceh itu disikapi dingin oleh warga dan tidak menjadi bahasan di berbagai tempat keramaian, mulai dari warug kopi sampai pada tempat pertemuan di tingkat desa, kecamatan maupun pertemuan warga di tingkat kabupaten. “Ikuti saja dahulu prosesnya menurut aturan hukum yang berlaku di NKRI ini, meski sudah disahkan DPR Aceh, bukan serta merta qanun tersebut langsug berlaku, tapi masih membutuhkan koreksi dari Mendagri, jadi kita tunggu saja apa kata pemerintah pusat nantinya,” ujar MS Selian, tokoh pemuda di Agara. (b26)

Penolakan Pemekaran ALA Hanya Isapan Jempol KUTACANE (Waspada) : Isu penolakan pemekaran Provinsi ALA yang mengatasanamakan masyarakat Aceh Tenggara ,yang disampaikan kepada gubernur beberapa hari yang lalu, ternyata hanya isapan jempol. Pasalnya, kehadiran SB yang mengaku mewakili masyarakat Aceh Tenggara untuk menolak pemekaran Aceh Leuser Antara (ALA), hanya akal-akalan saja dan tak lebih untuk mencari popularitas di tengah maraknya pro kontra tentang pengesahan bendera Aceh oleh DPR Aceh. “Ini jelas merupakan pemanfaatan situasi dan mencari sensasi serta popularitas semata,” ujar Nawi Sekedang, salah seorang tokoh pemuda dan tokoh masyarakat Agara, Jumat (29/3) menyikapi surat yang disampaikan SB yang mengaku sebagai warga Aceh Tenggara kepada Gubernur Aceh Zaini Abdullah. Sampai sekarang, warga merasa kebingungan, masalahnya hanya beberapa orang saja yang kenal dengan SB yang mengaku mewakili tokoh masyarakat Agara, bahkan warga Bumi Sepakat Segenep sempat terkecoh dan mengira

jika SB tersebut mantan Wakil Bupati Agara. Namun setelah ditelusuri lebih jauh, SB yang mengatakan mewakili masyarakat Agara untuk menolak ALA kredibilitas dan kapabilitasnya sangat-sangat diragukan, bahkan ditengarai hanya mencari keuntungan pribadi sepert menangguk untung di air keruh. Bahkan, sampai sekarang warga tak tahu di mana keberadaan SB, sebagian ada yang mengatakan sejak 2008 lalu tak lagi menetap di Agara, namun telah pindah ke Subulussalam dan tak terdaftar lagi sebagai penduduk Agara. Menurut beberapa warga di seputaran Kota Kutacane, urai Nawi yang juga Ketua Asosiasi Kepala Desa se- Kecamatan Bambel tersebut, sebelum hengkang dan menghilang tanpa khabar berita dari Agara, SB hanya berjualan emas kecil-kecilan di Pasar Inpres Kutacane. Sebab itu, warga Agara merasa heran mewakli organisasi apa, kelembagaan apa SB jadi kebabalasan mengatakan mewakli masyarakat Agara menolak pemekaran ALA, sedangkan beliau pun sudah pinah dari Kutacane dan tak terdaftar lagi sebagai penduduk Agara. (b26)

35 Kasus Narkoba Menjamah Pelajar LHOKSEUMAWE (Waspada) : Pada 2012, Polres Lhokseumawe telah menemukan sebanyak 35 kasus narkoba dengan penggunanya bukan hanya kalangan orang dewasa saja, juga mulai menjamah pelajar sebagai pelakunya. Hal itu diungkapkan Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kabag Ren Polres Lhokseumawe AKBP Budiman, Jumat (29/3) terkait perkembangan kasus narkoba di tengah masyarakat selama 2012 – 2013. Budiman menyebutkan, saat ini kasus narkoba sudah menjamah ke segala sektor, bukan hanya kalangan orang dewasa saja yang menjadi penggunanya. Bahkan saat ini narkoba juga sudah menjamah kalangan pelajar, baik SMA maupun SMP. Pada 2012, Polres Lhokseumawe menemukan 35 kasus narkoba, di antaranya jenis sabusabu lebih banyak jumlah pemakainya daripada pengguna ganja di Kota Lhokseumawe. Dirincikan narkoba jenis sabu-sabu ditemukan sebanyak 22 kasus, sedangkan untuk ganja ditemukan sebanyak 13 kasus. Sedangkan dari 22 kasus pengguna narkoba jenis sabu-sabu

tersebut, ternyata penggunanya bukan hanya kaum adam saja, tapi para kaum hawa juga ditemukan sebanyak empat orang dan satu orang anak-anak juga ikut menggunakan. Sementara untuk pengguna narkoba jenis ganja ditemukan 14 orang berjenis kelamin lakilaki dan dua perempuan, sementara pada kasus narkoba jenis ganja ini tidak ditemukan pada anak-anak. “Tidak menutup kemungkinan ada lagi yang lainnya,” ujar AKP Budiman. Pengguna narkoba jenis sabu-sabu paling banyak ditemukan pada kalangan wiraswasta, yaitu sebanyak 22 orang, kalangan mahasiswa tiga orang, satu orang ditemukan pada kalangan ibu rumah tangga, pelajar dan narapidana. Di sisi lain untuk narkoba jenis ganja, juga paling banyak ditemukan pada kalangan wiraswasta, yaitu sebanyak sembilan orang, kalangan mahasiswa hanya ditemukan tiga kasus, sedangkan dua kasus ditemukan pada kalangan ibu rumah tangga dan nelayan. “Bahkan di dalam Lapas Narkoba bisa bermain,” tutur Budiman. (b16)

Sayuti Abubakar: Hukun Mati Pemerkosa Diana JAKARTA (Waspada): Kasus pemerkosaan dan pembunuhan terhadap bocah Diana di Aceh menarik perhatian pengacara Sayuti Abubakar yang menetap di Jakarta. Menurut penasihat hukum ini, pelaku itu layak mendapat hukuman maksimal yakni hukuman mati. “Pelaku mesti dijerat dengan pasal pembunuhan berencana yaitu pasal 340 KUHP, di mana ancaman maksimalnya adalah hukuman mati dan seumur hidup. Dalam kasus Diana juga ada pelaku yang masih kategori anak-nak karena berusia 17 tahun,” ungkap Sayuti dari Kantor Pengacara Sayuti Abubakar & Partners Law Firm di Jakarta Sayuti menerangkan, menurut UU No.23 Tahun 2002 Pasal 81 Ayat 1 yakni setiap orang yang disengaja melakukan kekerasan atau ancaman kekerasan memaksa anak melakukan persetubuhan dengannya atau dengan orang lain, dipidana dengan pidana penjara paling lama 15 tahun dan paling 3 tahun dan denda paling banyak Rp300 juta dan paling sedikit Rp60 juta. “Ancaman maksimal 15 tahun kepada pelaku karena tidak ada pengaturan khusus dalam UU Perlindungan Anak mengenai pemidanaan

terhadap pelaku pemerkosaan sekaligus pembunuhan secara mutilasi,” tambahnya, Jumat (29/3) di Jakarta. Menyangkut satu pelaku yang masih berkategori anak-anak, Sayuti menyitir UU Perlindungan Anak Pasal 16 Ayat 1 setiap anak berhak memperoleh perlindungan dari sasaran penganiayaan, penyiksaan, atau penjatuhan hukuman yang tidak manusia. Maka pelaku yang masih anak-anak tersebut wajib juga kita lindungi bersama-sama karena masih bisa dibina. “Yang harus dihukum berat adalah A karena pelaku kemungkinan telah mempengauhi Hasbi yang di bawah umur utk melakukan kejahatan tersebut. Kasus ini mesti menjadi pelajaran bagi kita semua agar tidak terulang lagi,” papar Sayuti pengacara kelahiran Peusangan, Kabupaten Bireuen ini. Sebagiamana diketahui, A, 28, dan H, 17, ditangkap polisi setelah memperkosa dan membunuh Diana, warga Peulanggahan, Kecamatan Kuta Raja, Aceh Besar. Korban dilaporkan hilang pada Selasa (19/3) malam dan ditemukan meninggal dunia pada Rabu (27/3) di kawasan Peulanggahan. (cmh)

Nelayan Keluhkan Kuala Beuracan Dangkal MEUREUDU (Waspada) : Ratusan nelayan di Kecamatan Trienggadeng dan Meureudu, Kabupaten Pidie Jaya, mengeluhkan kondisi kuala (Muara) Krueng Beuracan yang semakin dangkal sejak puluhan tahun. Sementara hasil tangkapan mereka juga sering dipermainkan para toke bangku alias agen penampung (tengkulak). Akibat kondisi kuala dangkal dan bantaran sungai ambruk, menyebabkan para nelayan sulit saat mendaratkan ikan. Demikian ungkap beberapa nelayan, Jumat (29/3). “Sejak bertahun-tahun para nelayan mengeluhkan kondisi kuala yang semakin dangkal. Jika para nelayan hendak mendaratkan ikan terpaksa dengan cara mentransit boat alias perahu yang lebih kecil atau menunggu pasang naik,” kata Muhammad, nelayan setempat. Kepala Mukim Meureudu Dalam Muhammad Sulaiman mengatakan, selama ini para nelayan cukup sabar dengan kondisi memprihatinkan, nasib mereka benar-benar telah didiskrimisasipihakpemerintahdaerahsetempat. Buktinya, kata dia, untuk Kuala Krueng Meureudu pemerintah daerah selalu merespon bangunan infrastruktur yang dibutuhkan. Sementara untuk Kuala akrueng Beuracan selalu luput dari perhatian. “Nelayan berharap

diperhatikan, sebab nelayan di Kuala Krueng Beuracan juga warga Pidie Jaya dan Aceh,” tuturnya. Mengingat kondisi memprihatinkan itu, nelayan setempat meminta instansi terkait mengeruk mulut Kuala Beuracan. Para nelayan sudah sering meminta pemerintah setempat mengeruk kuala tersebut. Kadis Kelautan dan Perikanan (DKP) Kabupaten Pidie Jaya, Jailani, mengatakan, pihaknya tidak pernah mendiskriminasi nelayan di Pidie Jaya. Namun, untuk penggalian Kuala Beuracan akan ditangani melalui dana APBN. “Termasuk pengerukan dan pembangunan Break Water sekaligus pembangunan tanggul penahan sungai atau kuala. Kami minta agar mereka bisa bersabar,” katanya. Sementara ribuan nelayan di Kabupaten Pidie dan Kabupaten Pidie Jaya hingga kini masih saja mengeluhkan fasilitas Pusat Pendaratan Ikan (PPI) belum lengkap sehingga harga ikan sering dipermainkan agen penampung. Abdullah mengaku penghasilan nelayan Pidie dan Pidie Jaya masih terbatas. Ketika hasil laut melimpah, nelayan menjual ikan ke luar daerah yang telah memiliki tempat penyimpanan, tentunya juga dengan harga sangat murah sehingga merugikan para nelayan. (b09)


