Issuu on Google+

Medan 23-31 0C

P.Sidimpuan 19-290C

R.Prapat 24-32 0C

Penyabungan 19-29 0C

Berastagi 18-27 0C

Sibolga 21-310C BMKG Polonia

Hujan guntur

Berawan

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

http://epaper.waspadamedan.com

SABTU, Pahing, 25 Desember 2010/19 Muharram 1432 H z No: 23367 * Tahun Ke-64

Terbit 20 Halaman (A1-12, B1-8) z zHarga Eceran: Rp 2.500,-

Getty Images

Pelatih timnas Malaysia Rajagobal Khrisnasamy bersukaria dengan anak asuhannnya saat lolos ke babak final AFF Suzuki Cup 2010.

Gonzales: Insya Allah Kita Menang

TIMNAS Indonesia siap melumatkan Malaysia, Minggu (26/12) di lapangan Bukit Jalil, Kuala Lumpur, Malaysia.

Pemko Medan Tutupi Ranking CPNS

MEDAN (Waspada): Peserta calon pegawai negeri sipil (CPNS) yang merasa dirugikan meminta kepada Pemko Medan untuk membuka semua hasil ranking yang telah diserahkan USU. Bila Pemko tidak bersedia, maka jelas ada indikasi perubahan hasil pengumuman. “Kita minta kepada Kepala Badan Kepegawaian Daerah (BKD) Medan untuk membuka semua hasil perangkingan tersebut. Kalau memang tidak ada permainan dilakukan pihak panitia kenapa tidak berani membuka hasil perangkingan tersebut,” kata Fahmi salah seorang peserta CPNS yang dalam website Pemko dinyatakan lulus namun di pengumuman tertulis tidak ada namanya kepada Waspada, Jumat (24/12). Lanjut ke hal A2 kol 1

Pelatih Malaysia: Tak Peduli Cedera Gonzales

K UA L A L U M P U R (Waspada): Tim nasional (Timnas) sepakbola Indonesia tiba di Kuala Lumpur International Airport (KLIA) Malaysia, Jumat (24/12) sekitar pukul 12:30 waktu setempat, dua hari menjelang laga final leg pertama Piala AFF 2010. Pasukan Garuda tersebut disambut oleh siswa-siswa Sekolah Indonesia Kuala Lumpur (SIK) dengan kalungan

bunga. Penyerang timnas, Christian Gonzales mengatakan bahwa timnya siap bermain untuk memenangkan pertandingan. “Kami dalam kondisi fit, Insya Allah kita menang. Doakan kami menang,” kata Gonzales. Sementara Ketua Umum PSSI Nurdin Halid mengatakan bahwa tim dalam kondisi baik. “Para pemain sudah mempersiapkan diri dengan baik, bila ada yang cidera maka penggantinya juga kualitasnya baik,” kata dia.

Nurdin Halid berharap pertandingan antara Indonesia dan Malaysia yang digelar Minggu (26/12) di Stadion Bukit Jalil, Selangor, Malaysia, tersebut berjalan lancar. “Kami juga sudah minta kepada pihak Malaysia agar keamanan dapat terjaga dengan baik,” katanya. Ia mengatakan, “Kami sudah biasa bertemu dengan Malaysia dan kami cukup optimistis untuk memenangkan pertandingan ini.” Di babak penyisihan sebelumnya Indonesia menekuk Malaysia dengan skor 5-1. Dalam rombongan terlihat

pelatih Alfred Riedl beserta para pemain berjalan dengan santai dan langsung menuju tempat istirahat. Warga Indonesia Di Malaysia Antusiastis Masyarakat Indonesia di Malaysia antusiastis untuk menyaksikan laga final leg pertama Piala AFF 2010 di Stadion Bukit Jalil, Selangor, Malaysia pada 26 Desember. Para pendukung tim nasional sepakbola Indonesia itu datang dari berbagai tempat di Semenanjung Malaysia seperti Kuala Lumpur, Selangor, Lanjut ke hal A2 kol 3

Banjir Landa Sigumpar,Tobasa, Ratusan Ha Sawah Tergenang Air

sangka, merupakan urutan dari keberhasilan Polres Madina. Sebelumnya satuan narkoba berhasil menangkap empat pengedar daun ganja kering dari tiga lokasi yang berbeda di daerah itu,dimana tiga

BALIGE (Waspada): Akibat tinggi curah turun sejak 22 hingga 24 Desember 2010 mengakibatkan banjir melanda kawasan Kecamatan Sigumpar, Kabupaten Toba Samosir sehingga ratusan sawah yang berada di pinggir Jalan Lintas Sumatera (Jalinsum) tergenang air dan diprediksi akan membuat gagal panen. Pantauan Waspada di lokasi, Jumat (24/12) terlihat derasnya turun hujan kembali mendatangkan bencana banjir dan daerah simpang Puskesmas Sigumpar tergenang air hingga setinggi lutut orang dewasa. Sempat terjadi kecelakaan lalu lintas, dimana satu unit mobil angkutan kota terbalik di tengah-tengah badan jalan tergelincir akibat arus air yang cukup deras, Kamis (23/12). Hingga berita ini diturunkan, 3 unit alat berat keruk milik Pemkab Tobasa dan PT TPL terus mengeruk di lokasi kejadian untuk memperlancar aliran air ke dalam sungai yang

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 7

Waspada/Munir Lubis

GANJA:Kapolres Madina AKBP Hirbak Wahyu Setiawan didampingi Kasat Narkoba AKP Hendra saat memeriksa mobil Toyota Avanza B 8157 NO yang digunakan kelima tersangka membawa daun ganja 10 bal dari Madina ke Sumbar di Mapolres Madina Kamis ( 23/12).

Lagi, Polres Madina Ringkus 5 Pengedar Ganja Antar Provinsi PANYABUNGAN (Waspada): Aparat satuan narkoba Polres Madina kembali meringkus lima tersangka pengedar daun ganja kering antar provinsi dalam suatu operasi digelar pada Selasa (21/12) dinihari. Penangkapan kelima ter-

Al Bayan

Syahadat Praktek Oleh: H. Syarifuddin Elhayat ZAMAN dulu, ada sebuah pedepokan pembinaan anak-anak nakal (madat—istilah sekarang narkoba) dan bekas penjahat, mereka diajar dan dibina oleh seorang syekh yang mumpuni dengan metode agama,sehingga para santrinyapun berubah baik dan mendapatkan ketenangan tinggal di pedepokan tersebut. Satu ketika sang guru menerima murid-murid baru yang juga datang dari kalangan anak nakal dan penjahat. Saat halaqoh diadakan,para santri senior protes pada syekhnya. “Kalau tuan guru kurang selektif menerima santri baru, bisa jadi ketenangan belajar kami akan terganggu,” begitu kata mereka. Baik, kata sang guru, saya hanya menerima para murid yang bisa bersyahadat dengan baik, sehingga diapun akan mudah menerima pelajaran dan pembinaan dengan baik. “Jadi apakah murid baru yang tuan syekh terima hari ini syahadatnya lebih fasih ketimbang kami maupun orang-orang yang guru tolak,” kata santri senior.

Lanjut ke hal A2 kol 2

Anak Nelayan Tewas Di W aduk Waduk Kolam Sapi BIREUEN (Waspada): Ahmad Yani,7, putra dari M.Yusuf Piah, 45, seorang nelayan miskin di Desa Peuneulet Tunong, Kecamatan Simpang Maplam, Bireuen, Kamis (23/12) sekira pukul 00:00 ditemukan dalam kondisi tak bernyawa lagi dalam sebuah waduk kolam sapi berkedalaman 3 meter. Korban tewas diduga terpeleset saat memancing ikan di kolam, yang berjarak 300 meter dari rumahnya itu. Keterangan yang dihimpun Waspada Jumat (24/12) di rumah duka, anak malang itu yang masih duduk di bangku sekolah MIN itu, sebelum tenggelam, Kamis (23/12) pagi, pergi memancing ke waduk kolam sapi. Ketika berada di lokasi itu, korban sempat dilihat dua warga yaitu Nazir Idris dan Tgk A Wahab, Bahkan, Nazir Idris saat melintas di lokasi korban berada sempat menanyakan kepadanya kenapa tidak sekolah. Namun korban tidak Lanjut ke hal A2 kol 7

Syahrini Ke Malaysia, “Yakin 100% Menang” JAKARTA (Waspada): Penyanyi Syahrini akan terbang langsung untuk mendukung skuad Merah putih tersebut. Syahrini berangkat pada Minggu (26/12) pagi. Mantan teman duet Anang ini mengaku tak memiliki persiapan khusus. Tetapi, pelantun ‘Jangan Memilih Aku’ ini akan membawa atribut untuk mendukung pasukan Garuda tersebut. “Aku paling bawa spanduk ‘I Love Bambang Pamungkas, I Love Okto’. Aku juga akan pakai baju merah. Kita akan memerahkan Stadion Bukit Djalil demi Timnas Indonesia,” kata Syharini saat ditemui di kantor Kementerian Tenaga Kerja dan Transmigrasi, Kalibata, Jakarta Selatan. Penyanyi asal Bogor ini yakin skuad asuhan Alfred Riedl itu akan mampu mengalahkan Malaysia. Ia berharap Timnas menang telak seperti pada awal babak penyisihan. “Kayaknya sih kalau lawan Malaysia sih yakin 100% menang. Kalau melihat pengalaman kemarin Indonesia vs Malaysia. Aku kan lihat langsung juga di stadion,” ujarnya. (vivanews)

Yuni Shara Yakin Menang

Waspada/Jimmi Sitinjak

TERENDAM: Ratusan hektare areal persawahan tergenang air akibat bencana banjir derasnya turun hujan, sebagaimana foto yang direkam, Jumat (24/12).Akibat tinggi curah turun sejak 22 hingga 24 Desember 2010 mengakibatkan banjir melanda kawasan Kecamatan Sigumpar sekitarnya sehingga ratusan sawah yang berada di pinggir jalan lintas sumatera (Jalinsum) tergenang air dan diprediksi akan membuat gagal panen.

HISTORY HISTORY

Mengenang 6 Tahun Tsunami :

Ratusan Siswa Gelar Doa Bersama

Waspada/Syarif Ali Usman

Candi Sipamutung di Desa Siparau Kec. Barumun Tengah hampir terlupakan, sarana perhubungan menuju lokasi ini belum tersentuh pembangunan menyebabkan keberadaan situs budaya tersebut jarang dikunjungi wisatawan.

Candi Sipamutung Padanglawas Butuh Perhatian CANDI Sipamutung di Desa Siparau, Kec. Barumun Tengah, Kab. Padanglawas merupakan bukti sejarah peradaban yang diperkirakan berdiri pada abad XI, kini kondisinya tidak terawat dan butuh perhatian serius.

JAKARTA (Waspada): Meski mengaku tak suka sepakbola, Yuni Shara tetap mengikuti pemberitaan soal tim nasional Merah Putih yang akan melawan Malaysia di ajang Piala AFF 2010. Yuni memperkirakan jika Indonesia tetap fokus dan bermain bagus seperti pertandingan sebelumnya, Indonesia pasti mampu mengatasi Malaysia. “Kemenangan itu kan bisa didapat kalau Indonesia fokus. Kalau nggak fokus mana mungkin kita bisa menang,” kata Yuni saat ditemui di Studio RCTI, Jakarta Barat, Jumat (24/12). Penyanyi bertubuh mungil ini sangat antusias melihat animo masyarakat yang begitu besar untuk memberikan dukungan demi pasukan Merah Putih. “Saya kagum sama pendukung putra bangsa. Penonton Indonesia rela antre berjam-jam mendukung Timnas Indonesia,” ucapnya. Semakin bagusnya penampilan skuat asuhan Alfred Riedl ditambah dengan dukungan penuh dari masyarakat Indonesia dianggap kakak Krisdayanti ini sebagai sebuah kekuatan yang akan membawa prestasi. Yuni berharap Indonesia bisa menang di kandang Malaysia. (vivanews)

Candi yang dikelilingi oleh rangkaian perbukitan rendah tersebut terletak di di pinggir Sungai Barumun yang membelah dataran Padanglawas dan berjarak sekitar Lanjut ke hal A2 kol 3

BANDA ACEH (Antara) : Ratusan siswa siswi di sekolah Madrasah Ibtidaiyah Negeri (MIN) Lhoknga, Kecamatan Lhoknga, Kabupaten Aceh Besar, Jumat, mengikuti doa bersama mengenang enam tahun tsunami yang terjadi pada 26 Desember 2004. Ratusan siswa yang didampingi guru di sekolah itu tampak larut dalam bacaan Surat Yasin guna mendoakan sanak keluarga, siswa dan dewan guru yang meninggal dalam musibah di penghujung tahun 2004 itu. “Doa bersama di sekolah tersebut kami gelar lebih awal, mengingat pada peringatan tsunami tersebut sekolah libur,” kata Kepala Sekolah MIN Lhoknga Amatan Azizah. Pernyataan itu disampaikannya usai pelaksanaan doa bersama di mushala sekolah yang berada di kawasan Gampong Lamkruet, Kecamatan Lhoknga, Jumat (24/12). Disebutkannya, sebanyak 280 siswa yang terdiri dari kelas satu sampai kelas enam dan 26 dewan guru ikut serta da-

lam doa bersama yang berlangsung di sekolah yang berjarak sekitar 14 kilometer dari kota Banda Aceh. MIN Lhoknga merupakan salah satu daerah pesisir yang hancur akibat tsunami Aceh itu. Ia menambahkan, pelaksanaan doa bersama di seko-lah tersebut telah direncakan lebih awal dan telah diberitahukan kepada siswa agar dapat membawa Yasin pada hari Jumat. “Alhamdulillah seluruh siswa membawa semuanya, meskipun ada siswa yang belum bisa membaca dengan lancar mereka tetap antusias untuk mengikuti doa sampai selesai,” demikian Amatan.

Serampang - Jangan sampai menendang tv .... - He.... he....he....


Berita Utama

A2

Pemko Medan ....

Menurutnya, dugaan terjadinya perubahan hasil pengumuman semakin menguat dengan tidak bersedianya pihak panitia mengumumkan hasil ranking di Kantor BKD Medan. “Kalau memang BKD tidak bermain, kenapa mereka tidak menempelkan hasil pengumuman ranking tersebut. Dari awal mereka telah mengatakan bahwa rekrutmen CPNS tahun 2010 secara transparan dan terbuka. Tapi apa buktinya? Untuk melihat ranking itu, kita dibola-bola oleh BKD,” katanya. Demikian juga dikatakan orangtua Sabrina, Kamal Fahri Lubis, yang juga menjadi korban dalam penerimaan CPNS. Dia menduga penerimaan CPNS Pemko Medan ini penuh dengan kucurangan. Ini merupakan indikasi korupsi. Pantauan Waspada, Jumat (24/12), dari mulai waktu pengumuman, Rabu (22/12), pihak panitia tidak ada menempelkan hasil pengumuman CPNS maupun hasil rangking di Kantor Walikota Medan. Para peserta CPNS merasa kecewa karena BKD Medan hanya mengharapkan pengumuman dari koran. “Kita bukan tidak percaya sama koran, tapi kan lebih puas kalau ada pengumuman di Kantor BKD. Ini menunjukkan pihak BKD tidak bekerja dengan serius,” katanya. Sementara itu, Kepala BKD Kota Medan Lahum ketika dikonfirmasi mengatakan,

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Me3. 2. KxGd4, Mf2+mat. Atau 2. Me1, Mg1+mat.

Jawaban TTS: TTS Topik

R E F I L K A M A N I T U N O F R O P R M H A S I

Infokom

E R E N S I E N N T E K U S P T I F A T R P D A E S E R T O U O O F S T T R D W A R E A L R E P O

P N O L L U L I I F O R M U L I T R

I

I

S K A O G I M D U N T I I N K A T A E S R I N E P U T

E T

Jawaban Sudoku: 1 5 2 3 8 0 9 7 4 6

8 2 9 6 1 7 0 4 3 5

9 3 7 8 4 2 6 5 1 0

6 7 0 4 5 9 3 1 8 2

0 4 5 1 6 3 2 8 7 9

4 0 3 9 7 6 8 2 5 1

2 6 1 7 9 4 5 3 0 8

7 9 4 5 2 8 1 0 6 3

3 1 8 2 0 5 7 6 4 9

5 8 6 0 3 1 4 9 2 7

hasil perankingan bisa saja dibuka tetapi harus ada kesepakatan antara USU, DPRD dan Walikota Medan. “Kita tidak bisa membuka sembarangan karena bisa saja ada pelamar yang tidak setuju kalau hasilnya diketahui orang banyak karena rendah. Makanya susah kita membukanya,” katanya berkilah. USU siap membuka Secara terpisah Humas USU Bisru Hafi menyatakan, keterlibatan mereka dalam proses seleksi CPNS hanya pada pembuatan soal dan perangkingan nilai. Terkait adanya laporan perubahan hasil pengumuman itu sudah menjadi kewenangan tim seleksi CPNS, yakni kabupaten/ kota . “Kapasitas kami sesuai yang tertera dalam kontrak hanya membuat naskah soal dan memberi perankingan nilai. Terkait penunjukan hasil ujian secara transparan, hal itu tidak bisa dilakukan USU, sebab kapasitasnya tidak dalam menyampaikan hasil ujian kepada masyarakat,” katanya. Ketika ditanya bila pengadilan maupun KPK meminta hasil ujian dibuka, Bisru Hafi menjawab kalau memang diminta pihaknya bersedia untuk membukanya. “Kalau memang diminta penegak hukum untuk dibuka, maka kita siap membukanya. Namun, kalau tidak ada, ya tidak mungkin dibuka,”ungkapnya. Adapun sembilan peserta CPNS yang dirugikan di antaranya, Didi Prayuda Sembiring. Dia ikut ujian untuk mengisi formasi D3 akutansi. Kemudian Sarbina, yang mengikuti program S1 akutansi. Selanjutnya Basara Lestari dan Dosma Lasniroha Tambunan, Inri Andalta Sitepu M a r i a A r b i n a Ta m b u n melamar jabatan Analisis Hukum, Fahmi melamar jabatan Penjaskes. Kesembilan peserta ini telah dinyatakan lulus dalam website, namun hilang dipengumuman. (m50/m41)

Shahadat ....

Tuan Syekh menjawab, ”Kalaulah yang antum (kamu) maksudkan hanyalah membaca syahadatain semata, orang-orang munafik bahkan kuffar sekalipun banyak yang dapat lebih fasih membacanya, sedangkan syahadat yang saya maksudkan adalah ucapan mereka yang tidak bertentangan antara ikrar dan perbuatannya serta amalannyapun akan bersandar pada kalimah itu. Itulah sesungguhnya yang luput dari praktek kita seharihari.Wallahu a’lam.—Iyo pulak,benar juga tua kata tuan syekh, bahwa syahadat “praktek, adalah syahadat yang kita ucapkan dengan lidah, dibenarkan oleh hati dan diikuti dengan amal perbuatan (Iqroor Billisan, Tashdiq bil Qolb, wa amalun bil fi’li).— Itulah baru hidup dalam ber Syahadatain. Bagaimana kita Ncek,Lenteralah…..

Sabtu 25 Desember 2010

Bupati Tapsel Minta PWI Tingkatan Profesionalitas Dan Kemitraan

DPRD Desak Angkutan Liar Ditertibkan P.SIDIMPUAN (Waspada): DPRD Kota Padangsidimpuan, mendesak pemerintah kota menertibkan keberadaan angkutan liar yang kian menjamur. “Keberadaan jasa pengangkutan umum yang diduga tidak memiliki izin resmi dari pemerintah kota Padangsidimpuan kian menjamur. Sayangnya, sejauh ini pemerintah belum melakukan tindakan-tindakan tegas terhadap pemilik usaha,”ungkap wakil ketua Komisi II DPRD Padangsidimpuan, Khoiruddin Nasution kepada Waspada ketika ditemui, Jumat (24/12) Dijelaskan, keberadaan angkutan liar sudah menyalahi Undang-undang Nomor 22 tahun 2009 tentang lalu lintas. Dikatakan, pemerintah sudah banyak dirugikan dengan menjamurnya angkutan liar salah satunya dari sektor pajak daerah. Angkutan-angkutan pribadi yang menjadi angkutan umum tidak membayar pajak sesuai dengan aturan yang berlaku. Sebab, angkutan pribadi itu membayar pajak sebagai angkutan pribadi bukan sebagai angkutan sewa. “Pajak angkutan umum lebih tinggi daripada pajak angkutan pribadi, makanya daerah sudah dirugikan,”ujarnya. Dijelaskan, harusnya seluruh angkutan sewa di kota Padangsidimpuan harus memakai plat kuning. Namun, pada kenyataannya, banyak mobil angkutan yang menggunakan plat hitam atau angkutan pribadi. “Kami mendesak agar pemerintah segera menertibkan semua angkutan berplat hitam itu, karena sudah merugikan daerah,”ungkapnya. Selain itu, angkutan sewa harus mengikut sertakan organisasi yang digunakan. PAD Meningkat Sekretaris Komisi II DPRD Padangsidimpuan, Sopian Harahap juga menyesalkan sikap pemerintah yang terkesan tidak peduli. Padahal menurutnya, jika pemerintah bertindak tegas maka PAD Padangsidimpuan akan meningkat. Selama ini, pengutipan pajak daerah dari sektor pengangkutan tidak maksimal. Dikatakan, pemerintah harus meninjau izin operasi para angkutan, sebab banyak dugaan mereka tidak memiliki izin yang lengkap dari pemerintah. Lebih lanjut dia mengatakan, keberadaan loket angkutan liar itu juga sudah meresahkan para pengguna jalan, karena akibat banyak angkutan maka jalanan yang berada di daerah itu semakin macet dan tidak terkendali. “Saya juga meminta Dinas Perhubungan untuk menertibkannya, karena sudah meresahkan warga terutama para pengguna jalan,”ujarnya. Iman Hasibuan, 30, salah seorang pengendara sepeda motor mengakui sangat terganggu dengan keberadaan angkutan liar tersebut. Sebab, angkutan liar itu membuat arus lalu lintas yang berada di kawasan itu menjadi macet dan semraut. “Saya meminta kepada pemerintah untuk segera menertibkannya, karena tempat parkir mobil itu sudah mengganggu kelancaran arus lalu lintas. (crm)

WASPADA

Waspada/Ist

AUDIENSI PWI: Bupati Tapsel, Syahrul M Pasaribu, menerima audensi pengruus dan panitia konfrensi PWI Tabgsel di ruang kerjanya, Rabu (22/12) malam. Bupati Tapsel minta PWI meningkatkan profesionalitas dan kemitraan bersama pemerintahan daerah yang dia pimpin.

P.SIDIMPUAN (Waspada): Bupati Tapanuli Selatan, H Syahrul M Pasaribu, meminta Persatuan Wartawan Indonesia (PWI) sebagai wadah pers terbesar dan tertua di negara ini untuk meningkatkan profesionalitas dalam tugas, dan kemitraan berasama pemerintahan daerah yang dipimpinnya saat ini. Hal itu disampaikan Bupati Tapsel saat menerima audensi panitia konfrensi keIV dan pengurus PWI Perwakilan Tapanuli Bagian Selatan, (Tabagsel) di ruang kerjanya, Rabu (22/12) malam. “Mungkin jarang ada kepala daerah yang mau menerima

Polres Madina Gelar Operasi Cipta Kondisi

Waspada/Munir Lubis

OPERASI CIPTA KONDISI: Jajaran Polres Madina saat melakukan Operasi Cipta Kondisi di jalinsum depan Mapolres Madina , Kamis(23/12).

Gonzales: ....

PANYABUNGAN ( Wa s p a d a ) : M e n j e l a n g perayaan Natal dan Tahun Baru 2011,jajaran Polres Kabupaten Mandailing Natal menggelar Operasi Cipta Kondisi. Operasi mulai dilaksanakan Kamis ( 23/1) sore di jalinsum depan Mapolres Ma d i n a d e n g a n s a s a ra n pengendara roda dua dan empat yang melintas. Puluhan personel anggota Polres Madina diterjunkan. Selain menggeledah barang bawaan digunakan untuk tindak kejahatan seperti senjata tajam,senpi dan barang haram, polisi juga mengecek kelengkapan surat-surat kendaraan bermotor. ”Operasi Cipta Kondisi digelar sebelum Operasi Lilin dan ini bertujuan untuk mengantisipasi hal-hal yang tidak diinginkan pada perayaan Natal dan Tahun Baru 2010 nanti,” ujar Kapolres Madina KBP Hirbak Wahyu Setiawan didampingi Kabag Humas Iptu E.Banjar Nahor Kamis ( 23/12). (a24)

khawatir tidak laku, tetapi kemudian pihak Malaysia akhirnya yang melakukan penjualan dan kami hanya menyiapkan lokasi loket penjualan tiketnya. Jadi risiko ditanggung the Football Association of Malaysia (FAM), seperti PSSInya Malaysia,” kata Da’i. Ia mengatakan, sampai hari ini sudah lebih 9 ribu tiket terjual dan tersisa 3 ribu lembar tiket karena PSSI membeli lagi 1.500 tiket tambahan. Tak Peduli Cedera Gonzales Kabar kurang fitnya striker kunci timnas Indonesia, Cristian Gonzales terdengar juga ke telinga pelatih Malaysia, Rajagobal Khrisnasamy. Meski demikian, pelatih berusia 54 tahun itu tidak mempedulikan cedera penyerang asal Uruguay tersebut. “Ini bukan keuntungan

atau menjadi kerugian bagi kami. Saya yakin mereka memiliki pilihan lain. Semua 22 pemain mereka mampu melawan kami,” kata Rajagobal seperti dilansir dari New Straits Times. Gonzales mengalami cedera paha dua hari lalu saat menjalani sesi latihan timnas Indonesia di Lapangan C Senayan, Jakarta. Walaupun mengalami cedera, striker berusia 34 tahun itu tetap akan diturunkan di leg 1. Meski berita cedera Gonzales santer terdengar, untuk saat ini Rajagobal mengaku hanya ingin fokus untuk mempersiapkan timnya saat bertemu dengan Indonesia di leg 1 di Stadion Bukit Jalil, Minggu (26/12). “Saya hanya ingin fokus. Kami akan bermain dan mempersiapkan diri untuk hari

Minggu nanti,” jelas Rajagobal. Rajagobal sadar, bermain di partai final bukanlah laga mudah. Untuk itu, ia berharap anak asuhnya bisa fokus dan tidak dalam tekanan bermain di hadapan pendukung sendiri. Harus Menang 3-0 Wakil Presiden Federasi Sepakbola Malaysia (FAM) Te n g k u Ab d u l l a h Su l t a n Ahmad Shah berharap skuad arahan K. Rajagopal mampu menundukkan Tim Garuda dihadapan publik Bukit Jalil. “Saya berharap dan menilai kita (Malaysia) butuh kemenangan besar, paling tidak 3-0 sebagai bekal untuk melakoni leg kedua di Jakarta,” ungkap Tengku Abdullah saat memantau latihan timnas Malaysia di Wisma FAM, sebagaimana diutip Utusan Online, Jumat (24/1). (ant/vivanews)

Lagi, Polres ....

patnya merupakan warga Kelurahan Tanah Garam Kecamatan Lubuh Sikarak, Kota Solok, Sumatera Barat. Sebagai barang bukti diamankan 10 bal daun ganja kering dibalut dengan lakban warna kuning,satu buah tas warna hitam, dua unit HP dan satu minibus B 8157 NO warna hitam. Kapolres Madina AKBP Hirbak Wahyu Setiawan didampingi Kasat Narkoba AKP Hendra dan Kabag Humas Iptu Banjar Nahor di Mapolres Madina Kamis ( 23/12) mengatakan, dimankannya kelima tersangka berikut barang bukti, berawal dari informasi warga bahwa pada Senin (20/12) malam di kawasan Kecamatan Tambangan ada satu unit mobil minibus berpe-

numpang lima orang diperkirakan pengedar ganja antarprovinsi akan membawa ganja dari Madina ke Sumbar melalui jalur darat dengan melintasi kawasan Kotanopan. “Setelah diperiksa, tersangka memiliki 10 bal daun ganja kering bernama AAC dan ke empat tersangka lainnya hanya tukang perantara atau kurir yang datang dari Kota Solok ke Desa Laru Lombang untuk menjemput tersangka AAC dengan imbalan upah sebesar Rp 200 ribu setelah daun ganja berhasil dibawa pulang kembali ke Kota Solok,” katanya. Hirbak mengatakan,daun ganja seberat 10 bal itu dibeli AAC dari bernama Kosim (DPO) di Desa Laru Lombang, Ke c a m a t a n Ta m b a n g a n ,

Kabupaten Mandailing Natal pada Selasa (21/12) sekira pukul 02:00 dengan harga Rp 600 ribu per bal Untuk mempertanggungjawabkan perbuatannya, kelima tersangka kini mendekam dalam sel tahanan Polres Madina dan kepada mereka dikenakan melanggar pasal 111 ayat (2) subs pasal 114 ayat (2) subs pasal 115 ayat (2) Undang-undang RI nomor 35 tahun 2010 tentang narkotika golongan satu ( ganja). Dalam priode tiga bulan terakhir lanjut Hirbak ,jajaran Polres Madina sudah berhasil mengungkap 12 kasus peredaran daun ganja, dengan mengamankan 29 tersangka berikut barang bukti 6 mobil dan sekira 100 bal daun ganja kering. (a24)

Candi Sipamutung ....

benteng yang juga tempat pemujaan, karena masih terdapat bekas dinding dari bahan tanah dan parit pembatas mengelilingi kompleks candi diperkirakan seluas 100 hektare. Hal ini sesuai dengan pendapat warga asli yang telah bertempat tinggal daerah itu sejak dari moyang mereka yang umumnya bermarga Harahap, Siregar, Hasibuan dan Daulay. Beberapa kalangan menyebut Candi Sipamutung merupakan satu-satunya candi yang didirikan umat Budha dan paling megah di antara candi yang terdapat di Kab. Padanglawas dan Padanglawas utara yang umumnya didirikan umat Hindu. Bentuk dan ukurannya terdiri dari sebuah biara induk menghadap ke timur dengan denah bujur sangkar berukuran 11 X 11 meter, tinggi 13 meter. terdiri dari bagian kaki, badan dan atap. Sedangkan di kedua sisinya terdapat 6 biaro yang lebih kecil, pada bagian bawahnya tersusun 16 buah stupa yang lebih kecil. Lima buah Biaro dari bata dan sebuah dari batu andesit.

Biaro-biaro yang terbuat dari bata adalah Biaro perwara di sebelah timur candi induk berbentuk mandapa berdenah segi empat berukuran 10,25 X 9,9 meter, tinggi 1,15 meter. Kompleks candi ini dikelilingi tembok berukuran 74 x 74 meter dengan pintu masuk sejenis gapura. Di daerah Padanglawas, yang berdekatan tersebut terdapat sedikitnya 11 candi yang sebagia sudah dipugar yaitu Candi Bahal I, Bahal II dan Bahal III di Desa Portibi Paluta. Candi Tandihat I dan Tandihat II, Candi Manggis. Candi Stopayan, Candi Paya, Candi Pulo, Candi Sangkilon di Palas. Namun popularitas candi Sipamutung yang menjadi pelengkap cagar budaya dan keindahan alam Bumi Padanglawas itu tertinggal dari candi yang lainnya. Hal ini disebabkan sarana perhubungan menuju situs budaya tersebut belum tersentuh pembangunan dan hal ini menjadi salah satu pemicu pesona wisata candi Sipamutung kian terlupakan. Selain itu, kesadaran warga setempat untuk ikut memelihara situs kuno tersebut ma-

sih kurang. Lingkungan candi yang dipagar dengan kawat berduri telah rusak, sehingga kerbau piaraan wargapun masuk dan merumput di lokasi candi. Me n u r u t k e t e r a n g a n warga, juru kunci atau penjaga candi yang dihunjuk dari masyarakat setempat, sebanyak empat orang tidak pernah bekerja atau menjalankan tugasnya, sehingga hewan piaraanpun bebas keluar masuk. Kepala Dinas Pemuda dan Olahraga Padanglawas H. Khoiruddin Harahap didampingi Kabid Kebudayaan di Sibuhuan, Sabtu (11/12), mengatakan Pemkab Padanglawas sadar akan potensi wisata berupa candi di daerah tersebut, karena itu Pemkab telah merencanakan pembenahan infrastruktur demi mengembangkan wisata. “Keinginan untuk merenovasi dan menjadikan cagar budaya tersebut menjadi daerah wisata pasti ada, karena tujuannya adalah untuk menarik minat para wisatawan baik lokal mau pun luar negeri agar berkunjung ke sana,” ujar H.Khoir. * Syarif Ali Usman

Johor, bahkan banyak yang datang langsung dari Indonesia. Duta Besar Indonesia untuk Malaysia Da’i Bachtiar mengatakan di Kuala Lumpur, Jumat (24/12), animo masyarakat Indonesia untuk menonton langsung sangat tinggi sehingga tiket yang dijatahkan untuk suporter Indonesia sebanyak 15 ribu lembar sepertinya kurang. “Saya menerima informasi dari tempat penjualan tiket di KBRI sudah hampir habis. Pagi tadi masih tersisa sekitar 3.000 tiket. Sepertinya kalau melihat besarnya minat masyarakat maka tiket akan terjual semuanya,” katanya. Para pendukung Tim Garuda yang akan meramaikan Stadion Bukit Jalil itu membeli tiket di loket KBRI. “Sebelumnya saya sempat dari empat tersangka merupakan pengedar antar provinsi karena berasal dari Kota Padang Sumbar. Selain membekuk ke empat tersangka, petugas juga berhasil menyita barang bukti berupa 35 bal daun ganja kering, satu unit mobil Daihatsu Xenia BA 1142 BN warna silver, satu unit sepeda motor Suzuki merk SPIN BA 6087 WW dan dua buah HP nokia type 1202 dan 6220. Kelima tersangka yang ditangkap petugas di jalan umum Muarasipongi, Kecamatan Muarasipongi Selasa (21/12) yakni AAC,32, warga Kampung Jawa No 688 Kecamatan Tanjung Harapan Kota Solok, NG alias W,20, DZP,23, BS,21, dan HMP, 20, keem40 km dari Ibu kota Kab. Padanglawas, Sibuhuan. Menuju lokasi candi, jalan aspal hanya sampai di Desa Binanga (Ibu kota kecamatan) dan melewati jalan desa sepanjang 3 km. Kemudian meniti jembatan gantung yang berada di atas sungai Barumun. Kompleks candi berjarak 250 meter dari pinggir aliran Sungai Barumun. Sejumlah pendapat mengatakan lokasi tersebut merupakan titik awal dari asalusul manusia zaman dahulu memasuki wilayah Padanglawas dan sekitarnya, karena pada saat itu perjalanan hanya dapat dilalui melalui jalur laut dan sungai. Pendapat itu menyatakan para leluhur memasuki Padanglawas melalui Laut Labuhan Bilik (Labusel) kemudian berangsur menuju Sungai Barumun dan menemukan Padanglawas sebagai tanah harapan. Melihat keadaan lokasi dari luar kompleks candi, kemungkinan kawasan yang jadi perkampungan Desa Siparau dan didiami 160 KK tersebut adalah bekas sebuah

audiensi pada malam hari. Tapi inilah saya, asalkan demi hubungan kemitraan yang baik dan bertujuan untuk pembangunan daerah ke arah yang lebih maju, saya siap kapan saja,” katanya mengawali perbincangan. Syahrul Pasaribu yang pernah mengikuti pelatihan jusrnalistik mengaku sudah tidak asing lagi dengan PWI. Karena telah mengenalnya lebih dalam, apalagi para pengurus PWI Cabang Sumatera Utara dalam beberapa periode terakhir. “Saya sudah tahu banyak tentang kontribusi positif dan peran penting PWI dalam pencampaian pembangunan di Sumut. Karenanya saya sangat berharap hal yang sedemikian itu juga tercipta di Tapsel,” kata anggota DPRD Sumut tiga periode itu. Terkait konfrensi, Syahrul menyebut agenda ini merupakan keharusan dan kegiatan rutin di setiap akan berakhirnya masa periodesasi kepengurusan lama. Karena itu, Bupati berharap konfrensi PWI Perwakilan Tabagsel ini tidk menimbulkan perpecahan di antara anggota yang keseluruhannya 33 orang. “PWI adalah organisasi profesi, konfrensi ini jangan dipolitisasi, karena akan menimbulkan perpecahan sesama anggota. Manuver itu hal biasa, namun kebersamaan dan kekompakan antar sesama itu harus lebih diutamakan. Buktikan PWI organinasi profesional yang diisi kalangan intelek,” pesannya. Kepada panitia dan pengurus PWI Perwakilan Tabagsel, Bupati berpesan agar siapapun yang terpilih sebagai ketua dan pengurus nanatinya, tetaplah menjalin kemitraan dan kerjasama dengan Pemkab Tapsel. Karena Pemkab Tapsel sangat membutuhkan kerjasama dan peran serta segenap elemen masyarakat dalam

pencapaian kemajuan pembangunan dan peningkatan kesejahteraan rakyat. “Kekompakan dan kebersamaan kunci segalanya,” ujar Bupati. Sementara Ketua PWI Perwakilan Tabagsel, Syaripuddin Nasution, menyambut baik dan sangat setuju dengan harapan Bupati Tapsel tersebut. Katanya, PWI selama ini tetap memiliki hubungan kemitraan yang baik dengan Pemkab Tapsel. Semoga di bawah kep e m i m p i n a n Sy a h r u l M Pasaribu kemitraan itu semakin meningkat. Pa d a k e s e m p a t a n i t u Syaripuddin Nasution juga menyampaikan harapan kepada Bupati, yakni dalam hal upaya peningkatan profesionalitas wartawan di daerah itu. “Kiranya Pemkab Tapsel di tahun-tahun mendatang, sudi kiranya memprakarsai pelaksanaan pelatihan-pelatihan jurnalistik. Kamid ari PWI siap untuk bekerjasama dalam penyelenggaraannya,” katanya. Ketua Panitia Konfrensi, Parlagutan Harahap, pada kesempatan itu juga menyampaikan harapan dan permohonan dukungan dari Pemkab Tapsel. Dalam rangka mensukseskan konfrensi yang akan akan digelar 15 Januari 2010 di Sibuhuan, Kab. Padanglawas. Hal senada juga disampaikan pengurus PWI Perwakilan Tabagsel, H Basyrah Batubara. “Kami sangat mengharap dukungan Pemkab Tapsel dalam kesuksesan konfrensi ini. Kemudian PWI juga siap meningkatkan kemitraan bers a m a Pe m k a b t a p s e l k e depan,” ujarnya. Turut hadir dalam audiensi itu, Sekretaris dan Bendahara Panitia Konfrensi, Riswandy dan Sukri Falah Harahap. Sedangkan Bupati Tapsel didampingi Kasubbag Humas Protokol, Juprianto Gultom. (a20)

Anak Nelayan ....

korban, juga saat itu tidak melihat ada korban di lokasi, namun hanya melihat ada kail yang tergeletak di tempat itu. “Halimah kakaknya korban, tidak melihat adiknya di tempat itu, tapi hanya menemukan pancing berbentuk gulungan tanpa gagang. Dari bukti itu, warga langsung menyisir waduk seluas 171 hektare itu dan juga menyelam,” tambah M Yusuf. “Akhirnya Kamis (23/12) sekira pukul 00:00 jasad anak saya ditemukan, tak jauh dari tanggul saluran air waduk tempat dia yang sempat dilihat warga sedang memancing ikan,” ujarnya. Warga memperkirakan Ahmad Yani jatuh ke kolam akibat terpeleset. “Waduk ini sangat dalam dan saat itu keadaan kawasan itu juga sepi,” kata M.Yunus Isa ditemani M.Jafar saat menunjukkan waduk. (amh)

menjawabnya dan terus memancing. Namun, alangkah kagetnya Nazir dan warga lain, karena ba’da Maghrib mereka mendengar kabar Ahmad Yani belum pulang ke rumah. Kedua orang tuanya M Yusuf dan Nurmi sangat cemas. Kecemasan dan kekhawatiran keduanya bertambah, setelah melintasi kawasan waduk itu tidak melihat ada anaknya berada di situ. “Jam lima sore, anak saya sempat pulang kerumah bawa pulang ikan belut kecil. Lalu pukul enam dia kembali pergi memancing ke waduk itu sendiri. Karena sudah magrib belum juga pulang, kami jadi khawatir, lalu mencari dan terus melaporkannya sama masyarakat,” kata ayah korban M.Yusuf Piah. M Yusuf juga mengatakan, anaknya Halimah, kakak dari

Waspada/Abdul Mukthi Hasan

JENAZAH Ahmad Yani disemayamkan di rumah orang tuannya Desa Peuneulet Tunong, Kecamatan Simpang Mamplam, Bireuen, Jumat (24/12).

Banjir Landa ....

berada di simpang Silimbat Kec.Silaen. Aktifitas tersebut sempat menimbulkan antrian panjang kendaraan dari Simpang YTP Arjuna Kec. Laguboti hingga Gapura Kec. Siantar Narumonda. Selain air yang menggenangi areal persawahan, banjir juga mengakibatkan kerugian bagi para petani tambak (kolam-red) ikan karena puluhan ekor ikan yang berada di dalam tambak-tambak berkeluaran terbawa arus air yang menghantam pembatas tambak hingga kepemukiman warga. Perekonomian Lumpuh Air hujan yang mengguyur terus menerus terlebih tiga hari terakhir, juga telah melumpuhkan perekonomian warga Sigumpar disebabkan

air juga menggenangi pusat jual beli lokasi Pasar Onan Silimbat setinggi kurang lebih 60 cm. Tampak para inang-inang hanya menumpuk barang dagangannya di pinggir jalan yang bertempat sedikit lebih tinggi dari lokasi banjir. Para pengemudi angkot juga merasakan imbas dari bencana itu. Bus angkutan umum jurusan Balige-Porsea juga terkena imbas dari bencana banjir. “Saya menyesal menarik hari ini, coba bayangkan, hanya untuk melintasi wilayah Porsea- Laguboti saja , harus memakan waktu hingga 1,5 jam. Seyogyanya waktu yang dibutuhkan untuk rute Porsea – Balige hanya berkisar 60 menit saja” kata Hutajulu, seorang sopir. (a33)


Medan Metropolitan

WASPADA Sabtu 25 Desember 2010

A3

Dispenda Medan Diragukan Kelola BPHTB

Waspada/Hamdani

BERDAGANG DI REL KA: Sejumlah pedagang kaki lima menggelar dagangan di lintasan rel KA di Jalan Kapten R Selian, Kecamatan Medan Belawan, Kamis (23/12). Buruknya penataan pasar tradisional di Medan Utara ini membuat pedagang berjualan di semberang tempat. Masyarakat mengharapkan Pemko memberikan relokasi tempat yang layak bagi para pedagang.

Lampu Jalan Rusak

MEDAN (Waspada): Pemko Medan dinilai terlalu memaksakan membuat Perda tentang Bea Pengalihan Hak Atas Tanah dan Bangunan (BPHTB). Menurut seorang anggota Pansus Ranperda BPHTB Khairuddin Salim, dipastikan Dinas Pendapatan Daerah (Dispenda) Medan belum siap melaksanakan Perda itu nanti. Khairuddin Salim berbicara kepada Waspada di gedung DPRD Medan, Kamis (23/ 12). Ketidakyakinannya terhadap kesiapan Dispenda Medan didasari atas studi banding Panitia Khusus (Pansus) Ranperda BPHTB ke Pemko Surabaya beberapa hari lalu. Diakui anggota Pansus dari Fraksi Partai Demokrat ini, Pemko Surabaya sukses melaksanakan Perda tentang BPHTB. Dalam setahun mereka mampu mengisi kas Pemko Surabaya Rp600 miliar lebih.‘’Tapi, Dispenda Surabaya telah melakukan persiapan sangat matang,’’ katanya. Untuk Pemko Medan, kata Khairuddin, sangat berbeda dengan yang dilakukan Pemko Surabaya. Perda tentang BPHTB Medan harus sudah terlaksana mulai 1 Januari 2011. Masalahnya, Pansus belum melihat persiapan yang dilakukan oleh Dispenda, sebagai instansi yang melaksanakan Perda tentang BPHTB ini. ‘’Katakanlah tentang struktur organisasi pengelola BPHTB. Juga tentang kesiapan pegawai yang menangani masalah ini,’’ ujarnya. Berbeda dengan yang dilihat Pansus di Pemko Surabaya. Kata Khairuddin Salim, jauh sebelum Perda tentang BPHTB diberlakukan, Dispenda Surabaya telah mempersiapkan diri dengan baik. Salah satunya adalah menjalin kerjasama dengan BPN untuk menerima pegawai magang dari Dispenda. Dia menilai, Pemko Medan terlalu memaksakan diri untuk mengambil pelaksanaan Perda tentang BPHTB ini. Diakui tujuannya memang baik untuk menambah pendapatan. Namun, menurut Khairuddin Salim, dengan persiapan yang sangat minim seperti ini, dikhawatikan pelaksanaan Perda nantinya tidak maksimal. Dia menyarankan, sebaiknya Pemko Medan melakukan uji coba dulu, sebelum mengambil alih peran itu secara keseluruhan.

Sebelumnya, mulai Januari 2011, BPHTB yang selama ini ditangani pemerintah pusat kini diserahkan pengelolaannya kepada pemerintah daerah sesuai dengan Undang-Undang No.28/ 2009 dan Peraturan Pemerintah No.69/2010. Walikota Medan Rahudman Harahap dan Kakanwil Pajak Sumut Yusri Natar Nasution telah menandatangani draf perjanjian yang menyatakan bahwa BPHTB menjadi pajak daerah di Kota Medan mulai tahun depan. Hal ini terungkap pada acara sosialisasi dan mekanisme UU No.28/2009 dan PP No.69/2010 yang dilaksanakan di Hotel Garuda Plaza Jalan Sisingamangaraja Medan, Kamis (23/12). Sosialisasi ini merumuskan langkah-langkah pengoperasian kegiatan pengutipan dan pengoptimalan pendapatan dari BPHTB tersebut. Bukan pekerjaan mudah Kakanwil Pajak Sumut I HYusri Natar Nasution mengatakan, pengelolaan BPHTB bukan pekerjaan yang mudah dan ringan. Diperlukan SDM yang benar-benar berkualitas sehingga dalam pelaksanaannya nanti tidak menemui masalah. “Untuk itu saya minta agar SDM pegawai Dispenda Kota Medan dapat ditingkatkan,” ujarnya. Menurut Yusri, hasil pendapatan yang diperoleh pihaknya dari pajak BPHTB sampai 22 Desember 2010 terealisasi 92 persen atau Rp179 miliar dari target yang ditetapkan, yakni Rp194 miliar. “Kita yakin ini akan bertambah lagi, sebab kita masih memiliki waktu untuk melakukan pengutipan,” jelasnya. Sedangkan hasil yang diperoleh dari hasil pengutipan PBB, lanjutnya, telah melebihi dari target yang ditetapkan. Sampai 22 Desember 2012, pihaknya telah berhasil mengumpulkan pajak PBB sebesar Rp216 miliar. Sedangkan target yang ditetapkan adalah Rp206 miliar. Yusri berharap dalam pengelolaan BPHTB harus bisa memberikan pelayanan terbaik kepada masyarakat. Kemudian, dituntut kesiapan dari DPRD Medan untuk menyiapkan Perda tentang PBB, sehingga pengelolaan bisa dilakukan Pemko pada 2012, tidak menunggu sampai 2014. “Kalau bisa lebih cepat mengapa tidak.” (m12/m50)

Pajak Tetap Dikutip MEDAN (Waspada): Pemerintah Kota Medan tidak peduli dengan keluhan masyarakat terhadap penerangan lampu jalan yang banyak rusak. Padahal, pada saat Walikota Medan Rahudman Harahap berkampanye janji bila terpilih akan memperbaiki semua lampu jalan yang rusak. Namun, itu semua hanya isapan jempol belaka. “Pada waktu kampanye dulu pak walikota selalu berjanji akan memperbaiki semua lampu jalan yang telah rusak. Tapi sampai saat ini janji itu tak

ada realisasinya. Padahal sudah hampir lima bulan menjabat Walikota Medan,” kata Burhanuddin warga Jalan Multatuli, Kecamatan Medan Maimon

Mulai 1 Januari NPWP Dan Fiskal Dihapus MEDAN (Waspada) : Mulai 1 Januari 2011 NPWP dan Fiskal Luar Negeri (FLN) tidak dipungut lagi kepada penumpang tujuan luar negeri melalui bandara dan pelabuhan laut. Kepala FLN Bandara Polonia Medan Mulyanto, kemarin, mengatakan, selama ini bagi yang tidak memiliki Nomor Pokok Wajib Pajak (NPWP) dan warga berusia 21 tidak ditanggung oleh keluarga dalam Kartu Keluarga (KK) dikenakan beban fiskal luar negeri Rp 2,5 juta sekali berangkat. Menurutnya, sejak 1 Januari 2011, wajib pajak orang pribadi dalam negeri yang tidak memiliki NPWP dan telah berusia 21 tahun yang akan bertolak ke luar negeri, tidak dikenakan fiskal luar negeri. Hal tersebut berdasarkan Pasal 8 Peraturan Pemerintah (PP) No. 80 tahun 2008 tentang pajak penghasilan bagi wajib pajak orang pribadi dalam negeri yang bertolak ke luar negeri berlaku 1 Januari 2009 sampai 31 Desember 2010. Sedangkan Kantor FLN Bandara, Mulyanto menyatakan segera ditutup karena tidak ada lagi memungut pajak. “Pihaknya juga akan memasang pengumuman di Bandara agar penumpang tujuan luar negeri tidak bingung,” ujarnya. (m32)

kepada Waspada, Jumat (24/12). Dikatakannya, rusaknya lampu jalan tersebut membuat warga was-was keluar rumah malam hari. Untuk itu, diminta kepada Walikota Medan agar segera memperbaiki semua lampu jalan yang rusak agar tetap aman dan nyaman. “Pak walikota ingin Kota Medan aman, sejahtera, religius. Tapi kalau lampu jalan tidak terang bagaimana mau aman. Warga tetap was-was keluar rumah pada malam hari kalau lampu jalan gelap,” katanya. Dari catatan Waspada, kemarin, lampu jalan yang banyak rusak di kawasan Gang Pena Kelurahan Denai, Jalan Teh Kelurahan Mangga, Jalan Setia Budi Ujung Medan Selayang, Jalan Alfala, Jalan Sisingamangaraja, Jalan Multatuli, Kec. Medan Maimon, dan sejumlah jalan lainnya. Saat ini hanya tersisa tiang dan lampu yang rusak. Padahal, masyarakat tetap dipungut pajak penerangan jalan dari pembayaran listrik. “Kami tetap bayar 10 persen dari uang listrik rumah. Tapi sampai saat ini kami tidak bisa menikmati lampu jalan yang terang. Kalau malam gelap gulita. Jadi kemana uang yang kami bayar itu? Janganlah Kantor Walikota dan rumah dinas saja terang-benderang, kami gelap di sini,” kata Mahmud, 47, salah seorang warga Kelurahan

Denai, Kec. Medan Tuntungan. Menurutnya, saat Rahudman masih kampanye kondisinya berbeda 180 derajat. Semua lampu jalan hidup dan terang-benderang. Namun, begitu dilantik, banyak lampu yang padam dan tidak diperbaiki lagi. Keluhan ini sudah berulang kali disampaikan kepada lurah maupun camat, namun tidak juga diperhatikan. “Kami sudah sampaikan ke lurah maupun camat, tapi jawabannya tidak memuaskan. Nantilah itu. Kita akan usahakan kalau ada anggarannya. Hanya itu yang dapat kami terima,” ucap warga. Hal serupa juga disampaikan Edi Lubis, 30, salah seorang warga Jalan Teh 1, Kelurahan Mangga. Menurutnya, pihaknya sudah lama menyampaikan ke lurah maupun camat, namun sampai saat ini tidak ada hasilnya. Sementara itu, pembayaran pajak penerangan jalan terus dilakukan. Pendataan ulang Walikota Medan Rahudman Harahap ketika dikonfirmasi mengatakan, pihaknya akan kembali melakukan pendataan ulang lampu jalan yang rusak pada 2011. Seluruh camat dan lurah akan diberikan kewenangan untuk melakukan pendataan dan pengecekan. Setelah itu dilaporkan kepadanya. “Nanti kita maksimalkan

kembali lampu jalan supaya menjadi terang benderang. Kami tahu masyarakat membayar PPJ sebesar 10 persen dari rekening listriknya. Saya tetap komit dengan janji saya kepada masyarakat,” katanya. Dia menambahkan, penanganan lampu jalan masih menjadi wewenang Dinas Pertamanan, meskipun banyak masyarakat meminta agar dialihkan ke lurah atau camat saja, sehingga bisa langsung menanganinya. “Lurah dan camat hanya melaporkan saja, namun untuk penanganan tetap wewenang Dinas Pertamanan,” tandasnya. Dinas Pertamanan jangan diam Anggota Komisi D DPRD Medan Muslim Maksum ketika diminta tanggapannya mengatakan, Dinas Pertamanan Kota Medan harus proaktif dalam menyahuti keluhan masyarakat. Mereka harus langsung turun kelapanganuntukmengatasipersoalan ini. Jangan sampai masyarakat kecewa dengan Pemko. “Semua keluhan harus disahuti. Jangan diam. Banyak keluhan terjadi akibat dinas terkait tidak mau mendengar keluhan yang disampaikan. Untuk itu, kita minta kepada Pemko agar menyegerakan perbaikan lampu jalan demi keamanan dan kenyamanan masyarakat Kota Medan,” katanya. (m50)

Penyandang Cacat Kembali Melihat Kehidupan PENYANDANG cacat juga manusia yang diberikan Tuhan kelebihan berbeda dari yang lainnya. Perbedaan yang terkadang tidak diketahui penyandangnya, sulit diterima masyarakat sekelilingnya. Padahal mereka punya hak yang sama seperti manusia normal, mereka juga punya kesetaraan dan derajat yang sama seperti manusia yang lengkap panca inderanya. Ani Lubis, tuna daksa, pernah mengalami masa paling buruk dalam hidupnya ketika dinyatakan dokter kakinya lumpuh akibat polio saat umur 10 tahun. Baginya masa depannya telah hancur dan dia tak berguna lagi karena harus hidup

cacat selamanya. Masyarakat seakan menolaknya, begitu pula dirinya yang menolak orang lain untuk hadir dalam hidupnya. Sulitnya menerima kenyataan pernah dia lampiaskan dengan mencoba bunuh diri hingga 3 kali dan selalu diselamatkan Tuhan. Pernah suatu kali dia hempaskan tubuhnya ke jalan ketika kendaraan lewat. Sebuah mobil pun terguling ketika ingin mengelak tubuhnya, mobil hancur, tapi dia tidak terluka parah. Dia mengungkapkan hal itu terjadi karena dia merasa hanya seorang diri cacat di dunia ini, keinginannya untuk menggapai cita-cita telah pupus. Saat itu yang terpikir yang meninggal-

kan dunia membuatnya hancur. Namun, pada tahun 80-an, ketika itu Dinas Sosial menampungnya untuk dibina dan diberi keterampilan. Di sana dia bertemu dengan penyandang cacat lainnya. Dia merasa senang dan bersyukur karena ternyata dia tidak sendirian. Masih banyak penyandang cacat yang lebih parah tapi mensyukuri keadaanya, bahkan merasa kekuranggan itu adalah kelebihan. Dia melakukan operasi sebanyak 14 kali untuk perkembangan kakinya, kini kakinya sudah bisa diluruskan dan tidak berdampak lumpuh pada organ tubuh yang lainnya, walaupun dia tetap tidak bisa berjalan, namun ini harus disyu-

Waspada/Silfa Humairah

TUNA DAKSA ASUH ANAK CACAT: Seorang tuna daksa (cacat tubuh bagian kaki), Ani Lubis (foto kanan) mampu mengasuh seorang bocah (kiri) yang tidak bisa bicara, mendengar dan berjalan di usianya 4 tahun di yayasannya, Jalan Dahlia Raya, Medan Helvetia. Foto diambil Jumat (24/12).

kuri karena pemerintah membiayai perobatannya. Semangat Ani bangkit, dia bercita-cita membuat yayasan bagi penyandang cacat. Menjadi tukang cuci pun dilakukannya untuk mengumpulkan uang untuk membangun yayasan yang diimpi-impikannya. Suatu kali ia jatuh sakit karena terlalu bersemangat bekerja, terlalu banyak pikiran untuk mendirikan yayasan, cita-cita yang orang anggap mustahil bagi Ani yang dari kalangan miskin dan cacat. Dia divonis dokter lambung kronis pada tahun 2006 yang berefek lumpuh pada organ tubuh lainnya, kemudian gila dan meninggal karena terlalu banyak memporsir pikiran dan tenaga. Tapi Tuhan berkehendak lain. Pada tahun itu pula, dia bertemu dengan orang Korea bernama Kang, yang memberikannya rumah untuk menampung penyandang cacat secara cuma-cuma. Bahagia bukan kepalang dirasakannya, dengan segera dia mengumpulkan penyandang cacat dan diajarkannya keterampilan seperti menjahit, bordil, membuat aksesories, merangkai bunga, dan daur ulang sampah. Tuhan memberi keajaiban baginya, dia sehat dan masih hidup hingga sekarang. Anak binaanya sekarang 60 orang, terdiri dari mereka tuna netra, tuna daksa, tuna rungu dan yatim piatu. Salah satunya Moseshope, 4, yang diambilnya dari kampung, Moseshope tidak bisa bicara dan berjalan, pen-

dengarannya juga terganggu. Dokter mengatakan dia mengalami cereberal palsi dan epilepsi. Dan harus diterapi dan diperiksa dalam seminggu 3 kali. Dia mengungkapkan, kesusahannya mendapatkan bantuan dana, selama ini mereka berjalan sendiri dengan hasil penjualan aksesories, jahitan, dan bengkel yang dikelola penyandang cacat binaanya. Sekarang anak binaannya ada yang kecil dan belum mungkin disuruh bekerja, dia harus sekolah dulu. Sebelumnya pernah bolak-balik kantor, dan perusahaan untuk meminta bantuan, namun hasilnya ditolak mentahmentah, jadilah kami bertahan seadanya begini. “Walaupun sebenarnya sangat mengharapkan bantuan dari donator untuk membiayai anak ini, namun jika harus mengemis lebih baik saya menjalankan yayasan ini seadanya,” ungkapnya. Tapi dia mengenal seorang yang baginya berhati mulia, anggota DPRD Medan Hasyim adalah orang yang sangat merespon dan perhatian terhadap orang cacat. “Bukan karena bantuan materi, tapi perhatiannya yang saya suka darinya,” tambahnya. “Saya sangat berterima kasih kepada pemerintah, khususnya Dinas Kesejahteraan dan Sosial yang mengangkat semangat saya kembali untuk hidup, saya melihat cahaya dalam kehidupan,” ungkapnya dalam puisi yang dia hadiahkan untuk Dinas Kesejahteraan dan Sosial. * Silfa Humairah

Waspada/David Swayana

Asisten Kessos Pemko Medan Farid Wajedi (kanan) didampingi Kadis Kesehatan Kota Medan dr. Edwin Effendi, MSc (tengah) ketika melakukan inspeksi mendadak (sidak) di Puskesmas Sering, Kecamatan Medan Perjuangan, Kamis (23/12) tengah malam.