WASPADA Sabtu 30 Maret 2013

Pemerintah Aceh-UNICEF Teken Rencana Kerja Multitahunan

BNI Renovasi Masjid Kampus Unigha SIGLI (Waspada): Bank Negara Indonesia (BNI) (Persero) tbk wilayah Medan, Sumatara Utara memberikan bantuan biaya renovasi Masjid kampus Unigha, Glee Gapui, Sigli senilai Rp24 juta. Bantuan itu diserahkan pimpinan cabang BNI Sigli H Narsito melalui Rektor Unigha Sigli, Prof Bansu I Ansari MPd, di Gedung Delapan Sagoe, Kamis (28/3). Rektor Unigha Sigli, Prof Bansu I Ansari mengungkapkan sebelumnya PT BNI telah juga telah menyerahkan bantuan dana senilai Rp69 juta untuk renovasi mesjid tersebut. Dana tahap awal itu sudah digunakan untuk merehap bangunan bagian bawah masjid itu. Direncanakan dana senilai Rp24 juta yang baru diterima itu akan digabung dengan dana sumbangan mahasiswa baru untuk renovasi bagian atas gedung. Prof Bansu mengungkapkan, bantuan ini diperolehnya berkat kerja sama antara Unigha dengan BNI yang sudah beberapa tahun terakhir ini terjalin dengan baik. Diharapkan dengan adanya bantuan dana tersebut aktifitas ibadah mahasiswa dan civitas akademika akan terlaksana dengan baik di masjid tersebut. Pimpinan Cabang BNI Cabang Sigli Narsito dalam kesempatan itu berharap pihaknya dapat mempererat lagi kerja sama dengan Unigha Sigli. (b10)

Usut Kasus Perampasan Tanah TANAH JAMBO AYE (Waspada): Asmawati, guru dari Gampong Matang Drien, Kecamatan Tanah Jambo Aye, Aceh Utara mendesak kepolisian dan kejaksaan Aceh Utara untuk mengusut kasus perampasan terhadap tanah rumah miliknya. Dua kasus yang dilapor ke Polres Aceh Utara, hanya kasus perusakan baru disidangkan pengadilan. KArmawati, 37, Kamis (28/3) mengatakan, pada 5 Juni 2012 telah melaporkan dua kasus ke Polres Aceh Utara. Pertama perusakan satu unit rumah semi permanen dengan kerugian Rp300 juta, dan kedua perampasan tanah rumah dengan kerugian Rp150 juta. Asmawati menambahkan dalam kasus ini polisi menetapkan Sofyan Gadeng sebagai tersangka, berikut statusnya menjadi terdakwa setelah dilimpahkan ke Pengadilan Negeri Lhoksukon. Tambahnya, kasus ini juga terlibat oknum kepolisian dari polres setempat bernisial RD. Kemudian kasus kedua, Asmawati mendesak penyidik Polres Aceh Utara agar mengusut tuntas. Dan, dia menilai ada misteri di balik kasus ini karena terlibat oknum polisi. Kasus perampasan selain terlibat Sofyan dan RD, juga melibatkan pembeli, yaitu MH. Maka untuk itu, Asmawati mendesak penyidik memeriksa RD dan MH. Kapolres Lhoksukon AKBP Farid BE melalui Kasat Reskrim AKP Ahmad Fauzi mengatakan, kedua kasus ini telah p21 (lengkap), dan sudah dilimpahkan ke kejaksaan. (cmk)

Forsi Asokaya Bantu Pengungsi Rohingya BIREUEN (Waspada): Sejumlah pengurus dan anggota Forum Silaturrahmi (Forsi) Asokaya Bireuen menyerahkan bantuan kepada muslim Rohingnya, Myanmar yang terdampar ke pengairan Aceh Utara beberapa waktu lalu dan kini ditempatkan di kantor bekas imigrasi Aceh Utara, Desa Punteut. Ketua Forsi-Asokaya Eropa, Tarmizi AG, Kamis (28/3), menyatakan, bantuan tersebut disalurkan pihaknya yang ikut didampingi para anggota Forsi Asokaya di Bireuen dan Keuchiek Bandar Bireuen, Adnan Adam, Minggu (24/3), berupa barang bahan pangan di antaranya beras, telur dan sejumlah bahan keperluan lainnya. “Bantuan yang kami salurkan itu merupakan bantuan masyarakat muslim setelah kami menggelar rapat kordinasi dengan badan ketahanan pangan,” katanya. (cb02)

BKPP Bener Meriah Uji Publik 1.098 Honorer REDELONG (Waspada): Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Kabupaten Bener Meriah, mengumumkan 1.098 tenagahonorerdaerahKatagoriII(KII)yangterdaftardalamDatabase Calon Pegawan Negeri Sipil (CPNS) pada Kamis (28/3). “Pengumuman tersebut bertujuan untuk uji publik terhadap nama-nama yang telah terdaftar, apabila ada warga yang mengetahui nama tercantum tidak memenuhi persyaratan sebagaimana dalam peraturannya dipersilakan mengklarifikasi dengan membawa bukti ke kantor BKPP Bener Meriah,” kata Kepala BKPP Abdullah Husni di ruang kerjanya. Dijelaskan Abdullah Husni, 1.098 tenaga honorer yang ada dalam data Katagori II tersebut telah masuk dalam database CPNS, sebelum dilakukan verifikasi akhir untuk diangkat sebagai PNS, Badan Kepegawaian Nasional (BKN) nomor E.26-30/v.3386/99 tertanggal 10 Desember 2012. Di hadapan Sekretaris dan Kabid Formasi Tenaga Kepegawaian pada kantor BKPP Bener Meriah, Abdullah Husni menyatakan bahwa nama-nama yang terlampir dalam salinan surat keputusan dari BKN merupakan hasil dari data verifikasi yang dilakukan Kantor Inspektorat daerah setempat dua tahun lalu. “Jadi data ini bukan kemaren dimasukkan, akan tetapi telah dua tahun lalu,” ucap Kepala BKPP Bener Meriah tersebut. (b33)

Warga Harap Jalan KareungPulo Naleung Diaspal BIREUEN (Waspada):Warga Desa Pulo Naleung, Kec. Peusangan dan warga Desa Kareung, Kec. Kuala, Bireuen, mengharapkan jalan desa mereka segera diaspal, karena jalan yang dilakukan pengerasan beberapa waktu lalu, kini berdebu sehingga yang rumahnya di pinggir jalan kewalahan dengan debu. Sekdes Kareung Mulyadi, Kamis (28/3) menuturkan warga desanya banyak yang melaporkan kewalahan dengan debu yang bersumber dari jalan, dan mereka mengharapkan supaya jalan ini segera diaspal. Kadis Bina Marga, Cipta Karya Perumahan Rakyat Fadli melalui Kabid Pembangunan Jalan dan Jembatan, Rita Hayati mengatakan, untuk melanjutkan pengaspalan jalan Kareung ke Pulo Naleng itu, sekarang pihaknya kita sekarang ini sedang membuka proses pelelangan pelaksanaan lanjutan pengaspalan jalan tersebut sepanjang 1 km dan pembangunan taludnya bersumber dari dana otsus Rp1,5 miliar. “Setelah proses pelelangan, maka pengasplan jalan itu akan dilaksanakan Mei,” katanya. (cb02)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu)

Garuda Indonesia

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Berangkat (flight, tujuan, waktu)

10:40 16:00

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:20 16:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:00

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:30


FY 3400 Penang*



Waspada/Arman Konadi

PERSONIL Polda Aceh melakukan prosesi upacara saat mengantar jenazah AKP Suhardiman, Kasubbag Renmin Dit Sabhara Polda Aceh saat dimakamkan di pemakaman keluarga, Kamis (28/3)

Kerusakan Hutan KEL 1 Juta Hektare TAKENGEN (Waspada): Sekitar 1 juta hektare hutan di Kawasan Ekosistem Leuser (KEL) diprediksi alami kerusakan. Hal ini diduga akibat pemerintah Aceh mengabaikan pasal 150 UU No.11 tahun 2006 tentang tata kelola pengawasan terhadapa ekosistem Leuser. “Dari 2,6 juta hektare luas keseluruhan KEL di Aceh- Sumut, 1 juta hektare di antaranya diprediksi telah rusak. Ini diperparah sejak pemerintah Aceh mengabaikan UU pasal 150 dan ‘membubarkan’ Badan Pengelola (BP) KEL Aceh pada 29 Oktober 2012 lalu,” jelas Fauzan Azima, pengamat lingkungan, Jumat (29/3) di Takengen. Menurut mantan Kepala BP KEL Aceh ini, potensi tindak kerusakan hutan sangat sulit dicegah seiring program pemerintah Aceh yang melanjutkan tata kelola pembangunan di se-

jumlah bidang. Di antaranya seperti fasilitas umum, pengolahan tambang dan bertambahnya areal perkebunan. “Saat ini bagian hutan di KEL telah banyak yang dipugar, di antaranya untuk peningkatan infrastruktur jalan, pelebaran kebun dan pengelolaan tambang. Secara tidak langsung hal ini telah merusak pelestarian hutan,” paparnya. Selain itu, lanjutnya, dengan dibubarkannya BP KEL Aceh yang berfungsi melakukan pengawasan (monitoring), upaya pelestarian dan pengelolaan telah menyebabkan kondisi hutan menjadi ‘liar. “Bukan saja hutannya yang rusak, namun saya kira banyak satwa maupun tumbuhan langkanya terancam punah akibat adanya aksi perburuan liar di sana. Bila kondisi ini terus dibiarkan, kelak akan berimbas bagi kehidupan anak cucu,” ungkapnya. Dia juga menyebutkan, sebelumnya, ketika BP KEL Aceh masih beroperasional sebagai badan pengelolaan untuk ke-

lestarian, pemantau dan pengawasan, pihaknya telah melakukan upaya guna menekan angka kerusakan dan perburuan liar di sana. “Tidak bisa dipungkiri, kendati aksi perambahan hutan maupun perburuan kerap berlansung di seputar kawasan ekosistem Leuser, namun peran BP KEL Aceh saat itu mampu mengurangi aksi liar di sana. Bahkan jumlahnya keruskan hutan juga masihrelatifkecil.Untukdisepanjang 2007-2008 kerusakan hutan di KEL hanya berkisar sekitar 58.000 hektare saja,” paparnya. Mengatasi persolan kerusakan KEL Aceh, hendaknya pemerintah Aceh dapat kembali memberlakukan pasal 150 UU No.11 tahun 2006 yang menyatakan: pemerintah pusat (Indonesia) bersedia memberikan kewenangan kepada pemerintah Aceh di dalam pengelolaan ekosistem Leuser yang terdapat di wilayah Aceh serta melindungi, menjaga, melestarikan, merehabilitas fungsi wilayah dan memanfaatkan dengan sebaik-baiknya. (cb09)

Mantan Bupati Pidie Tutup Usia SIGLI (Waspada): Mantan Bupati Pidie AbdullahYahya, Kamis (28/3) pukul 14:30 meninggal dunia di Rumah Sakit Umum Zainoel Abidin (RSUZA) Banda Aceh. Armarhum tutup usia pada umur 68 (Juli 1945Maret 2013) dalam perawatan tim medis di ruang Gurutee II. Jasad mantan bupati Pidie priode 2000-2006 itu dikebumikan di komplek perkuburan keluarga di Desa Paloh, Kemukiman Ujong Rimba, Kecamatan Mutiara Timur, Pidie, Kamis (28/ 3) malam. Suami Khairiah Adam ini meninggalkan tiga anak dan lima cucu. HasanYahya (adik kandung)

Mantan Bupati Pidie Abdullah Yahya mengatakan armarhum Abdul-

lah Yahya meninggal dunia karena sakit parginson yang sudah lama diderita. Sebelum meninggal dunia armarhum sedang dalam perawatan tim medis RSUZA selama dua pekan. “Beliau dikebumikan di pekuburan keluarga, karena itu wasiatnya,” kata Hasan Yahya. Ratusan kerabat hadir pada acara prosesi pemakaman mantan Bupati Pidie Abdullah Yahya. Antara lain, mantan wakil bupati Jalaluddin Harun, mantanwakilBupatiPidieNazirAdam, mantan Kadis Kehutanan dan Perkebunan Pidie M Amin Affan danpuluhanpejabatPidielainnya serta handaitaulan. (b10)

Gayo Lues Kehilangan Putra Terbaik BLANGKEJEREN (Waspada) : Bagai disambar petir di siang hari. Berita kepergian Hasi, menghadap Sang Pencipta begitu mengejutkan. Masih hangat berita saat Kadis Perindustrian Perdagangan Koperasi dan UKM Gayo Lues ini dipercayakan akan mendongkrak industri dan perdagangan di tahun 2013 ini. Almarhum berpulang ke pa-ngkuan Allah SWT, Jumat (29/3) sekira pukul 04:00 di RSUD Sangir, setelah bergelut dengan penyakit yang memang sebelumnya telah lama ia derita ( jantung, darah tinggi dan kolesterol). Berita inipun menghentak jajaran Pemerintah Kabupaten Gayo Lues. Bupati Gayo Lues Ibnu Hasim melalui Kabag Humas Setdakab Gayo Lues, Syafruddin ikut terhenyak begitu almarhum telah berpulang. “Saya pribadi dan keluarga serta jajaran Pemkab Gayo Lues, turut berduka cita sedalam-dalamnya. Kembali Gayo Lues kehilangan putra terbaik. Beliau adalah contoh birokrat yang penuh dedikasi, selamat jalan Pak Hasbi,” kata Syafruddin. Almarhum sendiri saat menjabat sebagai Kepala Disperindagkop Gayo Lues selama 3 tahun pada periode 2010-2013, begitu ramah dengan bawahannya. Tak jarang, almarhum bekerja hingga larut malam ditemani para stafnya di bagian Tata Usaha. Birokrat handal yang dilahirkan di Kutapanjang, 21 September 1963 ini, memiliki pengalaman yang bervariasi di

Waspada/Jasvira Sautisa

ALMARMAHUM Hasbi bersama istri Jumiati ketika pembukaan acara Dekranasda se- Aceh di Gayo Lues beberapa bulan lalu lingkungan pemerintah, baik sebelumnya di Kabupaten induk Aceh Tenggara maupun di Gayo Lues, setelah dimekarkan pada 2002 lalu, dengan berbagai jabatan strategis yang pernah diembannya. Almarhum yang memiliki latar belakang pendidikan yang tidak jauh dari dunia yang digelutinya, setelah manamatkan SMA Negeri 1 Kutacane tahun 1982. Hasbi, memilih untuk melamar di APDN (Akademi Pemerintahan Dalam Negeri) Banda Aceh sebuah institut/lembaga perguruan Tinggi Akademi yang memproduksi lahirnya para calon-calon kepala pemerintahan (lulusan 1986). “Posisinya sebagai birokrat menjadikan almarhum sebagai pemimpin yang powershif sehingga diakhir kariernya Almarhum tercatat sebagai Kadis terbaik Gayo Lues. Kami sangat kehilangan, selamat jalan pak Sebi, “ tutur Syafruddin lagi di rumah duka, Kutapanjang Kecamatan Kutapanjang Gayo

Lues. Sebi, nama panggilan akrab almarhum adalah orang yang cukup berjasa terhadap pemekaran Gayo Lues baik secara inspirasi maupun materi. Setelah Gayo Lues dimekarkan dari Aceh Tenggara 2002, HasbiE dipercayakan oleh almarhum Pj Bupati Gayo Lues Ali Kasim sebagai Kabag Ekonomi pada Setdakab Gayo Lues selama empat tahun. Dan, pada 2007 dengan kepemimpinan Ibnu Hasim –Firdaus, Hasbi dipercayakan menjabat sebagai Kepala Polisi Pamong Praja (Satpol PP). Ia sempat menduduki posisi itu selama 4 tahun, selanjutnya di 2010 hingga ajal menjemput sebagai Kadis Perindustrian dan Perdagangan Gayo Lues. Kini almarhum telah meninggalkan tiga anak, dua lelaki satu perempuan dari istri yang dicintainya. Jenazahnya disemayamkan usai shalat Jumat di Kecamatan Kutapanjang. Jasvira Sautisa

BANDA ACEH (Waspada): Komitmen UNICEF untuk membantu memenuhi hak-hak anak melalui perbaikan sistem dan peningkatan kapasitas di bidang pendidikan, kesehatan, dan kesejahteraan rakyat di Aceh, diwujudkan melalui penandatanganan rencana kerja multitahunan untuk periode 2013 - 2014. Penandatanganan rencana kerja tersebut dilakukan Kepala Bappeda Aceh Abubakar Karim dan perwakilan Unicef Banda Aceh Umar Bin Abdul Azis di kantor Bappeda Aceh, Kamis (28/3). Kepala Bappeda Abubakar Karim menyebutkan bahwa momentum penandatanganan rencana kerjasama ini sangat penting bagi masa depan anak-anak Aceh. “Sumber daya manusia yang sehat, cerdas, dan produktif merupakan aset yang sangat berharga bagi pembangunan Aceh,” katanya ketika memberikan sambutan. Menurut dia, peningkatan kualitas sumber daya manusia dalam pencapaian tumbuhkembang optimal sangat ditentukan kualitas perkembangan anak selama periode usia dini, yang diukur dari meningkatnya derajat kesehatan dan status gizi, kecerdasan dan keceriaan, pematangan emosional dan spiritual, dan perlindungan dari segala bentuk kekerasan. Oleh sebab itu, untuk menjamin pemenu-

han hak tumbuh kembang anak usia dini, diperlukan upaya peningkatan kesehatan, gizi, perawatan, pengasuhan, perlindungan, kesejahteraan, dan rangsangan pendidikan yang dilakukan secara simultan, sistematis, menyeluruh, terintegrasi, dan berkesinambungan Perwakilan UNICEF Banda Aceh, Umar Bin Abdul Aziz, menyampaikan bahwa realisasi rencana kerja ini akan ditinjau setiap dua tahun dan disesuaikan dengan kemajuan dan perubahan yang terjadi di lapangan. “Pemerintah Aceh dan Unicef akan melakukan pemantauan bersama untuk mempelajari hasil dan dampak dari kerjasama ini,” katanya. Umar juga berharap kemitraan ini dapat menjadi model kolaborasi yang positif dan efektif antara pemerintah dan pihak luar sehingga hasilnya akan memberi kontribusi nyata dalam pencapaian tujuan pembangunan yang telah ditetapkan pemerintah Aceh. Penandatanganan rencana kerja multitahunan ini juga merupakan upaya menguatkan komitment Pemerintah Aceh dan Unicef untuk bahu membahu dalam upaya akselarasi pencapaian target-target MDGs. Untuk mendukung program ini, UNICEF menyediakan dana kurang lebih 1,8 juta USD atau sekitar Rp18 miliar. (b04)