Sejumlah Puskesmas Harus Dibenahi Asisten Kessos Dan Kadis Kesehatan Sidak Malam Hari MEDAN (Waspada): Menyusul pencanangan komitmen kesehatan yang dilakukan Walikota Medan Rahudman Harahap, kini Dinas Kesehatan berupaya meningkatkan kualitas pelayanan kesehatan dan keterampilan Sumber Daya Manusia (SDM) di Puskesmas. Namun sejumlah Puskesmas dinilai harus segera dibenahi guna mendukung komitmen kesehatan tersebut. “Sejumlah Puskesmas harus dibenahi baik secara fisik maupun pelayanannya,” kata Asisten Kessos Pemko Medan Farid Wajedi didampingi Kadis Kesehatan Kota Medan dr. Edwin Effendi, MSc kepada Waspada disela-sela inspeksi mendadak (sidak) di Puskesmas Sering, Kecamatan Medan Perjuangan, Kamis (23/12) tengah malam. Sebagaimana program kerja 100 hari Walikota Medan, lanjut Farid, upaya peningkatan kualitas pelayanan kesehatan kepada masyarakat telah dilakukan melalui penambahan waktu operasional Puskesmas rawat jalan hingga pukul 18:00 dan pengoperasian Puskesmas rawat inap selama 24 jam. “Hasil peninjauan kita di lapangan, ternyata penambahan waktu operasional Puskesmas rawat jalan dan Puskesmas rawat inap telah berjalan,” ujarnya. Hanya saja, kata Farid, sejumlah Puskesmas membutuhkan pembenahan sarana fisik dan kualitas SDM-nya. Contohnya, bangunan Puskesmas Medan Area mengalami kerusakan mulai dari atap, ruangan serta kurangnya penataan halaman. Jadi, pembenahan ini harus dibarengi dengan peningkatan kemampuan SDM. Sementara itu, Kadis Kesehatan Kota Medan dr. Edwin Effendi, MSc mengatakan, pihaknya tetap melaksanakan komitmen kesehatan yang

telah dicanangkanWalikota Medan. Karenanya, Dinas Kesehatan melakukan pendampingan dan pembinaan terhadap seluruh Puskesmas. Di samping itu, dilakukan upaya peningkatan kualitas SDM secara maksimal. Edwin mengakui adanya sejumlah fasilitas Puskesmas yang harus dibenahi termasuk kualitas SDM kesehatan. “Hasil peninjauan bersama Asisten Kessos Pemko Medan, ternyata ada beberapa Puskesmas yang membutuhkan pembenahan. Tujuannya agar tercipta pelayanan yang lebih prima dengan fasilitas memadai baik secara fisik maupun peralatan medis,” tambahnya. Kemudian, kata Edwin, Dinas Kesehatan Kota Medan berupaya memberikan insentif kepada para petugas Puskesmas rawat jalan dan Puskesmas rawat inap seiring dengan pertambahan jam kerja. “Jadi, insentif dimaksud akan disesuaikan dengan besarnya tanggungjawab dan kompetensi petugas kesehatan tersebut,” ujarnya. Sebelumnya, Ketua Komisi B DPRD Kota Medan Irwanto Tampubolon mengaku masih ada keluhan masyarakat tentang tidak adanya dokter yang siaga di Puskesmas rawat inap. Karena itu, Walikota harus melakukan evaluasi langsung terhadap kinerja Puskesmas rawat inap yang beroperasi 24 jam dan Puskesmas rawat jalan yang dibuka hingga pukul 18:00. Irwanto menilai, pengawasan terhadap Puskesmas rawat inap dan Puskesmas rawat jalan masih lemah. “Selama ini, Pemko Medan belum maksimal memberi tindakan tegas terhadap petugas Puskesmas yang tidak berada di tempat. Bila perlu, dokter yang tidak berada di tempat saat jam kerja, harus dipecat,” tegas Irwanto.(m25)


Medan Metropolitan

A4

WASPADA Sabtu 25 Desember 2010

Tiket Tembus Rp1,8 Juta Bandara Polonia Semakin Sesak

Waspada/Hamdani

ANTRE JEMPUT KELUARGA : Para penjemput antre di ruang tunggu pintu kedatangan dalam negeri Bandara Polonia untuk menunggu pihak keluarga terutama dari Jakarta, terkait libur Natal dan Tahun Baru. Beberapa hari menjelang Natal dan Tahun Baru Bandara Polonia disesaki para penumpang yang datang dari Jakarta dan berangkat ke luar negeri. Foto diambil Jumat (24/12).

Kepsek SMPN 14 Terima Penghargaan Dari Presiden MEDAN (Waspada): Supri Harahap, 47, penerima Satya Lencana pendidikan dari Presiden RI Susilo Bambang Yudhoyono pada puncak peringatan Hari Guru baru-baru ini, di Stadion Tenis Indoor, Senayan Jakarta bertekad mengabdikan diri di SMPN 14 Jalan Pandan Medan. Menurut Supri Harahap yang menjabat Kepala Sekolah di SMPN 14, Rabu (22/12), penghargaan Satya Lencana yang diterima dari Persiden Ri bukan akhir dari pengabdian. Hal tersebut merupakan awal untuk lebih meningkatkan pengabdian sebagai guru untuk mendidik anak bangsa di salah satu lembaga pendidikan yang dipimpinnya saat ini agar menjadi genberasi penerus bangsa yang sesuai dengan harapan, ujarnya. Dalam kesempatan tersebut Supri menjelaskan, penghargaan tanda kehormatan Satya Lencana pendidikan yang diberikan oleh pemerintah tersebut diterima melalui Direktorat Profesi Pendidik, Direktorat Jenderal Peningkatan Mutu Pendidik dan Tenaga Kependidikan, Kemendiknas kepada guru berprestasi dan guru berdedikasi di daerah khusus atau terpencil. Supri Harahap merupakan pemenang pertama seleksi guru berprestasi tingkat nasional tahun 2009 jenjang SMA, setelah mengikuti serangakaian kegiatan tes tertulis, penilaian dokumen portofolio selama menjadi guru. Dalam tes tersebut Supri Harahap mempresentasikan karya tulis di hadapan sembilan orang dewan juri dengan judul: “Penerapan Demorenasi dalam Pembelajaran untuk Meningkatkan Performansi Berbahasa Siswa Kelas IX IPS1 SMA Negeri 4 Medan.” Model pembelajaran itu kemudian dijadikan profil guru oleh Pustekom, Kemendiknas dan disiarkan secara nasional melalui TV Edukasi. Guru sederhana yang rajin menulis opini pendidikan di media massa itu sejak 11 Oktober 2010 dipercayakan menjadi kepala SMPN14 Medan sebagai apresiasi Pemko Medan dengan berbagai perstasinya.(m40)

Wilmar Simandjorang Launching Buku Di UDA MEDAN (Waspada): Agama, budaya, etos kerja dan norma merupakan salah satu faktor pendukung pembangunan regional. Wilmar Eliaser Simandjorang pengarang buku “Pembangunan Regional” mengatakan hal itu dalam launching bukunya dirangkaikan dengan seminar Pembangunan Regional Peluang dan tantangan di Provinsi Sumut, di Gedung Serba Guna Universitas Darma Agung (UDA), Jumat (24/12). Acara tersebut menghadirkan Rektor UDA Prof. Dr. Robert Sibarani, MS, Ketua Umum Yayasan UDA Ny. Sariaty PR. Siregar br Pardede; Drs Wilmar E Simandjorang, Dipl.Ec,M.Si sebagai presentase; Drs Soetarto, MSi sebagai moderator; Sabrina Harumi Pinem, S.Sos., MSi sebagai notulis, para guru besar Prof Bachtiar Hasan Miraza, Prof Dr Ir Sukaria Sinulingga, M.Eng, Dr Parulian Simanjuntak, Ir Mangindar Simbolon, Drs Jhon Tafbu Ritonga, M.Ec, dan para undangan lainnya. Di sela-sela presentasenya Wilmar mengatakan, dalam menunjang pembangunan re-

gional akan diutamakan perencanaan program jangka panjang tingkat provinsi dan daerah. Perencanaan hologram yang berjangka panjang nantinya akan mendukung pembangunan regional. Wilmar lahir di Huta Bagas, Sagala, Kec. Sianjur Mula-Mula Kab. Samosir, memiliki tiga orang putra dari istrinya Nurhaida Simarmata yang dinikahinya tahun 1981. Pendidikan Sarjana Bisnis Administrasi UNPAR Bandung (1978), Dipl. Economia, Scuala Superiore Enrico Mattei , Milan Italy (1985), Dipl. Implementation Development Economic ISVE Naples Italy (1989), Magister Perencanaan Wilayah dan Pedesaan, USU Medan (1992). Dalam bukunya, Wilmar menjelaskan studi kasus persfektif tentang kawasan industri Kuala Tanjung secara berturut, mulai dari gambaran umum industri aluminium Kuala Tanjung tentang konsepsi pusat pertumbuhan industri sebagai penggerak pembangunan regional. Menurutnya kawasan industri Kuala Tanjung sebagai

model pusat pertumbuhan industri dan penggerak pembangunan. Katanya lagi pengaruh kawasan industri Kuala Tanjung dalam lingkup nasional, regional, dan daerah proyek pabrik peleburan aluminium Kuala Tanjung selama pembangunan. Proyek Asahan Menanggapi isi dari buku tersebut, Prof Bachtiar Hasan Miraza, guru besar ekonomi USU, sebagai pembahas dalam acara tersebut mengatakan, buku dapat menjadi rujukan bagi pimpinan-pimpinan daerah begitu pula pimpinan provinsi dan nasional. Dia menambahkan, buku itu mampu menciptakan kesempatan kerja bagi masyarakat dan berguna bagi masyarakat maupun pimpinan dalam pembangunan regional di daerah-daerah. “Saya setuju dengan apa yang disampaikan Pak Wilmar tadi, jangan membesar-besarkan proyek Asahan. Tetapi, bagaimana kita bisa memanfaatkan proyek Asahan untuk pembangunan regional di daerah,” harapnya. (cba)

Kesehatan

Kenali Gejala Awal Gangguan Pendengaran JIKA anda memiliki anak yang kurang responsif diajak bicara atau kurang responsif terhadap suara-suara yang ada di sekitarnya, seperti suara klakson mobil, petir atau gelas pecah, itu wajib diwaspadai dan jangan disepelekan, karena bisa jadi si anak mengalami ketulian. Menurut dr. Delfitri Munir Sp.THT-KL(K), ketua Komite Daerah Penanggulangan Gangguan Pendengaran dan Ketulian Sumut, ini adalah sebagian gejala gangguan pendengaran pada anak yang harus bisa diamati. “Anak tidak mudah tertarik dengan pembicaraan atau suara-suara yang ada di sekelilingnya dan cenderung berusaha melihat muka lawan bicara dengan tujuan mencari petunjuk dari gerak bibir dan ekspresi muka guna mendapat informasi tambahan apa yang diucapkan, masih banyak gejala yang bisa diamati sehari-hari oleh orang tua,” ungkapnya kepada

Waspada, Jumat (24/12). Delfitri menuturkan, gangguan pendengaran atau tuli sejak lahir akan menyebabkan gangguan perkembangan bicara, bahasa, kognitif dan kemampuan akademik. “Penyebab gangguan pendengaran bayi pada masa sebelum lahir dan setelah lahir disebabkan faktor genetik dan nongenetik. Gangguan genetik bawaan dapat disertai kelainan lain seperti gangguan system saraf, telinga luar, tulang, otot dan gangguan metabolik,” ungkapnya. Sedangkan gangguan pendengaran nongenetik sebelum bayi lahir, lanjutnya, terjadi pada masa kehamilan terutama pada masa tiga bulan pertama kehamilan. Setiap ada gangguan seperti kurang gizi, adanya infeksi bakteri maupun virus dan pemakaian obat-obatan saat hamil dengan tidak melalui resep dokter dapat menyebabkan ketulian.

Untuk mengidentifikasi pendengaran terhadap bayi, bisa dilakukan sendiri oleh para orang tua. Pedoman identifikasi terhadap pendengaran bayi dan anak yakni, bayi normal umur 0 - 4 bulan akan terkejut terhadap suara ibunya atau aktifitasnya berhenti sebentar jika mendengar suara percakapan. Kedua, umur 5 – 6 bulan bayi mulai meniru suara. Ketiga, umur 7 – 12 bulan bisa merespons panggilan namanya. Namun, katanya, apabila orang tua menemukan si kecil memiliki kelainan pendengaran, jangan bersedih dulu. Hapus air mata Anda. Meski tidak mudah tetapi ini bukan akhir segalanya. Dengan dukungan orang tua, alat bantu bantu dan terapi yang tepat, buah hati anda dimungkinkan bisa hidup mandiri dan memiliki kemampuan mendengar dan berbicara mendekati normal. * Mursal AI

Waspada/Mursal AI

TESTIMONI GANGGUAN PENDENGARAN: Mahasiswa Fakultas Kedokteran Gigi USU Kafita memberikan testimoninya terkait gangguan pendengaran yang dia alami di RSIA Harapan Ibu, baru-baru ini. Berkat alat bantuan pendengaran, kini Kafita sudah bisa mendengar.

MEDAN (Waspada): Harga tiket pesawat dari Jakarta tujuan Medan, kemarin, menembus Rp1,4 juta sampai Rp1,8 juta sekali jalan. Selain harga melambung, tiket sulit didapat. Bagi penumpang yang merayakan Natal dan Tahun Baru 2011 di Medan, kenaikan harga tersebut mencekik leher. Merry Hutagalung penumpang dari Jakarta di Bandara Polonia, kemarin, menyatakan biasanya harga tiket Rp500 ribu sekali jalan untuk penerbangan LionAir. Kemarin, tiket yang dibelinya dari Jakarta mencapai Rp1,4 juta sekali jalan. “Yang parahnya sudah tiket mahal terkesan dibola-bola lagi saat akan balik ke Medan dari Cengkareng, alasan penerbangan pukul 07:00 sudah penuh, harus naik penerbangan LionAir pukul 08:00,” ujarnya. Merry bersama keluarga akan memeriahkan Natal dan Tahun Baru di Tapanuli. Bahkan Rudi Siahaan juga mengeluhkan tingginya harga tiket. Dia dari Palembang-Jakarta dan Medan tiket Lion Air Rp2,4 juta, padahal harihari biasa tiket pada rute yang sama hanya Rp1,2 juta, berarti ada kenaikan 100 persen. Itu pun harus membooking seat sejak 3 hari sebelum keberangkatan. Distric Manager LionAir Medan Yuli Aspita ketika dikonfirmasi melalui telepon selular tidak berhasil. Azwir, agen tiket dari Elite Travel Medan menyatakan, saat ini pergerakan harga tiket luar biasa tinggi dari Jakarta tujuan Medan antara Rp1,4 juta hingga Rp1,8 juta sekali jalan. Sementara dari Medan tujuan Jakarta seperti tiket Lion Air, Batavia Air dan Sriwijaya Air, berangkat Jumat masih terjual Rp500 ribu hingga Rp550 ribu. Harga tiket baru akan naik tiga haru pasca Tahun Baru dari Medan tujuan Jakarta rata-

rata Rp1 juta bahkan Rp1,7 juta.

Luar negeri Sementara itu, pihak maskapai penerbangan AirAsiamenyatakantiketpesawatdariMedantujuan Kuala Lumpur dan Penang habis terjual. Padahal kedua rute itu setiap hari tersedia 1.080 seat. Ada empat kali penerbangan Medan tujuan Kuala Lumpur dan dua kali pada rute Medan tujuan Penang setiap hari, menggunakan armada jenis Airbus 320 berkapasitas 180 seat. Hingga pukul 10:45, kemarin, hanya tersisa tiga seat para rute Medan tujuan Kuala Lumpur untuk berangkat, Minggu (26/12), sementara Jumat dan Sabtu seat habis terjual. Hal itu disampaikan Shela, staf penerbangan Air Asia di Bandara Polonia. Shela mengakui peningkatan permintaan seat pesawat dalam dua hari ini. Sementara harga tiket Air Asia Medan tujuan Kuala Lumpur lebih kurang Rp1,4 juta pergi pulang. Nonton Timnas Bahkan Anto, agen tiket dari Tunas Travel Medan menyatakan permintaan seat pesawat pada rute Medan tujuan Kuala Lumpur dan Penang tidak terlepas dengan final AFF Suzuki Cup 2010 antara Timnas Indonesia lawan Malaysia, Minggu malam di Stadion Bukit Jalil Kuala Lumpur. Orang yang berangkat ke Malaysia akhir tahun ada dua momen, yaitu menonton bola dan berlibur bersama keluarga, sehingga harga tiket melambung tinggi. Sementara penerbang Sriwijaya Medan tujuan Penang Rp 1,5 juta PP. Harga tersebut setelah tahun baru bakal turun lagi pada rute itu. Pantauan Waspada, kemarin, Bandara Polonia semakin dipadati pemudik yang merayakan Natal dan Tahun baru di Sumut. Selain itu, orang yang berangkat ke luar negeri semakin membeludak. (m32)

FITRA Bahas Keterbukaan Informasi Badan Publik MEDAN (Waspada): Forum Indonesia untuk Transparansi Anggaran (FITRA) Sumut menyampaikan hasil uji akses terhadap keterbukaan informasi anggaran badan publik pada seminar yang bertema: “Index Keterbukaan Informasi Anggaran Badan Publik” di Hotel Asean Internasional Medan, Kamis (23/12). Seminar tersebut membahas keinginan masyarakat untuk memperoleh keterbukaan informasi semakin tinggi, apalagi menyangkut pelayanan terhadap publik yang diselenggarakan oleh badan publik, badan pablik yang dimaksud meliputi: Dinas Pendidikan, Dinas Kesehatan, Disperindag, Biro Pemberdayaan Perempuan, Dinas Marga, Bappeda, DPRD Sumaut dan Dinas PKD Kota Medan serta Panwas Kota Medan. Dengan adanya UU No. 14 Tahun 2008 tentang Keterbukaan Informasi Publik (KIP) transparansi dan keterbukaan informasi yang menjadi hak publik. Untuk itu, semua lembaga pelayanan publik diajak untuk semakin transparan dan informasi harus dibuka sebesar-besarnya dengan pengecualian hal-hal yang menyangkut keamanan negara.

“Kegiatan ini bertujuan untuk melakukan sintesis terhadap temuan hasil penelitian di wilayah Provinsi Sumatera Utara serta melakukan verifikasi terhadap hasil temuan penelitian,” ujar Elfenda Ananda selaku Sekretaris Esekutif FITRA Sumut. Elfenda juga mengatakan, saat ini FITRA bekerjasama dengan Seknas FITRA dan kemitraan Partnership dengan dukungan United States Agency for International Development (USAID) dalam program Strengthening Integrity And Accountability Program II (SIAP II). Untuk mendukung melakukan uji akses permintaan dokumen anggaran kepada badan publik serta melihat seberapa jauh UU keterbukaan informasi publik ini dapat dilaksanakan atau direalisasikan dengan baik oleh badan-badan publik, baik di tingkat nasional maupun daerah. Kegiatan ini mendatangkan narasumber dari Badan Infokom Sumut Denny Simamora dan Ridwan Rangkuti dari Fisip USU Bidang Administrasi Publik. Turut hadir pada acara dari kalangan Akademisi, LSM, SKPD se Provsu, wartawan dan mahasiswa.(chr)

Musda MUI Jangan Sekadar Rutinitas MEDAN (Waspada): Bagi Nahdalatul Ulama (NU), Musyawarah Daerah (Musda) VII Majelis Ulama Indonesia (MUI) Sumatera Utara 28-30 Desember di Asrama Haji Medan mengandung makna sangat penting sehingga jangan sekadar acara rutinitas. Hal itu disampaikan Ketua PW NU Sumatera Utara Ashari Tambunan bersama sekretaris Misran Sihalolo, Rois Syuriah Pagar Hasibuan, Wakil Rois Musaddad Lubis, Wakil Ketua Marahalim Harahap, Abdullah Nasution, Ketua Lembaga Bahtsul Masail KH Asnan Ritonga dan warga Nahdiyyin Emir El Zuhdi Batubara kepada Waspada, Jumat (24/12). Untuk itu, lanjutnya, PW NU Sumatera Utara merasa berkepentingan terhadap Musda MUI agar menghasilkan kepemimpinan dan program kerja yang dibutuhkan umat, apalagi saat ini banyak warga NU tampil sebagai peserta Musda, bahkan duduk dalam kepengurusan MUI Sumatera Utara. Itu membuktikan NU memiliki kader-kader yang militan yang intelektual dan profesional. Diharapkan, Musda VII mampu menghasilkan berbagai program lebih baik dan menyentuh sehingga peran para ulama dan pemerintah menjadi semakin penting. Apalagi dalam kondisi saat ini terjadi degradasi kepercayaan di kalangan masyarakat terhadap pemimpin di semua bidang. Maka melalui Musda, MUI sebagai lembaga maupun Ormas Islam harus bisa menjadi cerminan suksesi yang islami. Dan menjadi teladan bagi pemilihan pimpinan suatu lembaga. PW NU Sumut pada perinsipnya siap mensukseskan Musda VII MUI. “Saya yakin kepercayaan masyarakat terha-

dap MUI semakin tinggi demi kemaslahatan umat umumnya,” ujarnya. Jalankan fungsi kontrol Sementara itu, Rois Syuriah PW NU Sumut Pagar Hasibuan mengatakan, bangsa Indonesia dikenal sangat religius karenanya menempatkan MUI menjadi organisasi sangat penting di Indonesia. Banyak nilai-nilai dimana bangsa Indonesia mengikutinya, baik secara sukarela maupun yang terpaksa. Tapi nilai agama ternyata berada di barisan depan terutama disaat ada perbedaan satu sama lain dalam penafsiran ditengah-tengah masyarakat. Menurut Pagar, dalam bentuk realitas ternyata nilai agama lebih dikedepankan. Maka kehadiran MUI sangat penting, MUI sebagai sebuah organisasi keagamaan selayaknyalah dapat menampung aspirasi masyarakat dari sleuruh bangsa terutama yang Islam. Sehubungan bangsa Indonesia dengan paham ahli sunnah waljamaah, kata pengurus MUI Sumut itu, maka selayaknya orang-orang di MUI diisi orang-orang yang berpaham ahli sunnah waljamaah, paling tidak akomodatif terhadap ahli sunnah waljamaah. Ke depan, lanjutnya, MUI harus mampu menjalankan fungsi kontrolnya di pemerintahan dan masyarakat akibat timbulnya modernisasi yang semakin gencar. Selain itu, kata Pagar, dalam membentuk kepengurusan hendaknya MUI dapat mengakomodir lembaga-lembaga, organisasi-organisasi yang layak dan dipilih untuk menempati komposisi kepengurusan dan tidak ditempati oleh kelompokkelompok organisasi tertentu, disamping dapat menerapkan konsep-konsep yang ideal.(m24)


Medan Metropolitan

WASPADA Sabtu 25 Desember 2010

A5

Nasib Polisi Berambut Gondrong SUASANA apel Pergeseran Pasukan (Serpas) di Lapangan Merdeka, Jumat (14/12) sore, yang semula khidmat mendengar arahan dari Kapolresta Medan Kombes Tagam Sinaga, mendadak riuh. Pasalnya, orang nomor satu di Polresta Medan ini tiba-tiba mendatangi barisan personel Polresta serta Polsekta yang sore itu berpakaian dinas dan berada dalam barisan. Kemudian, mantan Kapolsekta Medan Sunggal ini mendatangi anggotanya satu per satu. Sejumlah perwira yang hadir di antaranya Kasat Lantas Kompol I Made Ary, Kasat Intel Kompol Ahyan, Kabag Ops Kompol Dady Purba dan perwira lainnya, tidak menyangka kalau Kapolresta bakal merazia rambut seluruh polisi yang sedang mengikuti apel Serpas. Petugas Propam Polresta Medan terlihat tergesa-gesa mendampingi Kapolresta yang menarik anggotanya keluar dari barisan karena berambut gondrong. Kemudian petugas Propram mencatat nama anggota polisi yang dikeluarkan dari barisan. Setidaknya, ada 20-an anggota polisi dari kesatuan Reskrim yang terkena razia. Selanjutnya, barisan mereka dipisahkan dari anggota polisi yang lain. Setelah itu, Kapolresta mendatangi puluhan anggota polisi yang terkena razia rambut gondrong dan memberi RAZIA RAMBUT GONDRONG: Kapolresta Medan Kombes Tagam Sinaga (kiri) memerintahkan anggotanya yang berambut gondrong keluar dari barisan usai apel Serpas di Lapangan Merdeka Medan, Jumat (24/12) sore. Dalam razia dadakan itu, 20-an anggota polisi terjaring dan diharuskan mencukur rambut sebelum melakukan pengamanan Natal.

Waspada/Rudi Arman

DPRDSU Minta Polda Ambilalih Kasus Kepemilikan Granat Polresta Medan Dinilai Ceroboh MEDAN (Waspada): Kebijakan Polresta Medan yang melepas tersangka SLK dengan status wajib lapor dinilai terlalu ceroboh. Pasalnya, SLK diduga sebagai pemilik granat nenas yang ditemukan di Hotel Hermes Medan. Atas kecerobohan ini, sejumlah anggota DPRDSU meminta Poldasu segera mengambil alih penanganan kasus kepemilikan bahan peledak tersebut. “Kenapa polisi begitu cepat dan mudah melepaskan orang itu. Padahal, kalau umat Islam yang kedapatan membawa granat atau bahan peledak lainnya, selalu dikaitkan dengan teroris,”

kata anggota Fraksi Demokrat DPRD Sumut Marahalim Harahap kepada Waspada, Jumat (24/12). Menurut Marahalim, kebijakan Polresta menetapkan sta-

Kakak Beradik Dirampok MEDAN (Waspada): Dua wanita kakak beradik turunan Tionghoa, mengalami luka-luka karena terjatuh bersama sepedamotornya setelah tas yang disandang ditarik dua perampok di Jln. Gatot Subroto Medan, Jumat (24/12) petang. Informasi yang diperoleh Waspada di lapangan, kejadian bermula saat kedua korban Amoi dan Acim berboncengan sepedamotor melintas di Jalan Gatot Subroto, tiba-tiba tas sandang korban ditarik dua pria yang mengendarai sepedamotor. Karena tarikan yang cukup kuat, kedua korban terjungkal ke aspal berikut sepedamotornya. Akibat kejadian itu Amoi menderita luka-luka pada tangan kanan dan kaki. Sementara, Acim dilarikan ke rumah sakit karena mengalami benturan keras pada kepala. Selanjutnya, Amoi ditemani warga membuat pengaduan ke Polsekta Medan Baru. (m36)

32 Napi Terima Remisi Natal MEDAN (Waspada): 32 narapidana yang menghuni Rumah Tahanan (Rutan) Cabang Kecamatan Pancurbatu, Kab. Deli Serdang, menerima remisi Natal 2010, Kamis (23/12) siang. Para napi yang mendapat remisi tersebut masing-masing 30 remisi khusus dan 2 napi remisi khusus II. Dari 32 napi tersebut satu diantaranya wanita. Kacab Rutan Pancurbatu Mursadad, SH didampingi Kasubsi Pelayanan Tahanan J Sitanggang membenarkan ke 32 napi tersebut memperoleh remisi khusus natal. “Mereka memperoleh remisi berdasarkan penilaian atau kriteria yang sudah ditentukan. Kriteria tersebut, napi dapat menunjukkan iktikad baik untuk tidak mengulangi perbuatannya atau bertaubat dan tak akan mengulangi perbuatan nya,” ujar Kacab Rutan. Selain itu, kata Mursadad, para napi dinilai dari kelakuan baik. Selain itu sudah menjalani hukuman minimal 6 bulan lamanya serta sudah berkekuatan hukum tetap. Dia mengharapkan kepada napi yang belum memperoleh remisi jangan berputus asa dan agar dapat meningkatkan atau menunjukkan sikap arif dan bijaksana serta berprilaku baik untuk memperoleh remisi tersebut. Disebutkannya, pemberian remisi tersebut secara resmi pada 25 Desember 2010 bertepatan dengan perayaan Natal besar keseluruhan. Para napi yang memperoleh remisi tersebut, tujuh napi dalam kasus narkotika, asusila dua napi, traficking satu napi, ilegal logging empat orang, pencurian di siang hari dan malam hari secara kekerasan enam orang, pengrusakan tiga orang, penganiayaan satu orang serta delapan lain nya terkait dalam kasus pidana biasa. Satu diantaranya napi wanita dalam kasus narkotika. (h04)

Reporter Trans TV Diperiksa MEDAN (Waspada): Korban penganiayaan mantan Kapolres Pematangsiantar, Andi Siahaan, reporter Trans TV diperiksa tim penyidik Direktorat Reserse Kriminal Poldasu, Kamis (23/12). Andi mengenakan seragam Trans TV didampingi kuasa hukumnya, Jonly Sinaga, SH, diperiksa tim penyidik di ruang Unit Ranmor sejak pukul 11:00 hingga sore. Andi menjawab pertanyaan penyidik menyangkut aksi penganiayaan diduga dilakukan AKBP Fathori di salah satu ruangan Mapolres Pematangsiantar pada 27 November 2010. Selain itu, Andi juga memperagakan aksi pemukulan dan penganiayaan terhadap dirinya. “Dia (Kapolres) datang mencari saya, tiba-tiba tangannya memukul wajah sebelah kiri. Terus memukul perut dan bagian rusuk. Pukulan itu berulang-ulang, meski kedua tangan saya melindungi wajah,” kata Andi. Usai pemeriksaan, Andi mengatakan kepada wartawan, dirinya diperiksa sebagai saksi korban. “Saya hanya menceritakan bagaimana proses terjadinya pemukulan itu kepada penyidik,” sebutnya. Menurut Andi, pemukulan berlangsung sore hari ketika para tahanan dikeluarkan dari sel untuk berolahraga. Sementara, Andi dipindahkan ke sebuah gudang yang beralih fungsi menjadi ruang tahanan. “Perpindahan itu atas perintah AKBP Fathori, kata Kepala Tahanan Br Simbolon,” kata Andi. Tiba-tiba, lanjut Andi, Kapolres datang mengenakan baju olahraga, langsung memukul wajah sebelah kiri dengan tangan kiri yang dibungkus sarung tinju. “Aku tidak tau kenapa dia bersikap seperti itu. Tetapi saya rasa ada dendam pribadi. Sebab, pernah juga AKBP Fathori berseru dengan wartawan sampai melempar tongkat komando. Dia juga mengajak duel wartawan,” katanya. Kasat I Tipidum Dit Reskrim Poldasu AKBP Rudy Rifani mengatakan, semua yang diduga terlibat dan mengetahui akan diperiksa, termasuk kepala tahanan. “Kita tidak main-main. Kita lurus-lurus saja, semua akan kita ungkap,” kata Rudy. (m27)

tus wajib lapor kepada LSK, penduduk Pematangsiantar, yang diduga sebagai pemilik granat, tentu sangat mencurigakan. Padahal, selama ini setiap ada penemuan senjata api dan bahan peledak di Sumut, selalu dikaitkan dengan kegiatan terorisme. “Tapi kenapa dalam kasus ini, tiba-tiba polisi bisa begitu yakin orang yang diduga pemilik granat tersebut tidak ada kaitannya dengan terorisme. Janganjangan ada unsur diskriminasi hukum terhadap etnis-etnis tertentu di Sumut,” kataWakil Ketua PW Nahdatul Ulama Sumut itu. Marahalim menilai, kasus tangkap lepas kepemilikan granat ini bisa menjadi isu sensitif danbakalmenimbulkanberagam reaksi di kalangan masyarakat Sumut. Karena itu, dia meminta Polda Sumut segera mengam-

bilalih penanganan kasus itu. Sebab, menurut Marahalim, jika reaksi masyarakat yang muncul bersifat destruktif, tentu akan mengganggu kondusifitas dan stabilitas keamanan di Sumut. “Kapolda Sumut harus tegas kepada seluruh Polres se Sumut untuk melakukan penegakan hukum secara adil dan merata tanpa pandang bulu, ras dan agama dan tanpa tebang pilih,” tegasnya. Secara terpisah,Wakil Ketua DPRD Sumut Sigit Pramono Asri berpendapat, sebaiknya Polda segera mengambilalih penanganan kasus kepemilikan granat nenas tersebut serta menahan kembali LSK, yang diduga kuat sebagai pemilik granat dan menyelidiki asal usul bahan peledak tersebut. “Kan tidak mungkin granat-

nya tiba-tiba saja ada di dalam kamar hotel, tanpa ada yang membawanya. Polisi harus lebih serius melakukan penyelidikan. Kalau bahan peledak sudah beredar secara bebas di Sumut, kan bisa berbahaya,” kata politisi Partai Keadilan Sejahtera (PKS) itu. Jangan sampai, sindirnya, sudah jatuh korban di kalangan masyarakat akibat beredar bebasnya bahan peledak di Sumut, barulah pihak kepolisian kebakaran jenggot melakukan penyelidikan. Di masa mendatang, kata Sigit, aparat kepolisian harus bersikap lebih bijaksana dalam menangani berbagai kasus sehingga tidak menimbulkan kesan di masyarakat ada diskriminasi dalam penegakan hukum di Indonesia. (m48)

Istri Anggota DPRD Dilempar Batu MEDAN (Waspada): Bermaksud pergi berbelanja, Boru Saragih, 40, istri CP Nainggolan, anggota DPRD Medan, dilempar batu oleh tetangganya sendiri di Jln Pukat VII, Kel. Bantan, Kec. Medan Tembung, Jumat (24/12) sekira pukul 08:00. Selanjutnya, pelaku pelemparan sepasang suami istri berinisial RS, 35, dan istrinya PN, 34, diamankan pihak Polsekta Percut Seituan. Akibat peristiwa itu, Boru Saragih mengalami luka serius pada kepala sehingga harus menjalani perawatan di RS Elisabeth Medan. CP Nainggolan mengatakan, pagi itu istrinya hendak berbelanja. Sebelum pergi ke pasar korban melihat ada keri-

butan di antara tetangganya. Belum sempat bertanya, tiba-tiba PN melempar batu ke arah kepala korban. Tak hanya itu, pelaku juga memukul tubuh korban. “Akibat lemparan batu itu, kepala istriku terluka dan terpaksa dirawat di rumah sakit. Kondisinya masih lemah karena baru menjalani operasi di Penang,” ujar CP Nainggolan yang mengaku terkejut saat melihat istrinya dalam kondisi berlumuran darah. Sejumlah warga yang kesal dengan tindakan pelaku, spontan mendatanginya. Namun, CP Nainggolan langsung mencegah kerumunan massa dari tindakan anarkis dan menghubungi petugas Polsekta Percut

Seituan. Kemudian, pasangan suami istri tersebut diamankan di Polsekta Percut Seituan. Dalam kasus itu, polisi telah meminta keterangan lima saksi termasuk kepala lingkungan setempat. “Sejumlah warga sudah menandatangani surat keberatan agar pasangan suami istri itu tidak lagi bermukim di kawasan tersebut. Namun, semua itu terserah kepada pihak kelurahan setempat,” tambah CP Nainggolan. Kapolsekta Percut Seituan AKP Maringan Simanjuntak mengatakan, sejumlah saksi telah dimintai keterangannya. Sedangkan pasangan suami istri RS dan PN masih diperiksa. (h04)

2010, Kasus Narkoba Terbanyak Di Bandara Polonia SEPANJANG 2010, jajaran petugas Bea dan Cukai Bandara Polonia Medan paling banyak menangkap pembawa heroin dari luar negeri, seperti Malaysia dan Singapura tujuan Medan. Berdasarkan catatan Waspada, TSI, 62, warga Aceh Timur ditahan petugas Polda Sumut, dipersalahkan membawa sabusabujenisamfetamindariPenang tujuan Medan, Selasa (9/2). Wanita tinggi semampai itu ditangkap petugas Bea Cukai Bandara Polonia Medan saat membawa 400 gram sabu-sabu atas suruhan seorangWNI keturunan Tionghoa saat berada dalam pesawat Sriwijaya Air SJ103 dari Penang tujuan Medan. Saat diperiksa, dia mengaku tidak mengeta-hui jika di dalam plastik hitam yang berisi pakaian dalam dan tisu itu, terdapat narkoba. Kemudian, Senin (15/2), penerbangan Riau Airline (RAL) yang mengangkut puluhan penumpang dari Medan tujuan Gunung Sitoli terpaksa kembali lagi ke Bandara Polonia (Return To Base) akibat ek houst tail pipe (pipa saluran gas buang) jatuh dan menimpa rumah pendu-

duk di kawasan ujung runway 05. Manajemen RAL melalui manejer stasiun udara Iwan Zailani menyatakan siap memberi bantuan memperbaiki rumah Maruli Hutabarat, 48, yang tertimpa komponen pesawat itu. Sementara Rabu (3/3), seorang pemuda berinisial BKS, 40, asal Pante Rheng Bireuen ditangkap petugas Bea Cukai Bandara Polonia Medan karena kedapatan membawa sabusabu jenis amfetamin yang disembunyikan dalam sepatu. Setibanya dari Penang dengan menumpang pesawat Sriwijaya Air SJ-103, terlihat gerak- gerik BKS mencurigakan dan akhirnya dibawa ke ruang BC Polonia untuk diperiksa. Karena ke-dapatan membawa sabu-sabu, BKS diserahkan ke Polda Sumut. Rabu (27/3), SA asal Aceh Utara membawa 411 gram sabusabu jenis amfetamin dari Malaysia. Dia diamankan setibanya dari Penang menggunakan penerbangan Lion Air JT-289. Selanjutnya, petugas Densus 88 anti teror memboyong lima pemuda ke Banda Aceh melalui Bandara Polonia, Senin

(12/4). Mereka diduga sebagai anggota teroris yang ditangkap Polda Sumut di kawasan Jln SM Raja Medan, Minggu (11/4) dinihari. Setelah diperiksa petugas Polda Sumut selama empat jam, mereka diboyong ke Tempat Kejadian Perkara (TKP) di Banda Aceh Kamis (26/8), MYAL, 32, warga keturunan Tamil yang membawa 9,5 kg sabu-sabu dalam hand carry (tas jinjing) ditangkap petugas Bea Cukai Bandara Polonia Medan. Penumpang Silk Air MI-234 dari Singapura itu, tiba di Bandara Polonia Medan sekira pukul 20:05. Setelah menjalani pemeriksaan di kantor Bea Cukai, ter-sangka dibawa ke Polda Sumut. Setelah itu, Minggu (28/11) sekira pukul 22.30, petugas Bea Cukai Bandara Polonia Me-dan menangkap seorang wargaVietnam berinisial LTD, 49, yang membawa 1.482 gram sabusabu seharga Rp2,9 miliar. Penumpang Air Asia AK-456 dari Kuala Lumpur tujuan Medan ini akhirnya diboyong ke Polda Sumut untuk pemeriksaan lebih lanjut. (m32)

pengarahan tentang pentingnya berpenampilan rapi sebagai anggota Bhayangkara. “Rambut harus dicukur walaupun bertugas di Reserse. Rambut polisi jangan sampai tidak terurus, seperti teroris saja,” katanya. Tagam juga memerintahkan seluruh polisi yang terkena razia itu segera mencukur rambutnya. Usai mendengar pengarahan dari Kapolresta dan pendataan petugas Propam, puluhan polisi tersebut langsung meninggalkan lokasi Lapangan Merdeka guna mencukur rambutnya. Tak lama kemudian, sejumlah polisi yang terkena razia kembali lagi ke Lapangan Merdeka. Sebagian di antara mereka langsung melapor kepada Kapolresta sambil memperlihatkan model rambut yang sudah tercukur rapi. Ada juga yang menemui petugas Propam guna memberitahukan bahwa perintah Kapolresta agar mencukur rambut, telah dilaksanakan. Setelah itu, Kabag Ops Polresta Medan Kompol Dady Purba memerintahkan seluruh anggota polisi segera melakukan pengamanan gereja. Sebelumnya, Kapolresta mengharapkan suasana Natal dan Tahun Baru di Kota Medan berjalan dengan aman dan terkendali. Diharapkan, seluruh personel Polresta dan Polsekta menjalankan tugasnya dengan baik. “Mari kita pertanggungjawabkan kepada masyarakat kota Medan, khususnya umat Kristiani bahwa Polri dan TNI mampu melakukan pengamanan Natal di Kota Medan,” jelasnya. Sedangkan Kabag Ops Polresta Medan Kompol Dady Purba mengharapkan, seluruh anggota yang dilibatkan dalam pengamanan segera mendatangi gereja-gereja sebelum perayaan Natal dimulai dan tetap berada di lokasi hingga kegiatan selesai. (m39)

Karyawati Biliar Diadukan Ke Polisi MEDAN (Waspada): Dianiaya karyawati biliar hingga mengalami luka memar dan perhiasannya diambil, Halima alias Mai, 20, warga Jalan Mas, Kel. Sei Renggas II, Kec. Medan Area, mengadu ke Polresta Medan, Rabu (22/12). Menurut Mai, penganiayaan itu terjadi, Selasa (21/12) sekitar pukul 03:00, di Jalan Juanda, Medan. Pelakunya, Ch, 20, pegawai Monako Bilyard HM Joni, Medan. Kejadian bermula saat, Mai diajak AI, 22, temanya berkunjung ke rumah saudaranya mengendarai sepedamotor. Mai lalu menyimpan dompet berisi KTP dan surat-surat berharga lainya ke dalam jok sepeda motor milik AI. Usai berkunjung AI mengantar Mai pulang ke rumahnya. Tak lama setelah sampai di rumah, Mai menghubungi AI memberitahukan dompetnya tertinggal di dalam jok sepedamotor. Namun, saat bersamaan Ch datang ke rumah AI meminjam sepedamotornya. Takut, dompet berisi KTP milik temanya hilang, AI memberitahukan kepada Ch di dalam jok

sepeda motornya ada dompet milik Mai. Tak lama kemudian AI menghubunghi Mai memberitahukan sepeda motornya dipakai Ch. Kemudian Mai menghubungi Ch yang pernah satu kos sama dirinya di kawasan Teladan. Selanjutnya Ch yang sedang nongkrong bersama temannya di warkop Juanda, menghubungi Mai. “Kemari kau ke warkop Juanda kalau kau mau KTP kau,” ucap Ch. Mai ditemani temannya Dika, 19, datang menjumpai Ch. Namun, Ch memberikan KTP dengan cara melemparkannya ke wajah Mai. Melihat KTPnya dibuang, Mai mengutipnya, tetapi disaat bersamaan Ch menendang Mai. Sehingga keributan antara keduanya terjadi. “Dia (Ch) memukul muka ku kemudian menarik kalung ku sampai dada ku tergores,” aku Mai. Kasat Reskrim Polresta Medan Kompol Fadilla Zulkarnaen, SIK, ketika dikomfirmasi wartawan melalui telepon, belum mengetahui laporan tersebut. “Nanti saya cek dulu, “ ungkapnya. (m39)

Pengedar Ganja Disergap MEDAN (Waspada): Seorang pengedar ganja Jn alias A Cuan, 23, warga Jalan AR Hakim, Kel. Tegal Sari, Medan Area, diciduk petugas Polsekta Percut Seituan, Jumat (24/12) siang. Tersangka ditangkap saat sedang bertransaksi dengan pembeli ganjanya seorang polisi yang menyaru di salah satu warung Jalan Industri, Kel. Banten Timur, Medan Tembung. Dari tersangka A Cuan, disita barang bukti 6 amplop daun ganja kering. Informasi diperoleh di kepolisian menyebutkan, sebelumnya tersangka dudukduduk di warung itu menunggu calon pembeli ganja. Tak berselang lama datang polisi yang menyaru sebagai pembeli narkoba meng-

hampiri tersangka. Tak menyangka pembelinya petugas, tersangka memberikan ganja yang dipesan dan langsung disergap. Sedangkan daun ganja 6 amplop diletakkan di bawah telapak kakinya yang masih mengenakan sepatu. Saat dikonfirmasi, Acuan mengaku sudah dua tahun menggeluti sebagai penjual ganja. Menurutnya, daun ganja kering itu dibelinya dari bandar narkoba di kawasan Titi Sewa Tembung. “Tersangka sudah dijebloskan ke dalam sel sedangkan barang buktinya sudah disita sebanyak 6 amplop,” jelas Kapolsekta Percut Seituan AKP Maringan Simanjuntak. (h04)

Kapolresta Medan: Berikan Yang Terbaik Kepada Masyarakat MEDAN (Waspada): Memasuki Tahun Baru 2011, jajaran Polresta Medan terus berupaya melakukan pembenahan dalam memberi pelayanan kepada masyarakat. “Upaya peningkatan kinerja tersebut, bukan sebatas menekan angka kriminalitas, tetapi meningkatkan kinerja dalam penanganan kasus yang dilaporkan ke jajaran Polresta Medan,” kata Kapolresta Medan Kombes Tagam Sinaga melalui Kasubag Humas AKP Edward Tampubolon, Jumat (24/12). Pada tahun 2011, Polresta berupaya memberikan yang terbaik kepada masyarakat. Dalam menangani kasus yang ada, personel Polresta bekerja secara profesional dan proporsional sesuai prosedur hukum yang berlaku. Bahkan, lanjutnya, dalam melakukan penyelidikan/penyidikan, Polresta tidak sembarangan menetapkan terlapor sebagai tersangka apalagi sampai menjebloskannya ke dalam penjara. Namun semua itu harus sesuai prosedur yang ada, baik pengakuan saksi atau barang bukti. ”Kalau sudah cukup unsurnya, maka polisi bisa melakukan penahanan terhadap tersangka,” tambahnya. Disinggung adanya kasus yang belum tuntas, Tampubolon memaparkan, untuk mengetahui sejauh mana kasus yang telah dilapor-

kan ke polisi, maka petugas penyidik pembantu akan melayangkan surat pemberitahuan perkembangan hasil penyelidikan ( SP2HP) kepada pelapor. “Dalam surat tersebut, pelapor akan menerima pemberitahuan atau bukti-bukti yang masih diperlukan dalam penuntasan kasus itu,” jelasnya. Mengenai tingkat kepercayaan masyarakat terhadap kinerja Polresta Medan, Tampubolon mengaku, selama ini masyarakat masih menaruh harapan yang cukup besar. Pasalnya, hampir setiap hari polisi menerima pengaduan. Artinya masyarakat memberi kepercayaan kepada polisi untuk menyelesaikan perkaranya walau hanya perkara rumahtangga.“Semakin banyak masyarakat mengadu, maka dapat dijadikan alasan bahwakinerjapolisimasihdipercaya,”tambahnya. Dalam peningkatan kinerjanya, Polrsesta Medan juga tidak menampik adanya personel yang melakukan tindakan melanggar disiplin. Namun Tampubolon mengharapkan peran serta dan kepedulian masyarakat dalam memajukan Polri agar lebih dicintai semua kalangan. Saat diminta data-data tentang kasus-kasus yang paling menonjol selama tahun 2010, Tampubolon belum bisa memberikannya. “ Nanti kalau sudah bisa diekspos akan kita berikan kepada wartawan,” jelasnya. (m39)

Waspada/Rudi Arman

PATROLI: Kapolresta Medan Kombes Tagam Sinaga menyerahkan bantuan 10 unit sepedamotor untuk keperluan patroli kepada Satuan Samapta Polresta Medan. Diharapkan bantuan tersebut mempermudah anggota polisi melaksanakan tugas di wilayah hukum Polresta Medan. Terlihat 10 unit sepedamotor jenis trail yang diperuntukkan bagi Satuan Samapta, diparkir di halaman Polresta Medan, Jumat (24/12) sore.


Opini

A6

WASPADA Sabtu 25 Desember 2010

Gaji PNS Dipotong Zakat Oleh Dr H Saparuddin Siregar, SE. Ak, MAg Dukungan penguasa memang mutlak diperlukan dalam penghimpunan ZIS

D TAJUK RENCANA

Euforia Sepak Bola Nasional

S

epanjang pekan ini kita dihadapkan pada euforia sepak bola nasional. Bagaimana tidak tim nasional Indonesia yang tergabung dalam PSSI (persatuan sepakbola seluruh Indonesia) akan menghadapi Malaysia di final piala AFF.

Pelatih timnas Alfred Riedl sepertinya membawa banyak perubahan pada pola permainan Indonesia. Sudah lama negara yang dulu cukup disegani sebagai punggawa bola di Asia Tenggara tak menunjukkan prestasi besar. Kini tinggal dua pertandingan lagi dan Indonesia bisa mengunci gelar. Wajar kalau kemudian semua stasiun televisi, media cetak dan online menggambarkan setiap saat perkembangan yang terjadi di timnas Indonesia. Mereka gencar mengungkap fakta dan data seputar pertemuan Indonesia dan Malaysia. Permainan Indonesia memang berbeda. Saat menghadapi Thailand, timnas mampu menang 2-1. Begitu juga dengan perlawanan Filipina yang bisa disudahi dengan aggregate 2-0 untuk timnas. Kecepatan dan operan kaki ke kaki menjadi ciri khas timnas. Beberapa pemain malah sudah seperti pesepakbola Eropa atau Amerika Latin. Lihat cara kerja Okto dari sisi kiri lapangan. Dia mampu menyisir lapangan hingga mendekati kotak finalti lawan layaknya Robinho dari Brazil. Tinggi badannya sebenarnya bukan standar pesepakbola Eropa namun dia mampu berlari kencang dan mengirim umpan-umpan terukur. Wajar kalau kemudian masyarakat Indonesia jatuh cinta dengan tim nasional. Pernak-pernik timnas pun jadi incaran. Termasuk merchandise dan kostum kebesaran timnas. Laga pertama akan Intisari berlangsung di Stadion Bukit Jalil Malaysia. Konon harga tiket di sana ada yang dijual Lama-lama pemain antara 30 ringgit Malaysia hingga 50 ringgit sepakbola kita tidak Malaysia. Ada pula yang 100 ringgit Malaysia. Berbeda dengan penjualan tiket di dalam perlu lagi dibekali negeri, Malaysia menjualnya dengan tertib. latihan Kungfu selain Sepakbola kita sebenarnya masih jauh dari bisnis yang sebenarnya. Tekanan-tekanan latihan sepakbola. politis dan campur tangan berbagai pihak Sebab selama ini yang yang masih melihat sepakbola dalam negeri kita lihat adalah dengan sebelah mata masih banyak. Tak bisa dihindari dan kita yakin kalau kerusuhan di tengah euforia ini tidak ditindaklanjuti dengan lapangan. pembinaan yang baik sepakbola kita tidak akan pernah maju. Bisa saja setelah piala AFF ini, Indonesia akan kembali terjungkal ke sepakbola tanpa prestasi. Dari sisi penjualan tiket untuk final saja sudah bermasalah. Belum lagi dengan beberapa persoalan lain. Jika mau lebih profesional tirulah kompetisi di negara-negara Eropa. Atau kalau tidak mau terlalu jauh berkacalah dengan kompetisi J-League atau liga Jepang atau juga Turki bahkan Amerika Serikat. Di tiga negara yang disebutkan itu sepakbolanya belum semaju Eropa atau Amerika Latin. Namun para pemain top dunia sudah mulai mau dikontrak klub di sana untuk bermain. Atau lihat pula Korea dan Jepang yang para pemainnya sudah mengisi beberapa tempat di klub Eropa. Park Ji Sung yang ada di Machester United atau Nakamura yang sempat bercokol di Italia dan sekarang di liga Portugal menjadi salah satu contoh bagaimana negaranya mampu menghasilkan pesepakbola berkualitas internasional. Kita mungkin masih akan lama baru bisa mendapatkan pemain bertalenta besar. Namun paling tidak kalau kompetisi dan liga dimenej dengan baik harapannya adalah para pemain besar di Eropa maupun Amerika Latin walau sudah menghabiskan usia emasnya mau bermain di kompetisi Indonesia. Dengan begitu kita akan melihat pelan-pelan perbaikan dari sisi kualitas. Lamalama pemain sepakbola kita tidak perlu lagi dibekali latihan Kungfu selain latihan sepakbola. Sebab selama ini yang kita lihat adalah kerusuhan di tengah lapangan. Jadi selain bermain bola, pemain juga harus punya ilmu bela diri tingkat tinggi untuk menghindari serangan secara fisik. Malah wasit pun kerap jadi bulan-bulanan pemain dan ofisial. Semoga masuknya Indonesia ke final piala AFF menjadi titik balik kemajuan sepakbola nasional. Irama itu paling tidak akan merasuki kompetisi di liga domestik yang menunjukkan sportifnya permainan. Tidak ada lagi kekerasan apalagi teror yang kemudian merusak sejumlah fasilitas umum atau bahkan merugikan masyarakat. Tentu saja kita semua ikut mendoakan agar timnas bisa menang di Malaysia dan mampu menunjukkan kondisi yang sama saat bertanding di Indonesia.*

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta Pusat 10340 Tel: (021) 31922216, Faks: (021) 3140817.

 Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385  Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109  Biro Asahan: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412 Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan hitam-putih Rp. 33.000,Halaman depan berwarna Rp. 90.000,Ukuran kolom: 40,5 mm E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press Isi di luar tanggung jawab percetakan

ua orang ibu yang setiap harinya bertemu di rumah salah seorangnya, samasama terperangah ketika bertemu pada suatu acara lembaga amil zakat. Mereka tidak menyangka kalau sama-sama tercatat sebagai muzakki di lembaga amil zakat itu. Salah satu ibu merupakan majikan dari wanita yang duduk di sebelahnya, yang sehari-hari bekerja di rumahnya sebagai pembantu. Usai acara, seorang pengurus lembaga amil zakat itu beramah tamah dan berdialog dengan sang ibu pembantu. ”Apa yang mendorong ibu untuk senantiasa berzakat ?” tanya si pengurus. ”Oh ...ya saya memang mendapat didikan dari orang tua saya untuk berusaha mengeluarkan zakat dari rezeki yang saya peroleh, meski sekecil apapun rezeki itu. Mudah.mudahan akan barokah,” jawab si Ibu. ”Kalau boleh tau berapa penghasilan ibu dan berapa yang dapat ibu sisihkan untuk zakat setiap bulannya?” si pengurus bertanya lebih jauh. ”Suami saya bekerja sebagai petugas kebersihan di perusahaan swasta, dia memberi nafkah keluarga Rp 600.000,- perbulan dan saya juga memperoleh sekitar itu perbulannya dengan bekerja sebagai pembantu rumah tangga”, ” saya menyisihkan untuk zakat Rp 60.000 per bulan,” jawab si Ibu. ”Wah... luar biasa ibu, lalu bagaimana dengan belanja rumah tangga dan biaya pendidikan anak-anak..?” si Pengurus terkagum-kagum dan ingin mengetahui bagaimana si ibu mengatur ekonomi rumah tangganya. ”Kami mencukupkan apa yang ada saja pak ... untuk keperluan belanja dapur. Kalau mengenai pendidikan anak-anak Alhamdulillah tidak mengalami kesulitan, karena anak saya yang lima orang semuanya tetap memperoleh beasiswa di sekolahnya sejak SD sampai kuliah.”

si ibu menjawab terharu dan bangga. Dialog di atas adalah suatu kisah nyata yang dituturkan KH Didin Hafidhuddin, ketua BAZNAS (Badan Amil Zakat Nasional), ketika menyampaikan ceramah pada acara sosialisasi ZIS yang diselenggarakan di aula Martabe Kantor Gubernur Sumatera Utara pada hari Rabu tanggal 18 Desember 2010 barubaru ini. Suatu hal yang mencengangkan lagi dari kelanjutan kisah diatas seperti dituturkan KH Didin Hafidhuddin bahwa jumlah setoran si Ibu Majikan hanya Rp 50.000,- setiap bulan, atau lebih kecil dari jumlah zakat yang disetorkan pembantunya. Tetapi soal ini penulis berprasangka baik, si Ibu Majikan mungkin menyetorkan zakatnya ke beberapa lembaga amil zakat sekaligus dan juga ada yang dibayarkan langsung kepada mustahiq, sehingga kalau ditotal-total sesungguhnya jauh lebih besar dari Rp 50.000,- itu. Kisah nyata diatas adalah salah satu bukti dari sekian banyak yang telah pula membuktikannya. Bagaimana mungkin pasangan suami istri dengan penghasilan yang terbilang kecil ternyata mampu mengantarkan lima orang anaknya sampai perguruan tinggi, kalau bukan karena keberkahan zakat yang dikeluarkannya. Itulah yang dijanjikan Allah, salah satunya pada surah Al Baqarah(2) :274 ” Orang-orang yang menafkahkan hartanya pada siang hari dan malam hari, baik dengan cara sembunyi ataupun terang-terangan, maka bagi mereka balasan disisi Allah,mereka tidak akan mengalami rasa takut dan tidak akan mengalami duka cita”, dan pada ayat 276 surah yang sama ” Allah menghapuskan keberkahan Riba dan menambah keberkahan Zakat/Sadaqah, dan Allah tidak menyukai orang-orang kafir yang berbuat dosa” . Masih dari penuturan KH Didin, Guru Besar IPB ini, bahwa zakat tidak

hanya membawa keberkahan didalam kegiatan usaha bahkan meningkatkan etos kerja karyawan. Terhadap penjelasan ini penulis telah membuktikannya sendiri di perusahaan tempat penulis bertugas. Pada tahun 2004 penulis mendapat amanah untuk memimpin sebuah BPR Syariah (BPRS) dengan aset sebesar Rp 5 miliar. Berbekal pemahaman bahwa menunaikan zakat adalah suatu perintah wajib, mulai tahun itu penulis mengusulkan sebagai UPZ (unit Pengelola Zakat) ke BAZDA SU dan menerapkan pemotongan zakat dari gaji seluruh karyawan, zakat dari bagi hasil tabungan/deposito dan zakat dari keuntungan perusahaan. Dalam perjalanan usaha, tahun demi tahun, tampak perkembangan yang menggembirakan, asset tumbuh rata-rata Rp 5 miliar per-tahun, demikian pula kesejahteraan karyawan yang semakin membaik. Disamping itu etos kerja tampak jauh membaik, karyawan dapat bekerja mandiri dan tidak membutuhkan pengawasan. Inilah agaknya bentuk peningkatan etos kerja yang dimaksud Prof. Didin. Demikian pula di Bank Sumut, Sebagaimana pernah dituturkan Direktur Utamanya Gus Irawan kepada penulis, bahwa pada suatu kesempatan Gathering, Gus mengumumkan kebijakan kenaikan gaji. Pengumuman ini tentu disambut riuh oleh karyawan, ”namun ...” kata Gus (suara riuh mendadak tertahan), ”seiring dengan kenaikan gaji maka akan dilakukan pula pemotongan zakat sebesar 2,5%.” Mendengar lanjutan pengumuman ini suara riuh berbaur dengan suara yang agaknya sedikit kurang gembira. Penulis meyakini dengan adanya pemotongan zakat ini telah membawa keberkahan bagi Bank Sumut maupun karyawannya. Sehingga Bank ini memperoleh Golden Award 2009 dari majalah info bank sebagai bank dengan predikat ”Sangat Bagus” selama 5 tahun berturutturut dari sisi keuangannya. Tidak hanya sampai disitu, dari sisi pelayanan Bank Sumut juga telah meraih Award peringkat I Best Teller Service Banking Service Excellence serta peringkat II Best Customer Service Banking Service Excellence

dari majalah Info Bank dan MRI pada tahun yang sama. Dukungan penguasa memang mutlak diperlukan dalam penghimpunan ZIS, apalagi untuk pemotongannya dari Gaji. Badan Amil Zakat di beberapa pemerintahan Kabupaten dan Kota menunjukkan keberhasilan dalam menghimpun zakat memang atas dukungan Bupati atau Walikotanya. Sebut saja Walikota Pemerintah Kota Padang sebagai contoh, beliau menggunakan jumlah setoran zakat seseorang kepada BAPERJAKAT Kota Padang untuk dapat dipertimbangkan dan diangkat pada jabatan-jabatan strategis. Bahkan di Kota Kutai Kalimantan Timur, Walikota langsung memotong zakat dari hasil penagihan pekerjaan rekanannya untuk disetorkan ke BAZDA Kutai. Wajar saja kalau BAZDA Kota Kutai menjadi yang terbesar penghimpunannya dibanding BAZDA lain di Indonesia. Selain perlunya dukungan pemerintah bagi suksesnya penghimpunan ZIS, perlu pula dibudayakan penyetoran ZIS kepada lembaga semacam BAZ, LAZ dan UPZ, bukan dilakukan penyerahan secara langsung oleh pribadi atau perusahaan kepada individu-individu muzakki. Bukankah para muzakki dapat merekomendasikan kepada Lembaga Zakat tentang mustahiq-mustahiq yang dirasanya perlu menerima. Penyaluran melalui lebih maslahat karena penyaluran ZIS dapat dikordinasikan sesama lembaga penghimpun zakat dan dapat dilakukan upaya pembinaan Mustahiq, bilamana mungkin diantara mereka dapat dilatih dan diberi modal kerja sehingga dapat berubah menjadi Muzakki. Akhirnya, semoga sukses pemotongan ZIS dari Gaji PNS Muslim Propinsi Sumatera Utara terhitung bulan Januari 2011. Dengan penuh keyakinan semoga keberkahan beserta kita. Insya Allah visi-misi Pemerintah Propinsi Sumatera Utara“Rakyat tidak lapar, tidak bodoh, punya masa depan” dapat direalisasikan. Yakinkan...! bahwa meskipun gaji saudara-saudara dipotong, Allah akan menggantinya. Kenapa takut? Penulis adalah Wakil Ketua BAZDA SU

Urgensi Zakat Dikelola Negara Oleh Nispul Khoiri Pengelolaan zakat yang dilakukan negara dapat bersinergi dengan semangat otonomi daerah

D

isahkannya Undang-Undang (UU) No 38 Tahun 1999 tentang Pengelolaan Zakat di Indonesia (berlaku pada 13 Oktober 1999) pantas disyukuri. UndangUndang ini banyak memberikan implikasi positif per-zakatan di Indonesia. Undang-Undang pengelolaan zakat secara yuridis menetapkan adanya proses pengesahan dua lembaga pengelola zakat yakni lembaga dibentuk pemerintah disebut “Badan Amil Zakat” (BAZ) dan lembaga dibentuk oleh masyarakat dikukuhkan pemerintah disebut “Lembaga Amil Zakat” (LAZ) Seiring dalam perjalanannya, dalam perkembangannya terus dirasakan banyak kelemahan. Undang-Undang zakat dipandang tidak mampu lagi memenuhi tuntutan zaman terutama dalam penggalian potensi harta zakat yang begitu besar. Karena itu berbagai desakan muncul, mengharuskan UU ini direvisi. Salah satu materi dipandang urgen untuk direvisi adalah mengenai otoritas kelembagaan pengelolaan zakat. Selama ini UU zakat telah mensahkan dualisme kelembagaan zakat (BAZLAZ). Selain adanya lembaga zakat pemerintah (BAZ) juga terbuka ruang pihak swasta mendirikan LAZ. Paradigma ini harus diubah, pengelolaan zakat harus dikelola lembaga tunggal. Paling tidak melihat beberapa negara (seperti Malaysia) pengelolaan zakat dilakukan oleh lembaga khusus dan tidak terlihat dualisme lembaga. Perdebatan yang panjang bisa muncul, siapakah seharusnya mengurus zakat (amil). Apakah harus ditangani oleh negara atau masyarakat. Banyak kalangan menginginkan seharusnya pengelolaan zakat menjadi bagian

aktivitas negara. Negara sebagai regulator, pengawas dan operator sebagaimana halnya pajak. Banyak pula kalangan menginginkan pengelolaan zakat diurus pihak swasta lebih akuntabilitas dan dipercayai masyarakat. Kebutuhan hukum Peran pemerintah (regulator, operator, pengawas) dalam mengurus zakat jus-tru dirasakan seba-gai kebutuhan hu-kum dalam masya-rakat. Paling tidak ada berbagai pertimbangan logis dan realistis pen-tingnya negara mengintervensi dalam pengelolaan zakat. Pertama, zakat membawa kekuatan imperatif (kewajiban ) pemungutannya dapat dipaksakan (Qs. at-Taubah; 9 dan 103). Negara yang mempunyai otoritas untuk melakukan pemaksaaan seperti halnya pajak, karena negara mempunyai kekuatan dengan perangkat pemerintahannya, dan didukung regulasi yang mengikat dana zakat akan mudah terkumpulkan, kemudian dapat menjadi bagian pendapatan negara seperti halnya pajak Kedua, besarnya jumlah potensi harta zakat yang belum tergali secara maksimal mengharuskan menjadi perhatian negara. Berdasarkan informasi disampaikan oleh Prof Darmayanti (anggota DPD RI) saat Rapat Dengar Pendapat Umum tentang Pembahasan Revisi UU Zakat No 38/1999 pada Jumat 05 Nopember 2010, Kementerian Agama KantorWilayah Provinsi Sumatera Utara menyampaikan potensi zakat Indonesia hari ini berkisar Rp19 trilyun per tahun. Sedangkan penerimaan zakat harta dan zakat fitrah secara nasional pada tahun 2009 baru mencapai Rp1,2 trilyun. Pada kenyataannya, dana zakat yang berhasil dihimpun dari masyarakat jauh

dari potensi yang sebenarnya. Potensi yang besar itu akan dapat dicapai dan disalurkan kalau pelaksanaannya dilakukan oleh negara melalui departemen teknis pelaksana. Ketiga, agenda besar dihadapi negara hari ini adalah pengentasan kemiskinan (poverty). Jumlah penduduk miskin/penduduk yang berada di bawah garis kemiskinan di Indonesia pada bulan Maret 2009 sebesar 32,53 juta atau 14,15 %. Berdasarkan data dari Kementerian Pembangunan Daerah Tertinggal, dari keseluruhan kab/kota termasuk daerah tertinggal masih ada sekitar 183 kab/kota dalam kategori daerah tertinggal. Pengentasan kemiskinan ataupun program kesejahteraan umat tidak cukup dilakukan dengan program APBN/APBD. Potensi dana zakat yang cukup besar tersebut sebuah alternatif untuk itu dan akan turut membantu pencapaian sasaran pembangunan nasional. Keempat, keadilan menjadi bagian prinsip dasar kenegaraan. Persoalan keadilan dan kesejahteraan umum adalah persoalan struktural yang tidak mungkin terjangkau secara merata tanpa melibatkan negara (indirect giving). Kelima, pengelolaan zakat oleh negara, dapat membangun jaringan kerja (net working) lebih terarah, semakin mudah berkoordinasi, komunikasi dan informasi dengan unit pengumpul zakat (LAZ), sehingga pengentasan kemiskinan semakin terarah, tepat guna dan tidak overlapping dalam penyaluran dana zakat, kepastian dan mendisipilinkan muzakki membayar zakat ke lembaga semakin terjamin, sekaligus terbangun konsistensi lembaga pengelola zakat bisa terjaga terus menerus karena sudah ada sistem yang mengatur. Keenam, pengelolaan zakat yang dilakukan negara dapat bersinergi dengan semangat otonomi daerah dalam meningkatkan kesejahteraan masyarakat daerah. Peran konkrit Pemda dalam mekanisme pengelolaan zakat dengan menfasilitasi pembentu-

kan Lembaga Pengelolaan Zakat (LPZ) Pemda, menetapkan susunan organisasi LPZ sesuai masing-masing daerah, menempatkan aparatur Pemda sebagai pengurus BAZ, membantu biaya operasional LPZ daerah setiap tahun. Dana zakat yang terkumpul dari daerah didistribusikan kembali kepada daerahnya masing-masing. Penutup Mengintegrasikan zakat menjadi domain negara, tidak saja mengembalikan pengelolaan zakat ke khittah awalnya, tetapi peran yang dimainkan negara, mengimplementasikan semangat ajaran zakat sebagai jaminana sosial masyarakat miskin, mendistribusikan keseimbangan harta antara kaya dan miskin dan secara material potensi harta zakat yang tergali secara maksimal menyadarkan rasionalitas redistribsusi oleh negara dan menempatkan zakat menjadi bagian pendapatan negara seperti mana halnya pajak. Namun akuntabilitas menjadi unsur penting dilakukan oleh pemerintah, harus ada pertanggung jawaban secara transparan. Potensi dana zakat yang begitu besar tidak tertutup kemungkinan mengundang kerawanan berbagai penyimpangan. Artinya kita gagal membuktikan lembaga pengelola zakat pemerintah sebagai institusi publik yang kredibel, konsekwensinya umat bukannya simpatik, malah timbul antipati. Penulis adalah Dosen FD IAIN-SU, Dosen FH UMSU

Pengumuman

Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

APA KOMENTAR ANDA SMS

081265134674

Faks 061 4510025

Email komentar@waspada.co.id

+6281265078051 Gapura memasuki kota Medan dari wilayah barat sangat tidak terawat dan jorok banyak sampah dan bau amis dan terkesan Pemko Medan tidak merawatnya. Jembatan kampung lalang begitu tidak terawat dan tolong di bawah jembatan begitu banyak sampah dibuang di sisi jembatan dekat sungai. Apa kerja dinas kebersihan dan pertamanan pemko medan sampah begitu banyak di bawah jembatan kampung lalang tidak dibuang dan kok tidak diperhatikan.

+6285276210089 Bapak gubenur Sumatra Utara tolong ditindak anggota LLAJR yg ada di Bandarbaru kenapa mobil Tanah Karo yg melintas hanya kena bayaran 5000 rupiah per truk nya kenapa mobil angkutan kami dari Aceh Tenggara Gayolues Aceh Singkil Aceh Barat kok sampe ratusan ribu membayar di pos tersebut. Pak apa kami ini harus dipaksakan kalau tidak dibayar kok harus ditilang mereka semua pake mobil mewah mungkin tak di setor pad-nya pak tolong ditertibkan pak Wagub Sumut trim’s.

+6285227678840 Assalamu’alaikum bapak Guberner Aceh tolong bapak majukan permainan sepakbola anak u12

+6285270972781 Kepada KPK dan Gubsu yang terhormat, tolong diusut penerimaan CPNS di kabupaten Batubara, karena terindikasi adanya kecurangan,dimana anak bupati lulus menjadi PNS

SUDUT BATUAH * Wagubsu: Aktualisasi pemuda tak hanya politik - Jalur politik lebih cepat popular * Pebisnis setuju tarif parkir di Medan naik - Alamak tak sepaham kita, he...he...he * Di Medan jangankan jalan, trotoar pun macet - Yah namanya juga “Ini Medan Bung’ oel

D Wak

WASPADA

Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Sofyan Harahap, H. Azwir Thahir, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Desk Edisi Luar Kota: H. Halim Hasan. Desk Edisi Medan & Sekitarnya: H. Akmal AZ. Asisten Redaktur: Rudi Faliskan (Berita), David Swayana (Kota Medan, Infotainmen), Irwandi Harahap (Kota Medan), Feirizal Purba, Diurna Wantana (Sumatera Utara), H.T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, KMS Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (KMS Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Humas: H. Erwan Effendi, Aidi Yursal. Litbang: Hj. Emma Sujianti Tarigan. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (Aceh). Wartawan Kota Medan (Umum): H. Erwan Effendi, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), Nurkarim Nehe, Bustami Chie Pit, Sapriadi (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat), Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap (Padang Sidimpuan), Sori Parlah Harahap (Gunung Tua), Idaham Butarbutar, Syarif Ali Usman (Sibuhuan), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Sudarmansyah (Blang Pidie), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

 Semua wartawan Waspada dilengkapi dengan kartu pers Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah ditandatangani Pemimpin Redaksi 


Laporan Khusus

WASPADA Sabtu 25 Desember 2010

A7

Tabir Empat Abad Tun Seri Lanang Keturunan Ke-8, Hj Pocut Haslinda Akan Terima Gelar Kehormatan Pahang

Tun Seri Lanang dalam bentuk lukisan, dibuat oleh Hj Pocut Haslinda

Hijrah ke Aceh Hj Pocut Haslinda menuturkan, Tun Seri Lanang datang ke Aceh bukanlah direncanakan tetapi melalui peristiwa yang unik dan nuansa perjuangan melawan imperialis/kolonialis Portugis dan Belanda. Menjelang perpindahan Tun Seri Lanang dari Johor ke Aceh, situasi ekonomi dan politik daerah Melayu dalam suasana terpolarisasi. “Ini berawal dari keberadaan Portugis di Malaka. Satu kelompok pro terhadap bercokolnya imperialis Portugis di Melayu dan yang lainnya kontra,” kata Pocut yang mempunyai lima orang anak dari perkawin a n n y a d e n g a n Te u k u Syahrul Muda Dalam, yakni Teuku Riefky Harsya (anggota DPR RI), Teuku Rafly Pasha (Penasehat Gubernur Aceh Irwandi Yusuf ), Cut Intan Fitria Safi (Manager di SCTV ), Cut Maudila Natasya Mutia (almarhumah) dan Teuku Marvi Marsya. Pada awalnya, mayoritas kesultanan di kawasan Melayu menentang Portugis, tetapi dengan strategi politik divide et impera (memecah belah bangsa), Portugis berhasil membuat kaum Melayu menjadi saling bermusuhan. Pada tahun 1511, Malaka bertekuk lutut pada Portugis dan ke-

mudian lahirlah Kesultanan Johor Lama yang berdiri sekitar tahun 1528an, Perak kemudian menyusul Pahang sekitar tahun 1575. Tidak demikian halnya di ujung Barat Sumatera. Kesultanan Aceh Darussalam dalam masa kejayaannya memperlihatkan jati diri anti Portugis sebagaimana diperlihatkan pemerintahan Ali Mughayat Syah (1511 – 1530). Portugis diusir dari negeri kerajaan kecil seperti Pidie, Daya, Samudera Pasai, Tamiang, Peureulak dan Aru, kemudian bersatu dalam Kesultanan yang disebut Aceh Darussalam. Tidak hanya itu, Aceh meneruskan ekspansi perjuangannya ke negeri seberang dengan menyerang Portugis di Malaka pada tahun 1540-1547. Tahun demi tahun peperangan berlangsung, pasukan Aceh menghadapi tantangan berat, tidak hanya dari pasukan Portugis tapi juga kerajaan-kerajaan di semenanjung Malaya yang justru berada di pihak Portugis. Johor yang saat itu dipimpin Sultan Alaudin Riaayat Syah berada di pihak Portugis, karena terkait perjanjian dengan Portugis. Hal ini membuat marah Aceh, sehingga Aceh berpikir bahwa untuk mengenyahkan Portugis di Malaka, harus lebih dahulu me-

Waspada/Hasriwal AS

naklukkan kerajaan-kerajaan di Semenanjung Malaka yang pro Portugis. Kemarahan Aceh juga dipicu ulah Johor yang membantu Aru ketika hendak ditaklukkan Aceh Darussalam, ditambah lagi Johor justru menyerang Aceh di tahun 1540 yang dibantu oleh kesultanan Pahang dan Perak. Negeri Pahang dan Perak ikut terlibat karena Sultan Zainal Abidin beristerikan adik Sultan Johor sedangkan Sultan Perak sendiri adalah saudara Sultan Johor. Inilah latar belakang mengapa Aceh Darussalam melancarkan serangan ke Johor dengan tiga jurus yakni, Johor, Malaka dan Patani. Baru pada tahun 1613 semasa Sultan Iskandar Muda (1607-1636), Aceh berhasil mengepung Batu Sawar, ibukota Johor, selama sembilan hari. Sultan Johor Alaudin Riayat Syah III (1597-1615) akhirnya menyerahkan diri dan berjanji tidak lagi bekerjasama dengan Portugis dan Belanda. Sebagai penggantinya, Aceh mengangkat Sultan Muzafar Syah dengan perjanjian tidak membantu Portugis. Sedangkan Sultan Alaudin, bersama Raja Abdullah dan bendaharanya Tun Seri Lanang dibawa ke Aceh. Mereka diperlakukan dengan baik. Raja Abdullah dinikah-

Ternyata, Tun Seri Lanang tidak hanya sekadar raja yang bijaksana dan sastrawan agung, pujangga dan negarawan, tetapi juga ulama penyebar ajaran Islam, khususnya di kawasan Timur Aceh. Bukunya berjudul Sulalatus Salatin telah menjadi referensi sejarah Melayu di sekolah-sekolah Negeri Malaysia. Alkisah, Pendopo Kegubernuran Aceh Darusalam, dulu merupakan Istana Darul Dunia Sultan Iskandar Muda, Mahkota Alam Syah Johan berdaulat, tempat dimana Tun Seri Lanang diangkat dan menjalankan tugasnya sebagai Penasehat Kerajaan. Kemudian Sultan menghadiahkan Kenegerian Samalanga dan mengangkat Dato Bendahara Tun Muhammad Tun Seri Lanang, bergelar Orang Kaya Seri Paduka Tun Seberang, menjadi Raja Pertama Kenegerian Samalanga, Aceh Darusalam (1613-1659). Tun Seri Lanang disebut Tun Seberang karena ia berasal dari negeri jiran, Malaysia, warga seberang yang berhasil menjadi Uleebalang pertama Samalanga, Aceh Utara. Tun Seri Lanang mempunyai turunan yang masih hidup, baik di Indonesia maupun Malaysia. Keturunannya kedelapan adalah Hajjah Pocut (Cut Nyak)

kan dengan Ratna Jauhari, adik Sultan Iskandar Muda. Selanjutnya Abdullah dan istrinya disertai 2.000 pasukan diantar pulang ke Johor untuk kembali membangun Kesultanan Batu Sawar. Tun Seri Lanang tidak pulang ke Batu Sawar. Dia justru diangkat menjadi Penasehat Sultan Iskandar Muda atas pertimbangan kepintaran yang terkandung dalam diri negarawan negeri seberang itu dan seterusnya dipercaya memimpin negeri Samalanga sebagai raja pertama. Hingga akhir hayatnya Tun Seri Lanang dimakamkan di Lamtjook (Samalanga), Aceh pada tahun 1659. Permata Melayu dari Malabar Hj Pocut Haslinda juga menelusuri asal usul silsilah Tun Seri Lanang. Bendahara Orang Kaya dan Paduka Raja Tun Seberang itu ternyata merupakan turunan Mani Purindam keenam alias Amir Badaruddin Khan, putra Nizamul Muluk Akbar Syah (kemungkinan besar leluhurnya turunan dari Arab berserak sampai ke Malaysia, Aceh, Deli dan Serdang serta tanah Nusantara). Pada abad kedelapan, banyak khalifah Arab hijrah ke India (Malabar) serta

Haslinda Syahrul Muda Dalam binti H. Teuku Abdul Hamid Azwar. Sedangkan keturunannya yang ketigabelas adalah Datuk dari Kerajaan Pahang, Dato Sri Haji Adnan bin Haji Yaakob. Bukan hanya sekadar menunjukkan susur galur (keturunan), Hajjah Pocut Haslinda berperan aktif dalam menggali sejarah Tun Seri Lanang sejak tahun 1988 sehingga memberi kesan mendalam bagi kerajaan Pahang Darul Makmur. Gelar kehormatan akan diberikan kepadanya pada Januari 2011 mendatang, dinamakan: ‘Darjah Kebesaran Mahkota Pahang yang Amat Mulia-Peringkat Kedua Darjah Indera Mahkota Pahang (DIMP)’ dan berhak menyandang gelar Datok. Bagaimana kilasan sejarah Tun Seri Lanang berdasarkan kisah penggalinya, wartawan Waspada Hasriwal AS telah mewawancarai Hajjah Pocut Haslinda, di kediamannya di Jalan Tirtayasa, Jakarta Selatan, Kamis (16/12), bertepatan dengan hari ulangtahunnya ke-65.

menetap turun-temurun sampai ke Negeri Pahili (Gujarat) di India Selatan. Sejak leluhurnya hingga zaman Nizamul Muluk Akbar Syah meraih sukses berniaga sambil menyebarkan agama Islam sampai membangun suatu kerajaan di Negeri Benua Keling Pahili. Sebagai raja, Nizamul Muluk Akbar Syah bergelar Nizam al Muluk Akbar Syah memerintah sekitar 1335 – 1388 M (764-798 H) – (Silsilah Raja-Raja Deli Serdang yang disusun Teuku Syahbuddin Razie atas permintaan Teuku Haji Abdullah Isomuddin). Nizamul Muluk mempunyai dua putera dan seorang puteri, dimana putera pertamanya bernama Syekh Amir Badaruddin Khan alias Mani Purindam, yang kedua adalah Raja Akbar Muluk Syah dan yang putri bernama Damia Seri Wandi. Hal ini dituliskan Tun Seri Lanang dalam buku Sulalatus Salatin, dimana karyanya itu merupakan ‘titah’ Raja agar titah ini sampai kepada anak cucu. Setelah Raja Nizamul wafat, putra keduanya Raja Akabra diangkat sebagai raja pengganti ayahnya, sedangkan Mani Purindam mengembara ke Pasai dan Malaka di Abad ke-13. Dalam pengembaraannya ke Malaka, Mani Purindam berserta

Hj Pocut Haslinda (kanan) berfoto bersama adik dan cucu-cucunya. Dia akan menerima gelar Datok dari Negeri Pahang, Januari 2011.

Waspada/Hasriwal AS

rombongannya diserang ombak besar dan akhirnya terdampar di daerah Jambu Air, wilayah Kesultanan Samudera-Pasai. Di sana Mani Purindam menikah dengan Canden Dewi, puteri dari Sultan Pasai ke-6, Sultan Said Malikuzzahir yang berkuasa dari 1403-1405. Dari perkawinan Mani Purindam dengan Canden Dewi lahirlah seroang anak bernama Raja Derikan Akbar Qamaruddin (Pocut Simpul Alam), kemudian Pocut Simpul menikah dengan Sultan Bahren Syah Ratu Purba yang juga Sultan Pasai ke 11 dan mempunyai anak bernama Pocut Raya Ali Akbar. Anak Pocut Simpul Alam inilah yang kemudian mendirikan kerajaan dan sekaligus menjadi penguasa dan bangsawan di wilayah Deli dan Serdang (silsilah yang disusun oleh Tengku Syahbuddin Razi). Pendiri Kerajaan Deli adalah Pocut Hisyamuddin yang bergelar Laksamana Kuja Pahlawan (Panglima Sultan Iskandar Muda yang berkuasa mewakili Sultan mulai dari Tamiang sampai Pasir Ay a m D e n a k d i t a h u n 1630M). Pocut Hisyamuddin kemudian digantikan anaknya y a n g b e r n a m a Tu a n k u Panglima Perunggit sebagai Raja ke 2 (1634-1700 M), dan akhirnya melepaskan diri dari Aceh. Raja ke-2 ini digantikan anaknya Tuanku Panglima Padrap (Pidali) sebagai Raja ke 3. Tuanku Pidali memiliki empat anak, yakni Tuanku Jalaludin, Tuanku Gandar Wahid, Tuanku Umar dan Tuanku Tawar. Tuanku Gandar Wahid merupakan pengganti ayahnya Tuanku Pidali. Sedangkan Tuanku Umar memisahkan diri dan kemudian mendirikan Kerajaan Serdang. Setelah lama bermukim di Pasai, Mani Purindam kembali ke negeri asalnya, Pahili. Selang beberapa waktu, Mani Purindam pergi ke Negeri Malaka dan di sana dia diterima oleh Raja Malaka. Sang Raja kemudian menikahkan puterinya Tun Ratna Sandari dengan Mani Purindam. Dari anak cucunya Mani Purindam dengan puteri Malaka inilah kemudian menjadi penguasa dan bangsawan di Aceh, Johor, Pahang, Perak, Terengganu dan Selangor, serta kemudian menjadi nenek moyang Tun Seri Lanang. Dari perkawinan Mani Purindam dengan Tun Ratna Sandari lahir sepasang anak, yakni Tun Ratna Wati dan Tun Ali Seri Nara Diraja. Tun Ratna Wati menikah dengan Sultan Muhammad Syah (Sultan Malaka ke 3) yang berkuasa dari 14221444. Anak cucu turunan Tun Ratna Dewi dan Sultan Muhammad Syah menjadi penerus kesultanan di

Tun Seri Lanang adalah orang pertama yang menjadi Uleebalang Negeri Samalanga pada tahun 1613 sam-pai mangkat pada tahun 1659 di Kuta Blang, Samalanga, dan juga ulama penyebar Islam.

H

AJJAH Pocut H a s l i n d a mengenang awal penggalian sejarah Tun Seri Lanang untuk memenuhi wasiat orangtuanya, Teuku Abdul Hamid Azwar, sebelum meninggal. Almarhum adalah turunan ketujuh, menyimpan koleksi peninggalan Tun Seri Lanang. Mulai dari buku hingga rencong dan pistol telah diserahkan kepadanya sebagai bukti sejarah. Suatu tugas berat, pasti memakan waktu, dana, tenaga dan pikiran, namun amanah harus dilaksanakannya. Demikianlah tekad yang membara di dalam diri Hj Pocut Haslinda. Menurut Pocut Haslinda, upaya penggalian sejarah Tun Seri Lanang ini pertama kali digagas pada 1988 atas lawatan pihak Kerajaan Pahang ke Aceh guna mencari informasi awal. Berkat hubungan muhibah, pihak Kerajaan Pahang semakin menyadari betapa pentingnya Aceh bagi sejarah Melayu. Hubungan Aceh – Pahang telah dimulai sejak masa Sultan Iskandar Muda Meukuta Alam menikahi Puteri Kamaliah dari keluarga Diraja Pahang yang kemudian terkenal di Aceh dengan sebutan Putroe Phang (Putri Pahang). Upaya tersebut juga disokong adanya wasiat dari pihak keluarga Tun Seri Lanang di Jakarta yang dipegang oleh Pocut Haslinda untuk mencari datuk mereka yang berada di Malaysia. “Bersama abang saya Teuku Syamsul kami terus dihinggapi tanda tanya akan Datuk kami, dan awalnya kami belum mengetahui bagaimana peranan sesungguhnya yang dimainkan Tun Seri Lanang di Aceh,” ujar Pocut Haslinda. Di tahun 1996 kunjungan resmi kedua dari Kerajaan Pahang, dilakukan oleh Tengku Abdullah, selain untuk membina kembali hubungan Malaysia – Aceh, juga menelusuri hubungan sejarah yang terbina antara kedua negeri itu sejak zaman Sultan Iskandar Muda. Terbitnya buku ‘Aceh Dalam Perang Mempertahankan Proklamasi Kemerdekaan 1945-1949 dan Peranan Teuku Hamid Azwar’ pada tahun 1998 merupakan secercah harapan mengungkap perjalanan dan sejarah ‘Pujangga, Sastrawan Agung dan Negarawan’ Tun Seri Lanang. Buku tersebut dikirim ke Kerajaan Pahang, kemudian oleh Datok Sri Wan Abdul Wahid bin Wan Haji Hasan dilakukan pengkajian terhadap peran Tun Seri Lanang yang merupakan keturunan Kerajaan Pahang. Babak baru sejarah Tun Seri Lanang dimulai dengan ditemukannya makam Tun Seri Lanang di Samalanga, Aceh Utara. Jika sebelumnya Tun Seri Lanang merupakan tawanan sebagaimana ditulis oleh Winstedt, (“ Tun Sri Lanang of the Malay Annals was a prisoner with the Sultan at Pasai. Samalanga and records in the introduction to that work that his master died at Acheh” Tun Seri Lanang dari Malaya adalah tawanan......) maka dengan penemuan yang dilakukan secara berterusan ini terungkaplah, Tun Seri Lanang bukanlah sekedar tawanan di Aceh. Tetapi lebih dari itu, Tun Seri Lanang adalah orang pertama yang menjadi Uleebalang Negeri Samalanga pada tahun 1613 sampai mangkat pada tahun 1659 di Kuta Blang, Samalanga, dan juga ulama penyebar Islam. Sampai kini bangunanbangunan sejarah pada masa perjuangannya terdapat di Dayah kuta Blang (pondok pesantren), Masjid Raya, Masjid Matang Wakeuh dan Tanjungan.

Malaka dan Johor Lama. Sedangkan keturunan Tun Ali secara tradisional menduduki jabatan Bendahara di Kesultanan Malaka dan Johor Lama yang bernama Sultan Mahmud II . Dari keturunan Tun Ali inilah lahir Tun Seri Lanang d a r i j a l u r i b u n y a Tu n Genggang binti Tun Jamal bin Tun Mal Ali bin Tun Hasan Tumenggung bin Tun Mutahir bin Tun Ali bin Mani Purindam. Gelar Datuk dari Pahang Perjuangan Pocut Haslinda bersama almarhum suami dan abangnya dalam menggali sejarah Tun Seri Lanang ternyata tidak saja bermanfaat bagi keturunannya, tapi juga menjadi catatan berharga dalam perjalanan sejarah perjuangan bangsa Indonesia. Demikian pula Negeri Pahang, Malaysia, merasakan karya Pocut Haslinda sebagai khidmat bakti yang cemerlang. Negeri itu mengucapkan terima kasih dan akan memberikan penghargaan kepada Hj. Pocut Haslinda. Melalui surat undangan yang diperlihatkannya dari Menteri Besar Pahang, tertulis ucapan terimakasih yang setinggi-tingginya dan meminta Pocut Haslinda untuk terus menyumbangkan khidmat bakti yang cemerlang kepada Raja dan Negeri Pahang Darul Makmur. Pocut akan menerima gelar ‘Darjah Kebesaran Mahkota Pahang yang Amat Mulia-Peringkat Kedua Darjah Indera Mahkota Pahang (DIMP)’ dan berhak membawa gelaran ‘Datok’. Penyematan gelar Datuk dari Kerajaan Pahang kepada Pocut Haslinda ini akan digelar pada Januari 2011 bersamaan dengan acara ‘Pengurnian Darjah Kebesaran dan Pingat Negeri Pahang Darul Makmur Sempena Ulang Tahun Hari Keputeraan yang ke-80 Kebawah Duli Yang Maha Mulia Sultan Pahang’. Hj Pocut Haslinda merasa bersyukur telah membuka tabir Tun Seri Lanang empat abad lampau. Wasiat orangtuanya telah terpenuhi. Ia terharu. “Sejarah dari nenek moyang kami ini dapat terbuka dan ini juga merupakan sejarah tidak hanya pada turunan Tun Seri Lanang tetapi juga sejarah bangsa Indonesia dan Malaysia, bahkan bangsabangsa Melayu di dunia ini.” Besar harapannya agar pemerintah Indonesia memberi pengakuan, sebagaimana halnya pemerintah Malaysia, bahwa Tun Seri Lanang merupakan sejarahwan, negarawan, ulama dan pahlawan. “Tun Seri Lanang adalah kebanggaan kita semua,” demikian Pocut Haslinda mengakhiri perjumpaan dengan Waspada. Hasriwal AS


Ekonomi & Bisnis

A8

WASPADA Sabtu 25 Desember 2010

Armin Nasution

Analisis

Redaktur Ekonomi

Industri Sepak Bola Nasional PEKAN ini seorang pebisnis sudah menjanjikan saya satu tiket di final piala AFF yang bakal digelar di Jakarta. Selain tiket, tentu saja dilengkapi dengan akomodasi ke sana. Namun dengan berat hati dan atas berbagai pertimbangan keinginannya tersebut saya tolak dengan halus. Entah kenapa saya malah lebih tertarik kalau ada yang menawarkan untuk menonton final piala AFF leg pertama di Stadion Bukit Jalil Malaysia daripada terbang ke Jakarta. Banyak pertimbangan untuk itu. Pertama memang saya belum pernah jatuh cinta dengan sepakbola nasional. Berbeda dengan minat saya memperhatikan sepakbola Eropa seperti liga Spanyol, liga Inggeris, liga Italia atau juga sepakbola Amerika Latin. Liga Indonesia atau timnas-nya sekali pun belum bisa dibandingkan dengan belahan dunia lain yang saya sebut tadi. Kedua, tentu saja kekhawatiran terjadinya keributan pasca pertandingan. Iya kalau Indonesia menang dan jadi juara. Bagaimana kalau kemudian kalah telak. Kekuatan suporter Indonesia lain dengan di luar negeri. Di sini selain bawa petasan, masih banyak yang membawa benda tajam ke stadion. Belum lagi pulangnya. Kalau aman bolehlah, tapi biasanya kalau tim kesayangan kalah selalu berujung kerusuhan. Ketiga, pemain sepakbola kita masih bayak yang kurang disiplin. Selain harus mampu bermain bola di lapangan saya melihat mereka juga dibekali ilmu bela diri. Sehingga kerapkali keributan di lapangan berujung dengan adu fisik.Wasit pun sering jadi sasaran amuk massa. Memang pembinaan sepakbola nasional masih merupakan pekerjaan rumit yang perlu diselesaikan dengan bertahap. Hingga kemudian kita bisa melihat bagaimana sepakbola ini menjadi industri dan menggerakkan bisnis. Setiap Agustus dan Januari bisnis sepakbola di Eropa benar-benar dinanti masyakarat dunia. Bagaimana tidak nilai transfer pemain saja bernilai triliunan rupiah. Ingat bagaimana ketika Christiano Ronaldo saat pindah dari Machester United ke Real Madrid dibandrol Rp1,2 triliun. Atau bagaimana dulu Zinedine Zidan pindah dari Juventus ke Real Madrid. Semua ditransaksikan dengan harga ratusan miliar rupiah hingga triliunan rupiah. Bisnis sepakbola di Eropa memang berkembang pesat. Bahkan sebagian klub sudah mencatatkan diri di bursa saham.

Dampak ekonomi sepakbola secara bisnis, luar biasa. Melibatkan dana triliunan rupiah. Nilai pasar David Beckham 150 juta dolar. Michel Ballack, pemain top Jerman, berkisar 30 juta Euro. Belum lagi nilai jual dan nilai pasar Ronaldinho, pemain terbaik dunia asal Brazil saat itu. Semuanya seperti melengkapi kesempurnaan cabang olahraga sepakbola yang mampu membuat bola mata dunia tidak berkedip di depan TV. Pengelolaan keuangan yang modern dan klub sudah seperti perusahaan. Adakalanya rugi dan di kemudian hari bisa untung besar. Jadi industri sepakbola di Eropa benar-benar menghitung efek bisnis. Itu belum lagi pendapatan masing-masing klub dari penjualan merchandise. Seperti gantungan kunci, ballpoint, gunting kuku, kaus, topi juga pernak pernik lain. Sepakbola benar-benar telah menjadi bisnis dan masuk dalam satu satu industri di Eropa. Saya percaya industri sepakbola di sana tidak langsung menjelma sebesar sekarang. Pasti berproses. Indonesia pun sepertinya akan menuju ke sana. Itu sebabnya kebijakan transfer dan perekrutan pemain asing sudah diizinkan. Apalagi perkembangan terbaru adalah munculnya naturalisasi pemain.Warga negara lain bisa direkrut menjadi pemain nasional. Banyak bisnis ikutan yang muncul dari perkembangan industri sepakbola. Banyak pula orang yang kemudian menjadi pebisnis dari industri ini. Komisi agen, pendapatan untuk klub hingga penjualan merchandise tadi merupakan contoh riil. Kita pun berharap pengelolaan klub di dalam negeri sampai pembinaan sepakbola nasional benar-benar menjadi industri serta bisnis yang memiliki aturan. Selama ini klub di daerah mengandalkan Anggaran pendapatan Belanja Daerah (APBD) dan maupun sponsor. Agar klub di daerah tak menggerogoti APBD, muncul Surat Menteri Dalam Negeri No. 903/187/SJ tertanggal 30 Januari 2007, kini masih menyisahkan beban bagi dunia persepakbolaan nasional. Surat itu berisi pelarangan penggunaan dana Anggaran Pendapatan Belanja Daerah (APBD) secara rutin bagi klub sepak bola. Surat itu mendapat penolakan dari berbagai daerah. Pasalnya sudah lama klub sepak bola daerah bergantung kepada dana APBD dan dana APBD memang banyak disedot dan menjadi harapan dari berbagai klub di Indonesia. Kalau kemudian sepakbola sudah lebih banyak menjadi domain bisnis, tidak lagi politik, barulah cabang ini menjadi bagian dari industri.

Waspada/Sapriadi

MENJAGA PADI: Seorang ibu terlihat menjaga padinya di sawah di Kecamatan Rawang Panca Arga, Asahan, dari makanan burung, karena dalam waktu dekat ini akan menghadapi musim panen. Namun harga beras di Asahan tetap merangkak naik meskipun ada beberapa wilayah yang panen.

Plaza Di Medan ‘Diserbu’ Konsumen MEDAN (Antara): Plaza di Medan masih “diserbu” warga pada H-1 Natal, sementara manajemen pusat perbelanjaan mewah di daerah itu masih menawarkan diskon hingga Januari 2011. “Syukur plaza masih ramai dikunjungi menjelang Natal, Sabtu (25/12). Diperkirakan kunjungan masih ramai hingga malam hari dan bahkan pada Natal (Sabtu),” kata Marcomm Manager Sun Plaza Ang Fu Shen di Medan, Jumat (24/12). Warga meramaikan plaza bukan saja untuk membeli sandang dan keperluan Natal dan Tahun Baru lainnya, tetapi juga memenuhi pusat jajanan.

Menjelang Natal, kunjungan diakui meningkat dibandingkan hari biasa dan diperkirakan tingkat kunjungan masih akan ramai hingga akhir tahun, katanya. Ketua Asosiasi Pengelola Pusat Belanja Indonesia (APBBI) Sumut Paulus Tamie menyebutkan berdasarkan laporan sementara kunjungan ke plaza menjelang Natal naik sekitar 20 persen dibanding hari biasa. “Data akurat baru bisa (diperoleh) nanti usai Natal. APBBI akan meminta data itu ke anggota,” katanya. Dia mengakui kunjungan yang meningkat itu juga dipicu warga Tionghoa yang berbelanja untuk keperluan Imlek tahun depan, khususnya untuk produk sandang. “Pada umumnya semua warga selalu memanfaatkan ajang diskon untuk berbelanja,” katanya. Paulus juga mengakui,

Baru 10 Persen Orang Kaya Patuh Bayar Pajak Waspada/Rasudin Sihotang

CABAI NAIK: Selama sepekan, harga cabai merah naik dari Rp18 ribu per kg naik menjadi Rp20 ribu, kemudian naik lagi hingga Rp22 ribu per kg. Menurut seorang pedagang di Pasar Tradisional Tanjungbalai, D Br Manik, harga tersebut kemungkinan akan terus naik sampai berakhirnya perayaan hari besar keagamaan. Foto direkam, Jumat (24/12).

Harga Cabai Merah Terus Naik TANJUNGBALAI (Waspada): Menjelang hari besar keagamaan Natal dan Tahun Baru, harga cabai merah di pasar tradisional Tanjungbalai terus merangkak naik, Jumat (24/12). Pantauan Waspada di Pasar Bengawan menyebutkan, harga cabai merah naik sejak tiga hari lalu dari Rp32 ribu per kg menjadi Rp35 ribu per kg, sedang sepekan sebelumnya masih berada di kisaran Rp30 ribu per kg. Kemudian, untuk komoditi cabai hijau asal Berastagi, naik

dari Rp20 ribu per kg menjadi Rp22 ribu per kg, sedang sepekan terakhir harganya masih Rp18 ribu per kg. Berbeda dengan komoditi lain yang harganya masih bertahan selama 3 hari lalu yakni, bawang merah di level Rp20 ribu per kg, bawang putih juga sekitar Rp20 ribu per kg, menyusul bawang prei dan daun sop masing-masing Rp10 ribu per kg, serta kentang Rp6.500 ribu per kg. “ Harga yang turun hanya wortel dari Rp5.000 per kg turun

menjadi Rp4.000, serta buncis dari Rp6.000 per kg menjadi Rp4.000 per kg,” ucap D br Manik, seorang pedangan di Pasar Bengawan, Tanjungbalai. Menurut Br Manik, kenaikan dipicu meningkatnya permintaan konsumen terhadap kebutuhan beberapa komoditi menjelang hari besar perayaan Natal dan Tahun Baru. Dikatakan Br Manik, harga-harga tersebut kemungkinan akan terus naik selama dua pekan kedepan sampai perayaan Tahun Baru berakhir. (crs)

Redam Capital Inflow, BI Tempuh 5 Kebijakan JAKARTA (Waspada): Bank Indonesia (BI) akan menempuh bauran kebijakan (policy mix) guna menghadapi tekanan inflasi dan capital inflow diperkirakan masih akan datang. “Dalam menghadapi tekanan inflasi dan capital inflow, BI menempuh paling tidak lima bauran kebijakan,” papar Direktur Riset Ekonomi dan Kebijakan Moneter BI Pery Warjiyo, di Jakarta, kemarin. Adapun kebijakan tersebut yakni kebijakan suku bunga, dengan tetap mempertahankan BI rate di angka 6,5 persen. “Kita masih konsisten dengan pencapaian sasaran inflasi serta mendorong intermediasi perbankan dan pertumbuhan ekonomi dan kenaikan BI rate akan semakin mendorong capital inflow dan tekanan apresiasi rupiah,” paparnya. Kedua dengan mengguna-

kan kebijakan nilai tukar, dengan apresiasi rupiah lebih rendah (5,5 persen pada 2010 dan 14,9 persen pada 2009). “Apresiasi rupiah lebih besar mempercepat impor dan menurunkan per t u m b u h a n e k o n o m i , meskipun dapat menurunkan inflasi,” imbuhnya. Ketiga, akumulasi cadangan devisa. Di mana cadangan devisa meningkat dari 66 miliar dolar AS di 2009 menjadi 93,4 miliar dolar AS tahun ini. “Selain sebagai implikasi dari kebijakan stabilisasi nilai tukar rupiah, akumulasi cadangan devisa diperlukan untuk self insurance dalam menghadapai sudden reversal,” tambahnya. Keempat, kebijakan makroprudensial terhadap capital flow menggeser Sertifikat Bank Indonesia (SBI) ke term deposit untuk mengurangi supply SBI dapat dibeli investor asing.

“Perlunya memitigasi risiko sudden and large capital flow reversals yang berpotensi menimbulkan instabilitas moneter dan sistem keuangan,” paparnya. Kelima, kebijakan makroprudensial untuk pengelolaan likuiditas domestik dengan menaikan Giro wajib Minimum (GWM). “Perlunya ekses likuiditas domestik baik melalui penguatan operasi moneter dengan mengarahkan lebih jangka panjang maupun melalui penyerapan likuiditas secara langsung dengan GWM,” ungkapnya. Dia menambahkan capital inflow sampai berdampak pada apresiasi rupiah BI telah mempersiapkan langkah cadangan. “BI telah mempersiapkan langkah-langkah lanjutan terhadap capital flow jika pada waktunya diperlukan,” pungkasnya. (okz)

JAKARTA (Waspada): Tidak patuhnya masyarakat golongan menengah ke atas menjadi alasan penerimaan pajak rendah. Sekarang ini, kelompok tertinggi di kasta ekonomi ini yang patuh membayar pajak hanya sekira 10 persen. Hal ini diungkapkan Pengamat Politik dari Indef Deniey Adi Purwanto dalam buku bertajuk berselancar di tengah pemulihan Ekonomi Global, diluncurkan pada seminar Proyeksi Ekonomi Indonesia 2011 di Hotel Century Atlet, Jakarta, kemarin. “Relatif rendahnya jumlah penerimaan pajak disebabkan oleh tax base rendah. Proporsi wajib pajak yang patuh membayar pajak pun masih sangat kecil, dan kelompok orangorang kaya dan kelas menengah Indonesia yang patuh membayar pajak baru sekitar 10 persen,” ungkapnya dalam buku tersebut. Semestinya, lanjutnya, upaya mengenjot peningkatan pajak tidak dengan cara menambah tingkat pajak namun melalui penambahan wajib pajak perseorangan. Selain itu, pemerintah harus mampu menjaga momentum pertumbuhan, karena jika pertumbuhan ekonomi tinggi maka penerimaan

pajak juga akan meningkat. Dia juga menilai instrumen pajak bagai pisau bermata dua. Jika upaya peningkatan pajak melalui intensifikasi dan ekstensifikasi pajak tidak dilaksanakan dengan tepat justru akan kontra produktif terhadap perekonomian. “Beban pajak tinggi akan membunuh pelaku usaha, pada akhirnya justru tidak mampu memberikan kontribusi pada pembayaran pajak. Sebaliknya ketika pemerintah memberikan keringanan atau insentif pajak, awalnya akan mengurangi peluang penerimaan pajak, namun jika mampu mendorong pertumbuhan sektor industri bukankah akan berpeluang meningkatkan penerimaan dalam jangka panjang,” paparnya. Saat ini dia melihat kurangnya kreatifitas dari pemerintah dalam mengoptimalkan penerimaan pajak. “Pemerintah kurang mampu berhitung dengan cermat dalam pemberian insentif pajak kepada pelaku usaha, terutama kepada usaha yang potensial memiliki nilai tambah dan penyerapan tenaga kerja tinggi,” tambahnya. Jika dilihat dari rasio penerimaan pajak terhadap PDB, tax ratio Indonesia sudah mencapai 12 persen. (okz)

Sayur Mayur Di Kisaran Melonjak KISARAN (Waspada): Menjelang tahun baru harga sejumlah sayuran seperti cabai, kentang, wortel, sawi, bawang melonjak di pasar pagi Jalan Diponegoro Kisaran, Jumat (24/12). A Kuang, 52, pedagang, ditemui di kiosnya mengatakan sejak seminggu terakhir harga sejumlah sayuran naik tajam, para pedagang mengakui kenaikan harga tersebut mengikuti pasar dan permintaan konsumen dan tidak mengetahui sebab yang pasti kenaikan. Pantauan Waspada harga cabai merah Rp35.000 per kg,

cabai rawit Rp39.000 per kg, kentang besar Rp6.500 per kg, kentang kecil Rp4.500 per kg, buncis Rp7.000 per kg, wortel Rp.5.000 per kg, sawi Rp6.000 per kg, brokoli Rp8.500 per kg, bawang putih Rp23.000 per kg, bawang merah Rp18.000 per kg. kacang panjang Rp7.000 per kg. Ny Rodiah,48, pengusaha rumah makan yang sedang berbelanja di pasar pagi mengaku terasa dengan kenaikan harga sayuran menjelang tahun baru ini.’’ Tapi karena udah langganan dapat diskon juga,” ujar Nyak Diah. (a36)

dibanding 2009 jumlah kunjungan dan omset tahun ini membaik. “Tetapi belum terlalu membaik. Pada Idul Fitri lalu saja omset hanya naik sekitar 10 persen, meski kunjungan naik hingga 30 persen. Dan biasanya kunjungan dan omset saat Natal dan Tahun Baru agak lebih rendah dibanding Idul

Fitri,” jelasnya. Menurut dia, belum membaiknya omset pedagang akibat daya beli masyarakat yang masih lemah. Bukan hanya karena dampak krisis global yang belum teratasi sepenuhnya, tetapi juga dampak kenaikan tarif dasar listrik yang membuat harga berbagai barang

naik, sehingga menambah pengeluaraan rumah tangga. “Untuk menarik minat beli itulah para ‘tenant’ (penyewa) melakukan penawaran diskon,” katanya. Di sejumlah plaza seperti Sun Plaza, Medan Fair Plaza, Thamrin Plaza dan Medan Mal, diskon diberikan mulai dari 10 hingga 70 persen.