HMTI Unsyiah Gelar i-SAT 2013 BANDA ACEH (Waspada): Himpunan Mahasiswa Teknik Industri (HMTI) Fakultas Teknik Unsyiah, menggelar serangkaian kegiatan yang dipaket dalam acara i-SAT 2013 di Balai Keurukon Fakultas Teknik, Selasa-Rabu (2627/3). Ketua Panpel, Riyan Haikal, mengatakan, i-SAT 2013 ini diadakan sebagai sarana dalam rangka meningkatkan kreatifitas dan kecerdasan SDM generasi muda Aceh. “Lomba Cerdas Cermat SMA se-Banda Aceh dan Aceh Besar sebagai acara utama dalam rangkaian acara i-SAT 2013 diikuti 16 tim dari berbagai sekolah,” jelasnya. Rangkaian kegiatan lainnya terdiri dari lomba Essai, Fotografi, dan Mini Project. Sekolah

yang menjuarai Cerdas Cermat i-SAT 2013 adalah SMAN 2 Modal Bangsa, disusul juara kedua dari SMA Fatih Billingual School A, dan juara ketiga SMA Fatih Billingual School B. Adapun untuk lomba Essai, Putri Jannah dari SMAN 1 Sigli menjadi juara pertama, Tri Asih Wulandari (SMAN 10 Fajar Harapan) juara kedua, dan Muhammad Fadhil (SMAN 10 Fajar Harapan) sebagai juara ketiga. Dari 20 foto terbaik, RaihanYulanda (SMAN 10 Fajar Harapan) terpilih sebagai pemenang dengan tema “Kopi Ulee Kareng Harumkan Nama Aceh”. Dari perlombaan Mini Project, SMAN 4 DKI Jakarta, Banda Aceh menjadi juara pertama dengan karya “Rak Sepatu ‘Cucok Cin’”. (b04)

Lampu Minyak Meledak, Tiga Luka Bakar BLANGKEJEREN (Waspada) : Gara-gara lampu teplok meledak, ibu bersama kedua anaknya di Desa Sangir Dusun Pisang Abu, Kecamatan Dabun Gelang, terbakar hingga mengalami luka bakar yang cukup serius. Peristiwa naas itu menimpa keluarga Selasih, 40, Rabu (27/3) malam. Kejadian bermula ketika sang ibu, Selasih, hendak menyalakan lampu teplok di bagian rumah selepas magrib. Ditemani kedua anaknya, Sulasfitri,9, dan Surmasni, 6, mencoba menyalakan lampu untuk menerangi rumah seperti biasanya. Teplok pertama menyala dengan normal. Saat hendak menyalakan lampu berikutnya, ternyata kehabisan bahan bakar. Selasih kemudian mencoba mengisi teplok dengan minyak tanah. Duduk mengelilingi lampu bersama dua buah hatinya, usaha sang ibu berjalan lancar saat mengisi minyak tersebut. Namun tak disangka, saat wanita berusia 40 tahun itu menuangkan minyak tanah ke dalam teplok, bagaikan petir secepat kilat api dari lampu pertama yang digunakan sebagai penerangan ternyata menyambar hingga spontan

meledak. Sang kepala keluarga yang mendengar letupan dan teriakan kepanikan dari dapur langsung bergerak. Tak disangka, Ibrahim melihat seluruh keluarganya terbakar api.Tanpa berpikir panjang ia langsung menggendongkan kedua anaknya keluar untuk mencari air. “Saya bingung. Kaget dan panik. Yang saya liat kedua anak saya terbakar, saya langsung teriak minta tolong. Beruntung saja tetangga membantu, dan langsung membawa ke RSUD,” tutur Ibrahim. Pria berusia 45 tahun ini juga mengaku sempat ikut tersulut api sedikit ketika menyelamatkan keluarganya. Beruntung api tidak melebar dan membakar rumah. Karena korban semua melarikan diri ke luar rumah. Dari catatan medis RSUD, korban paling parah dialami Selasih dan Sulasfitri, dengan luka bakar pada kepala, wajah, bagian kaki dan kedua tangan. Untuk Surmasni luka bakar di bagian kaki, tangan dan perut. Kini ketiga korban telah di rujuk ke RSUD Datu Beru Kabupaten Aceh Tengah. (cjs)

Pemerintah Aceh-Kemendagri Kerjasama PNPM-BKPG BANDA ACEH (Waspada): Pemerintah Aceh dan Dirjen Pemberdayaan Masyarakat Desa (PMD) Kementerian Dalam Negeri, sepakat kerjasama dalam pelaksanaan PNPM Mandiri Pedesaan dan Bantuan Keuangan Peumakmu Gampong (BKPG). Nota kesepahaman (MoU) kerjasama itu ditandatangani Gubernur Aceh Zaini Abdullah dengan Dirjen PMD, Tarmizi A Karim, pada rapat forum koordinasi pimpinan daerah seAceh, Kamis (28/3) di gedung serba guna kantor gubernur, Banda Aceh. “Seja 2009 sampai 2012 program BKPG itu telah terlaksana dengan baik, karena ada dukungan Dirjen PMD yang mengintegrasikan pelaksanaannya dengan PNPM Mandiri Pedesaan melalui penyediaan tenaga pendamping,” ujar Zaini Abdullah. Karena itu, Zaini berharap pemerintah pusat melalui berbagai kementerian serta lembaga lainnya dapat meningkatkan program dan kegiatannya di Aceh, terutama dalam mendukung penguatan perdamaian.

“Program PNPM Mandiri Pedesaan akan berakhir tahun 2014, tetapi kita sudah bersepakat untuk melanjutkan agar program yang telah dilaksanakan tidak terputus di tengah jalan,” ungkap Tarmizi A. Karim yang hadir di Aceh bersama Dirjen PUM dan Dirjen Kesbangpol. Untuk itu, Tarmizi meminta pemerintah kabupaten/kota mengawasi pelaksanaan program PNPM Mandiri Pedesaan ini di daerah masing-masing sehingga dapat berjalan baik dan tepat sasaran.“Program ini menyentuh langsung masyarakat, tolong diawasi,” paparnya. Kepala Badan Pemberdayaan Masyarakat (BPM) Aceh, Zulkifli menyebutkan alokasi dana BKPG tahun 2013 dari APBA murni untuk tiap gampong Rp70 juta. Sementara jumlah gampong di Aceh mencapai 6.451 gampong. “Gampong yang mendapat alokasi BKPG 2013 ini sesuai Surat Keputusan Gubernur Aceh,” kata Zulkifli. Sedangkan alokasi dana PNPM dalam program BLM tahun 2013 untuk Aceh Rp426 miliar ditambah dana penunjang Rp79 miliar. (b06)

120 Makalah Dipresentasikan Di Konferensi Pembangunan Aceh BANDA ACEH (Waspada): Sedikitnya 120 makalah dipresentasikan pada konferensi internasional untuk pembangunan Aceh (AIDC) 2013, yang dibukaWakil Gubernur Aceh Muzakkir Manaf di Universiti Malaya, Kuala Lumpur, 26 Maret 2013. “Ini suatu pencapaian yang harus dibanggakan dalam bidang akademik serta menginternasional pemikir-pemikir dan peneliti-peneliti untuk pembangunan Aceh berkelanjutan,” kata Munawar Badruddin, Ketua Panitia Pengarah AIDC, saat penutupan, Rabu (27/3). Penutupan konferensi AIDC IV yang digelar mahasiswa asal Aceh di Malaysia itu dilakukan Tan Sri Dato’ Seri Sanusi Junid. “Kita berharap tahun depan ADIC ke lima dapat dilaksanakan di Aceh,” ujar Munawar Badruddin. Tan Sri Sanusi Junid dalam sambutannya saat penutupan mengatakan, keberhasilan pelaksanaan AIDC 2013 merupakan kesuksesn orang Aceh seluruh dunia. “Orang Aceh bisa sukses di mana saja, tetapi tetap memikirkan Aceh,” tuturnya.

Tan Sri menyebutkan membangun Aceh ke depan harus mencontoh Taiwan. “Orang Taiwan perlu 25.000 orang untuk membangun Taiwan seperti sekarang, tetapi Aceh cukup 4.000 orang berilmu yang memiliki karakter, amanah, berani, disiplin, rajin dan setia,” tuturnya. Karena itu, pihaknya berharap dalam membangun Aceh ke depan tidak perlu menunggu keluarga jadi gubernur. “Bek kue’eh (jangan iri). Artinya jangan senang melihat orang susah, dan susah melihat orang senang,” tutup Tan Sri. Wagub Aceh Muzakkir Manaf mengharapkan para mahasiswa Aceh di Malaysia harus berprestasi tinggi dalam pendidikan. “Aceh ke depan tergantung kepada saudara-saudara di Malaysia dan dimanapun berada,” tandasnya. Konferensi AIDC itu dihadiri akademisi dari Aceh seperti Alyasa’ Abubakar,Yusny Sabi, Alfian Ibrahim, Hasbi Amiruddin, Abdul Razak Ahmad, Bukhari Daud, Syafiie Syam dan Muhammad Iqbal Moctar. (b06)


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000



: : : : :

Bursa Automotive

Air Condition Ban Radial Central Lock Nippon Denso Double Blower


: Power Stearing : Power Window : Radio Tape : Ve l g R a c i n g :Electric Window

5 CM 6 CM

Rp. 65.000 Rp. 78.000

HONDA Accord Maestro ‘91 Kondisi mulus sekali (original). Hub. 0821 6399 3022

TOYOTA Avanza S VVT-i Over Kredit Th. 2006. Hitam spt baru orisinil, sudah dibayar 23 x sisa 13 x 4.210.000. Balik DP 80Jt. Nego. Hub. 0852 7688 3371

HONDA Accord Th. 87 (Prestice) W. Biru, AC, VR, 17. BK Medan Hrg. Rp. 27 Jt Nego. Hub. Jl. Aluminium II No. 11 Tg. Mulia HP. 0813 9770 4080

DAIHATSU CHARADE TH. 80 W. Biru, BK Medan, VR, BR, Hrg. Rp. 13 Juta Nego. Jl. Aluminium II No. 11 Tg. Mulia. HP. 0813 9770 4080 DAIHATSU KREDIT TERMURAH 100% BARU

Granmax PU DP 11 Jutaan,Granmax MB DP 17 Jutaan, Terios DP 20 Jutaan, Xenia 20 Jutaan, Sirion/Luxio juga Ready. Bisa tukar tambah, Data dijemput, SUMUT dan ACEH Pasti Ok HUB. HIDAYAT 0853 7073 3999


New Gran Max PU DP 10 Jt-an, Angs 2,5 Jt (48 bln), All new Nenia DP 26 Jt-an, Angs 3 Jtan (60 bln), Proses cepat, Data dijemput, Lgsg disetujui Hub. ARIF NASUTION ASTRA 0812 6005 2465 (24 jam)


Gran Max Pick Up 1.3 DP 12 Jt’an Angs. 2 Jt’an Luxio D M/T DP 20 Jt’an Angs. 3 Jt’an Xenia 10 D DP 20 Jt’an Angs. 3 Jt’an Angs. 3 Jt’an Terios TS Xtra DP 30 Jt’an Hub. ERWIN HP. 0812 6315 4132 DAIHATSU HEBOH



Khusus Pembelian di bulan ini dan Angs. mulai dari 1,1 Jt/bln, Tersedia jg Terios, Granmax, Pickup, Luxio, Sirion, Proses cepat, Data dijemput Hub. Riky 0812 6595 820 - 0878 6700 0029

DAIHATSU 100% BARU Xenia D Plus..........DP 28 Jt-an...Angs. 3,1Jt Terios....................DP 33 Jt-an Angs. 4 Jt-an Pick Up.................DP 12 Jt-an Angs. 2 Jt-an Hub. PT. Capella Medan / Josua 0812 6311 0820 PORT RANGER 2006 Double Cabin 4x4. Tipe lengkap. BK Medan. Siap pakai. H. 135 Jt. Hub. 0853 6010 8884 warna putih.


Avanza, Innova, Fortuner PURBA: 0813 9736 0333 -0878 6946 5276

HONDA City 1,5 EXI Matic Thn. ‘98 (Over Kredit) Silver met. Mulus, siap pakai. BK Asli Medan, Balik DP: 29Jt (Nego). Sisa Angs: 2,3 Jt x 28 bulan. Hub. 0811 635 367 - 777 56757. Jl. SM Raja Lewat Simp. Amplas. NB: Bisa Tukar Tambah Dgn yang lebih murah.

TOYOTA Avanza Type G 2007, Warna biru, BK Mdn, cat dan mesin mulus, siap pakai. Hrg. Nego. HP. 0821 6021 0957

ISUZU Panther New Hi Grade Thn. 99 W.Hijau mulus, lengkap. Hrg. 85Jt Nego. Hub. 0812 65282117

TOYOTA Kijang LGX Th. 2000 Solar. W. Silver, BK Medan. Hrg. Nego. Jual Cepat HP. 0811 652 506

ISUZU Panther Hi Sporty 97. AC DB. Hijau. Sehat dan mulus, Marindal. Hub. 0852 7552 8833 - 061. 77998752

TOYOTA Corolla DX dijual. Thn. 1980. Warna coklat, Retro. Ban Donat, AC Dingin, Tape, CD, Ada Tule. Semua Sp. Original. Hub. 0813 6113 8191, 0823 7062 7015

Panther Pick Up Turbo...DP 20 Jt-an Panther LM, LV, LS, Touring.......DP 50 Jt-an Hub. SUPRAPTO, HP. 0813 7507 0088 / 061-77860168

DAIHATSU Espass Th. 95 1.3. W. Biru, lengkap, BK Medan Rooling Door. Hrg. Rp. 35Juta Nego. Hub. Jl. Aluminium II No. 11 Tg. Mulia. HP. 0813 9770 4080

Rp. 91.000 Rp. 104.000

TOYOTA Innova G Model V Bensin Over Kredit Thn. 2007. Hitam met, sgt terawat, jok Embitec, Full acesories, Sudah dibayar 15 x Sisa 21 x 5.400.000, pajak baru, Balik DP 65Jt. Nego. Hub. 08236156 7527

# ISUZU 100% BARU (0% + Full Disc) #

PR O M O DA I H AT S U B AR U Paket Murah, Khusus PNS, Swasta & Wiraswasta juga Ok.., Terios, Xenia, Gran Max PU & MB, Luxio, Sirion, Beli Daihatsu sekarang pilih Hadianya Uang Rp. 1M/ Emas 1,5 Kg Hub. PAIREN 0812 6305 0708

7 CM 8 CM

HYUNDAI GETZ Warna kuning lengkap, mulus. Th. 2005. Hub. 0852 966 323 68

OPEL Blazer LT. Injection Silver Met Thn ‘97 Sgt mulus originil, Mesin sehat, AC dingin, Hrg 49 Jt/nego Hub. 0823 6635 9858

SUZUKI Karimun ‘00. Medan asli, silver met. sangat mulus. Bisa Tukar + mbl. Hub. 0812 638 1362 SUZUKI Forsa Th. 87. W. Biru, lengkap, BK Medan. Hrg. Rp. 19 Juta Nego. Hub. Jl. Aluminium II No. 11 Tg. Mulia HP. 0813 9770 4080

SUZUKI AVV Type X Thn 2005 Warna Hitam, BK Mdn, Pakai TV 3 Layar, Siap pakai HP: 0852 7650 6242



TOYOTA Fortuner G Diesel Manual Th. ‘08. Warna hitam metalik, ban baru. Km. 45 xxx, mobil mulus sekali, BK Medan asli, Rp. 279,5Jt. Depan Kampus UISU No. 200. Hub. 0815 337 336 88 / 7851402 TOYOTA Innova G Solar Manual Th. ‘08 Bln 10, New Model, warna hitam metalik. Ban besar, mobil mulus BK Asli Medan. 1 tangan dr baru Rp. 202Jt. Jl. SM. Raja No. 200. Hub. 0821 6767 7000 / 7851402


Thn. 2008 Bensin BK Medan, A/n. Sendiri Silver Metalik, PW, PS, CL, AC DB Pajak Feb. 2014, Kondisi Mulus Jarang Pakai. Harga Nego Peminat Hub. 0811 600 1856 0813 7042 4849

SUZUKI Carry RV, MB Th. 98. Silver (Siap pakai). 45Jt. An. Pemilik langsung. Hub. 0813 7008 0493 - 0853 5922 3993

TIMOR DOHC Dijual. Warna Biru, tahun 1998. Siap pakai, Jok baru. Balut baru Siap cat. HP. 061-7756 7581

SUZUKI Karimun GX Over kredit Thn 2003 Hitam Met, Sudah dibayar 15x Sisa 21 x 2.499.000, Balik DP 40 Jt/ nego Hub. 0812 6063 7823





MIO Soul Dijual. Thn. 2011. Cantik, plat BB. Samosir. Lengkap, tangan pertama. H. 6.500.000. Hub. 0853 6010 8884



TOYOTA Hard Top Bensin Kanvas Th. ‘78. Abu2 Rp. 59Jt/ Solar Th. ‘82. Warna putih merah, Rp. 89Jt. Hub. 0853 6231 2323

Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500

- Carry PU 1,5 DP 15 Jt-an Angs. Rp. 2,5Jt-an - Mega Carry PU DP 21 Jt-an Angs. Rp. 2,7 Jt-an - R3 GL DP 45 Jt-an Angs. Rp. 3,6Jt-an R3 Ready Stock, Full bonus, Aziz: 0853 6239 3789


1. All New Avanza Angs. Rp. 2.656.000 x 59 Bulan 2. New Yaris Angs. Rp. 3.140.000 x 59 Bulan 3. New Rush Angs. Rp. 3.208.000 x 59 Bulan 3. New Rush Angs. Rp. 3.208.000 x 59 Bulan 4. Grand New Kijang InnovaAngs. Rp. 3.243.000 x 59 Bulan Angs. Rp. 6.218.000 x 59 Bulan 5. Grand New Fortuner Dapatkan Diskon Special + Hadiah langsung untuk pembelian di Bulan ini, Ready Stock Toyota Tipe Lainnya

Info Hub: 0852 7515 0363 (Dealer Resmi Toyota)

NB: Terima tukar tambah



Jaminkan BPKB Mobil dan Truk (yang masih kredit juga bisa) Proses Cepat, Data dijemput 1 Hari Cair Hub. 0853 7000 3949 ( Eno)/ 0813 9756 6003 (Hutabarat)

Harian WASPADA Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab PT. Harian WASPADA.

Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602






ANDA PRIA, Ingin berjualan Sari Roti di Kabanjahe Hub. 0813 9632 5020 (Hendrik) - 0852 6060 4057 (Suryadi)

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188




SYARAT: - Pria/ wanita usia 18 s/d 39 tahun - Pendidikan SLTA, SMK, DIPLOMA dan SARJANA - Tidak pernah dipenjara atau dihukum berat - Tidak pernah dideportasi atau diusir dari Korea - Tidak sedang dicekal untuk pergi ke luar negeri GAJI & FASILITAS: - Rp. 10.000.000 s/d 15.000.000/ Bulan - Gaji diatas belum masuk lembur 1.Website: - Kontrak kerja 3 - 5 tahun - Tempat tinggal, Asuransi, dll 2. Izin: 506/776/DSTKM/2011 - Mendapat bantuan Pembiyaan pemberangkatan dari BANK Bagi Peminat datang langsung ke: GEMILANG PRESTASI Jl. SISINGAMANGARAJA Gedung ILP Lt. 1 No. 270 Depan Kampus UISU PERTANIAN MEDAN SUMATERA UTARA


Perusahaan Asing yang bergerak di bidang perbankan butuh SDM yang potensial dan mau bekerja keras untuk posisi: I. Sales Officer/ Personal Loan (PL) II. SUPERVISOR III. Tele Marketing IV. Kurir Persyaratan pria/ wanita - Max 35 thn - Min SMU/ sederajat - Tidak terikat kerja/ kuliah - Bisa bahasa Hokkian/ Inggris dan berpengalaman di Perbankan, menjadi nilai tambah - Rajin, jujur dan bertanggung jawab Lamaran lengkap di kirim ke: Jl. Iskandar Muda No. 20B/ 167 Medan Up: Bpk. Kamal Nasution HP: 0853 6181 6611


Membutuhkan segera: A. 1 (satu) orang Area Supervisor ditempatkan di P. Siantar B. 1 (satu) orang Account Executive (AE) Salon ditempatkan di Medan Dengan persyaratan: 1. Pria/ wanita max 35 tahun 2. Pendidikan min. S1 (Area Supervisor) 3. Pendidikan min. D3 Account Executive (AE) Salon 4. Menguasai Area Sumut 5. Menguasai Microsoft Office 6. Mampu berkomunikasi dengan baik 7. Mampu bekerja mandiri Fasilitas: Gaji + Incentive Lamaran diantar langsung ke: PT. MUSTIKA RATU BUANA INTERNATIONAL Jl. Budi Luhur No. 196 Lt. 3 Medan

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

FAX.4561347 Iklan Anda Dijemput Khusus Wilayah Medan Hub. 0813 6207 8393 Wilayah Marelan, Labuhan, Belawan Hub. 0812 6390 660




UMROH 2013


Umroh Reguler 9 Hari 2 Apr, 19, 3 & 9 May Umroh Reguler 11 Hari 26 April, 24 Mei Umroh Reguler 14 Hari 21 April, 17 May Umroh Plus Cairo 19 April Umroh Plus Turkey 24 April Umroh Plus Dubai 27 April Umroh Plus Aqso 20 April Umroh Ramadhan Awal, Pertengahan, Full Ramadhan


Bagi Jamaah luar kota menginap di Hotel Madani (Gratis) Pesawat via Singapore



TELP. 061-4576116 FAX 061-4512319 HP. 0813.6137.2321 – 0812.6495.8456

Jl. SM. Raja No. 4 / 18 Medan Telp. 061-7326981, 0852 6213 3488, 0813 9690 8811





Bernama Juliana Raja Gukguk


Cocok untuk investasi, LT. 340m² Lokasi Jl. Bayu Ringroad Hub. 0812 6462 0043 (TP)


Tanah Datar & Bangunan sudah di pagar tembok keliling tinggi pagar 2 mtr, Uk. 15x40m di Marelan, Hrg 240 Jt Hub langsung 0852 9777 7979




Anda Butuh Perabot Jepara Asli?