Pembatasan BBM Bersubsidi Matikan Usaha Perikanan JAKARTA (Waspada): Ketua Umum Gabungan Pengusaha Perikanan Indonesia (GAPPINDO), Herwindo mengatakan, kebijakan pembatasan BBM bersubsidi dilaksanakan bertahap pada 2011 berpotensi mematikan sejumlah usaha perikanan tuna. “Kalau peraturan itu keluar, sama saja dengan pemerintah membunuh usaha penangkapan ikan tuna,” kata Herwindo di Jakarta, Jumat (24/12). Menurut dia, kebijakan pembatasan BBM subsidi akan sangat berdampak terutama pada kapal memiliki bobot di atas 30 GT. Sedangkan paling terkena dampak adalah kapal-kapal tuna milik perusahaan perikanan tangkap asal Indonesia yang harus beroperasi hingga sejauh di kawasan perairan Samudera Hindia dan Pasifik. “Biasanya mereka (pengelola kapal) bisa beli tiga bulan sekaligus (dengan memakai) BBM subsidi,” kata Herwindo. Dengan demikian, peraturan pembatasan BBM bersubsidi berpotensi mematikan usaha

penangkapan tuna dan sejumlah usaha perikanan lainnya. Pemerintah dan DPR pada 14 Desember 2010 menyepakati pemberlakuan pengaturan BBM bersubsidi secara bertahap mulai Maret 2011 untuk jenis premium di wilayah Jabodetabek. Dengan kesepakatan tersebut, maka mulai Maret 2011, seluruh mobil pribadi tidak boleh memakai premium bersubsidi, tapi mesti nonsubsidi seperti pertamax. Namun, pengaturan itu akan diberlakukan setelah pemerintah menyerahkan kajian komprehensif akhir Januari 2011 untuk disetujui Komisi VII DPR. Stok Jelang libur Natal dan Tahun Baru, pemerintah memastikan stok bahan bakar minyak (BBM) nasional dalam kondisi aman dengan ketahanan stok rata-rata mencapai 22,4 hari. Berdasarkan data 20 Desember lalu, stok premium mencapai 1,084 juta kilo liter (kl) atau cukup untuk 16,25 hari dan solar 1,496 juta kl atau cukup hingga 20,4 hari. Sedangkan minyak tanah

(kerosene) volumenya mencapai 488,587 ribu kl untuk 58,7 hari, avtur 241,223 ribu kl atau 24,2 hari, IDO/MDF mencapai 132,022 ribu kl atau 297,4 hari dan MFO 265,044 ribu kl atau 27 hari. Sedangkan stok pertamax 129,049 ribu kl atau cukup untuk 44,8 hari dan pertamax plus 18.111 kl untuk 52,7 hari. “Agar masyarakat tidak mengalami kesulitan membeli BBM dan LPG, pemerintah menyiagakan SPBU beroperasi penuh 24 jam, khususnya di kota-kota besar di Indonesia, mulai 23 Dsember 2010 sampai dengan 2 Januari 2011,” ungkap laporan Ditjen Migas yang dikutip dari situs resminya, Jumat (24/12). Selain itu, disiapkan pula armada dan SPBU-SPBU di jalur keramaian perayaan Natal dan Tahun Baru serta memenuhi stok LPG. Pemerintah juga membentuk satgas BBM dan LPG di Kantor Kementerian ESDM, Kantor Pusat Pertamina dan seluruh wilayah/region Pertamina untuk mengamankan pasokan BBM selama Natal dan Tahun Baru. (okz/ant)

Pemkab Asahan Tunggu Surat Gubernur Sebelum OP Beras KISARAN (Waspada): Sebanyak 1.658 ton beras dari cadangan beras pemerintah (CBP) dikucurkan dalam Operasi Pasar Khusus (OPK) untuk masyarakat miskin. Hal itu dilakukan lakukan untuk menyeimbangkan harga beras di pasar yang merangkak naik, sedangkan untuk masyarakat umum Pemkab Asahan masih menunggu surat keputusan Gubernur Sumut. Kepala Bulog Divre III Kisaran, Muhammad Zaim Madjid dikonfirmasi Waspada, Jumat (24/12), menjelaskan OPK itu dilakukan sejak minggu lalu dan akan berakhir hingga 31 Desember 2010. OPK itu akan digelar di enam wilayah, seperti Kabupaten Asahan, Batubara, Kota Tanjungbalai, Labuhanbatu, Selatan dan Utara, itu dilakukan sebagai langkah menindak lanjuti surat Gubernur Sumatera Utara nomor 501/12786 tanggal 10 Desember 2010 dan faksimili Perum Bulog Divre Sumut No F-1132/01020/2010 tanggal 10 Desember 2010 yang dikhususkan hanya untuk warga miskin yang telah ditetapkan Gubsu sebagai rumah tangga

sasaran (RTS) lewat surat Gubsu nomor 501/546 tanggal 26 Januari 2010. “Ada sekitar 110.589 rumah tangga miskin (RTM) yang berada di enam kabupaten itu, dan mereka akan mendapatkan beras dalam OPK ini sebanyak 15 kg, dengan harga Rp1.600 per kilogram. OPK ini menjadi pertama yang digelar se Indonesia akibat dari kenaikan harga beras yang terus merambat naik.” ungkap Madjid. Sementara, Kabag Ekonomi Kabupaten Asahan, M Syarif, dikonfirmasi Waspada, mengatakan OPK itu dikhususkan untuk warga miskin yang terdaftar menerima bantuan raskin, sedangkan untuk umum, pihaknya masih menunggu surat keputusan dari gubernur. Kenaikan harga itu, menurutnya, disebabkan menjelang perayaan Natal dan tahun baru sehingga permintaan di pasar meningkat. “Mungkin naiknya harga beras kan terus meningkat, namun tidak tertutup kemungkinan setelah perayaan Natal dan Tahun Baru, harga itu akan mulai menurun dan akan

kembali stabil,” ungkap Syarif. Menurutnya, kenaikan harga beras itu tidak terlalu mengganggu perekonomian warga, karena menurut perhitungan perekonomian masyarakat Asahan meningkat 4 persen dari tahun sebelumnya. Namun demikian kenaikan harga beras itu harus tetap diwasapadai, dengan melakukan monitoring dengan para pedagang agar harga tetap wajar dan mampu dibeli oleh warga. “Kita tetap memantau perkembangan harga, bila harga ini terus melonjak, maka Gubsu akan mengirimkan surat untuk melakukan OP,” ungkap Syarif. Sedangkan salah satu pedagang di Jalan Cokro Aminoto Kisaran, Bardan, mengatakan harga beras terus mengalami peningkatan, dan paling murah atau setara dengan beras bulog mencapai Rp 7.000 per kilogram. Akibatnya banyak pembeli yang mengeluh dengan kenaikan itu. “Penjualan sedikit menurun, karena daya beli masyarakat menurun. Ini harus menjadikan perhatian pemerintah,” ungkap Bardan. (csap)


Luar Negeri

WASPADA Sabtu 25 Desember 2010

A9 Assange: Kemungkinan Besar Dia Dibunuh Di Penjara AS

3 Divonis Dalam Komplotan Teror Di Pangkalan Militer Australia MELBOURNE, Australia (AP): Tiga pria yang meyakini Islam berada di bawah ancaman negara-negara Barat telah divonis di satu pengadilan Australia Kamis (23/12) atas tuduhan berkomplot dalam satu serangan bunuhdiri terhadap satu pangkalan tentara Sydney. Ketiga pria tersebut — warganegara Australia asal Somalia atau Lebanon — telah divonis di Pengadilan Tinggi negara bagian Victoria dengan tuduhan berkomplot melakukan serangan teroris dan mereka dapat menghadapi hukuman seumur hidup. Dua orang lainnya terbukti tak bersalah dalam tuduhan yang serupa. Kelimanyaditangkapdalamserangkaianpenggerebekandinihari di kota selatan Melbourne tahun 2009. Polisi mengatakan kelompok tersebut berencana untuk mengirimkan satu tim dengan senjata otomatik dalam satu serangan bunuhdiri terhadap Holsworthy Barracks, satu pangkalan tentara di pinggiran kota Sydney. Para pejabat mengatakan para tersangka termotivasi oleh keyakinan bahwa Islam berada di bawah serangan Barat dan mereka berencana untuk terus menembaki sampai mereka mati. Dalam peradilan itu, para jaksa mengatakan para tersangka kesal dengan keterlibatan Australia dalam berbagai perang di Irak dan Afghanistan. Australia menjadi sekutu kuat AS dalam memerangi terorisme setelah serangan 11 September. Terorisme amat langka di Australia, namun puluhan warga Australia tewas dalam berbagai serangan teroris di luar negeri, sebagian besar di Indonesia, termasuk pengeboman klab malam di Bali 2002. Peradilan itu dimulai September dan juri membahas lebih dari lima hari sebelum menjatuhkan vonis bersalah terhadapWissam Fattal Mahmoud, 34, Aweys Edow Saney, 27, dan El Nayef Sayed, 26. Abdirahman Mohamud Ahmed, 26, dan Yacqub Khayre, 23, terbukti tidak bersalah dan mereka dibebaskan. (m10)

PBB Akui Ouattara Sebagai Presiden Pantai Gading PBB, New York (Antara/Reuters): Majelis Umum PBB mengakui Alassane Ouattara sebagai presiden sah Pantai Gading, setelah PBB mengatakan dia telah mengalahkan Laurent Gabgbo dalam pemilihan presiden bulan lalu. Majelis Umum yang beranggotakan 192 negara secara resmi Kamis (23/12) mengakui Ouattara, dengan suara bulat memutuskan bahwa daftar diplomat yang ia ajukan ke badan dunia itu diakui sebagai satu-satunya wakil resmi Pantai Gading di PBB. Duta besar baru negara itu untuk PBB adalah Youssouf Bamba. Gbagbo menolak untuk mundur menyusul pemilihan 28 November yang negara-negara Afrika, negara-negara besar Barat dan PBB katakan telah dimenangkan oleh penantangnya, Ouattara, yang memicu krisis yang sudah menewaskan sedikitnya 173 orang dan mengancam untuk menyalakan kembali perang saudara 2002-2003 di negara itu. Langkah oleh PBB itu akan berfungsi untuk memperkuat klaim Ouattara untuk menjadi pemimpin sah Pantai Gading dan memperdalam pengucilan Gbagbo, yang memiliki beberapa pendukung di masyarakat internasional, kata seorang diplomat PBB pada Reuters. Dutabesar Gabgbo untuk PBB, Alcide Djedje, telah meninggalkan New York, sebagaimana semua stafnya, kata beberapa diplomat Barat pada Reuters, yang menambahkan mereka telah membawa perangkat keras komputer dari misi Pantai Gading bersama mereka. Djedje sekarang adalah menlu Gbagbo. Secara terpisah, pasukan penjaga perdamaian PBB di Pantai Gading, dikenal sebagai UNOCI, mengatakan mereka mengkhawatirkan mengenai “pelanggaran keras hak asasi manusia dan tindakan intimidasi” di sejumlah bagian kota penting negara itu Abidjan dan di Pantai Gading barat. Menurut para diplomat Barat di NewYork, penandaan rumah adalah mengkhawatirkan, karena hal itu dapat mengindikasikan bahwa sejumlah kelompok siap untuk (melakukan) kekerasan etnik. UNOCI menghadapi kesulitan sejak truk-truk pasokan dan patrolinya dirintangi oleh pasukan yang setia pada Gbagbo. Menteri Luar Negeri AS Hillary Clinton Kamis mengulangi seruan AS agar orang kuat Pantai Gading Laurent Gbagbo mundur, dan mengimbaunya‘segera’ melakukan hal itu untuk menghentikan kekerasan yang melanda di negara Afrika Barat tersebut.

Mau Cincin Pertunangan Kate Middleton? Cuma AS$3 Di China BEIJING, China (Antara/AFP): Para pedagang China yang ingin mengeruk uang dengan memanfaatkan kehebohan sehubungan dengan pernikahan Pangeran William dari Inggris dan Kate Middleton April tahun depan menjual tiruan cincin pertunangan Kate dengan harga cuma AS$3 (kira-kira Rp27.500). Tiruan cincin batu safir-dan-permata yang bernilai AS$45.000 yang diberikan Pangeran Inggris itu kepada Kate Middleton ditawarkan di berbagai toko di Taobao.com, toko ‘daring’ (dalam jaringan) terbesar di China. Cincin aslinya dulu dimiliki oleh ibu Pangeran William, Putri Diana. Kebanyakan dijual dengan harga kurang dari 100 yuan (sekitar AS$15), yang termurah —yang diduga dibuat dari zircon dan suasa— tersedia dengan harga cuma 19,9 yuan, atau sekitar AS$3, demikian laman Taobao yang diteliti oleh AFP. Cincin asli tersebut diberikan kepada Putri Diana oleh ayah Pangeran William, Pangeran Charles, ketika mereka bertunangan pada Februari 1981. Charles dan Diana bercerai pada 1996 dan dia tewas dalam kecelekaan mobil di Paris pada tahun berikutnya. Media China pekan ini melaporkan pabrik diYiwu, China timur, pasar grosir terbesar di dunia untuk produk kecil, membuat tiruan oleh-oleh perkawinan kerajaan, dari cincin sampai gelas dan boneka tiruan. Produsernya, yang khawatir jika memikirkan tuntutan hukum mengenai hak cipta, mengatakan mereka membuat perubahan kecil pada cincin perkawinan tiruan mereka, dengan mengurangi jumlah ‘permata’ di sekitar batu ‘safir,’ demikian laporan tersebut. “Saya percaya pemilik perusahaan lain sama dengan saya —tak seorang pun dari kami mau menghadapi resiko” berkaitan dengan pembuatan tiruan persis seperti aslinya, kata Zhou Mingwang, pengusaha di Yiwu.

The Associated Press

KORBAN SERANGAN BOM DI QUETTA. Para petugas kepolisian Pakistan memeriksa kerusakan pada kendaraan polisi

setelah satu bom meledak di Qeutta, Pakistan, Jumat (24/12). Satu bom yang dipasang di satu sepedamotor dilengkapi pemicu jarak jauh telah meledak di Quetta yang menewaskan seorang polisi dan mencederai lima orang lainnya, kata pejabat kepolisian Hamid Syakil.

Taliban Serang 5 Pos Pengamanan Pakistan 11 Tentara Dan 24 Pejuang Tewas Dalam Bentrokan KHAR, Pakistan (AP): Sekitar 150 pejuang Taliban menyerang lima pos keamanan di kawasan suku dekat perbatasan Afghanistan tengah malam, menyulut perang yang menewaskan 11 tentara dan 24 pemberontak, kata militer Pakistan Jumat (24/12). Pertempuran di kawasan Mohmand itu menunjukkan bahwa pihak pemberontak memiliki kemampuan yang besar untuk mengkoordinasikan dan melancarkan serangan, meski militer melancarkan operasi besar-besaran terhadap Taliban dan al-Qaida di baratlaut Pakistan. Sedikitnya 12 tentara juga cedera dalam beberapa bentrokan, kata satu pernyataan dari Frontier Corps, divisi paramiliter pasukan bersenjata Pakistan. Pertempuran itu berakhir Jumat pagi. Informasi dari wilayah suku Pakistan hampir tidak mungkin untuk diverifikasi ka-

rena aksesnya ketat dan zona konflikberbahaya.Mohmanselama ini telah menjadi tempat berbahaya selama bertahun-tahun dan jadi sasaran operasi militer. Lokasi perbatasannya menjadi titik transit yang strategis bagi pemberontak yang berusaha memasuki Afghanistan, di mana pasukan AS dan NATO dikerahkan. Pejabat senior pemerintah di Mohmand, Amjad Ali Khan, mengatakan 11 tentara tewas dalam pertempuran itu, sementara puluhan lainnya cedera. Pasukan itu menghubungi helikopter tempur untuk membantu memukul mundur para

pejuang militan itu, kata May. Fazl Ur Rehman, jurubicara pasukan keamanan Korps Garis Depan. Pertempuran berakhir sebelum pagi. Informasi dari daerah persukuan Pakistan hampir tidak mungkin untuk diverifikasi secara independen karena akses terhambat dan daerah konflik tersebut amat berbahaya. Mohmand merupakan satu daerah rusuh selama beberapa tahun dan menjadi fokus operasi tentara. Lokasi perbatasannya membuat daerah tersebut menjadi titik transit amat bernilai bagi para pemberontak yang berusaha untuk melakukan perjalanan ke Afghanistan, di mana pasukan AS dan NATO memeranginya. Juga terjadu Jumat, satu bom yang dilengkapi alat pemi-

Korut Diduga Lakukan Uji Nuklir Ketiga 2011 SEOUL, Korea Selatan (AP/ Antara/Reuters): Korea Utara diduga akan melakukan uji senjata nuklir ketiganya tahun depan dan prospek untuk pembicaraan bilateral dengan Selatan semakin tipis, kata laporan sebuah riset lembaga kementerian luar negeri Korea Selatan, Jumat (24/12). Laporan rutin itu diterbit-kan sehari setelah Pyongyang berikrar untuk melakukan ‘perang suci’nuklir dan Seoul mengadakan latihan militer besar di dekat perbatasan. Korea Utara (Korut), yang melakukan uji nuklir pada 2006 dan 2009 belum menunjukkan pihaknya mengirimkan senjata sebagai bagian dari program persenjataan plu-toniumnya,tetapiujiketigaakanmeningkatkan ketegangan lebih lanjut di semenanjung yang ter-belah itu dan mengguncang pasar global. “Ada kemungkinan Korut

untuk melakukan uji coba nuklirnya yang ketiga untuk mengupayakan perbaikan pada kemampuan produksi senjata nuklirnya, menjaga ketegangan militer tinggi dan mempromosikan status Kim Jong-un (putra termuda pewaris Kim Jong-il) sebagai pemimpin berikutnya,” menurut laporan itu. Analisis 2011 yang ditulis oleh Institut Luar Negeri dan Keamanan Nasional, dijalankan oleh Departemen Luar Negeri. Para pengamat mengatakan, taktik Korut untuk menunjukkan kemajuan yang telah dibuat ke arah pengembangan senjata nuklir adalah taktik yang bertujuan memulai kembali pembicaraan antara dirinya, Korea Selatan, China, Jepang, Rusia dan AS, dari yang diharapkan bisa memeras konsesi. Tabuh genderang perang Sehari sebelumnya, Korut dan Korsel menabuh genderang

perang Kamis, dengan masingmasing mengancam yang lainnya dengan pembalasan segera jika diserang. Seoul telah melakukan beberapa hari latihan militer dalam satu dadar kekuatan yang dimaksudkan untuk mencegah Korut, termasuk latihan peluru tajam awal pekan ini di garis depan pulau yang digempur Korut bulan lalu. Marah akibat latihan itu, Korut mengamcam Kamis pihaknya akan melakukan‘perang suci’ nuklir jika Seoul mengenainya dalam latihan tersebut dan memperingatkan, bahkan penyusupan kecil pun ke wila-yahnya akan mendapat respon efektif. Kepala Pertahanan Kim Yong Chun mengatakan Korut ‘benar-benar menyiapkan peluncuran ‘perang suci’ dan akan menggunakan kemampuan nuklirnya. Dia menyebutkan latihan Korsel Senin itu merupa-

Gema Internasional

Obama Gagal Di Timur Tengah SIAPA PUN yang menjadi presiden Amerika Serikat, apakah dari partai Republik atau Demokrat,sudahmerupakan‘kewajiban’ yang tak terelakkan yaitu melakukan feeding atau pemberian makanan kepada Israel selepas sukuYahudi diberikan kesempatan memiliki suatu negara di tanahPalestinayangdiambilpaksa dari bangsa Palestina tahun 1948.Mengapasedemikianlemah AS atau tidak punya kekuatan melepaskan Israel agar berdiri sendiri menghidupi dirinya, hal itu terjadi karena, antara lain, pertama AS lah yang mendukung berdirinyanegaraIsraeldiwilayah Palestina yang waktu itu dikuasai oleh Prancis dan Inggris. Kedua, begitu kuatnya kelompok penekan (pressure group) Yahudi baik di negara AS sendiri maupun bangsa Yahudi yang ada di negara-negara lain terutama di benua Eropa. Keturunan Yahudi semenjak memiliki negara sendiri, mereka kompak bersatu mendukung keberadaan Israel di Timur Tengah, sebagai hasil perampokan tanah dan harta milik bangsa Palestina. Itulah Yahudi yang mendapat

dukungan penuh terutama dari AS, Inggris, dan Prancis. Israel yang keberadaannya dilingkungannegara-negaraArab jelas tidak merasa nyaman selalu dihantui oleh ketakutan akan dihancurkan oleh negara-negara sekitarnya yang berdalih bahwa Israel telah mengambil paksa milikbangsaPalestina,bahkansampai sekarang setelah Perang Tujuh Hari 1967 Israel telah berhasil menguasai beberapa wilayah negara sekitarnya dan mengklaim bahwa Israel telah ‘mengambil kembali’ tanah air mereka berdasarkan sejarah sah milik Israel. Pergantian presiden AS, siapa pun yang terpilih menjadi presiden, setelah Perang Dunia II diyakini bahwa para pelobby Israel yang tangguh dan menguasai kehidupan sosial, politik, dan ekonomi Amerika selalu “menitipkan” pesan agar melindungi Israel. Kira-kira kemungkinan yang akan terjadi jika ada presiden AS yang tak mendukung Israel maka AS bisa saja collapse karena kekuatan politik dan ekonomi negara paman Sam dikuasai oleh tokoh-tokoh Yahudi. Bahkan sampai saat ini, diyakini

cu jarak jauh yang dipasang di sepedamotor meledak di pinggiran kota Quetta di baratdaya Pakistan, yang menewaskan satu perwira polisi dan mencederai lima orang lainnya, kata pejabat kepolisian Hamid Shakil. Quetta adalah ibukota provinsi Baluchistan, di mana satu gerakan pemberontak menuntut otonomi lebih luas bagi wilayah tersebut. Sajjad Mohmand, jurubicara Taliban di Mohmand, mengatakan kepada BBC bahwa hanya dua pejuang yang tewas dalam bentrokan tersebut. Dia mengatakan mereka telah menangkap dua tentara dalam keadaan hidupdankinimenahanjugaenam mayat tentara. Para pejabat keamanan membantah klaim tersebut, dengan mengatakan tidak ada prajurit yang hilang. (m10)

kegiatan ekonomi dunia pun lebih banyak dikuasai oleh kelompok Yahudi. Apakah Israel selalu patuh dan tunduk kepada his master’s voice? Tidak juga, kadang-kadang Israel membangkang pada tuannya,AS.Namun‘kenakalan’ Israel yang menentang saran atau anjuranbahkanperintahAStelah membuat negara adidaya ini menjadisasarancemoohandunia internasional yang tak mampu menjinakkanIsraeldengansegala kelakuannya yang cenderung bertingkahbrutalterhadaplawanlawannya di dunia Arab. Presiden Barack Hussein Obama yang dalam kampanye pemilihan presiden AS dua tahun lalu selalu mengumandangkan bahwa kebijakan AS akan berubah. Demikian halnya dalam pidato di Kairo tahun lalu Obama juga ingin mencitrakan AS sebagai sahabat negara-negara Islam dan AS takkan berperang dengan Islam. Tapi kenyataannya, Obama pun tak mampu menekan Israel agar duduk dalam satu meja perundingan terutama dengan Otoritas Palestina. Obama mengajukan solusi dua

negara agar tercipta perdamaian antara kedua bangsa. Nasib usulan dua negara pun tidak jelas dan nyata sekali bangsa Israel yang saat ini dikomandoi oleh tokoh rasisme dan penentang munculnya negara Palestina, Benjamin Netanyahu, berkalikali menyatakan takkan ada negara Palestina yang bebas dan berdaulat penuh. Sebagaimana presidenpresiden pendahulu Obama, dia pun melanjutkan feeding kepada pemerintahan Netanyahu, tapi sangat sedikit menerima konsesi dari Israel. Tindakan Obama yang tak mendapat respons dari Netanyahu dipandang sinis oleh orang Amerika sendiri yang menulis “Obama’s Middle East turkeys and continue to feed carrot” kepada Israel. Begitulah sikap orang Yahudi. Amerika Serikat telah terlalu banyak memberikan carrot sampai-sampai Netanyahu tercekik lehernya, Amerika tak mendapat balasan apa-apa dari Bibi (panggilan populer Benjamin Netanyahu). Lagipula dalam lingkungan pemerintahan koalisi Israel, antara lain Menteri Luar Negeri Avigdor Lie-

berman dikenal sebagai seorang hard-liner dan rasist sering mengendalikan Netanyahu yang sifatnya kadang-kadang tidak teliti dan mudah diintimidasi. Apa yang didapat AS dengan segala pemberiannya kepada Israel?Taksatupunkecualihanyalah janji-janji belaka untuk memulailaginegosiasibatasan-batasanbagimasa depannegaraPalestina. Jika negosiasi gagal, dan diyakini akan selalu gagal, Netanyahu akan kembali ke rumah kekuasaan,negaraYahudi. Israel sementarainihanyaperlumembekukanbeberapaperluasanpemukimandanberjanjiakan bernegosiasi lagi yang hanya sekedar memperoleh segala sesuatunya sebagaimana dijanjikan Obama. Berbagai negosiasi takkan ke mana-manadanNetanyahumasih saja tetap mendapat ganjaran atau hadiah dari sang paduka tuan,PresidenObama.Duniabisa mengatakanbahwaObamatelah gagal dengan kebijakan Timur Tengah-nya.Obamaterusmenerus memberi “feedings” tapi tak mampu memberikan sticks atau menghukum Israel. (Kosky).

kan satu ‘provokasi militer berat’ yang menunjukkan Korsel dan AS berkomplot melakukan invasi ke Korut. (m10)

LONDON, Inggris (Antara/AFP): Pemimpin WikiLeaks Julian Assange mengatakan dalam wawancara yang dipublikasikan Kamis (23/12), ‘kemungkinan besar’ dia dibunuh dalam sebuah penjara Amerika Serikat jika dia diekstradisi dari Inggris dengan tuduhan spionase. Warga Australia yang tinggal dengan uang jaminan di Inggris itu sedang melawan upaya Swedia untuk mengekstradisinya karena pengaduan kekerasan seksual, tapiWashington diperkirkan akan mempertimbangkan bagaimana mendakwanya karena bocornya ribuan kawat diplomatik AS. Assange mengatakan pada Guardian, akan menjadi ‘tidak mungkin secara politik’ bagi Inggris untuk mengirimnya melintasi Atlantik, dan menambahkan bahwa pemerintah PM David Cameron ingin menunjukkan hal itu tidak akan ‘diputuskan-bersama’ dengan Washington. “Menurut hukum, Inggris memiliki hak untuk tidak mengekstradisi karena kejahatan politik.” Spionase merupakan kasus klasik kejahatan politik. Merupakan kebijakan pemerintah Inggris mengenai apakah akan menggunakan pengecualian itu,” katanya. Dia menyatakan pemerintah AS telah“berusaha untuk menandatangani perjanjian pembelaan” dengan Bradley Manning, tentara angkatan darat AS yang diduga memberi WikiLeaks kawat-kawat diplomatik itu. Assange menambahkan bahwa jika AS berhasil mendapatkannya, dia diekstradisi dari Inggris ke Swedia, maka ‘kemungkian besar’ baginya untuk dibunuh ‘gaya-Jack Ruby’ di penjara AS. Ruby, seorang pemilik klab malam, telah menembak mati Lee Harvey Oswald di sebuah pos polisi di Dallas, Texas, beberapa hari setelah Oswald ditangkap karena pembunuhan Presiden AS John F. Kennedy pada 1963. AssangesebelumnyamengatakanbahwadiadanstaflainWikiLeaks telah menerima ancaman kematian sejak laman Internet itu mulai mengeluarkan sembunyian sekitar 250.000 kawat rahasia Deplu AS November lalu. Laki-laki berusia 39 tahun itu tinggal di rumah besar temannya di Inggris Timur sejak pembebasannya dari penjara pekan laluberdasarsyarat-syaratjaminanyangkeras,yangtermasukmelapor pada polisi tiap hari dan mengenakan kartu elektronik. Dari Oslo The Associated Press melaporkan Jumat (24/12), satu suratkabar Norwegia mengatakan pihaknya memiliki 250.000 kawat rahasia yang tak disensor berupa dokumen diplomatik AS yang sebagiannya telah didistribusikan WikiLeaks. Pengumunan Kamis itu nampaknya akan membuat suratkabar Aftenposten sebagai media pertama selain lima suratkabar mitraWikiLeaks yang memiliki material kawat rahasia diplomatik AS itu. Perkembangan itu tentu meningkatkan kekhawatiran pemerintah AS akan tersiarnya sebagian kawat diplomatiknya yang tak disensor itu sehingga akan dapat menimbulkan bahaya. Pendiri WikiLeaks Julian Assange tidak dikenakan tuduhan dalam kasus itu — karena membocorkan dokumen namun tak dipenjarakandiInggrisbulaninisetelahduawanitadiSwediamenuduhnya melakukan kejahatan seks, termasuk perkosaan. (m10)

Italia: Para Anarkhis Ingin Balas Pada Chile Dan Swiss ROMA, Italia (AP): Seorang pejabat senior Italia mengatakan kelompok yang diakui anarkis yang mengebom mail yang dikirim ke kedutaan Chile dan Swiss ingin membalas pukulan yang dialami gerakannya di sejumlah negara. Beberapa paket kecil meledak pada saat dibuka para petugas kedutaan Italia dan Selandia Baru Kamis, yang mencederai serius dua orang di misi diplomatik asing di kedutaan asing di Roma. Alfredo Mantovano, wakil menteri di kementerian dalam negeri yang meliputi polisi anti-terorisme, mengatakan Swiss menjadi sasaran karena telah meningkatkan kerjasama Italia-Swiss baru-baru ini untuk menangkap sejumlah pengikut anarkis. Mantovano juga mengatakan kepada Radio Italia Jumat bahwa Chile menjadi sasaran karena tahun lalu ada anggota gerakan anarkis yang tewas di Chile. Tidak lama setelah ledakan ganda itu, menteri dalam negeri Italia mengatakan anarkis nampaknya berada di belakang ledakan tersebut. Satu pernyataan tertulis yang ditemukan di salah satu kedutaanbesar menyebutkan namanya satu kelompok anarkis Yunani yang tewas dalam satu tembak menembak dengan polisi di Athena Maret lalu. Menteri Dalam Negeri Roberto Maroni menyatakan para penyelidik telah mengikuti kemungkinan hubungan anarkis di belakang serangan itu “menyusul insiden-insiden yang dapat disamakan yang terjadi pada November di Yunani”. Ledakan di kedubes Chile dan Swiss di Roma yang melukai dua staf terjadi Kamis. Menteri Luar Negeri Franco Frattini menilai serangan-serangan itu mencerminkan “ancaman serius” terhadap kedutaan besar asing, sementara Dubes Chile Oscar Godoy Arcaya mengecam “aksi terorisme yang benar-benar tidak rasional dan brutal” itu.

Separuh Penerbangan Di Paris Dibatalkan PARIS, Prancis (Antara/AFP): Pihak berwenang penerbangan Prancis telah membatalkan separuh dari penerbangan-penerbangan ke dalam dan ke luar bandara Roissy Charles-deGaulle Paris sampai pada pukul 13:00 waktu setempat Jumat (24/12), karena musim dingin yang membeku. Petugas prakiraan cuaca memperkirakan kondisi di bawah nol derajat Celcius Jumat pagi dan bandara mengalami kesulitan untuk mendapatkan cukup glycol, cairan yang digunakan untuk mencairkan es yang membalut pesawat, kata para pejabat dalam sebuah pernyataan Kamis malam. Sebelumnya, empat landasan pacu Bandara utama Roissy-Charles-de-Gaulle di Paris ditutup untuk sementara hingga pukul 10:00 waktu setempat (16:00 WIB) Minggu akibat salju, kata otoritas bandara tersebut. Sebelum penutupan dilakukan pada pukul 09:00 waktu setempat (15:0WIB) semua jadwal keberangkatan dan kedatangan pesawat ratarata mengalami keterlambatan 30 menit hingga

satu jam. Otoritas Penerbangan Prancis pada Sabtu lalu meminta sejumlah maskapai untuk membatalkan setidaknya seperempat dari penerbangan terjadwal mereka menuju Roissy antara pukul 14:00WIB hingga 22:00WIB, sedangkan 60 persen penerbangan juga mengalami penundaan pada Sabtu. Ratusan penumpang yang pesawatnya mengalami pengalihan rute ke Roissy karena penutupan Bandara Heathrow di London Sabtu, terpaksa menginap semalamam di ruang tunggu keberangkatan bandara tersebut. Bandara Heathrow London yang merupakan bandara dengan aktifitas penumpang paling sibuk di dunia menutup landasan terbang sampai paling tidak Ahad untuk membersihkan salju, sementara bandara Gatwick London juga menutup landasan pacunya untuk beberapa jam. Maskapai penerbangan British Airways membatalkan semua keberangkatan jarak dekat dari dua bandara itu, dengan semua penerbangan jarak jauh dari Heathrow dibatalkan pada hari itu.

The Associated Press

MENYINGKIRKAN SALJU. Ben Somrak (kiri) dan Luke Martin, dari Crested Butte, Colorado, AS, menyekop salju dari atap Gas Caffe Kamis (23/12). Badai salju telah melanda berbagai bagian Amerika Serikat, yang menjadi hambatan bagi mereka yang ingin mudik liburan Natal.


Sport

A10 LONDON (Waspada): Manajer Chelsea Carlo Ancelotti (foto) mengecam perencanaan jadwal Liga Premier, karena timnya mesti memainkan dua duel dalam tiga hari selama Natal. Pasukan Ancelotti, yang membuntuti pemimpin klasemen Manchester United dengan selisih tiga poin, merasa terjebak pada agenda padat yang diselingi tradisi Boxing Day. The Blues menjadi anti pati, karena mesti menyambangi markas sesama pemburu gelar Arsenal pada 27 Desember, lantas menjamu Bolton Wanderers hanya berselang dua hari. “Saya ingin mengatakan sesuatu mengenai pertandingan melawan Bolton, karena kami tidakakanmemilikikemungkinan untuk pemulihan,” kecam Ancelotti, sebagaimana diberitakan AFP, Jumat (24/12).

Reuters

Arsitek asal Italia itu makin anti, mengingat adanya recovery yang tak seimbang antara timnya dengan para rival. Bolton menjamuWest Bromwich Albion pada 26 Desember, sedangkan London Blues mesti menanti 24 jam berikutnya sebelum melawan Arsenal di Emirates Stadium. Itu artinya The Trotters asuhan Owen Coyle punya tambahanwaktusehariuntukmengatasi sakit kaki sebelum berangkat me-

nuju Stamford Bridge. Ancelotti yakin, masa rehat itu memberi Bolton keuntungan yang signifikan. “Kami hanya punya dua hari, Bolton sayangnya bermain tanggal 26. Kami bermain tanggal 27. Itu bukan hal yang baik, mendapat kurang sehari untuk pemulihan. Saya tidak senang,” sesal Ancelotti. Selain mengecam agenda padat Premiership, mantan pelatih AC Milan, Juventus dan AC Parma itu juga menepis

rumor yang terkesan ingin memecahkan keutuhan Frank Lampard cs. Terutama menyangkut spekulasi bahwa Si Biru siap melakukan penawaran 30 juta pound (46 juta dolar) buat Tottenham Hotspur untuk mendapatkan Luka Modric pada bursa transfer Januari mendatang. “Modric pemain bagus, tetapi kami tidak tertarik. Kami juga mesti menghormatiTotten-ham,” tegas Ancelotti.

LONDON (Waspada): Arsenal masih minus Thomas Vermaelensedikitnyasebulanlagi. Demikian manajer Arsene Wenger dalam laman Arsenal, yang dikutip Jumat (24/12). “Kebugarannya masih kurang dan kami harus meningkatkannya. Itu akan membutuhkan waktu tiga hingga empat pekan,” beber Wenger. Bek sentral asal Belgia itu sudah absen sejak Agustus lalu, karenacederaAchilles.Vermaelen pun tidak ikut andil dalam sukses TheYoung Guns menembus urutan kedua Liga Premier, dua poin di bawah pemimpin klasemen Manchester United. Gunners sebenarnya sempat berharap mantan kapten Ajax Amsterdam itu dapat dimainkan awal bulan depan dan memulai

Man United Arsenal Man City Chelsea Tottenham Sunderland Bolton Newcastle Liverpool Blackpool West Brom Blackburn Stoke City Everton Aston Villa Birmingham Fulham Wigan Wolves West Ham

16 9 7 0 36-16 34 17 10 2 5 34-19 32 18 9 5 4 25-15 32 17 9 4 4 31-12 31 17 7 6 4 25-22 27 18 6 9 3 21-18 27 18 6 8 4 30-25 26 17 6 4 7 27-26 22 17 6 4 7 21-22 22 16 6 4 6 24-29 22 17 6 4 7 24-29 22 18 6 4 8 23-28 22 17 6 3 8 21-22 21 18 4 9 5 20-21 21 17 5 5 7 19-28 20 17 3 9 5 17-20 18 17 2 10 5 16-20 16 17 3 7 7 13-28 16 17 4 3 10 18-30 15 18 2 7 9 16-31 13

Reuters

memberi debut bagi Wojciech Szczesny ketika kalah 0-1 dari MU, dua pekan silam. Wenger sumringah Arsitek asal Prancis itu pun semakinsumringah,sebabKieran Gibbs yang tidak dimainkan selama dua minggu karena cedera pergelangan kaki, kelihatan mulai membaik. “Gibbs seharusnya sudah bisa main pada awal Januari,” papar The Professor. Gelandang Abu Diaby juga akan kembali, setelah dua bulan absen karena menderita cedera pergelangan kaki. Kapten Cesc Fabregas dan penyerangRobinvanPersiehampirsepenuhnyafit,setelahmendapat tambahan waktu pemulihan

Modric menjadi figur kunci dalampenampilanmengesankan Spurs selama 18 bulan terakhir. “Dia pemain bagus, tetapi tidak seorang pun berbicara mengenai Modric di sini,” ujarnya lagi. “Jika kami ingin memiliki sesuatu,kamibisamelakukannya. Tapi kini ada empat laga dalam beberapa hari, periode ini sangat penting bagi Liga Premier. Kami harus fokus, saya tidak perlu membicarakan yang lain,” tukas Ancelotti. (m15/ant/afp/ap)

Daftar Top Skor Liga Premier: 11 Dimitar Berbatov (MU) 10 Carlos Tevez (Man City) Andy Carroll (Newcastle) 9 Tim Cahill (Everton) 8 Samir Nasri (Arsenal) Johan Elmander (Bolton) Kevin Nolan (Newcastle) 7 Marouane Chamakh (Arsenal) Didier Drogba (Chelsea) Florent Malouda (Chelsea) Darren Bent (Sunderland)

Reuters

Striker Chelsea Didier Drogba dan winger MU Ryan Giggs gagal melakoni bigmatch pekan lalu.

Chelsea-MU 1 Maret

LONDON (Antara/AFP): Laga tunda dua kekuatan besar Liga Premier antara Chelsea dan Manchester United (MU) dijadwal ulang Selasa, 1 Maret 2011. Bigmatch tersebut ditunda akibat lapangan yang membeku di Stamford Bridge, hari Minggu lalu. Tanggal baru 1 Maret itu telah diajukan pada kedua tim, yang masih terlibat dalam pertandingan pertemuan kedua Liga Premier dan putaran kelima Piala FA. Jika kedua klub yang tengah bersaing memperebutkan gelar juara liga itu tersingkir dari Piala FA, maka penjadwalan ulang partai tersebut sepertinya tidak ada masalah.

Ferguson Siapkan Pensiun Van Der Sar

Arsitek Arsenal Arsene Wenger merasa perlu meningkatkan kebugaran Thomas Vermaelen (kiri). pemanasannya dalam derbi LondonlawanChelsea,Senin(27/ 12) malam.TetapiWenger menegaskan, “Saya lebih suka mengatakan akhir Januari”. “Dia sudah memulainya sekarang dan tanda-tandanya bagus. Tapi saya beberapa kali mendapat tanggapan yang kurang baik bahwa saya sangat berhati-hati denganVermaelen,” katanya lagi. Namun masalah cedera kiper Gunners berkurang, karena Lukasz Fabianski akan kembali dari masalah pinggul untuktam-pilmenjamuTheBlues di Emira-tes Stadium. CederayangdialamiFabianksi danManuelAlmunia(pergelangan kaki) membuatWenger terpaksa

Sabtu 25 Desember 2010

Ancelotti Anti Agenda Padat

Vermaelen Perlu Sebulan Lagi

Klasemen Liga Premier

WASPADA

menyusul penundaan laga akhir pekan lalu melawan Stoke City. “Semuanya sudah kembali. Mereka semua siap dalam tim untuk menghadapi Stoke: Diaby, Fabregas, Van Persie - juga Fabianski,” ungkap Wenger. Van Persie berarti bisa menjadi alternatif di garis serang London Reds, yang selama ini terlalu bertumpupadapenyerangMaroko Marouane Chamakh yang telah mengoleksi tujuh gol. “Maka, secara keseluruhan kami sekarang hanya kehilangan Vermaelen, Almunia dan Kieran Gibbs.Merekatidakakankembali selama Natal, tetapi semua yang lain siap tempur,” optimismeThe Professor. (m15/ant/afp/uefa)

LONDON (Waspada): Bos Manchester United (MU) Sir Alex Ferguson, mengaku dirinya sudah memperkirakan kiper asal Belanda Edwin vander Sar akan pensiun pada akhir musim ini. “Kami memang merencanakan dan menyiapkan ini sebagai musim terakhirnya,” papar Ferguson,sepertidikutipdariAFP, Jumat (24/12). Dia bahkan mengklaim, United sudah merencanakan hidup tanpaVan der Sar di lapangan,meskikiperveteranBelanda itu bisa saja tetap tinggal di Old Trafford. Ditanya apakah Van der Sar akan melatih kiper penerusnya, Ferguson mengatakan, masalah tersebut belum dibicarakan. “Tetapi Edwin pemain yang akan menarik dalam hal pengetahuannya dan menonjol dalam pertandingan,” puji manajer berdarah Skorlandia tersebut. United sendiri mengklaim, telah mendapatkan penjaga gawang Anders Lindegaard dari Aalesunds FK untuk kontrak tiga setengah tahun dengan nilai yang tidak diungkapkan. Kiper berusia 26 tahun itu sudah latihan bersama Setan Merah MU dan akan terdaftar secara formal ketika bursa transfer musim dingin dibuka pada Januari 2011. “Kami tidak bisa men-

Reuters

Sir Alex Ferguson sudah memperkirakan Edwin van der Sar (kanan) akan pensiun akhir musim ini. daftarkan (Lindegaard) hingga setelah laga melawan Stoke, karena ‘Bank Holiday’. Tetapi dia latihan bersama kami sekarang, itu yang penting,��� tegas Sir Fergie. “Ini akan membawa dia ke level kebugaran yang lebih baik, karena dia sudah tidak bermain

selamabeberapapekan.Kitaakan lihat bagaimana kemajuannya,” katanya menambahkan. Soal agenda padat tutup tahun Liga Premier yang diselingi dengan Boxing Day, dia justru mengaku terkejut bahwa ada tim lain mempertanyakan betapa kerasnya liga tahun ini.

Namundiajugamengatakan, senang jika Red Devils masih bisa merebut posisi puncak begitu periode penting ini berakhir. “Tujuan saya adalah berusaha tetap di puncak pada 4 Januari. Itu akan bagus,” tegasnya.

(m15/ant/afp/rtr)

Boxing Day Keuntungan Ganda Red Devils KEUNTUNGAN ganda sepertinya bakal didulang pemimpin klasemen Manchester United pada agenda laga Liga Premier bertajuk Boxing Day sepanjang dua hari ke depan. Ujungujungnya, laju Setan Merah pun akan semakin kencang dalam berburu gelar liga yang musim lalu digenggam Chelsea. United yang kini memimpin sendirian di puncak klasemen, memang pantas diprediksi bakal menjauhkan jaraknya dari para rival. Mereka akan membuka kotak hadiah Natal besok malam di Old Trafford Stadium dengan tambahan tiga poin dari tamunya Sunderland. Sehari kemudian di tempat lain, dua rival utamanya justru mesti saling ‘bunuh’. Tim peringkat dua Arsenal menjamu sang juara bertahan Chelsea dalam bigmatch berlabel derbi London di Emirates Stadium. The Gunners kini dua angka di bawah United, sedangkan The Blues minus tiga poin. Maka, siapa yang terjungkal di Emirates, otomatis akan semakin jauh tertinggal dari John O’Shea dan kawan-kawan. Berarti, berkuranglah satu saingan Red Devils, atau bisa saja malah dua manakala laga berakhir seri. Dengan kesimpulan Manchester City bukanlah pesaing dalam perebutan gelar, lempanglah Setan Merah yang masih menyimpan satu laga tunda. Sekarang, alkisah beralih pada perjuangan Sunderland di Teathre of Dreams. Secara teori, tidak ada satu unsur pun yang menguatkan peluang The Black Cats untuk membawa angka dari markas Setan Merah. Sunderland secara teknis bahkan compang-camping,

ka-rena tidak akan diperkuat tujuh pemain pilihan pertama pelatih Steve Bruce di Old Trafford. Danny Welbeck tidak bisa main karena perjanjian pinjaman dengan United. Kapten Lee Cattermole diskors. Titus Bramble, Michael Turner, John Mensah, Fraizer Campbell dan David Meyler, semuanya cedera. Sejarah juga mengebiri kans Si Kucing Hitam. Sunderland terakhir kali menang di markas MU pada 1968 silam. Mereka pun se-lalu gagal dalam 14 kali usaha terakhirnya, sejak kemenangan 2-1 pada Piala Liga Inggris di Stadium of Light, 10 tahun lalu. “Saya telah berusaha keras, namun belum meraih satu pun. Kami akan terus berusaha,” tekad Bruce, seperti dikutip dari Reuters, Jumat (24/12). Bruce merupakan mantan kapten Setan Merah, yang tak pernah mampu menaklukkan bekas bosnya, Sir Alex Ferguson. Dia masih sebatas ‘nyaris’ ketika musim lalu sempat membawa Sunderland memimpin 2-1 di Old Trafford, namun kemudian berakhir 2-2 akibat bunuhdiri pada injury time dari bek sentral Anton Ferdinand, adik kandung kapten MU Rio Ferdinand. “Tahun lalu kami bermain bagus. Kami juga telah bermain sangat baik di kandang melawan mereka (MU) dua kali, maka mari berharap kami bisa mempertahankannya,” beber Bruce. Hanya tekad tersebut yang patut diwaspadai United, apalagi Black Cats sudah membuktikannya musim ini dengan menembus peringkat enam. Ahmed Elmohamady cs secara mengejutkan juga

Sinyal Neuer Menuju Munich BERLIN (Waspada): Kiper nomor satu Jerman Manuel Neuer memberi sinyal kepada klubnya FC Schalke 04 bahwa dirinya tidak akan bertahan lama di bawah mistar The Royal Blues. Tampil memukau bagi Jerman pada Piala Dunia 2010 dan bagi Schalke di Liga Champions, Neuerkinidikaitkandengansuatu kepindahan ke Bayern Munich. Indikasinya menguat, karena kontrak kiper kawakan Jorg Butt akan berakhir musim ini tidak diperpanjang FC Hollywood. Neuer pun janji akan mengakhiri spekulasi masa depannya dengan mengatakan tidak akan menandatangani suatu kontrak baru pada masa istirahat Natal bersama Schalke. “Tidak akan ada hadiah bagi para suporter (Schalke) menjelang Natal,” ujar kiper berumur 24 tahun itu, seperti dilansir DPA, Jumat (24/12). Pelatih Schalke Felix Magath, tetap berusaha meyakinkan para penggemar Royal Blues bahwa Neuer kemungkinan bertahan

hingga kontraknya berakhir tahun 2012 mendatang. Tapi Neuer segera menepis klaim mantan pelatih Munich tersebut. “Saya tidak dapat mengatakan hal yang sama. Saya tidak akan menyerah pada tekanan,” tegas Neuer. Dia bersikukuh, karena Royal Blues terpuruk di Bundesliga pada musim ini setelah musim lalu bisa menempati posisi kedua pada klasemen akhir di bawah Bayern. Raul Gonzales cs kini menghuni posisi sepuluh pada klasemen sementara, terpaut 21 poin di bawah pemuncak Borussia Dortmund. Kendati pasukan Magath lolos ke babak 16 besar Liga Champions, itu tetap tak melunakkan sikap Neuer. Maka, Presiden Schalke Clemens Tonnies langsung menggertak Munich, yang dia nilai sebagai penyebab gamangnya sang kiper andalan untuk bertahan di Auf Schalke. “Jika nanti ada suatu persetujuan antara Manuel Neuer dan

Minggu, 26 Desember (GMT): Fulham vs West Ham Utd *MNC Live pkl 19.00 WIB Wolverhampton vs Wigan Newcastle vs Man City Blackburn vs Stoke City Everton vs Birmingham Bolton vs West Brom Man United vs Sunderland *MNC Live pkl 22.00 WIB Blackpool vs Liverpool *Global Live pkl 22.00 WIB Aston Villa vs Tottenham *MNC Live pkl 00.30 WIB Senin, 27 Desember: Arsenal FC vs Chelsea *Global Live pkl 03.00 WIB

12:00 15:00 15:00 15:00 15:00 15:00 15:00 15:00 17:30 19:00

getty images

Ahmed Elmohamady (kanan) dan kawan-kawan diragukan untuk menahan laju John O’Shea cs di Old Trafford Stadium.

Tetesan Air Mata Perpisahan Simao

DPA

Kiper Schalke Manuel Neuer (kanan) berseberangan dengan pelatihnya, Feliz Magath. Uli Hoeness (Presiden Bayern), itu tentu akan menjadi satu masalah ilegal dan serius,” tegas Tonnies. “Jika itu masalahnya, maka

telah mempermalukan Chelsea 3-0 di Stamford Bridge, dua bulan silam. “Saya kira ini liga yang berat, Sunderland merupakan contoh sempurna. Beberapa pekan lalu mereka berada di bawah, sekarang mereka malah menantang untuk meraih tempat ke Liga Europa,” pesan Ferguson. *Jonny Ramadhan Silalahi

kami akan mengambil tindakan,” katanya lagi, tanpa menyebutkan secara khusus apakah masalah serta tindakan yang akan dilakukan klubnya. (m15/ant/dpa/afp)

MADRID (Waspada): Winger Portugal Simao Sabrosa meneteskan air mata saat melakukan perpisahan dengan Atletico Madrid, Kamis (Jumat WIB) di Vicente Calderon. “Sulit bagi saya untuk berbicara saat ini,” tutur Simao, yang telah menandatangani kontrak dua tahun dengan tim elit Turki, Besiktas. “Saya ingin berterimakasih kepada klub, karena mempercayai saya dan membayar sangat banyakkepadaBenficauntukmengontrak saya,” tambah Simao, sepertidilansirAFP,Jumat(24/12). Simao gabung Atletico pada 2007dariklubPortugalSCBenfica senilai 20 juta euro, tapi gagal mengangkat klub itu menjuarai La Liga Primera. “Saya tidak merasa menipu siapa pun,” jelasnya. “Saat saya tiba, saya katakan bahwasayainginmelakukanyang terbaik untuk memenangi gelar dan saya akhirnya berakhir dengan dua (gelar) di Eropa,” katanya lagi sambil melawan isak tangisnya. Pemain sayap berusia 31

tahun itu membantu Atletico memenangi Liga Europa dan Piala Super Eropa 2010. Dia populer di antara rekan setimnya dan fans, tetapi kontraknya yang akan berakhir Juni 2011 tidak juga diperpanjang Atleti. “Sedihmeninggalkanklubini, karena ini tempat saya punya banyak teman dan tempat saya merasa seperti di rumah,” tambah Simao. Presiden Atletico Enrique Cerezo memuji Sabrosa sebagai contoh profesionalisme, berkomitmen, dan berdedikasi pada pekerjaannya. Simao mencetak satu-satunya gol kemenangan Atletico 10 atas Espanyol di Piala Raja Spanyol dalam penampilan terakhirnya bagi tim tersebut, Rabu lalu. Dia pula yang membuka pesta kemenangan 3-0 Atletico atas tuan rumah Malaga di La Liga, akhir pekan lalu. Dua catatan teraktual itu menjadi kado perpisahan manis dari Simao buat fans Atleti, karena mulai Januari mendatang dia segera berbaju Besiktas. (m15/ant/afp/rtr)

AP

Simao Sabrosa (kanan) merayakan gol terakhirnya bagi Atletico Madrid saat melawan Espanyol dalam duel Copa Del Rey, Rabu lalu.


Sport

WASPADA Sabtu 25 Desember 2010

A11

Andrea, Si Ateng Dari Montasik

Waspada/Munawardi Ismail

Pemain sayap Persiraja Andrea fose di depan koleksi sepatu bolanya. ANDREA merupakan bek sayap impresif yang dimiliki Persiraja Banda Aceh saat ini. Untukukuranpemainsepakbola, postur tubuhnya memang tidak seideal pemain Eropa. Tapi lihat saja aksinya saat berduel di la-

pangan hijau. Ketat dalam menjaga lawan dan rajin membantu serangan. Itulah yang membuat lajang kelahiran 18 April 1984 ini selalu menjadi pilihan setiap pelatih yang menjadi juru taktik di

Persiraja. Terbukti, meski kerap berganti pelatih, posisinya di sayap kiri selalu di bawah kawalannya. Meski dengan tinggi hanya 162 cm, Andrea selalu bisa tampil spartandalammembelaklubnya.

Terbukti, untuk sementara timnya meraup 15 poin dari lima kali pertandingan. Pengagum Roberto Carlos yang akrab disapa Ateng ini, amat menjiwai karirnya sebagai pengocek si kulit bundar. Begitu pun, menjadi aneh jika kemudian ada yang menanyakan koleksi golnya. “Pada intinya, semua pemain itu ingin mencetak gol setiap tampil. Meski tugas utama itu ada di pundak striker,” ujar sulung dari enam bersaudara putra pasangan Fakhri AR,57, dan Puteri, 50, ini. Momentum mencetak gol memang menjadi hal langka bagi Andrea yang berperan sebagai pemain belakang. Jadi, tipis peluang untuk mengoyak jala lawan. Akan tetapi, begitu kans

ada di depan mata, dia pun tak menyia-nyiakan kesempatan. Itulah yang terjadi di Stadion Narasinga Rengat, pada Senin (20/12) lalu. Saat timnya membabat Persires 3-1, Ateng menyumbang satu gol. “Saya sudah empat tahun lamanya menunggu gol itu,” katanya sembari tersenyum. Ini mengingatkan kita pada aksi winger Manchester United, Patrick Evra. Bek sayap asal Perancis itu pun mengakui pandangan tersebut. Untuk mencari satu gol saja, dia harus menunggu tiga tahun lamanya. Sambil berseloroh, Ateng mengakui mungkin ada siklus empat tahun sekali, sehingga pria 26 tahun ini mencetak gol lagi. “Hasrat saya, Insya Allah, ingin

selalu tampil bagus dan memberi yang terbaik untuk tim,” katanya. Adasatuyangdisesalinyausai tampil di Rengat, yakni kartu kuning. Hukuman kartu kuning itulah yang membuatnya absen pada 3 Januari nanti saat timnya melawan Persipasi Bekasi di Stadion H Dimurthala, Banda Aceh. Sebab, pada laga perdana di Bengkulu, pemilik jersey nomor 3 ini juga mendapat kartu serupadariwasityangsama.“Dua kali kartu dari wasit yang sama, mungkin dia dendam dengan saya,” katanya sambil terkekeh. Kenangan di SUGBK Lazimnya pemain bola, Andrea mengenal permainan itu dariSekolahSepakBola(SSB)Ban Timoh saat masih duduk di bangku Sekolah Menengah Per-

tama(SMP)pada1996.“Sepakbola itu sudah mendarah daging dalamhidupkusejakkecil,”ujarputra Montasik, Aceh Besar ini. Darah bolanya mungkin saja mengalir dari sang ayah, yang juga pemain sepakbola antar kampung. Ateng delapan tahun belajar ilmusepakboladiSBBBanTimoh yang diasuh Darmawan AG— mantan pemain Persiraja era80an. Dari situ dia mulai memperkuat Persiraja Junior U-16 dan U-18.“Waktu itu main di Liga Bogasari,” kenang Andrea. Debut profesionalnya di tim senior Persiraja dimulai penuh kenangan. Bagaimana tidak, dia langsungtampildiStadionUtama Gelora Bung Karno (SUGBK) saat Laskar Rencong berduel dengan Persija Jakarta.

Kala itu, Persiraja diasuh SinyoeAliandoe.Bermaindengan rekan senior semacam Tarmizi Rasyid, Irwansyah (alm), Dahlan Djalil Cs tak membuat Andrea grogi dan salah. “Mental Andrea bagus,diatidakdemampanggung saat tampil perdana. Padahal mainnya di Gelora,” ujar mantan pilar Persiraja, Tarmizi Rasyid, yang kini sudah“gantung sepatu”. Sejakitulah,namanyamewarnai sepak terjang Persiraja. Pada musim 2007-2008 dia ikut sang mentor Anwar bermain di PSSB Bireuen dan PSAP Sigli. Dalam dua musim terakhir dia sudah tak berpindah ke lain hati. “Insya Allah, jika ada umur panjang dan sehat badan akan terus bermain untuk Persiraja,” tutup Andrea. Semoga. *Munawardi Ismail

Agar FORMI Lebih Dikenal BANDA ACEH (Waspada): Federasi Olahraga Rekreasi Masyarakat Indonesia (FORMI) Provinsi Aceh menggelar sosialisasi mengenai organisasi FORMI serta rencana pembentukan pengurus FORMI pada tingkat kabupaten/kota di Aceh. Kegiatan sosialisasi itu dibuka Ketua Umum FORMI Aceh Drs H SyafwanYusuf di Banda Aceh, Jumat (24/12). Dalam sambutannya, Syafwan mengatakan sosialisasi itu untuk menjelaskan keberadaan FORMI Aceh agar dapat lebih dikenal di tengah masyarakat. “Untuk itu juga kita segera dibentuk pengurus FORMI di tingkat kabupaten/kota Aceh,” jelasnya. FORMI, katanya, merupakan

organisasi yang bermitra dengan KONI. Kalau KONI mengurus olahraga bersifat prestasi, maka FORMImempunyaitugaskhusus memasyarakatkan dan melestarikan olahraga-olahraga tradisionalyangtumbuhditengah masyarakat. “Saat ini, ada sejumlah olahraga tradisional Aceh yang telah kita bina dan tampilkan di berbagai event nasional, di antaranya Geude-Geude yang berasal dari Pidie, Pelibat (Aceh Tenggara), Silat Pelintau (AcehTamiang) dan Silat Gelombang (Aceh Selatan),” jelas anggota Komisi E DPRA ini. Dengan adanya pengurus FORMI di tingkat kabupaten/kota, lanjut Syafwan, diberharapkan lebih banyak menggali potensi-potensi olahraga tradisional di Aceh yang selama ini terpendam, sehingga dapat le-

bih dilestarikan dan dikenal oleh masyarakat luar. “Kita juga akan membuat kajian-kajian kembali mengenai olahraga tradisional serta menerbitkan buku mengenai olahraga tersebut beserta peraturan-peraturannya,” kata Syafwan. Wakil Ketua KONI Aceh Ir Maulisman Hanafiah menyatakansangatmendukungkeberadaanFORMIAcehdalammengangkat dan melestarikan olahraga tradisional. “Selama ini kita hanya terpaku pada olahraga prestasi, sehingga olahraga tradisional terkesan dilupakan. Padahal, olahraga tradisional juga memiliki nilai jual di dunia internasional,” cetusnya. Selain sosialisasi dan pembahasan rencana pembentukan FORMI kabupaten/kota, acara juga diselingi dengan penataran

singkat mengenai olahraga tradisional terompah panjang yang akan diperlombakan pada 30 Desember mendatang. “Kita sudah meminta setiap daerah menyiapkan tim yang beranggotakan tiga orang untuk mengikuti lomba ini,” jelas Ketua Panitia, Drs Bachtiat Hasan MPd. Diamenambahkan,sosialisasi FORMI Aceh yang berlangsung sehari penuh itu diikuti utusan dari 10 kabupaten/kota di Aceh yaitu Banda Aceh, Aceh besar, Pidie,PidieJaya,AcehUtara,Lhokseumawe, Aceh Tengah, Aceh Tenggara, Aceh Barat Daya dan Aceh Barat. “13 Daerah lagi tidak dapat mengirimkan utusannya dengan berbagai alasan. Namun, pada prinsipnya mereka sangat mendukung pembentukan FORMI tingkat kabupaten/kota ini,” pungkas Bachtiar. (b07)

PSPS Mundur Dari LPI PEKANBARU (Antara): PSPS Pekanbaru memastikan diri mundur dari Liga Primer Indonesia yangbergulir8Januari2011, meski sebelumnya ikut mendeklarasikan LPI di Semarang. “Alasan kami tidak tampil di LPI sudah jelas, PSPS hanya ikut liga yang diakui oleh PSSI seperti saat ini kami tampil di Liga Super Indonesia,” kata Ketua Ha-

rian PSPS, Jefri Nazir, di Pekanbaru, Jumat (24/12). Menurut Jefri, hingga kini kompetisiLPIyangdigagaspengusaha nasional Arifin Panigoro itu belum mendapat pengakuan dari PSSI selaku otoritas sepakbola nasional di Tanah Air. Nada ancaman yang dikeluarkan PSSI, yang menyebutkan akan mencoret klub dari keang-

gotaannya jika terbukti mengikuti LPIkarenadinilaitelahmelanggar statuta otoritas organisasi sepakbola itu juga menjadi pertimbangan. “Alasan statuta juga menjadi pertimbangan kami, sebab LPI merupakan kompetisi di luar PSSI. Karena itu kami mengurungkan niat untuk tampil di kompetisi itu,” tegasnya lagi.

Perekrutan Pemain Wewenang Pelatih MEDAN (Waspada): Kiprah pemain asing PSMS yang belum sesuai harapan rupanya menimbulkan anggapan perekrutannya bukan atas rekomendasi pelatih PSMS terdahulu Zulkarnain Pasaribu. Manajemen PSMS pun membantahnya. SekretarisUmumPSMSyang juga menjabat Manajer Tim Idris mengatakan hal itu kemarin. Menurutnya,tudinganpihakyang menyebutkan manajemen mengintervensiperekrutanbeberapa pemain asing seperti Gaston Castano dan Vagner Luis tidak benar. “Pengurus dan manajemen tidak pernah ikut campur pada perekrutan pemain, kami hanya mengawasi, Semuanya merupakan wewenang pelatih,” sebut Idris. Memang, performa tim diakuinya masih belum sesuai harapan masyarakat. Namun,

semua itu menurutnya terjadi akibat ketidaksepahaman yang terjadi antara pemain dan pelatih terdahulu. Materi latihan monoton yang disampaikan pelatih tidak sesuai menurut pemain. “Mulai dari start latihan hingga menjelang pertandingan, pelatih selalu memberikan latihan yang monoton sehingga menimbulkan kebosanan bagi pemain,” sebutnya. Dia juga menegaskan, pemberhentian pelatih terdahulu juga bukan karena berselisih paham dengan pengurus, namun karena ketidakmampuan pelatih menyusun strategi dalam pertandingan yang menjadi pertimbangan pengurus untuk memberhentikan sang arsitek. “Pelatih tidak mampu menyusun strategi dalam pertandingan sehinga dalam tiga laga terakhir, bukan hanya tidak membawa poin, bahkan men-

Problem Catur Putih melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2.

cetak gol saja tim tidak pernah. Pemecatan pelatih bukan atas keputusan salah seorang pengurus, tapi merupakan keputusan lewat rapat pengurus ,” sebut Idris. AsistenManajerPSMSBenny Tomaso mengatakan, pembuktian kualitas pemain akan terjadi pada pertandingan selanjutnya menghadapi Persih Tembilahan 3 januari 2011. Jika memang pemain gagal, Pelatih PSMS Rudy W Keltjes berhak mencoret pemain yang dinilai tidak berkontribusi maksimal. “Pelatih punya wewenang mencoret pemain yang tidak punya kontribusi, termasuk pemain asing. Untuk itu, kita lihat saja nanti hasilnya di tangan Rudy W Keltjes. Kalau memang tidak bagus, pemain akan dicoret termasuk Gaston yang sudah mencetak dua gol untuk PSMS,” ucapnya. (m17)

TTS TOPIK

Sebelumnya pada pendeklarasianLPIdiSemarang,24Oktober 2010, PSPS yang diwakili Direktur Utama, Dityo Pramono tercatat sebagaisatudiantarabelasanklub sepak bola Tanah Air yang berkomitmen tampil di LPI. LPI yang dikelola secara profesional, dengan menyuntikan dana dan bagi keuntungan kepada klub-klub peserta kompetisi dinilai merupakan solusi krisis keuangan PSPS yang hingga kini masih mengandalkan APBD Pekanbaru. Sikap Dityo itu telah menyebabkan perpecahan di tubuh manajemen PSPS yang berujung pada pemecatan dirinya dari posisi direktur utama dan asisten manajer, seiring keluarnya ancaman dari PSSI. Informasi terakhir menyebutkan, kompetisi LPI bakal digelar 8 Januari 2011 yang diikuti 19 klub peserta yang sudah memastikan diri berpartisipasi diantaranya Persebaya Surabaya, Persema Malang dan Persibo Bogor.

Waspada/Armansyah Th

Kapolda Sumut Irjen Pol Oegroseno, Ketua Pengprov IMI yang juga Ketua HDCI Sumut Ijeck, Ketua Umum XTrim Dodi, bersama wakil dari Panti Asuhan usai penyerahan bantuan, di Medan, Jumat (24/12).

Bakti Sosial IMI, HDCI Dan Poldasu M E D A N ( Wa s p a d a ) : Pengprov IMI Sumut, bersama komunitas pecinta motor Besar Harley Davidson Club Indonesia (HDCI) Sumut dan Poldasu, menggelar bhakti sosial berupa penyaluran bantuan kepada Panti Asuhan di Medan, Sabtu (25/12) ini. Acara penyerahan bantuan danbingkisanberlangsungdiPanti Asuhan Yayasan Karya Murni, Jl. Karya Wisata, Medan Johor kemarin, oleh Kapolda Sumut Irjen Pol Oegroseno, bersama Ketua Pengprov IMI yang juga Ketua HDCI Sumut Ijeck, Ketua Umum XTrim (Expedition Trail Mania) Dodi, dan para anggota HDCI Sumut, dihadiri anak-anak Panti Asuhan. Kapolda Irjenpol Oegroseno dalam sambutannya menyatakan, terkesan dengan motto di panti asuhan ini yakni Hargailah Kehidupan. Hidup, katanya, harus berarti, jangan disia-siakan. Dalam kesempatan ini, ucap Kapolda, mereka ingin berbagi rasa, berbagi kebersamaan dalam keragaman,dimanaumatNasrani merayakan Natal. “Suasana yang

religius ini harus dinikmati bersama tanpa ada perbedaan dengan yang lain. Saya bangga dengan anak-anak,” ucap Oegroseno, dihadapan penghuni panti asuhan khusus tuna netra ini. Suster Aurelia, mewakili Pengurusan yayasan menyatakan terima kasih atas kunjungan danbantuandarirombonganIMI, HDCI dan Poldasu ini. “Ada kebahagiaan tersendiri atas kun-

jungan ini, kami semua mendapat semangat dalam aktifitas di panti asuhan yang mengasuh anak-anak tunanetra ini,” ucap Sekretaris Yayasan Karya Murni ini. Dalam kesempatan ini, Kapolda dan Ketua IMI Sumut/ HDCI Sumut, spontan memberi sumbangan dua unit komputer, setelah mendengar penuturan Sekretaris Yayasan, bahwa mereka baru saja kehilangan

beberapa komputer dari ruangan kelas, yang membuat anak-anak kembali kesulitan dalam belajar. Ijeck, di sela-sela acara mengatakan, bhakti sosial yang mereka gelar, merupakan kegiatan rutin klub dalam setiap menyambut hari-hari besar agama, dan dalam pelaksanaannya selalu bekerja sama dengan Poldasu serta Bank Bukopin. “Kita ingin berbagi rasa dengan mereka,” ucap Ijeck. (m47)

18 Tim Ikut Kompetisi Divisi I PSSI Sabang SABANG (Waspada): 18 tim bersaing pada Kompetisi Divisi I PSSI Sabang 2010 yang dimulai sejak 22 Desember hingga 15 Januari 2011 mendatang. Empat tim terbaik dari kompetisi ini selanjutnya berhak promosi ke Divisi Utama PSSI Sabang. Sebaliknya, empat tim Divisi Utama bakal terdegradasi ke Divisi I Kompetisi yang digelar di Stadion Sabang Maroke itu dibuka resmi Ketua KONI Sabang Islamuddin ST, Rabu (22/12) sore. “Kita berharap kompetisi ini

INFOKOM

berjalan lancar sebagai ajang pembinaan sepakbola di Sabang,” ucap Islamuddin. Sebelumnya pada laga pembuka antara tim Borneo asal Kuta Barat Kecataman Sukakarya Sabang dan kesebelasan TNI AL yang tergabung dalam PS Samudera dimenangkan Borneo dengan skor 2-0. Borneo yang diperkuat beberapa pemain yang memperkuat tim Sabang di Porprov Aceh langsung menggebrak pertahanan PS Samudera di menitmenit awal.

Sudoku

Mendatar

Menurun

1. Sumber acuan, buku-buku yang dianjurkan untuk dibaca. 8. Ilmu pengetahuan terapan. 10. Buku acuan yang memuat kata dan ungkapan, disusun menurut abjad. 11. Nama Menkominfo bermarga Sembiring. 13. Isi yang paling penting. 15. Siaran bukan siaran langsung. 16. Surat keterangan tercetak sebagai bukti menyelesaikan kursus. 19. Bukti; Cetakan percobaan. 20. Perangkat keras (Inggris). 21. Buat berita suatu peristiwa. 22. Foto, gambar yang dibuat dengan kamera.

2. Selaput tipis dari seluloid untuk gambar negatif atau positif. 3. Singkatan populer Rencana Strategis. 4. Tinta (Inggris). 5. H. Mohammad ______, tokoh pers diabadikan untuk nama jalan dimana kantor Infokom Sumut berlokasi. 6. Penyelidikan pendapat umum. 7. Kepanjangan “Kom” dari Infokom atau Kominfo. 9. Koran elektronik. 10. Tempat bekerja. 12. Penerangan, kabar atau berita. 14. Singkatan populer Interna tional Networking (jaringan internasional). 16. Perangkat lunak (Inggris). 17. Kamera (Belanda). 18. Lembar isian untuk diserahkan pada bagian pendaftaran.

Kapten Borneo Ade Saputra langsung menceploskan gol cepatnya saat pertandingan baru berjalan dua menit. Dia berhasil memanfaatkan bola rebound dari tangkapan penjaga gawang Samudera Wahyudi. Samuderasendirisebenarnya memiliki sejumlah peluang mencetak gol lewat Zuhri dan Sahruddin. Namun lemahnya penyelesaian akhir membuat papan skor tak berubah 1-0. Borneo baru bisa menambah keunggulan di menit ke-67 melalui kaki Ade Saputra. (b29)\

10x10

Isi kotak kosong dengan angka 0 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 5x2 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di halaman A2 kolom 1.

1 7 8

3 8 1 0 7 9 6 5

6 0 4 0 4 1 5 9 3 2 1 7 2 9

4 2 0 1 9 7 9 4 8 5 3 5 1 8

5 4 5

0 0 3 5 1 1 4 0

e10


Sport

A12

WASPADA

Sabtu 25 Desember 2010

PSSI Berlebihan

JAKARTA ( Waspada): Pelatih Timnas Indonesia Alfred Riedl sangat serius menyiapkan pasukannya jelang bentrok dengan tuan rumah Malaysia pada leg pertama babak final AFF Suzuki Cup 2010, di Stadion Bukit Jalil, Malaysia, Minggu (26/ 12) malam.

Antara

Firman Utina (kiri) dan kawan-kawan tidak boleh lagi bicara dengan wartawan sampai berakhirnya dua leg final Suzuki AFF Cup 2010.

Timnas Suguhkan Permainan Cantik KUALA LUMPUR (Antara): Manajer tim nasional Indonesia Andi Darussalam mengatakan, Tim Garuda akan menyuguhkan permainan cantik dan menarik dengan tetap berupaya memenangi pertandingan. “Insya Allah kami akan bermain semaksimal mungkin dan berusaha mencetak gol dan tentunya bisa meraih kemenangan agar jalan menuju juara semakin terbuka.” Demikian Andi dalam jumpa pers bersama pelatih Malaysia Rajagobal R Krishna Samy di Stadion Bukit Jalil, Selangor, Jumat (24/12). Dia mengklaim, tidak masalah bagi timnas meski bermain di kandang lawan. “Kami punya Bambang Pamungkas yang sudah pernah bermain untuk klub di Selangor dan dia punya fans di sini,” tegasnya Menurutnya, pertandingan antara Indonesia dan Malaysia merupakan duel klasik antarn egara serumpun sehingga tidak boleh ada gangguan dari kedua belah pihak.

Itu bisa dilihat dengan tidak adanya waktu luang bagi Markus Haris Maulana cs. Begitu tiba di Malaysia, Jumat (24/12) siang, mereka langsung melahap menu latihan di MSN Field Kuala Lumpur pada sore harinya. Namun tindakan berlebihan dilakukan pengurus PSSI dan jajaran pelatih tim Merah Putih, karena melarang setiap pemain timnas

meladeni wartawan yang akan melakukan wawancara langsung. Akibatnya, para pemain Garuda Merah Putih sangat sulit dimintai keterangan. Bahkan ancaman sanksi berat akan diberikan, sekiranya melanggar ketentuan yang telah diputuskan. “Mohon maaf Bang, saya dilarang berkomentar kepada wartawan takut kena sanksi,” jelas Oktavianus Maniani sembari berusaha mengakhir pembicaraan dan menutup telepon selulernya ketika coba dihubungi Waspada. Ketua Umum PSSI Nurdin Halid membenarkan batas yang diberlakukan kepada pasukan Alfred Riedl tersebut. Menurutnya, hal tersebut guna menghindari publikasi berlebihan yang bisa saja merusak mental bertanding Irfan Bachdim

dan kawan-kawan di babak final. Lebih dari itu, lanjut Nurdin, semua pemain diminta untuk konsentrasi penuh menghadapi Malaysia, agar bisa memenuhi ambisi meraih gelar juara AFF Cup untuk pertama kali setelah kegagalan pada tiga kesempatan sebelumnya. “Kami memang melarang semua pemain timnas untuk berkomentar di media masa. Ini semua demi untuk menghindari publikasi berlebihan yang bisa merusak mental mereka,” ujar Nurdin. “Larangan ini hanya berlaku hingga selesainya babak final AFF Cup. Setelah itu, semuanya bebas untuk diwawancara. Silahkan saja semua media melakukan wawancara dengan siapa saja pemain timnas,” katanya lagi.

Percepat latihan Rombongan Timnas bertolak ke Kuala Lumpur dari Bandara Halim Perdanakusumah sekitar pukul 09.30 WIB, menggunakan pesawat carter khusus. Timnas tiba sekitar pukul 12.30 di Subang Airport, Malaysia, langsung Shalat Jumat dan check-in di Hotel Palace of Golden Horses. Menurut Nurdin Halid, pesawat pribadi digunakan untuk meminimalisir kelelahan fisik para pemain sekiranya harus menumpangi pesawat reguler akibat harus menunggu di Bandara. “Rombongan berangkat dengan pesawat pribadi. Dengan begitu, bisa memberikan kenyamana kepada pemain timnas, karena mereka tidak perlu menunggu di bandara,” jelas Nurdin. Namun persiapan saat menjalani latihan di Malaysia tidak bisa berjalan sesuai

harapan. Hujan rintik-rintik yang mengguyur Kuala Lumpur membuat skuad Merah Putih mempercepat sesi latihan perdana. Sebab hal itu dikhawatirkan bakal membuat kondisi fisik pemain drop akibat cuaca buruk. “Seharusnya kami menggelar latihan selama 80 menit, tapi karena cuaca buruk membuat kami hanya berlatih 60 menit saja. Tapi saya pikir itu sudah cukup untuk kubagaran fisik pemain,” papar Riedl. Arsitek asal Austria itu mengklaim, latihan yang diberikan sudah sangat memenuhi syarat bagi pemainnya jelang tampil di laga final yang akan digelar besok malam. Sebab menu latihan yang diberikannya memang hanya untuk kebugaran fisik dengan stretching bola, ditambah sedikit latihan teknik. (yuslan)

Rajagobal Ingatkan Kunjungan Balasan KUALA LUMPUR (Waspada): Pelatih Timnas Malaysia Rajagobal R Krishna Samy (foto) menegaskan, timnya harus bermain sebaik-baiknya sekaligus mengingat masih akan melakukan kunjungan balasan ke Indonesia. Demikian Rajagobal dalam temu pers bersama manajer tim Indonesia Andi Darussalam di Stadion Bukit Jalil, Selangor, Jumat (24/12). “Kami tidak bisa menentukan hasilnya sekarang. Namun yang perlu kita ingat, kita akan main lagi di Indonesia (29 Desember),” katanya. Dia pun terus memantau kondisi Mohd Khyril Muhymeen bin Zambri yang belum 100 persen fit, sebelum memasukkannya dalam line-up Harimau Malaysa untuk final leg pertama, Minggu (26/12) malam. Mengenai kabar kurang fitnya striker kunci Indonesia Cristian ‘El Loco’ Gonzales, pelatih berusia 54 tahun itu mengaku tidak mempedulikannya. “Ini bukan keuntungan atau menjadi kerugian bagi

Waspadai Bola Crossing MEDAN (Waspada): Ketua Umum Biranta FC Ir Jose Rizal, meminta Timnas Indonesia mewaspadai bola-bola ‘crossing’ (silang-red) dari Malaysia yang sangat berbahaya, baik dari sektor kiri maupun kanan. “Kita sadar bermain di Stadion Bukit Jalil Kuala Lumpur, pasukan Rajagopal pasti akan didukung suporternya. Namun diminta Maman Abdurrachman cs jangan menghiraukannya. Bermainlah seperti saat membantai mereka di Gelora Bung Karno (GBK).” Demikian Jose Rizal kepada Waspada di kantornya PT Jorindo Agung Jalan Setiabudi Medan, kemarin, menanggapi final leg pertama Suzuki AFF Cup 2010 di Kuala Lumpur, Minggu (26/12) malam. Jose yakin Firman Utina cs akan tampil dengan semangat juang tinggi dan mengerahkan segenap kemampuannya untuk menggedor pertahanan Negeri Jiran. Secara terpisah mantan pemain PSMS Medan era 70-an Drs H Freddy Hutabarat mengatakan, pola 4-4-2 ala Alfred Riedl sangat efektif, jika menampatkan dua striker Christian ‘El Loco’ Gonzales dan Irfan Bachdim. Juga memanfaatkan Arif Suyono atau Ahmad Nasuha dan Muhamamd Ridwan yang berani menusuk serta umpan matang dari Ahmad Bustomi maupun Firman Utina dari lini tengah. Menurut Freddy, target bermain draw alias jangan kalah di Kuala Lumpur sesungguhnya sudah cukup bagus. “Namun melihat kepercayaan diri dari para pemain cukup merata, saya yakin bisa menang tipis. Dengan harapan leg kedua (29/12) di SUGBK, pasukan Rajagopal harus dibantai,” pintanya. (m24)

kami. Saya yakin mereka (Indonesia) memiliki pilihan lain,” jelasnya. “Semua 22 pemain mereka mampu melawan kami,” tambah Rajagobal seperti dikutip dari New Straits Times. Gonzales mengalami cedera paha dua hari lalu saat menjalani sesi latihan di Lapangan C Senayan, Jakarta,

Rabu lalu. Penyerang Persib Bandung itu terpaksa melakukan latihan terpisah pada Kamis. “Saya hanya ingin fokus. Kami akan bermain dan mempersiapkan diri untuk hari Minggu nanti,” ujar Rajagobal. Dia pun sadar, bermain pada partai final bukanlah

hal mudah. “Tekanan memang ada di mana-mana. Sebagai pelatih, saya perlu menanganinya,” ujarnya lagi. Sedangkan kapten tim Malaysia Safiq Rahim mengklaim, mereka optimis memenangkan leg pertama sekaligus menuntaskan dendam terhadap pasukan Alfred Riedl. “Kami tidak akan mengulangi kesalahan lagi,” tegas Safiq dalam Berita Harian. “Kami akan bermain serius dan yakin bisa menang dengan skor 2-0 untuk membantu kami bermain lagi pada leg kedua di Jakarta nanti,” tambah Safiq. Malaysia memang punya memori buruk, karena sempat digasak Indonesia 5-1 pada partai perdana babak penyisihan Grup A pada 1 Desember di Stadion Utama Gelora Bung Karno, Jakarta. (m15/vvn/nst)

Pacu Semangat Atlet Muda Sumut ● Kejuaraan Tenis Meja Piala Waspada KISARAN (Waspada): Petenis meja Sumut yang dipersiapkan menghadapi Pra PON, Husni Hidayat mengucapkan terimakasih atas digelarnya Kejuaraan Terbuka Tenis Meja se Sumatera Piala Waspada di Kisaran pada 17-19 Desember lalu. “Even ini terbukti mendukung pembinaan atlet usia dini dan remaja dengan digelarnya nomor pertandingan kelompok umur,” ucap Husni kepada Waspada, Jumat (24/12). “Seperti kita tahu, belakangan memang sangat jarang digelar turnamen tenis

meja di Sumut, sehingga dikhawatirkan proses pembinaan di klub-klub kurang bergairah,” jelasnya. Dikatakan, digelarnya nomor kelompok umur sudah pasti akan memacu semangat atlet muda di Sumut untuk ikut bersaing dan terus menggeluti olahraga tenis meja. “Hal ini terbukti dengan besarnya jumlah peserta pada turnamen di gagas Harian Waspada itu,” tambah atlet binaan PTM Sahabat Medan itu. Husni sendiri pada even itu berhasil menjuarai nomor bergengsi tunggal putra

senior setelah di final mengalahkan rekan setimnya M Nasser. PTM Sahabat pada kejuaraan diikuti 300-san peserta tersebut mengirimkan atletatlet muda yang kesehariannya berlatih di Gedung Pasar Suka Ramai Medan. “Kita berharap kejuaraan tenis meja ini dapat digelar rutian oleh Waspada,” pinta Manajer PTM Sahabat Ahui. Prestasi lainnya yang berhasil diraih PTM Sahabat adalah juara I beregu putra, juara III U-17 (Juliani Indah Pratiwi), juara I,II dan III U 18+ putra (Husni Hidayat, M Nasser dan A yung). (a36)

Santri Ponpes Ahmadul Doakan Timnas Menang KOTAPINANG ( Waspada): Santri Pondok Pesantren Ahmadul Jariyah menggelar doa dan zikir bersama, Kamis (23/ 12) malam, demi kemenangan tim nasional Indonesia atas Malaysia pada leg pertama final Suzuki AFF Cup 2010 besok malam di Kuala Lumpur, Dibimbing sejumlah tenaga pengajar, tak kurang dari 589 santri yang menimba ilmu di pesantren itu, larut dalam kegiatan yang digelar di Masjid Ahmadul Jariyah Jalan Bedagai, Kecamatan Kotapinang, Kabupaten Labuhanbatu Selatan (Labusel). Turut hadir H Ahmad Darji Rambey dan Hj Farimah Daulay selaku pemilik yayasan. Seluruh santri terlihat khusuk saat membacakan doa-doa berisikan harapan agar anak-anak asuhan Alfred Riedl dapat menaklukkan tim Negari Jiran. Muhammad Juri, guru pembimbing santri mengatakan, kegiatan tersebut merupakan bentuk apresiasi pesantren yang cukup besar terhadap olahraga khususnya sepakbola. Selama ini, kata dia, santri Ahmadul terus mengikuti pertandingan yang dilakukan Timnas di Piala AFF. “Kita sangat berharap Timnas mengalahkan Malaysia,” katanya kepada Waspada, Jumat (24/12). Menurutnya, kegiatan itu tanpa persiapan sama sekali, sebab usulan datangnya justru dari para santri, yang kepincut dengan taktik spektakuler mantan pelatih Laos, Riedl. “Saatnya sepakbola negeri ini bersinar. Ini satu kesempatan besar bagi Indonesia,” harap Juri. Ketua KONI Labuhanbatu Selatan H Syaiful Masyhuri yang juga pimpinan pesantren tersebut mengharapkan, Timnas mampu menunjukkan penampilan maksimalnya. Kemenangan Timnas, menurutnya, sangat penting untuk memberikan moti-vasi untuk kebangkitan sepakbola nasional. “Kita hanya bisa mengucapkan selamat bertanding dan kita dukung penuh perjuangan anak-anak merah putih,” ucap Syaiful. (cden)

Waspada/Bustami Chie Pit

Beberapa pemain PTM Sahabat Medan diabadikan bersama usai mengikuti Kejuaraan Terbuka Tenis Meja se Sumatera Piala Waspada di Kisaran, Asahan, baru baru ini.

Waspada/Hang Tuah J Said

Striker Redaktur FC Dedi Sahputra (7) mendapat pengawalan ketat pemain Berita Sore FC Robinson Simbolon (13) dan Andi ATT (4) pada laga penyisihan minggu pertama Liga Futsal Waspada Cup III di Deli Futsal Plaza Medan.

Pembuktian Empat Tim Terbaik ● Semifinal Liga Futsal Waspada Cup III LIGA Futsal Waspada Cup III dipastikan melahirkan jawara baru setelah juara bertahan Cheers United Waspada Online terhenti di babak penyisihan dan “dileburnya” tim juara tahun pertama (2008) Dragon Ball FC. Even dalam rangka menyambut HUT Ke-64 Harian Waspada itu telah memasuki babak semifinal yang akan digelar di Lapangan Deli Futsal Plaza Medan, Sabtu (25/12) siang ini. Empat tim terbaik di laga penyisihan sebelumnya yakni Redaktur FC, PAP FC, Berita Sore FC dan YPAI FC akan membuktikan diri sebagai tim terbaik untuk tampil di final. Pada semifinal pertama, juara Grup B PAP FC akan meng-hadapi runner-up Grup A Berita Sore FC dan di game kedua juara Grup A Redaktur FC meladeni runner-up Grup B YPAI FC. Duel antara PAP dan Berita Sore dipastikan berlangsung ketat, mengingat kedua tim memiliki materi pemain yang relatif berimbang. PAP, sudah dua kali berturut tampil sebagai runner-

up dan tentunya ingin membuat sejarah baru tampil juara. Diperkuat pemain yang memiliki kemampuan merata seperti M Pitoyo, Novrizal, Bayu Anggono, Juni Hartoyo, Bambang Hariawan, Afriadi, Zulkarnain, Andi Santiago dan Bahtiar Effendi, tim ini terbukti tampil gemilang di babak penyisihan dengan memenangi semua laga. Berita Sore, meski sempat terseok-seok di penyisihan Grup dengan menelan sekali kekalahan, sekali seri dan sekali menang, kansnya tetap besar lolos ke final. Kepiawaian striker Edwin Dhani memanfaatkan peluang sekecil apa pun menjadi gol, ditambah benteng kokoh Robinson Simbolon di barisan pertahanan, membuat tim ini tidak bisa dipandang sebelah mata. Bersama Redaktur FC, Berita Sore menjadi tim paling produktif dengan telah mengoleksi 16 gol Di pertandingan kedua, meski lebih diunggulkan, Redaktur FC harus tetap waspada dengan penampilan YPAI FC yang turut diperkuat beberapa pemain old-

Jadwal Semifinal, Sabtu (25/12): 11.00 PAP FC vs Berita Sore FC 12.00 Redaktur FC vs YPAI FC crack sarat pengalaman. Akurasi tendangan triker Syahdewiko (mantan pemain Bintang Utara/Timur) telah teruji dimana striker ini total sudah mengoleksi delapan gol dalam tiga laga penyisihan sebelumnya. Belum lagi penampilan pemain muda Amal yang sudah mengoleksi tiga gol. Gawang Redaktur yang dijaga Zulkifli Harahap diprediksi bakal diuji dengan tembakan bola-bola akurat Syahdewiko dan Amal. Dibutuhkan penampilan maksimal seluruh pemain khususnya duet David SyawanaDedi mengunci pergerakan kedua andalan YPAI itu. Partai semifinal kali ini memang seru untuk disaksikan. Siapa pun pemenangnya, itu bukan tujuan utama, melainkan mempererat tali silaturrahim antar karyawan dan wartawan Waspada Group jauh lebih penting. Semoga! ● Dedi Riono


Sumatera Utara

WASPADA Sabtu 25 Desember 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:24 12:37 12:25 12:32 12:31 12:28 12:25 12:20 12:27 12:27

‘Ashar 15:48 16:00 15:48 15:54 15:54 15:53 15:49 15:44 15:51 15:50

Magrib 18:22 18:32 18:23 18:27 18:27 18:30 18:24 18:19 18:25 18:23

‘Isya

Imsak

Shubuh Syuruq

Kota

19:36 19:46 19:37 19:41 19:42 19:44 19:38 19:34 19:39 19:37

04:53 05:10 04:54 05:04 05:03 04:53 04:53 04:49 04:56 04:58

05:03 05:20 05:04 05:04 05:13 05:03 05:03 04:59 05:06 05:08

L.Seumawe 12:30 L. Pakam 12:23 Sei Rampah12:22 Meulaboh 12:34 P.Sidimpuan12:21 P. Siantar 12:22 Balige 12:22 R. Prapat 12:19 Sabang 12:37 Pandan 12:23

06:24 06:41 06:25 06:35 06:34 06:24 06:24 06:20 06:27 06:29

Zhuhur ‘Ashar 15:53 15:47 15:46 15:57 15:46 15:46 15:47 15:44 15:59 15:48

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:25 18:21 18:20 18:31 18:23 18:22 18:23 18:20 18:31 18:25

19:39 19:35 19:34 19:45 19:38 19:36 19:37 19:34 19:45 19:39

05:02 05:53 04:52 05:04 04:47 04:51 04:50 04:46 05:10 04:50

05:12 05:03 05:02 05:14 04:57 05:01 05:00 04:56 05:20 05:00

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:23 12:25 12:35 12:27 12:24 12:31 12:19 12:30 12:23 12:22

18:25 18:24 18:30 18:28 18:22 18:28 18:19 18:28 18:24 18:20

19:39 19:38 19:44 19:42 19:36 19:42 19:33 19:43 19:38 19:35

04:50 04:53 05:07 04:55 04:54 05:02 04:48 04:59 04:49 04:51

05:00 05:03 05:17 05:05 05:04 05:12 04:58 05:09 04:59 05:01

Panyabungan 12:20 Teluk Dalam12:27 Salak 12:25 Limapuluh 12:21 Parapat 12:23 GunungTua 12:20 Sibuhuan 12:20 Lhoksukon 12:29 D.Sanggul 12:23 Kotapinang 12:18 AekKanopan 12:20

06:33 06:23 06:23 06:35 06:18 06:22 06:20 06:17 06:41 06:21

15:48 15:49 15:57 15:52 15:48 15:54 15:44 15:54 15:47 15:46

06:21 06:24 06:38 06:26 06:25 06:33 06:19 06:30 06:20 06:22

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur ‘Ashar 15:46 15:53 15:50 15:45 15:47 15:45 15:45 15:52 15:48 15:43 15:44

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:23 18:31 18:25 18:19 18:22 18:22 18:22 18:25 18:24 18:19 18:20

19:37 19:45 19:39 19:34 19:37 19:36 19:36 19:39 19:38 19:33 19:34

04:45 04:51 04:53 04:50 04:51 04:46 04:45 05:01 04:51 04:45 04:47

04:55 05:01 05:03 05:00 05:01 04:56 04:55 05:11 05:01 04:55 04:57

06:16 06:22 06:24 06:21 06:22 06:17 06:16 06:32 06:22 06:16 06:18

RSU T. Pura Gunakan Alat Mutakhir Operasi Katarak

Ratusan Bolol Miras Terjaring Penertiban

T.PURA (Waspada): Dalam teknologi modern saat ini peralatan medis sudah cukup canggih dan bisa cepat operasinya dengan menggunakan alat canggih’operasi-mata” seperti mesin Phacoemulsifikasi yakni alat operasi sedot untuk katarak. Demikian Direktur Rumah Sakit UmumTanjungpura Langkat melalui dr H Emir El Newi, Spm, Rabu (22/12). “Alat canggih perdana digunakan di RSUTanjungpura, si pasien tidak disuntik biusnya tetes aja, tidak berdarah dan tidak dijahit. Alat modern ini berasal dari Italia merk Assistant dan lamanya dilaksanakan operasi memakan waktu 7–15 menit,” imbuhnya. Sedangkan alat modern ini juga jenis mesinVitrektomy merk Assistant vitreous mata sebagai tim ahli Dr Reni Guspita Spm digunakan untuk alat sedot vitreous mata untuk berdarah,ok, trauma, diabetes, kecelakaan dan lain lain. (c02)

T. TINGGI (Waspada): Ratusan botol minuman keras (miras) dari berbagai merek dan jenis terjaring razia penertiban yang dilakukan tim gabungan Satpol PP dan Denpom Tebingtinggi menjelang hari besar Natal dan Tahun Baru, Jumat (24/12) siang. Raziayangdigelarmulaipukul10:30hinggapukul12:00kesejumlah warung dan toko grosir di Kota Tebingtinggi menemukan ratusan botol miras yang dijual tanpa izin. Di toko Awi di Jalan Ahmad Yani petugas menjaring 31 botol bir bintang, 32 botol kecil Heieken, 10 botol kecil guiness dan 7 kaleng guiness. Di toko Raipinawati Jalan Jendral Sudirman, Kel. Sri Padang terjaring 10 botol bir putih, 9 botol besar scout dan 6 botol bir hitam terdiri dari ukuran besar dan kecil. Penertiban sempat mendapat perlawanan dari pemilik toko, namun setelah mendapat penjelasan petugas, penertiban dapat dilanjutkan. Kasat Pol. PP Tebingtinggi, Drs Djayardi,BA ketika dikonfirmasi melalui Kasi Operasional Ahmad Arifin Harahap mengatakan, razia miras dan PSK akan terus dilakukan untuk menjaga ketenangan dan ketertiban masyarakat selama hari besar Natal dan Tahun Baru. Menjualan miras tanpa izin melanggar peratusan daerah (perda) No. 25 tahun 1998 bab II psal 4 :1 Bab XX pasal 29 huruf c. Seyogyanya razia digelar mulai pukul 08:00, namun baru dapat digelar pukul 10:30. Hal itu karena ketiadaan Personil Polres, karena sedang cuti Natal, tim dibantu dua orang personil dari Denpom Tebingtinggi, jelas Harahap. (a09)

PTPN III Kebun Rambutan Menyemak T. INGGI (Waspada): Areal kebun kelapa sawit PTP Nusantara III Kebun Rambutan seakan tidak diurus sehingga terlihat semak belukar. Seperti terlihat di Afdeling I Paya Bagas, Rabu (22/12) yang merupakan areal tanaman kelapa sawit muda yang menghasilkan, tepatnya di tepi jalan pohon jenis kayu gondang berdiri subur tak ubahnya seperti kayu yang dikebunkan. Namun pihak asisten perkebunan walaupun setiap hari masuk ke lapangan, tetapi tidak melihat ada pohon yang berdiri tersebut. Bukan itu saja, tanaman kelapa sawit menghasilkan (TM) di Afdeling III terlihat baru saja dipupuk. Namun ironis pohon sawit yang dipupuk itu, piringannya semak (di sekeliling pangkal pohon semak), sehingga pupuk yang ditabur tidak jatuh ke tanah, tetapi sangkut di dedaunan semak. Manajer Kebun Rambutan Sigit dan APK yang dikonfirmasi wartawa tidak berhasil ditemui, sebab menurut Satpam Marga Manurung mengatakan, semuanya tidak ada di tempat. (a07)

Peringatan Hari Guru Dan HUT PGRI Ke-65 Di Binjai BINJAI (Waspada):Walikota Binjai menyatakan masa depan sebuah bangsa ditentukan oleh SDM. Peningkatan sumber daya manusia, sektor pendidikan harus maju dan berkualitas. Pendidikan akan maju dan berkualitas jka guru bermartabat, profesional dan sejahtera. Hal itu dikemukakanWalikota Binjai dibacakan Sekdako Iqbal Pulungan pada peringatan Hari Guru nasional dan HUT PGRI ke 65 di GOR Selasa( 21/12). Sekdako Iqbal Pulungan pada peringatan Hari Guru dan HUT PGRI menyerahkan penghargaan kepada guru berprestasi dan guru yang memasuki purna bhakti.Walikota juga mengajak para gurumeningkatkanduniapendidikandankualitasgurudanmenjaga kode etik guru. (a03)

Polsek Binjai Timur Ringkus Jurtul Judi Togas BINJAI (Waspada) : Polsek Binjai Timur, Rabu (23/12) pukul 22:00 meringkus RB, (34) Jurtul Judi Togas, warga jalan DrWahidin, Kelurahan Sumber Mulyo Rejo, Kecamatan BinjaiTimur, tersangka diringkus petugas ketika malam itu menunggu pembeli tebakan judi untung-untungan yang tidak jauh dari rumahnya. Guna pengusutan selanjutnya tersangka bersama barang bukti uang sebanyak Rp 200.000 diduga uang tebakan pemasang dan kertas rekapan tebakan dan jumlah uang pasangan serta alat judi lainnya diamankan dibalik terali besi rumah tahanan Polsek Binjai Timur, sebelum berkas perkaranya dilimpahkan ke Jaksa Penuntut Umum (JPU). Kapolres Binjai, AKBP Dra Rina Sari Ginting melalui Kapolsek Binjai Timur AKP Ismui ketika dikonfirmasi seputar diringkusnya Jurtul (Juru Tulis ) judi Togas membenarkan. Menurut Kapolsek tersangka dijerat dengan pasal perjudian 303 subs 303 bis KUH PIdana ancaman hukuman di atas 5 tahun penjara ujarnya. (a04)

BKP DS Sosialisasikan Proksi Desa Mapan LUBUK PAKAM (Waspada) : Desa merupakan penyokong ketahananpangankarenadesaadalahlumbung-lumbungpertanian yang mengintensipkan pemberdayaan untuk meningkatkan kapasitas dan kemandirian masyarakat serta menjalin kemitraan dengan stake holder untuk bersama-sama meningkatkan kemandirian masyarakat dalam mewujudkan ketahanan pangan. HalitudikemukakanKepalaBadanKetahananPangan(Ka.BKP) Kab.Deliserdang Murtiani Pane, S.Sos, pada sosialisasi program aksi desa mandiri pangan (Proksi Desa Mapan) di Gedung Serbaguna PKK Deliserdang di Lubuk Pakam, Selasa (21/12). Menurut Murtiani, pemerintah melalui Badan Ketahanan Pangan Kementerian Pertanian sejak 2006 telah meluncurkan Proksi Desa Mapan. Namun Deliserdang kegiatan baru dilakukan pada akhir 2009. (a05)

Waspada/Abdul Hakim

TINJAU POS: Kapoldasu Irjen Pol Oegroseno berkunjung ke Kab. Langkat memantau Pos Pengamanan Natal Dan Tahun Baru di Jalinsum Sei Karang Stabat, Jumat (24/12). Dalam kunjungan singkat itu Kapoldasu bersama rombongan yang mengendarai motor gede menyempatkan shalat Jumat di Masjid Darussalam lingkungan Mapolres Langkat sebelum bertolak ke Medan. Sementara Polres Langkat menyiagakan hampir seluruh kekuatan personil untuk pengamanan Natal dan menyambut Tahun Baru 2011.

Kabupaten/Kota Harus Siapkan Anggaran Penanggulangan AIDS MEDAN (Waspada): Kabupaten/kota yang ada di Sumatera diharapkan menyiapkan anggaran penanggulangan Human Immunodeficiency Virus/ Aquired Immuno Deficiency Syndrome (HIV/AIDS) melalui Komisi Penanggulangan AIDS (KPA) di daerah masing-masing. Pasalnya, penanggulangan HIV/AIDS merupakan tanggungjawab bersama dan harus melibatkan pemerintah kabupaten/kota.

“Penderita AIDS jangan disingkirkan, tetapi penyakitnya yang harus ditanggulangi,” kata Ketua Pelaksana Harian KPA Provinsi Sumut Ibnu Saud saat membuka rapat kordinasi KPA Sumut dengan KPA kabupaten/ kota, Bappeda, Dinas Kesehatan dan instansi terkait lainnya, di Medan, baru-baru ini. Sementara itu, Kadis KesehatanSumutdr.CandraSyafei,SpOG melalui Project Officer Global Fund Komponen AIDS Andi Ilham Lubis memaparkan sejak pertama kali dilaporkan pada 1987, kasus HIV/AIDS di Indonesia terus meningkat. Hingga September 2010 tercatat sebanyak 22.726 kasus HIV/AIDS dengan faktor risiko terbesar Heteroseksual 51,3 persen, pengguna

dan anak-anak yakni usia di bawah1tahunsebanyak21orang, usia 1-4 tahun sebanyak 42 orang dan usia 15-19 tahun sebanyak 346 orang. Beberapa kebijakan penanggulangan HIV/AIDS, lanjut Andi,memutusmatarantaipenularan dengan upaya pencegahan dan memberi penyuluhan kepada remaja, integrasi pelayanan dalam sistem kesehatan nasional, serta peningkatan jangkauan pelayanan yang bermutu dan berkualitas. “Sedangkan prioritasnya antara lain peningkatan testing dan konseling HIV, pencegahan HIV secara maksimal, percepatan upaya peningkatan pengobatan, penguatan sistem kesehatan dan investasi strategi informasi,” ujar Andi. (m25)

USU Beri Penjelasan Ke Pemkab DS LUBUK PAKAM (Waspada): Bupati Deliserdang Drs H Amri Tambunan berdasarkan pengumuman nomor 811/7292 tanggal 23 Desember 2010 menetapkan kelulusan seorang pelamar CNPSD formasi jabatan guru PPKN SMP di Deliserdang yang pengumumannya sempat ditunda. Ditetapkannya kelulusan pelamar CPNSD untuk formasi jabatan guru PPKN SMP atas nama Dina Malahayi dengan nomor ujian 181800018 setelah bupati Deliserdang Drs H Amri Tambunan melalui suratnya no-

mor 80/7258 tanggal 22 Desember2010memintapenjelasandari USU atas adanya perbedaan nomorujianpadadaftarperingkat hasil ujian dengan data fisik LJK (lembar jawaban komputer) hasil ujian atas nama Dina Malahayati formasi jabatan guru PPKN SMP di Deliserdang. Berdasarkan surat permintaan bupati Deliserdang, pihak USU sebagai mitra dalam proses penerimaan CPNSD di Pemkab Deliserdang Tahun 2010 melalui suratnya nomor 8018/H5.1.R4/ 010 tanggal 23-12-2010 ditanda tangani Pembantu Rektor IV Prof

Dr Ningrum Natasya Sirait SH,MLI atas nama Rektor USU menjelaskan bahwa berdasarkan verifikasi terhadap data yang bersangkutan dan LJK hasil ujian Sdri Dina Malahayati menempati rangking 3 (tiga) dengan nomor ujian sebenarnya adalah 181800018. Berdasarkan penjelasan dari pihak USU, Pemkab Deliserdang menetapkan kelulusan Dina Malahayatiyangsempattertunda sesuai dengan surat keputusan Bupati Deliserdang nomor 1131 Tahun 2010 tanggal; 23-12-2010 dan diumumkan dengan peng-

TEBINGTINGGI (Waspada): Taman bacaan masyarakat “Pelita Hati” Kota Tebingtinggi,melaksanakan kegiatan duskusi buku keagamaan bagi jamaah masjid serta lomba mewarnai bagi siswa TK dan SD. Pelaksanaan itu, untuk menarik minat masyarakat membaca dan datang ke TBM. Diskusi buku keagamaan, dilaksanakan, Jumat (24/12), ba’da shalat Jumat bersama jamaah Masjid Al Muthmainnah dan masyarakat di sekitar TBM. Sedangkan keesokan harinya dilaksanakan kegiatan lomba mewarnai, kata pengelola TBM “Pelita Hati” Hermanto. Dalam diskusi buku keagamaan, dipandu Ketua TBM “Pelita Hati” Drs Abdul Khalik, MAP, selama ini pemahaman keagamaan di kalangan masyarakat masih pada tahap pengetahuan dasar. Masyarakat, belum terlihat bergairah menimba ilmu agama melalui bahan bacaan. Salah satu sebabnya, karena belum adanya budaya membaca atau karena kesibukan rutinitas sehari-hari. “Membaca itu memang harus dibiasakan, kalau tidak susah melakukannya,” ujar peserta Abdurrahman. Sedangkan Usman Hasibuan, mengatakan keberadaan TBM di kelurahan cukup bagus untuk mendekatkan masyarakat dengan buku-buku keagamaan. “Mungkin di Tebingtinggi ini, baru TBM Pelita Hati yang ada,” ujar dia. Tokoh agama di Kel. Deblod Sundoro itu, berharap untuk menumbuhkan minat keagamaan perlu dilakukan diskusi buku keagamaan secara berkesinambungan. Sedangkan Ketua TBM “Pelita Hati” berharap kiranya masyarakat di sekitar TBM bisa memulai gerakan “Stop Hidupkan Televisi Saat Jam Belajar.” Gerakan itu, harap Khalik, bisa dimulai dari rumah setiap jamaah masjid. Teknisnya, dalam rentang waktu antara shalat Maghrib dan Isya diberlakukan larangan menghidupkan televisi dan menganjurkan anak untuk membaca atau belajar. “Gerakan ini kita harapkan bisa memicu munculnya kesadaran membaca,” ujar Khalik. Saat ini, TBM “Pelita Hati” beralamat di Lk.01, Kel. Deblod Sundoro, Kec. Padang Hilir, memiliki koleksi buku mencapai 1.200 judul dari berbagai disiplin ilmu. Buku-buku itu merupakan bantuan Pemerintah Pusat, Pemprovsu dan Pemko Tebingtinggi serta dari pengadaan mandiri. (a08)

umuman nomor 811/7292 tanggal 23 Desember 2010 ditanda tangani Sekdakab Deliserdang Drs H Azwar.S.MSi atas nama Bupati Deliserdang Drs H Amri Tambunan. Kepala BKD Deliserdang Sahnan SH didampingi Kabid Pengadaan dan Mutasi Pegawai HJoniRitawan,S.SosdanKasubid Pengadaan Pegawai Drs Sahrul, MPd membenarkan diumumkannya kelulusan seorang pelamar CPNSD yang sempat tertunda setelah pihak USU memberi penjelasan.(a05)

Wagubsu Serahkan Anugrah Raskin Award Ke Tanjungbalai

PNPM-MP Percepat Tanggulangi Kemiskinan LUBUK PAKAM (Waspada): Program Nasional Pemberdayaan Masyarakat Mandiri Perdesaan (PNPM-MP) di Kab. Deliserdang diyakini berjalan baik dan mampu memberikan kontribusi besar bagi upaya percepatan penanggulangan kemiskinan. Hal itu dikemukakan Wakil Bupati Deliserdang H Zainuddin Mars pada seminar lokakarya PNPM-MP Tahun Anggaran 2010 di Aula Cendana Kantor Bupati Deliserdang di Lubuk Pakam, Selasa (21/12) yang dihadiri Kaban Pemberdayaan Masyarakat dan Pemdes Pemprovsu Drs H Rusli Abdullah. Wabup menjelaskan, sejak 2003 hingga 2010 penyerapan anggaran melalui PNPM-MP di daerah ini mencapai Rp74 miliar lebih yangantaralaindigunakanuntukpembangunansektorinfrastruktur perdesaan, pendidikan, kesehatan dan penguatan ekonomi masyarakat melalui kegiatan simpan pinjam kelompok perempuan. Sementara Kaban Pemberdayaan Masyarakat dan Pemdes Pemprovsu mengatakan kondisi kemiskinan dan pengangguran di Sumut harus segera ditanggulangi dengan memberikan kepercayaan sekaligus mendelegasikan kewenangan kepada masyarakat untuk merencanakan, melaksanakan, mengawasi dan memelihara hasil-hasil pembangunan dengan mengulirkan program PNPMMP. Dijelaskan,penduduk miskin di Sumut berjumlah 1.499.700 jiwa termasuk di Deliserdang yang saat ini berjumlah 45.504 orang dengan penurunan berkisar 3.185 orang per tahun.(a05)

narkotik suntik 39,6 persen, Lelaki Suka Lelaki (LSL) 3,1 persen dan Perinatal (penularan dari ibu ke bayi)sebesar2,6persen. “Umumnya kasus tersebut dominan berada di kota-kota besar seperti Medan,” ujarnya. Andi menjelaskan, 8 persen dari kasus berada pada usia 2029 tahun, 31 persen berusia 3039 tahun dan 9,2 persen pada usia 40-49 tahun. Karena itu, diperlukan pengetahuan tentang kesehatan yang dimulai sejak anak duduk di bangku kelas 6 Sekolah Dasar. Di Sumatera Utara, dilaporkan sebanyak 3310 kasus HIV/ AIDS dengan rata-rata 70-90 kasus baru ditemukan setiap bulan. Bahkan, kasus HIV/AIDS telah menjangkiti kelompok bayi

TBM Pelita Hati T. Tinggi Diskusi Buku Keagamaan

Waspada/Rahmad F Siregar

RASKIN AWARD: Wagubsu Gatot Pujo Nugroho,ST menyerahkan anugrah piagam penghargaan Raskin Award kepada Pemko Tanjungbalai. Program Raskin Madani di Tanjungbalai berjalan sejak (mantan)Walikota dr H Sutrisno Hadi,SpOG pada 2007 sampai sekarang.

TANJUNGBALAI (Waspada): Wagubsu Gatot Pujo Nugroho,ST menyerahkan anugrah piagam penghargaan Raskin Award kepada Pemko Tanjungbalai di aula kantor Walikota, Kamis (23/12) sore. Anugrah Raskin Award ini peringkat pertama diraih Kota Tanjungbalai, disusul Kab. Nias, dan Kota Medan. Untuk juara harapan I jatuh ke tangan Kab. Tapsel, diikuti Kab. Labuhanbatu dan Simalungun. MenurutWagubsu, anugrah itu pertama kali di Sumut, dan program Raskin sejalan dengan cita-cita Sumut maju, mandiri dan sejahtera, serta rakyat tidak lapar, tidak sakit dan tidak bodoh. KhususbagiTanjungbalai,Wagubsu mengingatkan untuk meningkatkan program Raskin Madani. “ Lebih sulit mempertahankan daripada meraihnya. Jadi Tanjungbalai harus lebih menggiatkan program Raskin Madani ini,” pesan Wagubsu. Sementara, Kordinator Tim Raskin Sumut Ir H Djaili Azwar menjelaskan, anugrah Raskin Award merupakan reward dari Pemprovsu kepada Pemda yang berhasil menjalankan program

raskin. Kata Asisten Ekbangsos Pemprovsu itu, kriteria penilaian anugrah Raskin Award ini, pertama keseriusan Pemda menjalankan Raskin dengan mengalokasikan dana APBD. Dan, kriteria itu hanya dipenuhi oleh Pemko Tanjungbalai. Penilaian kedua, lanjut Djaili, pembayaran lancar atau cash and carry. “ Harapan kami, 32 kab/kota di Sumut mengikuti langkahTanjungbalaiyangmengalokasikan sebagian APBD untuk menyalurkan Raskin Madani,” harap Djaili. Program Raskin Madani dilaksanakandiKotaTanjungbalai sejak (mantan) Walikota dr H Sutrisno Hadi,SpOG padaTahun Anggaran 2007 sampai sekarang. Program ini dilaksanakan untuk mendukung program Raskin Pusat dengan tujuan memenuhi kebutuhan pokok warga tidak mampu dan peningkatan penanggulangan kemiskinan. Hadir pada penyerahan anugrah Raskin Award itu, Kepala Sub Divisi Bulog, anggota DPRD Tanjungbalai, para Kadis, Kaban, Kakan dan Kabag serta penjabat Walikota Tanjungbalai. (a37)

Waspada/Edi Saputra

BERKELIARAN: Pengguna jalan tampak menghindari seekor babi yang berkeliaran di Dusun II, Desa Sialang Buah, Kec.Teluk Mengkudu menuju lokasi objek wisata pantai Sialang Buah. Foto direkam, Kamis (23/12).