Berbagai ukuran: - Tiang listrik dari Pipa besi panjang: 11 meter besar 6 inci 9 meter besar 5 inci 7 meter besar 4 inci - Tiang lampu jalan dan tiang lampu taman Telp. (061) 8456 286

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

HP: 0812 6571 7999 / 0812 6072 799 Jl. Asrama No. 189 Dwikora Medan




Informasi Pembaca Bursa Property






845.8996 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim



G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

yang berumur sekitar 30 thn. Yang bertempat tinggal terakhir di Jl. Pelita I Gg. Selaras No. 06 Lingkungan IV Kelurahan Sidorame Barat II. Kecamatan Medan Perjuangan. Diharapkan agar segera pulang ke rumah, keluarga sangat merindukan dan ada urusan penting. Bagi yang menemukan harap hub. 0821 6030 5377 dan akan diberi hadiah sepantasnya.




Selama 100 Hari (Tanpa merekrut): Info: ID.AM 100044 atau SMS “Petunjuk”ke087801710444Telp.(021)41013414





Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.7194 Fax. (061) 415.7504 SUMUT - INDONESIA

RUMAH DIJUAL CEPAT Perum. Griya Nusa Tiga Blok D No. 1 Jl. Flamboyan Raya Tg. Selamat Medan Tuntungan, LB. ±160, LT. ±430m, KT 4, KM 2, Garasi, Sertifikat Hub. 0813 6164 6800


2 Buah Surat Pernyataan/Pengakuan Ganti Rugi Tgl. 18-11-52. An. Sugianto 1. Luas +/- 867,50 M2. 2. Luas +/- 458 M2 Hilang/Tercecer disekitar Desa Wonosari Kec. Tanjung Morawa. Bagi yang menemukan Hub. 0821 61 48 7753




Strategis di Jl. Ring Road, Setia Budi, Medan, Rp. 19 Jt/thn

Hub. 0813 9655 7571


Uk. 8,5x19m (2 LT), Baru direnovasi, 3 KT, 2 KM, Cuci, Jemuran, 1 KP diatas, Alamat Villa Gading Mas 3 Blok Q No. 21 Mariendal - Medan Hub. 0811 638 727 (Khusus Muslim)


RUMAH DIJUAL CEPAT Uk. Tanah 10x12m, Bangunan Rumah Semi Permanen, LB. 8x10m, KT 2, Km sumur, Harga 80 Jt/nego alamat Jl. Veteran Dusun 3 Desa Banten Gg. Madrasah No. 1 Helvetia Labuhan Deli, SK Camat Hub. 0811 642 096 - 0819 618 159

Disamping Mesjid, SHM, Uk. 8,6x15,8m, Lantai 2, KM 4, KT 3, Dapur Luas, Full keramik, Garasi, Pagar besi, Jl. Tanjung II No. 145 Blok 3 Perumnas Helvetia HP: 0813 96 82 3344 - 0812 608 1706/ Ellys



1 unit Rumah Tinggal Lt 2, 2 KM, 3 KT LT 108m, di komp Taman Riviera Blok NCT 41, Medan letak strategis pinggir jalan Jalinsum dekat Poldasu. Harga 370 Jt/ bisa Nego. Minat Hub. 081281652225.




Atasi bau kaki, Gosyen kaos kaki anti bacterial, Hrg pabrik, Kwalitas export/ Super bagus, Bebas ongkir utk pakai sendiri/ dijual Hub. LIE MEI 0813 1591 6159 RINA 0857 6084 8346 - 0853 6000 8740


Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.3334 HP. 0813.7580.8866


TERCECER Surat Izin Pemakaian tempat berjualan No. 5113/6453/PDPKM/2005 Tgl. 3 Oktober 2005 No. Kiosk 326 An. PAULINA BR SITEPU. Tercecer di Jl. Bandung Raya.


Telah tercecer/hilang Asli SK Tanah An. JOHANIS (Almh.) Letak tanah Jl. PWS Gg. Dewi No. 44-C Lk. III Kel. Sei Putih Timur II Kec. Medan Petisah seluas +/- 138,75M2. Tercecer/ hilang pada tahun 2012 disekitar Jl. PWS - Medan


Sebuah Surat Tanah atas nama: GANTI GINTING MUNTHE dengan No. 21759/A/I/10. Bagi yang menemukan harap Hub. 0852 5831 2155 atau 08211 9181 251, dan akan diberi imbalan serta tidak dituntut. TERCECER

STUK BK 8173 BJ. No. Uji: Jkt. 576321. a/n. LIAN SIOK TJU. Alamat Jl. Ksatria No. 21 B Medan. Merk Mitsubishi.


STUK BK 9801 CN. No. Uji AB. 04 00943 a/n. PT. MESTIKA SAKTI. Alamat Jl. Tureli Timbang Deli. Merk: Mitsubishi.





Anda tuntaskan sendiri (Insya Allah): AsamUrat,Bengkak,Maag/asamlambung ( akut), Syarat terjepit, DM/Gula Basah ( busuk )/kering, stroke, typhus, DBD, wasir, dll dengan produk alami Hub : Pak Ngadi HP : 0813 7500 7177



Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG

Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna KHUSUS WANITA: KHUSUS PRIA: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DIJAMIN 100% KONSULTASI UMUM: HANYA TEMPAT - Buka aura KAMI KLINIK - Cari jodoh MAK EROT - Pelaris - Mencari orang hilang JL. LAKSANA NO. 55 J MASUK DARI JL. AMALIUN YUKI SIMPANG RAYA MEDAN (PRAKTEK TETAP) HP: 0812 4038 333 -

(Untuk reumatik & asam urat)

Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887


WASPADA Sabtu 30 Maret 2013

07:00 Kartun 09.00 Dahsyat Weekend 11:00 Intens 12:00 Seputar Indonesia Siang 12:30 Idola Cilik 14.30 Tom & Jerry 16.00 Target Operasi 16.30 Seputar Indonesia 17.00 Yang Muda Yang Bercinta 18.30 Cinta 7 Susun 19.30 Layar Drama Tukang Bubur Naik Haji 21.00 Berkah 22.30 Box Office Movie 00.00 Seputar Indonesia


07.00 SCTV Musik Inbox 09.00 Liputan 6 Terkini 09.03 Hot Shot 10:00 SCTV FTV Pagi 11.00 Liputan 6 Terkini 12:00 Liputan 6 Siang 12.30 Film Layar Lebar 14.00 Liputan 6 Terkini 14.30 SL Eat Bulaga Indonesia 16.00 Liputan 6 Terkini 16.03 SL Eat Bulaga 16.30 Liputan 6 Petang 18.00 Biang Kerok Cilik 19.00 Cinta Rock Star 20.00 Para Pencari Tuhan 21.00 Ustad Fotocopy 22.00 SCTV Musik Karnaval 2013

07:00 Ayo Main 07:30 Pengobatan Alternatif 08:00 Smart Mom Happy Kid 08:30 Pose 09:00 Masak Apa Hari Ini 09:30 Pelesir 10.30 Serial Pilihan 11:30 Mata Pancing 12:00 Layar Kemilau 16.00 Tuntas 16.30 Inspirasi Sore 17.00 Animsi Spesial 18:00 Sepatu Super 19:00 Tendangan SI Madun 21.00 Raden Kian Santang 22.00 Hidayah 00.00 Layar Tengah Malam

07:30 Foody With Rudy 08:00 Clinic Secret Herbal 08.30 Fenomania 09:00 Property On Sale 09:30 Kaki 5 10:00 Travelleza 10:30 Tamu Rempong 11:00 Hidup Hanya Sekali 11:30 Topik Siang 12:00 Klik ! 13:00 Mantap 14:00 Total Football 14:30 Kampiun Sepakbola Nasional 15:00 ISL 17:30 Topik Petang 17:35 Pesbukers 18.30 Viva La Vida 21.00 Crazy Sport 22:00 Sinema Spesial

07:00 KISS Pagi 08:00 Jelita 08:30 Hypermart Show 09:00 Sinema Akhir Pekan 11.00 Football Headliner 11.30 Live Patroli 12:00 Sinema Pintu Taubat 14:00 Hot KISS 14:30 Live Fokus 15.00 Tukar Nasib 16.00 The Voice Indonesia 18.00 Drama Seri Indonesia 19.00 Sinema TV 20:00 Gebyar BCA 21.30 Mega Bollywood

07.00 Bedah Editorial Media Indonesia 08.30 811 On The Weekend 10.05 Untuk Buah Hati 10.30 Metro Xin Wen 11.05 Oprah Winfrey 12.05 Metro Siang 13.05 Spirit Football 13.30 Auto Zone 14.05 Power Players 16.05 Oprah Winfrey Show 18.05 Metro Hari InI 18.30 Metro Highlights 20.05 Metro Files 21.05 Top Nine News 21.30 Idenesia 22.30 Stand Up Comedy 23.05 Destroyed in Seconds 23.30 Metro Sports

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

B7 07.00 Mozaik Islam 08.00 Celebrity ON Vacation 08.30 Wisata Kuliner 09.00 Ceriwis 09:45 Ala Chef 10:30 Woow 11:00 Insert Siang 12:00 Bioskop Indonesia 13:00 Griya Unik 13.30 New Rival 14.00 Sketsa 15:00 Bingkai Berita 15.30 Gengges 16.00 Insert Investigasi 16:45 Reportase Investigasi 17:15 Cari CInta 18.00 Indonesia Mencari Bakat 20:30 Bioskop TransTV Spesial 22:00 Bioskop TransTV 00.3:00 Bioskop Trans TV

07:00 Sarapan Pagi 07:30 MLS Soccer 10:30 Soccer One 11:00 Prediksi 12:00 Live News Kabar Siang 13:00 Damai Indonesiaku 15:00 Ujung Negeri 15:30 Khatulistiwa 16.00 Bukan Jalan Biasa 17.00 News Kabar Petang 19:00 Apa Kabar Indonesia Malam 20:00 Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Nama & Peristiwa

08:00 Balto 10:30 Obsesi 11.00 Buletin Indonesia Siang 12:00 Awas Ada Sule 13.00 Top Banget 13.30 Before 30 14:00 Naruto 15.30 BoBoi Boy 16.00 Fokus Selebriti 16:30 Kemayu 17:00 Eneng Dan Kaos Kaki Ajaib 18:00 Komeng Acak Adul 19:00 Big Movies 22.00 Big Movies

07:00 Plester 07:30 Selebrita Pagi 08:30 Party Kejutan 09:00 Asli Enak 09:30 Spotlite 10:00 Wolipop 10:30 RAN 11.30 Redaksi Siang 12:00 Selebrita Siang 12:30 Galeri Sepak Bola Indonesia 13:30 One Stop Football 14.00 Highlights Otomotif 15.00 Seleb Expose 16:00 Marry Me 16:30 Redaksi Sore 17:30 5 Juta 5 Menit 19:00 On The Spot 20.00 Pas Mantab 23.00 Mister Tukul 00.00 Masih Dunia Lain 01:00 Theater 7 **m31/G

KateWinsletTampilDiDivergent Aktris peraih Oscar KateWinslet bergabung dalam film Divergent kisahnya diadaptasi dari novel laris. Studio film Summit Entertainment mengatakan bahwa Winslet akan berperan sebagai Jeanine Matthews yang dingin dan tidak disukai. Divergent diadaptasi dari seri pertama novel trilogi karangan Veronica Roth mengisahkan masyarakat yang dibagi menjadi lima faksi menentukan bagaimana cara mereka hidup. Orang-orang Abnegation

tidak mementingkan diri sendiri, sementara masyarakat Erudite mengejar pengetahuan sepanjang hidup.Winslet akan menjadi pemimpin dari Erudite, seperti dikutip dari Reuters. Sebelumnya, sudah diumumkan beberapa pemeran yang bergabung di film tersebut, termasuk bintang sedang naik daun Shailene Woodley dan pendatang baru Inggris Theo James. Divergent akan dirilis pada Maret 2014 adalah film adaptasi dari novel dewasa muda, mengikuti jejak The Twilight Saga dan kesuksesan The Hunger Games

dibintangi peraih Oscar Jennifer Lawrence. Lima film Twilight tentang kisah cinta vampir, manusia, dan manusiaserigalameraihlebihdari 3.3 miliar dolar di box office seluruh dunia. Sementara The Hunger Games meraih lebih dari 690 juta dolar dari pendapatan di seluruh dunia. FilmlanjutanHungerGa-mes akandirilispadaNovembertahun ini, sementaraThe Mortal Instruments:CityofBones,adaptasidari novel dewasa muda lain dengan tema supernatural dan dystopia akan dirilis di bioskop Amerika Serikat pada Agustus.(ant) Daniel Craig/rtr



Eminem Kembali Dengan Album Baru Penggemar Eminem tidak perlu menunggu lebih lama lagi untuk menikmati album baru penyanyi rap Amerika bernama lengkap Marshall Bruce Mathers III itu. Dalam wawancara dengan radio Power 106 pekan ini, produser rekaman Dr Dre mengatakan album tahun 2013 Eminem hampir selesai, mengon-firmasi rumor yang sudah beredar selama berbulan-bulan.“Em sedang menyelesaikan proyeknya,” kata Dr Dre, yang juga mentor Eminem, seperti dikutip Huffington Post. Penggemar rapper yang juga dikenal dengan nama Slim

Shady itu pertama kali menangkap rencana Eminem merilis album ketika melihat toko milik sang bintang. Toko itu menjual topi bertuliskan tahun-tahun Eminem merilis album solo, salah satunya bertulisan “2013.” Bulan lalu, Paul Rosenberg, Presiden Shady Records, membahas rencana Eminem merilis album baru. “Kami sangat berharap bisa merilis album baru Eminem tahun 2013. Dia sudah beberapa lama mengerjakannya,” kata Rosenberg kepada Billboard. Rosenberg memperkiraka-

n album baru itu akan keluar setelah Memorial Day, peringatan kepada mereka yang tewas saat bertugas dalam Angkatan Bersenjata AS pada Senin terkahir bulan Mei. “Tapi kami belum tahu kapan persisnya. Kami sudah menjadwalkannya tampil di Eropa pada Agustus, jadi kami masih lihat dulu,” tambahnya. Dr Dre juga berencana kembali masuk studio, ke dunia musik yang telah digeluti selama 30 tahun. “Sedikit sulit untuk dapat inspirasi supaya bisa kembali ke sana, tapi musik adalah cinta pertama saya dan saya akan terus melakukannya selama saya bisa,” kata dia.(ant)

Kate Winslet/rtr

Spielberg Buat Mini Seri Napoleon

Sutradara Steven Spielberg akan membuat mini seri televisi tentang Napoleon berdasarkan skenario Stanley Kubric, seperti dikutip dari laman AFP. Pembuat film E.T mengerjakan skenario dibuat lima dekade lalu oleh Kubrick, sutradara karya klasik 2001: A Space Odyssey dan A Clockwork Orange.

Steven Spielberg “Saya telah mengembangkan skenario Stanley Kubrick untuk mini seri, bukan film, tentang kehidupan Napoleon,” kata Spielberg pada Canal Plus tanpa menyebutkan apakah dia akan menyutradarai atau hanya memproduksi proyek itu. “Kubrick menulis skrip pada 1961, sudah lama sekali,” kata

dia. Spielberg dan Kubrick pernah sama-sama terlibat dalam pengembangan A.I. Artificial Intelligence yang keluar pada 2001. Kubrick, terkenal dengan perfeksionisme obsesif, meninggalkan proyek Napoleon karena masalah anggaran dan produksi, seperti dikutip dari Hollywood Reporter. Dalam surat dalam draft untuk para eksekutif studio pada 1971, Kubrick tutup usia di umur 70 tahun pada 1999 menulis, “Saya tidak mungkin mengatakan pada kalian apa yang akan saya lakukan, kecuali bahwa saya akan membuat film terbaik yang pernah saya ciptakan.” Kubrick menawarkan peran-peran utama untuk Oskar Werner juga Audrey Hepburn. Dia awalnya meminta penulis Clockwork Orange Anthony Burgess untuk menulis buku tentang Napoleon akan digunakan sebagai dasar filmnya. Namun dia dikabarkan kecewa dengan manuskrip itu. (ant)


Elvis Presley/

Elvis dan Marilyn Monroe Mejeng Di Gedung Filateli Puluhan prangko Elvis Presley dan Marilyn Monroe menarik perhatian pengunjung Pameran Filateli Kreatif 2013 di Gedung Filateli Jakarta. Prangko spesial dua artis legendaris tersebut dikoleksi Ketua umum Perkumpulan Filatelis Indonesia R. Soeyono dan juga Sribudhi Soeyono lewat hasil berburu pada setiap pameran prangko dunia. “Saya dapatkan dari pameran prangko dunia, tapi karena ini prangko khusus, harganya

juga lebih mahal,” ungkap Soeyono yang mengoleksi prangko bertema Elvis Presley. Sekitar 30 set prangko maupun sampul hari pertama dari King of Rock n Roll itu berasal dari berbagai negara, seperti Palau, Grenada, Gambia, dan Turkmenistan. Sementara sekitar 30 koleksi set prangko Marilyn Monroe juga diterbitkan dari banyak tempat, seperti Nevis di Karibia, Amerika Serikat, dan Mozambique.

Marilyn Monroe tampil dengan variasi pose, termasuk gaya khas memegang rok putih yang melambai tiup angin. Soeyono mengaku masih mencari perangko bergambar band Inggris terkemuka The Beatles. “Soalnya itu yang terkenal di zaman saya,” katanya. Koleksi prangko Elvis Presley dan Marilyn Monroe dapat dilihat pada Pameran Filateli Kreatif 2013 yang berlangsung hingga 1 April di Gedung Filateli Jakarta.(ant)

Pameran tokoh fiktif agen rahasia Inggris James Bond dihelat di Shanghai, Kamis, hanya seminggu setelah pemerintah komunis menyensor bagian-bagian film terbaru 007, Skyfall. Namun, Neil McConnon, kepala kurator Designing 007 Fifty Years of Bond Style, mengatakan tidak ada sensor dalam pameran yang diselenggarakan Barbican London. “Sama sekali tidak ada hasil editan untuk pengunjung China,” kata dia seperti dikutip AFP. “Sebelumnya kami telah mengalami banyak sensor dalam beberapa pameran, tapi tidak kali ini.” Sebagian adegan Skyfall yang syuting di sudut komersial China dianggap terlalu sensitif oleh otoritas China sebelum dirilis Januari. Adegan menampilkan prostitusi di Macau, daerah administras khusus China dihapus, begitu pula perkataan bahwa musuh Bond disiksa agen rahasia China. Adegan saat seorang centeng menyerang petugas keamanan China di pencakar langit Shanghai juga dihapus. Pameran di Shanghai itu dihelat di Museum Seni Minsheng. Pameran tersebut menampilkan lebih banyak koleksi Skyfall dibandingkan acara serupa di London dan Toronto, misalnya perahu Daniel Craig saat memasuki kasino Macau. Ada juga busana dikenakan Michelle Yeoh, pemeran agen rahasia China Wai Lin dalam Tomorrow Never Dies.(ant)

Selena Gomez/ Selena Gomez berencana memperkenalkan single terbarunya, Come & Get It, pada perhelatan MTV Movie Awards 14

April mendatang. “Ini penampilan perdana saya sebagai musisi lagi. Saya sangat gugup! Tapi keren,” katanya kepada MTV.