Ternak Babi Berkeliaran Di Lokasi Menuju Objek Wisata TELUK MENGKUDU (Waspada) : Ternak babi berkeliaran di jalan menuju objek wisata pantai Indah Sialang Buah tepatnya di Dusun II, Desa Sialang Buah, Kec. Teluk Mengkudu, Kab. Serdang Bedagai. Hal ini menjadi pemandangan bagi para pengunjung lokasi itu . Pemandangan seperti itu terjadi sudah bertahun-tahun ternak babi berkeliaran di jalan, akibat pemilik ternak tidak mengandangkan ternak-ternak mereka. Pantauan Waspada, Kamis (23/12) sore warga yang melintas terlihat sedikit takut, pasalnya babi bebas berkeliaran di jalan, sehingga warga yang akan melitas terlihat mengangkat kakinya ketika melintas di daerah itu. “ Ketika melintasi jalan ini, kami takut dan risih setiap melintas di daerah ini, karena ternak babi selalu berkeliaran di jalan, padahal jalan ini jalan umum, tapi pemiliknya tidak mengurung ternakternak itu,” ujar Marni warga Desa Bogak. Hal itu berimbas ke pengunjung yang akandatang ke lokasi objek wisata Pantai Indah Sialang Buah terus berkurang bahkan pengunjung pantai hampir tidak ada, padahal dulu Pantai Sialang Buah salah satu objek terindah, keluh seorang pengelola pantai. Sementara itu Kasatpol-PP Sergai Drs Purba Siregar pada wartawan mengatakan, pihaknya akan menunggu laporan dari warga dan pihak kecamatan.’’ Apabila diminta maka pihak kami akan turun melakukan penertiban, sebab selama ini belum ada laporannya, ‘’ ujarnya. (ces)


B2

Sumatera Utara

RANTAUPRAPAT (Waspada): Bupati Labuhanbatu dr H TigorPanusunanSiregaryangdiwakiliSekretarisDaerahKabupaten (Sekdakab) H Hasban Ritonga meminta agar aparat pemerintahan jangan mempermainkan hak orang miskin. “Beras miskin adalah hak orang miskin. Sangat tidak manusiawi raskin disampaikan kepada yang tidak berhak,” ujar Sekdakab saat Penganugerahan Piagam Penghargaan Raskin Award kepada Bupati L.Batu sebagai Juara Harapan II oleh Tim Koordinasi Raskin Sumatera Utara, Kamis (23/12) di Ruang Data dan Karya Kantor Bupati setempat. Sementara penyaluran raskin tahun 2010 di L.Batu disalurkan kepada 20.411 KK rumah tangga sasaran/rumah tangga miskin (RTS/RTM) yang dialokasikan dari Januari hingga Oktober 2010 masing-masing 306.165 kg (306.165 ton) dengan volume per RTS 15 kg per bulan. Sedangkan untuk November dialokasikan 408.220 kg (408.220 ton) dengan volume 20 kg per RTS. Total raskin yang disalurkan kepada 20.411 RTS selama tahun 2010 berjumlah 3.469.870 kg (3.469,87 ton). (a27)

TANJUNGBALAI (Waspada) : Anggota Polsek Tanjungbalai Utara meringkus seorang pemakai shabu berikut pengedarnya. Informasi dihimpun menyebutkan, tersangka FP, 24, warga Jalan Family, Lingk. I, Kel. Sirantau, Kec. Datukbandar diringkus di Jalan Alteri diduga sebagai pemakai tengah membawa narkotika jenis shabu saat mengendarai sepeda motor jenis Honda Supra Fit No.Pol BK 4423 OB, Rabu (21/12), selanjutnya digelandang menuju Mapolsek. Selang 1 jam, setelah dilakukan pengembangan terhadap FP, petugas langsung meringkus pengedar Mukh, 31, warga Jalan Burhanuddin, Lingk. III, Kel. Perjuangan, Kec. Teluknibung dari rumahnya. Namun, tersangka sempat membuang 6 paket kecil shabu ke parit belakang rumah saat mengetahui kedatangan petugas. Dari tangan FP diamankan 1 paket platik kecil berisi shabushabu berat kotor 0,12 gram berikut sepeda motor Honda Supra Fit No.Pol. BK 4423 OB. Sedangkan dari tersangka pengedar diamankan 6 bungkus paket kecil shabu dengan berat kotor 6,4 gram, 2 batang sendok shabu terbuat dari pipet plastik, 1 unit timbangan elektrik merk constant, 1 buah dompet, 2 lembar plastik klip dan HP Nokia type 1112 warna hitam. (crs)

Pencandu Narkoba Pembohong Nomor Satu KISARAN (Waspada): Pecandu narkoba untuk mendapatkan keinginannya menjadi pembohong nomor satu di dunia, hal itu perlu diantisipasi dengan memperhatikan pola hidup remaja oleh orangtua dan tenaga didik. Hal itu dikemukakan Staf Ahli Badan Narkotika (BNK) Medan ZulkarnaenNasutiondalamPendidikandanPelatihanPencegahan Pemberantasan Penyalahgunaan dan Peredaran Gelap Narkoba (P4N) kepada Kepala Sekolah dan Guru Bimbingan Conseling se-Kabupaten Asahan yang dilakukan BNK Kabupaten Asahan, di Aula Melati Kantor Bupati, Kamis (23/12). Diamenegaskan,selainsifatpembohongitu,dibarengidengan sifat mencuri, untuk mendapatkan uang, sehingga pengguna narkoba selalu nekat melakukannya meskipun bahaya mengancamnya hanya untuk mendapatkan benda haram itu. Kemudian sifat yang cenderung ditimbulkan, sering termenung dan menyendiri (melamun), karena selalu berhalusinasi sesuatu yang tidak mungkin terjadi. Kalakhar BNK Asahan AKBP Zahara mengatakan, bila anak divonis pencandu narkoba, orangtua diharapkan bersikap tenang dengan mengendalikan emosi, hindarkan ketersinggungan atau merasa bersalah, karena tindakan itu tidak ada manfaatnya. Namun dewasalah berfikir dan hadapi kenyataan, melakukan dialog terbuka dengan anak saat dia tidak di bawah pengaruh narkoba.(csap)

Reformasi Peradilan Harus Dilanjutkan RANTAUPRAPAT (Waspada): Reformasi peradilan di Indonesia khususnya di Sumatera Utara (Sumut) harus terus dilanjutkan karena merupakan tuntutan reformasi untuk memulihkan kepercayaan masyarakat. Ketua Pengadilan Tinggi Sumut H Rivai Rasyad menegaskan itu saat silaturahmi dengan Bupati Labuhanbatu, unsur Muspida dan masyarakat di Pendopo Rantauprapat, Rabu (23/12) malam. Dikatakan Rivai Rasyad, sejak 2001 Mahmakah Agung mulai mereformasi diri untuk menjawab aspirasi masyarakat tentang peradilan yang memihak kepada keadilan. Setelah reformasi itu, para hakim tidak lagi alergi dengan kritik dari masyarakat. Menurutnya, memulihkan kembali kepercayaan masyarakat kepada peradilan khususnya para hakim tidak semudah membalik telapak tangan. Namun, pekerjaan membenahi internal kehakiman tidak boleh berhenti karena arus besar reformasi memang menginginkan para hakim adalah pemutus perkara yang adil dan bijaksana. (a27)

Polres Tanjungbalai Tangkap Penulis Togel TANJUNGBALAI (Waspada) : Satreskrim PolresTanjungbalai meringkus seorang penulis togel dengan modus menggunakan telefon selular. Informasi dihimpun menyebutkan, tersangka AH, 47, Jalan Wira Karya, Lingk. I, Kel. Kisaran Timur, Kab. Asahan, tertangkap tangan saat melakukan transaksi melalui telefon selular di Jalan Mesjid, Kel. Pulosimardan, Kec. Datukbandar Timur, Kota Tanjungbalai, Kamis (23/12) sekira pukul 13:00. Tersangka kemudian digelandang menuju Mapolres Tanjungbalai untuk mempertanggungjawabkan perbuatannya berikut barang bukti berupa, uang tunai Rp 92.000, 1 batang pulpen, dan 1 unit telefon selular jenis Nokia. KapolresTanjungbalai AKBP Puja Laksana melalui Kasubbag Humas Iptu Yani Sinulinga membenarkan. Dikatakan, Polres Tanjungbalai komitmen untuk memberantas segala bentuk perjudian sampai tuntas. (crs)

Polres L. Batu Kerahkan 2/3 Kekuatan Amankan Natal Dan Tahun Baru RANTAUPRAPAT (Waspada): Polres Labuhanbatu kerahkan sebanyak 2/3 dari 624 seluruh kekuatan personil, untuk pengamanan Perayaan Natal danTahun baru 2011 yang akan ditempat di Gereja-gereja dan Jalan Lintas Sumatera. “ Sebanyak 2/3 dari 624 personil akan dikerahkan untuk PAM Perayaan Natal dan Tahun Baru 2011 termasuk Pos PAM Jalinsum dan Gereja, sesuai dengan pola Operasional PAM,” jelas Kapolres Labuhanbatu AKBP Roberts Kennedy SIK, SH,M.Hum kepada Waspada, Kamis (23/12) usai Gelar Apel Operasi Lilin Toba 2010 di halaman Mapolres setempat. Kasat Lantas Polres Labuhanbatu AKPTriyadi SIK,SH kepada Waspada menjelaskan, pihaknya telah mendirikan 9 Pos Pam untuk mendukung pengamanan lalulintas terhitung sejak 24 Desember 2010 hingga 2 Januari 2011 yakni, 5 Pos Pengamanan, 2 Pos Simpatik dan 2 Pos Pantau. Dari 5 Pos Pam yakni berada di Aek Kanopan, Aek Natas, Kotapinang, Cikampak dan Langgapayung. 2 Pos Simpatik yakni, Stasiun Kereta Api dan Aek Nabara, serta 2 Pos Pantau yakni, di Berangir Kecamatan Na-IX-X dan Pekan Tolan. (a26)

Sabtu 25 Desember 2010

Polres Asahan Masih Memburu Kawanan Pencuri Di Pulau Jawa

Jangan Permainkan Hak Orang Miskin

Polsek TBU Ringkus Pengedar Shabu

WASPADA

KISARAN (Waspada): Polres Asahan masih memburu kawanan pencuri di pulau jawa, sedangkan salah satu diantaranya sudah diamankan. Kapolres Asahan AKBP J Didiek Dwi Priantono, melalui Kasat Reskrim, AKP Yoris MY, dikonfirmasi Waspada, melalui saluran telefon, Jumat (24/12), pengejaran hingga Pulau Jawa itudilakukandengantertangkapnyasatudiantara kawanan pencuri di Jatiwaringin, Pondok Gede, Bekasi Jawa Barat, Kamis (23/12). Dia diamankan karena terbukti terlibat dalam pencurian PT Intan Kisaran, Kecamatan Airjoman dengan melarikan uang tunai sebanyak Rp 65 juta beberapa waktu lalu, sementara kawanan lainnya masih dalam pengejaran. “Kitamasihpengejaran,karenaadatersangka

Waspada/Nurkarim Nehe

KUNJUNGI AL MUSLIM: PR I Universitas Asahan Ir Anshoruddin MM melepas rombongan mahasiswa UNA Kisaran ke Universitas Al Muslim Bireuen Jumat (24/12) dipimpin PR II Drs HM.Saleh Malawat MMA dalam misi study banding dan silaturahmi sampai Minggu (26/12)

PDAM Tirta Kualo T. Balai Utang Rp 5,1 M TANJUNGBALAI (Waspada) : Perusahaan Daerah Air Minum (PDAM) Tirta Kualo Kota Tanjungbalai terbelit utang sebesar Rp 5,1 miliar. “ Kondisi PDAM Tirta Kualo hancur total, utang kepada rekanan Rp 2,3 miliar dan utang luar negeri untuk pembangunan WaterTreatment Plant II atau instalasi pengolahan air bersih pada 2003 senilai Rp 2,8 miliar dan sudah jatuh tempo,” kata Direktur PDAM Tirta Kualo Ismed Daulay melalui Kabag Hubungan Langganan Mukmin Mulyadi dan Kabag Umum Keuangan Herianto pada temu pers kemarin. Turut hadir di sana, Kabag Teknik Syarifuddin, Kasubbag

Distribusi dan Transmisi Ahmad Kasim Lubis serta Kasubbag Umum Syafrida Dewi. Selain terbelit utang, lanjut mereka, PDAM itu juga memiliki piutang atau tunggakan pelanggan sebesar Rp 3,061 miliar. “ Sejak pergantian Direktur dari Segaryono ke Ismed Daulay, yang tertagih baru Rp 300 juta,” jelas mereka. Oleh sebab itu, menurut Mukmin dan Herianto, masa kepemimpinanIsmedDaulayini, program prioritas 2010 hanya perbaikan internal yang meliputi keuangan, dan disiplin pegawai. Baru selanjutnya pada 2011, perbaikan eksternal dengan program kinerja perwilayah. Maksudnya,perbaikanpertama diarahkan di satu kecamatan, seperti masalah jaringan atau pencurian meteran air. Jika satu

kecamatan masalahnya sudah rampung, baru berpindah ke kecamatan lain. Menyangkut distribusi air bersih, Mukmin dan Herianto mengakui kapasitas air PDAMTirta Kualo hanya 205 liter per detik ditambah sumur bor. Sementara jumlah pelanggan mencapai 18 ribu. “ Idealnya, untuk melayani 18 ribu pelanggan, kapasitas air harus 300 liter perdetik,” jelas mereka. Maka itu, lanjutnya, PDAM berencana melanjutkan kembali pembangunan WTP III yang terhenti akibat pelanggaran hukum. Untuk kelanjutan pembangunanWTP III, kata mereka, dibutuhkan dana sebesar Rp 6 miliar. “ Jika ini terealisasi, distribusi air bersih tidak ada masalah lagi,” kata mereka. (a37)

Pemakaian Mobil Plat Merah Di Labusel Disalahgunakan KOTAPINANG (Waspada): Selaindigunakanuntukkeperluan dinas, mobil inventaris milik Pemkab Labuhanbatu Selatan (Labusel)ternyatajugadigunakan untuk keperluan lain, yakni jalanjalan pergi ke kafe. Mobil plat merah itu digunakan famili dan kerabat dari pemegang mobil dinas sebenarnya. Pantauan Waspada, Rabu (22/12) sekira pukul 21:37, dua unit mobil DaihatsuTerios warna hitam plat merah milik Pemkab Labusel, yang masing-masing BK 1027 Y dan BK 1021 Y parkir di halaman parkir Kafe Diva Jalan Bukit Kotapinang. Pengendara kedua mobil dinas itu pun bukan pejabat eselon Pemkab Labusel sebagai pemegang mobil plat merah, melainkan pasangan remaja yang sedang menikmati hidangan malam di tempat kafe. Dari dalam mobil bernomor polisi BK 1027Y terlihat turun lima orang penumpang pria dan wanita. Sementara mobil berplat BK 1021 Y ditumpangi dua pa-

sangremaja.Setelahselesaimereka berangkat meninggalkan kafe menuju arah simpang tiga bukit. Pemandangan serupa juga terlihat di lokasi yang sama, Senin (20/12) malam lalu. Saat itu satu unit mobil dinas Pemkab Labusel jenis Daihatsu Terios BK 1094 Y parkir di halaman kafe sekitar pukul 22:30. Mobil ditumpangi empat orang wanita dan seorang pria. Parahnya, kelimanya bukan pejabat Pemkab. Sejumlah warga yang enggan namanya disebutkan kepada Waspada mengatakan, selama ini banyak mobil dinas Pemkab Labusel digunakan di luar peruntukannya. Padahal pemberian mobil dinas bertujuan untuk membantu kelancaran tugas seorang pejabat eselon jabatan tertentu. “Selama ini banyak kendaraandinasyangleluasadigunakan bukan dalam tugas,” ungkap warga. Tergolong Korupsi Sementara itu Abdullah Hehamahua Penasehat Komisi Pemberantasan Korupsi (KPK)

dalam seminar nasional menyambut hari HAM sedunia 2010baru-baruinidiUnimedMedan mengatakan, penggunaan mobil dinas di luar peruntukan dapat digolongkan sebagai tindakan korupsi (Waspada, 17/ 12 hal-I). Menurutnya, menggunakan mobil dinas untuk kepentingan pribadi merupakan bagian dari 30 bentuk-bentuk korupsi dan merupakan tujuh di antara 21 keluarga besar korupsi yakni merugikankeuangannegara,suap menyuap, penggelapan dalam jabatan, pemerasan, perbuatan curang, serta benturan kepentingan dalam pengadaan dan gratifikasi. Perbuatan itu kata dia, selain merugikankeuangannegara,juga melanggar hak asasi manusia (HAM) yang disebabkan tidak terpenuhinya hak masyarakat. “Perbuatan mengakibatkan hakhak masyarakat terabaikan dan terzalimi bahkan menghilangkan nyawa orang lain,” katanya. (c05/ cden)

BPD Dan Masyarakat Desak Bupati Nonaktifkan Kades Pematang Panjang LIMAPULUH (Waspada): Badan Permusyawaratan Desa (BPD) Pematang Panjang, Kecamatan Limapuluh, Kab. Batuvara bersama ratusan warga desa mendesak Bupati Batubara OK Arya Zulkarnain segera merespon rekomendasi DPRD DPRD tentang penonaktifan Kades Pematang Panjang M Sanusi. Desakan itu disampaikan Ketua BPD Pematang Panjang Drs Taufik Helmi didampingi anggota Hamdan, SE dan ratusan warga Desa Pematang Panjang, Jumat (24/12). Menurut Helmi, berdasarkan hasil pertemuan BPD dengan Komisi A DPRD

Batubara dan peninjauan yang dilakukandewanbeberapawaktu lalu, DPRD telah melayangkan surat rekomendasi penonaktifan Kades Pematang Panjang M Sanusi. “Rekomendasi itu sudah disampaikan kepada Bupati pada 6 Desember lalu. Namun hingga saat ini belum ada respon dari Bupati,” kata Helmi. Anggota BPD Pematang Panjang Hamdan SE menambahkan, terbitnya rekomendasi dewan itu juga berdasarkan pengaduan BPD dan masyarakat yang menduga telah terjadi penyelewengan penggunaan Alokasi Dana Desa (ADD) 2009-

2010 senilai ratusan juta rupiah. Hamdan meminta Bupati Batubara segera memanggil Kades M Sanusi agar diperiksa dan dilakukan pengusutan. Apalagi masyarakat Desa Pematang Panjang saat ini sudah sangat gerah dengan kasus itu. “Jangan sampai kesabaran masyarakat hilang,” katanya. Kata Hamdan, masyarakat sangat berharap agar Bupati secepatnya menuntaskan masalah ini.Sebabjikatidak,kasusinidapat menimbulkanpresedentidakbaik bagi kepemimpinan OK Arya ke depan.Padaakhirnyamasyarakat nanti tak percaya lagi dengan Bupati. (a31)

Randi Dari Lahir Tidak Pernah Tersentuh Imunisasi Malang benar nasib Randi warga Dusun 1 Desa Limalaras, Kec.Tanjungtiram, Kab Batubara sering menderita sakit-sakitan dan perut terlihat membesar. Sedangkan orangtuanya sendiri tidak mengatahui secara pasti sakit diderita bocah berusia 5 tahun itu apakah terindikasi menderita gizi buruk. Ditambah lagi kecurigan itu timbul putra keduanya sejak lahir tidakpernahmendapatimunisasi sebagaimanalanyaknyadilakukan banyak orang terhadap balita maupun pengobatan medis baik melalui Posyandu maupun Puskesmas dengan alasan tidak mampu. ‘’Kita tidak ada biaya untuk membawanyaberobatmemeriksa sakit dideritanya ke medis sebab untuk makan sehari saja

sulit karena semata mengharapkan dari penghasilan suami sebagai nelayan,’’tutur Yusniar, 23 ibu kandung Randi ketika dikonfirmasi wartawan, Kamis (23/12).’’Dia (Randi) sering sakitsakitan seperti asma,’’katanya lagi Begitujugakehidupanmereka yang boleh dikatakan tergolong miskin luput dari perhatian pemerintah. Selain tidak pernah mendapatkanpelayanankesehatan sampai kepada program Imunisasi tidak mereka ketahui. ‘’Ini mencerminkan lemahnya sosialisasi dilakukan aparat terkait didesa sehingga ada warga yang tidak mengetahui.Padahal dana sosialisasi itu cukup besar dianggarkan dalam APBD. Namun realisasinya dipertanyakan,’’sebut seorang tokoh pemuda desa kepada Waspada.

Kartini, salah seorang warga desa mengaku prihatin dengan kondisi kehidupan keluarga Randi. Begitu juga dilihat dari rumah tempat tinggal mereka tidak sepenuhnya beratap bila musimhujanseringditerpabasah salah satu faktor menyebabkan Randi sakit-sakitan. Kadis Kesehatan Kab Batubara dr Surya Dharma yang dihubungi melalui telefon selular tidak mengetahui hal itu dan berjanji untuk melacaknya apakah Randi terindikasi menderita gizi buruk maupun menerima laporan dari petugas medis di desa. ‘’Saya segera mengontak petugas di desa maupun Puskesmas mempertanyakan hal ini untuk selanjutnya meninjau langsung melihat kondisi si anak,’’katanya. (a11)

lainnya yang belum tertangkap,” ungkapYoris. Oleh sebab itu, penyidikan terus dikembangkan untuk menangkap semua tersangkanya, yang kemungkinan besar masih berada di Pulau Jawa dan tidak tertutup kemungkinan mereka ada di wilayah lain. “Sedangkantersangkayangberhasildiamankan, AS, warga Jatiwaringin, Pondok Gede, Bekasi, akan dibawa ke Mapolres Asahan untuk penyelidikan lebih lanjut,” kata Yoris. MenurutYoris, keberhasilan penangkapan itu, tidak terlepas dari peran serta dari warga setempat dang kerja sama dengan polisi setempat sehingga tersangka dapat diamankan. “Kita akan tetap mengejar tersangka lainnya, yang diprediksi lebih dari satu orang, yang tersebar di berbagai tempat,” jelas Yoris. (csap)

Pekerjaan Pembangunan Jalan Di Labuhan Ruku Dipertanyakan LIMAPULUH(Waspada):Pembangunan pengerasan ruas jalan Kampung Kedah, KelurahanLabuhanRukusampaiperbatasanKampung Bajang, Desa Pahang, Kec Talawi, Kab Batubara dipertanyakan dan berpotensi korupsi terhadap penggunaan dana rakyat tersebut. ‘’Yang kita ketahui paket pekerjaan proyek berupa pengaspalan, namun trealisasi pengerasan bersumber dari Alokasi BDB (Bantuan Daerah Bawahan) APBD Tahun 2010 mencapai lebih Rp 1 miliar,’’tukas sumber Waspada, Jumat (24/12) menyikapi pekerjaan proyek tersebut. Menurutnya rekanan pemenang proyek mensubkan pekerjaan kepada rekanan daerah sampai sekarang masih berjalan dengan volume proyek sepanjang lebih kurang 2 km. ‘’Jika benar paket melalui proses cco tidak sampai mengubah jenis pekerjaan di lapangan. Kalau bentuknya pengaspalan tetap dikerjakan dan paling terjadi perubahan pada volume proyek,’’ujarnya. Setiap terjadi perubahan pada pekerjaan

proyek setidaknya diketahui oleh dewan atau Panggar (Panitia Anggaran) tidak dapat dilakukan secarasepihakoleheksekutif(DinasPUdanPertambangan)setempatkarenamenyangkutpenggunaan anggaran APBD. ‘’ DPRD selaku lembaga legislasi mempunyai wewenanguntukmelakukanevaluasisetiappekerjaan pembangunan fisik maupun non fisik baik yang sudah selesai maupun yang masih berjalan di lapangan karena sudah merupakan bagian dari tupoksi melakukan pengawasan,’’katanya. Di tempat terpisah Ketua Dewan Pakar DPC PPP Batubara, Jhon Adek mengatakan panjang ruas jalan itu sekitar 1,7 km tidak sampai 2 km sebagaimana pernah diukur mengunakan data km kenderaan sepedamotor beberapa waktu lalu . Sedangkan pekerjaan baru dimulai dalam seminggu terakhir atau sekitar 40 % satu paket denganpembuatanturap.‘’Jikakerjacepatmungkin terselesaikan untuk mengejar akhir tahun 2010. Bagaimana mutuhnya tidak ketahui.Tahulah kalau namanya bekerja buru-buru,’’katanya. (a11)

Dua Truk Pembawa Pakaian Bekas Diamankan RANTAUPRAPAT (Waspada): Diduga tidak memiliki dokumen resmi sebagai bukti kepemilikan barang bawaanya, dua unit truk B 9437 FG dan BL 8946 AA yang mengangkut pakaian bekas impor(BarangMonza)sebanyak140baldiamankan Polres Labuhanbatu, Rabu (22/12) saat melintasdiJalinsumkawasanKecamatanTorgamba, Labusel, dari arah Dumai, Riau, menuju Medan. Informasi yang diperoleh di Mapolres, dua unit truk yang membawa pakaian bekas impor itu diamankan setelah polisi menerima informasi dari masyarakat kalau kedua truk diduga tidak memiliki dokumen sah itu akan melintasi di wilayah hukum Polres Labuhanbatu. Saat diamankan polisi, supir truk yang membawa muatan pakaian bekas import itu tidak dapat menunjukkan dokumen sah atas barang bawaanya kepada petugas. Kepada petugas, para sopir mengaku hanya disuruh membawa

pakaian bekas impor oleh pemiliknya itu menuju Medan. Kedua sopir truk B 9437 FG dan BL 8946 AA itu masing-masing, Jasman Hutagalung,40, warga, Lingkungan Tapian Nauli, Pasar IV Kecamatan Sunggal, serta Edison Nainggolan,49, wargak Jalan Masjid, Helvetia, Medan. Kapolres Labuhanbatu AKBP Roberts Kennedy SIK,SH,M.Hum melalui Kasubbag Humas Iptu MT Aritonang, SH kepada Waspada, Kamis (23/ 12)diMapolresmembenarkan,telahmengamankan duaunittrukyangmengangkutpakaianbekasimpor (Barang monza) tanpa adanya dokumen sah. Aritonang juga menambahkan, sebelumnya dua unit truk colt diesel BK 9873 YJ dan BK 8321 TF yang membawa kayu olahan tanpa ada dokumen sah dan dikemudikan DM,32, sopir, warga Dusun Bukit Sembilan, Desa Simpang Kanan, serta AA (35) sopir, warga Dusun Rawa Mulia, Desa Simpang Kanan, Riau, juga berhasil diamankan jajaran Polres Labuhanbatu.(a26/a27)

Kerusakan Komputer Masih Terjadi Di Stasiun Rantauprapat RANTAUPRAPAT(Waspada): Sasiun PT KAI Rantauprapat hingga kini belum bisa secara maksimal melayani para penumpang. Pasalnya kesalahan komputer mengakibatkan adanya virus. ‘’Bersama ini kami memohon kepada penumpang kereta api untuk datang lebih awal 30 menit sebelum keberangkatan kereta api,’’ ujar kepala stasiun (KS) PT KA Rantauprapat M Ilud Siregar kepada Waspada. Jumat (24/ 12) di Rantauprapat. Kesalahan yang terjadi di tiket para penumpang kereta api Sribilah Pagi (KA U1) yang seharusnya berangkat pukul 08:00 terjadi kesalahan cetak pada tiket penumpang kereta api pukul 08:40, Sribilah Siang (KA U3) yang seharusnya

berangkat pada pukul 14:45 terjadi kesalahan cetak pada tiket para penumpang kereta api pukul 14:00, ujar Ilud. KS PTKA Rantauprapat menambahkan Sribilah Utama (KA U5) yang seharusnya berangkat pada pukul 17:10 dan terjadi kesalahan cetak ditiket para penumpang pada pukul 17:00 dan Sribilah Malam (KA U7) keberangkatan pukul 23:00 terjadi kesalahan dalam percetakan tiket para penumpang pada pukul 23:10, kerusakan komputer yang ada di stasiun Rantauprapat sampai kerusakan komputer yang terjadi di stasiun Medan diperkirakan masih terjadi kesalahan dalam percetakan jam keberangkatan tiket kereta api sampai akhir bulan Desember 2010, untuk itu atas nama PT KA meminta maaf kepada para penumpang ujar Ilud. (c01)

Jaringan Telkomsel Di Labusel Picu Pertengkaran KOTAPINANG (Waspada): Meski pihak TelkomselRegionalSumateratelahberjanjiuntuk segera melakukan perbaikan jaringan, namun sampaikinijaringankomunikasiselulerTelkomsel di kawasan Labuhanbatu Selatan dan sekitarnya masihkacau.Bahkandampaknyatambahparah, sejumlah warga mengaku bertengkar dengan keluarganya karena kesalah pahaman. Kepada Waspada, Jumat (24/12) sejumlah pelanggan Telkomsel mengaku kecewa dengan kondisi jaringan saat ini. Berkali-kali sambungan telefon mereka terputus secara mendadak saat sedang melakukan komunikasi. Tak hanya itu, masuknya penelefon lain yang tak dikenal, kerap jadi pemicu pertengkaran rumahtangga. Yunita, 25, warga Desa Cikampak, Kecamatan Torgamba mengatakan, Senin (20/12) lalu dia ditelefon pacarnya. Namun saat hendak menjawab panggilan itu, ponselnya tiba-tiba tak berungsi. Parahnya, di tempat lain telefon sang pacar ternyata tersambung ke nomor seorang pria. Akibatnya,Yuni dan pacarnya terlibat pertengkaran mulut. “Pacar saya mengira saya sama pria lain, karena yang ngangkat seorang pria. Padahal itu bukan ponsel saya,” katanya. Muhammad Hasir, 30, warga Jalan Kampung Makmur, Kelurahan Kotapinang, Kecamatan

Kotapinang pun mengalami nasib serupa. Dia mengatakan kerap cekcok dengan istrinya, karena beberapa kali saat bertelefon suara wanita tibatibamasuk.Parahnya,sambungantelefonnyasering terputus mendadak, sehingga mengganggu komunikasinya.“Jumlahpulsadikartumasihbanyak tapi tiba-tiba pas bicara sambungan putus tibatiba,” kata ayah satu anak itu. Menurut pria yang dalam sebulan mengaku menghabiskan pulsa rata-rata Rp700 ribu itu, terputusnyasambungantelefonseringkalidibarengi dengan ponselnya yang tak berfungsi beberapa detik. Akibat kondisi itu lanjut dia, kolega bisnisnya sering marah karena mengira dirinya memutus komunikasi sepihak. “Terus-terusan seperti ini bisa hancur bisnis saya,” katanya. Warga juga mengancam akan mengadukan permasalahan kepada DPRD Labusel dan YLKI agar segera ditindak lanjuti, karena kondisi yang terjadi saat ini sangat merugikan dan meresahkan. Pihak Telkomsel yang dikonfirmasi sampai kini belum bisa memastikan apa penyebab kekacauan jaringan tersebut. Public Relation Telkomsel Regional Sumatera Henny Purweni mengatakan pihaknya masih menindaklanjuti masalahitu.“Kamimasihmenindaklanjutimasalah ini,” katanya. (cden)

KTP Gratis Di Batubara Masih Terkendala T.TIRAM (Waspada): Ribuan warga lanjut usia (Lansia) di Kabupaten Batubara bersabar memperoleh KTP/KK , gratis’ yang dicanangkan Bupati Batubara H OK Arya Zulkarnain, SH.MM MenurutwargalansiadiTanjungtiram,Jumat (24/12) untuk Desa Bagan dalam sudah siap semua persyaratan, foto, formulir sebanyak 356 orang. Bahkan aparat desa sudah mengurusnya ke Dinas Capil di Bulan-bulan tetapi ditolak dengan alasan dana untuk KTP gratis belum dianggarkan di APBD Batubara Sayangnya, kata mereka tidak jelas dari dana anggaran mana, PAPBD 20 10 atau harus menu-

nggu anggaran APBD tahun 2011. Awalnya para lansia merasa yakin dapat KTP/ KK gratis karena sebelumnya Bupati OK Arya sudah menyerahkan secara simbolis kepada seorang lansia di Dinas Sosial Batubara di Perupuk beberapa bulan lalu Karena itu pihak kecamatan maupun desa mempersiapkannya, ternyata ditolak di Capil alasan dananya belum cair Kadiscapil Batubara Syarifuddin dihubungi via ponselnya, Jumat (24/12) untuk mendapat penjelasansekitarkendalapalayananKTP/KK‘gratis’ lansia tidak berhasil HP nya tak aktif (a30)


WASPADA Sabtu 25 Desember 2010

Rumah Di Jalan Horas Sibolga Terbakar SIBOLGA (Waspada) : Rumah milik Mukti di Jalan Horas Sibolga terbakar, Rabu (22/12) siang. Tidak ada korban jiwa dilaporkan akibat kebakaran tersebut, namun kerugian materi diperkirakan mencapai ratusan juta rupiah. Informasi yang diperoleh di lokasi kebakaran menjelaskan, rumah yang sekaligus memiliki usaha home industri pembuatan roti tersebut terbakar diduga akibat hubungan arus pendek listrik. Kobaran api semula terlihat dari arah teras rumah dengan gumpalan asap yang membumbung tinggi dan warga sekitar yang melintas berteriak dan berusaha memadamkan api. Hitungan jam kobaran api berhasil dipadamkan, namun bagian teras rumah hingga ruang tamu hangus terbakar dan sejumlah perabotan rumah tangga termasuk peralatan home industri turut terbakar. (a34)

Tulis Judi Kim Ditangkap P. SIANTAR (Waspada): EM, 42, warga Huta IV, Nagori Talun Rejo, menulis angka-angka tebakan judi Kim, sejenis judi toto gelap (togel) hingga ditangkap pihak Polsek Perdagangan, Polres Simalungun. Keterangan dihimpun menyebutkan, EM ditangkap saat menulis angka-angka tebakan judi Kim di kediamannya di Huta IV, Nagori Talun Rejo, Kecamatan Bandar, Simalungun, Rabu (22/12). Penangkapan terhadap EM dilakukan sesudah pihak Polsek Perdagangan mendapat informasi dari masyarakat yang merasa resah dengan perbuatan EM. Informasi itu ditindaklanjuti pihak PolsekPerdagangandenganmelakukanpenyelidikandanpenangkapan terhadap EM. (a14)

Polres Pakpak Bharat Apel Gelar Pasukan Operasi Lilin 2010 SALAK (Waspada): Kepolisian Resort (polres) Pakpak Bharat gelar pasukan operasi lilin 2010, Kamis (23/12) bertempat di halaman mako (markas komando) Polres setempat. Bertindak selaku inspektur upacara AKBP Suriadi Bahar (Kapolres Pakpak Bharat) dan komandan upacara Iptu Ruslan (Kasubbag Bin OPS). Beberapa pamen (perwira menengah) serta segenap unsur kepolisian Pakpak Bharat dan Koramil 0208 Salak, juga turut hadir dalam acara itu. Dalam amanat Kapolri pada apel gelar pasukan operasi lilin 2010 yang dibacakan AKBP Suriadi Bahar mengatakan, acara ini bertujuan untuk mengetahui kesiapan tugas operasi, baik dari aspek personel, materil, sarana komunikasi dan sarana mobilitas lainnya termasuk pelibatan komponen masyarakat, sehingga terdapat sinergitas antar aparat keamanan dan segenap potensi masyarakat. Kapolres AKBP Suriadi Bahar kepada Bupati Pakpak Bharat menekankan,pihaknyapadaoperasililin2010akanlebihmemfokuskan di Pospol Lae Ikan, Kecamatan STU Jehe dan Pospol Sukaramai, Kecamatan Kerajaan. (c08)

Pemuda Gereja Dilibatkan Amankan Natal P. SIANTAR (Waspada): Polres Pematangsiantar turut melibatkan pemuda gereja, organisasi massa (ormas) dan elemen masyarakat dalam kegiatan pengamanan perayaan Natal danTahun Baru. Mereka akan ditempatkan di gereja-gereja dan sejumlah tempat yang dijadikan lokasi untuk perayaan Natal. “Dilibatkannya beberapa elemen masyarakat itu agar sekecil apapun potensi gangguan keamanan menjelang dan selama perayaan natal dapat diantisipasi. Sejumlah personel polisi turut dikerahkan untuk mengantisipasi kemungkinan terjadinya aksi teror Natal dan malam Tahun Baru,” ujar Kapolres Pematangsiantar AKBP Alberd TB Sianipar usai memimpin apel gelar pasukan pengamanan Natal dan Tahun Baru di Markas Brimob Pematangsiantar, Kamis (23/ 12). Kasatlantas Polres Pematangsiantar AKP Hendrik Situmorang menyebutkan, guna kelancaran arus lalu lintas dan kenyamanan bagi masyarakat yang merayakan Natal, pihkanya mempersiapkan empat pos pengamanan di jalur padat. “Kami berharap keberadaan pos yang dilengkapi fasilitas kesehatan dan rute perjalanan akan membantu masyarakat merayakan Natal dengan tenang dan lancar,” kata dia. Danki 2 Den B Brimob Pematangsiantar AKP Heriyono menyebutkan, untuk menjamin keamanan malam Natal danTahun baru sudah dipersiapkan dua satuan setingkat pleton (SST).(a14)

Danrem 022/PT Tutup Geladi Lapang Intelijen P. SIANTAR (Waspada): Pangdam I/BB Mayjen TNI Leo Siegers menyebutkan, Geladi Lapang Intelijen merupakan ajang uji coba kemampuan dan keterampilan personel Satuan Intelijen Kodam I/Bukit Barisan. Danrem 022/PT Kolonel Inf Karsiyanto mewakili Pangdam I/ BB Mayjen TNI Leo Siegers membacakan amanat Pangdam I/BB itu sekaligus memimpin penutupan Geladi Lapang Satuan Intelijen tersebar jajaran Kodam I/BB di lapangan apel Makorem 022/PT, Jalan Asahan, Km 3,5, Pematangsiantar, Rabu (23/12), sebut Kapenrem Mayor CAJ Drs. Prinaldi, Kamis (23/12). MenurutPangdam,mekanismeGeladidengansegaladinamikanya merupakan miniatur dari kondisi situasi yang mungkin dihadapi dalam keadaan sesungguhnya. (a14)

Pejabat Jadi Rekanan Pengadaan Buku DAK 2010 SAMOSIR(Waspada):DidugapengadaanbukuDAKdiKabupaten Samosir tahun 2010 sebanyak 35 sekolah untuk tingkat SMP dan SD sarat KKN. Seorang oknum pejabat dituding menjadi rekanan dengan memperalat seorang rekanan, ungkap sumber kepada Waspada, Kamis (23/12). Kabag Humas Gomgom Naibaho saat dikonfirmasi Waspada, Kamis(23/12)melaluiselularmaupunSMStidakmemberikanjawaban terkait tudingan hal itu. Sesuai PP No 30 tentang disiplin PNS, seorang PNS selaku abdi negara dilarang keras mengurusi pekerjaan diluar tupoksinya.(c10)

RPJMD Samosir Titik Beratkan Pada Penetapan Kinerja Daerah SAMOSIR (Waspada) : Penyusunan RPJMD Pemkab Samosir 2010-2015 mengacu PP No 8 tahun 2008 tentang tahapan, tata cara penyusunan, pengendalian dan evaluasi pelaksanaan rencana pembangunan daerah yang menekankan arahan dalam penetapan kinerja daerah untuk 5 tahun ke depan serta indikasi rencana program prioritas, ujar Kabid Fisik dan Prasarana Bappeda Kab. Samosir Hotraja Sitanggang kepada Waspada, Kamis (23/12). Yang RPMD tahap pertama 2006-2010 penyusunannya mempedomani surat edaran Mendagri No 050/2020/SJ tentang petunjuk dokumen RPJP dan RPJM Daerah. Tahun 2011, Kabupaten Samosir memfokuskan pengembangan sektor pariwisata dimana seluruh SKPD dalam pelaksanaan program dan kegiatan merujuk kepada pembangunan berbasis pariwisata. Hingga berakhir tahun 2010, pemkab Samosir belum memiliki PerdaTata Ruang yang harus dimiliki suatu daerah dan sesuai Permen PU No.16 tahun 2009 tentang pedoman penyusunan Rencana Tata Ruang Wilayah (RTRW) Kabupaten, pemkab Samosir tahun 2011 akan merealisasikan perda RTRW. Masa berlakunya RTRW sama dengan RPJP, sedangkan RPJP masa berlakunya adalah integrasi dari 4 kali RPJMD dan RPJMD yakni intergrasi 5 kali RKPD yang menjadi dasar pembahasan KUA PPAS di setiap SKPD. (c10)

Sumatera Utara

B3

Tidak Ada Alasan Menunda Pemungutan Suara Ulang Di Madina PANYABUNGAN ( Waspada): Sekaitan dengan bergulirnya jadwal pembahasan R-APBD TA 2011, Ketua Fraksi Demokrat DPRD Kabupaten Mandailing Natal, Ir Ali Mutiara Rangkuti, mengingatkan pemerintah daerah, DPRD maupun KPUD dalam hal percepatan pemungutan suara ulang Pemilukada Madina sesuai dengan amanah putusan Mahkamah Konstitusi ( MK). “Semua pihak harus fokus dalam mempersiapkan hal tersebut. Tidak ada satupun alasan, baik alasan hukum formil, politik, maupun anggaran, untuk menunda-nunda atau memperlambatnya,”ujarnyakepadaWaspada di Panyabungan Kamis (23/12). Ali Mutiara mengatakan, sampaihariinikita belummelihat adanyaputusanhukumyangmengikat secara tegas tentang adanya perubahan akan hal itu. Jadi, sampai hari ini, semua pasangan calon masih berhak ikut serta dan masyarakat tidak perlu resah. “Hal terpenting yang harus menjadi pemikiran pemerintah dan masyarakat, adalah bagaimana menciptakan sebuah kondisiyangkondusifbagidaerah untuk menyelenggarakan pemungutan suara pada pemilukada

yang akan datang, baik dari aspek stabilitas daerah maupun anggaran,” terangnya. Khususnya mengenai anggaran,dia tegaskan bahwa tak ada harga yang pantas untuk sebuah momentum aktualisasi kedaulatan rakyat.” Untukitusayaberharapkebijakan APBD 2011 harus diarahkan untuk mempercepat pemungutansuaraPemilukada,” paparnya. Money Politics Ali mengungkapkan, tentang kemungkinan adanya lagi money politics dalam pemungutan suara ulang yang akan datang, , “Sejak awal,sebelumpemungutansuara yanglalu,sayasudahpernahsampaikan, terjadinya praktik money politics ini kerap tidak hanya berawal dari kemauan dari pasangan calon bupati/wakil bupati, namun didukung oleh masih dominannya partisipasi politik masyarakat yang tidak sehat,” lanjutnya. Untuk itu, Ketua Fraksi Demo-krat DPRD Madina itu kembali berharap agar kebijakan anggaran ke depan tidak hanya diarahkankepadapenyelenggaraan pemungutan suara, namun dengan bekerjasama dengan infrastruktur sosial yang ada, baik media maupun Lembaga Swadaya masyarakat , KPU dan pemerintah daerah dapat melakukan upaya-upaya penyehatan partisipasi publik dalam pemilukada. Sosialisasi anti money politics harus menjadi perhatian bersama.Ditempatyangberbeda,

Ridwansyah Lubis, SH, Direktur Program Peningkatan SDM dan Partisipasi Publik CSAID (Centre for Studies and Aid Information of Development), menegaskan pentingnya, sosialisasi anti money politics, tidak boleh diaktualiasikan dengan sekedar kampanye spanduk dan poster yang berisikan jargon-jargon anti moneypolitics.”Kitaharusmelihat money politics secara lebih subtantif,denganmelihatnya sebagai bentuk gerakan apatisme masyarakat secara massal terhadap pemerintahan dan pembangunan yang selama ini berjalan.” ungkapnya. Dikatakan, masyarakat akan menolak money politics selama masyarakat mengakui peran pemerintah secara efektif dalam perubahan kualitas hidup masyarakat. Dengandemikianmasyarakat tidak akan menjual hak politiknya demi lembaran uang receh, dengan mempertaruhkan masa depan hidupnya secara kolektif. “Oleh karena itu sosialisasi anti money politics ini nantinya, diharapkan dapat melibatkan banyak komponen masyarakat, dan dilakukan dalam bentuk yang lebih efektif untuk membangun kesadaran masyarakat.Dan dalam pola jangka panjang, penyadaran masyarakat ini harus aktualisasikan oleh pemerintah daerah yang akan datang, dengan tidak lagi mengabaikan berbagai bentuk aspirasi publik,” harap Ridwan. (a24)

Setelah Sempat Menolak

Pemkab Karo Terima Hasil Seleksi CPNS Dari ITB KABANJAHE (Waspada): Setelahsempatmenolak,Pemkab Karo mau menerima dokumen hasil seleksi CPNS Karo dari pihak InstitutTeknologi Bandung (ITB), Kamis(23/12)pukul15:30diruang rapat Bupati Karo Jalan Djamin Gintings Kabanjahe. Penyerahan dokumen berupa hak copy dan sebuah CD yang berisi data hasil seleksi Lembaran Jawaban Komputer (LJK) ujian CPNS Kabupaten Karo pada 15 Desemberlalu,dilakukan IrHandi Nusantara,MT staf LPPM-ITB dan diterima Kepala BKD Karo Drs Kawar Sembiring,MSc. Acara disaksikan oleh Sekdakab Karo Ir Makmur Ginting yang juga ketua panitia penerimaan CPNS Karo ,Ispektur Inspektorat Kabupaten Karo Drs Walman Pasaribu,Kasdim0205/TKMayor S.Sembiring,Kasat Intel Polres Tanah Karo AKP Hery,Asisten III Drs Ramli Sembiring, staf ahli bidang hukum Hormat Barus,

SH.

Sebelumnya Pemkab Karo, sempat menolak dokumen hasil seleksi CPNS. Karena pihak yang dipercayakan ITB membawa dokumen, tiba di Kabanjahe, Kamis (23/12) sekira pukul 00:15. Saat itu para pejabat yang berkepentingan yang ada di di kantor Bupati Karo hanya kepala BKD Drs Kawar Sembiring selaku sekretaris panitia dan sejumlah stafnya. Karenaharitelahlarutmalam dan untuk menjaga keamanan dokumen negara dan keselamatanduaorangpetugasyangdipercayakan ITB untuk mengantar dokumen,ahirnya bermalan di markasPolresTanahKarodengan diantar dua orang wartawan. Alasan pihak ITB, mereka terlambat karena kesulitan mendapatkan tiket pesawat terbang dari Jakarta ke Medan. Menurut Handi Nusantara dia bersama temannya Dedek berangkat dari

Bandung, Rabu (22/12) pukul 06:00. Karena sulitnya mendapatkan tiket sehubungan dengan liburan natal, maka pukul 20.15 Wib baru bisa berangkat dari Bandara Soekarno-Hatta menujuBandaraPoloniaMedan.Selanjutnya tiba di Kabanjahe dengan naik mobil carteran Kamis (23/ 12) dini hari sekira pkl 00:15. Seogianya,hasil ujian sudah diumumkan pada Rabu (22/12), namun karena kejadian pengumuman menjadi molor. Rencana pihak Pemkab Karo hasil ujianCPNSdiumumkandikantor Bupati Karo, Kamis malam (23/ 12)danmelaluimassmediaJumat (24/12).Namunhalitumasihmenunggu proses pemindahan data dari CD ke dokumen pengumuman dan SK Bupati Karo. Pantauan Waspada di kantor Bupati, Kamis (23/12),pukul 19:40, ratusanorangberdatangan ke kantor bupati hendak melihat pengumuman hasil ujian CPNS itu. (c06)

Umat Nasrani Dapat Bingkisan Natal Dari Fraksi Demokrat P.SIDIMPUN(Waspada):Perwakilan umat Nasrani di wilayah Kota Padangsidimpuan memperolehbingkisanHariNatal2010 dari Fraksi Demokrat di kantor DPRD Padangsidimpuan, Kamis (23/12). MenurutKetuaFraksiDemokrat DPRD Padangsidimpuan, H Khoiruddin Nasution, kegiatan itu bertujuan meningkatkan silaturahmi partai berlambang segi tiga berlian dengan umat beragama, termasuk Nasrani. “Kami Fraksi Demokrat sangat mengharapkan partisipasi dari seluruh kalangan, seperti umat Nasrani dalam memacu kemajuan pembangunan daerah kita ini,” katanya. Dijelaskan, Kota Padangsidimpuan dapat berkembang seperti saat ini tidak terlepas dari partisipasi dari seluruh kalangan masyarakat. Harus diakui, Padangsidimpuan salah satu kota yang sangat menghormati kebebasan umat beragama, bahkan antar umat beragama hidup saling berdampingan. “Tidak ada agama atau suku yang dikucilkan. Semuanya sama dalam mewujudkan cita-cita kemajuan pembangunan daerah, dan pencapaian tingkat kesejahteraan masyarakat,” tuturnya. Ketua DPC Partai Demokrat Kota Padangsidimpuan, Darwin Harahap, saat menyerahkan bingkisan Natal menegaskan, sebagai partai nasionalis, Demokrat menjunjung tinggi keberagamn umat beragm di daerah itu. Partai Demokrat tidak membeda-bedakan masyarakat Padangsidimpuan. Kren itulah kader Partai Demokat berasal dari berbagai macam agama dan suku, sehingga partai ini semakin

Waspada/Sukri Falah Harahap

BINGKISAN NATAL: Ketua Fraksi Demokrat, Ketua DPC Demokrat, Ketua DPRD Padangsidimpuan juga dari Demokrat, diabadikan bersama para penerima bingkisan Natal 2010 diabadikan bersama di depan gedung DPRD, Kamis (23/12). disukai masyarakat. Terkaitpenyerahanbingkisan ini, Pendeta H Manik, 45, mengucapkan terimakasih umat Nasrani di Kota Padangsidim-puan kepada Partai Demokrat. Mereka siap bekerjasama dengan partai ini demi percepatan pembangunan daerah. Menurutnya, kaum Nasrani di Kota Padangsidimpuan sangat merasa nyaman dalam melaksanakanibadah.Karenamasyarakat yang berbilang kaum did aerah ini menjunjung tinggi nilai-nilai persaudaraan. “Saya sangat berterima kasih, meski umat kami bukan mayoritas did aerah ini, namun kami sangat nyaman untuk menjalankan ibadah,��� ujar pimpinan salah satu gereja di Kecamatan Padangsidimpuan Hutaimbaru itu. Pada kesempatan it, dia juga mengungkapkan rasa haru atas kegiatan yang dilakukan Fraksi

Demokrat tersebut. Karena penyerahan bingkisan Natal dari DPRD merupakan yang pertama kalinya mereka jalani. “Seingat saya, di Kota Padangsidimpuan, baru kali ini umat Nasrani mendapat perhatian khusus dari salah satu partai terbesardiIndonesia.Terimakasih kami kepada Fraksi Demokrat,” ujarnya. Hadirpadapenyerahanbingkisan itu, Ketua DPRD Padangsidimpuan, Azwar Syamsi Lubis, Ketua Fraksi Demokrat KhoiruddinNasution,SekretarisFraksi DemokratRikaHanumNasution, dan Ketua DPC Partai Demokrat, Darwin Harahap. Adaapunpenerimabingkisna itu adalah umat Nasrani yang mewakiliberbagaielemendiKota Padangsidimpuan, seperti TNI, Polri, tokoh agama, tokoh masyarakat, tokoh pemuda, pers, dan lainnya. (a20)

Waspada/Sukri Falah Harahap

TANAM POHON: Hj Rahmianna Delima Pulungan dan Faisal Reza Pardede (3 dan 2 kiri) diabadikan bersama para guru, staf pengajar, dan orang tua siswa SMKN 1 Sipirok usai melakukan tanam pohon bersama di lingkungan sekolah itu, Kamis (22/12).

Hj Rahmianna Tanam Pohon Di SMKN 1 Sipirok SIPIROK (Waspada): Anggota Komisi E DPRD Sumatera Utara juga istri Wakil Bupati Tapanuli Selatan, Hj Rahmianna Delima Pulungan, melakukan penanaman pohon di lingkungan SMK Negeri 1 Sipirok, Kec. Sipirok, Kab. Tapsel, Kamis (23/12). “Penghijauan merupakan salah satu kegiatan penting yang harus dilaksanakan secara konseptual dalam menangani krisis lingkungan. Begitu pentingnya sehingga penghijauan sudah merupakan program nasional yang dilaksanakan di seluruh Indonesia,” katanya sebelum menanam pohon. Menurut Nyonya Aldinz Rapolo Siregar ini, banyak fakta yang menunjukkan, tidak jarang pembangunan dibangun di atas lahan pertanian maupun ruang terbuka hijau. Seperti Saluran UdaraTegangan EkstraTinggi (SUTET) yang akan dibangun di atas lahan SMKN 1 Sipirok. Padahal, tambahnya, tumbuhan dalam ekosistem berperan sebagai produsen pertama yang mengubah energi surya menjadi energi potensial untuk makhluk lainnya. Seperti mengubah CO2 menjadi O2 dalam proses fotosintesis. Karena itulah perlu dilakukan penghijauan, sehingga dapat mengurangi CO2 atau polutan lainnya yang berperan menimbulkan terjadinya efek rumah kaca atau gangguan iklim. “Pohon berperan dalam kehidupan dan kesehatan lingkungan secara fisik, juga berperan estetika serta kesehatan jiwa. Penghijauan sangta penting untuk menangani krisis lingkungan, namun perencanaan dan penanamannyaharus secara konseptual,” ucapnya. Penanaman pohon yang digagas Naposo Nauli Bulung Napa Napa ni Sibualbuali Sipirok Sumatera Utara (NNBS Sumut) ini melibatkan seribuan pelajar SMKN 1 Sipirok, guru, dan para orangtua. Pada kesempatan itu Rahmianna menyampaikan kegiatan penghijauan ini adalah upaya untuk meminimalisir dampak dari keberadaan Saluran Udara Tegangan Ekstra Tinggi (SUTET) yang melintas di areal gedung pendidikan SMK Negeri 1 Sipirok. Sementara Ketua NNBS, Faisal Reza Pardede, menmbeberkan hasil penelitian pengaruh radiasi elektromagnetik seperti SUTET terhadap keseha-

tan, selama ini masih kontroversial. Adapotensigangguankesehatanmasyarakat yang lebih besar yanhg diakibatkan oleh radiasi elektromagnetik dari berbagai peralatan elektronikmaupunkomunikasi.Namunjustrusangat akrab dengan kehidupan masyarakat seharihari. Beberapa fenomena di sekitar SUTET sering dikemukakan oleh masyarakat dan dianggap sebagai indikator gangguan kesehatan. Antara lainmenimbulkanbusurcahaya,suaramendesis, bulu badan berdiri, atau tes pen maupun lampu neon menyala. Hal ini pada hakikatnya hanyalah fenomena teknis dan sama sekali tidak ada hubungannya dengan gangguan kesehatan. Manusia di bawah SUTET yang menderita sesuatu penyakit, tidak dapat diklaim semata-mata akibat radiasi elektromagnetik SUTET.Tapi dapat pula oleh kontribusi faktor-faktor fisika, kimia dan biologi, di samping perilaku manusia yang bersangkutan. Satu faktor penting yang harus diperhitungkan secara matang adalah faktor sosial ekonomi dan budaya masyarakat setempat. Salah satu solusi yang dapat dilakukan, yakni dengan melakukan pemberdayaan masyarakat di bawah dan di sekitar SUTET. Termasuk keluarga besar SMK Negeri 1 Sipirok salah satunya dengan melakukan penghijauan. Padadasarnyakitatidakpernahmenghalangi keberadaan SUTET ini, tapi alangkah bijaksana jika PT PLN merelokasi SUTET dari areal pendidikan ini. Tapi dengan niat yang baik, secara bersama kita telah melakukan penghijauan sebagai langkah antisipatif terhadap ketidakperdulian PT PLN kepada pelajar yang merupakan generasi bangsa. Mengakhiri acara Hj Rahmianna Delima Pulungan melakukan penanaman pohon secara simbolis disaksikan para staf pengajar SMKN 1 Sipirok, orangtua murid, dan beberapa elemen lainnya. Ke depan Rahmianna berharap keluarga SMKN 1 Sipirok supaya mengelola lingkungan sekolah dengan baik. Karena lingkungan yang baik tentu keberadaan siswa dan guru akan lebih nyaman dalam proses belajar mengajar. (a20)

RSUD P. Sidimpuan Akan Naikkan Upah Cleaning Service 2011 P.SIDIMPUAN (Waspada): Angin surga bagi sekira 20 petugas kebersihan (cleaning service) RSUD Kota Padangsidimpuan yang dikontrak mulaidiawaltahun2010,akanmendapatkenaikan upah dari Rp500 ribu menjadi Rp600 ribu di tahun 2011. Demikian Direktur Rumah Sakit Umum Daerah(RSUD)drAminuddindihadapanpetugas dan para staf rumah sakit, terkait minimnya gaji yang diterima oleh petugas kebersihan selama tahun 2010, Selasa (21/12) di ruang pelayanan. ‘’Kami sadari upah para petugas kebersihan selama ini minim, namun walupun demikian, kita akan upayakan kenaikan upah kepada petugas kebersihan di tahun 2011 sekira Rp 600 ribu. Semoga pemko dan DPRD mensahkan permohonan kenaikan upah para petugas kebersihan,’’ papar Aminuddin. Terkait adanya dugaan pemotongan upah terhadap petugas kebersihan selama tahun 2010, diakuidirekturterhadapparapetugas,diakibatkan hambatan komunikasi dari pihak manajemen, sehingga muncul presepsi negatif terhadap

pimpinan dan petugas RSUD. ‘’Di dalam kontrak tahun 2010, sudah kami lihat pembukuan ternyata gaji yang diterima para petugas kebersihan Rp500 ribu, adanya muncul presepsi pemotongan upah, mungkin kehilapan dan ketidaktahuan para pekerja, ungkap Amin. Salah satu petugas kebersihan mengakui sangat berterimakasih terhadap manajemen dan pimpinan RSUD atas perhatian dan kerelaan untuk rencana peningkatan upah terhadap mereka, akibat gaji yang mereka terima selama ini hanya pas-pasan. Ketua Fraksi Demokrat H Khoiruddin Nasution di tempat terpisah mengatakan, akan turut memperjuangkan kenaikan upah terhadap petugas kebersihan di RSUD Kota Padangsidimpuan tahun 2011. “Hak-hakpekerjadiRSUDituakankitasahuti dan dibahas nantinya, semoga rekan-rekan di parlemen turut menerima usulan kenaikan upah,” imbuh Khoir Nasution. (crm)

Hilangkan Budaya Sirik, Iri, Dan Gosip Menyikapi Hasil Pilkada Karo MEDAN (Waspada):Pesta demokrasi Pilkada Tanah Karo selesai sudah, semua pihak diharapkan dapat menerima apapun hasil dari proses itu. Siapapun pemenangnya harus dihormati. “Yang menang merangkul yang kalah dan yang kalah menerima dengan legowo, sebab semuainitujuanyahanyasatumembangunbumi turangkearahyanglebihbaik,“katapraktisihukum Sumut, Aldian Pinem menjawan Waspada, Rabu (22/12). Pinem juga merupakan Presiden LSM Perjuangan Hukum dan Politik (PHP) mengatakan, Pilkada putaran kedua Kab. Karo putaran berlangsung 21 Desember 2010, sudah selesai, siapapun nanti yang menang baik pasangan DR HC Kena Ukur Jambi Surbakti-Terkelin Berahmana, SH atau rivalnya Siti Aminah PeranginanginSumihar Sagal, SE harus dihormati. “Seluruh komponen etnis Karo baik berdomosili di Medan dan Tanah Karo atau di mana saja agar mendukung siapapun pemenangnya. Mari kita buktikan kalau etnia Karo sudah dewasa dalam berpolitik, “ tegas Pinem. Dia mengatakan, budaya“ACC” yang artinya aceng (sirik) cian (iri) dan cekurak (gosip) yang selama ini merasuki pola pikir suku Karo harus dihilangkan. Sebab, katanya, kalau sifat-sifat ini

masih melekat, dipastikan siapapun memimpin Tanah Karo akan mengalami kendala pemikiran mengoptimalkan pembangunan di daerah itu “ Masyarakat Karo jangan sirik iri, atau menggosip atas kemenangan yang diraih orang lain, terlebih bukan kelompok kita, sebab budaya ini bisa menghambat pembangunan di Tanah Karo, “ tegasnya.Menurutnya, para tokoh agama, budaya dan akademisi putra Karo harus memberikan pencerahan kepada mayarakat yang sudah letih menghadapi proses Pilkada tersebut.”Jangan lagi ada pihak-pihak yang memprovokasi masyarakat agar terjadi perang urat syaraf yang hasil hanya menyengsarakan warga Karo, “ tegasnya. Menurut Pinem dengan selesainya Pilkada ini, yang harus dilakukan semua pihak adalah memberikan masukan positif kepada pemimpin yang akan menjalankan roda pemerintahan Kab Karo.”Bukan waktu lagi kita saling hujat karena kondisi ini hanya akan menimbulkan persoalan baru yang tak berujung, “ ujarnya. “Tinggalkan sifat-sifat yang arahnya memunculkan permusuhan. Sebab ini, bisa menimbulkan kesenjangan sosial yang dapat merusak konsentrasi pembangunan kedepannya untuk Tanah Karo, “ ujar Pinem. (m49)


Sumatera Utara

B4

WASPADA Sabtu 25 Desember 2010

Pembangunan RSU Hadrianus Sinaga Masuki Penyelesaian Akhir

Penyelidikan Kasus Asusila Anggota DPRD Madina Dihentikan

SAMOSIR (Waspada) : Pembangunan Rumah Sakit Dr Hadrianus Sinaga yang beralamat di Pangururan bernilai Rp 27 miliar saat ini sedang dalam proses penyelesaian. Proyek yang didanai dari DIPA Depkes 2010 dilaksanakan PT Adhi Karya, Tbk (Persero) di bawah pengawasan konsultan pendamping PT Arkonin Jakarta dan pelaksanaan dimulai tanggal 24 Agustus 2010. Pelaksanaan pembangunan di dukung tenaga kerja sebanyak 300 karyawan yang sudah dicover melalui Jamsostek Pematang Siantar. Menurut Site Enginering PT. Adhi Karya, Tbk (Persero) Lufty kepada Waspada, Jumat (24/12) pelaksanaan hanya tinggal finishing selanjutnya pemeliharaannya hingga Juli 2011. Masa kontrak pelaksanaan tanggal 30 Desember 2011, sesuai batas waktu proyek yang didanai dari APBN dan APBD berdasarkan peraturan Menteri Keuangan RI. Pembangunan RSU Hadrianus Sinaga meliputi ruang poliklinik, ICU, IGD, Farmasi, IPAL, laundry, ruang jenazah, dapur, dan 3 gedung rawat inap. Serah terima pertama pekerjaan diperkirakan dilaksanakan akhir tahun 2010 dan serah terima kedua setelah pemeliharaan diserahkan bulan Juli 2011 kepada Direktur RSU Dr. Hadrianus Sinaga Pangururan, sebut Lufty didamping staf pengendalian PT. Adhi Karya,Tbk Jati. (c10)

PANYABUNGAN (Waspada) : Penyelidikan kasus asusila diduga melibatkan anggota DPRD Madina berinisial BEH dihentikan Polres Madina karena tidak cukup bukti. Itu dijelaskan Kasat Reskrim Polres Madina AKP Sarluman Siregar, Kamis (23/12). Penyelidikan juga dihentikan karena kedua belah pihak telah berdamai secara kekeluargaan. BEH yang dihubungi melalui kuasa hukumnya Ridwan Rangkut menjelaskan, penyelidikan kasus itu telah dihentikan setelah Polres Madina melakukan penyelidikan dan proses pengaduan Tim Asiah sesuai hukum acara pidana. Dengan ketentuan, pemeriksaan beberapa kali terhadap saksisaksi yang diajukan pelapor, meminta keterangan ahli, menganalisa VER dan melakukan gelar perkara tanggal 15 Desember 2010. (csh)

Kisman Pimpin Karang Taruna Sergai

Sat Pol Air Polres Samosir Antisipasi Pengunjung Dari Gangguan Laka Danau SAMOSIR (Waspada) : Dengan kekuatan 12 personil dan 1 buah speed boat type C-1, Polisi Perairan Polres Samosir siap antisipasi pengunjung yang datang ke Samosir dalam liburan Natal 2010 dan Tahun Baru 1 Januari 2011, sebut Kasat Pol Perairan Polres Samosir Iptu D.Sinaga kepada Waspada, Jumat (24/12) di Tomok. Dengan luas DanauToba wilayah Kab. Samosir yang mencapai sekira 10.000 hektare, polisi perairan Polres Samosir dibawah kendali Kapolres Samosir AKBP EP Sirait siap meningkatkan pengamanan di beberapa titik yang dianggap rawan Laka Danau sepertilokasiTomok,Tuktuk,AmbaritabahkanOnanRunggu.Apalagi saat ini, Mabes Polri menggelar Operasi Lilin Terang sampai ke tingkat Polda, Polres dan Polsek. Disebutkan Kasat Pol Perairan Iptu D. Sinaga, umumnya faktor timbulnya laka Danau diakibatkan cuaca kurang baik dan ombak besar. Kantor Sat Pol Perairan Polres Samosir berada di Simpang Hotel Carolina Tuktuk Siadong dengan status bangunan pinjam pakai, sebut Sinaga. (c10)

Akhiri Hidup Dengan Gantung Diri PEMATANGSIANTAR (Waspada): Seorang pria, Sumarno, 37, swasta, Huta I, Nagori Bandar Siantar, Kecamatan Gunung Malela,KabupatenSimalungundidugamengakhirihidupnyadengan menggantung diri di pohon rambung. Keterangan dihimpun menyebutkan Sumarno mengakhiri hidupnya dengan menggantung diri di satu pohon rambung di perkebunan PTPN III Kebun Bangun Tanam 2000, Kecamatan Gunung Malela, Simalungun pada Jumat (24/12) dinihari. Sumarno diduga nekat mengakhiri hidupnya akibat stres hingga pergi ke perkebunan rambung dan mengikatkan seutas tali ke cabang pohon rambung serta ke lehernya. Perbuatan nekat itu baru diketahui ketika para pekerja perkebunan menemukan Sumarno tergantung di pohon rambung. Sebentar saja warga berdatangan melihat kejadian dan sampai ke pihak kepolisian dari Polsek Bangun. Pihak Polsek Bangun menurunkan Sumarno yang sudah dalam keadaan meninggal sesudah melakukan penyelidikan di sekitar tempat kejadian. Selanjutnya, jenazah Sumarno dibawa ke RSUD Dr Djasamen Saragih, Kota Pematangsiantar guna keperluan visum. Kapolres Simalungun AKBP Drs Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas Iptu Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK menyebutkan kejadian itu masih dalam penyelidikan dengan menyita seutas tali nylon sebagai barang bukti. “Namun, dugaan sementara, korban meninggal akibat bunuh diri dengan cara gantung diri dan motifnya akibat stres.”(a14).

Pos Pol Air Babalan Diresmikan

Waspada/Rasudin Sihotang

BERSERAKAN: Sampah rumah tangga terlihat berserakan sampai ke luar tong sampah di Gg. Kim Ban Lie, Kel. Perwira, Kec. Tanjungbalai Selatan, Kota Tanjungbalai. Ria Br Siahaan, 13, seorang pemungut sisa makanan yang setiap hari singgah ke lokasi tersebut mengatakan, hampir 3 hari sampah disana tidak diangkut petugas kebersihan. Akibatnya, selain merusak pemandangan, menimbulkan aroma tidak sedap dan menjadi sarang lalat penyebar penyakit. Foto direkam, Jumat (24/12).

2011, Sergai Salurkan Dana PNPM Rp29,1 M SEIRAMPAH (Waspada): Untuk menumbuhkembangkan perekonomian masyarakat Kabupaten Serdang Bedagai terutama mempercepat penanggulangan kemiskinan secara terpadu dan berkelanjutan, perlu kerja keras dan kemitraan yang baik antara Pemkab Sergai dengan stakeholhers dalam pelaksanaan Program Nasional Pemberdayaan Masyarakat Mandiri Pedesaan (PNPM-MP).

Hal itu ditegaskan Wakil BupatiSergaiHSoekirmandalam ceramahnya berjudul “Strategi penanggulangan kemiskinan pedesaanmelaluipemberdayaan masyarakat” pada seminar dan lokakarya (semiloka) DPRD PNPM-MP Sergai di aula Sultan Serdang kantor Bupati Sergai di Sei Rampah, Rabu (22/12). Dikemukakan, sejak 2007 Pemkab Sergai menyalurkan bantuan PNPM Mandiri Perdesaandanpada2011bantuanyang sama juga disalurkan ke seluruh kecamatan di Kabupaten Sergai untuk diteruskan kepada desa yang ditetapkan. Dana PNPM-MP yang dialokasikan di Sergai pada 2011, menurut Soekirman, sebesar Rp29,1 yaitu Rp 24.100.000.000, dana Bantuan Langsung Masyarakat PNPM-MP yang ber-

sumber dari APBN sebesar Rp19.280.000.000,-, costsharing APBD Sergai Rp 4.820.000.000,, kemudian dana PNPM Integrasi Rp 5 miliar bersumber dari APBN sebesar Rp 4 milyar dan costsharing dari APBD Sergai Rp1 miliar. Diungkapkan pula, melalui dana PNPM-MP 2010 dilakukan berbagai kegiatan fisik maupun non fisik di 163 desa di Sergai dengan 145 jenis kegiatan di antaranyapembangunanjalansepanjang61.909meter,pembangunan/ perbaikan saluran irigasi 21.507 meter,membuatjembatan11unit sepanjang 134 meter. Selanjutnya pembangunan 10 ruang belajar anak sekolah, pembangunan 21 unit sarana air bersih ditambah pembangunan fisikpelengkapsepertipembuatan gorong-gorong, bronjong dan tembok penahan air serta

pembangunan parit tepi jalan sepanjang 26.569 meter. Sementara untuk non fisik, dilakukan kegiatan penyuluhan dan diklat, pemberian makanan tambahan bagi 200 balita, permodalan bagi 312 kelompok simpan pinjam perempuan di berbagai desa dan kecamatan serta pembangunan pasca krisis di kecamatan Dolok Merawan, Dolok Masihul, Serba Jadi dan Kecamatan Pantai Cermin. “Melalui bantuan PNPM Mandiri Perdesaan ini juga, sebanyak 45.009 rumah tangga miskin telah mendapatkan bantuan dan menyerap tenaga kerja sebanyak 3.572 orang yang seluruhnya bertujuan untuk meningkatkan kesejahteraan masyarakat dan menciptakan lapangan pekerjaan,” papar Soekirman. (a07)

PKS Bertekad Raih 3 Besar Di Sergai

BABALAN ( Waspada): Kapolres Langkat AKBP Mardianto, Sik, meresmikan pos Pol Air Babalan Langkat di TPI Jalan Babalan, Rabu siang ( 22/12 ). Hadir di sana Muspika Babalan,Dan Ramil 13 /PB Kapten Inf Bustami, Ketua DHD Angkatan 45 H Asnawi Daud, Dan POM P.Brandan, Kamla, Dan Pos Pol Air AKP SuwitoWidodo,H Syafruddin Basyir mewakili tokoh masyarakat, Kades/Lurah Kapolres Langkat AKBP Mardianto Sik dalam sambutan peresmian pos Pol-Air Babalan Langkat sekaligus pengguntingan pita ,dapat mendekatkan warga perairan Babalan. Karena wilayah itu sangat rawan penyelundupan senjata api,seluruh personil modus operandi perlu diwaspadai . Kanit Pol Air AKP SuwitoWidodo juga mengimbau para nelayan untuk kembali memasang selar untuk dapat dideteksi petugas bila ada permasalahan ditengah laut dalam mencari ikan H Syafruddin Basyir, mewakili masyarakat mantan Ketua DPRD Langkat juga untuk mendukung keberadaan pospol air ini. (c02)

SEIRAMPAH (Waspada): Helmi Indra terpilih memimpin PKS Kab.Serdang Bedagai masa bakti 2010-2015. Keputusan itu diambil dari hasil Musyawarah Daerah(Musda)IIPartaiKeadilan Sejahtera (PKS) Serdang Bedagai yang dilaksanakan secara aklamasi di Balai Kartini, SabtuMinggu (18-19/12). Sementara struktur lainnya Sekretaris Umum dijabat Edy Gunawan, Bendahara Muhammad Fahmi. Bidang Kaderisasi Zainala Arif, Bidang Cabang Dakwah I Ishak, Cab.Dakwah II Dedy

350 Personil Polres Sergai Amankan Natal dan Tahun Baru

Puluhan Anak TK Negeri Pembina P.Hilir Basuh Kaki Ibunya

SEIRAMPAH(Waspada):Sebanyak350personilPolridikerahkan untuk pengamanan Natal danTahun Baru di wilayah hukum Polres Kab. Serdang Bedagai. Selain Polri, pengamanan juga dibantu dari 30 personel TNI, 30 personel Brimob, 30 personel Dishub dan Satpol PP serta dibantu unsur Pramuka. Demikian dikatakan Kapolres Serdang Bedagai, AKBP Drs Eri Safari usai memimpin upacara apel gelar pasukan operasi lilin 2010, di lapangan Desa Firdaus, Kec.Sei Rampah, Kamis (23/ 12).“Di sepanjang jalur lintas Sumatera (Jalinsum) kita mendirikan 4 pos pengamanan yang berlokasi di Perbaungan, Bengkel, Sei Rampah dan Sei Bamban. Di samping itu juga ditempatkan 4 tim pengurai yang bertugas memperlancar arus lalu lintas bagi pengguna jalan,” terangnya. Hadir di sana, Wakil Bupati Serdang Bedagai, H Soekirman, Kajari Sei Rampah, Erwin Harahap, SH. MH, Kasatpol PP, Purba Siregar, KTU RSUD Sultan Sulaiman, Dewi Sri Warni, Muspika se Sergai dan para undangan. (a07)

TEBINGTINGGI (Waspada): Memperingati Hari Ibu Tahun 2010,berbagaicaradilakukanoleh setiap orang untuk menghormati dan menyanyangi para kaum ibu sebagai ujung tombak dalam membina keluarga di dalam rumah tangga. Seperti yang dilakukan di Taman Kanak-Kanak (TK) Negeri Pembina Kecamatan Padang Hilir,Kota Tebing Tinggi dalam memperingati Hari Ibu Tahun 2010 menggelar kegiatan mambasuh kaki massal, memberikan setangkaibungadansuapankasih sayanganakkepadaibunya,Rabu (22/12) dihalaman TK Negeri

Mariadi, Cab.Dakwah III Safril Damanik, Cab.Dakwah IV Auzarul, Bidang Pembangunan Umat M Iqbal Husin, Bid.Perempuan Agustini, Bid.Generasi Muda, Profesi KependudukanOlahragaSuyarman,Bid.Ekonomi & Kewirausahaan Karyanto, Bid.Lembaga Sosial Ardiansyah. Semua pengurus itu dikukuhkan sesuaiSKNo.039/D/SKEP/DPWAB-PKS/1432 H ditandatangani Ketua DPW PKS Sumut H Muhammad Hafedz dan Sekretaris DPW PKS Sumut H SatryaYudha Wibowo.

Pembina Padang Hilir Jalan Ahmad Bilal Kota Tebingtinggi Pantuan di lapangan, puluhan anak-anakTKNegeriPembina yang membasuh kaki ibunya itu dilakukan tampak penuh kasih sayangdanketulusanyang diringi lagu“Terima Kasih Ibu”dinyanyikan oleh para gurunya, sehingga para orang tua ada yang meneteskan air mata kebahagian saat kakinya dibasuh dengan air oleh anaknya sendiri hingga bersih. Setelah membasuh kaki ibunya, anak-anak TK memberikan setangkai bunga dan menyuapi makan nasi kepada ibunnya sebagai tanda cinta dan kasih

Usai Musda pengurus yang terpilih langsung dilantik yang dihadiri Bupati Serdang Bedagai HT Erry Nuradi diwakili Asisten II Aladin Berutu, Ketua Wilda I Sumut Ustadz Andre Susilo, Ustadz Hidayatullah yang juga anggota DPRD Dapil III Sumut, Ustadz Sigit Pramono Asri anggota DPRD Sumut yang juga sebagai MPP PKS Sumatera Utara. Ketua DPD PKS Sergai yang baru dilantik Helmi Indra dalam pidato mengatakan, PKS memposisikan diri menjadi partai yang siap melayani masyarakat

sayang kepada orang tua yang telah melahirkan dan membesarkannya. Usai membasuh kaki, memberi setangkai bunga dan menyuapi makan nasi ke ibunya, anak-anak TK Negeri Pembina Padang Hilir bersama para gurunya serta para orang tua murid berkelilingkotadengankendaraan Odong-Odong. Disela-selakegiatanitu,Kasek TK Negeri Pembina Padang Hilir Kota Tebingtinggi, Dra Supriatik, mengatakan, kegiatan ini digelar dalam rangka memperingati Hari Guru dan pembagian raport semesteranakTKNegeriPembina

Secercah Harapan Buat MUI Tebingtinggi PENGURUS Majelis Ulama Indonesia (MUI) Kota Tebingtinggi telah dilantik pada 20 Desember 2010 bertepatan dengan 14 Muharram 1432 H. Dilihat dari komposisi pengurusan MUI periode 2010 – 2015 ini, masyarakat muslim menaruh harapan kepada MUI Kota Tebingtinggi dapat memberikan pencerahan kepada ummat.

Dari posisi Ketua Umum Al Ustadz HA Dalil Harahap berlatarbelakang pendidikan pesantren, sosok yang teguh dan konsekwen, lurus, tawaddu’ dan wara’. Begitu juga dari unsurunsur wakil ketua di antaranya H ahyar Nasution alumni Univa Medan yang juga berlatarbelakang pendidikan pesantren. HM Ghojali Saragih, H Sujarno Alamsyah, juga alumni Univa Medan, H Nizar Rangkuti, Agussul Khoir dan Abu Hasyim Siregar, H Ibrahim Harahap, Dosen STAIS Tebingtinggi Deli, H Haznam Siregar, alumni STAIS Tebingtinggi Deli. Mereka adalah ustadz yang cukup kondang di Kota Tebingtinggi dan sekitarnya. Walau di

kalangan masyarakat muslim di Kota Lemang itu agak pesimis dengan komposisi kepengurusan MUI, karena hampir 80 persen PNSdanbirokrat,sehinggadikhawatirkantidakdapatmenjalankan fungsi MUI secara netral dan mandiri. Tetapi bila dilihat dari kiprah mereka di masyarakat, mereka cukup tegas menyampaikan tausiyah Amar Ma’ruf Nahi Mungkar, yang hak tetap hak dan yang batil tetap batil. Mereka adalah tokoh-tokoh Islam yang cukup kompeten di bidangnya terdiri dari Nahdiyin, Washliyin dan Muhammadiyin. Kepada pengurus MUI yang dilantik itu, umat Islam di KotaTebingtinggi menggantung-

kan harapan agar MUI dapat berperan dalam menjalankan fungsinya sebagai lembaga yang mencegah Nahi dan Mungkar. Di samping itu juga dapat berperan sebagai Wattawassaobilhaq (menyampaikan yang benar) dan Wattawasahaubissabri(menyampaikankesabaran) terutama dapat menjadi lembaga “penengah” diantara lembagalembaga pemerintah di Kota Tebingtinggi agar tercipta kondusifitas dan percepatan kesejahteraan masyarakat Kota Tebingtinggi. Perlu Laboratorium Penjamin Halal Sementara itu, tokoh masyarakat Islam di Kota Tebingtinggi,

Ismail yang staf pengajar di STAIS Tebingtinggi Deli, Rabu (22/12) mengatakan, untuk menghindari ummat Islam mengonsumsi makanan-makanan yang diragukan halalnya, perlu ada laboratoriumpenjaminHalal(berlabel halal setiap kemasan makanan), serta pembekalan kepada pengusaha ayam potong agar menyemblih ayam itu sesuai dengan syari’at Islam. Selain itu perlu Muzakarah tentang aqidah, akhlak, terutama Masailul Fiqhiyah (masalahmasalahhukumIslam)yangterus berkembang perlu dilaksanakan kecara rutin setiap masjid secara bergilir di 35 kelurahan di Kota Tebingtinggi. ● Muhammad Idris.

Serdang Bedagai. Karena bekerja untuk Serdang Bedagai adalah ibadah dalam rangka mewujudkanvisidaripartaidakwahiniyakni dengan semboyan,” Menjadi Partai Dakwah Yang Kokoh dan Transformatif Untuk Melayani Serdang Bedagai. Ditegaskan, PKS Sergai mempunyai target 3 besar di Serdang Bedagai. Maka dari itu diharapkan kader PKS di tingkat daerah sampai ranting harus bekerja keras, sehingga target menjadikan PKS 3 besar di Sergai dapat tercapai. (a07)

Padang Hilir. “Inti dari semua kegiatan ini adalah untuk mengajar kan anak untuk dapat menghargai seorang ibu,” ujar Supriatik Dikatakan, TK Negeri Pembina Padang Hilir Kota Tebingtinggi berdiri sejak tahun 2007 dengan jumlah anak didik 78 orang dan 8 orang tenga pengajar berpendidikan S-1. ( a08)

PERBAUNGAN (Waspada): Bendahara Karang Taruna Kab.Serdang Bedagai priode 2005-2010 Kisman berhasil terpilih menjadi Ketua untuk priode 2010-2015 pada Bulan Bhakti Karang Taruna (BKKT) II tahun 2010, sekaligus Temu Karya Karang Taruna Se Sergaike-II, Kamis (23/12) sore di Wisma Juang Perbaungan. Mantan Ketua Karang Taruna Kab.Sergai priode 2010-2015 yang saat ini menjabat Sekretaris KT Sumut Zulkarnain Herman ketika dikonfirmasi Waspada, Jumat (24/12) mengatakan, Kisman terpilih menjadi ketua setelah dilakukan voting dengan tiga calon yakni Rahmat dengan 4 suara , Andi Ginting SP 3 dan Kisman 7 suara dari 15 pengurus kecamatan sementara satu kecamatan abstein, terangnya. “ Pengunduran diri saya, karena telah menjabat Sekretaris KT Sumut,selainitujugasebagaiupayaregenerasidankaderisasipenguruspengurus yang lebih muda dengan harapan agar KT Kab.Sergai lebih baik dari priode yang lalu,’’ imbuh Zulkarnain. Hadir di sana Bupati Sergai diwakili Kadispora Drs JonniW Manik, Ketua Karang Taruna Sumut Solahuddin Nasution, Ketua karang Taruna Sergai Zulkarnain Herman, pengurus Karang Taruna Kota Binjai, Pematangsiantar, Medan serta undangan lainnya. Sebelumnya Ketua KT Sumut Solahuddin menyatakan,”kita sangat menyangkan sosok Zulkarnain Herman yang tidak lagi maju sebagai calon Ketua KT Sergai, karena faktor usia tetapi beliau adalah aset Karang Taruna yang patut dicontoh,” ungkap Solahuddin. Bupati Sergai dalam sambutan tertulisnya yang dibacakan oleh Kadispora Sergai Drs JoniW.Manik, MM mengatakan,generasi muda adalah generasi yang akan mewarisi semua tugas dan tanggung jawab untuk mengisi, mempersatukan dan membangun bangsa ini menjadi bangsa yang besar, maju dan sejahtera sebagai wuhud dari keinginan dan tujuan generasi terdahulu. (ces)

Musda PAN Simalungun Diundur Hingga Januari 2011 SIMALUNGUN (Waspada): Musyawarah Daerah (Musda) Partai Amanat Nasional (PAN) ke-IV Kab. Simalungun yang sempat direncanakan akan digelar pada 27 Desember 2010, akhirnya diundur hingga Januari 2011. “ Musda ke-IV PAN Simalungun diundur hingga Januari 2011,” tegas Ketua SC (Stering Comite), Ir Endi Cuaca dan ketua OC, Munap MR, kepada Waspada, Jumat (24/12), sore. Menurut Endi, penundaan jadwal pelaksanaan Musda dari yang semula direncanakan pada 27 Desember 2010 menjadi Januari 2011 karena alasan teknis.Waktu yang tersedia bagi panitia untuk persiapan pelaksanaan tidak cukup, sehingga harus diundurkan hingga pertengahan Januari 2011, agar persiapan benar-benar maksimal. Enam Balon Ketua Siap Bertarung Sementara, meskipun jadwal pelaksanaan Musda diundur hingga Januari 2011, namun tidak mengurangi semangat para kandidat ketua DPD PAN Kab.Simalungun untuk tetap mendaftar sebagai bakal calon ketua kepada panitia. Hingga batas waktu terakhir pendaftaran,Jumat (24/12), tercatat enam nama balon (bakal calon) ketua DPD PAN Simalungun yang mendaftar atau yang mengembalikan formulir pendaftaran kepada panitia. Mereka masing-masing, Evra Sassky Damanik, S.Sos, Ir Sariadi Saragih, Kaliaman Sitio, SH, Salbin Damanik, SH, Iskandar Nasution, SH dan Burhanuddin Sinaga. Berkas keenam balon Ketua DPD PAN Simalungun itu akan diserahkan ke DPW untuk diverifikasi dan selanjutnya ditetapkan apakah layak sebagai calon untuk dipilih pada Musda ke-IV PAN Simalungun. Keenam kandidat merupakan kader-kader handal di DPD PAN Simalungun, bahkan tercatat nama Burhanuddin Sinaga saat ini masih sebagai Ketua DPD PAN Simalungun. Selain itu, Burhan saat ini juga menduduki kursiWakil Ketua DPRD Simalungun. Sementara, saingan dekatnya adalah Evra Sasky Damanik, S.Sos saat ini menjabat sebagai Ketua Fraksi Amanah Pembela Habonaron di DPRD Simalungun. Kemudian, Salbin Damanik, SH yang disebut-sebut sudah mendapat restu dari DPW PAN Sumut bakal menjadi kuda hitam yang siap mengalahkan Burhanuddin dan Evra Sassky. Ketiga balon orang nomor satu di DPD PAN Simalungun itu sudah mulai‘bergerlya’ mencari dukungan ke DPC dan DPRt. Sedangkan, tiga nama lainnya Kaliaman, Sariadi dan Iskandar kurang diperhitungkan dan dianggap hanya sebagai penggembira saja. (a15)

Musyawarah PK Golkar Babalan Alot P.BRANDAN (Waspada): Musyawarah PK (pengurus kecamatan) Partai Golkar Kecamatan Babalan, Langkat di SKB Jalan Thamrin P.Brandan, Rabu siang (22/12) berlangsung alot. Hadir pada pembukaan itu, Camat Babalan Nanang Hadi Irawan, S.Sos, Kapolsek P.Brandan AKP HM Kosim S ,PK Golkar Babalan T Hutajulu, Unsur PD Golkar Langkat H Syahrum Hakim, M Irian Nasution, Siti Anggur Ritonga, serta undangan. Camat Babalan Nanang Hadi Irawan menggharapkan pemilihan PK berjalan lancar dan pilihlah orang-orang yang tau berorganisasi. M Idris Nasution dari unsur pemuda Babalan dalam musyawarah itu berhasil unggul detelah mengungguli Torang Hutajulu. Sementara itu pengurus Partai Golkar melantik kepengurusan AMPI Kecamatan Babalan yang dipimpin Ketua terpilih Darwis Siagian. (c02)

Ratusan Ibu Ikuti Lomba Batik Khas DS-Tari Tradisional LUBUK PAKAM (Waspada): Menyambut dan memeriahkan Hari Ibu ke-82, HUT PKK ke-38 dan HUT Dharma Wanita Persatuan ke-11 tahun 2010, seratusan ibu-ibu dari berbagai instansi di jajaran Pemkab Deliserdang ikuti lomba busana batikkhasDeliserdangdanlomba taritradisionaldaerahdiBalairung Pemkab Deliserdang Lubuk Pakam, Selasa (21/12). Lomba dibuka Ketua TP PKK Deliserdang Ny Hj Anita Amri Tambunan berlangsung meriah karena peserta tidak hanya menampilkan rancangan batik untukpakaiankerja,tapijugagaun pestamaupundanpakaiansantai. Bahkankemeriahansemakin hangat ketika peserta lomba tari tradisional membawakan tari yang membuat pengunjung mengikuti irama musik.Seperti penampilantortorBatak“Sigalegale” yang menghadirkan sosok pria

mirip “Sigalegale”, sejumlah pengunjung di bagian latar Balairung ikut menortor. Ketua TP PKK Ny Hj Anita Amri Tambunan di sela acara menjelaskan, pagelaran lomba dilakukan untuk menunjukkan kepada masyarakat tentang batik khas Deliserdang sehingga diharapkan ke depan akan semakin berkembang. Menurut Ketua Dekranasda ini, motif batik khas Deliserdang ada tiga jenis yakni Melayu, Simalungun dan Karo sebagai etnis tertua di daerah ini. Jadi semua motif itu ada artinya termasuk tarian tradisional yang menghadirkanbeberapatarietniklainnya. Namun ke depan pihaknya akan menggelar lomba busana batik khas Deliserdang dengan melibatkan para remaja. Rencananyakegiatantersebutdiadakan secara masal pada peringatan

Hari Jadi Kabupaten Deliserdang ke-65 pada 1 Juli 2011, katanya. Ketua Panpel yang juga Ketua GOW Deliserdang Sri Rahmawaty Barus menjelaskan, selain lomba busana dan tari tradisional, pihaknya juga mengadakan lomba pidato yang pesertanya para kaum ibu. Sri mengaku lomba busana batik khas Deliserdang yang dilaksanakan merupakan rancangan Ketua TP PKK Deliserdang dalam rangka menyambut dan memeriahkan Hari Ibu ke82, HUT PKK ke-38 dan HUT Dharma Wanita Persatuan ke11 tahun 2010 di Deliserdang. Selain dihadiri ratusan klaum ibu juga telihat hadir Asisten I Setdakab Drs HM Iqbal Nasution, Wakil Ketua TP PKK Deliserdang Ny Hj Asdiana Zainuddin beserta pengurus dan unsur pengurus DharmaWanita Persatuan.(a05)


Agenda

WASPADA Sabtu 25 Desember 2010

07.00 Doraemon Robot Kingdom 09.00 Dahsyat 11.00 Intens 12.00 Seputar Indonesia 12.30 Film Keluarga : 102 Dalmations 15.00 Aksi Anak Bangsa 17.30 Seputar Indonesia 18.00 Dia Jantung Hatiku 20.00 Putri Yang Ditukar 21.15 Kemilau Mandiri Fiesta 22.15 BOM : War Of The World 02.00 Seputar Indonesia Malam

CATATAN

07.00 Inbox 09.00 Hot Shot 10.00 SCTV FTV Pagi 12.00 Liputan 6 Siang 12.30 SCTV FTV 14.00 SCTV FTV 14.30 Status Selebritis 15.00 Hip Hip Hura 16.00 SCTV FTV 17.00 Liputan 6 Petang 17.30 Uya Emang Kuya 18.00 Islam KTP 20.30 Titip Rindu 22.33 SCTV Sinema 00.30 Liputan 6 Malam

07.30 Cerita Pagi 09.00 Layar Pagi 11.00 Sidik 11.30 Lintas Siang 12.00 Layar Kemilau 15.00 Disney Club 16.30 Lintas Petang 17.00 Zona Juara 18.00 Animasi Spesial 19.00 Upin & Ipin 20.30 Sinema Utama 22.00 Cerita Pilihan 23.00 Premier Highlights 00.00 Lintas Malam

07.00 Star Kids 08.00 Sinema Pagi 10.00 Kabut Cinta 11.30 Topik Siang 12.00 Klik! 13.00 Mantap 14.00 Buaya Darat 17.00 Topik Petang 17.35 Katakan Katamu 18.30 Super Family 19.30 Super Deal 2 Milyar 21.00 World Most Amazing Video 22.00 Mohon Ampun Aku 23.00 Telisik 23.30 XYS 00.00 Topik Malam

Batik bermotif pemain naturalisasi yang juga penyerang Timnas, Irfan Bachdim, diproduksi perajin di Kota Malang, Jawa Timur, banyak diminati masyarakat. Pemain berdarah Belanda tersebut, menjadi inspirasi para pembatik di kota tersebut meraup keuntungan.

Rp. 12.000 Rp. 24.000

3 CM 4 CM

BURSA

LOWONGAN

DIBUTUHKAN TENAGA DIII

REKAM MEDIK WANITA MUSLIM DI RSU SUFINA AZIZ JL. KARYA BARU NO. 1 KEL. HELVETIA TIMUR KEC. MEDAN HELVETIA 20124 (061) 844.1111 - 846.1861

BURSA

PENDIDIKAN

INGIN LULUS PTN ? Di UMB-PTN/ SNMPTN 2011 IKUTI SEGERA...!!! PROGRAM INTENSIVE 2011 Untuk alumni SMA/ SMK agar lulus testing ke PTN melalui USM ITB, SIMAK, UI, UM UGM, UMB PTN, SNMPTN, USM UNDIP, STAN, STT TELKOM, dll Tahun 2011 Mulai belajar: Senin, 17 Januari 2011 Daftarkan sekarang juga

Di BT/ BS MEDICA

Jl. Bantam No. 12 Medan Telp. (061) 457.8058 Jl. Iskandar Muda No. 19B Medan Telp. (061) 415.9280 Belajar pagi hari: Jl. Bantam No. 12 Medan Belajar pagi atau sore hari: Jl. Iskandar Muda No. 19B Medan

BURSA

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

07:05 Editorial Media Indonesia 08:05 Agung Sedayu 09:05 Indonesia Now 09:30 Fashion Galery 10:30 Metro Xin Wen 11:05 OprahWinfrey Show 13:05 Spirit Football 13:30 Expedition 14.30 Behind The Scene : Laskar Pelangi 15:05 Provocative Proactive 16:05 Supernanny 16.30 Distroyed In Seconds 17:05 Metro Hari Ini 18.30 Metro Highlights 19.05 Metro Files 20.05 Mother Theresa 21.05 Top Nine News 21.30 Bunda Reinha 23.30 Metro Sports

07.30 Kuliner Pilihan 08.00 Gula Gula 08.30 Koper dan Ransel 09.00 Ceriwis 10.00 Ala Chef 10.30 Benu Buloe 12.30 Ngulik 13.00 Peppy The Xplorer 13.30 Belajar Indonesia 14.00 The Camp 14.30 Kenari 15.00 Hidup Kedua 15.30 Sahabat JP 16.00 Gaul Bareng Bule 17.00 Reportase Investigasi 18.15 Termehek-Mehek 19.00 IMB bersama 2 Supermi 20.30 Bioskop TRANS TV 22.30 Bioskop TRANS TV 00.30 Sinema Dinihari

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Batik Motif Bachdim Laris Manis

1 CM 2 CM

07.30 Bolt 08.00 The Chef Indonesia 09.00 Bango Cita Rasa Nusantara 09.30 KiSS Plus 10.00 Arti Sahabat 12.00 FTV Siang 14.00 Voice Of Indonesia 16.00 Fokus 17.00 1 Lawan 100 19.00 Indonesia Got Talent 21.00 Spesial Program 22.00 Take Celebrity Out 00.30 Sinema Malam

B5

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU Xenia Xi (1,3) Sporty (lengkap) Th. 2009 W. hitam, sgt mulus, orisinil, jarang pakai, jok kulit, mobil seperti baru. Hrg. 133Jt/ damai. Hub. 061-7773 1399

DAIHATSU Taruna CSX Th. 99 W. Biru silver met. AC, Tape, VR, BR, BK Asli Mdn, jok kulit, sehat, mulus & original. Hub. 0813 7618 8118 DAIHATSU AKHIR TAHUN

Xenia..................DP 11 Jt-an Pick Up...............DP 9 Jt-an Luxio...................DP 10 Jt-an Hub. DIKA (061) 77443877 - 0852 7074 7744

DAIHATSU TAFT GT 4X4 1986

W. Hitam, BK Baru Tanpa seri. AC, CD, Jok Starco Baru. Ban Rad. Velg Cobra. NB: Kondisi mobil tidak perlu rawat lagi. Siap pakai. Hub. 0812 6025 8795 Jl. S. Budi No. 94H. Tj. Rejo

HYUNDAI Accent Thn. 2000 Warna silver, satu nama. 0812 6400 747 ISUZU Panther Grand Deluxe BK Medan, warna birumetalik. AC, Tape, VR, BR, Pajak panjang. Harga: 60Jt Nego. Thn. 95. Hub. 0813 6130 1393

Black Panther Thn. 2003 Lengkap tangan I Harga Nego. Tanpa Perantara. Hub. 0812 6053 739. -0812 6081 769 Mobil L.300 Minibus Bensin Model Ambulance. Thn. 93. Komplit, siap pakai. harga Rp. 29Jt Nego. Hub. 0812 6369 1144 - 0617 6374 656

M-Eterna-90. BK 777 ED. Kondisi mulus. Original. Hub. 0 6 1 91145520 - 0815 3374 8820 MAZDA Vantrend Thn. 94 W. Merah met. An. Sendiri. Jual Cepat. Harga 25Jt Nego. AC, Tape, V. Racing, & Mitsubishi Jetstar Thn. 87. W. Hijau met. Hub.0813 6233 0005

TOYOTA Great Corolla Wrn. Merah. Thn. 94. Hub. 0852 6158 2168 TOYOTA Kijang Kapsul LGX Thn. 1997. W. Biru, Bensin 1,8 BK Medan mulus sekali. Hub. TP (061) 77967599 - 0821 65611 836

TOYOTA Fortuner 2.7 GLUX Bensin A/T 2006. Silver metalic. Kondisi baik, harga nego. Hub. 0812 65856787

Salah satu pengusaha batik di Malang, Hanan Jalil, Kamis mengatakan, lolosnya Timnas Indonesia ke Final Piala AFF 2010 menjadi inspirasi untuk menciptakan ide kreatif membuat batik bermotif Irfan Bachdim. Ia menjelaskan, selama perhelatan Piala AFF 2010, sudah sekitar 1.800 potong

Rp. 36.000 Rp. 48.000

5 CM 6 CM

baju dan 400 potong kaos bermotif Irfan Bachdim terjual laris, bahkan permintaannya hingga Jakarta. “Untuk batik motif Bachdim, permintaannya hingga Jakarta dan sejumlah daerah di Indonesia, namun untuk motif lainnya, seperti macan dan pantai mendapat

TOYOTA COROLLA DX TAHUN 81

Warna Biru, VR, BR 16”. AC, CD, Power. KC Film Baru, pajak Full 1 tahun. Interior Orisinil. Harga 22,5Jt/Nego. Hub. 0813 7525 7988 TOYOTA Kijang Grand Extra Long Thn. 93. Mdn asli, AC DB, DVD, TV, PW, PS, VR, W. Abu2 tua met. Cat asli, sgt mulus. Hub. 061-6993 9763 Khs. Pemakai.

TOYOTA Kijang Super 1991 Dijual. AC. HP. 0813 9707 8749 TOYOTA Hi-Lux. Pick-Up Thn. 2008 Warna silver, BR/VR, Tape. Hub. 0819 7231 134 DEALER RESMI SUZUKI MOBIL

PU 1.5 DP 6 Jt-an. Angs. 3.170.700 APV Dp. 12 Jt-an Angs. 4.830.000 NB: Proses Mudah & Cepat Data dijemput Hub. 0812 6540 809 / (061) 7772 2121

SUZUKI Carry Real Van 1.3 Thn. 97. W. Merah Met. AC, RT, BR, M. Mulus. Jarang pakai. & T. Pakai. Hub. 7348522 / 0813 7624 4166 TP.

SUZUKI Carry MB Thn. ‘89. W. Biru, BK Mdn Kondisi mulus. Hub. 0813 7034 9566

BURSA

SEPEDA MOTOR YAMAHA Mio Th. 2009. W. Hitam. Harga Rp. 8,7Jt. Hub. 0812 6547 978

BURSA

RENTAL MOBIL

batik tersebut sangat tinggi, terbukti pesanan batik untuk motif pemain Timnas tersebut tidak pernah berhenti “Hingga kini masih banyak pesanan batik bermotif Irfan Bachdim, meski tergolong mahal namun tidak mempengaruhi animo masyarakat untuk membeli,” katanya. Sementara itu, salah satu pembatik, Bintoro

7 CM 8 CM

Rp. 91.000 Rp. 104.000

BURSA

PROPERTY

Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

LB LT RM RT

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUKO DIJUAL

Di Jl. Medan Area Selatan No. 301/ 61 Ukuran Tanah 4x25m², Ukuran Bangunan 4x18m², Sertifikat Hak Milik, Hrg Rp. 550 Jt/nego Hub. 0812.6003.3505

RUMAH DIJUAL

Rumah Tingkat, 4 Kmr, 3 Kmr Mandi, Telp Rmh, Garasi/ Rumah papan Uk. Tanah 28x17m Hub. 0812.7390.6707

RUMAH DIJUAL CEPAT Ukuran tanah bangunan 117m atau 10x13m, Perumahan Ray Pendopo 3 No. 4 Pinggir jalan Jl. Perhubungan Bandar S e t i a H P. 0 8 1 3 . 9 6 9 2 . 2 7 3 1 / 0813.9600.0311 Bisa cash/ over kredit

RUMAH DIJUAL

Di Jl. Murni V/ 6A Tanjung Rejo Medan (Jl. Setia Budi Indah), LT. 6,25x20m, LB. 150m² (2 Tkt), KT 3, KM 2, Ada Musholla, 15meter dari Mesjid, Usia Rumah 6 thn Hub. 0812.641.3512 - 8222.742

RUMAH LUX DIJUAL

Terletak di Complek Citra Wisata Medan Johor, LT. 490, LB. ±500, Full furnish, SHM, 5 KT, 1 KT Pembantu 5 KM, Harga 2,8 M Hub. 0878.6935.6788 0852.7500.2388 Maaf Tanpa Perantara

RENTAL MOBIL MURAH Rp. 250.000/Hari HP. 061.66477734, 0852 9616 660 Maaf TP.

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

KEPADA KAUM MUSLIMIN DAN MUSLIMAT HADIRILAH HIDANGAN HIDAYAH ALLAH

BERSAMA MAJELIS DZIKIR AT’TASYKIR SUMUT

PIMPINAN AL-USTADZ H. AZWARDIN NST PADA HARI/ TGL : MINGGU, 26 DESEMBER 2010 PUKUL : 07.30 PAGI TEMPAT : MESJID RAYA AL-MASHUN MEDAN

TAUSYIAH OLEH AL-USTADZ HASBI AL MAWARDI LUBIS DEMIKIAN DISAMPAIKAN SEBAGAI UNDANGAN

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

NB: untuk perubahan type kamar menjadi : Triple menambah USD 50 Double menambah USD 100 AKOMODASI HOTEL BERBINTANG HOTEL MADINAH: DALLAH TAIBA, Setaraf ***** HOTEL MAKKAH : AL BUSTAN, AN NADWAH, Setaraf **** HOTEL JEDDAH : AL AZHAR ***** Harga Ekonomis Fasilitas Paket Bisnis

Khusus bagi jema’ah dari luar kota nginap di Hotel Madani Gratis OFFICE: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4 / 18 Medan Telp. 061- 7326981, 0811647795 Fax. 061-7326981

Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu,

TANAH 15x20, Bangunan 8x15, Jl. Eka Pipa II No. 2D Kel. Gedung Johor Hub. 0812.1808.8720 - 0813.7046.8120

DIJUAL SEBIDANG TANAH

BURSA

Di Jl. Wijaya Kesuma XIII (Pasar IV Pdg. Bulan), Luas 10x14m², SHM Harga 80 Jt/nego

ELEKTRONIK

AC, KULKAS, M. CUCI, P. CLINER

Hub. 0817.819.109 0813.7564.5456

JUAL AC Bermacam Merek, 1/2, 3/4, 1, 1 1/2, 2pk 1,3Jt - 2Jt. Kulkas 1Pt- 2pt/ 600rb - 1,2Jt, 2 Pt Jumbo 2 Jt. Prejer 5rak=1,2jt, 6 rak SOCES 1,8Jt M. Cuci 1 tb-2tb 600rb-1,2jt. PC. Cliner 800rb. Jual.

TANAH DIJUAL

Uk. 14x65m dan Rmh Semi Permanen (SHM), Hrg 140 Jt Lokasi Jl. Baru Sei Mencirim dekat SMPN 3 Sunggal Hub. 0811.659.235

LAPTOP, HANDICAM, CAMERA, FAX, PRINTER

Handicam Sony Hi-8 = 1 Jt. JVC Mini DV 1,5JtDVD 2Jt. Camera 5 Mp- 12 Mp 500rb - 1.2Jt. Fax. Printer=600rb (jual & beli)/Cash Credit Hub. UD. SENANG HATI: 4517509

69677449 Jl. Sekip 67 A

K AV L I N G A N P R O M O SPESIAL AKHIR TAHUN

BURSA

KOMUNIKASI DIJUAL CEPAT

N-E 90 Komplit Brown/Moca....Rp. 2.850.000 N-E51 L-Standar Segel Hitam..Rp. 750.000 Tape Sony ................................Rp. 250.000 Hub. 0852 61082 593 Perumnas Helvetia 0852 769 888 93

BURSA

HILANG/TERCECER TERCECER

SIM C, TNK Spd. Motor Honda BK 4657, KTP dan Surat2 penting lainnya A/n. Ir. ROSDIANA Br. BARUS Jl. Senam No. 23 A Medan. Tercecer antar Jl. Senam Ke Jalan Juanda. Bagi siapa yang menemukan mohon diantar ke alamat tsb diatas. Tidak dituntut apapun.

KEHILANGAN DOMPET

Tidak dituntut dan akan diberi hadiah sepantasnya. Ciri2 dompet warna hitam dan Surat Kendaraan bermotor SIM dan ATM a/n. Muhammad Erwin BK 2930 AAZ

TELAH TERCECER

Sebuah Surat Tanah Dengan Ukuran 7x16m2. Terletak di Jl. Garu II B No. 64 A/n. SYAMSUL LUBIS. Pada Hari Jumat Tgl. 18/12-2010. Sekitar Jl. Sisingamangaraja.

BURSA

SIAP HUNI, READY STOK VILLA MEGAWAI PERMAI

JL. DANAU LAUT TAWAR BINJAI PERUMAHAN VILLA MEGAWATI PERMAI HUNIAN YG AMAN ASRI TERLETAK DI TENGAH KOTA BINJAI BEBAS BANJIR, AKSES CEPAT ±200M DARI RINGROAD MEGAWATI DAPATKAN DISCOUNT HINGGA 30 JUTA KUNJUNGI PAMERAN KAMI DI PLAZA MEDAN FAIR LT. 1 TUNAI/ KPR HUB: 0812.6080.0079 0852.1330.1555 0812.6082.9093 0813.6135.7031 0852.6210.3562 0812.6537.6769

TANAH

TANAH KEBUN DIJUAL Lokasi Payaroba Binjai Pinggir Sungai, Uk. 2814m² Harga murah Rp. 25.000/m² Hub. 0812.475.2924 0812.6397.8123

Hanya dengan Rp. 14 Jt-an, Anda bisa mempunyai Tanah dgn Uk. 6x18m² di tambah discont Rp. 1 Jt + Rp. 1 Jt + Gratis biaya surat, Siap bangun Lok: Psr. 5 Sei Mencirim Sunggal diski Hub. 0813.6112.2791 - 0819.3327.6858

DIJUAL SEBIDANG TANAH

Di Jl. Sei Semayang Kec. Sunggal Luas 20x35m², Sertifikat Jual beli Harga 140 Jt/nego

PELUANG BISNIS

JUAL: JUAL BIBIT - ALAT PERTANIAN

Isi: Bibit Tanaman Perkebunan, Hutan buah, Pisau deres eks jerman, Kambing Pe, Itik Tegal/ Alabio Kontak: (061) 7853.855

TERMURAH

BERKUALITAS

PELUANG USAHA PEMASANGAN DEPOT AIR MINUM ISI ULANG STANDAR DEPKES

14 Jt s/d 40 Jt (Nego)

AIR MINERAL DAN SISTEM RO JUAL ALAT-ALAT DEPOT ISI ULANG

CV. MITRA INTERNUSA JL. YOS SUDARSO KM. 15,5 NO. 121 MEDAN

RINALDI: (061) 685.0456 MOBILE 0813.6214.3160

Hub. 0817.819.109 0813.7564.5456

DIJUAL KEBUN DUKU

Luas ±1200m² (3 Rante) di Jl. Bangau/ Dipinggir Jln Aspal Kp. Nangka Kec. Mencirim Timur Binjei Lokasi Strategis dekat Rencana Pembangunan Kantor Pemkot Binjai, SK Camat Hub. 0813.7503.4449

Pasang Iklan “WASPADA”

Telp: 061 - 4576602

PELUANG USAHA

Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA

Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866

MINI & EFEKTIF IKLANKAN PRODUK ANDA

Harian

WASPADA

MBAK ALIN HUB. 0813.7739.9508 Ingin Promosikan Produk Anda

Harian

WASPADA Media yang Tepat untuk Iklan Anda

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

BEST NONY

DIJUAL

ANDA BUTUH DANA TUNAI

Jaminan BPKB Mobil sepeda motor, Becak. Bunga 1,5%. BPKB Aman, Data Dijemput, Proses Cepat. HP. 061.66477734, 0852 9616 6601 Maaf TP

ALAMAT PRAKTEK:

JL. STM NO. 11

(DEPAN MESJID SALMAN) SIMP. LIMUN - MEDAN HP. 0812.6041.5751 PRAKTEK JAM 09.00 WIB S/D MALAM IZIN DINKES: NO. 448/1813/11/2008

KUSUK & LULUR

BURSA

BURSA

BUTUH DANA

PENYEMBUHAN TOTOK DARAH

UNTUK SARAF DAN PEMBULUH DARAH KHUSUS PENYAKIT: SAKIT KEPALA/ MIGRAIN, STROKE, HIPERTENSI, JANTUNG, SALURAN PENCERNAAN, REUMATIK, ASAM URAT DIABETES, GANGGUAN SEKS, KOLESTEROL, SAKIT PUNGGUNG, LIVER, GANGGUAN SYARAF TERJEPIT

PERABOT

KESEHATAN

061-4576602. Terimakasih

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

PROGRAM TANGGAL HARGA UMROH REGULER 9 HARI 1, 4, 14, 25 MARET USD 1.575 1, 11, 22 APRIL USD 1.750 UMROH REGULER 14 HARI 9 , 23 MARET 8, 22 APRIL UMROH + CAIRO 12 HARI 16 MARET, 21 APRIL USD 2.300 UMROH + TURKEY 12 HARI 22 MARET, 19 APRIL USD 2.600 UMROH + AQSHO 11 HARI 25 MARET, 26 APRIL USD 2.800

silahkan hubungi kami di

BURSA

FAX.4561347

Izin Usaha : 503/1099.SK.HO/SL/NT/08 JADWAL HARGA UMROH TAHUN 2011 / 1432 H

HA TI-HA TI terhadap penipuan yang ATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer.

07.30 Selamat Pagi 08.30 Cooking Paradise 09.00 Suamiku Hebat 09.30 Samba Dan Sahabat 10.00 Opera Anak 11.00 Asli Enak 11.30 Redaksi Siang 12.00 Selebrita Siang 13.30 Galeri Sepak Bola 14.00 One Stop Football 15.30 Mancing Mania 16.30 Redaksi Sore 17.30 Tahu Rasa 18.00 Gara Gara Magic 19.00 OVJ Roadshow 21.00 Pas Mantab 22.00 Scary Job 22.30 Pemberani 23.30 Dua Dunia **m31/B

Irfan Bachdim/blogspot.com

AMANAH UMROH

Pelanggan Yang Terhormat

07.00The Penguin Of The Madagascar 09.30 Dokter Seleb 10.00 Danamon Semangat Bisa 10.30 Naruto The Movie 12.30 Americas Funniest 13.00 Global Siang 13.30 Genie 14.00 One Cubed 14.30 MTV Staying Alive 2010 15.30 Glee 16.30 Fanboy & Chum Chum 17.00 Spongebob 18.00 Super Hero Kocak 19.00 MTV Station Cam 21.00 Power Kids 21.30 Barclays Premier League

mengatakan, adanya bentuk kreasi baru tersebut, membuat dirinya tidak pernah berhenti membatik. “Sebelumnya, kita hanya membatik seminggu tiga kali untuk memenuhi pesanan, namun dengan adanya kreasi baru ini, tiap hari kita harus mengerjakan batik motif Bachdim tersebut, sehingga tidak pernah berhenti membatik,” katanya. (ant)

WASPADA

Rp. 65.000 Rp. 78.000

TOYOTA Kijang LSX EFI bensin Th. 2003 Dijual. W. Biru met. AC, Tape, VR, BR, BK Asli Mdn, mesin sehat, jok kulit, body sgt mulus. Tinggal pakai. Hrg. 120Jt/damai. Hub. 0852 7060 9048

pesanan hingga Suriname, Arab Saudi sampai Malaysia,” katanya. Hanan menjelaskan, baju batik bermotif Bachdim dijual seharga Rp300 ribu hingga Rp500 ribu per potong, sementara untuk jenis kaos, dijual seharga Rp100 ribu per potong. Hanan mengatakan, meski harganya tergolong mahal, namun minat masyarakat untuk membeli

06.30 Apa Kabar Indonesia 08.30 Potret Garpu Cipta Karya 09.00 Property Agung Podomoro 09.30 KPP 10.00 Nuansa 1000 Pulau 10.30 Tinju Legendaris 12.00 Kabar Siang 13.00 Jejak Islam 14.00 News Boom 15.00 Documentary One 16.00 Kabar ++ 17.00 Tepi Jaman 17.30 Kabar PEtang 19.00 Tokoh 20.00 Apa Kabar Indonesia Malam 21.00 Local Documentary 22.00 Documentary One 22.50 FIFA Club World Cup 2010 01.00 Kabar Malam

JUS MENGKUDU TEKNOLOGI JEPANG Mengapa Konsumsi Mengkudu ? Hub: BAPAK SUGENG MARINIR 0813 9718 1159 - 0852 7011 7530

JL. KLAMBIR V NO. 152 KP. LALANG MEDAN

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481

Pengobatan Alat Vital H. Suhendar

Pengobatan Alat Vital H. Suhendar

Besar dan panjang di tempat Tidak ada hasil, Mahar kembali Ditangani secara profesional Alami bukan suntik, menggunakan metode terapi dan ramuan tradisional, Paling aman tidak ada efek samping

Untuk keluhan dan pengaduan silahkan hubungi langsung:

H. Suhendar sudah di kenal sebagai pakar kejantanan yang sudah berpengalaman, sanggup mengatasi keluhan alat vital khusus pria, memperbesar, memperpanjang (garansi), meningkatkan kekerasan, tambah kuat dan tahan lama dalam berhubungan

OBAT TELAT BULAN

Anda Telat? Produk Import Untuk Telat Bulan 5 - 7 Jam Pasti lancar Aman & Bergaransi Hub: Apotek Sinar Farma Jl. Amper a 88B Sibolga HP. 0812.5095.0888 Garansi luar kota OBAT DIPAKAI BARU DILUNASI

TERAPY ALAT VITAL TERBESAR DAN TERPERCAYA IZIN DINKES NO. 037/DRHP/1973/12JULI/73

PERNAH HADIR DI JOHOR MALAYSIA PERNAH HADIR DI LIVE TOP NEWS METRO TV

SEBAGAI PENGOBATAN TERBAIK MASTER OF KEJANTANAN DAN KEROHANIAN TERAPY NYATA DAN LUAR BIASA, BESAR, PANJANG, LANGSUNG DITEMPAT DAN BERGARANSI UNTUK SELAMANYA 100% ALAMI. METODE PENGURUTAN DISEKITAR ALAT VITAL MELALUI TO-TOK URAT URAT KEJANTANAN. KAMI TIDAK MENGGUNAKAN VACUM, SEPERTI SUNTIK SILIKON, DLL. JANGAN SALAH INFORMASI, DISINI TEMPATNYA, HANYA DGN WAKTU 25 MENIT KAMI AKAN BUKTIKAN ALAT VITAL ANDA MENJADI JUMBO DAN TAHAN LAMA: BAGI ANDA YG KECEWA DITEMPAT LAIN, KAMI SIAP MEMBANTU ANDA. RAHASIA TERJAMIN UNTUK SEMUA AGAMA, MEMBUKA AURA, KARIR DAN JABATAN, JUGA MENGOBATI KENCING MANIS, LEMAH SYAHWAT, DLL HUB. H. ANDI BERSAMA H. ZAENAL 0812.2764.4325 - 0812.82733.704 JL. SM. RAJA MASUK AMALIUN DEPAN HOTEL MELATI GG. PADUAN TENAGA NO. 11

AHLI PENGOBATAN ALAT VITAL: PRIA/ WANITA

Yang sudah dipercaya dan Bisa bukti di tempat !! Ditangani oleh: A. SAEPUDIN DARI PELABUHAN RATU

Jika anda cari pengobatan harus teliti dulu sebelum berobat, mana yang ahli dan mana yang asli. Sebenarnya banyak pengobatan lain juga yang memberikan bukti, tapi kenyataannya tidak ada perubahan sama sekali. Makanya kalau berobat harus serahkan kepada ahlinya. Cuma disini satusatunya pengobatan asli dan benar-benar bukti langsung kelihatan perubahannya ditempat. Jika ada keinginan datang dan buktikan di tempat kami. Dijamin anda tidak akan kecewa, pasti berhasil. Bahkan banyak pasien dari tempat lain juga yang datang berobat kesini semua berhasil.

Khusus Wanita ! Khusus Pria ! * Lemah syahwat, Kuat, Keras, Tahan Lama * Susuk Banyu Sapu Jagad * Susuk Banyu Bulan Tgl 14 DIJAMIN * Memperbesar, Panjang, Impotensi * Susuk Bintang berkelip-kelip * Mani Encer, Ejakulasi Dini, Hernia * Susuk Keruncang * Mati Rasa/Total, Kencing Manis. * Susuk Siraja Asem * Diabetes, Mandul * Ingin kembali perawan, buka aura Alamat: * Memperbesar/ Kencang payudara, Pelet Jln. Amaliun Simpang Laksana * Ingin punya keturunan, Pengasihan No. P.33, 100 M dari Yuki * Penglarisan Usaha, Problem Rmh Tangga Simpang Raya * Ingin cepat dapat jodoh, Ditinggal pacar HP: 0813 9693 8588 Izin Kejari DSP 22/-0-101-/2009

Mahar Rp. 500 ribu

Klinik H. Suhendar di bawah kontrol dan pengawasan langsung H. SUHENDAR Diberitahukan kepada masyarakat untuk berhatihati terhadap pengobatan sejenis yang mengakungaku kerabat atau saudara, soal cara boleh sama tapi keahlian yang membedakan

H. SUHENDAR HP. 0812.131.6364 Jl. Tempuling No. 43 B - Serdang (masuk Gg. Sado) Medan Telp. (061) 663.4220 Saksikan !!! Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu Malam Minggu Pukul 20.00 WIB

KLINIK

PUTRA PASUNDAN RAJANYA PENGOBATAN ALAT VITAL ANDA GAGAL DITEMPAT LAIN...???