Gomez setahun belakangan vakum dari dunia tarik suara untuk menyelesaikan proyekproyek filmnya. “Saya senang se-kali!” lanjutnya tentang penam-pilannya di MTV Movie Awards, seperti dikutip dari Huffington Post. Bulan ini, single Gomez berjudul Rule The World juga beredar di dunia maya. Album mendatang ini merupakan album studio keempat mantan kekasih Justin Bieber itu. Gomez menyebut album ini sedikit bernuansa Spanyol dan tentu dance pop. “Ini proyek tersulit yang pernah saya kerjakan. Saya ingin mengontrol album ini secara kreatif,” kata gadis berusia 20 tahun itu. Gomez terakhir kali mengeluarkan album pada tahun 2011 berjudul When The Sun Goes Down. Sejak itu, ia berkonsentrasi pada karier aktingnya. Ia mengeluarkan film antara lain Spring Breakers dan Hotel Transylvania. Selain itu ia juga sibuk dengan lini busana miliknya, Dream Out Loud.(ant)

AKB 48/

Juni Pemilu AKB48 Grup idola Jepang AKB48 akan menggelar pemilihan umum ke-5 yang menobatkan siapa anggota terpopuler dan siapa akan tampil membawakan single berikutnya pada 8 Juni di Stadium Nissan, Yokohama. Pemilu AKB48 adalah acara tahunan terbesar di dunia musik dan hiburan Jepang. Pada acara tersebut, para penggemar dapat membeli CD (hanya dijual di Jepang) dan menyumbang voting yang menentukan anggota terbaik. Tahun lalu, lebih dari satu juta voting terkumpul, perhatian media Jepang dan kesadaran orang-orang tentang acara tersebut hampir menyamai pemilu politik, demikian laman Japan Today. Para penggemar luar Jepang pun dapat ikut meramaikan pemilu tersebut lewat Google+. Dengan mengirim pesan dukungan untuk anggota AKB48 favoritnya, para penggemar dapat terhubung dengan sister group dari JKT48. Kali ini, penggemar AKB48 juga menyumbang voting untuk menentukan siapa anggota yang akan tampil pada single ke-32 yang dirilis Agustus. Voting berlangsung dari 21 Mei hingga hari sebelum pemilihan, 7 Juni.(ant)

Robert Downey Jr

Iron Man 3 Promosi Di Seoul

Robert Downey Jr, pemeran Tony Stark di film superhero Iron Man, dijadwalkan mengunjungi Korea Selatan pada April untuk mempromosikan Iron Man 3. Aktor Hollywood akan tiba di ibu kota Korea Selatan pada 3 April, untuk menghadiri konferensi pers Iron Man 3 digelar keesokan harinya, demikian disampaikan Sony Pictures Korea, distributor lokal untuk film superhero itu. Seoul, adalah persinggahan pertama Downey Jr dalam rangka tur promosi global Iron Man 3 dilangsungkan menjelang pemutaran perdana film tersebut di Korea Selatan pada 25 April, sepekan lebih awal dari jadwal penayangan di Amerika Serikat. Film pertama dan kedua Iron Man masing-masing ditonton 4,32 juta dan 4,5 juta penonton di Korea Selatan.(ant)



WASPADA Sabtu 30 Maret 2013

Siswa Tertarik Dunia Jurnalisme Road Show Communication Goes To School SUKSES pada pekan sebelumnya, kali ini Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan melanjutkan kegiatan “Road Show Communication Goes To School”. Kali ini, dua sekolah beruntung yang kedatangan rombongan STIK-P adalah SMAN 21 Medan dan SMA Swasta Perguruan Eria Medan masing-masing pada Sabtu (23/3) dan Senin (25/3) lalu. Seperti biasa, road show STIK-P hadir dengan memperkenalkan dunia broadcasting, public relations (PR), dan jurnalisme. Meskipun, di tengah-tengah persiapan siswa kelas XII yang bakal menjalani Ujian Nasional (UN) pada April mendatang, kegiatan tersebut berhasil melunturkan ketegangan mereka. Kegiatan segudang ilmu itu diisi dengan beragam aktivitas yang menyenangkan, di antaranya siswa disuruh bergaya bak reporter televisi di hadapan kamera setelah mendapat pemaparan tentang dunia ilmu komunikasi, khususnya praktisi jurnalistik. Pada awalnya mungkin, broadcasting, PR, dan jurnalisme masih asing di telinga para siswa. Namun setelah mendapat pemaparan dari ketiga narasumber STIK-P yang ahli dalam bidangnya masing-masing, alhasil siswa pun mengerti dan bahkan beberapa di antara mereka langsung menyatakan berminat mendalami ilmu tersebut. Bila di SMAN 21 hadir sebagai narasumber adalah Dra Hj Nadra Ideyani Vita MSi (Puket I STIK-P) yang memaparkan seputar dunia PR didampingi Suprapti Indah Putri SP MIKom

STIK-P menawarkan kesempatan kepada siswa lulusan SLTA mendalami ilmu PR dan jurnalisme di kampus yang didirikan tokoh pers nasional, Bunda Hj Ani Idrus. -Waspada/Dio Utama-

(mantan reporter MetroTV dan Puket II STIK-P) yang menjelaskan tentang broadcasting dan jurnalistik televisi, maka anak-anak Eria kedatangan duet Suprapti dan Austin Tumengkol SSos MIKom (Redaktur Kreasi Waspada dan Puket III STIK-P) sebagai pemateri dunia kewartawanan. PKS III SMAN 21, Drs Sastra Jaya, mengatakan pihaknya mendukung kegiatan positif seperti yang digelar STIK-P karena menambah wawasan dan pengetahuan siswa. Selain itu, siswa juga memiliki alternatif sesudah menamatkan studinya kelak. “Jika perlu, setiap tahun road show STIK-P dilakukan di sini. Adanya kegiatan ini dapat menyadarkan siswa akan potensi yang mereka miliki dan setamatnya nanti tidak salah pilih kampus sesuai bakat dan minat masingmasing,” ujarnya didampingi guru Bahasa Inggris, Insanuddin Siregar. Menurut Sastra, ilmu jurnalisme merupakan hal baru bagi mereka karena memang tidak dipelajari di SLTA. Namun bukan berarti tidak diminati, justru dengan adanya kegiatan ini dapat menumbuhkan minat pada siswa. Hal senada dikatakan Drs H Khoiruddin Hasibuan MPd. Kepala SMA Eria ini mengatakan bahwa road show ini dapat memancing potensi siswa yang ingin menjadi wartawan atau praktisi PR, sehingga mereka yang memiliki talenta dapat menyalurkan bakat minatnya tersebut. “Sudah seharusnya ketika tamat nanti, siswa sudah tahu mau menempuh jalur pendidikan seperti apa, sehingga nantinya tidak salah pilih jurusan,” kata Khoiruddin. *Arianda Tanjung & Dio Utama




-Waspada/Arianda Tanjung-

-Waspada/Arianda Tanjung-

-Waspada/Dio Utama-

Teks Foto:


1. PUKET II STIK-P Suprapti Indah Putri SP MIKom memberi tutorial menjadi reporter televisi kepada sepasang siswa SMAN 21 Medan. 2. PANCA Ramadhan dan Puspita Ladiba terpilih sebagai peserta terbaik SMA Eria dalam kegiatan road show STIK-P. 3. PULUHAN siswa SMA Eria antusias mendengarkan Puket III STIK-P Austin Tumengkol SSos MIKom dan Puket II Suprapti Indah Putri SP MIKom saat memaparkan dunia kewartawanan dan broadcasting. 4. PERWAKILAN SMAN 21 Medan diabadikan bersama pemateri STIK-P dan siswa sehabis kegiatan road show Communication Goes To School di sekolah tersebut. Info Kreasi Jika sekolah atau kampus kalian bikin kegiatan dan ingin diliput tim Kreasi, silakan hubungi: Afli (085658109651), Arianda (085658008201), Dio (085262748330) -Waspada/Dio Utama-

Denada Awli, SMA Eria Medan “Menurut aku sih, road show STIK-P ini dapat memancing potensi siswa yang ingin menjadi wartawan atau praktisi PR. Jadinya, mereka yang memiliki talenta dapat menyalurkan bakat maupun minatnya sekaligus bekerja di media atau perusahaan terkemuka. Kegiatan ini sangat positif sekali, karena tidak semua tahu tentang ilmu komunikasi. Berkat STIK-P, kami jadi tahu akan dunia PR dan jurnalisme, apalagi kampusnya juga terakreditasi lho. Jadi nggak meragukan.”

Teks: Afli Yarman Foto: Dio Utama

Laili Farhana, SMAN 21 Medan “Hadirnya road show STIK-P ini membuat saya jadi tahu apa itu broadcasting, public relations (PR), dan jurnalisme. Dari ketiga dunia penuh prospek itu, saya tertarik dengan broadcasting tapi juga ingin mencoba jadi fotografer. Karena itu, saya pun tertarik masuk STIKP. Harapannya, semoga dari road show ini semakin banyak siswa yang berminat masuk ke kampus ilmu komunikasi itu.”

Ervina Sanika, SMAN 21 Medan “Road show STIK-P mantap! Selain mendapat pengetahuan baru, kita juga diberikan kesempatan praktik langsung jadi reporter. Kegiatan ini pun harus berlanjut setiap tahunnya ke sekolah-sekolah lain agar makin banyak yang kenal STIK-P dengan sederet ilmu PR dan jurnalismenya. Kalo saya sendiri lebih tertarik menjadi jurnalis atau lebih spesifiknya dunia fotografi agar bisa jadi seorang fotografer profesional.”

Kassandra, SMA Eria Medan “Memang sih, ilmu jurnalisme merupakan hal baru bagi saya, karena memang jarang dipelajari di sekolah. Dengan adanya road show STIK-P di Eria, saya bisa lebih mengenal tentang broadcasting, public relations (PR), dan jurnalisme. Karena road show pula saya tertarik dan ingin lebih mendalami profesi jurnalistik, karena juga profesi mulia, seperti guru, dokter yang bersifat membantu masyarakat. So, siapa takut jadi wartawan…”

Waspada, Sabtu 30 Maret 2013  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you