N

Kami memberi bukti bukan janji, alat vital besar dan panjangditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama. Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin menceng-kram, wangi. Buktikan disini (Bergaransi) HP. 0812.8481.8889 Alamat praktek: Jl. SM. RAJA SAMPING UISU MASUK JL. SEMPURNA 300M NO. 49 MEDAN

TERAPI KEJANTANAN ALAT VITAL PRIA & WANITA PALING SPEKTAKULER DARI PEL. RATU PANTAI SELATAN Ditangani Langsung:

BPK. UMAR & UST. A. AZIS

Melayani berbagai macam keluhan antara lain:

KHUSUS PRIA TAMBAH UKURAN:

- Panjang: 13 - 16 - 19 - 22 cm - Diameter: 3.5-4-4.5-5-5.5-6cm - Kuat dan tahan lama - Ejakulasi dini, sphilis/ Raja singa - Mani encer - Lemah syahwat, diabetes, impoten, dl KHUSUS WANITA: - Memperbesar, payudara, terapi perawan/ virgin, kista, lemah kandungan, kanker payudara, ingin mempunyai keturunan, dll PRIA & WANITA Ingin cepat dapat jodoh, penghasilan disegani atasan, menyatukan & memisahkan PIL/ WIL, Puter giling, juga melayani pasang susuk, dll --> Bergaransi, hasil permanen alami tanpa efek samping, langsung reaksi ditempat Alamat: Jl. SM. Raja dekat Taman Makan Pahlawan No. 130B Medan samping Show Room AUTO 2000. Dibelakang bengkel tambal ban

HP. 0813 8042 6253


Aceh

B6

WASPADA

Sabtu 25 Desember 2010

Lagi, Suplai Air Tirta Mon Pase Macet

Debu Truk Pengangkut Tanah Beterbangan BIREUEN (Waspada): Lalulalangnya truk pengangkut tanah dari Galian C di jalan Desa Tgk Meunasah Digadong, Kota Juang, Bireuen sangat mengganggu kenyamanan warga. Bahkan, akibat banyaknya debu yang beterbangan sejumlah anak-anak menderita batuk. Menurut Saifuddin warga Desa Tgk Meunasah Digadong, Kota Juang, Bireuen, Kamis (23/12), debu yang beterbangan bukan saja memberi rasa tidak nyaman kepada warga setempat, namun warga Meunasah Dayah, dan warga Desa Meunasah Blang juga merasakan hal serupa. “Kami telah melaporkan keberatan tersebut kepada pihak terkait, namun tak ada tanda-tanda ditindaklanjuti,” kata seorang warga sambil menunjuk ke truk pengangkut tanah yang melintas.(amh)

LHOKSUKON, Aceh Utara (Waspada): Suplai air bersih dari PDAM Tirta Mon Pase, untuk ribuan pelanggan di Kec. Tanah Jambo Aye, Aceh Utara, kembali macet sejak tiga hari terakhir. Sebagian pelanggan terpaksa menggunakan air sumur dan membeli air bersih seharga Rp5.000 per jerigen. Keterangan dihimpun Waspada, Kamis (23/12), desa-desa yang suplai air bersihnya terhenti sejak tiga hari lalu, antara lain, Desa Meunasah Panton, Samakurok, dan Pantonlabu, ibukota Kec. Tanah Jambo Aye. “Ini sudah kesekian kali. Seringkali suplai air bersih PDAM Tirta Mon Pase, tersendat atau mati total. Ironisnya, sebelum air dimatikan, tidak pernah ada pemberitahuan dari pihak PDAM melalui media massa. Kalaupun tidak ada pemberitahuan di koran-koran kan bisa melalui radio,” protes Yandrasyah, 32. Hal serupa juga dikeluhkan Marzuki, 40, warga Kota Pantonlabu. “Kami dengar air macet karena jaringan listrik PDAM diputuskan oleh PLN. Terlepas dari benar tidaknya kabar itu, semestinya ada pemberitahuan resmi dari PDAM. Dengan demikian pelanggan tidak lagi menunggu-nunggu air PDAM dan mereka bisa segera menyiapkan sumber air bersih alternatif,” katanya. Secara terpisah, Direktur Utama PDAM Tirta Mon Pase, Zulfikar Rasyid, menjelaskan, PLN memutuskan jaringan listrik milik PDAM di Desa Matang Bayu, Kec Baktiya—Alue Ie Puteh, Aceh Utara. Menurut dia, persoalan tersebut juga sudah diberitahukan pihaknya kepada para pelanggan. “Saat ini kita sedang mengupayakan dana senilai Rp3 miliar dari Pemerintah Aceh Utara. Usulan ini sudah kita ajukan ke DPRK. Jika dana itu disetujui, kita bisa segera lunasi ke PLN dan sulpai air bersih akan kembali lancar. Kita juga sudah minta PLN agar tidak memutuskan dulu jaringan listrik itu, karena kami masih menunggu uang subsidi dari Pemerintah Aceh Utara. Namun, PLN menolak permintaan kita,” tandas Zulfikar.(cmus)

750 Polisi Amankan Natal Dan Tahun Baru BANDA ACEH (Waspada): Dalam menciptakan suasana kondusif pada perayaan Natal dan Tahun Baru 2011, jajaran Kepolisian Daerah Aceh menggelar Operasi Lilin 2011. Operasi dimulai dengan gelar pasukan di Lapangan Mapolda Aceh, Kamis (23/12) dengan pemimpin upacara Kapolda Aceh Irjen Pol Fajar Prihantoro. Seusai memimpin upacara Fajar Prihantoro mengatakan sekitar 750 anggota Polda Aceh akan ditempatkan di 68 pos pengamanan termasuk di dalamnya personil Brimob ditambah kekuatan dari TNI dan unsur lainnya dalam pengamanan Natal dan Tahun Baru. Kapolda berharap pada perayaan Natal dan Tahun Baru berjalan lancar dan kondusif. Untuk itu selain peran aparat dalam melaksanakan pengamanan, masyarakat juga sangat dibutuhkan untuk ikut menjaganya. Dalam paparannya, Kapolda mengajak serta instansi terkait dan masyarakat untuk turut aktif menjaga keamanan dengan memprioritaskan pada pusat aktivitas perayaan Natal dan pergantian tahun baru mendatang. Usai memimpin gelar pasukan, Kapolda memeriksa kesiapan peralatan dan personil di jajaran Polda Aceh.(gto/b09)

Pasangan Suryadi-Mulya Jadi Pema Unimus

Pelaku Perampokan SPBU Masih Sulit Diidentifikasi Waspada/Abdul Mukthi Hasan

BIREUEN (Waspada): Pasangan Suryadi dan Mulia Rahman, terpilih menjadi Presiden dan Wakil Presiden Mahasiswa (Pema) setelah memperoleh 802 suara dalam Pemilihan Raya (Pemira) mahasiswa di kampus setempat 20-21 Desember. Meeka mengalahkan pasangan Sulaiman-Ramadhani dan M Yani-Ramadhan yang hanya mendapat 621 dan 143 suara. Sementara 143 suara rusak. Rektor Universitas Almuslim Peusangan, Drs Amiruddin Idris melalui Kabag Humas Kemahasiswaan, Zulkifli S.Kom, Kamis (23/12) mengatakan, setelah melaksanakan Pemira akhirnya pasangan Suryadi-Rahman terpilih sebegai presiden dan wakil mahasiswa priode mendatang. “Proses pemilihan atau pentas demokrasi bagi mahasiswa Unimus berlangsung di tiga tempat pemungutan suara (TPS-red), berjalan lancar. “Kami berterimakasih kepada mahasiswa yang berpartisipasi memberikan hak suaranya dan tetap menjaga ukhuwah serta persahabatan antar mahasiswa,” kata Zulkifli.(amh)

Tiga Desa Terancam Terisolir BIREUEN (Waspada): Desa Matang Kule, Bale Daka dan Desa Teupin Panah, Kecamatan Peulimbang terancam terisolir. Pasalnya, kondisi tiang bawah jembatan yang berada di kawasan Desa Lancok Bungong yang merupakan jalur transportasi warga desa-desa itu kondisinya sudah retak dan jika tidak segera diperbaiki dapat dipastikan ketiga desa itu akan terisolasi. Informasi diperoleh, Kamis (23/12), warga tiga desa itu sekarang ini semakin cemas karena tiang jembatan untuk melintasi ke desa mereka sudah retak dan bila tak segera ditanggulangi maka yang dikhawatirkan akan jadi kenyataan dan besar petani desa-desa itu juga terancam tidak bisa melintas lagi menuju perkebunan dikawasan Desa Blang Paya dan Garab bila hal itu jadi kenyataan. “Pondasi tiang dudukan jembatan itu sejak beberapa waktu terakhir diduga bergeser dampak dari derasnya terjangan air terutama saat musim penghujan. Terlebih kondisi aliran di sepanjang alur di sana, juga sudah dangkal sehingga setiap tahun sejumlah desa dikawasan itu, sering dilanda banjir setiap tahun sekarang diperparah lagi rusaknya abudmennya,” kata M Nur warga setempat.(amh)

Operasi Lilin 2010, Polres Sabang Gelar Pasukan SABANG (Waspada): Sedikitnya 40 anggota gabungan yang terdiri unsur TNI, Polri dan unsur Satpol PP serta Dinas Perhubungan setempat diikutsertakan dalam Operasi Lilin 2010 yang akan dimulai sejak tanggal 24 Desember 2010 hingga 4 Januari 2011. Prioritas utama dalam operasi lilin tahun ini akan di khususkan dalam hal pengamanan sejumlah tempat ibadah termasuk Gereja yang ada di Sabang, bahkan untuk pengamanan malam tahun baru pihak kepolisian dan tim pengamanan akan memfokuskan dibeberapa titik rawan yang ada di Kota Sabang. Hal tersebut disampaikan Kapolres Sabang AKBP Sigit Kusmardjoko Kamis (23/12) kemarin setelah memimpin upacara gelar pasukan di Mapolres setempat, menurutnya hingga saat ini tingkat ke amanan di Sabang masih terkendali dengan baik, namun khusus untuk menyambut perayaan natal dan malam tahun baru 2010 ini pengamanan akan di lakukan secara serentak di seluruh Indonesia. “Untuk tahun ini dan seperti tahun-tahun sebelumnya kita akan mengamankan sejumlah tempat ibadah khususnya gereja yang ada di Sabang dan di sejumlah titik rawan pada perayaan malam tahun baru,” tandas Kapolres. Ia juga menyebutkan dalam amanat Kapolri yang dibacakan dalam gelar pasukan ada beberapa poin penting yang harus di antisipasi termasuk hasil kajian analisa intelijen yang menyebutkan masih adanya eksistensi kelompok-kelompok atau jaringan terorisme yang belum terungkap hingga perlu diantisipasi. Sementra itu dalam gelar pasukan yang juga di hadiri langsung olehWakilWalikota Sabang Islamuddin ST, Kamis kemarin, Kapolres menjelaskan rencana keterlibatan pihak Badan Narkotika Kota (BNK) Sabang yang akan ditempatkan dibeberapa titik rawan di Sabang.(b29)

TERJEBAK LUMPUR: Satu mobil terjebak lumpur saat melintas di kawasan Alue Sijuek, pedalaman Peudada Bireuen Kamis (23/12) yang rusak parah sejak beberapa waktu lalu. Kerusakan jalan sepanjang sekitar 5 km tebus ke kawasan Jaba itu sampai sekarang belum diperbaiki.

Komisi B DPRK Bersama Kadistanak Tinjau Lahan BIREUEN (Waspada): Anggota DPRK Bireuen dari Komisi B bersama Kadistanak dan sejumlah unsur terkait meninjau lahan terlantar di Desa Paya Bilie, Kecamatan Jeunieb. Ini untuk mendukung aspirasi masyarakat di desa itu yang sebelumnya minta dibangun jalan menuju perkebunan dan kejelasan status lahan garapan. Geuchik Desa Paya Bilie Ismail Arbi, 56, mengatakan, lahan garapan masyarakat sudah terlantar dan saat ini mau digarap lagi oleh petani, sudah diusulkan ke Pemkab luasnya sekitar 1500 hektar,

dan kejelasan status lahan tersebut. “Dulunya lahan itu digarap masyarakat, tapi terlantar pasca konflik. Luas keseluruhan dari batas gampong sebelah timur dan barat 2 kilometer, sebelah selatan sekitar sekitar 8 kilometer. Dari luas itu, 1500 hektar, mau kami garap dan sudah kami ajukan permohonan ke kabupaten,” ujarnya di lokasi. Kepala Dinas Pertanian Perkebunan Peternakan dan Kehutanan Bireuen, Ir H Azmi Abdullah yang didampinggi Kabid Kehutanan Dailami S.Hut dan sejumlah pejabat terkait lainnya mengatakan, tinjauan yang mereka lakukan bersama Komisi B untuk melihat langsung kondisi di lapangan termasuk status lahannya, lahan garapan itu sejak lama sudah digarap masyarakat, tapi kondisinya terlantar.

Martabat Kaum Ibu Harus Tetap Dipertahankan BIREUEN (Waspada): Wanita tiang agama dan tiang negara. Karena itu, harkat dan martabat kaum ibu harus tetap dipertahankan. Perjuangan kaum ibu 82 tahun silam, wajib diwarisi oleh generasi penerus untuk melanjutkan cita-cita perjuangan pendahulunya. Demikian antara lain sambutan Ketua III STEI Kebangsaan Bireuen Agus Irwanto,SE saat membuka seminar Hari Ibu diselenggarakan Badan Eksekutif Mahasiswa (BEM) STEI Kebangsaan Bireuen di Aula Setdakab setempat Kamis (23/12). Ketua Panpel Aisyah dalam keterangannya menjelaskan, peringatan Hari

Ibu ke-82 yang dilaksanakan BEM STEI Kebangsaan Bireuen disponsori Bank BNI Cabang Bireuen dan Disdikbudpora setempat. Peringatan dirangkai dengan acara seminar dan lomba baca puisi dan menulis cerpen, diikuti 100 peserta siswa SMP, MTsN,SMA, MA dan mahasiswa. Dikatakan, sebagai pemateri seminar Hari Ibu dihadirkan Syarifah Alwiyah S PdI, Ketua Nahdatul Aisyiah Lhokseumawe dengan judul makalah “Perjuangan hak seorang Ibu “ dan Noveri Kusumawati Sag, Kepala MIN Cot Meurak Bireuen berjudul “Perjuangan perempuan dalam mengangkatharkatdanmartabatkaumibu”. Dalam kesempatan tersebut, juga

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *

FireFly

16:20

11:35 JT 397 Medan/Jakarta 20:00 JT 307 Jakarta

06:40 12:15

12:55 SJ011 Medan/Jakarta

13:25

12:20 AK 306 Kuala Lumpur *

12:45

FY 3401 Penang ** 14:10 FY 3400 Penang “” * Setiap Senin, Rabu, Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

PENGAMAT sejarah/birokrat senior Provinsi Aceh, T Hamid Zein, SH alias Ayah Hamid menyesalkan situs sejarah di Aceh Utara tidak terawat. Penyesalan itu diungkapkan mantan Ka Biro Hukum Setda Provinsi Aceh ini,

di depan para Imum Mukim dan mantan Imum Mukim, pemuka agama dan pemuka masyarakat, pada rapat ‘duek dreng’ di rumah adat pahlawan nasional/srikandi Aceh, Cut Nyak Meutia di Gampong (Desa) Masjid Pirak, Kec Matangkuli, Aceh

Waspada/M Jakfar Achmad

14:30

BANDA ACEH (Waspada): Pemerintah Aceh dan Pemerintah Kabupaten Aceh Selatan harus memberikan sanksi yang tegas bagi PT Pinang Sejati Utama (PSU). Pasalnya, konflik antara masyarakat dengan perusahaan tersebut tampak semakin meluas. Seperti diberitakan sebelumnya, akibat jalan tak kunjung diperbaiki, masyarakat Manggamat memblokir jalan, disusul dengan mogok awak mobil penumpang (mopen) trayek Manggamat-Kuta Fajar. Aksi itu sebagai bentuk akumulasi kekecewaan mereka terhadap pemerintah, karena tak kunjung membangun jalan yang telah hancur akibat setiap hari dilintasi truk pengangkut bijih besi milik PT PSU. Menurut Pjs. Koordinator LBH Banda Aceh Pos Tapaktuan, Zul Azmi, SH, jika investasi sudah melahirkan bencana berupa kerusakan fasilitas umum dan lingkungan, maka pemerintah harus mengambil tindakan tegas berupa pencabutan izin lingkungan. “UU No. 32/2009 Tentang Perlindungan dan Pengelolaan Lingkungan Hidup juga menyebutkan, apabila izin lingkungan telah dicabut/dibatalkan maka izin usaha dan atau kegiatan dibatalkan,” ungkap Azmi kepada Waspada, Kamis (23/12). Selain itu, kata dia, dalam UU tersebut juga telah disebutkan kewajiban bagi setiap subyek hukum apabila telah terjadi kerusakan lingkungan, yaitu berupa ganti kerugian, tindakan pemulihan dan tindakan pencegahan. Jika melihat tuntutan masyarakat terhadap kerusakan jalan akibat dilintasi oleh mobil operasional PT PSU telah berlangsung lama, sebut Azmi, maka seharusnya Pemerintah Aceh atau pun Pemkab Aceh Selatan sudah dapat menelaah itikad baik dari PT PSU ini. “Selain kerusakan jalan, persoalan lain yang dihadapi oleh masyarakat adalah potensi terganggunya kesehatan warga masyarakat akibat debu yang bertebaran dari badan jalan,” imbuhnya. (b07)

Situs Sejarah Di Aceh Utara Tidak Terawat

Berangkat (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta

diumumkan para pemenang lomba Puisi dan Cerpen, dengan rincian, lomba baca puisi kelompok I, Dewi Karwina, ma-hasiswi Unimus Peusangan meraih juara I, juara II Yulis Safriani, mahasiswi Unimus Peusangan, dan juara III diraih Ulfa siswi SMPN-1 Bireuen. Di kelompok II, juara I Wildsa Zahrina, siswi MAN Peusangan, juara II, Indriani siswi MTsN Peusangan dan juara III Andri Kurniawan, siswa SMA Sukma Bangsa. Sementara juara menulis cerpen, juara I dimenangkan Wilda Zahrina, siswi MAN Peusangan, juara II Rauza Maulidia, siswi SMAN-2 Bireuen dan juara III Khairul Azmi, dari Unimus Peusangan. (b16)

Pemerintah Aceh Harus Tegas Terhadap Pelanggar UU No. 32 Tahun 2009

Pengamat Sejarah/birokrat Senior Aceh Sesalkan:

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu):

Menjawab wartawan berkaitan status lahan, Kabid Kehutanan Dhailami, Shut menjelaskan, lahan garapan masyarakat itu masuk dalam katagori areal budidaya atau areal penggunaan lain (APL-red). Letaknya juga masih sangat jauh dari hutan produksi, begitu juga dengan batas sebelah selatan Desa Paya Bilie, berbatasan dengan hutan, Kabupaten Bireuen. Sementara Ketua Komisi B DPRK Bireuen,Tgk Mahdi Hasballah yang akrab disapa Tgk Ujong yang didampinggi Sekretaris komisi B, Azhari Ahmad dan Tgk M.Amin M.Hasan selaku anggota, mengatakan lahan garapan masyarakat, saat konflik terlantar. Sekarang mau digarap kembali, dan sudah diusulkan ke kabupaten.(amh)

BIREUEN (Waspada): Pihak Polres Bireuen dikabarkan masih sulit mengidentifikasi pelaku perampokan SPBU di desa Paya Meuneng, Peusangan, kabupaten setempat yang terjadi Senin (20/ 12), walaupun rekaman CCTV telah berada pada tim penyidiknya. ”Perkembangan penyelidikan hingga sekarang (Kamis-red) tidak ada yang begitu menonjol, namun tim tetap berusaha memburu pelakunya,” kata Kapolres Bireuen HR Dadik J, Kamis (23/12). Sebagaimana diberitakan sebelumnya, SBPU di Desa Paya Meuneng, Peusangan, Bireuen, Senin (20/12) sekira pukul 03.00 ib, dirampok tiga pria menggunakan satu senjata api laras panjang dan satu laras pendek. Para tersangka berhasil membawa kabur uang sekitar Rp 10 juta yang diambil dari tiga laci SPBU. Menurutnya, sulitnya pengungkapan, selain saat itu jejak pelakunya kabur, juga pada rekaman CCTV yang telah berada pada tim penyidik pelakunya hanya terlihat bentuk badannya dan gerakan, sedangkan cirri-ciri wajahnya sulit dikenali. Walaupun begitu kata Kapolres, tim yang dibentuk khusus untuk mengembangkan kasus tersebut tidak putus asa dan tetap melakukan pengembangan dengan teknik tersendiri mengindentifikasi tiga pelaku. “Dalam berbagai kasus kriminal, apalagi kasus perampokan tidak begitu mudah diungkap, apalagi mungkin para pelaku sudah memperhitungkan adanya rekaman CTV di SPBU tersebut. Kalau tidak mengetahui adanya rekaman, tentunya pelaku tidak memakai helm dan penu-tup wajah. Tetapi yang terekam, pelaku sudah pakai helm tertutup, wajah ditutup lagi dan menunduk,” jelasnya. Kecuali itu, lanjut Kapolres, untuk mengungkapkan kasus itu langkah awal pihaknya telah memeriksa empat karyawan yang bertugas malam itu. Juga telah memintaiketerangan dari pemilik SPBU dan salah seorang sopir kendaraan jenis pick-u yang parkir di SPBU saat kejadian. (amh)

RUMAH CUT NYAK MEUTIA: Para imum Mukim, mantan Imum Mukim, pemuka agama dan pemuka masyarakat Aceh, foto bersama di depan rumah adat pahlawan nasional/srikandi Aceh, Cut Nyak Meutia, usai rapat ‘duek dreng’ naskah qanun adat dan reusam, Rabu (22/12).

Utara, Rabu (22/12). “Saya ini turunan ‘po rumohnyoe’ (pemilik rumah ini-red), menetes air mata ketika melihat kondisi rumah Aceh, di gampong Cut Nyak Meutia ini tidak terurus. Belum bicara masalah makamnya yang tidak dipugar,” tandas T Hamid Zein. Bukankah, mengelola situs sejarah dengan baik bahagian dari syukur kita terhadap Allah SWT. “Dalam kapasitasnya sebagai keluarga Cut Nyak Meutia, saya sangat terharu seraya mengucapkan ribuan terima kasih kepada masyarakat Aceh Utara, atas prakarsa LSM KANAPAKAD – NGO asing USAID Serasi, telah menyelenggarakan ‘duek dreng’ Imum Mukim Pase di tempat mulia ini,” papar Ayah Hamid dengan nada suara serak. Mengingat jasa pahlawan yang tidak ada tolok ukurnya, semua data sejarah kepahlawanan nasional perlu diabadikan. Data kepahlawanan nasional dalam konstektual Aceh,termasuk Cut Nyak Meutia, di Pemerintahan Kabupaten (Pemkab) Aceh Utara, menyimpan data yang sangat menumental. Seiring ‘duek dreng’ Imum Mukim, sekaligus menjadi salah satu upaya mengaktualisasi situs sejarah, aktivis hukum Provinsi Aceh Ini sangat respek terhadap pengabadian data sejarah kepahlawanan yang ada di daerah ini. Srikandi Aceh, Cut Nyak Meutia, kata dia, salah seorang pahlawan nasional yang sudah dinobatkan sejak masa Presiden RI, Soekarno (SK Penobatan No 107, 2

Mei 1964-red). Ia mengatakan patut dihormati dan makamnya perlu dipugar, dilestarikan dan dirawat. Apakah pemugaran, pelestarian dan perawatannya tanggungjawab Pemerintah Provinsi (Pemprov) Aceh ?, tanya salah seorang Imum Mukim.“Pemprov Aceh/jajarannya dan semua kita dalam memelihara data sejarah kepahlawanan tersebut harus bertanggungjawab,” tandas deputy intervensi kebijakan strategis BRA pusat tersebut. Hamid Zein menguraikan sekilas penggalan sejarah, jasad Cut Meutia terbaring di sebuah kawasan hutan belantara, Gunong Lipeh, antara Kec Matangkuli dan Kec Cot Girek,Aceh Utara. Ia gugur di rimba Lhok Reuhat, Alue Drien, atau kawasan bantara sungai (krueng) Peutoe, wilayah eks Kewedanaan Lhoksukon, 25 Oktober 1910, ditembak oleh pasukan Belanda Marsose di bawah pimpinan Mosselman, bersama rekannya Tgk Chik Paya Bakong alias Tgk Seupot Mata. Makam Cut Meutia terpuruk jauh ke pedalaman Aceh Utara, dengan keadaan situs itu tidak terurus, penziarah malas datang karena jangkauannya yang sulit. Masyarakat hanya tahu keberadaan (kehebatan), keperkasaan

dan keberanian Cut Meutia, hanya lewat buku-buku sejarah. Antara lain tercantum dalam buku sejarah ‘Aceh Sepanjang Abad”, karangan wartawan legendaris Sumatera Utara (Medan) H.Mohammad Said (alm), (pendiri Hr Waspada), kata bakal calon (balon)kuatBupatiAcehUtaratersebut. LSM KANAPAKAD Terkait komentar Hamid Zein, budayawan Aceh.direktur LSM Keurukon Aneuk Nanggroe Papah Adat Keuneubah Aceh Darussalam (KANAPAKAD),Syamsuddin Jalil alias Ayah Panton yang ditemui terpisah, Rabu kemarin mengatakan.“Bangsa yang kerdil adalah bangsa yang melupakan jasa para pahlawannya.” Kita perlu mendefinisikan kembali tentang keberadaan para pahlawan. Pahlawan bukan saja yang dimakamkan di TMP (Taman Makam Pahlawan), kata dia, seraya menambahkan. “Cut Meutia, Cut Nyak Dhien, Tgk Umar Johan pahlawan dan lain-lain yang sudah diakui oleh negara sebagai pahlawan nasional, para syuhada itu tidak dimakamkan di TMP. Dengan demikian, ziarah pahlawan setiap hari besar bersejarah itu, menurut pendapat saya perlu digilir ke makam-makam para pahlawan di luar TMP yang perannya tidak kecil dalam merebut kemerdekaan RI dari penjajah Belanda dan facisme Jepang,” ujar Ayah Panton. M Jakfar Achmad


Aceh

WASPADA Sabtu 25 Desember 2010

B7

DKP Didesak Cek Lahan Tambak Udang JULOK, Aceh Timur (Waspada): Terkait pembagian 705.000 benur udang windu bantuan Dinas Perikanan dan Kelautan (DKP) Kab. Aceh Timur, untuk petani tambak dalam beberapa kecamatan, instansi itu diminta segera mengecek lahan tambak. Hal itu dianggap penting menyusul pengecekan yang dilakukan siswa/i terhadap lahan tambak dibeberapa tempat dalam wilayah Julok, Kab. Aceh Timur, sehingga ditemukan hasil, bahwa dalam beberapa tahun terakhir budidaya udang kerap gagal panen menyusul racun jenis Partisida dan Amoniak, yang berasal dari penumpukan racun puluhan tahun yang silam, menjadi penyebab. Demikian Wakakurikulum dan Kujur SMKN Perikanan Aceh Timur, Rahmatsyah Putra, A.Md, kepada Waspada, Kamis (23/12) di Idi. Menurutnya, lahan yang dimanfaatkan para petani tambak di Aceh Timur, sangat rentan gagal panen terhadap species udang windu. “Jikapun itu dipaksakan, akan mendapatkan hasil yang tidak maksimal, karena kandungan pertisida dan amoniak sangat tinggi pada lahan tambak di Aceh Timur,” katanya. Dia mengatakan, kondisi tersebut terjadi setelah dilakukan pengecekan yang dilakukan pihaknya d sejumlah tambak dalam wilayah Aceh Timur. Resudu racun dilahan tambak dalam wialayah Aceh Timur, terlalu banyak mengendap berpuluh-puluh tahun, sehingga akan mengakibatkan suhu air didasar tambak

relatif panas dan dapat menyebabkan kematian benur udang yang akan ditebarkan. “Karena spesies udang rentan sekali terhadap pengaruh zat racun. Kecuali bibit bandeng, karena bandeng lebih tinggi relatif persentase hidupnya dibandingkan benur udang,” sebutnya seraya menambahkan, meski demikian DKP juga harus melakukan penyuluhan kepada petani tambak sebelum dikucurkan bantuan bibit tersebut. Karenanya, dia meminta DKP Aceh Timur, untuk membuat penyuluhan terlebih dahulu untuk kelompok tani sebelum memberi bantuan benur udang kepada petani tambak, sehingga dana yang dianggarkan untuk bantuan tersebut dapat dimamfaatkan secara maksimal. “Sehingga program ini berjalan maksimal di Aceh Timur,” tandasnya. Kepala Dinas Kelautan dan Perikanan Aceh Timur, T. Dahlan, SE, M.AP, kepada Waspada, Kamis (23/12) mengatakan, pada dasarnya DKP menampung aspirasi dan usulan tersebut untuk perkembangan dan pertumbuhan petani tambak, sehingga hasil yang diperoleh masksimal. “Kita akan tampung usulan itu, namun teknisnya nanti akan dilakukan oleh Petugas Tehnis Lapangan (PTL) bersama penerima bantuan bibit udang ini. Artinya, apapun masukan, kita terima demi kemajuan bersama,” ujar T. Dahlan yang juga mantan Camat Peudawa dan Asisten I Setdakab Aceh Timur. (cmad)

FPPD Minta Utamakan Putra Daerah REDELONG Bener Meriah ( Waspada): Sejumlah warga yang mengatasnamakan Forum Peduli Putra Daerah (FPPD) Kabupaten Bener Meriah, Rabu (22/12), mendatangi gedung Dewan Perwakilan Rakyat Kabupaten (DPRK) setempat. Kedatangan FPPD ke gedung dewan untuk meminta agar pihak legislatif dapat memberikan masukan kepada Pemkab Bener Meriah, maupun Pemerintah Aceh, terkait dengan masalah penerimaan Calon Pegawai Negeri Sipil (CPNS) di daerah itu. Maksud kedatangan FPPD Bener Meriah ini, untuk meminta kebijakan pemerintah setempat guna membatasi peserta tes CPNS di daerah itu, dengan tujuan agar putra daerah setempat dapat menjadi prioritas. Semula dikabarkan, FPPD Bener Meriah, akan menggelar aksi demo di depan gedung DPRK setempat, untuk menyampaikan aspirasi mereka. Namun, aksi demo tersebut batal dilakukan karena jumlah massa yang mendatangi gedung dewan hanya beberapa orang dan akhirnya dilakukan audensi di aula DPRK setempat. Padahal, pihak keamanan dari Polres Bener Meriah, maupun belasan personel dari satuan Polisi Pamong Praja (Satpol-PP) telah disiapkan di seputaran gedung dewan untuk mengamankan jalannya aksi demo. Dalam audensi antara FPPD dengan pihak dewan yang langsung diterima Ketua DPRK Bener Meriah, Drs Rusli M Saleh. Para pemuda ini menyampaikan tuntutan yang intinya, meminta perhatian pemerintah terhadap putra daerah dalam penerimaan CPNS Formasi 2010. Namun, tuntutan yang disampaikan oleh FPPD kepada pihak dewan dinilai telah terlambat karena pendaftaran tes CPNS telah berakhir, sehingga tidak mungkin lagi dilakukan pembatasan untuk para pelamar dari luar daerah. “Apa yang disampaikan oleh adik-adik ini sudah terlambat karena pendaftaran sudah tutup. Dan sebelumnya kami juga sudah melayangkan surat kepada pihak Pemkab Bener

Waspada/Muhammad H. Ishak

Meriah dan ke Gubernur tentang diprioritaskan putra daerah untuk formasi tahun ini,” kata Drs Rusli M Saleh, didampingi sejumlah anggota dewan Kabupaten Bener Meriah, di hadapan para pemuda yang tergabung di FPPD. Disebutkan Ketua DPRK, jauh hari sebelum FPPD Bener Meriah, mendatangi gedung dewan dengan misi untuk meminta putra daerah diprioritaskan dalam penerimaan CPNS, pihak dewan telah duluan mengirimkan surat kepada bupati dan gubernur soal penerimaan CPNS. Dalam surat tersebut, lanjut Drs Rusli M Saleh, pihaknya meminta kepada gubernur dan bupati agar bisa memprioritaskan warga yang telah mengabdi di Bener Meriah, dalam peneriman pegawai tahun ini. “Apa yang kalian minta hari ini, sebelumnya sudah kami lakukan, makanya saya katakan kalian terlambat. Namun demikian, aspirasi ini tetap akan disampaikan ke pihak Bupati Bener Meriah dan Gubernur,” tegas mantan Kadis Dikjar Bener Meriah ini. Menurut Koordinator FPPD Amtsal ST, di hadapan anggota DPRK Bener Meriah, ribuan pelamar CPNS yang telah mendaftar di Kabupaten Bener Meriah, hampir 80 persen berasal dari luar daerah dan pendaftar CPNS lokal hanya sekitar 20 persen, sehingga perlu pembatasan pendaftar dari luar daerah tersebut. Ditambahkan, siapa saja dipersilahkan untuk ikut tes CPNS, namun putra daerah harus diutamakan. “Untuk SDM di Kabupaten Bener Meriah, sudah cukup banyak yang memenuhi persyaratan sehingga perlu pembatasan peserta yang mendaftar dari luar daerah,” ungkap Amtsal ST. Dari pantauan Waspada, audiensi yang digelar di aula DPRK Bener Meriah, antara FPPD dengan anggota dewan hanya berlangsung beberapa saat setelah adanya kesepakatan, berupa pembuatan surat tuntutan dari FPPD Bener Meriah, yang akan disampaikan kepada pihak Pemkab Bener Meriah dan Pemerinta Provinsi Aceh.(cb04)

NYARIS HANYUT: Satu unit rumah di kawasan pinggiran sungai Simpang Jernih, Kab. Aceh Timur, nyaris tenggelam akibat banjir. Lebih-lebih pinggiran sungai terus dikikis saat musim penghujan. Foto direkam baru-baru ini.

Puluhan KK Diminta Mengungsi Khawatir Banjir SIMPANG JERNIH, Aceh Timur (Waspada): Khawatir terulang banjir bandang sebagaimana terjadi tahun 2006 silam yang mengakibatkan 530 rumah hanyut, Pemkab Aceh Timur meminta puluhan KK yang masih berdomisi dipinggiran sungai Kec. Simpang Jernih, segera mengungsi. Hal itu dianggap penting, menyusul kawasan tersebut dalam setahun terakhir kerap terjadi banjir, lebih-lebih saat musim hujan tiba sebagaimana lumrah terjadi dalam setahun 10 hingga 15 kali. “Meski telah berulangkali kita himbau, tapi 17 KK di kawasan Pantee Kera, tetap tidak mau pindah,” sebut

Bupati Aceh Timur, Tgk. Muslim Hasballah melalui Camat Simpang Jernih, Iswandi, S.Sos.I, kepada Waspada, Jumat (24/12). Dia menjelaskan, ketika masih wewenang Camat Dahnil Harmy, SH, hingga akhir Oktober 2010, belasan Kepala Keluarga (KK) telah direlokasi ke tempat yang lebih tinggi (perbukitan). Beberapa titik yang rawan banjir, warga telah memindahkan lokasi rumahnya ke lokasi yang disediakan Pemkab setempat, pasca banjir bandang. Namun 17 KK di Dusun Alue Meurbo, Desa Pantee Kera, hingga kini masih bersikeras tidak mengindahkan himbauan tersebut, sehingga tidak kurang dari 3 hingga 4 kali dalam sebulan rumah-rumah mereka digenangi banjir akibat luapan air sungai. “17 KK tidak mau pindah, dengan alasan itu adalah tanah leluhurnya,” sebut

Iswandi. Iswandi menyebutkan, desa yang kerap terjadi banjir yakni, desa Simpang Jernih, Pantee Kera, Ranto Panjang, Tampor Paloh, Tampor Bor, dan Desa Meulidi. “Jika banjir tiba, luas sungai terus meluas akibat pinggirannya di kikis air yang meluap. Bayangkan, jika setiap banjir pinggiran itu dikikis, maka rumah yang di pinggiran sungai akan hanyut dan kawasan itu akan tenggelam,” katanya. Oleh sebabnya, lanjut Iswandi, dia meminta 17 KK yang kini masih berdomisili di pinggir sungai Pantee Kera, segera pindah sebelum kawasan itu diterjang banjir, “Sebab kondisi cuaca yang masih ekstrim sangat berpotensi akan terjadi banjir besar-besaran di kawasan ini. Makanya kita desak warga pindah ke tempat yang lebih tinggi,” tandas Camat. (cmad)

Simeulue hingga kini belum teraliri arus listrik. “Dana otsus Aceh harus difokuskan untuk pembangunan infrastruktur, terutama jalan. Dana itu juga bisa digunakan untuk membantu pembangunan listrik di Aceh, terutama pembangunan listrik yang belum ada sama sekali di sebagian daerah di Simeulue, seperti dilaporkan Pak Rahmad tadi,” kata Ahmad Mujani. Selain kepada ke Ahmad Mujani, sebelumnya Rahmad juga sudah pernah melaporkan keluhan serupa ke Dinas Pertambangan dan Energi (Distamben) Aceh di Banda Aceh, 2 Agustus 2010 dan kepada anggota DPD asal Aceh di Jakarta, yakni Abdurrahman BTM, Teuku Bachrum Manyak, Ahmad Farhan Hamid, dan Ir Mursyid. Rahmad menuturkan soal, jika diharap dari Anggaran Pendapatan Belanja Kabupaten (APBK) Simeulu yang sangat minim, pembangunan listrik itu masih sangat lama terwujud. Dia merincikan, pembangunan listrik yang belum merata itu tersebar di empat kecamatan, yakn Kecamatan Alafan, Teluk Dalam, Simeulu Barat, dan Salang.(cmr/si)

Muhammad Rapyan/Waspada

Sekjen DPP Partai Gerindra yang Juga Wakil Ketua Fraksi Gerinda di DPR-RI, Ahmad Mujani menerima laporan anggota DPRK Simeulue Rahmad, Selasa (21/12).

BLANGPIDIE (Waspada): Aksi pengerahan seluruh keucik dan perangkat desa yang dilakukan oleh Bupati Aceh Barat Daya (Abdya) terkait perseteruan yang terjadi antara pemerintah kabupaten Abdya dengan lembaga DPRK Abdya terhadap usulan anggaran, dinilai sebagai bentuk penekanan politik yang sudah arah, bahkan cenderung ‘aneh’ karena mengarah provokatif. Padahal, Pemkab Abdya masih sangat memungkinkan melakukan upaya lain, berupa pembukaan akses komunikasi dua arah serta melakukan evaluasi kembali terhadap rancangan usulan yang telah diberikan sebelumnya sehingga tidak perlu menyibukkan diri serta para perangkat desa untuk jauh-jauh datang ke kantor Bupati di Blangpidie. “Sikap Bupati yang melakukan pengerahan massa dengan mengatasnamakan Musrenbang (Musyawarah Perencanaan Pembangunan) jelas sebuah tindakan yang sangat provokatif. Untuk apa masyarakat digiring kedalam persoalan yang sebenarnya bukan beban mereka, tindakan seperti itu jelas sangat nyeleneh dan terkesan seperti orang salah minum obat,” ujar Drs.Tarmizi,MS, Ketua Yayasan Pembangunan dan Pengembangan Abdya (YP2A) kepada Waspada, terkait aksi yang digelar di depan Kantor Bupati Abdya yang diikuti oleh seluruh keucik dan perangkat desa Kamis (23/12). Aksi yang dimotori langsung oleh Bupati Akmal Ibrahim tersebut, menurut Tarmizi sebagai indikasi kepanikan yang sedang dipertontonkan oleh pihak Pemkab Abdya dengan berlindung di belakang rakyat. Padahal, penyebab munculnya deadlock (kebuntuan) pembahasan anggaran di DPRK Abdya dianggap sebagai bentuk kesalahan dari pihak pemkab Abdya sendiri, yang tidak ‘cerdas’ mengajukan usulan. (sdp)

Sawah Korban Banjir Terancam Gagal Tanam

Ahmad Mujani: Krisis Listrik Simeulue Bisa Diatasi Lewat Dana Otsus BANDA ACEH (Waspada): Ketua Dewan Pimpinan Cabang (DPC) Partai Pemuda Kabupaten Simeulue yang juga anggota DPRK setempat, Rahmad SH bertemu Sekretaris Jenderal (Sekjen ) Dewan Pimpinan Pusat Partai Gerindra Ahmad Mujani. Pada pertemuan ini Rahmad meminta agar Fraksi Gerindra di Senayan membantu mendorong pembangunan listrik di daerah kepulauan Simeulue yang sampai kini masih ada sekitar 33 gampong di sana yang belum ada sama sekali aliran listrik PLN. Menanggapi laporan ini Ahmad Mujani yang juga Wakil Ketua Fraksi Gerindra di Senayan kepada pers menyatakan, Pemerintah Aceh bisa memanfaatkan sebagian dana Otsus 2011 yang telah ditetapkan nilainya sekitar Rp 4,5 triliun untuk mengatasi hal ini. Penegasan ini disampaikan Ahmad Mujani usai melakukan silaturahmi dengan pengurus Gerindra se Aceh di Banda Aceh, Selasa (21/ 12). Usai acara Rahmad yang memang menunggui Ahmad Mujani usai memimpin acara, melaporkan soal masih adanya 2.500-an Kepala Keluarga dalam empat kecamatan di

Tudingan Terhadap Bupati Akmal

BIREUEN (Waspada): Ratusan hektar sawah di Desa Lancok Bungong, Cot Geulumpang, Paloh Pupu, dan Jambo Dalam, Kecamatan Plimbang, Bireuen, yang dihantam banjir kiriman terancam gagal tanam musim ini. Pasalnya, selain benih padi hanyut dibawa banjir petani pun tak memiliki benih lain. “Padi yang baru kami semai habis dibawa banjir, kami sangat mengharapkan pemerintah membantu bibit padi. Kalau tidak, dipastikan musim ini kami gagal tanam,” kata Junaidi, petani Desa Paloh Pupu. Akibat hujan lebat yang mengguyur kawasan Kecamatan Peulimbang, Kab. Bireuen, Senin (20/12) menjelang maghrib, lagi-lagi, Desa Desa Lancok Bungong, Paloh Pupu, Jambo Dalam, dan sebagian Desa Cot Geulumpang diterjang banjir. Bahkan, banjir kiriman kali ini lebih parah dari sebelumnya. Pasalnya, selain puluhan rumah warga terendam air setinggi lutut orang dewasa juga puluhan hektar padi yang baru disemai bibitnya juga menjadi korban terjangan banjir kali ini.(amh) Waspada/Ist

Kapolres Simelue menandatangi MOU bersama di Apel gelar pasukan, Kamis (23/12).

Polres Simeulue Gelar Pasukan Bersama Unsur Muspida SIMEULUE (Waspada): Polres Simeulue, Kamis (23/2) pagi menggelar Apel Bersama dengan unsur Muspida Kabupaten Simeulue. Hadir di sana mewakili Bupati Simeulue, Sekdakab Mohd Riswan R, alias Moris. Mewakili Dandim 0115/Simeulue Pasi Ops Kodim 0115 Simeulue, Kepala Dinas Kehutanan & Perkebunan, Ir. Ibnu Abbas. Kepala Dinas Perhubungan & Komintel, Drs. Riswan NS. Kasat Pol PP danWH, Alihasmi, SH. Kepala Dinas Kelautan & Perikanan, Juaini Saili. Bertindak selaku Inspektur Upacara, Kapolres Simeulue AKBP Drs. Parluatan Siregar. Sedangkan Komandan Upacara Kapolsek Teluk Dalam IPDA Andriamus, dengan peserta segenap personal Polri, TNI, Sat Pol PP &WH, Polhut, serta pegawai Dinas dan Sekretariat Daerah Pada kesempatan itu dalam amanatnya, Kapolres Simeulue menghimbau kepada semua elemen untuk selalu menjaga dan memelihara kekompakan antara komponen dengan pemerintahan di Kabupaten

Simeulue. Hal utama yang ingin dicapai dari pemupukan kekompakan ini, untuk menciptakan Simeulue yang aman dan damai guna mewujudkan ketenteraman seluruh warga. Dengan begitu, pencapaian kesejahteraan rakyat yang diidamkan lebih mudah, kata Kapolres. Teristimewa lagi, katanya, kebersamaan juga untuk menjaga, menciptakan dan memelihara kondisi daerah agar kondusif dalam memasuki Tahapan Pemilu Kada 2011 Gubernur/ Wakil Gubernur, Bupati/Walikota &WakilWalikota/Wakil Bupati sampai dengan pelantikan pejabat terpilih Kemudian khusus pada penegakkan hukum yang ada Simeulue, Kapolres menekankan untuk lebih meningkatkan peran serta dan kapasitas masing-masing sesuai bidang tugasnya guna menjaga dan memelihara seluruh sumberdaya yang ada di pulau itu. “Baik sektor peningkatan Pendapatan Daerah dengan meningkat kesadaran masyarakat membayar pajak kenderaan bermotor atau menindak tegas

para pelaku Illegal Logging guna lestarinya alam di Simeulue maupun meningkat hasil di sektor pertanian,” terang Parluatan. Kemudian pada kesempatan tersebut, Inspektur Upacara menyapaikan bahwa upaya yang dilakukan Polres Simeulue dalam penertiban pemanfaatan hasil hutan/kayu bertujuan semata-mata untuk menyelamatkan Hutan Simeulue dari para pembalak liar. Dalam apel bersama itu pula Inspektur Upacara meminta kepada seluruh komponen Muspida turut mensosialisasikan kepada seluruh warga soal Undang-undang No. 22 Tahun 2009 tentang LLAJ sehingga terciptanya Kamtibcar Lantas di Simeulue. Sehingga volume Laka Lantas dapat ditekan sekecil mungkin. Apel bersama juga dilakukan penanda tanganan Nota Kesepahaman atau MoU antara Polres Simeulue dengan tiga Dinas Kehutanan dan Perkebunan, Dinas Kelautan & Perikanan, Dinas Perhubungan & Komintel serta Sat Pol PP dan WH Kabupaten Simeulue. (cmr)

Giliran Rutan Disosialisasi Bahaya Narkoba BIREUEN (Waspada): Setelah mensosialisasi bahaya narkoba ke sejumlah tempatdi Bireuen, Badan Narkotika Nasional Kabupaten (BNNK) setempat, Rabu (22/12), giliran ke Rumah Tahanan Negara (Rutan) Bireuen mereka lakukan hal sama. Kapolres Bireuen AKBP H.R Dadik Junaedi S.H melalui Kasat Bimas Iptu Shaiful Anam STP yang didampinggi Kabag Kesbang Linmas, Drs Sulaiman Aziz, yang dihubungi usai acara membenarkan, pihaknya giliran ke Rutan melakukan sosialisasi bahaya narkoba untuk memberikan pemahaman kepada napi yang menjalani hukuman itu. “Sosialisasi yang kita lakukan kepada perangkat desa, mahasiswa, pelajar dan masyarakat dan hari ini ke rutan Bireuen tujuannya untuk memberi pemahaman tentang bahaya mengunakan atau memakai narkoba,” kata Kasat Bimas Polres Bireuen Iptu Shaiful Anam, STP.(amh)

Arus Penumpang Ke Sabang Masih Normal SABANG (Waspada): Seminggu menjelang perayaan tahun baru di Sabang, arus penumpang maupun mobilitas kendaraan ke daerah tujuan wisata ini masih normal. Arus penumpang warga yang akan berlibur pada akhir tahun ini diperkirakan baru mengalami lonjakan pada dua hari sebelum malam pergantian tahun. Kepala UPTD Pelabuhan Balohan Irawadi SE yang ditanyai wartawan Kamis (23/12) mengatakan aktivitas di pelabuhan Balohan masih normal. Arus penumpang khususnya dari Banda Aceh ke Sabang belum menunjukkan adanya lonjakan. Demikian halnya mobilitas kendaraan, baik kendaraan umum seperti truk, pik up dan minibus serta kendaraan pribadi masih belum mengalami penumpukan. Pada keberangkatan Kamis pagi dari Balohan – Ulee Lheue, Irawadi mengatakan jumlah kendaraan yang terangkut truk tiga unit, colt dua unit,sepeda motor 50 unit dengan jumlah penumpang sebanyak 300 jiwa.”Kita prediksi lonjaka penumpang terjadi dua hari sebelum tahun baru hingga dua hari sesudahnya. Kita dengan tim terpadu siap mengantisipasi adanya lonjakan penumpang dan kendaraan,” katanya.(b29)


Kreasi

B8

WASPADA

Sabtu 25 Desember 2010

Pesta Akhir Tahun Ala M’Star DALAM rangka merayakan hari jadinya yang kedua, M’Star yang bergerak di bidang Music Management Artis dan EO (Event Organizer) ini menggelar berbagai kegiatan di antaranya Festival Band, Singing Contest, Model Pemula Competition dan High School Photography di lapangan parkir Plaza Milenium Jl Kapten Muslim Medan, 18-19 Desember lalu. Acara dibuka dengan performa dari Band Maouri yang merupakan salah satu artis M’Star. Mengusung tema “ Bithday Party M’Star : Raih Prestasi Tanpa Narkoba “, kegiatan ini pun terbilang cukup sukses terbukti dengan jumlah penonton yang memadati acara tersebut selama dua hari berturutturut. Dari jumlah peserta sendiri yang paling mencolok adalah festival band dengan jumlah peserta mencapai 72 band yang berasal tidak hanya dari kota Medan saja tetapi dari kota-kota lain, seperti, Binjai dan Stabat. Masing-masing band diwajibkan membawa dua buah lagu dan salah satunya

harus membawakan berupa lagu ciptaannya sendiri. Dari lomba model, peserta wajib mengena-kan dress code bertemakan “Rockstar”. Kompetisi model ini sendiri dibagi menjadi kategori anakanak dan remaja. Tak ingin kalah dari peserta lainnya, para peserta yang mengikuti perlombaan singing contest dan fotografi masing-masing menunjukkan kebolehannya. Antusias penonton sendiri lagi-lagi terlihat ketika selama beberapa jam kota Medan diguyur oleh hujan namun minat mereka tidak luntur terus menyaksikan acara. Ketua Panitia sekaligus Manajer Officer Executive M’Star Dimas Rico Ferdian

mengatakan, selain merayakan HUT M’Star yang kedua, acara ini juga bertujuan memberikan wadah bagi remaja menunjukkan bakat mereka, baik itu di dunia musik, tarik suara, modeling maupun fotografi. “ Untuk membuat event yang besar pastinya membutuhkan persiapan matang, Nah, untuk event ini sendiri persiapan yang aku lakukan selama kurang lebih enam bulan dengan berbagai hambatan namun hal itu wajar dan kuanggap sebagai motivasi,” jelas Dimas. Dikatakan mahasiswa Ilmu Public Relation STIK-P itu, dunia komunikasi dan pekerjaan yang saat ini ditekuninya memiliki relevansi, contohnya saja event yang baru digelarnya semalam. “Jika aku tidak memiliki bekal ilmu dalam berkomunikasi dengan baik, tentunya aku nggak bisa meyakinkan sponsor dalam bekerjasama dan membuat peserta tertarik ikut lomba,” terangnya lagi. Di akhir pembicaraan,

Dimas berharap ke depan M’Star dapat menjadi sebuah Event Organizer yang besar dan wadah bagi band-band medan yang benar-benar ingin berkecimpung di dunia musik. Rangkaian acara pun ditutup dengan pengumuman peme-nang sekaligus menampilkan performa dari band D’cyinesta dan Maouri yang juga artis dari M’Star. PEMENANG LOMBA Festival Band: Goofy (I), Tenesia, Poppey dan juara favorit Medanes Singing Contest: Jogi Simanjuntak (I), Jeremy Sianipar, Christian Nainggolan dan juara favorit Siti Afifah Model Anak-anak: Sonya (I), Adinda, Andriana dan juara favorit Sony Model Remaja: Desi Anggia Murni (I), Pinky, Anggi Rafila dan juara favorit Sarah Soraya Fotografi: Tio (I), Syafriana Fitri dan Zulham Fardiyah *Arianda Tanjung Salah satu penampilan peserta Festival band yang ditunggu-tunggu penonton turut memeriahkan acara Birthday Party M’Star. Selama 2 hari, tercatat 72 band pamer kebolehan masing-masing.

Goofy Band Berawal Dari Hobi Juara I Festival Band BAGI kebanyakan orang hobi merupakan awal dari segalanya, hal ini jugalah yang mungkin dialami oleh grup band Goofy. Band yang digawangi oleh Muhammad Reza (keyboard), Agung Nugra Iskandar (gitar), Muhammad Fadhillah (vokal), M Aghil Septiandra (drum), Agustino Satya MWira (bass) dan TMuhammadIqbal(gitar)inijuga mengaku terbentuk karena

antarapersonelnyamemilikihobi yang sama, yaitu ngeband. Nama Goofy sendiri diambil dari nama sebuah tokoh kartun seekor kucing yang jahil namun lucu. Kini band yang beraliran pop modern ini sudah menciptakan12buahlaguyangdiantaranya bercerita tentang cinta, persahabatan dan pengorbanan. Sebut saja, “Merasa Sempurna” yang menceritakan sebuah perhatian

yang diberikan seorang pria kepada gadis yang sangat dicintainya namun malah acuh dan tak mau tahu. “Liriklaguyangkamiciptakan nggak jauh-jauh dari seputar masalah remaja. Mulai dari cinta, persahabatandanpengorbanan,” ujar Andra, mahasiswa semester III jurusan ekonomi ini. Menurut para personil yang udah pada kuliah ini, aliran yang

Panitia M’Star Management menyempatkan diri foto bersama di sela-sela acara Birthday Party M’Star.

Para pemenang Singing contes foto bersama setelah menerima hadiah.

Foto-foto: Khairil Umri Batubara/ Ayu Prasandi

Desi Anggia Murni

Apa Kata Mereka? Yopi Armanda UMSU Medan “Bagi aku, tema acaranya sangat cocok buat remaja dan begitu juga dengan konsep acaranya yang menarik. Walau mungkin bisa dibilang masih ada beberapa kekurangan, acara M’star boleh dinilai sukses. Semoga M’star dapat terus berkarya dan menggelar kegiatankegiatan yang menarik lagi.”

Ingin Jadi Model Profesional

Friska Putri UMSU Medan “Acara yang digelar ini cukup baik dan bisa dibilang menarik perhatian para kawula muda di Medan, apalagi buat remaja yang emang hobi ngeband, modeling, nyanyi sampai fotografi. Ya, itung-itung kegiatan ini jadi ajang pembuktian mereka. Cuma aku berharap ke depannya M’star bisa lebih baik lagi.”

Harry Prasetyo Kartika Sari Harahap UMSU Medan “Kalo menurut aku sih acara kayak gini pas banget buat anak muda. Selain mereka bisa unjuk gigi dengan bakat yang mereka miliki, event ini juga salah satu kegiatan positif bagi remaja daripada keluyuran.”

SMA Kartika 1-2 “ Buatku sih acaranya bagus, temanya juga menarik. Selain itu acara ini juga dapat memotivasi seluruh remaja Medan untuk berkarya dalam bidang musik, modeling dan fotografi. Harapannya acara seperti ini terus aksis di kota Medan dan buat M’star nggak pernah bosan buat nyelenggarain kegiatan musik seperti ini.” Teks & Foto: Arianda Tanjung

MEMILIKI keinginan kuat serta tekad yang bulat untuk menjadi seorang model profesional membuat gadis berparas manis ini harus berusaha keras dalam merintis karir sejak dini. Sejak kecil, Desi Anggia Murni atau akrab dipanggil Desi ini sudah tertarik dengan dunia model. Selain karena memilki bakat dalam dunia modeling, menjadi seorang model juga merupakan salah satu cita-cita dalam hidupnya. Model yang satu ini memang masih terbilang belia, tapi prestasi yang diraihnya dalam dunia model bisa dikatakan cukup lumayan. Gadis kelahiran 14 tahun silam ini sudah menyabet banyak prestasi, di antaranya juara I M’Star Modeling Competition, Juara II Sophie Martin BC. Rosida, Top Ten Metropolitan Star 2010 serta memenangi berbagai kontes busana muslim. Puteri dari M Rifai dan Darnawati ini mengaku dunia modeling merupakan salah satu jalan bagi dirinya untuk menyalurkan bakat yang telah dimilikinya sejak kecil dan akan terus mengasah kemampuannya hingga menjadi seorang model yang terkenal nantinya. Tak hanya memilki bakat sebagai seorang model, gadis yang kini tercatat sebagai siswi kelas 2 SMP Pertitwi ini ternyata memilki kemampuan lain. Menjadi seorang presenter ternama merupakan cita-cita lain dalam hidupnya dan hal itu juga didukung dengan bakat yang dimilikinya. “ Model memang menjadi impianku sejak kecil, karena itu sejak SMP aku memutuskan untuk masuk ke dalam sebuah agensi yang mampu melatihku menjadi model yang profesional,” ujar gadis yang mengidolakan Luna Maya ini. Disinggung masalah perannya sebagai seorang pelajar, dia mengaku dapat membagi waktu antara belajar dengan berlatih model karena dua hal tersebut merupakan yang penting bagi masa depannya. “ Aku pastinya akan tetep memperhatikan pelajaran karena itu merupakan salah satu faktor yang dapat mendukung aku dalam berkecimpung di dunia model,” tutur Desi yang kini sedang mempersiapkan dirinya untuk mengikuti ajang pemilihan Gadis Sampul dan Aneka Yess. “Aku sih berharap bisa terus berkecimpung di dunia model ini serta menyabet beberapa gelar juara serta yang paling utama bisa terpilh menjadi Gadis Sampul tahun depan,” harap Desi lagi. Kalo kamu percaya diri, pasti bisa.... Sukses selalu Des... *Arianda Tanjung

mereka miliki ini disukai masyarakat khususnya remaja. Karena itu,inimerupakantantanganbagi mereka agar lagu-lagu ciptaan yang telah dibuat dapat diminati oleh masyarakat. Band yang terbentuk sejak beberapa tahun silam ini sudah mengikuti berbagai festival yang tidak hanya digelar di kota Medan tapi juga di kota lain seperti Binjai. Festival yang sudah mereka ikuti di antaranya Pensi SMA Kartika I-I,FestivalBandLP3I,PensiSMAN 1 Binjai, Festival M’Star Competition dan lainnya. Beberapa gelar juara yang mereka sabet di antaranya,juaraIPensiSMAN1Binjai, juaraIFestivalBandLP3Idanjuara I M’Star Competition. Ditanya harapan Goofy ke depan, mereka sama-sama menginginkan Goofy dapat menjadi band yang profesional dalam musik sehingga bisa terkenalsecaranasionaldandapat terus menciptakan karya-karya lagu buat pecinta musik. “Bagi kami, musik adalah hidup dan kreativitas yang tidak akan pernah terpisahkan saat ini esokdanselamanya,”ujarmereka kompak. Nah, bagi kalian yang ingin kenal langsung ama keenam cowok keren ini, datang aja ke studio musik yang ada di Jl Setia Budi Komplek Ruko Point Medan. Sukses ya... *Arianda Tanjung


Waspada, Sabtu 25 DFesember 2010